2ZQDA

Ceftazidime acyl-intermediate structure of class a beta-lact toho-1 e166a/r274n/r276n triple mutant
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
total genus 95
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqdA00
1ES2A 1K38A 1ERMA 3N8RA 4RA7A 3MBZA 4PPRA 4DRTA 4P85A 3UE1A 3QNBA 2XDMA 5CXWA 1E3UA 1K54A 1Q2QA 2X01A 3GVBA 5FSRA 5FQJA 1NXYA 3IF6A 4QHCA 4R0QA 5CECA 3HBRA 1WYCA 1N9BA 4H8RA 4E3NA 1BZAA 1OMEA 4MNRA 3ZG5A 1O07A 2ZQDA 3ISGA 2Q9MA 5FASA 3V39A 4FD8A 4Y0UA 3Q7VA 2Y2OA 2V20A 5IHVA 1YLJA 2XD1A 1YM1A 3UE0A 3WS1A 1EWZA 5AQAA 4WMCD 5AQ9A 1K57A 5DF7A 1DJAA 1K55C 1FOFA 1KGGA 1PW1A 2XK1A 2EX9A 5HAIA 4OOYA 5FI2A 4PM8A 1MKIA 3SH9A 1FCNA 5E2GA 3ZNYA 4IBRA 4OQ0A 5CGWA 1K6SA 2R9XA 4OOMA 4S2LA 3O87A 1SHVA 2XLNA 5KSHA 5E43A 2J8YA 1JVJA 2ZM2A 4KZBA 2P9VA 3PAGA 5FA7A 1MBLA 1IYSA 2E8IA 3IXDA 1L0FA 1FCOA 3A3JA 1IYPA 1FQGA 4D2OA 1XGJA 2Y2KA 4R23A 3ITBA 4N92A 1RGZA 1K54C 4XUZA 4K91A 2WZXA 5KSCA 3TG9A 1RGYA 4O7DA 1NY0A 3PBOA 4KZ4A 4OP8A 2HPBA 4EQIA 1ONGA 1XA1A 5AQ7A 1ZC2A 3Q07A 1FR6A 5I94A 3PBQA 4X56A 3TOIA 3TSGA 3EQVA 4N1HA 3VMAA 3CJMA 1BUEA 5F1FA 4UA9A 1YT4A 4EBPA 3O3VA 5HAQA 2Y59A 2WGIA 4NK3A 3SS5A 1JTGA 3HUOA 4R3BA 3VFHA 2BG1A 1E25A 3QHYA 1L0EA 4A5RA 2WGWA 5E2EA 4DKIA 3HLDA 3ZG9B 1E4DA 4KZ5A 4OQGA 1YMSA 2ZQCA 5EVIB 5D3OA 1KDSA 3RJUA 2IWBA 4XUXA 1VQQA 3IHBA 4LCLA 3GQZA 3UPPA 4R4SA 4S2KA 1LL9A 2ZQ8A 1SDNA 1XX2A 1YLZA 5CTMA 2ZC6B 2XH9A 4ID4A 3HREA 4FH4A 4CPKA 3P09A 4OPQA 4P87A 3N6IA 5FI6A 4OPRA 1XP4A 1J9MA 3A3DA 1QMEA 3FZCA 3IH8A 1LLBA 4MBKA 4IEDA 4X55A 1I5QA 1BSGA 4EBNA 1MXOA 4X69A 2Y2QA 3UDIA 1K56D 2CC1A 3LEZA 4QY5A 3VSLA 4OQHA 5DVAA 4OOLA 4BL2A 2OSUA 1RCJA 2Y2LA 5E2FA 4BQMA 4KQOA 1GCEA 4QJGA 2BLSA 2EX2A 2FFYA 1L0DA 3LY3A 5DF8A 3S1YA 5JYPA 3UPOA 2HDUA 1G6AA 4RVAA 2OLUA 5F82A 4X53A 3UDXA 1YQSA 1MWSA 1W5DA 3M6HA 2HDQA 1WYBA 1KGEA 4LCMA 1BLSA 2WGWB 4S2OA 5AQBA 5EVID 2WYXA 4GD8A 3HLWA 1BLCA 4BD1A 3RXXA 5M19A 4N1XA 4OP5A 1LI0A 4KZAA 5GHXA 2Y2JA 1K6RA 2EFUA 3ITAA 2ZC4B 3Q1FA 4E3LA 3ZCZA 2XGNA 3HUMA 3NDEA 4LENA 2X02A 4S2PA 1HZOA 1IELA 3NBLA 4OONA 3V50A 2C5WB 4OLGA 4HESA 3WS2A 5F1GA 3SS3A 1PZOA 4MBFA 5GHYA 2XFTA 4RYEA 4Y0OA 3M6BA 3LY4A 4BLMA 3NIAA 4ZBEA 5G18A 1XGIA 1TDGA 3IWQA 2OLVA 4JF5A 2WKEA 4BL3A 4GB7A 5U47A 1HTZA 4DXBA 5FAQA 1K25A 4JPMA 5M1AA 5DTTA 4DXCA 5KMWA 2J9PA 4E3JA 4X68A 3BLMA 3DWZA 1W8YA 4GDNA 1KVLA 5EUAA 3W4PA 4DE3A 1PW8A 4GOGA 3FKVA 3DTMA 1O7EA 3E2KA 4QD4A 1H5XA 1C3BA 3NY4A 1NRFA 3NDGA 3C4OA 1MWRA 3OPLA 5FAOA 1YLPA 3ZDJA 3VOZA 1YLWA 4OQIA 1IKGA 3BFGA 5L2FA 4EV4A 2PU4A 1EROA 5FAPA 3PBRA 2RL3A 5M18A 4KG2A 5CHJA 2QZ6A 3IWOA 5FQQA 3MKFA 4L0LA 4WZ4A 2ZJ9A 3JYIA 1YMXA 2ZC7A 4C6YA 3A3FA 1L2SA 1CEFA 1PZPA 5FQ9A 2WKIA 1KE3A 1KGFA 4KENB 2Y91A 2WUQA 2G2UA 2V1ZA 1NYYA 3I7JA 1Z6FA 3G2ZA 3IWIA 4GDBA 5CRFA 5EOEA 5FI7A 1KVMA 1KE0A 5FQIA 1DJBA 5A93A 4KZ7A 2XFSA 4ZJ1A 3IF6B 3VOYA 3WRZA 1CI9A 4E6WA 4KZ8A 2EFXA 3HLBA 3VP3A 5GHZA 2Z2MB 3FWLA 1CEGA 3E2LA 3G30A 3Q81A 2OV5A 4ZAMA 3WRTA 3IHAA 3VP2A 4RX2A 3UO9A 3IT9A 3Q7VB 2P74A 2ZM8A 3ZVWA 2Y55A 4N9KA 3C5AA 4C3QA 2Y4AA 1XXMA 3HL9A 3VSKA 4WEKA 1GA9A 2HP9A 4KZ9A 3ZG0A 4DE1A 4JXWA 4E6XA 2A3UA 5FATA 2EXAA 4JXGA 4WMCA 4HBUA 5EVLA 3OPRA 4KQQA 1PI5A 2VGJA 3G4PA 2ZMAA 1ZG6A 3WWXA 4Q8IA 5CHMA 2Q9NA 4F94A 4BD0A 2DRWA 2Z2LB 3LO7A 5EVIC 1LI9A 2HDSA 2HP5A 5A91A 4UA7A 1W7FA 4ZDXA 3ZG7B 5HARA 1ONHA 2P9VB 4QY6A 4PM9A 4LV3A 3SS4A 1AXBA 3GV9A 4R4RA 5FDHA 5CGXA 2XD5A 5GLAA 3ZG8B 1L0GA 1E3UD 3W8KA 3EQUA 1Q2PA 5E2HA 3PBTA 1BT5A 2V2FF 4JXSA 2I72A 1PI4A 1ES3A 1SCWA 2Y2GA 3NCKA 5HL1A 1LHYA 4GD6A 1GHMA 4OVDA 1PWCA 5FQMA 3UY6A 4EBLA 2Y2PA 3IF5A 3W4QA 4DDSA 3ZHHA 5CEBA 2H0YA 5EPHA 1PWDA 3PBNA 2ZM0A 4FSFA 2A49A 3V5MA 5CHUA 3G31A 3BFEA 4HEFA 4JF6A 4OKPA 2WZZA 1M6KA 4WBGA 5CGSA 4BJPA 4DDYA 3O86A 3HUNA 4JXVA 1K4EA 4QB8A 5GLCA 3OCLA 5DTSA 1TVFA 3AGFA 2JBFA 3HLCA 2GDNA 3DWKA 3SOIA 1FSWA 1PIOA 3OC2A 2ZQAA 3CMZA 2Y2HA 4Y0TA 4OPYA 3UN7A 1XKZA 3VP4A 2EXBA 4U3TA 1CI8A 5TR7A 3UPNA 5CTNA 4M3KA 3MKEA 1W8QA 4IBXA 3ZVTA 2VGKA 4C75A 1IEMA 1MPLA 2XQZA 3MFDA 3NI9A 3P98A 4U0TA 3VP1A 1NJ4A 3N8SA 3IXBA 2Y2IA 3WS4A 5BOHA 1TEMA 1JTDA 3G35A 4E3OA 3C4PA 3V3RA 4S2MA 4DE2A 1KE4A 4P0MA 1N4OA 1DJCA 3G2YA 3PAEA 1YLTA 2C6WB 1CK3A 2RCXA 2WAFA 3SH8A 3BLSA 1K56A 3MZFA 3CG5A 4KZ6A 4DF6A 2Y2MA 1JWZA 4MLLA 4S2JA 4K0XA 3MXRA 5A92A 3SH7A 4YINA 2XR0A 4E3IA 1H8ZA 1M40A 5F83A 5HW3A 1H8YA 1KDWA 3OZHA 1WE4A 1MY8A 4OLDA 1BULA 4UA6A 2DNSA 1LL5A 5HX9A 3GR2A 1XPBA 4E3MA 3G32A 4WZ5A 3RXWA 4JKTA 4Y7PA 3IH9A 4B88A 3NC8A 3FYZA 3VFFA 3BFFA 5EVIA 4N9LA 3A3IA 1IYOA 3S22A 2QPNA 1PYYA 2UWXA 5FQKA 1SDEA 4LV1A 2QMIA 3PTEA 4YFMA 2PBYA 3PBSA 4S2IA 1W79A 1S0WA 2H5SA 3Q82A 4OPZA 1K4FA 3UE3A 4DE0A 2R9WA 2ZQ9A 4ZJ3A 5GLDA 5TGFA 4JF4A 3O88A 3W4OA 5J8XA 3N8LA 1QMFA 3ZFZA 1GHPA 3CZDA 1DY6A 1HD8A 1TDLA 2H10A 3MZEA 1MWUA 1FCMA 2X71A 3OPPA 4PM7A 2IWCA 5CERA 4PMAA 3IF6C 4WELA 4Z9QA 3GSGA 3BEBA 2JCHA 2DCFA 2ZD8A 1ALQA 1IKIA 1I2WA 1YLYA 1JWPA 4KG6A 4WYYA 5GL9A 4R1GA 1ESIA 1NZUA 2EX6A 4XXRA 2JC7A 4E3KA 2B5RA 3BYDA 4WZ5C 3G34A 4LV2A 4MBHA 1GA0A 1K57C 2WADA 1PWGA 1Y54A 2WAEA 3N4IA 5DTKA 3IQAA 2XEPA 4GKUA 4OH0A 3BFCA 5GLBA 3C7UA 3UNWA 2XF3A 4B4XA 1IYQA 3LCEA 1RP5A 4EUZA 3IXHA 4WEJA 3MZDA 2J9OA 1GHIA 1ZKJA 1MWTA 3BRMA 2J7VA 1FR1A 2ZC3B 4U0XA 5CEDA 1ES5A 4JLFA 5A90A 2H0TA 3DW0A 4S2NA 4IVKA 4IVIA 3WS0A 1U60A 2HDRA 3GMWA 3BM6A 1ESUA 1I2SA 3A3EA 3B3XA 3HVFA 3OCNA 4UHUA 4RX3A 3AGDA 4GN2A 3OPHA 5HFOA 5TFQA 5KZHA 1EI5A 2ZC5B 1ZG4A 1VM1A 2ZLYA 4FH2A 4KQRA 4LV0A 4BENA 3QNCA 3M2JA 2EX8A 2ZQ7A 4FCFA 1XA7A 4NETA 3D4FA 5JYOA 4CJNA 1NZOA 3HLGA 4GNUA 4R3JA 1ES4A 3UDFA 3BFDA 5EECA 4B4ZA 4QU3A 4ZTKA 3WS5A 3AGEA 5EOOA 3C7VA 1BTLA 1FSYA 1S6RA 1BLPA 3ZGAB 3ZNTA 3IXGA 3MXSA 3HLFA 4ZJ2A 3FV7A 1SKFA 3VP0A 2WKHA 4WM9A 3Q7ZA 4HBTA 2PU2A 3M2KA 4KZ3A 5HAPA 3BECA 2IWDA 1NYMA 3N7WA 4KG5A 1G68A 4P6BA 1K55A 1JWVA 3GTCA 4PM6A 4GZBA 3FKWA 4UAAA 4X6TA 3S4XA 4EWFA 4JBFA 2HP6A 4MEZA 4PM5A 2JE5A 5DF9A 3V3SA 1ERQA 2WGVA 3GRJA 2FFFB 3HLEA 2G2WA 2WK0A 4K0WA 1HVBA 4S2NC 2Y2NA 5EE8A 1BLHA
chains in the Genus database with same CATH superfamily
