2ZQDA

Ceftazidime acyl-intermediate structure of class a beta-lact toho-1 e166a/r274n/r276n triple mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqdA00
5CHUA 1ERMA 3HBRA 2Y2IA 4XUXA 2IWCA 4GOGA 3G32A 3MZDA 3B3XA 1K6SA 3N4IA 1IEMA 3UPOA 3LY4A 3Q7VA 1KE3A 4LENA 5CGXA 2J8YA 3G30A 3C4PA 2XR0A 1OMEA 3GMWA 1MBLA 1PZOA 2Y2JA 2Y2MA 3IXGA 3MXSA 3RJUA 2WGWB 1CK3A 4MEZA 5EOEA 1ERQA 1BLSA 3BFGA 3AGDA 1FSYA 3LO7A 4FD8A 2ZC6B 2E8IA 1KE0A 3VOYA 2DRWA 3P98A 2A3UA 3IT9A 4OOLA 2DNSA 2Y91A 4R4RA 3Q7ZA 3D4FA 3NC8A 4OVDA 3PBRA 5CXWA 5KMWA 3NDGA 3N8LA 1GCEA 4N9KA 5CHMA 1VQQA 1MY8A 3BM6A 1HZOA 4N1XA 5FI7A 3PBTA 3VMAA 4N92A 3MKEA 4X56A 3UPPA 2EX8A 4L0LA 3FWLA 4E6XA 3OC2A 1MWRA 2B5RA 3A3EA 5TR7A 3QNBA 3O87A 1QMEA 2VGJA 5FI6A 5EECA 3I7JA 5GL9A 5G18A 1E4DA 4S2PA 3HL9A 3IWOA 4ZAMA 1FQGA 1LLBA 5GHZA 1ONHA 1ESUA 1W8QA 3VP1A 3UE3A 4KZ9A 3WS5A 1I5QA 3DWKA 5GLDA 3PBOA 5EPHA 3VP3A 3BFFA 5U47A 3N8RA 4JLFA 4DRTA 1K25A 4QJGA 5EE8A 1PW8A 4FH2A 3IXDA 3BEBA 2WKHA 4X55A 5HW3A 5M1AA 4M3KA 5FAOA 1O07A 2EXBA 1KGFA 2WZXA 2V2FF 1IKGA 5FQIA 4X6TA 5KZHA 3IF6B 2BG1A 4GNUA 5A93A 4QU3A 3SS4A 5CGSA 1IYOA 2HDUA 4JXGA 1FCMA 1PWCA 1KDWA 4WZ5C 2ZM8A 4GD8A 5GHXA 1CI9A 5E2FA 3TOIA 2P9VB 2C6WB 3HLWA 5FQMA 4LV1A 3HUMA 3GSGA 5A92A 2OSUA 4RYEA 4DE3A 4LV3A 1VM1A 5L2FA 1ES3A 3OCLA 2WAFA 4X69A 2HP6A 4C6YA 1Y54A 3PBSA 3V50A 1ES2A 3VFFA 1TVFA 4YINA 2C5WB 2V20A 1XP4A 1YT4A 1U60A 2H0YA 4WBGA 5CTNA 4BD1A 4RVAA 2IWDA 3A3IA 1FCOA 3HUNA 4PM7A 2V1ZA 3LEZA 4ZJ1A 4UA7A 1K54C 1LL9A 1FR6A 3Q1FA 2WGVA 3W8KA 1DJAA 4PPRA 1YLWA 1L0GA 3TG9A 3UN7A 4P85A 1O7EA 5A91A 1MXOA 2XH9A 1EWZA 3PAGA 3CZDA 1IKIA 1CEGA 3C5AA 4MBHA 5CEDA 4DE0A 3M6BA 2RL3A 4EWFA 2I72A 1L2SA 4S2MA 2ZQDA 3V39A 4IEDA 2JC7A 4DF6A 3C4OA 2Q9NA 3UPNA 3P09A 4PM6A 4E3KA 1PW1A 4HBUA 1IYQA 4BJPA 4E3MA 4B4ZA 1BUEA 1E3UD 1PI5A 3GQZA 3W4PA 3NCKA 2ZQCA 4MNRA 4R4SA 5FQ9A 3UDIA 3AGEA 5E2HA 3PAEA 4E6WA 2WK0A 4BQMA 5DF7A 4Y0TA 5AQAA 5HAIA 5BOHA 4OP8A 1DY6A 1Z6FA 2EX9A 3MZEA 1WYBA 1ES4A 1KVMA 1N4OA 1YLZA 3LCEA 4X53A 4IBXA 1I2SA 1H5XA 3UDXA 5HAQA 1BLCA 3PBNA 1BSGA 4OQ0A 2WGWA 5CGWA 3VFHA 3SS5A 3VP0A 3ZGAB 3ZCZA 5HX9A 3CG5A 1XKZA 2WKIA 1IYPA 3G35A 1NZOA 5KSHA 1LI0A 2H10A 4WZ4A 3SH7A 2RCXA 3ZG5A 1G6AA 2JE5A 2DCFA 5FQQA 5CERA 3UE1A 4MBKA 5EUAA 5FSRA 3FYZA 3E2KA 3HREA 2G2WA 3HLEA 3IH8A 4JXSA 2A49A 5I94A 1KGGA 4OOYA 3VP4A 1BTLA 3O86A 3BLSA 3ZG7B 4EV4A 1PWDA 3Q7VB 1EI5A 3JYIA 5DF9A 1XX2A 4GN2A 5FATA 4PM5A 2XFTA 2ZMAA 3VP2A 4KZAA 3IWQA 4KENB 5AQ7A 4S2OA 2FFFB 3IH9A 3W4OA 3A3FA 4E3IA 5F83A 1S0WA 3ZDJA 1K4FA 4OPYA 3M2KA 1GA0A 4KQOA 4EBLA 3WWXA 4ZBEA 4PM8A 1K4EA 3G34A 4BENA 4OPRA 5EVIB 2Y2LA 3MBZA 3WRTA 1ZG6A 5DTTA 1TDLA 4GB7A 3IF6C 3GRJA 4GZBA 2ZJ9A 2ZC4B 1M6KA 4P0MA 3TSGA 4WEJA 3V3SA 3BFEA 5EVID 3ITBA 3SH9A 4P6BA 4Q8IA 1SDNA 1ZKJA 3G31A 4JXVA 3IF6A 3NY4A 4Z9QA 3UNWA 3UO9A 2WUQA 3BECA 4KZ7A 4XXRA 1K54A 2Y2OA 4OONA 1GHIA 4JBFA 2XD5A 3QNCA 4N1HA 1AXBA 3SOIA 4C3QA 4R3BA 4UHUA 3AGFA 2EXAA 4QD4A 5CHJA 5FI2A 1BLPA 3RXWA 3WS2A 1LHYA 3N8SA 3V3RA 3ZNYA 3ISGA 1Q2PA 1CI8A 2X71A 3CMZA 1IELA 1NZUA 5M18A 4RX2A 2WADA 1GA9A 3ZG0A 1YQSA 4ZJ2A 2WGIA 1DJCA 2WKEA 3S1YA 4X68A 4OPQA 5AQBA 3DW0A 1SHVA 3OPHA 5FAQA 3MZFA 4GKUA 4K91A 1H8YA 3A3DA 4U0XA 4HBTA 1KVLA 2UWXA 4R0QA 3HLFA 3HUOA 5EVIA 3Q07A 5J8XA 3IHAA 5DVAA 4F94A 3M6HA 3GR2A 4GD6A 1M40A 4JXWA 2ZQ7A 4N9LA 3EQUA 4CJNA 5EVIC 2VGKA 4DDSA 4LCMA 2J9OA 2R9WA 2ZQAA 1K55C 3MKFA 3MXRA 4OQGA 1JVJA 2HP9A 2XD1A 4JF6A 4KQQA 2X02A 3A3JA 3BLMA 3RXXA 1XGJA 5FDHA 1W79A 4KZ5A 3ITAA 5D3OA 5JYOA 3BYDA 3V5MA 3VOZA 4OQIA 1FOFA 2Q9MA 3LY3A 4NETA 3FZCA 1K38A 1MKIA 2QZ6A 2HDRA 3HLCA 1KE4A 3FKWA 2ZC5B 2HP5A 1KGEA 5GHYA 2G2UA 2H0TA 3NIAA 1CEFA 2Y4AA 3Q82A 4UA9A 4KZ3A 5M19A 1FR1A 3UDFA 1K56A 5DTKA 1K6RA 4BD0A 5TGFA 1YMSA 3ZHHA 1SCWA 3BFDA 4WEKA 3EQVA 1XPBA 4EBPA 1RP5A 1L0EA 5DTSA 3G2YA 1MPLA 2ZM0A 3GV9A 1W5DA 2Y59A 1NJ4A 3GTCA 1YLJA 4DE2A 4B88A 4OLGA 3UY6A 1ONGA 5CECA 1BLHA 3E2LA 2ZC7A 1ALQA 1LL5A 2OLVA 1NY0A 2GDNA 1RGYA 3NBLA 4GDBA 3UE0A 1JWZA 4DE1A 1FCNA 4E3LA 1BULA 4JF4A 4OH0A 5F1GA 3C7UA 4LCLA 1G68A 2PU2A 4EBNA 1HD8A 3IXBA 4FH4A 4UA6A 4QY6A 5HFOA 4A5RA 5HL1A 4IBRA 3O88A 1W8YA 4PMAA 4H8RA 4OLDA 4KG5A 1I2WA 1KDSA 1GHPA 4BL2A 3ZFZA 1K56D 1JTDA 1RCJA 4OQHA 4YFMA 1YLYA 3WS0A 3G4PA 1MWUA 1BZAA 1WE4A 1XA7A 3ZVWA 5A90A 1ESIA 2X01A 1HVBA 4MBFA 2FFYA 2PU4A 2J9PA 1NYYA 1NXYA 4R1GA 1JWPA 4P87A 2JBFA 3DWZA 1Q2QA 3OPPA 5CEBA 1YM1A 4ZTKA 3OPLA 3NI9A 3WS4A 4WMCD 4R23A 1NRFA 3VSKA 1K57C 3C7VA 1MWTA 1YLPA 4KZBA 4C75A 2R9XA 3CJMA 3QHYA 1ZG4A 4BL3A 2H5SA 2OLUA 3N7WA 3NDEA 4RA7A 4QHCA 2QPNA 4U0TA 5E2GA 2XFSA 1XGIA 4IVKA 2IWBA 2EX2A 2ZC3B 2EFXA 1IYSA 3SS3A 1K57A 3BRMA 1TEMA 3PBQA 3FV7A 1JTGA 3ZVTA 1PYYA 3ZG8B 1LI9A 4WELA 3OCNA 4MLLA 4LV2A 4OOMA 5EVLA 3IQAA 1N9BA 5HAPA 2XEPA 1RGZA 2XK1A 3HLBA 5CRFA 2Z2MB 5F1FA 4QB8A 1E25A 1E3UA 4K0WA 4Y7PA 4PM9A 3MFDA 4JPMA 4RX3A 1PWGA 2Z2LB 1S6RA 2Y2GA 4IVIA 5F82A 1MWSA 5IHVA 3WS1A 4S2KA 3HLDA 2OV5A 1TDGA 4WMCA 3ZNTA 3OPRA 3N6IA 1ZC2A 2EFUA 4U3TA 4Y0OA 3HLGA 5DF8A 5EOOA 1JWVA 3O3VA 5HARA 5GLAA 3W4QA 2XDMA 2ZLYA 4KQRA 4O7DA 5KSCA 2P9VA 3IXHA 4OKPA 3IHBA 4KG2A 1C3BA 5FA7A 4S2IA 1BT5A 4KZ8A 4DXCA 1PZPA 4HEFA 4HESA 1PIOA 5FASA 1XXMA 3G2ZA 2ZQ8A 2HDQA 1SKFA 1SDEA 4OP5A 5FAPA 4EUZA 1ES5A 5CTMA 2XF3A 5GLCA 4R3JA 2Y2QA 4NK3A 2XGNA 4QY5A 1EROA 5FQJA 1K55A 4CPKA 3VSLA 1XA1A 4E3NA 2Y2NA 4UAAA 4FCFA 4D2OA 2HDSA 4KZ4A 4DKIA 3SH8A 2P74A 2XQZA 4ZDXA 2J7VA 4B4XA 3OZHA 4DDYA 1QMFA 1PI4A 3HVFA 4JF5A 3ZG9B 4OPZA 1DJBA 4WZ5A 5JYPA 3S4XA 2CC1A 2EX6A 4ZJ3A 1J9MA 3FKVA 4E3JA 1NYMA 1H8ZA 2ZQ9A 2BLSA 3DTMA 5FQKA 1WYCA 3S22A 1YMXA 4DXBA 4WM9A 4S2JA 2WZZA 2Y2KA 4ID4A 3IWIA 5E43A 1L0DA 2Y2PA 4BLMA 4S2NA 4XUZA 2HPBA 2ZD8A 4Y0UA 4KG6A 3BFCA 2Y55A 2ZM2A 4S2LA 4GDNA 4KZ6A 3GVBA 3IF5A 3M2JA 4WYYA 4FSFA 3Q81A 2WYXA 2XLNA 4S2NC 5TFQA 3PTEA 5AQ9A 1HTZA 5GLBA 2WAEA 3WRZA 2JCHA 2Y2HA 1YLTA 4E3OA 1FSWA 1L0FA 4LV0A 1W7FA 4EQIA 4JKTA 5E2EA 1GHMA 2PBYA 4K0XA 2QMIA
chains in the Genus database with same CATH superfamily