3MBZA 3UE1A 1K54A 2X01A 5EM0A 1GSWA 4R0QA 5CECA 4WF0A 3ISGA 2W3DA 3V39A 5HWWA 3Q7VA 2Y2OA 2V20A 2Y8HA 5IHVA 5AQAA 2JKRM 5DF7A 3A0RA 1MKIA 3SH9A 1FCNA 2A2LA 5FEFA 2R9XA 4S2LA 3O87A 2XLNA 5E43A 2VV8A 2WKQA 1NLZA 2P9VA 3IXDA 4QWOA 1FQGA 4D2OA 1S66L 1K0KA 4R23A 4K91A 1ZTUA 4O7DA 2W3EA 2EWVA 2HPBA 1ONGA 3FPWA 4GLQA 1ZC2A 5I94A 2M1CA 4UQIS 3PBQA 3TOIA 3TSGA 3VMAA 1BUEA 5F1FA 5AVEA 1HLUP 2PT7A 4NK3A 2VA0A 3F1PA 1F9IA 3ZG9B 4KZ5A 2ZQCA 2O9BA 1KDSA 5EVEA 3RJUA 1T19A 3VE4A 2VGLS 2IWBA 3PR6A 4LCLA 3UPPA 4IUHA 3LR0A 1YLZA 4FH4A 4OPQA 3A3DA 2KLIA 4CLCB 3IH8A 1LLBA 3IX8A 4Y5FA 4EBNA 2V0UA 3UE6A 2WKRA 3VSLA 3NJAA 4IJGA 4BL2A 4RQ9A 1RCJA 5E2FA 3ZYTA 4EQ1A 2BLSA 5JYPA 2INWA 3FPVA 1J3WA 1G6AA 3SW1A 3M6HA 5EFWA 2O0YA 2HDQA 5AQBA 4P6ZS 1P0ZA 2EA9A 4BD1A 2ZL1B 5GHXA 1K6RA 4E3LA 3ZCZA 5EM1A 5HL6A 3DAVA 1IELA 3E4OA 1PZOA 4MBFA 2XFTA 4L9EA 1D7EA 3NIAA 5G18A 4BBUA 1TDGA 1MC0A 2WKEA 1CF0A 3W2ZA 1HTZA 4JPMA 5KMWA 3BLMA 3DWZA 1W8YA 2V1BA 1KVLA 2J3TD 1H0MA 1TS8A 3E2KA 3T1QB 1NRFA 1S4RA 3C4OA 3NDGA 3ULFA 1KOUA 3OPLA 3VOZA 2KDKA 4HOIA 5M18A 4KG2A 2QZ6A 4WZ4A 2ZJ9A 4C6YA 3A3FA 2V9AA 3BJNA 2JHEA 3BY8A 1PZPA 1XJ3A 2WKPA 1KGFA 2Y91A 1SZVA 4NXBA 2G2UA 3I7JA 2FZ0A 2DMWA 3LICA 3VE3A 4KZ7A 4ZJ1A 4E6WA 2EFXA 1ODVA 4ZAMA 3C38A 4RX2A 3UO9A 3Q7VB 4N9KA 1XXMA 1TS7A 4JXWA 2GX5A 2W3FA 3MJQA 4JXGA 3DTKA 4LRZE 2VGJA 3G4PA 1F5MA 3KYZA 4ZDXA 3ZG7B 2P9VB 4YOFA 4PM9A 1AXBA 5GLAA 4EESA 3B42A 3LIDA 1Q2PA 5E2HA 4P6ZM 5HL1A 4GD6A 3UB8A 2ZOIA 4DDSA 3ZHHA 4GCZA 1PWDA 3R4KA 1XJ2A 4FSFA 2A49A 2LB9A 1G28A 3BQAA 3F1PB 3BW6A 4HEFA 4WBGA 3MMHA 4HJ4A 4QB8A 4HY8A 3VV4A 1TVFA 3AGFA 2GDNA 3SOIA 3OOVA 2ZQAA 2EXBA 4CLCD 4HH2A 1W8QA 3ZVTA 1H3QA 4C75A 2XQZA 3MFDA 1NJ4A 2H28A 5FL3A 4CQHA 5BOHA 4HQAA 3D72A 3T1XA 4E3OA 1KE4A 4P0MA 1N4OA 1DJCA 3UB9A 3RTYA 2C6WB 3VOLA 5J7EA 2JKTI 4K0XA 5A92A 3KSHA 2DNSA 3GR2A 3G32A 1YKDA 3D3OA 3NC8A 3FYZA 3P7NA 2UWXA 2W1TA 3JPUA 2QMIA 3PTEA 2PBYA 3PBSA 1W79A 4HHDA 1S0WA 2H5SA 3LIAA 2R9WA 2ZQ9A 1LSWA 5GLDA 4JGQA 5J8XA 1PNEA 1QMFA 1V9ZA 1MWUA 4PMAA 3BEBA 2JCHA 2ZD8A 1L3LA 1ALQA 1I2WA 1JWPA 1IFQA 3U2AA 4E3KA 3BYDA 3G34A 4MBHA 2JKTM 1Y28A 1PWGA 3ZQ5A 1Y54A 3N4IA 1D1JA 3H9WA 5GLBA 2P04A 3LCEA 5KIZA 3BRMA 2ZC3B 4CLCC 4S2NA 4IVKA 4MMNA 1OT9A 1EW0A 3OPHA 1YSQA 2ZC5B 1LT0A 4LGWA 2EX8A 4FCFA 4PKYA 1XA7A 3HLGA 5EECA 1BTLA 1FSYA 2VK3A 5HAPA 3KYEA 5HWVA 3DTIA 3CPTA 4EETB 1JWVA 2PR5A 2Y79A 2V0WA 1ERQA 1UGUA 4MN6A 5EE8A 1ES2A 1ERMA 4RA7A 4DRTA 1XFNA 2OWJA 3GVBA 5FSRA 1NXYA 4QHCA 3F1OA 3HBRA 1N9BA 4E3NA 1OMEA 3ZG5A 3H82A 1O07A 5F5YA 3CHWP 3RFBA 2Q9MA 3HCYA 5FASA 2VLGA 1Z09A 3UE0A 3WS1A 4MN5A 1EWZA 2B18A 3TJZC 1VB6A 1K55C 2XK1A 2EX9A 5FI2A 2B95A 5E2GA 1K6SA 3K3DA 2J8YA 2ZM2A 4CLCA 3CAXA 3PAGA 5FA7A 1IYSA 4I5SA 5HPFA 3A3JA 1IYPA 3KSIA 3LIFA 2Y2KA 1RGZA 1K54C 4XUZA 2WZXA 1RGYA 3HJKA 1NY0A 3PBOA 4OP8A 4ZRRA 4WL9A 3CJMA 1TF1A 4NKPA 4JGRA 3O3VA 1JTGA 3VFHA 2BG1A 3DTEA 1L0EA 3HLDA 5DFYA 1GSXA 5D3OA 3L9KA 2W1TB 3A0VA 3LIBA 4R4SA 4S2KA 1P9WA 2ZQ8A 2ZC6B 4ID4A 4CPKA 3HREA 5TBMA 3NOUC 4OPRA 1XP4A 4G3WA 3NULA 4IEDA 1BSGA 1N9OA 3UDIA 3MFXA 4OOLA 2Y2LA 4BQMA 1GCEA 3S1YA 1L0DA 1X0OA 1WYBA 4S2OA 2WGWB 2HF6A 3T4LA 4HNBA 4IHQA 4GJ4A 5C5KA 2K7SA 2ZC4B 3IBJA 3NDEA 4LENA 3IBRA 1HZOA 3E98A 1STZA 4OONA 2JN7A 3LR4A 3V50A 3BY9A 4OLGA 3M6BA 2OLVA 1XJ4A 5U47A 5M1AA 4DXCA 3MR0A 4X68A 4E3JA 4Y3IA 3EEHA 2W3HA 3W4PA 4DE3A 3PYPA 3NY4A 3CPTB 5FAOA 1YLWA 5L2FA 1IKGA 2PU4A 2PDRA 5FAPA 3PBRA 4G3VA 2M7UA 4EW7A 5FQQA 3NHQA 2OAQ1 3PXPA 3K3CA 5HD5A 3QP2A 1L2SA 2XSSA 1CEFA 2WKIA 4KENB 4GDBA 5CRFA 1Z6FA 2L0WA 3S7NA 3D9YA 1YAXA 4MDZA 3DBAA 3F1OB 2PRFA 3MQOA 3HLBA 1YSPA 3VP3A 3FWLA 1CEGA 3E2LA 3H82B 1G5UA 3WRTA 5L09A 3IT9A 2Y55A 2VV6A 2Y4AA 3VSKA 1JNUA 4WEKA 1GA9A 3SZTA 4HP9A 5FATA 3IX4A 3P01A 5EVLA 2O9CA 4KQQA 3WWXA 2IA2A 4F94A 2DRWA 2Z2LB 1T18A 3LO7A 2HDSA 5J4EA 1N9NA 5HARA 4LV3A 3SS4A 3ZG8B 4R4RA 1BT5A 2I72A 1PI4A 3NCKA 4OVDA 1PWCA 5FQMA 4EBLA 3W4QA 1VETA 5EPHA 5HSQA 5CHUA 1OTEA 4JF6A 3O86A 4R70A 2PAVP 4JXVA 4KUKA 3OCLA 1PFLA 1PIOA 1S1YA 3VP4A 2HZ5A 4U3TA 5DFXA 5G4YA 2VGKA 5TBMB 1MPLA 3LIEA 3NI9A 4U0TA 3N8SA 3O5YA 5AJGA 1TEMA 1JTDA 3C4PA 3C2WA 3V3RA 4FOFA 4HJ6A 1CK3A 2QJ5A 2RCXA 4LPZA 3BLSA 3QP8A 3MZFA 3CG5A 4KZ6A 3NOTC 1WA9A 3MXRA 3SH7A 4YINA 5CX7A 1H8ZA 1M40A 5HDCA 5HW3A 1KDWA 2V1AA 1MY8A 1BULA 4UA6A 2EWWA 4WZ5A 4JKTA 1XJ6A 3VFFA 3BFFA 3A3IA 2QPNA 4R38A 1NRJA 5FEGA 3V67A 4LRXC 4YNRA 5TGFA 4JF4A 1OJGA 3W4OA 1F98A 4O8GA 1OTDA 4PM7A 3OPPA 4HI4A 2IWCA 3IF6C 1MZUA 3GSGA 1YLYA 2PR6A 4R1GA 1NZUA 2EX6A 2XA7M 4Y17A 1H8MA 2PD7A 1K57C 4PHTA 2NUTC 1GSVA 4GKUA 4OH0A 4YWZA 2GZAA 2BTFP 2VV7A 3UNWA 2XF3A 3LUQA 4B4XA 4I3AA 2HJ9C 4HH3A 2J9OA 1ZKJA 2QWSA 2VEAA 4U0XA 4UEYA 5A90A 2Z6DA 3DW0A 4IVIA 3WS0A 2NUPC 3BM6A 1ESUA 4I3JA 4GN2A 4I39A 3KYQA 1DP6A 1V9YA 1Y4OA 1ZG4A 2ZLYA 3KX0X 4FH2A 4WLAA 4BENA 3M2JA 3T1SA 4DJ2A 4L9GA 5JYOA 1NZOA 4R3JA 4B9OA 1ES4A 4ETXA 3BFDA 4QU3A 2HV1A 5EOOA 1S6RA 3ZGAB 1BLPA 2J3TC 3FV7A 3Q7ZA 3UB7A 3BECA 2IWDA 3F1NA 1G68A 3MS6A 4KQDA 4PAUA 4P6BA 3UMEA 1OTAA 1PRQA 2J3WA 4PM5A 5G4ZA 2KX6A 2FFFB 1VEUA 4L9FA 2WK0A 4S2NC 2Y2NA 4H6JA 1K38A 3C8CA 4PPRA 1OTBA 3LI9A 3QNBA 1AWIA 5CXWA 2XROA 1VETB 3IF6A 1NWZA 4H8RA 4MNRA 2I9VA 4Y0UA 2P08A 3MXQA 1K57A 3CITA 1FOFA 4LLOB 5AVFA 1PW1A 1FIKA 4OOYA 5MC7A 4B93A 4IBRA 4OOMA 4NXGA 3QP4A 5KSHA 4BWIA 2E8IA 3LI8A 3ITBA 4N92A 5AQ7A 3Q07A 1FR6A 4Q0JA 4JGOA 4X56A 3EQVA 3LR3A 4N1HA 4UA9A 2Y59A 3HUOA 4R3BA 1E25A 3MQQA 3QHYA 2WGWA 5I5LA 3RH8B 1E4DA 2GNXA 5K5BA 2HJEA 4OQGA 4LFUA 4E04A 4XUXA 1VQQA 2MJ6A 3GQZA 1LL9A 3HJIA 4Q0HA 5CTMA 2YKHA 2L1MA 3P09A 4P87A 1J9MA 1QMEA 3FZCA 4MBKA 4BBVA 1MXOA 2Y2QA 1N9LA 3T4OA 1G6OA 4QJGA 2EX2A 3LY3A 2FFYA 3UPOA 1TS0A 4X53A 3UDXA 1YQSA 1MWSA 1W5DA 1KGEA 4K08A 5EVID 2WYXA 4GD8A 3HLWA 3RXXA 4N1XA 4OP5A 1LI0A 3LGOA 2Y2JA 2EFUA 1LL8A 4S2PA 3NBLA 1UWPX 3FG8A 2C5WB 5F1GA 5GHYA 4XT2A 4Y0OA 3LY4A 3BWLA 4ZBEA 3IWQA 3T50A 4JF5A 1VHMA 1CQAA 5EUAA 3T4QA 1PW8A 4GOGA 4O01A 3DTMA 1O7EA 4QD4A 3F1NB 4DMZA 1YLPA 3BFGA 5HZHA 5CHJA 3KO6A 3IWOA 3MKFA 3JYIA 1VEUB 2HGVA 2JKGA 3IS2A 1D06A 5FQ9A 4H6JB 2O9AA 2PD8A 4Q0IA 2WUQA 3IWIA 2QKPA 3G2ZA 5L10A 1KVMA 1OJ5A 5FQIA 5A93A 2XFSA 3WRZA 3IF6B 4KZ8A 2Z2MB 2OV5A 3G30A 3NOPC 3CUEA 3IX3A 3VP2A 4GHIA 2ZM8A 5IU1A 4X1LA 3C5AA 4C3QA 4EXOA 4HIAA 2A24A 2HP9A 4KZ9A 3ZG0A 4D60A 4DE1A 2EXAA 2G7UA 3GDIA 3MQ0A 3K2NA 4HBUA 2LB5A 2ZMFA 1PI5A 2ZMAA 5CHMA 5EVIC 1LI9A 4UA7A 1ONHA 4QY6A 5FDHA 2XD5A 2B02A 1E3UD 3W8KA 5F68A 3LEQA 3PBTA 1OPXA 4PKYG 3UY6A 2Y2PA 2W27A 3E0YA 1SKOB 1W63M 3V5MA 5CGSA 3BFEA 4OKPA 4BJPA 4X1MA 3HUNA 1K4EA 3KSFA 3OC2A 3CMZA 2Y2HA 4Y0TA 3UN7A 1XKZA 1CI8A 3UPNA 1FILA 3TRCA 3P98A 3VP1A 2Y2IA 3WS4A 3G35A 4DE2A 2O99A 3G2YA 3PAEA 4EEPA 3R7WA 3L7HA 4EERA 1JWZA 4R6LA 4E3IA 4ARZA 2OAP1 5F83A 3S7OA 3OZHA 1WE4A 4MCWA 4OLDA 1LL5A 5HX9A 4E3MA 4Y7PA 3FC7A 4B88A 3QP5A 5EVIA 2R78A 4N9LA 1IYOA 2QJ7A 3MSHA 1OT6A 1PYYA 3S22A 5FQKA 1SDEA 4YFMA 4S2IA 1T1BA 5L8MA 2V8CA 3Q82A 4OPZA 3UE3A 4DE0A 4XT2B 3N8LA 4DN0A 3T4SA 1GHPA 3CZDA 3NECA 2QYBA 3MZEA 3PHYA 3G6OA 3EEAA 4WELA 3T4TA 2K2NA 4CLCE 4WYYA 2Z6CA 1ZHHB 4ME4A 3B33A 3T12B 1CJFA 4XXRA 2JC7A 4WZ5C 4LV2A 2ZBBA 3LR5A 3UB6A 4NXEA 5DTKA 1OTIA 3IQAA 3BFCA 3C7UA 2XA7S 1IYQA 4EUZA 3IXHA 3IS2B 4WEJA 1YPRA 3MZDA 1GHIA 1MWTA 1FR1A 5CEDA 1ES5A 3S7QA 5EV0A 1I2SA 3A3EA 3B3XA 4II7A 3OCNA 5HFOA 5KZHA 1EI5A 4LV0A 4KQRA 2ZQ7A 4GHIB 2W1RA 4GNUA 1XFQA 3UDFA 3TE8A 4ZTKA 4FUWA 3AGEA 3C7VA 3UB5P 3ZNTA 2A24B 3IXGA 3QP6A 4ZJ2A 2OOLA 3VP0A 2WKHA 4WM9A 5FDSA 4HBTA 5DKKA 2PU2A 3M2KA 3N7WA 1NYMA 4KG5A 3S7PA 4M4XA 4X6TA 3GTCA 4PM6A 3FKWA 3S4XA 4JBFA 1BYWA 4MEZA 4GS9A 5DF9A 3V3SA 4DJ3A 2G2WA 3KSGA 4K0WA 4BMWA 1BLHA 3N8RA 2V8FA 3E4QA 4P85A 2XDMA 1E3UA 1Q2QA 5FQJA 1WYCA 3OBFA 1BZAA 2ZQDA 4HJ3A 4FD8A 2ZOHA 2PHYA 1YLJA 4EEUA 2XD1A 1YM1A 4WMCD 5AQ9A 1DJAA 1KGGA 5HAIA 4PM8A 3ZNYA 4OQ0A 5CGWA 5HPIA 1SHVA 4UQIM 1JVJA 4KZBA 1T1AA 1MBLA 1L0FA 1FCOA 1XGJA 2VKSA 5KSCA 3TG9A 4F3LA 4KZ4A 4EQIA 1XA1A 2Q0OA 1UWNX 3R7WB 1YT4A 4EBPA 5HAQA 2ACGA 3LFVA 4JGPA 2VGLM 2WGIA 3SS5A 2KOIA 4ARZB 4A5RA 5DKLA 5E2EA 4DKIA 2JKFA 2PYRA 1YMSA 3C30A 5EVIB 4Y13A 5A8BA 5IT5A 3IHBA 1SDNA 1XX2A 2XH9A 3N6IA 4Z1WA 5FI6A 5HDSA 4HP4A 1S4SA 4X55A 1I5QA 1S1ZA 2PBDP 4X69A 2D02A 3TW8A 1K56D 2CC1A 3LEZA 3OLOA 4QY5A 4OQHA 5DVAA 2OSUA 3CLOA 4KQOA 3JVUA 5DF8A 4R3AA 2HDUA 4RVAA 2OLUA 2P7JA 4BBTA 5F82A 5LBRA 3BQ8A 4LCMA 1BLSA 2L4RA 1BLCA 5M19A 3U4LP 4KZAA 2D01A 2K31A 3ITAA 2OWHA 4O0PA 3Q1FA 2XGNA 3HUMA 2X02A 3B47A 5L07A 4HESA 3WS2A 3SS3A 1DRMA 4RYEA 1IOUA 4BLMA 1XGIA 4AFIA 3LYXA 4BL3A 3H7WA 4GB7A 3A0SA 4DXBA 5FAQA 1K25A 5DTTA 5TJJA 2J9PA 1P9RA 4GDNA 5F6AA 3EGXC 3FKVA 1H5XA 1C3BA 1MWRA 3ZDJA 4OQIA 4EV4A 1EROA 1T1CA 2RL3A 4GS9B 4L0LA 1YMXA 2ZC7A 4Y2FA 3ICYA 1NLYA 1KE3A 3JVVA 2V1ZA 1NYYA 5FI7A 5EOEA 1KE0A 5HDDA 1DJBA 3VOYA 1CI9A 1SKOA 5GHZA 3Q81A 2W3GA 4NEED 3IHAA 4ESPA 2QHKA 2P74A 1DP9A 3ZVWA 2XRNA 3HL9A 4E6XA 2A3UA 2GJ3A 4WMCA 3OPRA 5F69A 1ZG6A 4Q8IA 2Q9NA 5IS1A 4BD0A 3GECA 2HP5A 2J80A 5A91A 1A0KA 4ETZA 1W7FA 3EGDC 4EU0A 2M7VA 3GV9A 5CGXA 1LSXA 1L0GA 3EQUA 4F3LB 2V2FF 4JXSA 2ZMVA 2Y2GA 1SCWA 1ES3A 1LHYA 1GHMA 1S67L 3CUEC 3IF5A 5CEBA 3CWFA 4I3IA 2H0YA 3PBNA 2ZM0A 5J3WA 4WN5A 3G31A 2WZZA 1M6KA 4DDYA 2CMNA 4G3KA 3EWKA 5GLCA 5DTSA 3T4KA 3HLCA 2JBFA 3DWKA 1FSWA 2UV0E 2PYPA 4OPYA 4EUVA 5TR7A 5CTNA 4M3KA 3MKEA 4IBXA 2VX8A 1IEMA 3T4JA 3QP1A 2W0NA 3IXBA 4S2MA 4FTXA 4LRYC 1W63Q 1YLTA 2WAFA 3SH8A 1K56A 4NG2A 4DF6A 2Y2MA 4MLLA 4S2JA 2XR0A 1H8YA 1ACFA 2VZWA 1XPBA 3RXWA 3IH9A 4I38A 4KUOA 2YKFA 3CI6A 4LV1A 1LSVA 1TS6A 1K4FA 3T1RA 4ZJ3A 2AVXA 3O88A 5HD3A 3ZFZA 1DY6A 1HD8A 1TDLA 2H10A 1FCMA 2X71A 3H7WB 1P97A 5HWTA 5CERA 4Z9QA 2DCFA 1IKIA 4KG6A 5GL9A 1ESIA 1DP8A 2B5RA 1TD5A 4QPRA 5DJUA 1GA0A 2WADA 2WAEA 2XEPA 4GW9A 2ZL1A 1F2KA 1RP5A 2VJWA 4X25A 3MF0A 2J7VA 4JLFA 2H0TA 4WUJA 1U60A 2HDRA 3GMWA 3HVFA 4UHUA 5TFQA 4RX3A 3AGDA 5DJTA 1VM1A 3QNCA 3UMDA 2BASA 2JKRI 4NETA 3EOIA 3D4FA 4CJNA 4B4ZA 3WS5A 4IUKA 1MKMA 3MXSA 3HLFA 1SKFA 4Y15A 4NXFA 4KZ3A 1K55A 4GZBA 4UAAA 4EWFA 4MN7A 2HP6A 2E8JA 2JE5A 2WGVA 3GRJA 3HLEA 1HVBA 2FH5A 3E4PA
chains in the Genus database with same CATH topology
1ES2A 1K38A 1ERMA 3N8RA 4RA7A 3MBZA 4PPRA 4DRTA 4P85A 3UE1A 3QNBA 2XDMA 5CXWA 1E3UA 1K54A 1Q2QA 2X01A 3GVBA 5FSRA 5FQJA 1NXYA 3IF6A 4QHCA 4R0QA 5CECA 3HBRA 1WYCA 1N9BA 4H8RA 4E3NA 1BZAA 1OMEA 4MNRA 3ZG5A 1O07A 2ZQDA 3ISGA 2Q9MA 5FASA 3V39A 4FD8A 4Y0UA 3Q7VA 2Y2OA 2V20A 5IHVA 1YLJA 2XD1A 1YM1A 3UE0A 3WS1A 1EWZA 5AQAA 4WMCD 5AQ9A 1K57A 5DF7A 1DJAA 1K55C 1FOFA 1KGGA 1PW1A 2XK1A 2EX9A 5HAIA 4OOYA 5FI2A 4PM8A 1MKIA 3SH9A 1FCNA 5E2GA 3ZNYA 4IBRA 4OQ0A 5CGWA 1K6SA 2R9XA 4OOMA 4S2LA 3O87A 1SHVA 2XLNA 5KSHA 5E43A 2J8YA 1JVJA 2ZM2A 4KZBA 2P9VA 3PAGA 5FA7A 1MBLA 1IYSA 2E8IA 3IXDA 1L0FA 1FCOA 3A3JA 1IYPA 1FQGA 4D2OA 1XGJA 2Y2KA 4R23A 3ITBA 4N92A 1RGZA 1K54C 4XUZA 4K91A 2WZXA 5KSCA 3TG9A 1RGYA 4O7DA 1NY0A 3PBOA 4KZ4A 4OP8A 2HPBA 4EQIA 1ONGA 1XA1A 5AQ7A 1ZC2A 3Q07A 1FR6A 5I94A 3PBQA 4X56A 3TOIA 3TSGA 3EQVA 4N1HA 3VMAA 3CJMA 1BUEA 5F1FA 4UA9A 1YT4A 4EBPA 3O3VA 5HAQA 2Y59A 2WGIA 4NK3A 3SS5A 1JTGA 3HUOA 4R3BA 3VFHA 2BG1A 1E25A 3QHYA 1L0EA 4A5RA 2WGWA 5E2EA 4DKIA 3HLDA 3ZG9B 1E4DA 4KZ5A 4OQGA 1YMSA 2ZQCA 5EVIB 5D3OA 1KDSA 3RJUA 2IWBA 4XUXA 1VQQA 3IHBA 4LCLA 3GQZA 3UPPA 4R4SA 4S2KA 1LL9A 2ZQ8A 1SDNA 1XX2A 1YLZA 5CTMA 2ZC6B 2XH9A 4ID4A 3HREA 4FH4A 4CPKA 3P09A 4OPQA 4P87A 3N6IA 5FI6A 4OPRA 1XP4A 1J9MA 3A3DA 1QMEA 3FZCA 3IH8A 1LLBA 4MBKA 4IEDA 4X55A 1I5QA 1BSGA 4EBNA 1MXOA 4X69A 2Y2QA 3UDIA 1K56D 2CC1A 3LEZA 4QY5A 3VSLA 4OQHA 5DVAA 4OOLA 4BL2A 2OSUA 1RCJA 2Y2LA 5E2FA 4BQMA 4KQOA 1GCEA 4QJGA 2BLSA 2EX2A 2FFYA 1L0DA 3LY3A 5DF8A 3S1YA 5JYPA 3UPOA 2HDUA 1G6AA 4RVAA 2OLUA 5F82A 4X53A 3UDXA 1YQSA 1MWSA 1W5DA 3M6HA 2HDQA 1WYBA 1KGEA 4LCMA 1BLSA 2WGWB 4S2OA 5AQBA 5EVID 2WYXA 4GD8A 3HLWA 1BLCA 4BD1A 3RXXA 5M19A 4N1XA 4OP5A 1LI0A 4KZAA 5GHXA 2Y2JA 1K6RA 2EFUA 3ITAA 2ZC4B 3Q1FA 4E3LA 3ZCZA 2XGNA 3HUMA 3NDEA 4LENA 2X02A 4S2PA 1HZOA 1IELA 3NBLA 4OONA 3V50A 2C5WB 4OLGA 4HESA 3WS2A 5F1GA 3SS3A 1PZOA 4MBFA 5GHYA 2XFTA 4RYEA 4Y0OA 3M6BA 3LY4A 4BLMA 3NIAA 4ZBEA 5G18A 1XGIA 1TDGA 3IWQA 2OLVA 4JF5A 2WKEA 4BL3A 4GB7A 5U47A 1HTZA 4DXBA 5FAQA 1K25A 4JPMA 5M1AA 5DTTA 4DXCA 5KMWA 2J9PA 4E3JA 4X68A 3BLMA 3DWZA 1W8YA 4GDNA 1KVLA 5EUAA 3W4PA 4DE3A 1PW8A 4GOGA 3FKVA 3DTMA 1O7EA 3E2KA 4QD4A 1H5XA 1C3BA 3NY4A 1NRFA 3NDGA 3C4OA 1MWRA 3OPLA 5FAOA 1YLPA 3ZDJA 3VOZA 1YLWA 4OQIA 1IKGA 3BFGA 5L2FA 4EV4A 2PU4A 1EROA 5FAPA 3PBRA 2RL3A 5M18A 4KG2A 5CHJA 2QZ6A 3IWOA 5FQQA 3MKFA 4L0LA 4WZ4A 2ZJ9A 3JYIA 1YMXA 2ZC7A 4C6YA 3A3FA 1L2SA 1CEFA 1PZPA 5FQ9A 2WKIA 1KE3A 1KGFA 4KENB 2Y91A 2WUQA 2G2UA 2V1ZA 1NYYA 3I7JA 1Z6FA 3G2ZA 3IWIA 4GDBA 5CRFA 5EOEA 5FI7A 1KVMA 1KE0A 5FQIA 1DJBA 5A93A 4KZ7A 2XFSA 4ZJ1A 3IF6B 3VOYA 3WRZA 1CI9A 4E6WA 4KZ8A 2EFXA 3HLBA 3VP3A 5GHZA 2Z2MB 3FWLA 1CEGA 3E2LA 3G30A 3Q81A 2OV5A 4ZAMA 3WRTA 3IHAA 3VP2A 4RX2A 3UO9A 3IT9A 3Q7VB 2P74A 2ZM8A 3ZVWA 2Y55A 4N9KA 3C5AA 4C3QA 2Y4AA 1XXMA 3HL9A 3VSKA 4WEKA 1GA9A 2HP9A 4KZ9A 3ZG0A 4DE1A 4JXWA 4E6XA 2A3UA 5FATA 2EXAA 4JXGA 4WMCA 4HBUA 5EVLA 