3VOLA 2O9CA 3HBRA 1Y28A 2Y2IA 2OOLA 4UQIS 3B3XA 1EW0A 1KE3A 2PYRA 3G30A 2VK3A 2KX6A 3C4PA 4EERA 3IXGA 2WGWB 1ERQA 3BFGA 1KE0A 3LIEA 2DRWA 4OOLA 4ESPA 3PBRA 3N8LA 3CUEA 4X25A 1GSWA 5HWTA 1VQQA 1HZOA 3LR3A 2EX8A 2B5RA 3A3EA 5TR7A 2PR5A 5FI6A 2ZL1B 4S2PA 4HJ4A 4ZAMA 1FQGA 3CPTA 4PKYA 1ONHA 2GJ3A 4BBUA 4LFUA 3PYPA 3PBOA 5DKLA 4QJGA 5EE8A 3IXDA 4H6JB 2WKHA 5EM0A 5HW3A 2I9VA 5FAOA 2EXBA 4X6TA 2BG1A 3SS4A 5CGSA 2FZ0A 1PWCA 5GHXA 1PNEA 2P9VB 1YKDA 5FQMA 2OSUA 4LV3A 1VM1A 4C6YA 1Y54A 2INWA 3V50A 1ES2A 1T18A 1TVFA 4YINA 2V20A 1U60A 4G3WA 4UA7A 1LL9A 3JPUA 4LRYC 3UN7A 3TG9A 5A91A 1W63M 1MXOA 2NUPC 3C5AA 4Y2FA 3M6BA 2I72A 1L2SA 2V8FA 2A24A 3T1RA 4E3KA 4HBUA 3T1XA 3W4PA 2B18A 1S1YA 4X1LA 4WUJA 2WK0A 4BQMA 4ETZA 4Y0TA 2QHKA 2V0WA 3MZEA 1WYBA 1P97A 4X53A 3LCEA 3DTKA 4CLCC 5HAQA 1BSGA 5HX9A 3S7QA 3GECA 1XKZA 2WKIA 1IYPA 4ARZB 2H10A 2RCXA 1TS6A 2JE5A 5EUAA 3HLEA 2B95A 3VP4A 1V9ZA 3BLSA 3JVVA 1BYWA 5FATA 4PM5A 2ZMAA 3VP2A 3IWQA 4KENB 5AQ7A 2FFFB 3IH9A 4E3IA 3A3FA 5F83A 1S0WA 1LSVA 4EU0A 1K4EA 4D60A 5L09A 4OPRA 3MF0A 4CLCB 1ZG6A 1P9WA 3GRJA 4GZBA 1D06A 2ZC4B 3TSGA 3V3SA 1W63Q 1PRQA 3KYZA 3SH9A 3QP8A 3G31A 5L8MA 1FILA 3T4SA 4MN6A 4JBFA 5DFYA 2UV0E 4N1HA 3SOIA 3AGFA 4QD4A 5CHJA 1LL8A 5FI2A 3IS2A 1VHMA 3RXWA 2O0YA 3SW1A 2X71A 1IELA 4HIAA 2M1CA 2OWJA 5M18A 3B33A 1GA9A 2WGIA 3S1YA 3NOUC 4F3LB 1OJ5A 3MQOA 4K91A 1H8YA 3A3DA 5EV0A 2W3GA 4K08A 3HUOA 1TS7A 3Q07A 4HJ6A 2JKRI 5HWVA 3B47A 3H82B 3NOTC 3T1QB 4OQGA 4KQQA 3U4LP 3A3JA 3BLMA 3RXXA 1W79A 3T4KA 3VE3A 3ITAA 5D3OA 3IX8A 4GS9A 3VOZA 4OQIA 1J3WA 3HLCA 3CUEC 2G2UA 4LRXC 5DKKA 1YMSA 1D1JA 1XPBA 1L3LA 1Z09A 3G2YA 1MPLA 1NJ4A 3GTCA 4MN5A 1YLJA 2WKRA 1BLHA 3E2LA 2ZC7A 1V9YA 1NY0A 2GDNA 1P0ZA 3UE0A 3UE6A 4OH0A 3C7UA 5J4EA 3IXBA 2VEAA 4FH4A 2L0WA 3CPTB 3O88A 1STZA 1X0OA 4H8RA 1GHPA 2W1TA 2VGLS 1K56D 1JTDA 4OQHA 3WS0A 1BZAA 2X01A 1HVBA 4GHIB 2FFYA 2J9PA 4I39A 1XJ3A 3PHYA 3D72A 3OPLA 3WS4A 1NRFA 1MZUA 1MWTA 3N7WA 4RA7A 2QPNA 2XFSA 4IVKA 2ZC3B 3SS3A 3RH8B 1JTGA 1LI9A 4MLLA 1ZTUA 1K0KA 4NKPA 2XK1A 3HLBA 5CRFA 2PDRA 2Z2MB 1T1BA 2PD7A 1E3UA 2VLGA 3NOPC 4GLQA 5FEFA 1PWGA 1T1AA 1S6RA 2CMNA 2G7UA 1TDGA 4WMCA 3ZNTA 3OPRA 3TW8A 2EFUA 5EOOA 1JWVA 2AVXA 4O7DA 5KSCA 4KG2A 5F5YA 4HESA 5FDSA 3NULA 2Y2QA 4UQIM 2XGNA 1XA1A 5HWWA 4FCFA 4D2OA 3T1SA 2P74A 4Q0JA 4B4XA 1GSXA 3OZHA 1HLUP 1QMFA 1PI4A 3W2ZA 5JYPA 4WZ5A 2EX6A 4ZJ3A 3FKVA 2BLSA 5FQKA 3G6OA 3CWFA 4QPRA 2P7JA 1IOUA 4S2JA 3LIAA 2Y2KA 3L9KA 4BLMA 1VETB 1OTEA 1FIKA 3BFCA 2ZM2A 4GDNA 4KZ6A 4WYYA 2PHYA 4S2NC 1S4RA 3DTIA 3PTEA 1YLTA 4E3OA 1FSWA 1L0FA 4LV0A 4JKTA 5E2EA 4HH2A 2QMIA 4R3AA 5CHUA 1ERMA 1YSQA 5C5KA 3QP1A 3ICYA 2IWCA 3MZDA 2K2NA 3UPOA 3E0YA 4XT2B 4LENA 1XJ2A 2Y2MA 4MEZA 1CK3A 5EOEA 3VOYA 3P98A 3Q7ZA 5CXWA 2L4RA 1GCEA 5CHMA 4Y5FA 3EGDC 1MY8A 3VMAA 4N92A 3MKEA 1UWNX 3R4KA 3GDIA 4L0LA 3BY8A 3QNBA 3O87A 4DJ3A 5EECA 3I7JA 3L7HA 5GHZA 1ESUA 3VP1A 3UE3A 5GLDA 2PD8A 4CLCA 2W3FA 5EPHA 3PR6A 5U47A 4JLFA 4FH2A 4X55A 3F1NA 1KGFA 2V2FF 1IKGA 1DRMA 4GNUA 5A93A 5CX7A 2V1BA 1FCMA 1KDWA 3B42A 2C6WB 3LYXA 5HDCA 3GSGA 5A92A 4RYEA 2ZOHA 1ES3A 5L2FA 2PT7A 4X69A 2WAFA 2QYBA 4O0PA 2C5WB 1TS8A 1XP4A 4BD1A 1FCOA 3HUNA 4PM7A 4ZJ1A 3MMHA 1L0GA 1EWZA 2XH9A 1IKIA 3F1OB 5CEDA 2VV7A 4DE0A 2EWWA 4B9OA 2JC7A 1P9RA 2ZMVA 3LR0A 5DJUA 4B4ZA 1BUEA 4MNRA 5FQ9A 3PAEA 4E6WA 3T50A 5DF7A 3QP6A 1YLZA 3HJIA 1KVMA 4P6ZS 1H5XA 3PBNA 5CGWA 1TS0A 3SS5A 4R70A 3VP0A 3LICA 3V67A 3SH7A 5FSRA 3FYZA 3HREA 2XA7M 2A49A 2W3HA 1XX2A 4GN2A 3H7WB 4HH3A 4KZAA 5IT5A 4S2OA 3ZDJA 4LLOB 1K4FA 4OPYA 4JGRA 1GA0A 4KQOA 4PM8A 4GJ4A 5DTTA 1TDLA 1XFNA 2ZJ9A 3EEAA 1M6KA 4WEJA 3BFEA 3NJAA 3ITBA 3C38A 4P6BA 3SZTA 1ZKJA 1F5MA 3IF6A 3UO9A 1S1ZA 4KZ7A 4Q0IA 4R3BA 2EXAA 1BLPA 2O9AA 3N8SA 3ISGA 3CMZA 1VEUB 1DJCA 1S67L 5AQBA 1SHVA 2PYPA 2Z6CA 2GX5A 2KDKA 5J8XA 5MC7A 2J3TD 3M6HA 3BWLA 1DP9A 1M40A 4CJNA 4M4XA 5EVIC 4DDSA 4LCMA 5EM1A 2J9OA 2LB9A 2ZQAA 2HP9A 3E4OA 4DJ2A 2X02A 5FDHA 2D02A 3QP2A 4JGPA 4EUVA 3D3OA 3LY3A 4IUKA 3EEHA 4NETA 2ZC5B 2HP5A 3F1OA 5GHYA 2H0TA 1CEFA 4UA9A 1NRJA 5M19A 4ZRRA 1OTBA 1FR1A 3UDFA 4BD0A 2OAQ1 1OT9A 1SCWA 4EBPA 3KO6A 3CAXA 1W5DA 4OLGA 3UY6A 4PHTA 1G5UA 4CQHA 4EEUA 1N9NA 1ALQA 1UGUA 2OLVA 2W27A 1RGYA 1JWZA 5KIZA 3K3DA 1BULA 5F1GA 3C30A 1OPXA 1OTIA 1G68A 4EBNA 1XJ6A 4WN5A 3TE8A 3MSHA 4UA6A 3P7NA 5HFOA 3MQQA 4NXFA 1KDSA 4JGOA 4BL2A 3KSIA 1H0MA 1WE4A 1MWUA 5A90A 3JVUA 4R1GA 2PU4A 1NXYA 3DWZA 4Y17A 4ZTKA 2PAVP 3LIDA 3NI9A 4WMCD 4G3VA 4R23A 1K57C 3C7VA 4KZBA 2R9XA 2LB5A 1T19A 2HF6A 1GSVA 2OLUA 3BQ8A 4WF0A 4XT2A 1XGIA 2IWBA 2EX2A 2QJ7A 3CI6A 1IYSA 4MDZA 1K57A 3ZVTA 1PYYA 3ZG8B 2W3DA 4R38A 4LGWA 4LV2A 5EVLA 3IQAA 2FH5A 3T4LA 3MS6A 3DTEA 5HAPA 1RGZA 1E25A 4K0WA 2VKSA 4JPMA 2Z2LB 2Y2GA 5IHVA 3IBRA 4G3KA 4KUOA 4Y0OA 2VJWA 4Y15A 3O3VA 2P9VA 2ZMFA 3IXHA 4PKYG 3LR4A 4NEED 1BT5A 4KZ8A 4HEFA 2PBDP 1PIOA 2Q0OA 4IUHA 2ZQ8A 1SKFA 2DMWA 1ES5A 5HDSA 1G6OA 2Y79A 1K55A 4CPKA 3VSLA 2HDSA 1S4SA 4ZDXA 3IBJA 3HVFA 4OPZA 3MXQA 2Z6DA 4GHIA 3DTMA 5IS1A 1WYCA 1YMXA 4DXBA 3UMEA 4WM9A 2WZZA 5E43A 4XUZA 5G4YA 4E04A 5EVEA 3GVBA 3T12B 3Q81A 3HJKA 2XLNA 5TFQA 5AQ9A 2V1AA 3WRZA 4EW7A 3MR0A 2M7UA 1GHMA 2PBYA 2PRFA 2VZWA 3G32A 5FL3A 4Q0HA 3Q7VA 2J8YA 1OMEA 2Y2JA 3VE4A 1BLSA 1FSYA 2ZC6B 2A3UA 3IT9A 2DNSA 2Y91A 5TBMB 4R4RA 3D4FA 5G4ZA 4OVDA 5KMWA 4HHDA 2O9BA 2Y8HA 3FPVA 4EESA 3BM6A 4N1XA 5FI7A 2J3WA 3UPPA 2OAP1 4E6XA 1MWRA 1XFQA 1QMEA 4FTXA 5LBRA 2BASA 1VETA 3A0RA 1E4DA 3IWOA 3WS5A 4HY8A 3DWKA 3LIBA 3VP3A 1PFLA 3N8RA 1K25A 1PW8A 5F6AA 1O07A 3KYQA 5IU1A 3IF6B 4WZ5C 3TOIA 5E2FA 2K7SA 4LV1A 3HUMA 3ZYTA 3VFFA 3H7WA 1YT4A 2H0YA 4WBGA 5CTNA 3FPWA 4RVAA 3CLOA 2V1ZA 5L07A 3TRCA 1K54C 2D01A 1DJAA 4I3AA 4PPRA 4P85A 5EFWA 3CZDA 1CQAA 1CEGA 4MBHA 5HSQA 2RL3A 4NXBA 3KSGA 3R7WA 3C4OA 2Q9NA 1ODVA 5HDDA 3QP5A 1PI5A 3H9WA 3DAVA 2HGVA 2ZQCA 3NCKA 3OLOA 2ZOIA 1ZHHB 5E2HA 4HI4A 1DY6A 1Z6FA 2EX9A 3A0SA 1VEUA 4X1MA 4WL9A 4OQ0A 3ZCZA 3VFHA 4BBVA 4EQ1A 2WKQA 1LI0A 4WZ4A 4Y13A 1G6AA 3CITA 5CERA 4MBKA 3E2KA 3IH8A 4JXSA 5I94A 1BTLA 4BBTA 1T1CA 4EV4A 1PWDA 3Q7VB 2XSSA 4WLAA 3ULFA 3W4OA 3M2KA 3DBAA 2E8JA 2Y2LA 3F1PA 2H28A 4GB7A 2GNXA 4RQ9A 5EVID 1SDNA 2HZ5A 1OTDA 4Z9QA 4XXRA 1SKOB 4OONA 1GHIA 1OT6A 1VB6A 4C3QA 2M7VA 1LHYA 2ACGA 3O5YA 3C8CA 1NZUA 4RX2A 1YQSA 2WKEA 4H6JA 4X68A 5F69A 3DW0A 3OPHA 3MZFA 5AJGA 3LI8A 1MKMA 4R0QA 3HLFA 4HNBA 3IHAA 4YNRA 5DVAA 3C2WA 4F94A 1G28A 4JXWA 1UWPX 3EQUA 2VGKA 4FUWA 3MXRA 3MKFA 3LR5A 1JVJA 2JN7A 2XD1A 4HOIA 1XGJA 4KZ5A 2P08A 3NECA 1WA9A 3BYDA 3V5MA 1FOFA 2Q9MA 2P04A 2V0UA 1YAXA 2HDRA 1KGEA 3NIAA 5HD3A 3Q82A 1H8MA 2HJ9C 3BJNA 1DP6A 4F3LA 1K6RA 3ZQ5A 3UB6A 3UMDA 3ZHHA 3BFDA 3LFVA 1L0EA 5DTSA 2ZM0A 4GW9A 4B88A 1SKOA 4CLCE 4MN7A 1LL5A 4DE1A 4LCLA 2PU2A 3D9YA 3LIFA 3MFXA 4A5RA 5HL1A 4IBRA 3LI9A 4GCZA 4PMAA 1AWIA 1RCJA 4YFMA 3G4PA 1XA7A 5A8BA 1JWPA 2VX8A 5I5LA 3OPPA 4DN0A 3VSKA 1YLPA 2JKTI 4C75A 3QHYA 1ZG4A 4BL3A 3NDEA 4FOFA 4QHCA 5E2GA 2EFXA 4IHQA 3MJQA 3BRMA 3FV7A 4WELA 2EA9A 3K2NA 1N9BA 2K31A 2XEPA 2QKPA 4QB8A 1KOUA 4PM9A 3MFDA 3BY9A 3WS1A 4S2KA 3HLDA 2OV5A 5FEGA 4I3IA 1ZC2A 1JNUA 3HLGA 2XDMA 2ZLYA 3BW6A 4OKPA 3IHBA 4DXCA 1PZPA 3T4QA 2XRNA 5FASA 1XXMA 2HDQA 4R6LA 1SDEA 4OP5A 5FAPA 3OOVA 1EROA 5FQJA 3IX3A 2Y2NA 4UAAA 3S7NA 2W1TB 3E98A 5AVEA 4DKIA 2GZAA 3SH8A 3VV4A 4DDYA 4JF5A 3ZG9B 3LEQA 1DJBA 5AVFA 2CC1A 1J9MA 1NYMA 4BMWA 5J7EA 5HPFA 4ID4A 3IWIA 4IJGA 4S2NA 2HPBA 4EXOA 2Y55A 4S2LA 1IFQA 3M2JA 4FSFA 3UB9A 1DP8A 2BTFP 1HTZA 3KYEA 4EEPA 2JCHA 3KSFA 2Y2HA 3T4JA 3RTYA 4EQIA 2PR6A 4II7A 4XUXA 4GOGA 3N4IA 1K6SA 1IEMA 3LY4A 5CGXA 2HJEA 2NUTC 2XR0A 3GMWA 1MBLA 1PZOA 3RJUA 3MXSA 1Y4OA 3LO7A 3AGDA 4FD8A 3F1NB 4O8GA 2E8IA 