3OPRA 4KQQA 1PI5A 2VGJA 3G4PA 2ZMAA 1ZG6A 3WWXA 4Q8IA 5CHMA 2Q9NA 4F94A 4BD0A 2DRWA 2Z2LB 3LO7A 5EVIC 1LI9A 2HDSA 2HP5A 5A91A 4UA7A 1W7FA 4ZDXA 3ZG7B 5HARA 1ONHA 2P9VB 4QY6A 4PM9A 4LV3A 3SS4A 1AXBA 3GV9A 4R4RA 5FDHA 5CGXA 2XD5A 5GLAA 3ZG8B 1L0GA 1E3UD 3W8KA 3EQUA 1Q2PA 5E2HA 3PBTA 1BT5A 2V2FF 4JXSA 2I72A 1PI4A 1ES3A 1SCWA 2Y2GA 3NCKA 5HL1A 1LHYA 4GD6A 1GHMA 4OVDA 1PWCA 5FQMA 3UY6A 4EBLA 2Y2PA 3IF5A 3W4QA 4DDSA 3ZHHA 5CEBA 2H0YA 5EPHA 1PWDA 3PBNA 2ZM0A 4FSFA 2A49A 3V5MA 5CHUA 3G31A 3BFEA 4HEFA 4JF6A 4OKPA 2WZZA 1M6KA 4WBGA 5CGSA 4BJPA 4DDYA 3O86A 3HUNA 4JXVA 1K4EA 4QB8A 5GLCA 3OCLA 5DTSA 1TVFA 3AGFA 2JBFA 3HLCA 2GDNA 3DWKA 3SOIA 1FSWA 1PIOA 3OC2A 2ZQAA 3CMZA 2Y2HA 4Y0TA 4OPYA 3UN7A 1XKZA 3VP4A 2EXBA 4U3TA 1CI8A 5TR7A 3UPNA 5CTNA 4M3KA 3MKEA 1W8QA 4IBXA 3ZVTA 2VGKA 4C75A 1IEMA 1MPLA 2XQZA 3MFDA 3NI9A 3P98A 4U0TA 3VP1A 1NJ4A 3N8SA 3IXBA 2Y2IA 3WS4A 5BOHA 1TEMA 1JTDA 3G35A 4E3OA 3C4PA 3V3RA 4S2MA 4DE2A 1KE4A 4P0MA 1N4OA 1DJCA 3G2YA 3PAEA 1YLTA 2C6WB 1CK3A 2RCXA 2WAFA 3SH8A 3BLSA 1K56A 3MZFA 3CG5A 4KZ6A 4DF6A 2Y2MA 1JWZA 4MLLA 4S2JA 4K0XA 3MXRA 5A92A 3SH7A 4YINA 2XR0A 4E3IA 1H8ZA 1M40A 5F83A 5HW3A 1H8YA 1KDWA 3OZHA 1WE4A 1MY8A 4OLDA 1BULA 4UA6A 2DNSA 1LL5A 5HX9A 3GR2A 1XPBA 4E3MA 3G32A 4WZ5A 3RXWA 4JKTA 4Y7PA 3IH9A 4B88A 3NC8A 3FYZA 3VFFA 3BFFA 5EVIA 4N9LA 3A3IA 1IYOA 3S22A 2QPNA 1PYYA 2UWXA 5FQKA 1SDEA 4LV1A 2QMIA 3PTEA 4YFMA 2PBYA 3PBSA 4S2IA 1W79A 1S0WA 2H5SA 3Q82A 4OPZA 1K4FA 3UE3A 4DE0A 2R9WA 2ZQ9A 4ZJ3A 5GLDA 5TGFA 4JF4A 3O88A 3W4OA 5J8XA 3N8LA 1QMFA 3ZFZA 1GHPA 3CZDA 1DY6A 1HD8A 1TDLA 2H10A 3MZEA 1MWUA 1FCMA 2X71A 3OPPA 4PM7A 2IWCA 5CERA 4PMAA 3IF6C 4WELA 4Z9QA 3GSGA 3BEBA 2JCHA 2DCFA 2ZD8A 1ALQA 1IKIA 1I2WA 1YLYA 1JWPA 4KG6A 4WYYA 5GL9A 4R1GA 1ESIA 1NZUA 2EX6A 4XXRA 2JC7A 4E3KA 2B5RA 3BYDA 4WZ5C 3G34A 4LV2A 4MBHA 1GA0A 1K57C 2WADA 1PWGA 1Y54A 2WAEA 3N4IA 5DTKA 3IQAA 2XEPA 4GKUA 4OH0A 3BFCA 5GLBA 3C7UA 3UNWA 2XF3A 4B4XA 1IYQA 3LCEA 1RP5A 4EUZA 3IXHA 4WEJA 3MZDA 2J9OA 1GHIA 1ZKJA 1MWTA 3BRMA 2J7VA 1FR1A 2ZC3B 4U0XA 5CEDA 1ES5A 4JLFA 5A90A 2H0TA 3DW0A 4S2NA 4IVKA 4IVIA 3WS0A 1U60A 2HDRA 3GMWA 3BM6A 1ESUA 1I2SA 3A3EA 3B3XA 3HVFA 3OCNA 4UHUA 4RX3A 3AGDA 4GN2A 3OPHA 5HFOA 5TFQA 5KZHA 1EI5A 2ZC5B 1ZG4A 1VM1A 2ZLYA 4FH2A 4KQRA 4LV0A 4BENA 3QNCA 3M2JA 2EX8A 2ZQ7A 4FCFA 1XA7A 4NETA 3D4FA 5JYOA 4CJNA 1NZOA 3HLGA 4GNUA 4R3JA 1ES4A 3UDFA 3BFDA 5EECA 4B4ZA 4QU3A 4ZTKA 3WS5A 3AGEA 5EOOA 3C7VA 1BTLA 1FSYA 1S6RA 1BLPA 3ZGAB 3ZNTA 3IXGA 3MXSA 3HLFA 4ZJ2A 3FV7A 1SKFA 3VP0A 2WKHA 4WM9A 3Q7ZA 4HBTA 2PU2A 3M2KA 4KZ3A 5HAPA 3BECA 2IWDA 1NYMA 3N7WA 4KG5A 1G68A 4P6BA 1K55A 1JWVA 3GTCA 4PM6A 4GZBA 3FKWA 4UAAA 4X6TA 3S4XA 4EWFA 4JBFA 2HP6A 4MEZA 4PM5A 2JE5A 5DF9A 3V3SA 1ERQA 2WGVA 3GRJA 2FFFB 3HLEA 2G2WA 2WK0A 4K0WA 1HVBA 4S2NC 2Y2NA 5EE8A 1BLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES2 A;  1K38 A;  1ERM A;  3N8R A;  4RA7 A;  3MBZ A;  4PPR A;  4DRT A;  4P85 A;  3UE1 A;  3QNB A;  2XDM A;  5CXW A;  1E3U A;  1K54 A;  1Q2Q A;  2X01 A;  3GVB A;  5FSR A;  5FQJ A;  1NXY A;  3IF6 A;  4QHC A;  4R0Q A;  5CEC A;  3HBR A;  1WYC A;  1N9B A;  4H8R A;  4E3N A;  1BZA A;  1OME A;  4MNR A;  3ZG5 A;  1O07 A;  2ZQD A;  3ISG A;  2Q9M A;  5FAS A;  3V39 A;  4FD8 A;  4Y0U A;  3Q7V A;  2Y2O A;  2V20 A;  5IHV A;  1YLJ A;  2XD1 A;  1YM1 A;  3UE0 A;  3WS1 A;  1EWZ A;  5AQA A;  4WMC D;  5AQ9 A;  1K57 A;  5DF7 A;  1DJA A;  1K55 C;  1FOF A;  1KGG A;  1PW1 A;  2XK1 A;  2EX9 A;  5HAI A;  4OOY A;  5FI2 A;  4PM8 A;  1MKI A;  3SH9 A;  1FCN A;  5E2G A;  3ZNY A;  4IBR A;  4OQ0 A;  5CGW A;  1K6S A;  2R9X A;  4OOM A;  4S2L A;  3O87 A;  1SHV A;  2XLN A;  5KSH A;  5E43 A;  2J8Y A;  1JVJ A;  2ZM2 A;  4KZB A;  2P9V A;  3PAG A;  5FA7 A;  1MBL A;  1IYS A;  2E8I A;  3IXD A;  1L0F A;  1FCO A;  3A3J A;  1IYP A;  1FQG A;  4D2O A;  1XGJ A;  2Y2K A;  4R23 A;  3ITB A;  4N92 A;  1RGZ A;  1K54 C;  4XUZ A;  4K91 A;  2WZX A;  5KSC A;  3TG9 A;  1RGY A;  4O7D A;  1NY0 A;  3PBO A;  4KZ4 A;  4OP8 A;  2HPB A;  4EQI A;  1ONG A;  1XA1 A;  5AQ7 A;  1ZC2 A;  3Q07 A;  1FR6 A;  5I94 A;  3PBQ A;  4X56 A;  3TOI A;  3TSG A;  3EQV A;  4N1H A;  3VMA A;  3CJM A;  1BUE A;  5F1F A;  4UA9 A;  1YT4 A;  4EBP A;  3O3V A;  5HAQ A;  2Y59 A;  2WGI A;  4NK3 A;  3SS5 A;  1JTG A;  3HUO A;  4R3B A;  3VFH A;  2BG1 A;  1E25 A;  3QHY A;  1L0E A;  4A5R A;  2WGW A;  5E2E A;  4DKI A;  3HLD A;  3ZG9 B;  1E4D A;  4KZ5 A;  4OQG A;  1YMS A;  2ZQC A;  5EVI B;  5D3O A;  1KDS A;  3RJU A;  2IWB A;  4XUX A;  1VQQ A;  3IHB A;  4LCL A;  3GQZ A;  3UPP A;  4R4S A;  4S2K A;  1LL9 A;  2ZQ8 A;  1SDN A;  1XX2 A;  1YLZ A;  5CTM A;  2ZC6 B;  2XH9 A;  4ID4 A;  3HRE A;  4FH4 A;  4CPK A;  3P09 A;  4OPQ A;  4P87 A;  3N6I A;  5FI6 A;  4OPR A;  1XP4 A;  1J9M A;  3A3D A;  1QME A;  3FZC A;  3IH8 A;  1LLB A;  4MBK A;  4IED A;  4X55 A;  1I5Q A;  1BSG A;  4EBN A;  1MXO A;  4X69 A;  2Y2Q A;  3UDI A;  1K56 D;  2CC1 A;  3LEZ A;  4QY5 A;  3VSL A;  4OQH A;  5DVA A;  4OOL A;  4BL2 A;  2OSU A;  1RCJ A;  2Y2L A;  5E2F A;  4BQM A;  4KQO A;  1GCE A;  4QJG A;  2BLS A;  2EX2 A;  2FFY A;  1L0D A;  3LY3 A;  5DF8 A;  3S1Y A;  5JYP A;  3UPO A;  2HDU A;  1G6A A;  4RVA A;  2OLU A;  5F82 A;  4X53 A;  3UDX A;  1YQS A;  1MWS A;  1W5D A;  3M6H A;  2HDQ A;  1WYB A;  1KGE A;  4LCM A;  1BLS A;  2WGW B;  4S2O A;  5AQB A;  5EVI D;  2WYX A;  4GD8 A;  3HLW A;  1BLC A;  4BD1 A;  3RXX A;  5M19 A;  4N1X A;  4OP5 A;  1LI0 A;  4KZA A;  5GHX A;  2Y2J A;  1K6R A;  2EFU A;  3ITA A;  2ZC4 B;  3Q1F A;  4E3L A;  3ZCZ A;  2XGN A;  3HUM A;  3NDE A;  4LEN A;  2X02 A;  4S2P A;  1HZO A;  1IEL A;  3NBL A;  4OON A;  3V50 A;  2C5W B;  4OLG A;  4HES A;  3WS2 A;  5F1G A;  3SS3 A;  1PZO A;  4MBF A;  5GHY A;  2XFT A;  4RYE A;  4Y0O A;  3M6B A;  3LY4 A;  4BLM A;  3NIA A;  4ZBE A;  5G18 A;  1XGI A;  1TDG A;  3IWQ A;  2OLV A;  4JF5 A;  2WKE A;  4BL3 A;  4GB7 A;  5U47 A;  1HTZ A;  4DXB A;  5FAQ A;  1K25 A;  4JPM A;  5M1A A;  5DTT A;  4DXC A;  5KMW A;  2J9P A;  4E3J A;  4X68 A;  3BLM A;  3DWZ A;  1W8Y A;  4GDN A;  1KVL A;  5EUA A;  3W4P A;  4DE3 A;  1PW8 A;  4GOG A;  3FKV A;  3DTM A;  1O7E A;  3E2K A;  4QD4 A;  1H5X A;  1C3B A;  3NY4 A;  1NRF A;  3NDG A;  3C4O A;  1MWR A;  3OPL A;  5FAO A;  1YLP A;  3ZDJ A;  3VOZ A;  1YLW A;  4OQI A;  1IKG A;  3BFG A;  5L2F A;  4EV4 A;  2PU4 A;  1ERO A;  5FAP A;  3PBR A;  