3NC8A 4PAUA 3NDGA 4N9KA 3PBTA 4NG2A 4AFIA 4X56A 2JHEA 2HV1A 5K5BA 3FWLA 3OC2A 2VGJA 5GL9A 3T4OA 5G18A 3HL9A 5HZHA 1LLBA 4I5SA 4P6ZM 1W8QA 4KZ9A 1I5QA 3TJZC 2JKTM 2OWHA 3BFFA 4DRTA 3BEBA 4YOFA 5M1AA 4M3KA 2WZXA 5FQIA 5KZHA 4QU3A 1IYOA 2HDUA 4JXGA 1D7EA 2ZM8A 3KX0X 4GD8A 1CI9A 4UEYA 3HLWA 3FC7A 3RFBA 4DE3A 2VV8A 1A0KA 3OCLA 2HP6A 3S7OA 2YKFA 3EWKA 3PBSA 2IWDA 3A3IA 2QWSA 3LEZA 3T4TA 3W8KA 1FR6A 3Q1FA 2JKRM 2WGVA 4YWZA 1YLWA 3S7PA 1O7EA 1YSPA 1F9IA 3PAGA 4EWFA 3V39A 4S2MA 2ZQDA 4IEDA 4DF6A 3UPNA 4BWIA 5F68A 1F98A 1OTAA 3P09A 4PM6A 2KLIA 1PW1A 1IYQA 4Y3IA 4BJPA 1OJGA 4E3MA 2W0NA 1E3UD 3GQZA 4R4SA 3UDIA 3AGEA 4GS9B 1H3QA 5AQAA 4QWOA 5HAIA 1CF0A 5BOHA 4OP8A 1ES4A 1N4OA 4IBXA 1I2SA 1NLZA 3UDXA 1BLCA 1LSWA 2WGWA 3ZGAB 3CG5A 3G35A 2W1RA 1NZOA 5KSHA 3ZG5A 1TD5A 2DCFA 4NXGA 5FQQA 3UE1A 3LUQA 2G2WA 2XA7S 1KGGA 4OOYA 3O86A 3OBFA 3ZG7B 2O99A 1EI5A 3JYIA 5DF9A 4ME4A 2XFTA 5L10A 2JKFA 3HCYA 2L1MA 2MJ6A 4EBLA 3WWXA 4ZBEA 3G34A 4BENA 3PXPA 5EVIB 3MBZA 3WRTA 3IF6C 4L9EA 4P0MA 3K3CA 4I38A 4L9GA 4CLCD 4Q8IA 2EWVA 1F2KA 4JXVA 3NY4A 3UNWA 2WUQA 3BECA 1K54A 2Y2OA 2J3TC 2XD5A 3QNCA 1AXBA 2V9AA 4UHUA 3LGOA 3WS2A 1TF1A 4EETB 3V3RA 3ZNYA 1Q2PA 1CI8A 2WADA 3ZG0A 5J3WA 4ZJ2A 2WKPA 4B93A 5TBMA 4OPQA 5FAQA 4GKUA 4U0XA 4HBTA 1KVLA 2UWXA 3UB7A 5EVIA 3GR2A 4GD6A 2ZQ7A 4N9LA 1LT0A 4MCWA 2VA0A 1LSXA 2R9WA 3KSHA 1K55C 4JF6A 4HQAA 4KQDA 5JYOA 5HD5A 1S66L 3FZCA 1K38A 1MKIA 3FG8A 2QZ6A 1KE4A 3FKWA 2Y4AA 4KZ3A 5HL6A 1K56A 5DTKA 5TGFA 3F1PB 3QP4A 4WEKA 3EQVA 1RP5A 4HP9A 3EOIA 3NHQA 5TJJA 3BQAA 3GV9A 2Y59A 4DE2A 1ONGA 5CECA 3IS2B 4JGQA 2J80A 4GDBA 3NBLA 3IX4A 1FCNA 4E3LA 4JF4A 3UB5P 2V8CA 4MMNA 1HD8A 4Z1WA 4QY6A 4KUKA 1W8YA 4HJ3A 4OLDA 2QJ5A 1I2WA 4KG5A 3ZFZA 2VV6A 1YLYA 2B02A 3ZVWA 1ESIA 4MBFA 1NYYA 3MQ0A 4P87A 3A0VA 2JBFA 2JKGA 3U2AA 1Q2QA 5CEBA 1YM1A 4O01A 1NLYA 3P01A 1MC0A 1YPRA 3CJMA 2H5SA 3E4QA 4U0TA 2KOIA 1TEMA 2A2LA 3PBQA 4I3JA 2XROA 3OCNA 3CHWP 4OOMA 4ARZA 4ETXA 3EGXC 5F1FA 4Y7PA 4RX3A 4IVIA 5DFXA 5F82A 1MWSA 2ZBBA 3H82A 3N6IA 4U3TA 5DF8A 5HARA 5GLAA 3W4QA 4KQRA 1C3BA 5FA7A 4S2IA 2VGLM 3E4PA 1CJFA 3G2ZA 2YKHA 4EUZA 5CTMA 2XF3A 4L9FA 4R3JA 5GLCA 4NK3A 4QY5A 4E3NA 1XJ4A 4KZ4A 2XQZA 2J7VA 3UB8A 1N9OA 2W3EA 4HP4A 2R78A 3S4XA 1ACFA 4E3JA 3R7WB 2IA2A 1H8ZA 2ZQ9A 3S22A 1L0DA 2Y2PA 4NXEA 2ZD8A 4Y0UA 4KG6A 4DMZA 3IF5A 2WYXA 1NWZA 5HPIA 1N9LA 5GLBA 2WAEA 4LPZA 4LRZE 1W7FA 1SZVA 4K0XA 2A24B 5DJTA 2ZL1A
chains in the Genus database with same CATH topology
5CHUA 1ERMA 3HBRA 2Y2IA 4XUXA 2IWCA 4GOGA 3G32A 3MZDA 3B3XA 1K6SA 3N4IA 1IEMA 3UPOA 3LY4A 3Q7VA 1KE3A 4LENA 5CGXA 2J8YA 3G30A 3C4PA 2XR0A 1OMEA 3GMWA 1MBLA 1PZOA 2Y2JA 2Y2MA 3IXGA 3MXSA 3RJUA 2WGWB 1CK3A 4MEZA 5EOEA 1ERQA 1BLSA 3BFGA 3AGDA 1FSYA 3LO7A 4FD8A 2ZC6B 2E8IA 1KE0A 3VOYA 2DRWA 3P98A 2A3UA 3IT9A 4OOLA 2DNSA 2Y91A 4R4RA 3Q7ZA 3D4FA 3NC8A 4OVDA 3PBRA 5CXWA 5KMWA 3NDGA 3N8LA 1GCEA 4N9KA 5CHMA 1VQQA 1MY8A 3BM6A 1HZOA 4N1XA 5FI7A 3PBTA 3VMAA 4N92A 3MKEA 4X56A 3UPPA 2EX8A 4L0LA 3FWLA 4E6XA 3OC2A 1MWRA 2B5RA 3A3EA 5TR7A 3QNBA 3O87A 1QMEA 2VGJA 5FI6A 5EECA 3I7JA 5GL9A 5G18A 1E4DA 4S2PA 3HL9A 3IWOA 4ZAMA 1FQGA 1LLBA 5GHZA 1ONHA 1ESUA 1W8QA 3VP1A 3UE3A 4KZ9A 3WS5A 1I5QA 3DWKA 5GLDA 3PBOA 5EPHA 3VP3A 3BFFA 5U47A 3N8RA 4JLFA 4DRTA 1K25A 4QJGA 5EE8A 1PW8A 4FH2A 3IXDA 3BEBA 2WKHA 4X55A 5HW3A 5M1AA 4M3KA 5FAOA 1O07A 2EXBA 1KGFA 2WZXA 2V2FF 1IKGA 5FQIA 4X6TA 5KZHA 3IF6B 2BG1A 4GNUA 5A93A 4QU3A 3SS4A 5CGSA 1IYOA 2HDUA 4JXGA 1FCMA 1PWCA 1KDWA 4WZ5C 2ZM8A 4GD8A 5GHXA 1CI9A 5E2FA 3TOIA 2P9VB 2C6WB 3HLWA 5FQMA 4LV1A 3HUMA 3GSGA 5A92A 2OSUA 4RYEA 4DE3A 4LV3A 1VM1A 5L2FA 1ES3A 3OCLA 2WAFA 4X69A 2HP6A 4C6YA 1Y54A 3PBSA 3V50A 1ES2A 3VFFA 1TVFA 4YINA 2C5WB 2V20A 1XP4A 1YT4A 1U60A 2H0YA 4WBGA 5CTNA 4BD1A 4RVAA 2IWDA 3A3IA 1FCOA 3HUNA 4PM7A 2V1ZA 3LEZA 4ZJ1A 4UA7A 1K54C 1LL9A 1FR6A 3Q1FA 2WGVA 3W8KA 1DJAA 4PPRA 1YLWA 1L0GA 3TG9A 3UN7A 4P85A 1O7EA 5A91A 1MXOA 2XH9A 1EWZA 3PAGA 3CZDA 1IKIA 1CEGA 3C5AA 4MBHA 5CEDA 4DE0A 3M6BA 2RL3A 4EWFA 2I72A 1L2SA 4S2MA 2ZQDA 3V39A 4IEDA 2JC7A 4DF6A 3C4OA 2Q9NA 3UPNA 3P09A 4PM6A 4E3KA 1PW1A 4HBUA 1IYQA 4BJPA 4E3MA 4B4ZA 1BUEA 1E3UD 1PI5A 3GQZA 3W4PA 3NCKA 2ZQCA 4MNRA 4R4SA 5FQ9A 3UDIA 3AGEA 5E2HA 3PAEA 4E6WA 2WK0A 4BQMA 5DF7A 4Y0TA 5AQAA 5HAIA 5BOHA 4OP8A 1DY6A 1Z6FA 2EX9A 3MZEA 1WYBA 1ES4A 1KVMA 1N4OA 1YLZA 3LCEA 4X53A 4IBXA 1I2SA 1H5XA 3UDXA 5HAQA 1BLCA 3PBNA 1BSGA 4OQ0A 2WGWA 5CGWA 3VFHA 3SS5A 3VP0A 3ZGAB 3ZCZA 5HX9A 3CG5A 1XKZA 2WKIA 1IYPA 3G35A 1NZOA 5KSHA 1LI0A 2H10A 4WZ4A 3SH7A 2RCXA 3ZG5A 1G6AA 2JE5A 2DCFA 5FQQA 5CERA 3UE1A 4MBKA 5EUAA 5FSRA 3FYZA 3E2KA 3HREA 2G2WA 3HLEA 3IH8A 4JXSA 2A49A 5I94A 1KGGA 4OOYA 3VP4A 1BTLA 3O86A 3BLSA 3ZG7B 4EV4A 1PWDA 3Q7VB 1EI5A 3JYIA 5DF9A 1XX2A 4GN2A 5FATA 4PM5A 2XFTA 2ZMAA 3VP2A 4KZAA 3IWQA 4KENB 5AQ7A 4S2OA 2FFFB 3IH9A 3W4OA 3A3FA 4E3IA 5F83A 1S0WA 3ZDJA 1K4FA 4OPYA 3M2KA 1GA0A 4KQOA 4EBLA 3WWXA 4ZBEA 4PM8A 1K4EA 3G34A 4BENA 4OPRA 5EVIB 2Y2LA 3MBZA 3WRTA 1ZG6A 5DTTA 1TDLA 4GB7A 3IF6C 3GRJA 4GZBA 2ZJ9A 2ZC4B 1M6KA 4P0MA 3TSGA 4WEJA 3V3SA 3BFEA 5EVID 3ITBA 3SH9A 4P6BA 4Q8IA 1SDNA 1ZKJA 3G31A 4JXVA 3IF6A 3NY4A 4Z9QA 3UNWA 3UO9A 2WUQA 3BECA 4KZ7A 4XXRA 1K54A 2Y2OA 4OONA 1GHIA 4JBFA 2XD5A 3QNCA 4N1HA 1AXBA 3SOIA 4C3QA 4R3BA 4UHUA 3AGFA 2EXAA 4QD4A 5CHJA 5FI2A 1BLPA 3RXWA 3WS2A 1LHYA 3N8SA 3V3RA 3ZNYA 3ISGA 1Q2PA 1CI8A 2X71A 3CMZA 1IELA 1NZUA 5M18A 4RX2A 2WADA 1GA9A 3ZG0A 1YQSA 4ZJ2A 2WGIA 1DJCA 2WKEA 3S1YA 4X68A 4OPQA 5AQBA 3DW0A 1SHVA 3OPHA 5FAQA 3MZFA 4GKUA 4K91A 1H8YA 3A3DA 4U0XA 4HBTA 1KVLA 2UWXA 4R0QA 3HLFA 3HUOA 5EVIA 3Q07A 5J8XA 3IHAA 5DVAA 4F94A 3M6HA 3GR2A 4GD6A 1M40A 4JXWA 2ZQ7A 4N9LA 3EQUA 4CJNA 5EVIC 2VGKA 4DDSA 4LCMA 2J9OA 2R9WA 2ZQAA 1K55C 3MKFA 3MXRA 4OQGA 1JVJA 2HP9A 2XD1A 4JF6A 4KQQA 2X02A 3A3JA 3BLMA 3RXXA 1XGJA 5FDHA 1W79A 4KZ5A 3ITAA 5D3OA 5JYOA 3BYDA 3V5MA 3VOZA 4OQIA 1FOFA 2Q9MA 3LY3A 4NETA 3FZCA 1K38A 1MKIA 2QZ6A 2HDRA 3HLCA 1KE4A 3FKWA 2ZC5B 2HP5A 1KGEA 5GHYA 2G2UA 2H0TA 3NIAA 1CEFA 2Y4AA 3Q82A 4UA9A 4KZ3A 5M19A 1FR1A 3UDFA 1K56A 5DTKA 1K6RA 4BD0A 5TGFA 1YMSA 3ZHHA 1SCWA 3BFDA 4WEKA 3EQVA 1XPBA 4EBPA 1RP5A 1L0EA 5DTSA 3G2YA 1MPLA 2ZM0A 3GV9A 1W5DA 2Y59A 1NJ4A 3GTCA 1YLJA 4DE2A 4B88A 4OLGA 3UY6A 1ONGA 5CECA 1BLHA 3E2LA 2ZC7A 1ALQA 1LL5A 2OLVA 1NY0A 2GDNA 1RGYA 3NBLA 4GDBA 3UE0A 1JWZA 4DE1A 1FCNA 4E3LA 1BULA 4JF4A 4OH0A 5F1GA 3C7UA 4LCLA 1G68A 2PU2A 4EBNA 1HD8A 3IXBA 4FH4A 4UA6A 4QY6A 5HFOA 4A5RA 5HL1A 4IBRA 3O88A 1W8YA 4PMAA 4H8RA 4OLDA 4KG5A 1I2WA 1KDSA 1GHPA 4BL2A 3ZFZA 1K56D 1JTDA 1RCJA 4OQHA 4YFMA 1YLYA 3WS0A 3G4PA 1MWUA 1BZAA 1WE4A 1XA7A 3ZVWA 5A90A 1ESIA 2X01A 1HVBA 4MBFA 2FFYA 2PU4A 2J9PA 1NYYA 1NXYA 4R1GA 1JWPA 4P87A 2JBFA 3DWZA 1Q2QA 3OPPA 5CEBA 1YM1A 4ZTKA 3OPLA 3NI9A 3WS4A 4WMCD 4R23A 1NRFA 3VSKA 1K57C 3C7VA 1MWTA 1YLPA 4KZBA 