2RL3 A;  5M18 A;  4KG2 A;  5CHJ A;  2QZ6 A;  3IWO A;  5FQQ A;  3MKF A;  4L0L A;  4WZ4 A;  2ZJ9 A;  3JYI A;  1YMX A;  2ZC7 A;  4C6Y A;  3A3F A;  1L2S A;  1CEF A;  1PZP A;  5FQ9 A;  2WKI A;  1KE3 A;  1KGF A;  4KEN B;  2Y91 A;  2WUQ A;  2G2U A;  2V1Z A;  1NYY A;  3I7J A;  1Z6F A;  3G2Z A;  3IWI A;  4GDB A;  5CRF A;  5EOE A;  5FI7 A;  1KVM A;  1KE0 A;  5FQI A;  1DJB A;  5A93 A;  4KZ7 A;  2XFS A;  4ZJ1 A;  3IF6 B;  3VOY A;  3WRZ A;  1CI9 A;  4E6W A;  4KZ8 A;  2EFX A;  3HLB A;  3VP3 A;  5GHZ A;  2Z2M B;  3FWL A;  1CEG A;  3E2L A;  3G30 A;  3Q81 A;  2OV5 A;  4ZAM A;  3WRT A;  3IHA A;  3VP2 A;  4RX2 A;  3UO9 A;  3IT9 A;  3Q7V B;  2P74 A;  2ZM8 A;  3ZVW A;  2Y55 A;  4N9K A;  3C5A A;  4C3Q A;  2Y4A A;  1XXM A;  3HL9 A;  3VSK A;  4WEK A;  1GA9 A;  2HP9 A;  4KZ9 A;  3ZG0 A;  4DE1 A;  4JXW A;  4E6X A;  2A3U A;  5FAT A;  2EXA A;  4JXG A;  4WMC A;  4HBU A;  5EVL A;  3OPR A;  4KQQ A;  1PI5 A;  2VGJ A;  3G4P A;  2ZMA A;  1ZG6 A;  3WWX A;  4Q8I A;  5CHM A;  2Q9N A;  4F94 A;  4BD0 A;  2DRW A;  2Z2L B;  3LO7 A;  5EVI C;  1LI9 A;  2HDS A;  2HP5 A;  5A91 A;  4UA7 A;  1W7F A;  4ZDX A;  3ZG7 B;  5HAR A;  1ONH A;  2P9V B;  4QY6 A;  4PM9 A;  4LV3 A;  3SS4 A;  1AXB A;  3GV9 A;  4R4R A;  5FDH A;  5CGX A;  2XD5 A;  5GLA A;  3ZG8 B;  1L0G A;  1E3U D;  3W8K A;  3EQU A;  1Q2P A;  5E2H A;  3PBT A;  1BT5 A;  2V2F F;  4JXS A;  2I72 A;  1PI4 A;  1ES3 A;  1SCW A;  2Y2G A;  3NCK A;  5HL1 A;  1LHY A;  4GD6 A;  1GHM A;  4OVD A;  1PWC A;  5FQM A;  3UY6 A;  4EBL A;  2Y2P A;  3IF5 A;  3W4Q A;  4DDS A;  3ZHH A;  5CEB A;  2H0Y A;  5EPH A;  1PWD A;  3PBN A;  2ZM0 A;  4FSF A;  2A49 A;  3V5M A;  5CHU A;  3G31 A;  3BFE A;  4HEF A;  4JF6 A;  4OKP A;  2WZZ A;  1M6K A;  4WBG A;  5CGS A;  4BJP A;  4DDY A;  3O86 A;  3HUN A;  4JXV A;  1K4E A;  4QB8 A;  5GLC A;  3OCL A;  5DTS A;  1TVF A;  3AGF A;  2JBF A;  3HLC A;  2GDN A;  3DWK A;  3SOI A;  1FSW A;  1PIO A;  3OC2 A;  2ZQA A;  3CMZ A;  2Y2H A;  4Y0T A;  4OPY A;  3UN7 A;  1XKZ A;  3VP4 A;  2EXB A;  4U3T A;  1CI8 A;  5TR7 A;  3UPN A;  5CTN A;  4M3K A;  3MKE A;  1W8Q A;  4IBX A;  3ZVT A;  2VGK A;  4C75 A;  1IEM A;  1MPL A;  2XQZ A;  3MFD A;  3NI9 A;  3P98 A;  4U0T A;  3VP1 A;  1NJ4 A;  3N8S A;  3IXB A;  2Y2I A;  3WS4 A;  5BOH A;  1TEM A;  1JTD A;  3G35 A;  4E3O A;  3C4P A;  3V3R A;  4S2M A;  4DE2 A;  1KE4 A;  4P0M A;  1N4O A;  1DJC A;  3G2Y A;  3PAE A;  1YLT A;  2C6W B;  1CK3 A;  2RCX A;  2WAF A;  3SH8 A;  3BLS A;  1K56 A;  3MZF A;  3CG5 A;  4KZ6 A;  4DF6 A;  2Y2M A;  1JWZ A;  4MLL A;  4S2J A;  4K0X A;  3MXR A;  5A92 A;  3SH7 A;  4YIN A;  2XR0 A;  4E3I A;  1H8Z A;  1M40 A;  5F83 A;  5HW3 A;  1H8Y A;  1KDW A;  3OZH A;  1WE4 A;  1MY8 A;  4OLD A;  1BUL A;  4UA6 A;  2DNS A;  1LL5 A;  5HX9 A;  3GR2 A;  1XPB A;  4E3M A;  3G32 A;  4WZ5 A;  3RXW A;  4JKT A;  4Y7P A;  3IH9 A;  4B88 A;  3NC8 A;  3FYZ A;  3VFF A;  3BFF A;  5EVI A;  4N9L A;  3A3I A;  1IYO A;  3S22 A;  2QPN A;  1PYY A;  2UWX A;  5FQK A;  1SDE A;  4LV1 A;  2QMI A;  3PTE A;  4YFM A;  2PBY A;  3PBS A;  4S2I A;  1W79 A;  1S0W A;  2H5S A;  3Q82 A;  4OPZ A;  1K4F A;  3UE3 A;  4DE0 A;  2R9W A;  2ZQ9 A;  4ZJ3 A;  5GLD A;  5TGF A;  4JF4 A;  3O88 A;  3W4O A;  5J8X A;  3N8L A;  1QMF A;  3ZFZ A;  1GHP A;  3CZD A;  1DY6 A;  1HD8 A;  1TDL A;  2H10 A;  3MZE A;  1MWU A;  1FCM A;  2X71 A;  3OPP A;  4PM7 A;  2IWC A;  5CER A;  4PMA A;  3IF6 C;  4WEL A;  4Z9Q A;  3GSG A;  3BEB A;  2JCH A;  2DCF A;  2ZD8 A;  1ALQ A;  1IKI A;  1I2W A;  1YLY A;  1JWP A;  4KG6 A;  4WYY A;  5GL9 A;  4R1G A;  1ESI A;  1NZU A;  2EX6 A;  4XXR A;  2JC7 A;  4E3K A;  2B5R A;  3BYD A;  4WZ5 C;  3G34 A;  4LV2 A;  4MBH A;  1GA0 A;  1K57 C;  2WAD A;  1PWG A;  1Y54 A;  2WAE A;  3N4I A;  5DTK A;  3IQA A;  2XEP A;  4GKU A;  4OH0 A;  3BFC A;  5GLB A;  3C7U A;  3UNW A;  2XF3 A;  4B4X A;  1IYQ A;  3LCE A;  1RP5 A;  4EUZ A;  3IXH A;  4WEJ A;  3MZD A;  2J9O A;  1GHI A;  1ZKJ A;  1MWT A;  3BRM A;  2J7V A;  1FR1 A;  2ZC3 B;  4U0X A;  5CED A;  1ES5 A;  4JLF A;  5A90 A;  2H0T A;  3DW0 A;  4S2N A;  4IVK A;  4IVI A;  3WS0 A;  1U60 A;  2HDR A;  3GMW A;  3BM6 A;  1ESU A;  1I2S A;  3A3E A;  3B3X A;  3HVF A;  3OCN A;  4UHU A;  4RX3 A;  3AGD A;  4GN2 A;  3OPH A;  5HFO A;  5TFQ A;  5KZH A;  1EI5 A;  2ZC5 B;  1ZG4 A;  1VM1 A;  2ZLY A;  4FH2 A;  4KQR A;  4LV0 A;  4BEN A;  3QNC A;  3M2J A;  2EX8 A;  2ZQ7 A;  4FCF A;  1XA7 A;  4NET A;  3D4F A;  5JYO A;  4CJN A;  1NZO A;  3HLG A;  4GNU A;  4R3J A;  1ES4 A;  3UDF A;  3BFD A;  5EEC A;  4B4Z A;  4QU3 A;  4ZTK A;  3WS5 A;  3AGE A;  5EOO A;  3C7V A;  1BTL A;  1FSY A;  1S6R A;  1BLP A;  3ZGA B;  3ZNT A;  3IXG A;  3MXS A;  3HLF A;  4ZJ2 A;  3FV7 A;  1SKF A;  3VP0 A;  2WKH A;  4WM9 A;  3Q7Z A;  4HBT A;  2PU2 A;  3M2K A;  4KZ3 A;  5HAP A;  3BEC A;  2IWD A;  1NYM A;  3N7W A;  4KG5 A;  1G68 A;  4P6B A;  1K55 A;  1JWV A;  3GTC A;  4PM6 A;  4GZB A;  3FKW A;  4UAA A;  4X6T A;  3S4X A;  4EWF A;  4JBF A;  2HP6 A;  4MEZ A;  4PM5 A;  2JE5 A;  5DF9 A;  3V3S A;  1ERQ A;  2WGV A;  3GRJ A;  2FFF B;  3HLE A;  2G2W A;  2WK0 A;  4K0W A;  1HVB A;  4S2N C;  2Y2N A;  5EE8 A;  1BLH A; 
#chains in the Genus database with same CATH topology
 3MBZ A;  3UE1 A;  1K54 A;  2X01 A;  5EM0 A;  1GSW A;  4R0Q A;  5CEC A;  4WF0 A;  3ISG A;  2W3D A;  3V39 A;  5HWW A;  3Q7V A;  2Y2O A;  2V20 A;  2Y8H A;  5IHV A;  5AQA A;  2JKR M;  5DF7 A;  3A0R A;  1MKI A;  3SH9 A;  1FCN A;  2A2L A;  5FEF A;  2R9X A;  4S2L A;  3O87 A;  2XLN A;  5E43 A;  2VV8 A;  2WKQ A;  1NLZ A;  2P9V A;  3IXD A;  4QWO A;  1FQG A;  4D2O A;  1S66 L;  1K0K A;  4R23 A;  4K91 A;  1ZTU A;  4O7D A;  2W3E A;  2EWV A;  2HPB A;  1ONG A;  3FPW A;  4GLQ A;  1ZC2 A;  5I94 A;  2M1C A;  4UQI S;  3PBQ A;  3TOI A;  3TSG A;  3VMA A;  1BUE A;  5F1F A;  5AVE A;  1HLU P;  2PT7 A;  4NK3 A;  2VA0 A;  3F1P A;  1F9I A;  3ZG9 B;  4KZ5 A;  2ZQC A;  2O9B A;  1KDS A;  5EVE A;  3RJU A;  1T19 A;  3VE4 A;  2VGL S;  2IWB A;  3PR6 A;  4LCL A;  3UPP A;  4IUH A;  3LR0 A;  1YLZ A;  4FH4 A;  4OPQ A;  3A3D A;  2KLI A;  4CLC B;  3IH8 A;  1LLB A;  3IX8 A;  4Y5F A;  4EBN A;  2V0U A;  3UE6 A;  2WKR A;  3VSL A;  3NJA A;  4IJG A;  4BL2 A;  4RQ9 A;  1RCJ A;  5E2F A;  3ZYT A;  4EQ1 A;  2BLS A;  5JYP A;  2INW A;  3FPV A;  1J3W A;  1G6A A;  3SW1 A;  3M6H A;  5EFW A;  2O0Y A;  2HDQ A;  5AQB A;  4P6Z S;  1P0Z A;  2EA9 A;  