4C75A 2R9XA 3CJMA 3QHYA 1ZG4A 4BL3A 2H5SA 2OLUA 3N7WA 3NDEA 4RA7A 4QHCA 2QPNA 4U0TA 5E2GA 2XFSA 1XGIA 4IVKA 2IWBA 2EX2A 2ZC3B 2EFXA 1IYSA 3SS3A 1K57A 3BRMA 1TEMA 3PBQA 3FV7A 1JTGA 3ZVTA 1PYYA 3ZG8B 1LI9A 4WELA 3OCNA 4MLLA 4LV2A 4OOMA 5EVLA 3IQAA 1N9BA 5HAPA 2XEPA 1RGZA 2XK1A 3HLBA 5CRFA 2Z2MB 5F1FA 4QB8A 1E25A 1E3UA 4K0WA 4Y7PA 4PM9A 3MFDA 4JPMA 4RX3A 1PWGA 2Z2LB 1S6RA 2Y2GA 4IVIA 5F82A 1MWSA 5IHVA 3WS1A 4S2KA 3HLDA 2OV5A 1TDGA 4WMCA 3ZNTA 3OPRA 3N6IA 1ZC2A 2EFUA 4U3TA 4Y0OA 3HLGA 5DF8A 5EOOA 1JWVA 3O3VA 5HARA 5GLAA 3W4QA 2XDMA 2ZLYA 4KQRA 4O7DA 5KSCA 2P9VA 3IXHA 4OKPA 3IHBA 4KG2A 1C3BA 5FA7A 4S2IA 1BT5A 4KZ8A 4DXCA 1PZPA 4HEFA 4HESA 1PIOA 5FASA 1XXMA 3G2ZA 2ZQ8A 2HDQA 1SKFA 1SDEA 4OP5A 5FAPA 4EUZA 1ES5A 5CTMA 2XF3A 5GLCA 4R3JA 2Y2QA 4NK3A 2XGNA 4QY5A 1EROA 5FQJA 1K55A 4CPKA 3VSLA 1XA1A 4E3NA 2Y2NA 4UAAA 4FCFA 4D2OA 2HDSA 4KZ4A 4DKIA 3SH8A 2P74A 2XQZA 4ZDXA 2J7VA 4B4XA 3OZHA 4DDYA 1QMFA 1PI4A 3HVFA 4JF5A 3ZG9B 4OPZA 1DJBA 4WZ5A 5JYPA 3S4XA 2CC1A 2EX6A 4ZJ3A 1J9MA 3FKVA 4E3JA 1NYMA 1H8ZA 2ZQ9A 2BLSA 3DTMA 5FQKA 1WYCA 3S22A 1YMXA 4DXBA 4WM9A 4S2JA 2WZZA 2Y2KA 4ID4A 3IWIA 5E43A 1L0DA 2Y2PA 4BLMA 4S2NA 4XUZA 2HPBA 2ZD8A 4Y0UA 4KG6A 3BFCA 2Y55A 2ZM2A 4S2LA 4GDNA 4KZ6A 3GVBA 3IF5A 3M2JA 4WYYA 4FSFA 3Q81A 2WYXA 2XLNA 4S2NC 5TFQA 3PTEA 5AQ9A 1HTZA 5GLBA 2WAEA 3WRZA 2JCHA 2Y2HA 1YLTA 4E3OA 1FSWA 1L0FA 4LV0A 1W7FA 4EQIA 4JKTA 5E2EA 1GHMA 2PBYA 4K0XA 2QMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHU A;  1ERM A;  3HBR A;  2Y2I A;  4XUX A;  2IWC A;  4GOG A;  3G32 A;  3MZD A;  3B3X A;  1K6S A;  3N4I A;  1IEM A;  3UPO A;  3LY4 A;  3Q7V A;  1KE3 A;  4LEN A;  5CGX A;  2J8Y A;  3G30 A;  3C4P A;  2XR0 A;  1OME A;  3GMW A;  1MBL A;  1PZO A;  2Y2J A;  2Y2M A;  3IXG A;  3MXS A;  3RJU A;  2WGW B;  1CK3 A;  4MEZ A;  5EOE A;  1ERQ A;  1BLS A;  3BFG A;  3AGD A;  1FSY A;  3LO7 A;  4FD8 A;  2ZC6 B;  2E8I A;  1KE0 A;  3VOY A;  2DRW A;  3P98 A;  2A3U A;  3IT9 A;  4OOL A;  2DNS A;  2Y91 A;  4R4R A;  3Q7Z A;  3D4F A;  3NC8 A;  4OVD A;  3PBR A;  5CXW A;  5KMW A;  3NDG A;  3N8L A;  1GCE A;  4N9K A;  5CHM A;  1VQQ A;  1MY8 A;  3BM6 A;  1HZO A;  4N1X A;  5FI7 A;  3PBT A;  3VMA A;  4N92 A;  3MKE A;  4X56 A;  3UPP A;  2EX8 A;  4L0L A;  3FWL A;  4E6X A;  3OC2 A;  1MWR A;  2B5R A;  3A3E A;  5TR7 A;  3QNB A;  3O87 A;  1QME A;  2VGJ A;  5FI6 A;  5EEC A;  3I7J A;  5GL9 A;  5G18 A;  1E4D A;  4S2P A;  3HL9 A;  3IWO A;  4ZAM A;  1FQG A;  1LLB A;  5GHZ A;  1ONH A;  1ESU A;  1W8Q A;  3VP1 A;  3UE3 A;  4KZ9 A;  3WS5 A;  1I5Q A;  3DWK A;  5GLD A;  3PBO A;  5EPH A;  3VP3 A;  3BFF A;  5U47 A;  3N8R A;  4JLF A;  4DRT A;  1K25 A;  4QJG A;  5EE8 A;  1PW8 A;  4FH2 A;  3IXD A;  3BEB A;  2WKH A;  4X55 A;  5HW3 A;  5M1A A;  4M3K A;  5FAO A;  1O07 A;  2EXB A;  1KGF A;  2WZX A;  2V2F F;  1IKG A;  5FQI A;  4X6T A;  5KZH A;  3IF6 B;  2BG1 A;  4GNU A;  5A93 A;  4QU3 A;  3SS4 A;  5CGS A;  1IYO A;  2HDU A;  4JXG A;  1FCM A;  1PWC A;  1KDW A;  4WZ5 C;  2ZM8 A;  4GD8 A;  5GHX A;  1CI9 A;  5E2F A;  3TOI A;  2P9V B;  2C6W B;  3HLW A;  5FQM A;  4LV1 A;  3HUM A;  3GSG A;  5A92 A;  2OSU A;  4RYE A;  4DE3 A;  4LV3 A;  1VM1 A;  5L2F A;  1ES3 A;  3OCL A;  2WAF A;  4X69 A;  2HP6 A;  4C6Y A;  1Y54 A;  3PBS A;  3V50 A;  1ES2 A;  3VFF A;  1TVF A;  4YIN A;  2C5W B;  2V20 A;  1XP4 A;  1YT4 A;  1U60 A;  2H0Y A;  4WBG A;  5CTN A;  4BD1 A;  4RVA A;  2IWD A;  3A3I A;  1FCO A;  3HUN A;  4PM7 A;  2V1Z A;  3LEZ A;  4ZJ1 A;  4UA7 A;  1K54 C;  1LL9 A;  1FR6 A;  3Q1F A;  2WGV A;  3W8K A;  1DJA A;  4PPR A;  1YLW A;  1L0G A;  3TG9 A;  3UN7 A;  4P85 A;  1O7E A;  5A91 A;  1MXO A;  2XH9 A;  1EWZ A;  3PAG A;  3CZD A;  1IKI A;  1CEG A;  3C5A A;  4MBH A;  5CED A;  4DE0 A;  3M6B A;  2RL3 A;  4EWF A;  2I72 A;  1L2S A;  4S2M A;  2ZQD A;  3V39 A;  4IED A;  2JC7 A;  4DF6 A;  3C4O A;  2Q9N A;  3UPN A;  3P09 A;  4PM6 A;  4E3K A;  1PW1 A;  4HBU A;  1IYQ A;  4BJP A;  4E3M A;  4B4Z A;  1BUE A;  1E3U D;  1PI5 A;  3GQZ A;  3W4P A;  3NCK A;  2ZQC A;  4MNR A;  4R4S A;  5FQ9 A;  3UDI A;  3AGE A;  5E2H A;  3PAE A;  4E6W A;  2WK0 A;  4BQM A;  5DF7 A;  4Y0T A;  5AQA A;  5HAI A;  5BOH A;  4OP8 A;  1DY6 A;  1Z6F A;  2EX9 A;  3MZE A;  1WYB A;  1ES4 A;  1KVM A;  1N4O A;  1YLZ A;  3LCE A;  4X53 A;  4IBX A;  1I2S A;  1H5X A;  3UDX A;  5HAQ A;  1BLC A;  3PBN A;  1BSG A;  4OQ0 A;  2WGW A;  5CGW A;  3VFH A;  3SS5 A;  3VP0 A;  3ZGA B;  3ZCZ A;  5HX9 A;  3CG5 A;  1XKZ A;  2WKI A;  1IYP A;  3G35 A;  1NZO A;  5KSH A;  1LI0 A;  2H10 A;  4WZ4 A;  3SH7 A;  2RCX A;  3ZG5 A;  1G6A A;  2JE5 A;  2DCF A;  5FQQ A;  5CER A;  3UE1 A;  4MBK A;  5EUA A;  5FSR A;  3FYZ A;  3E2K A;  3HRE A;  2G2W A;  3HLE A;  3IH8 A;  4JXS A;  2A49 A;  5I94 A;  1KGG A;  4OOY A;  3VP4 A;  1BTL A;  3O86 A;  3BLS A;  3ZG7 B;  4EV4 A;  1PWD A;  3Q7V B;  1EI5 A;  3JYI A;  5DF9 A;  1XX2 A;  4GN2 A;  5FAT A;  4PM5 A;  2XFT A;  2ZMA A;  3VP2 A;  4KZA A;  3IWQ A;  4KEN B;  5AQ7 A;  4S2O A;  2FFF B;  3IH9 A;  3W4O A;  3A3F A;  4E3I A;  5F83 A;  1S0W A;  3ZDJ A;  1K4F A;  4OPY A;  3M2K A;  1GA0 A;  4KQO A;  4EBL A;  3WWX A;  4ZBE A;  4PM8 A;  1K4E A;  3G34 A;  4BEN A;  4OPR A;  5EVI B;  2Y2L A;  3MBZ A;  3WRT A;  1ZG6 A;  5DTT A;  1TDL A;  4GB7 A;  3IF6 C;  3GRJ A;  4GZB A;  2ZJ9 A;  2ZC4 B;  1M6K A;  4P0M A;  3TSG A;  4WEJ A;  3V3S A;  3BFE A;  5EVI D;  3ITB A;  3SH9 A;  4P6B A;  4Q8I A;  1SDN A;  1ZKJ A;  3G31 A;  4JXV A;  3IF6 A;  3NY4 A;  4Z9Q A;  3UNW A;  3UO9 A;  2WUQ A;  3BEC A;  4KZ7 A;  4XXR A;  1K54 A;  2Y2O A;  4OON A;  1GHI A;  4JBF A;  2XD5 A;  3QNC A;  4N1H A;  1AXB A;  3SOI A;  4C3Q A;  4R3B A;  4UHU A;  3AGF A;  2EXA A;  4QD4 A;  5CHJ A;  5FI2 A;  1BLP A;  3RXW A;  3WS2 A;  1LHY A;  3N8S A;  3V3R A;  3ZNY A;  3ISG A;  1Q2P A;  1CI8 A;  2X71 A;  3CMZ A;  1IEL A;  1NZU A;  5M18 A;  4RX2 A;  2WAD A;  1GA9 A;  3ZG0 A;  1YQS A;  4ZJ2 A;  2WGI A;  1DJC A;  2WKE A;  3S1Y A;  4X68 A;  4OPQ A;  5AQB A;  3DW0 A;  1SHV A;  3OPH A;  5FAQ A;  3MZF A;  4GKU A;  4K91 A;  1H8Y A;  3A3D A;  4U0X A;  4HBT A;  1KVL A;  2UWX A;  4R0Q A;  3HLF A;  3HUO A;  5EVI A;  3Q07 A;  5J8X A;  3IHA A;  5DVA A;  4F94 A;  3M6H A;  3GR2 A;  4GD6 A;  1M40 A;  4JXW A;  2ZQ7 A;  4N9L A;  3EQU A;  4CJN A;  5EVI C;  2VGK A;  4DDS A;  4LCM A;  2J9O A;  2R9W A;  2ZQA A;  1K55 C;  3MKF A;  3MXR A;  4OQG A;  1JVJ A;  2HP9 A;  2XD1 A;  4JF6 A;  4KQQ A;  2X02 A;  3A3J A;  3BLM A;  3RXX A;  1XGJ A;  5FDH A;  1W79 A;  4KZ5 A;  3ITA A;  5D3O A;  5JYO A;  3BYD A;  3V5M A;  3VOZ A;  4OQI A;  1FOF A;  2Q9M A;  3LY3 A;  4NET A;  3FZC A;  1K38 A;  1MKI A;  2QZ6 A;  2HDR A;  3HLC A;  1KE4 A;  3FKW A;  2ZC5 B;  2HP5 A;  1KGE A;  5GHY A;  2G2U A;  2H0T A;  3NIA A;  1CEF A;  2Y4A A;  3Q82 A;  4UA9 A;  4KZ3 A;  5M19 A;  1FR1 A;  3UDF A;  1K56 A;  5DTK A;  1K6R A;  4BD0 A;  5TGF A;  1YMS A;  3ZHH A;  1SCW A;  3BFD A;  4WEK A;  3EQV A;  1XPB A;  4EBP A;  1RP5 A;  1L0E A;  5DTS A;  3G2Y A;  1MPL A;  2ZM0 A;  3GV9 A;  1W5D A;  2Y59 A;  1NJ4 A;  3GTC A;  1YLJ A;  4DE2 A;  4B88 A;  4OLG A;  3UY6 A;  1ONG A;  5CEC A;  1BLH A;  3E2L A;  2ZC7 A;  1ALQ A;  1LL5 A;  2OLV A;  1NY0 A;  2GDN A;  1RGY A;  3NBL A;  4GDB A;  3UE0 A;  1JWZ A;  4DE1 A;  1FCN A;  4E3L A;  1BUL A;  4JF4 A;  4OH0 A;  5F1G A;  3C7U A;  4LCL A;  1G68 A;  2PU2 A;  4EBN A;  1HD8 A;  3IXB A;  4FH4 A;  4UA6 A;  4QY6 A;  5HFO A;  4A5R A;  5HL1 A;  4IBR A;  3O88 A;  1W8Y A;  4PMA A;  4H8R A;  4OLD A;  4KG5 A;  1I2W A;  1KDS A;  1GHP A;  4BL2 A;  3ZFZ A;  1K56 D;  1JTD A;  1RCJ A;  4OQH A;  4YFM A;  1YLY A;  3WS0 A;  3G4P A;  1MWU A;  1BZA A;  1WE4 A;  1XA7 A;  3ZVW A;  5A90 A;  1ESI A;  2X01 A;  1HVB A;  4MBF A;  2FFY A;  2PU4 A;  2J9P A;  1NYY A;  1NXY A;  4R1G A;  1JWP A;  4P87 A;  2JBF A;  3DWZ A;  1Q2Q A;  3OPP A;  5CEB A;  1YM1 A;  4ZTK A;  3OPL A;  3NI9 A;  3WS4 A;  4WMC D;  4R23 A;  1NRF A;  3VSK A;  1K57 C;  3C7V A;  1MWT A;  1YLP A;  4KZB A;  4C75 A;  2R9X A;  3CJM A;  3QHY A;  1ZG4 A;  4BL3 A;  2H5S A;  2OLU A;  3N7W A;  3NDE A;  4RA7 A;  4QHC A;  2QPN A;  4U0T A;  5E2G A;  2XFS A;  1XGI A;  4IVK A;  2IWB A;  2EX2 A;  2ZC3 B;  2EFX A;  1IYS A;  3SS3 A;  1K57 A;  3BRM A;  1TEM A;  3PBQ A;  3FV7 A;  1JTG A;  3ZVT A;  1PYY A;  3ZG8 B;  1LI9 A;  4WEL A;  3OCN A;  4MLL A;  4LV2 A;  4OOM A;  5EVL A;  3IQA A;  1N9B A;  5HAP A;  2XEP A;  1RGZ A;  2XK1 A;  3HLB A;  5CRF A;  2Z2M B;  5F1F A;  4QB8 A;  1E25 A;  1E3U A;  4K0W A;  4Y7P A;  4PM9 A;  3MFD A;  4JPM A;  4RX3 A;  1PWG A;  2Z2L B;  1S6R A;  2Y2G A;  4IVI A;  5F82 A;  1MWS A;  5IHV A;  3WS1 A;  4S2K A;  3HLD A;  2OV5 A;  1TDG A;  4WMC A;  3ZNT A;  3OPR A;  3N6I A;  1ZC2 A;  2EFU A;  4U3T A;  4Y0O A;  3HLG A;  5DF8 A;  5EOO A;  1JWV A;  3O3V A;  5HAR A;  5GLA A;  3W4Q A;  2XDM A;  2ZLY A;  4KQR A;  4O7D A;  5KSC A;  2P9V A;  3IXH A;  4OKP A;  3IHB A;  4KG2 A;  1C3B A;  5FA7 A;  4S2I A;  1BT5 A;  4KZ8 A;  4DXC A;  1PZP A;  4HEF A;  4HES A;  1PIO A;  5FAS A;  1XXM A;  3G2Z A;  2ZQ8 A;  2HDQ A;  1SKF A;  1SDE A;  4OP5 A;  5FAP A;  4EUZ A;  1ES5 A;  5CTM A;  2XF3 A;  5GLC A;  4R3J A;  2Y2Q A;  4NK3 A;  2XGN A;  4QY5 A;  1ERO A;  5FQJ A;  1K55 A;  4CPK A;  3VSL A;  1XA1 A;  4E3N A;  2Y2N A;  4UAA A;  4FCF A;  4D2O A;  2HDS A;  4KZ4 A;  4DKI A;  3SH8 A;  2P74 A;  2XQZ A;  4ZDX A;  2J7V A;  4B4X A;  3OZH A;  4DDY A;  1QMF A;  1PI4 A;  3HVF A;  4JF5 A;  3ZG9 B;  4OPZ A;  1DJB A;  4WZ5 A;  5JYP A;  3S4X A;  2CC1 A;  2EX6 A;  4ZJ3 A;  1J9M A;  3FKV A;  4E3J A;  1NYM A;  1H8Z A;  2ZQ9 A;  2BLS A;  3DTM A;  5FQK A;  1WYC A;  3S22 A;  1YMX A;  4DXB A;  4WM9 A;  4S2J A;  2WZZ A;  2Y2K A;  4ID4 A;  3IWI A;  5E43 A;  1L0D A;  2Y2P A;  4BLM A;  4S2N A;  4XUZ A;  2HPB A;  2ZD8 A;  4Y0U A;  4KG6 A;  3BFC A;  2Y55 A;  2ZM2 A;  4S2L A;  4GDN A;  4KZ6 A;  3GVB A;  3IF5 A;  3M2J A;  4WYY A;  4FSF A;  3Q81 A;  2WYX A;  2XLN A;  4S2N C;  5TFQ A;  3PTE A;  5AQ9 A;  1HTZ A;  5GLB A;  2WAE A;  3WRZ A;  2JCH A;  2Y2H A;  1YLT A;  4E3O A;  1FSW A;  1L0F A;  4LV0 A;  1W7F A;  4EQI A;  4JKT A;  5E2E A;  1GHM A;  2PBY A;  4K0X A;  2QMI A; 
#chains in the Genus database with same CATH topology
 3VOL A;  2O9C A;  3HBR A;  1Y28 A;  2Y2I A;  2OOL A;  4UQI S;  3B3X A;  1EW0 A;  1KE3 A;  2PYR A;  3G30 A;  2VK3 A;  2KX6 A;  3C4P A;  4EER A;  3IXG A;  2WGW B;  1ERQ A;  3BFG A;  1KE0 A;  3LIE A;  2DRW A;  4OOL A;  4ESP A;  3PBR A;  3N8L A;  3CUE A;  4X25 A;  1GSW A;  5HWT A;  1VQQ A;  1HZO A;  3LR3 A;  2EX8 A;  2B5R A;  3A3E A;  5TR7 A;  2PR5 A;  5FI6 A;  2ZL1 B;  4S2P A;  4HJ4 A;  4ZAM A;  1FQG A;  3CPT A;  4PKY A;  1ONH A;  2GJ3 A;  4BBU A;  4LFU A;  3PYP A;  3PBO A;  5DKL A;  4QJG A;  5EE8 A;  3IXD A;  4H6J B;  2WKH A;  5EM0 A;  5HW3 A;  2I9V A;  5FAO A;  2EXB A;  4X6T A;  2BG1 A;  3SS4 A;  5CGS A;  2FZ0 A;  1PWC A;  5GHX A;  1PNE A;  2P9V B;  1YKD A;  5FQM A;  2OSU A;  4LV3 A;  1VM1 A;  4C6Y A;  1Y54 A;  2INW A;  3V50 A;  1ES2 A;  1T18 A;  1TVF A;  4YIN A;  2V20 A;  1U60 A;  4G3W A;  4UA7 A;  1LL9 A;  3JPU A;  4LRY C;  3UN7 A;  3TG9 A;  5A91 A;  1W63 M;  1MXO A;  2NUP C;  3C5A A;  4Y2F A;  3M6B A;  2I72 A;  1L2S A;  2V8F A;  2A24 A;  3T1R A;  4E3K A;  4HBU A;  3T1X A;  3W4P A;  2B18 A;  1S1Y A;  4X1L A;  4WUJ A;  2WK0 A;  4BQM A;  4ETZ A;  4Y0T A;  2QHK A;  2V0W A;  3MZE A;  1WYB A;  1P97 A;  4X53 A;  3LCE A;  3DTK A;  4CLC C;  5HAQ A;  1BSG A;  5HX9 A;  3S7Q A;  3GEC A;  1XKZ A;  2WKI A;  1IYP A;  4ARZ B;  2H10 A;  2RCX A;  1TS6 A;  2JE5 A;  5EUA A;  3HLE A;  2B95 A;  3VP4 A;  1V9Z A;  3BLS A;  3JVV A;  1BYW A;  5FAT A;  4PM5 A;  2ZMA A;  3VP2 A;  3IWQ A;  4KEN B;  5AQ7 A;  2FFF B;  3IH9 A;  4E3I A;  3A3F A;  5F83 A;  1S0W A;  1LSV A;  4EU0 A;  1K4E A;  4D60 A;  5L09 A;  4OPR A;  3MF0 A;  4CLC B;  1ZG6 A;  1P9W A;  3GRJ A;  4GZB A;  1D06 A;  2ZC4 B;  3TSG A;  3V3S A;  1W63 Q;  1PRQ A;  3KYZ A;  3SH9 A;  3QP8 A;  3G31 A;  5L8M A;  1FIL A;  3T4S A;  4MN6 A;  4JBF A;  5DFY A;  2UV0 E;  4N1H A;  3SOI A;  3AGF A;  4QD4 A;  5CHJ A;  1LL8 A;  5FI2 A;  3IS2 A;  1VHM A;  3RXW A;  2O0Y A;  3SW1 A;  2X71 A;  1IEL A;  4HIA A;  2M1C A;  2OWJ A;  5M18 A;  3B33 A;  1GA9 A;  2WGI A;  3S1Y A;  3NOU C;  4F3L B;  1OJ5 A;  3MQO A;  4K91 A;  1H8Y A;  3A3D A;  5EV0 A;  2W3G A;  4K08 A;  3HUO A;  1TS7 A;  3Q07 A;  4HJ6 A;  2JKR I;  5HWV A;  3B47 A;  3H82 B;  3NOT C;  3T1Q B;  4OQG A;  4KQQ A;  3U4L P;  3A3J A;  3BLM A;  3RXX A;  1W79 A;  3T4K A;  3VE3 A;  3ITA A;  5D3O A;  3IX8 A;  4GS9 A;  3VOZ A;  4OQI A;  1J3W A;  3HLC A;  3CUE C;  2G2U A;  4LRX C;  5DKK A;  1YMS A;  1D1J A;  1XPB A;  1L3L A;  1Z09 A;  3G2Y A;  1MPL A;  1NJ4 A;  3GTC A;  4MN5 A;  1YLJ A;  2WKR A;  1BLH A;  3E2L A;  2ZC7 A;  1V9Y A;  1NY0 A;  2GDN A;  1P0Z A;  3UE0 A;  3UE6 A;  4OH0 A;  3C7U A;  5J4E A;  3IXB A;  2VEA A;  4FH4 A;  2L0W A;  3CPT B;  3O88 A;  1STZ A;  1X0O A;  4H8R A;  1GHP A;  2W1T A;  2VGL S;  1K56 D;  1JTD A;  4OQH A;  3WS0 A;  1BZA A;  2X01 A;  1HVB A;  4GHI B;  2FFY A;  2J9P A;  4I39 A;  1XJ3 A;  3PHY A;  3D72 A;  3OPL A;  3WS4 A;  1NRF A;  1MZU A;  1MWT A;  3N7W A;  4RA7 A;  2QPN A;  2XFS A;  4IVK A;  2ZC3 B;  3SS3 A;  3RH8 B;  1JTG A;  1LI9 A;  4MLL A;  1ZTU A;  1K0K A;  4NKP A;  2XK1 A;  3HLB A;  5CRF A;  2PDR A;  2Z2M B;  1T1B A;  2PD7 A;  1E3U A;  2VLG A;  3NOP C;  4GLQ A;  5FEF A;  1PWG A;  1T1A A;  1S6R A;  2CMN A;  2G7U A;  1TDG A;  4WMC A;  3ZNT A;  3OPR A;  3TW8 A;  2EFU A;  5EOO A;  1JWV A;  2AVX A;  4O7D A;  5KSC A;  4KG2 A;  5F5Y A;  4HES A;  5FDS A;  3NUL A;  2Y2Q A;  4UQI M;  2XGN A;  