4BD1 A;  2ZL1 B;  5GHX A;  1K6R A;  4E3L A;  3ZCZ A;  5EM1 A;  5HL6 A;  3DAV A;  1IEL A;  3E4O A;  1PZO A;  4MBF A;  2XFT A;  4L9E A;  1D7E A;  3NIA A;  5G18 A;  4BBU A;  1TDG A;  1MC0 A;  2WKE A;  1CF0 A;  3W2Z A;  1HTZ A;  4JPM A;  5KMW A;  3BLM A;  3DWZ A;  1W8Y A;  2V1B A;  1KVL A;  2J3T D;  1H0M A;  1TS8 A;  3E2K A;  3T1Q B;  1NRF A;  1S4R A;  3C4O A;  3NDG A;  3ULF A;  1KOU A;  3OPL A;  3VOZ A;  2KDK A;  4HOI A;  5M18 A;  4KG2 A;  2QZ6 A;  4WZ4 A;  2ZJ9 A;  4C6Y A;  3A3F A;  2V9A A;  3BJN A;  2JHE A;  3BY8 A;  1PZP A;  1XJ3 A;  2WKP A;  1KGF A;  2Y91 A;  1SZV A;  4NXB A;  2G2U A;  3I7J A;  2FZ0 A;  2DMW A;  3LIC A;  3VE3 A;  4KZ7 A;  4ZJ1 A;  4E6W A;  2EFX A;  1ODV A;  4ZAM A;  3C38 A;  4RX2 A;  3UO9 A;  3Q7V B;  4N9K A;  1XXM A;  1TS7 A;  4JXW A;  2GX5 A;  2W3F A;  3MJQ A;  4JXG A;  3DTK A;  4LRZ E;  2VGJ A;  3G4P A;  1F5M A;  3KYZ A;  4ZDX A;  3ZG7 B;  2P9V B;  4YOF A;  4PM9 A;  1AXB A;  5GLA A;  4EES A;  3B42 A;  3LID A;  1Q2P A;  5E2H A;  4P6Z M;  5HL1 A;  4GD6 A;  3UB8 A;  2ZOI A;  4DDS A;  3ZHH A;  4GCZ A;  1PWD A;  3R4K A;  1XJ2 A;  4FSF A;  2A49 A;  2LB9 A;  1G28 A;  3BQA A;  3F1P B;  3BW6 A;  4HEF A;  4WBG A;  3MMH A;  4HJ4 A;  4QB8 A;  4HY8 A;  3VV4 A;  1TVF A;  3AGF A;  2GDN A;  3SOI A;  3OOV A;  2ZQA A;  2EXB A;  4CLC D;  4HH2 A;  1W8Q A;  3ZVT A;  1H3Q A;  4C75 A;  2XQZ A;  3MFD A;  1NJ4 A;  2H28 A;  5FL3 A;  4CQH A;  5BOH A;  4HQA A;  3D72 A;  3T1X A;  4E3O A;  1KE4 A;  4P0M A;  1N4O A;  1DJC A;  3UB9 A;  3RTY A;  2C6W B;  3VOL A;  5J7E A;  2JKT I;  4K0X A;  5A92 A;  3KSH A;  2DNS A;  3GR2 A;  3G32 A;  1YKD A;  3D3O A;  3NC8 A;  3FYZ A;  3P7N A;  2UWX A;  2W1T A;  3JPU A;  2QMI A;  3PTE A;  2PBY A;  3PBS A;  1W79 A;  4HHD A;  1S0W A;  2H5S A;  3LIA A;  2R9W A;  2ZQ9 A;  1LSW A;  5GLD A;  4JGQ A;  5J8X A;  1PNE A;  1QMF A;  1V9Z A;  1MWU A;  4PMA A;  3BEB A;  2JCH A;  2ZD8 A;  1L3L A;  1ALQ A;  1I2W A;  1JWP A;  1IFQ A;  3U2A A;  4E3K A;  3BYD A;  3G34 A;  4MBH A;  2JKT M;  1Y28 A;  1PWG A;  3ZQ5 A;  1Y54 A;  3N4I A;  1D1J A;  3H9W A;  5GLB A;  2P04 A;  3LCE A;  5KIZ A;  3BRM A;  2ZC3 B;  4CLC C;  4S2N A;  4IVK A;  4MMN A;  1OT9 A;  1EW0 A;  3OPH A;  1YSQ A;  2ZC5 B;  1LT0 A;  4LGW A;  2EX8 A;  4FCF A;  4PKY A;  1XA7 A;  3HLG A;  5EEC A;  1BTL A;  1FSY A;  2VK3 A;  5HAP A;  3KYE A;  5HWV A;  3DTI A;  3CPT A;  4EET B;  1JWV A;  2PR5 A;  2Y79 A;  2V0W A;  1ERQ A;  1UGU A;  4MN6 A;  5EE8 A;  1ES2 A;  1ERM A;  4RA7 A;  4DRT A;  1XFN A;  2OWJ A;  3GVB A;  5FSR A;  1NXY A;  4QHC A;  3F1O A;  3HBR A;  1N9B A;  4E3N A;  1OME A;  3ZG5 A;  3H82 A;  1O07 A;  5F5Y A;  3CHW P;  3RFB A;  2Q9M A;  3HCY A;  5FAS A;  2VLG A;  1Z09 A;  3UE0 A;  3WS1 A;  4MN5 A;  1EWZ A;  2B18 A;  3TJZ C;  1VB6 A;  1K55 C;  2XK1 A;  2EX9 A;  5FI2 A;  2B95 A;  5E2G A;  1K6S A;  3K3D A;  2J8Y A;  2ZM2 A;  4CLC A;  3CAX A;  3PAG A;  5FA7 A;  1IYS A;  4I5S A;  5HPF A;  3A3J A;  1IYP A;  3KSI A;  3LIF A;  2Y2K A;  1RGZ A;  1K54 C;  4XUZ A;  2WZX A;  1RGY A;  3HJK A;  1NY0 A;  3PBO A;  4OP8 A;  4ZRR A;  4WL9 A;  3CJM A;  1TF1 A;  4NKP A;  4JGR A;  3O3V A;  1JTG A;  3VFH A;  2BG1 A;  3DTE A;  1L0E A;  3HLD A;  5DFY A;  1GSX A;  5D3O A;  3L9K A;  2W1T B;  3A0V A;  3LIB A;  4R4S A;  4S2K A;  1P9W A;  2ZQ8 A;  2ZC6 B;  4ID4 A;  4CPK A;  3HRE A;  5TBM A;  3NOU C;  4OPR A;  1XP4 A;  4G3W A;  3NUL A;  4IED A;  1BSG A;  1N9O A;  3UDI A;  3MFX A;  4OOL A;  2Y2L A;  4BQM A;  1GCE A;  3S1Y A;  1L0D A;  1X0O A;  1WYB A;  4S2O A;  2WGW B;  2HF6 A;  3T4L A;  4HNB A;  4IHQ A;  4GJ4 A;  5C5K A;  2K7S A;  2ZC4 B;  3IBJ A;  3NDE A;  4LEN A;  3IBR A;  1HZO A;  3E98 A;  1STZ A;  4OON A;  2JN7 A;  3LR4 A;  3V50 A;  3BY9 A;  4OLG A;  3M6B A;  2OLV A;  1XJ4 A;  5U47 A;  5M1A A;  4DXC A;  3MR0 A;  4X68 A;  4E3J A;  4Y3I A;  3EEH A;  2W3H A;  3W4P A;  4DE3 A;  3PYP A;  3NY4 A;  3CPT B;  5FAO A;  1YLW A;  5L2F A;  1IKG A;  2PU4 A;  2PDR A;  5FAP A;  3PBR A;  4G3V A;  2M7U A;  4EW7 A;  5FQQ A;  3NHQ A;  2OAQ 1;  3PXP A;  3K3C A;  5HD5 A;  3QP2 A;  1L2S A;  2XSS A;  1CEF A;  2WKI A;  4KEN B;  4GDB A;  5CRF A;  1Z6F A;  2L0W A;  3S7N A;  3D9Y A;  1YAX A;  4MDZ A;  3DBA A;  3F1O B;  2PRF A;  3MQO A;  3HLB A;  1YSP A;  3VP3 A;  3FWL A;  1CEG A;  3E2L A;  3H82 B;  1G5U A;  3WRT A;  5L09 A;  3IT9 A;  2Y55 A;  2VV6 A;  2Y4A A;  3VSK A;  1JNU A;  4WEK A;  1GA9 A;  3SZT A;  4HP9 A;  5FAT A;  3IX4 A;  3P01 A;  5EVL A;  2O9C A;  4KQQ A;  3WWX A;  2IA2 A;  4F94 A;  2DRW A;  2Z2L B;  1T18 A;  3LO7 A;  2HDS A;  5J4E A;  1N9N A;  5HAR A;  4LV3 A;  3SS4 A;  3ZG8 B;  4R4R A;  1BT5 A;  2I72 A;  1PI4 A;  3NCK A;  4OVD A;  1PWC A;  5FQM A;  4EBL A;  3W4Q A;  1VET A;  5EPH A;  5HSQ A;  5CHU A;  1OTE A;  4JF6 A;  3O86 A;  4R70 A;  2PAV P;  4JXV A;  4KUK A;  3OCL A;  1PFL A;  1PIO A;  1S1Y A;  3VP4 A;  2HZ5 A;  4U3T A;  5DFX A;  5G4Y A;  2VGK A;  5TBM B;  1MPL A;  3LIE A;  3NI9 A;  4U0T A;  3N8S A;  3O5Y A;  5AJG A;  1TEM A;  1JTD A;  3C4P A;  3C2W A;  3V3R A;  4FOF A;  4HJ6 A;  1CK3 A;  2QJ5 A;  2RCX A;  4LPZ A;  3BLS A;  3QP8 A;  3MZF A;  3CG5 A;  4KZ6 A;  3NOT C;  1WA9 A;  3MXR A;  3SH7 A;  4YIN A;  5CX7 A;  1H8Z A;  1M40 A;  5HDC A;  5HW3 A;  1KDW A;  2V1A A;  1MY8 A;  1BUL A;  4UA6 A;  2EWW A;  4WZ5 A;  4JKT A;  1XJ6 A;  3VFF A;  3BFF A;  3A3I A;  2QPN A;  4R38 A;  1NRJ A;  5FEG A;  3V67 A;  4LRX C;  4YNR A;  5TGF A;  4JF4 A;  1OJG A;  3W4O A;  1F98 A;  4O8G A;  1OTD A;  4PM7 A;  3OPP A;  4HI4 A;  2IWC A;  3IF6 C;  1MZU A;  3GSG A;  1YLY A;  2PR6 A;  4R1G A;  1NZU A;  2EX6 A;  2XA7 M;  4Y17 A;  1H8M A;  2PD7 A;  1K57 C;  4PHT A;  2NUT C;  1GSV A;  4GKU A;  4OH0 A;  4YWZ A;  2GZA A;  2BTF P;  2VV7 A;  3UNW A;  2XF3 A;  3LUQ A;  4B4X A;  4I3A A;  2HJ9 C;  4HH3 A;  2J9O A;  1ZKJ A;  2QWS A;  2VEA A;  4U0X A;  4UEY A;  5A90 A;  2Z6D A;  3DW0 A;  4IVI A;  3WS0 A;  2NUP C;  3BM6 A;  1ESU A;  4I3J A;  4GN2 A;  4I39 A;  3KYQ A;  1DP6 A;  1V9Y A;  1Y4O A;  1ZG4 A;  2ZLY A;  3KX0 X;  4FH2 A;  4WLA A;  4BEN A;  3M2J A;  3T1S A;  4DJ2 A;  4L9G A;  5JYO A;  1NZO A;  4R3J A;  4B9O A;  1ES4 A;  4ETX A;  3BFD A;  4QU3 A;  2HV1 A;  5EOO A;  1S6R A;  3ZGA B;  1BLP A;  2J3T C;  3FV7 A;  3Q7Z A;  3UB7 A;  3BEC A;  2IWD A;  3F1N A;  1G68 A;  3MS6 A;  4KQD A;  4PAU A;  4P6B A;  3UME A;  1OTA A;  1PRQ A;  