1XA1 A;  5HWW A;  4FCF A;  4D2O A;  3T1S A;  2P74 A;  4Q0J A;  4B4X A;  1GSX A;  3OZH A;  1HLU P;  1QMF A;  1PI4 A;  3W2Z A;  5JYP A;  4WZ5 A;  2EX6 A;  4ZJ3 A;  3FKV A;  2BLS A;  5FQK A;  3G6O A;  3CWF A;  4QPR A;  2P7J A;  1IOU A;  4S2J A;  3LIA A;  2Y2K A;  3L9K A;  4BLM A;  1VET B;  1OTE A;  1FIK A;  3BFC A;  2ZM2 A;  4GDN A;  4KZ6 A;  4WYY A;  2PHY A;  4S2N C;  1S4R A;  3DTI A;  3PTE A;  1YLT A;  4E3O A;  1FSW A;  1L0F A;  4LV0 A;  4JKT A;  5E2E A;  4HH2 A;  2QMI A;  4R3A A;  5CHU A;  1ERM A;  1YSQ A;  5C5K A;  3QP1 A;  3ICY A;  2IWC A;  3MZD A;  2K2N A;  3UPO A;  3E0Y A;  4XT2 B;  4LEN A;  1XJ2 A;  2Y2M A;  4MEZ A;  1CK3 A;  5EOE A;  3VOY A;  3P98 A;  3Q7Z A;  5CXW A;  2L4R A;  1GCE A;  5CHM A;  4Y5F A;  3EGD C;  1MY8 A;  3VMA A;  4N92 A;  3MKE A;  1UWN X;  3R4K A;  3GDI A;  4L0L A;  3BY8 A;  3QNB A;  3O87 A;  4DJ3 A;  5EEC A;  3I7J A;  3L7H A;  5GHZ A;  1ESU A;  3VP1 A;  3UE3 A;  5GLD A;  2PD8 A;  4CLC A;  2W3F A;  5EPH A;  3PR6 A;  5U47 A;  4JLF A;  4FH2 A;  4X55 A;  3F1N A;  1KGF A;  2V2F F;  1IKG A;  1DRM A;  4GNU A;  5A93 A;  5CX7 A;  2V1B A;  1FCM A;  1KDW A;  3B42 A;  2C6W B;  3LYX A;  5HDC A;  3GSG A;  5A92 A;  4RYE A;  2ZOH A;  1ES3 A;  5L2F A;  2PT7 A;  4X69 A;  2WAF A;  2QYB A;  4O0P A;  2C5W B;  1TS8 A;  1XP4 A;  4BD1 A;  1FCO A;  3HUN A;  4PM7 A;  4ZJ1 A;  3MMH A;  1L0G A;  1EWZ A;  2XH9 A;  1IKI A;  3F1O B;  5CED A;  2VV7 A;  4DE0 A;  2EWW A;  4B9O A;  2JC7 A;  1P9R A;  2ZMV A;  3LR0 A;  5DJU A;  4B4Z A;  1BUE A;  4MNR A;  5FQ9 A;  3PAE A;  4E6W A;  3T50 A;  5DF7 A;  3QP6 A;  1YLZ A;  3HJI A;  1KVM A;  4P6Z S;  1H5X A;  3PBN A;  5CGW A;  1TS0 A;  3SS5 A;  4R70 A;  3VP0 A;  3LIC A;  3V67 A;  3SH7 A;  5FSR A;  3FYZ A;  3HRE A;  2XA7 M;  2A49 A;  2W3H A;  1XX2 A;  4GN2 A;  3H7W B;  4HH3 A;  4KZA A;  5IT5 A;  4S2O A;  3ZDJ A;  4LLO B;  1K4F A;  4OPY A;  4JGR A;  1GA0 A;  4KQO A;  4PM8 A;  4GJ4 A;  5DTT A;  1TDL A;  1XFN A;  2ZJ9 A;  3EEA A;  1M6K A;  4WEJ A;  3BFE A;  3NJA A;  3ITB A;  3C38 A;  4P6B A;  3SZT A;  1ZKJ A;  1F5M A;  3IF6 A;  3UO9 A;  1S1Z A;  4KZ7 A;  4Q0I A;  4R3B A;  2EXA A;  1BLP A;  2O9A A;  3N8S A;  3ISG A;  3CMZ A;  1VEU B;  1DJC A;  1S67 L;  5AQB A;  1SHV A;  2PYP A;  2Z6C A;  2GX5 A;  2KDK A;  5J8X A;  5MC7 A;  2J3T D;  3M6H A;  3BWL A;  1DP9 A;  1M40 A;  4CJN A;  4M4X A;  5EVI C;  4DDS A;  4LCM A;  5EM1 A;  2J9O A;  2LB9 A;  2ZQA A;  2HP9 A;  3E4O A;  4DJ2 A;  2X02 A;  5FDH A;  2D02 A;  3QP2 A;  4JGP A;  4EUV A;  3D3O A;  3LY3 A;  4IUK A;  3EEH A;  4NET A;  2ZC5 B;  2HP5 A;  3F1O A;  5GHY A;  2H0T A;  1CEF A;  4UA9 A;  1NRJ A;  5M19 A;  4ZRR A;  1OTB A;  1FR1 A;  3UDF A;  4BD0 A;  2OAQ 1;  1OT9 A;  1SCW A;  4EBP A;  3KO6 A;  3CAX A;  1W5D A;  4OLG A;  3UY6 A;  4PHT A;  1G5U A;  4CQH A;  4EEU A;  1N9N A;  1ALQ A;  1UGU A;  2OLV A;  2W27 A;  1RGY A;  1JWZ A;  5KIZ A;  3K3D A;  1BUL A;  5F1G A;  3C30 A;  1OPX A;  1OTI A;  1G68 A;  4EBN A;  1XJ6 A;  4WN5 A;  3TE8 A;  3MSH A;  4UA6 A;  3P7N A;  5HFO A;  3MQQ A;  4NXF A;  1KDS A;  4JGO A;  4BL2 A;  3KSI A;  1H0M A;  1WE4 A;  1MWU A;  5A90 A;  3JVU A;  4R1G A;  2PU4 A;  1NXY A;  3DWZ A;  4Y17 A;  4ZTK A;  2PAV P;  3LID A;  3NI9 A;  4WMC D;  4G3V A;  4R23 A;  1K57 C;  3C7V A;  4KZB A;  2R9X A;  2LB5 A;  1T19 A;  2HF6 A;  1GSV A;  2OLU A;  3BQ8 A;  4WF0 A;  4XT2 A;  1XGI A;  2IWB A;  2EX2 A;  2QJ7 A;  3CI6 A;  1IYS A;  4MDZ A;  1K57 A;  3ZVT A;  1PYY A;  3ZG8 B;  2W3D A;  4R38 A;  4LGW A;  4LV2 A;  5EVL A;  3IQA A;  2FH5 A;  3T4L A;  3MS6 A;  3DTE A;  5HAP A;  1RGZ A;  1E25 A;  4K0W A;  2VKS A;  4JPM A;  2Z2L B;  2Y2G A;  5IHV A;  3IBR A;  4G3K A;  4KUO A;  4Y0O A;  2VJW A;  4Y15 A;  3O3V A;  2P9V A;  2ZMF A;  3IXH A;  4PKY G;  3LR4 A;  4NEE D;  1BT5 A;  4KZ8 A;  4HEF A;  2PBD P;  1PIO A;  2Q0O A;  4IUH A;  2ZQ8 A;  1SKF A;  2DMW A;  1ES5 A;  5HDS A;  1G6O A;  2Y79 A;  1K55 A;  4CPK A;  3VSL A;  2HDS A;  1S4S A;  4ZDX A;  3IBJ A;  3HVF A;  4OPZ A;  3MXQ A;  2Z6D A;  4GHI A;  3DTM A;  5IS1 A;  1WYC A;  1YMX A;  4DXB A;  3UME A;  4WM9 A;  2WZZ A;  5E43 A;  4XUZ A;  5G4Y A;  4E04 A;  5EVE A;  3GVB A;  3T12 B;  3Q81 A;  3HJK A;  2XLN A;  5TFQ A;  5AQ9 A;  2V1A A;  3WRZ A;  4EW7 A;  3MR0 A;  2M7U A;  1GHM A;  2PBY A;  2PRF A;  2VZW A;  3G32 A;  5FL3 A;  4Q0H A;  3Q7V A;  2J8Y A;  1OME A;  2Y2J A;  3VE4 A;  1BLS A;  1FSY A;  2ZC6 B;  2A3U A;  3IT9 A;  2DNS A;  2Y91 A;  5TBM B;  4R4R A;  3D4F A;  5G4Z A;  4OVD A;  5KMW A;  4HHD A;  2O9B A;  2Y8H A;  3FPV A;  4EES A;  3BM6 A;  4N1X A;  5FI7 A;  2J3W A;  3UPP A;  2OAP 1;  4E6X A;  1MWR A;  1XFQ A;  1QME A;  4FTX A;  5LBR A;  2BAS A;  1VET A;  3A0R A;  1E4D A;  3IWO A;  3WS5 A;  4HY8 A;  3DWK A;  3LIB A;  3VP3 A;  1PFL A;  3N8R A;  1K25 A;  1PW8 A;  5F6A A;  1O07 A;  3KYQ A;  5IU1 A;  3IF6 B;  4WZ5 C;  3TOI A;  5E2F A;  2K7S A;  4LV1 A;  3HUM A;  3ZYT A;  3VFF A;  3H7W A;  1YT4 A;  2H0Y A;  4WBG A;  5CTN A;  3FPW A;  4RVA A;  3CLO A;  2V1Z A;  5L07 A;  3TRC A;  1K54 C;  2D01 A;  1DJA A;  4I3A A;  4PPR A;  4P85 A;  5EFW A;  3CZD A;  1CQA A;  1CEG A;  4MBH A;  5HSQ A;  2RL3 A;  4NXB A;  3KSG A;  3R7W A;  3C4O A;  2Q9N A;  1ODV A;  5HDD A;  3QP5 A;  1PI5 A;  3H9W A;  3DAV A;  2HGV A;  2ZQC A;  3NCK A;  3OLO A;  2ZOI A;  1ZHH B;  5E2H A;  4HI4 A;  1DY6 A;  1Z6F A;  2EX9 A;  3A0S A;  1VEU A;  4X1M A;  4WL9 A;  4OQ0 A;  3ZCZ A;  3VFH A;  4BBV A;  4EQ1 A;  2WKQ A;  1LI0 A;  4WZ4 A;  4Y13 A;  1G6A A;  3CIT A;  5CER A;  4MBK A;  3E2K A;  3IH8 A;  4JXS A;  5I94 A;  1BTL A;  4BBT A;  1T1C A;  4EV4 A;  1PWD A;  3Q7V B;  2XSS A;  4WLA A;  3ULF A;  3W4O A;  3M2K A;  3DBA A;  2E8J A;  2Y2L A;  3F1P A;  2H28 A;  4GB7 A;  2GNX A;  4RQ9 A;  5EVI D;  1SDN A;  2HZ5 A;  1OTD A;  4Z9Q A;  4XXR A;  1SKO B;  4OON A;  1GHI A;  1OT6 A;  1VB6 A;  4C3Q A;  2M7V A;  1LHY A;  2ACG A;  3O5Y A;  3C8C A;  1NZU A;  4RX2 A;  1YQS A;  2WKE A;  4H6J A;  4X68 A;  5F69 A;  3DW0 A;  3OPH A;  3MZF A;  5AJG A;  3LI8 A;  1MKM A;  4R0Q A;  3HLF A;  4HNB A;  3IHA A;  4YNR A;  5DVA A;  3C2W A;  4F94 A;  1G28 A;  4JXW A;  1UWP X;  3EQU A;  2VGK A;  4FUW A;  3MXR A;  3MKF A;  3LR5 A;  1JVJ A;  2JN7 A;  2XD1 A;  4HOI A;  1XGJ A;  4KZ5 A;  2P08 A;  3NEC A;  1WA9 A;  3BYD A;  3V5M A;  1FOF A;  2Q9M A;  2P04 A;  2V0U A;  1YAX A;  2HDR A;  1KGE A;  3NIA A;  5HD3 A;  3Q82 A;  1H8M A;  2HJ9 C;  3BJN A;  1DP6 A;  4F3L A;  1K6R A;  3ZQ5 A;  3UB6 A;  3UMD A;  3ZHH A;  3BFD A;  3LFV A;  1L0E A;  5DTS A;  2ZM0 A;  4GW9 A;  4B88 A;  1SKO A;  4CLC E;  4MN7 A;  1LL5 A;  4DE1 A;  4LCL A;  2PU2 A;  3D9Y A;  3LIF A;  3MFX A;  4A5R A;  5HL1 A;  4IBR A;  3LI9 A;  4GCZ A;  4PMA A;  1AWI A;  1RCJ A;  4YFM A;  3G4P A;  1XA7 A;  5A8B A;  1JWP A;  2VX8 A;  5I5L A;  3OPP