2J3W A;  4PM5 A;  5G4Z A;  2KX6 A;  2FFF B;  1VEU A;  4L9F A;  2WK0 A;  4S2N C;  2Y2N A;  4H6J A;  1K38 A;  3C8C A;  4PPR A;  1OTB A;  3LI9 A;  3QNB A;  1AWI A;  5CXW A;  2XRO A;  1VET B;  3IF6 A;  1NWZ A;  4H8R A;  4MNR A;  2I9V A;  4Y0U A;  2P08 A;  3MXQ A;  1K57 A;  3CIT A;  1FOF A;  4LLO B;  5AVF A;  1PW1 A;  1FIK A;  4OOY A;  5MC7 A;  4B93 A;  4IBR A;  4OOM A;  4NXG A;  3QP4 A;  5KSH A;  4BWI A;  2E8I A;  3LI8 A;  3ITB A;  4N92 A;  5AQ7 A;  3Q07 A;  1FR6 A;  4Q0J A;  4JGO A;  4X56 A;  3EQV A;  3LR3 A;  4N1H A;  4UA9 A;  2Y59 A;  3HUO A;  4R3B A;  1E25 A;  3MQQ A;  3QHY A;  2WGW A;  5I5L A;  3RH8 B;  1E4D A;  2GNX A;  5K5B A;  2HJE A;  4OQG A;  4LFU A;  4E04 A;  4XUX A;  1VQQ A;  2MJ6 A;  3GQZ A;  1LL9 A;  3HJI A;  4Q0H A;  5CTM A;  2YKH A;  2L1M A;  3P09 A;  4P87 A;  1J9M A;  1QME A;  3FZC A;  4MBK A;  4BBV A;  1MXO A;  2Y2Q A;  1N9L A;  3T4O A;  1G6O A;  4QJG A;  2EX2 A;  3LY3 A;  2FFY A;  3UPO A;  1TS0 A;  4X53 A;  3UDX A;  1YQS A;  1MWS A;  1W5D A;  1KGE A;  4K08 A;  5EVI D;  2WYX A;  4GD8 A;  3HLW A;  3RXX A;  4N1X A;  4OP5 A;  1LI0 A;  3LGO A;  2Y2J A;  2EFU A;  1LL8 A;  4S2P A;  3NBL A;  1UWP X;  3FG8 A;  2C5W B;  5F1G A;  5GHY A;  4XT2 A;  4Y0O A;  3LY4 A;  3BWL A;  4ZBE A;  3IWQ A;  3T50 A;  4JF5 A;  1VHM A;  1CQA A;  5EUA A;  3T4Q A;  1PW8 A;  4GOG A;  4O01 A;  3DTM A;  1O7E A;  4QD4 A;  3F1N B;  4DMZ A;  1YLP A;  3BFG A;  5HZH A;  5CHJ A;  3KO6 A;  3IWO A;  3MKF A;  3JYI A;  1VEU B;  2HGV A;  2JKG A;  3IS2 A;  1D06 A;  5FQ9 A;  4H6J B;  2O9A A;  2PD8 A;  4Q0I A;  2WUQ A;  3IWI A;  2QKP A;  3G2Z A;  5L10 A;  1KVM A;  1OJ5 A;  5FQI A;  5A93 A;  2XFS A;  3WRZ A;  3IF6 B;  4KZ8 A;  2Z2M B;  2OV5 A;  3G30 A;  3NOP C;  3CUE A;  3IX3 A;  3VP2 A;  4GHI A;  2ZM8 A;  5IU1 A;  4X1L A;  3C5A A;  4C3Q A;  4EXO A;  4HIA A;  2A24 A;  2HP9 A;  4KZ9 A;  3ZG0 A;  4D60 A;  4DE1 A;  2EXA A;  2G7U A;  3GDI A;  3MQ0 A;  3K2N A;  4HBU A;  2LB5 A;  2ZMF A;  1PI5 A;  2ZMA A;  5CHM A;  5EVI C;  1LI9 A;  4UA7 A;  1ONH A;  4QY6 A;  5FDH A;  2XD5 A;  2B02 A;  1E3U D;  3W8K A;  5F68 A;  3LEQ A;  3PBT A;  1OPX A;  4PKY G;  3UY6 A;  2Y2P A;  2W27 A;  3E0Y A;  1SKO B;  1W63 M;  3V5M A;  5CGS A;  3BFE A;  4OKP A;  4BJP A;  4X1M A;  3HUN A;  1K4E A;  3KSF A;  3OC2 A;  3CMZ A;  2Y2H A;  4Y0T A;  3UN7 A;  1XKZ A;  1CI8 A;  3UPN A;  1FIL A;  3TRC A;  3P98 A;  3VP1 A;  2Y2I A;  3WS4 A;  3G35 A;  4DE2 A;  2O99 A;  3G2Y A;  3PAE A;  4EEP A;  3R7W A;  3L7H A;  4EER A;  1JWZ A;  4R6L A;  4E3I A;  4ARZ A;  2OAP 1;  5F83 A;  3S7O A;  3OZH A;  1WE4 A;  4MCW A;  4OLD A;  1LL5 A;  5HX9 A;  4E3M A;  4Y7P A;  3FC7 A;  4B88 A;  3QP5 A;  5EVI A;  2R78 A;  4N9L A;  1IYO A;  2QJ7 A;  3MSH A;  1OT6 A;  1PYY A;  3S22 A;  5FQK A;  1SDE A;  4YFM A;  4S2I A;  1T1B A;  5L8M A;  2V8C A;  3Q82 A;  4OPZ A;  3UE3 A;  4DE0 A;  4XT2 B;  3N8L A;  4DN0 A;  3T4S A;  1GHP A;  3CZD A;  3NEC A;  2QYB A;  3MZE A;  3PHY A;  3G6O A;  3EEA A;  4WEL A;  3T4T A;  2K2N A;  4CLC E;  4WYY A;  2Z6C A;  1ZHH B;  4ME4 A;  3B33 A;  3T12 B;  1CJF A;  4XXR A;  2JC7 A;  4WZ5 C;  4LV2 A;  2ZBB A;  3LR5 A;  3UB6 A;  4NXE A;  5DTK A;  1OTI A;  3IQA A;  3BFC A;  3C7U A;  2XA7 S;  1IYQ A;  4EUZ A;  3IXH A;  3IS2 B;  4WEJ A;  1YPR A;  3MZD A;  1GHI A;  1MWT A;  1FR1 A;  5CED A;  1ES5 A;  3S7Q A;  5EV0 A;  1I2S A;  3A3E A;  3B3X A;  4II7 A;  3OCN A;  5HFO A;  5KZH A;  1EI5 A;  4LV0 A;  4KQR A;  2ZQ7 A;  4GHI B;  2W1R A;  4GNU A;  1XFQ A;  3UDF A;  3TE8 A;  4ZTK A;  4FUW A;  3AGE A;  3C7V A;  3UB5 P;  3ZNT A;  2A24 B;  3IXG A;  3QP6 A;  4ZJ2 A;  2OOL A;  3VP0 A;  2WKH A;  4WM9 A;  5FDS A;  4HBT A;  5DKK A;  2PU2 A;  3M2K A;  3N7W A;  1NYM A;  4KG5 A;  3S7P A;  4M4X A;  4X6T A;  3GTC A;  4PM6 A;  3FKW A;  3S4X A;  4JBF A;  1BYW A;  4MEZ A;  4GS9 A;  5DF9 A;  3V3S A;  4DJ3 A;  2G2W A;  3KSG A;  4K0W A;  4BMW A;  1BLH A;  3N8R A;  2V8F A;  3E4Q A;  4P85 A;  2XDM A;  1E3U A;  1Q2Q A;  5FQJ A;  1WYC A;  3OBF A;  1BZA A;  2ZQD A;  4HJ3 A;  4FD8 A;  2ZOH A;  2PHY A;  1YLJ A;  4EEU A;  2XD1 A;  1YM1 A;  4WMC D;  5AQ9 A;  1DJA A;  1KGG A;  5HAI A;  4PM8 A;  3ZNY A;  4OQ0 A;  5CGW A;  5HPI A;  1SHV A;  4UQI M;  1JVJ A;  4KZB A;  1T1A A;  1MBL A;  1L0F A;  1FCO A;  1XGJ A;  2VKS A;  5KSC A;  3TG9 A;  4F3L A;  4KZ4 A;  4EQI A;  1XA1 A;  2Q0O A;  1UWN X;  3R7W B;  1YT4 A;  4EBP A;  5HAQ A;  2ACG A;  3LFV A;  4JGP A;  2VGL M;  2WGI A;  3SS5 A;  2KOI A;  4ARZ B;  4A5R A;  5DKL A;  5E2E A;  4DKI A;  2JKF A;  2PYR A;  1YMS A;  3C30 A;  5EVI B;  4Y13 A;  5A8B A;  5IT5 A;  3IHB A;  1SDN A;  1XX2 A;  2XH9 A;  3N6I A;  4Z1W A;  5FI6 A;  5HDS A;  4HP4 A;  1S4S A;  4X55 A;  1I5Q A;  1S1Z A;  2PBD P;  4X69 A;  2D02 A;  3TW8 A;  1K56 D;  2CC1 A;  3LEZ A;  3OLO A;  4QY5 A;  4OQH A;  5DVA A;  2OSU A;  3CLO A;  4KQO A;  3JVU A;  5DF8 A;  4R3A A;  2HDU A;  4RVA A;  2OLU A;  2P7J A;  4BBT A;  5F82 A;  5LBR A;  3BQ8 A;  4LCM A;  1BLS A;  2L4R A;  1BLC A;  5M19 A;  3U4L P;  4KZA A;  2D01 A;  2K31 A;  3ITA A;  2OWH A;  4O0P A;  3Q1F A;  2XGN A;  3HUM A;  2X02 A;  3B47 A;  5L07 A;  4HES A;  3WS2 A;  3SS3 A;  1DRM A;  4RYE A;  1IOU A;  4BLM A;  1XGI A;  4AFI A;  3LYX A;  4BL3 A;  3H7W A;  4GB7 A;  3A0S A;  4DXB A;  5FAQ A;  1K25 A;  5DTT A;  5TJJ A;  2J9P A;  1P9R A;  4GDN A;  5F6A A;  3EGX C;  3FKV A;  1H5X A;  1C3B A;  1MWR A;  3ZDJ A;  4OQI A;  4EV4 A;  1ERO A;  1T1C A;  2RL3 A;  4GS9 B;  4L0L A;  1YMX A;  2ZC7 A;  4Y2F A;  3ICY A;  1NLY A;  1KE3 A;  3JVV A;  2V1Z A;  1NYY A;  5FI7 A;  5EOE A;  1KE0 A;  5HDD A;  1DJB A;  3VOY A;  1CI9 A;  1SKO A;  5GHZ A;  3Q81 A;  2W3G A;  4NEE D;  3IHA A;  4ESP A;  2QHK A;  2P74 A;  1DP9 A;  3ZVW A;  2XRN A;  3HL9 A;  4E6X A;  2A3U A;  2GJ3 A;  4WMC A;  3OPR A;  5F69 A;  1ZG6 A;  4Q8I A;  2Q9N A;  5IS1 A;  4BD0 A;  3GEC A;  2HP5 A;  2J80 A;  5A91 A;  1A0K A;  4ETZ A;  1W7F A;  3EGD C;  4EU0 A;  2M7V A;  3GV9 A;  5CGX A;  1LSX A;  1L0G A;  3EQU A;  4F3L B;  2V2F F;  4JXS A;  2ZMV A;  2Y2G A;  1SCW A;  1ES3 A;  1LHY A;  1GHM A;  1S67 L;  3CUE C;  3IF5 A;  5CEB A;  3CWF A;  4I3I A;  2H0Y A;  3PBN A;  2ZM0 A;  5J3W A;  4WN5 A;  3G31 A;  2WZZ A;  1M6K A;  4DDY A;  2CMN A;  4G3K A;  3EWK A;  5GLC A;  5DTS A;  3T4K A;  3HLC A;  2JBF A;  3DWK A;  1FSW A;  2UV0 E;  2PYP A;  4OPY A;  4EUV A;  5TR7 A;  