A;  4DN0 A;  3VSK A;  1YLP A;  2JKT I;  4C75 A;  3QHY A;  1ZG4 A;  4BL3 A;  3NDE A;  4FOF A;  4QHC A;  5E2G A;  2EFX A;  4IHQ A;  3MJQ A;  3BRM A;  3FV7 A;  4WEL A;  2EA9 A;  3K2N A;  1N9B A;  2K31 A;  2XEP A;  2QKP A;  4QB8 A;  1KOU A;  4PM9 A;  3MFD A;  3BY9 A;  3WS1 A;  4S2K A;  3HLD A;  2OV5 A;  5FEG A;  4I3I A;  1ZC2 A;  1JNU A;  3HLG A;  2XDM A;  2ZLY A;  3BW6 A;  4OKP A;  3IHB A;  4DXC A;  1PZP A;  3T4Q A;  2XRN A;  5FAS A;  1XXM A;  2HDQ A;  4R6L A;  1SDE A;  4OP5 A;  5FAP A;  3OOV A;  1ERO A;  5FQJ A;  3IX3 A;  2Y2N A;  4UAA A;  3S7N A;  2W1T B;  3E98 A;  5AVE A;  4DKI A;  2GZA A;  3SH8 A;  3VV4 A;  4DDY A;  4JF5 A;  3ZG9 B;  3LEQ A;  1DJB A;  5AVF A;  2CC1 A;  1J9M A;  1NYM A;  4BMW A;  5J7E A;  5HPF A;  4ID4 A;  3IWI A;  4IJG A;  4S2N A;  2HPB A;  4EXO A;  2Y55 A;  4S2L A;  1IFQ A;  3M2J A;  4FSF A;  3UB9 A;  1DP8 A;  2BTF P;  1HTZ A;  3KYE A;  4EEP A;  2JCH A;  3KSF A;  2Y2H A;  3T4J A;  3RTY A;  4EQI A;  2PR6 A;  4II7 A;  4XUX A;  4GOG A;  3N4I A;  1K6S A;  1IEM A;  3LY4 A;  5CGX A;  2HJE A;  2NUT C;  2XR0 A;  3GMW A;  1MBL A;  1PZO A;  3RJU A;  3MXS A;  1Y4O A;  3LO7 A;  3AGD A;  4FD8 A;  3F1N B;  4O8G A;  2E8I A;  3NC8 A;  4PAU A;  3NDG A;  4N9K A;  3PBT A;  4NG2 A;  4AFI A;  4X56 A;  2JHE A;  2HV1 A;  5K5B A;  3FWL A;  3OC2 A;  2VGJ A;  5GL9 A;  3T4O A;  5G18 A;  3HL9 A;  5HZH A;  1LLB A;  4I5S A;  4P6Z M;  1W8Q A;  4KZ9 A;  1I5Q A;  3TJZ C;  2JKT M;  2OWH A;  3BFF A;  4DRT A;  3BEB A;  4YOF A;  5M1A A;  4M3K A;  2WZX A;  5FQI A;  5KZH A;  4QU3 A;  1IYO A;  2HDU A;  4JXG A;  1D7E A;  2ZM8 A;  3KX0 X;  4GD8 A;  1CI9 A;  4UEY A;  3HLW A;  3FC7 A;  3RFB A;  4DE3 A;  2VV8 A;  1A0K A;  3OCL A;  2HP6 A;  3S7O A;  2YKF A;  3EWK A;  3PBS A;  2IWD A;  3A3I A;  2QWS A;  3LEZ A;  3T4T A;  3W8K A;  1FR6 A;  3Q1F A;  2JKR M;  2WGV A;  4YWZ A;  1YLW A;  3S7P A;  1O7E A;  1YSP A;  1F9I A;  3PAG A;  4EWF A;  3V39 A;  4S2M A;  2ZQD A;  4IED A;  4DF6 A;  3UPN A;  4BWI A;  5F68 A;  1F98 A;  1OTA A;  3P09 A;  4PM6 A;  2KLI A;  1PW1 A;  1IYQ A;  4Y3I A;  4BJP A;  1OJG A;  4E3M A;  2W0N A;  1E3U D;  3GQZ A;  4R4S A;  3UDI A;  3AGE A;  4GS9 B;  1H3Q A;  5AQA A;  4QWO A;  5HAI A;  1CF0 A;  5BOH A;  4OP8 A;  1ES4 A;  1N4O A;  4IBX A;  1I2S A;  1NLZ A;  3UDX A;  1BLC A;  1LSW A;  2WGW A;  3ZGA B;  3CG5 A;  3G35 A;  2W1R A;  1NZO A;  5KSH A;  3ZG5 A;  1TD5 A;  2DCF A;  4NXG A;  5FQQ A;  3UE1 A;  3LUQ A;  2G2W A;  2XA7 S;  1KGG A;  4OOY A;  3O86 A;  3OBF A;  3ZG7 B;  2O99 A;  1EI5 A;  3JYI A;  5DF9 A;  4ME4 A;  2XFT A;  5L10 A;  2JKF A;  3HCY A;  2L1M A;  2MJ6 A;  4EBL A;  3WWX A;  4ZBE A;  3G34 A;  4BEN A;  3PXP A;  5EVI B;  3MBZ A;  3WRT A;  3IF6 C;  4L9E A;  4P0M A;  3K3C A;  4I38 A;  4L9G A;  4CLC D;  4Q8I A;  2EWV A;  1F2K A;  4JXV A;  3NY4 A;  3UNW A;  2WUQ A;  3BEC A;  1K54 A;  2Y2O A;  2J3T C;  2XD5 A;  3QNC A;  1AXB A;  2V9A A;  4UHU A;  3LGO A;  3WS2 A;  1TF1 A;  4EET B;  3V3R A;  3ZNY A;  1Q2P A;  1CI8 A;  2WAD A;  3ZG0 A;  5J3W A;  4ZJ2 A;  2WKP A;  4B93 A;  5TBM A;  4OPQ A;  5FAQ A;  4GKU A;  4U0X A;  4HBT A;  1KVL A;  2UWX A;  3UB7 A;  5EVI A;  3GR2 A;  4GD6 A;  2ZQ7 A;  4N9L A;  1LT0 A;  4MCW A;  2VA0 A;  1LSX A;  2R9W A;  3KSH A;  1K55 C;  4JF6 A;  4HQA A;  4KQD A;  5JYO A;  5HD5 A;  1S66 L;  3FZC A;  1K38 A;  1MKI A;  3FG8 A;  2QZ6 A;  1KE4 A;  3FKW A;  2Y4A A;  4KZ3 A;  5HL6 A;  1K56 A;  5DTK A;  5TGF A;  3F1P B;  3QP4 A;  4WEK A;  3EQV A;  1RP5 A;  4HP9 A;  3EOI A;  3NHQ A;  5TJJ A;  3BQA A;  3GV9 A;  2Y59 A;  4DE2 A;  1ONG A;  5CEC A;  3IS2 B;  4JGQ A;  2J80 A;  4GDB A;  3NBL A;  3IX4 A;  1FCN A;  4E3L A;  4JF4 A;  3UB5 P;  2V8C A;  4MMN A;  1HD8 A;  4Z1W A;  4QY6 A;  4KUK A;  1W8Y A;  4HJ3 A;  4OLD A;  2QJ5 A;  1I2W A;  4KG5 A;  3ZFZ A;  2VV6 A;  1YLY A;  2B02 A;  3ZVW A;  1ESI A;  4MBF A;  1NYY A;  3MQ0 A;  4P87 A;  3A0V A;  2JBF A;  2JKG A;  3U2A A;  1Q2Q A;  5CEB A;  1YM1 A;  4O01 A;  1NLY A;  3P01 A;  1MC0 A;  1YPR A;  3CJM A;  2H5S A;  3E4Q A;  4U0T A;  2KOI A;  1TEM A;  2A2L A;  3PBQ A;  4I3J A;  2XRO A;  3OCN A;  3CHW P;  4OOM A;  4ARZ A;  4ETX A;  3EGX C;  5F1F A;  4Y7P A;  4RX3 A;  4IVI A;  5DFX A;  5F82 A;  1MWS A;  2ZBB A;  3H82 A;  3N6I A;  4U3T A;  5DF8 A;  5HAR A;  5GLA A;  3W4Q A;  4KQR A;  1C3B A;  5FA7 A;  4S2I A;  2VGL M;  3E4P A;  1CJF A;  3G2Z A;  2YKH A;  4EUZ A;  5CTM A;  2XF3 A;  4L9F A;  4R3J A;  5GLC A;  4NK3 A;  4QY5 A;  4E3N A;  1XJ4 A;  4KZ4 A;  2XQZ A;  2J7V A;  3UB8 A;  1N9O A;  2W3E A;  4HP4 A;  2R78 A;  3S4X A;  1ACF A;  4E3J A;  3R7W B;  2IA2 A;  1H8Z A;  2ZQ9 A;  3S22 A;  1L0D A;  2Y2P A;  4NXE A;  2ZD8 A;  4Y0U A;  4KG6 A;  4DMZ A;  3IF5 A;  2WYX A;  1NWZ A;  5HPI A;  1N9L A;  5GLB A;  2WAE A;  4LPZ A;  4LRZ E;  1W7F A;  1SZV A;  4K0X A;  2A24 B;  5DJT A;  2ZL1 A; 
#chains in the Genus database with same CATH homology
 5CHU A;  1ERM A;  3HBR A;  2Y2I A;  4XUX A;  2IWC A;  4GOG A;  3G32 A;  3MZD A;  3B3X A;  1K6S A;  3N4I A;  1IEM A;  3UPO A;  3LY4 A;  3Q7V A;  1KE3 A;  4LEN A;  5CGX A;  2J8Y A;  3G30 A;  3C4P A;  2XR0 A;  1OME A;  3GMW A;  1MBL A;  1PZO A;  2Y2J A;  2Y2M A;  3IXG A;  3MXS A;  3RJU A;  2WGW B;  1CK3 A;  4MEZ A;  5EOE A;  1ERQ A;  1BLS A;  3BFG A;  3AGD A;  1FSY A;  3LO7 A;  4FD8 A;  2ZC6 B;  2E8I A;  1KE0 A;  3VOY A;  2DRW A;  3P98 A;  2A3U A;  3IT9 A;  4OOL A;  2DNS A;  2Y91 A;  4R4R A;  3Q7Z A;  3D4F A;  3NC8 A;  4OVD A;  3PBR A;  5CXW A;  5KMW A;  3NDG A;  3N8L A;  1GCE A;  4N9K A;  5CHM A;  1VQQ A;  1MY8 A;  3BM6 A;  1HZO A;  4N1X A;  5FI7 A;  3PBT A;  3VMA A;  4N92 A;  3MKE A;  4X56 A;  3UPP A;  2EX8 A;  4L0L A;  3FWL A;  4E6X A;  3OC2 A;  1MWR A;  2B5R A;  3A3E A;  5TR7 A;  3QNB A;  3O87 A;  1QME A;  2VGJ A;  5FI6 A;  5EEC A;  3I7J A;  5GL9 A;  5G18 A;  1E4D A;  4S2P A;  3HL9 A;  3IWO A;  4ZAM A;  1FQG A;  1LLB A;  5GHZ A;  1ONH A;  1ESU A;  1W8Q A;  3VP1 A;  3UE3 A;  4KZ9 A;  3WS5 A;  1I5Q A;  3DWK A;  5GLD A;  3PBO A;  5EPH A;  3VP3 A;  3BFF A;  5U47 A;  3N8R A;  4JLF A;  4DRT A;  1K25 A;  4QJG A;  5EE8 A;  1PW8 A;  4FH2 A;  3IXD A;  3BEB A;  2WKH A;  4X55 A;  5HW3 A;  5M1A A;  4M3K A;  5FAO A;  1O07 A;  2EXB A;  1KGF A;  2WZX A;  2V2F F;  1IKG A;  5FQI A;  4X6T A;  5KZH A;  3IF6 B;  2BG1 A;  4GNU A;  5A93 A;  4QU3 A;  3SS4 A;  5CGS A;  1IYO A;  2HDU A;  4JXG A;  1FCM A;  1PWC A;  1KDW A;  4WZ5 C;  2ZM8 A;  4GD8 A;  5GHX A;  1CI9 A;  5E2F A;  3TOI A;  2P9V B;  2C6W B;  3HLW A;  5FQM A;  4LV1 A;  3HUM A;  3GSG A;  5A92 A;  2OSU A;  4RYE A;  4DE3 A;  4LV3 A;  1VM1 A;  5L2F A;  1ES3 A;  3OCL A;  2WAF A;  4X69 A;  2HP6 A;  4C6Y A;  1Y54 A;  3PBS A;  3V50 A;  1ES2 A;  3VFF A;  1TVF A;  4YIN A;  2C5W B;  2V20 A;  1XP4 A;  1YT4 A;  1U60 A;  2H0Y A;  4WBG A;  5CTN A;  4BD1 A;  4RVA A;  2IWD A;  3A3I A;  1FCO A;  3HUN A;  4PM7 A;  2V1Z A;  3LEZ A;  4ZJ1 A;  4UA7 A;  1K54 C;  1LL9 A;  1FR6 A;  3Q1F A;  2WGV A;  3W8K A;  1DJA A;  4PPR A;  1YLW A;  1L0G A;  3TG9 A;  3UN7 A;  4P85 A;  1O7E A;  5A91 A;  1MXO A;  2XH9 A;  1EWZ A;  3PAG A;  3CZD A;  1IKI A;  1CEG A;  3C5A A;  4MBH A;  5CED A;  4DE0 A;  3M6B A;  2RL3 A;  4EWF A;  2I72 A;  1L2S A;  4S2M A;  2ZQD A;  3V39 A;  4IED A;  2JC7 A;  4DF6 A;  3C4O A;  2Q9N A;  3UPN A;  3P09 A;  4PM6 A;  4E3K A;  1PW1 A;  4HBU A;  1IYQ A;  4BJP A;  4E3M A;  4B4Z A;  1BUE A;  1E3U D;  1PI5 A;  3GQZ A;  3W4P A;  3NCK A;  2ZQC A;  4MNR A;  4R4S A;  5FQ9 A;  3UDI A;  3AGE A;  5E2H A;  3PAE A;  4E6W A;  2WK0 A;  4BQM A;  5DF7 A;  4Y0T A;  5AQA A;  5HAI A;  5BOH A;  4OP8 A;  1DY6 A;  1Z6F A;  2EX9 A;  3MZE A;  1WYB A;  1ES4 A;  1KVM A;  1N4O A;  1YLZ A;  3LCE A;  4X53 A;  4IBX A;  1I2S A;  1H5X A;  3UDX A;  5HAQ A;  1BLC A;  3PBN A;  1BSG A;  4OQ0 A;  2WGW A;  5CGW A;  3VFH A;  3SS5 A;  3VP0 A;  3ZGA B;  3ZCZ A;  5HX9 A;  3CG5 A;  1XKZ A;  2WKI A;  1IYP A;  3G35 A;  1NZO A;  5KSH A;  1LI0 A;  2H10 A;  4WZ4 A;  3SH7 A;  2RCX A;  3ZG5 A;  1G6A A;  2JE5 A;  2DCF A;  5FQQ A;  5CER A;  3UE1 A;  4MBK A;  5EUA A;  5FSR A;  3FYZ A;  3E2K A;  3HRE A;  2G2W A;  3HLE A;  3IH8 A;  4JXS A;  2A49 A;  5I94 A;  1KGG A;  4OOY A;  3VP4 A;  1BTL A;  3O86 A;  3BLS A;  3ZG7 B;  4EV4 A;  1PWD A;  3Q7V B;  1EI5 A;  3JYI A;  5DF9 A;  1XX2 A;  4GN2 A;  5FAT A;  4PM5 A;  2XFT A;  2ZMA A;  3VP2 A;  4KZA A;  3IWQ A;  4KEN B;  5AQ7 A;  4S2O A;  2FFF B;  3IH9 A;  3W4O A;  3A3F A;  4E3I A;  5F83 A;  1S0W A;  3ZDJ A;  1K4F A;  4OPY A;  3M2K A;  1GA0 A;  4KQO A;  4EBL A;  3WWX A;  4ZBE A;  4PM8 A;  1K4E A;  3G34 A;  4BEN A;  4OPR A;  5EVI B;  2Y2L A;  3MBZ A;  3WRT A;  1ZG6 A;  5DTT A;  1TDL A;  4GB7 A;  3IF6 C;  3GRJ A;  4GZB A;  2ZJ9 A;  2ZC4 B;  1M6K A;  4P0M A;  3TSG A;  4WEJ A;  3V3S A;  3BFE A;  5EVI D;  3ITB A;  3SH9 A;  4P6B A;  4Q8I A;  1SDN A;  1ZKJ A;  3G31 A;  4JXV A;  3IF6 A;  3NY4 A;  4Z9Q A;  3UNW A;  3UO9 A;  2WUQ A;  3BEC A;  4KZ7 A;  4XXR A;  1K54 A;  2Y2O A;  4OON A;  1GHI A;  4JBF A;  2XD5 A;  3QNC A;  4N1H A;  1AXB A;  3SOI A;  4C3Q A;  4R3B A;  4UHU A;  3AGF A;  2EXA A;  4QD4 A;  5CHJ A;  5FI2 A;  1BLP A;  3RXW A;  3WS2 A;  1LHY A;  3N8S A;  3V3R A;  3ZNY A;  3ISG A;  1Q2P A;  1CI8 A;  2X71 A;  3CMZ A;  1IEL A;  1NZU A;  5M18 A;  4RX2 A;  2WAD A;  1GA9 A;  3ZG0 A;  1YQS A;  4ZJ2 A;  2WGI A;  1DJC A;  2WKE A;  3S1Y A;  4X68 A;  4OPQ A;  5AQB A;  3DW0 A;  1SHV A;  3OPH A;  5FAQ A;  3MZF A;  4GKU A;  4K91 A;  1H8Y A;  3A3D A;  4U0X A;  4HBT A;  1KVL A;  2UWX A;  4R0Q A;  3HLF A;  3HUO A;  5EVI A;  3Q07 A;  5J8X A;  3IHA A;  5DVA A;  4F94 A;  3M6H A;  3GR2 A;  4GD6 A;  1M40 A;  4JXW A;  2ZQ7 A;  4N9L A;  3EQU A;  4CJN A;  5EVI C;  2VGK A;  4DDS A;  4LCM A;  2J9O A;  2R9W A;  2ZQA A;  1K55 C;  3MKF A;  3MXR A;  4OQG A;  1JVJ A;  2HP9 A;  2XD1 A;  4JF6 A;  4KQQ A;  2X02 A;  3A3J A;  3BLM A;  3RXX A;  1XGJ A;  5FDH A;  1W79 A;  4KZ5 A;  3ITA A;  5D3O A;  5JYO A;  3BYD A;  3V5M A;  3VOZ A;  4OQI A;  1FOF A;  2Q9M A;  3LY3 A;  4NET A;  3FZC A;  1K38 A;  1MKI A;  2QZ6 A;  2HDR A;  3HLC A;  1KE4 A;  3FKW A;  2ZC5 B;  2HP5 A;  1KGE A;  5GHY A;  2G2U A;  2H0T A;  3NIA A;  1CEF A;  2Y4A A;  3Q82 A;  4UA9 A;  4KZ3 A;  5M19 A;  1FR1 A;  3UDF A;  1K56 A;  5DTK A;  1K6R A;  4BD0 A;  5TGF A;  1YMS A;  3ZHH A;  1SCW A;  3BFD A;  4WEK A;  3EQV A;  1XPB A;  4EBP A;  1RP5 A;  1L0E A;  5DTS A;  3G2Y A;  1MPL A;  2ZM0 A;  3GV9 A;  1W5D A;  2Y59 A;  1NJ4 A;  3GTC A;  1YLJ A;  4DE2 A;  4B88 A;  4OLG A;  3UY6 A;  1ONG A;  5CEC A;  1BLH A;  3E2L A;  2ZC7 A;  1ALQ A;  1LL5 A;  2OLV A;  1NY0 A;  2GDN A;  1RGY A;  3NBL A;  4GDB A;  3UE0 A;  1JWZ A;  4DE1 A;  1FCN A;  4E3L A;  1BUL A;  4JF4 A;  4OH0 A;  5F1G A;  3C7U A;  4LCL A;  1G68 A;  2PU2 A;  4EBN A;  1HD8 A;  3IXB A;  4FH4 A;  4UA6 A;  4QY6 A;  5HFO A;  4A5R A;  5HL1 A;  4IBR A;  3O88 A;  1W8Y A;  4PMA A;  4H8R A;  4OLD A;  4KG5 A;  1I2W A;  1KDS A;  1GHP A;  4BL2 A;  3ZFZ A;  1K56 D;  1JTD A;  1RCJ A;  4OQH A;  4YFM A;  1YLY A;  3WS0 A;  3G4P A;  1MWU A;  1BZA A;  1WE4 A;  1XA7 A;  3ZVW A;  5A90 A;  1ESI A;  2X01 A;  1HVB A;  4MBF A;  2FFY A;  2PU4 A;  2J9P A;  1NYY A;  1NXY A;  4R1G A;  1JWP A;  4P87 A;  2JBF A;  3DWZ A;  1Q2Q A;  3OPP A;  5CEB A;  1YM1 A;  4ZTK A;  3OPL A;  3NI9 A;  3WS4 A;  4WMC D;  4R23 A;  1NRF A;  3VSK A;  1K57 C;  3C7V A;  1MWT A;  1YLP A;  4KZB A;  4C75 A;  2R9X A;  3CJM A;  3QHY A;  1ZG4 A;  4BL3 A;  2H5S A;  2OLU A;  3N7W A;  3NDE A;  4RA7 A;  4QHC A;  2QPN A;  4U0T A;  5E2G A;  2XFS A;  1XGI A;  4IVK A;  2IWB A;  2EX2 A;  2ZC3 B;  2EFX A;  1IYS A;  3SS3 A;  1K57 A;  3BRM A;  1TEM A;  3PBQ A;  3FV7 A;  1JTG A;  3ZVT A;  1PYY A;  3ZG8 B;  1LI9 A;  4WEL A;  3OCN A;  4MLL A;  4LV2 A;  4OOM A;  5EVL A;  3IQA A;  1N9B A;  5HAP A;  2XEP A;  1RGZ A;  2XK1 A;  3HLB A;  5CRF A;  2Z2M B;  5F1F A;  4QB8 A;  1E25 A;  1E3U A;  4K0W A;  4Y7P A;  4PM9 A;  3MFD A;  4JPM A;  4RX3 A;  1PWG A;  2Z2L B;  1S6R A;  2Y2G A;  4IVI A;  5F82 A;  1MWS A;  5IHV A;  3WS1 A;  4S2K A;  3HLD A;  2OV5 A;  1TDG A;  4WMC A;  3ZNT A;  3OPR A;  3N6I A;  1ZC2 A;  2EFU A;  4U3T A;  4Y0O A;  3HLG A;  5DF8 A;  5EOO A;  1JWV A;  3O3V A;  5HAR A;  5GLA A;  3W4Q A;  2XDM A;  2ZLY A;  4KQR A;  4O7D A;  5KSC A;  2P9V A;  3IXH A;  4OKP A;  3IHB A;  4KG2 A;  1C3B A;  5FA7 A;  4S2I A;  1BT5 A;  4KZ8 A;  4DXC A;  1PZP A;  4HEF A;  4HES A;  1PIO A;  5FAS A;  1XXM A;  3G2Z A;  2ZQ8 A;  2HDQ A;  1SKF A;  1SDE A;  4OP5 A;  5FAP A;  4EUZ A;  1ES5 A;  5CTM A;  2XF3 A;  5GLC A;  4R3J A;  2Y2Q A;  4NK3 A;  2XGN A;  4QY5 A;  1ERO A;  5FQJ A;  1K55 A;  4CPK A;  3VSL A;  1XA1 A;  4E3N A;  2Y2N A;  4UAA A;  4FCF A;  4D2O A;  2HDS A;  4KZ4 A;  4DKI A;  3SH8 A;  2P74 A;  2XQZ A;  4ZDX A;  2J7V A;  4B4X A;  3OZH A;  4DDY A;  1QMF A;  1PI4 A;  3HVF A;  4JF5 A;  3ZG9 B;  4OPZ A;  1DJB A;  4WZ5 A;  5JYP A;  3S4X A;  2CC1 A;  2EX6 A;  4ZJ3 A;  1J9M A;  3FKV A;  4E3J A;  1NYM A;  1H8Z A;  2ZQ9 A;  2BLS A;  3DTM A;  5FQK A;  1WYC A;  3S22 A;  1YMX A;  4DXB A;  4WM9 A;  4S2J A;  2WZZ A;  2Y2K A;  4ID4 A;  3IWI A;  5E43 A;  1L0D A;  2Y2P A;  4BLM A;  4S2N A;  4XUZ A;  2HPB A;  2ZD8 A;  4Y0U A;  4KG6 A;  3BFC A;  2Y55 A;  2ZM2 A;  4S2L A;  4GDN A;  4KZ6 A;  3GVB A;  3IF5 A;  3M2J A;  4WYY A;  4FSF A;  3Q81 A;  2WYX A;  2XLN A;  4S2N C;  5TFQ A;  3PTE A;  5AQ9 A;  1HTZ A;  5GLB A;  2WAE A;  3WRZ A;  2JCH A;  2Y2H A;  1YLT A;  4E3O A;  1FSW A;  1L0F A;  4LV0 A;  1W7F A;  4EQI A;  4JKT A;  5E2E A;  1GHM A;  2PBY A;  4K0X A;  2QMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...