5CTN A;  4M3K A;  3MKE A;  4IBX A;  2VX8 A;  1IEM A;  3T4J A;  3QP1 A;  2W0N A;  3IXB A;  4S2M A;  4FTX A;  4LRY C;  1W63 Q;  1YLT A;  2WAF A;  3SH8 A;  1K56 A;  4NG2 A;  4DF6 A;  2Y2M A;  4MLL A;  4S2J A;  2XR0 A;  1H8Y A;  1ACF A;  2VZW A;  1XPB A;  3RXW A;  3IH9 A;  4I38 A;  4KUO A;  2YKF A;  3CI6 A;  4LV1 A;  1LSV A;  1TS6 A;  1K4F A;  3T1R A;  4ZJ3 A;  2AVX A;  3O88 A;  5HD3 A;  3ZFZ A;  1DY6 A;  1HD8 A;  1TDL A;  2H10 A;  1FCM A;  2X71 A;  3H7W B;  1P97 A;  5HWT A;  5CER A;  4Z9Q A;  2DCF A;  1IKI A;  4KG6 A;  5GL9 A;  1ESI A;  1DP8 A;  2B5R A;  1TD5 A;  4QPR A;  5DJU A;  1GA0 A;  2WAD A;  2WAE A;  2XEP A;  4GW9 A;  2ZL1 A;  1F2K A;  1RP5 A;  2VJW A;  4X25 A;  3MF0 A;  2J7V A;  4JLF A;  2H0T A;  4WUJ A;  1U60 A;  2HDR A;  3GMW A;  3HVF A;  4UHU A;  5TFQ A;  4RX3 A;  3AGD A;  5DJT A;  1VM1 A;  3QNC A;  3UMD A;  2BAS A;  2JKR I;  4NET A;  3EOI A;  3D4F A;  4CJN A;  4B4Z A;  3WS5 A;  4IUK A;  1MKM A;  3MXS A;  3HLF A;  1SKF A;  4Y15 A;  4NXF A;  4KZ3 A;  1K55 A;  4GZB A;  4UAA A;  4EWF A;  4MN7 A;  2HP6 A;  2E8J A;  2JE5 A;  2WGV A;  3GRJ A;  3HLE A;  1HVB A;  2FH5 A;  3E4P A; 
#chains in the Genus database with same CATH homology
 1ES2 A;  1K38 A;  1ERM A;  3N8R A;  4RA7 A;  3MBZ A;  4PPR A;  4DRT A;  4P85 A;  3UE1 A;  3QNB A;  2XDM A;  5CXW A;  1E3U A;  1K54 A;  1Q2Q A;  2X01 A;  3GVB A;  5FSR A;  5FQJ A;  1NXY A;  3IF6 A;  4QHC A;  4R0Q A;  5CEC A;  3HBR A;  1WYC A;  1N9B A;  4H8R A;  4E3N A;  1BZA A;  1OME A;  4MNR A;  3ZG5 A;  1O07 A;  2ZQD A;  3ISG A;  2Q9M A;  5FAS A;  3V39 A;  4FD8 A;  4Y0U A;  3Q7V A;  2Y2O A;  2V20 A;  5IHV A;  1YLJ A;  2XD1 A;  1YM1 A;  3UE0 A;  3WS1 A;  1EWZ A;  5AQA A;  4WMC D;  5AQ9 A;  1K57 A;  5DF7 A;  1DJA A;  1K55 C;  1FOF A;  1KGG A;  1PW1 A;  2XK1 A;  2EX9 A;  5HAI A;  4OOY A;  5FI2 A;  4PM8 A;  1MKI A;  3SH9 A;  1FCN A;  5E2G A;  3ZNY A;  4IBR A;  4OQ0 A;  5CGW A;  1K6S A;  2R9X A;  4OOM A;  4S2L A;  3O87 A;  1SHV A;  2XLN A;  5KSH A;  5E43 A;  2J8Y A;  1JVJ A;  2ZM2 A;  4KZB A;  2P9V A;  3PAG A;  5FA7 A;  1MBL A;  1IYS A;  2E8I A;  3IXD A;  1L0F A;  1FCO A;  3A3J A;  1IYP A;  1FQG A;  4D2O A;  1XGJ A;  2Y2K A;  4R23 A;  3ITB A;  4N92 A;  1RGZ A;  1K54 C;  4XUZ A;  4K91 A;  2WZX A;  5KSC A;  3TG9 A;  1RGY A;  4O7D A;  1NY0 A;  3PBO A;  4KZ4 A;  4OP8 A;  2HPB A;  4EQI A;  1ONG A;  1XA1 A;  5AQ7 A;  1ZC2 A;  3Q07 A;  1FR6 A;  5I94 A;  3PBQ A;  4X56 A;  3TOI A;  3TSG A;  3EQV A;  4N1H A;  3VMA A;  3CJM A;  1BUE A;  5F1F A;  4UA9 A;  1YT4 A;  4EBP A;  3O3V A;  5HAQ A;  2Y59 A;  2WGI A;  4NK3 A;  3SS5 A;  1JTG A;  3HUO A;  4R3B A;  3VFH A;  2BG1 A;  1E25 A;  3QHY A;  1L0E A;  4A5R A;  2WGW A;  5E2E A;  4DKI A;  3HLD A;  3ZG9 B;  1E4D A;  4KZ5 A;  4OQG A;  1YMS A;  2ZQC A;  5EVI B;  5D3O A;  1KDS A;  3RJU A;  2IWB A;  4XUX A;  1VQQ A;  3IHB A;  4LCL A;  3GQZ A;  3UPP A;  4R4S A;  4S2K A;  1LL9 A;  2ZQ8 A;  1SDN A;  1XX2 A;  1YLZ A;  5CTM A;  2ZC6 B;  2XH9 A;  4ID4 A;  3HRE A;  4FH4 A;  4CPK A;  3P09 A;  4OPQ A;  4P87 A;  3N6I A;  5FI6 A;  4OPR A;  1XP4 A;  1J9M A;  3A3D A;  1QME A;  3FZC A;  3IH8 A;  1LLB A;  4MBK A;  4IED A;  4X55 A;  1I5Q A;  1BSG A;  4EBN A;  1MXO A;  4X69 A;  2Y2Q A;  3UDI A;  1K56 D;  2CC1 A;  3LEZ A;  4QY5 A;  3VSL A;  4OQH A;  5DVA A;  4OOL A;  4BL2 A;  2OSU A;  1RCJ A;  2Y2L A;  5E2F A;  4BQM A;  4KQO A;  1GCE A;  4QJG A;  2BLS A;  2EX2 A;  2FFY A;  1L0D A;  3LY3 A;  5DF8 A;  3S1Y A;  5JYP A;  3UPO A;  2HDU A;  1G6A A;  4RVA A;  2OLU A;  5F82 A;  4X53 A;  3UDX A;  1YQS A;  1MWS A;  1W5D A;  3M6H A;  2HDQ A;  1WYB A;  1KGE A;  4LCM A;  1BLS A;  2WGW B;  4S2O A;  5AQB A;  5EVI D;  2WYX A;  4GD8 A;  3HLW A;  1BLC A;  4BD1 A;  3RXX A;  5M19 A;  4N1X A;  4OP5 A;  1LI0 A;  4KZA A;  5GHX A;  2Y2J A;  1K6R A;  2EFU A;  3ITA A;  2ZC4 B;  3Q1F A;  4E3L A;  3ZCZ A;  2XGN A;  3HUM A;  3NDE A;  4LEN A;  2X02 A;  4S2P A;  1HZO A;  1IEL A;  3NBL A;  4OON A;  3V50 A;  2C5W B;  4OLG A;  4HES A;  3WS2 A;  5F1G A;  3SS3 A;  1PZO A;  4MBF A;  5GHY A;  2XFT A;  4RYE A;  4Y0O A;  3M6B A;  3LY4 A;  4BLM A;  3NIA A;  4ZBE A;  5G18 A;  1XGI A;  1TDG A;  3IWQ A;  2OLV A;  4JF5 A;  2WKE A;  4BL3 A;  4GB7 A;  5U47 A;  1HTZ A;  4DXB A;  5FAQ A;  1K25 A;  4JPM A;  5M1A A;  5DTT A;  4DXC A;  5KMW A;  2J9P A;  4E3J A;  4X68 A;  3BLM A;  3DWZ A;  1W8Y A;  4GDN A;  1KVL A;  5EUA A;  3W4P A;  4DE3 A;  1PW8 A;  4GOG A;  3FKV A;  3DTM A;  1O7E A;  3E2K A;  4QD4 A;  1H5X A;  1C3B A;  3NY4 A;  1NRF A;  3NDG A;  3C4O A;  1MWR A;  3OPL A;  5FAO A;  1YLP A;  3ZDJ A;  3VOZ A;  1YLW A;  4OQI A;  1IKG A;  3BFG A;  5L2F A;  4EV4 A;  2PU4 A;  1ERO A;  5FAP A;  3PBR A;  2RL3 A;  5M18 A;  4KG2 A;  5CHJ A;  2QZ6 A;  3IWO A;  5FQQ A;  3MKF A;  4L0L A;  4WZ4 A;  2ZJ9 A;  3JYI A;  1YMX A;  2ZC7 A;  4C6Y A;  3A3F A;  1L2S A;  1CEF A;  1PZP A;  5FQ9 A;  2WKI A;  1KE3 A;  1KGF A;  4KEN B;  2Y91 A;  2WUQ A;  2G2U A;  2V1Z A;  1NYY A;  3I7J A;  1Z6F A;  3G2Z A;  3IWI A;  4GDB A;  5CRF A;  5EOE A;  5FI7 A;  1KVM A;  1KE0 A;  5FQI A;  1DJB A;  5A93 A;  4KZ7 A;  2XFS A;  4ZJ1 A;  3IF6 B;  3VOY A;  3WRZ A;  1CI9 A;  4E6W A;  4KZ8 A;  2EFX A;  3HLB A;  3VP3 A;  5GHZ A;  2Z2M B;  3FWL A;  1CEG A;  3E2L A;  3G30 A;  3Q81 A;  2OV5 A;  4ZAM A;  3WRT A;  3IHA A;  3VP2 A;  4RX2 A;  3UO9 A;  3IT9 A;  3Q7V B;  2P74 A;  2ZM8 A;  3ZVW A;  2Y55 A;  4N9K A;  3C5A A;  4C3Q A;  2Y4A A;  1XXM A;  3HL9 A;  3VSK A;  4WEK A;  1GA9 A;  2HP9 A;  4KZ9 A;  3ZG0 A;  4DE1 A;  4JXW A;  4E6X A;  2A3U A;  5FAT A;  2EXA A;  4JXG A;  4WMC A;  4HBU A;  5EVL A;  3OPR A;  4KQQ A;  1PI5 A;  2VGJ A;  3G4P A;  2ZMA A;  1ZG6 A;  3WWX A;  4Q8I A;  5CHM A;  2Q9N A;  4F94 A;  4BD0 A;  2DRW A;  2Z2L B;  3LO7 A;  5EVI C;  1LI9 A;  2HDS A;  2HP5 A;  5A91 A;  4UA7 A;  1W7F A;  4ZDX A;  3ZG7 B;  5HAR A;  1ONH A;  2P9V B;  4QY6 A;  4PM9 A;  4LV3 A;  3SS4 A;  1AXB A;  3GV9 A;  4R4R A;  5FDH A;  5CGX A;  2XD5 A;  5GLA A;  3ZG8 B;  1L0G A;  1E3U D;  3W8K A;  3EQU A;  1Q2P A;  5E2H A;  3PBT A;  1BT5 A;  2V2F F;  4JXS A;  2I72 A;  1PI4 A;  1ES3 A;  1SCW A;  2Y2G A;  3NCK A;  5HL1 A;  1LHY A;  4GD6 A;  1GHM A;  4OVD A;  1PWC A;  5FQM A;  3UY6 A;  4EBL A;  2Y2P A;  3IF5 A;  3W4Q A;  4DDS A;  3ZHH A;  5CEB A;  2H0Y A;  5EPH A;  1PWD A;  3PBN A;  2ZM0 A;  4FSF A;  2A49 A;  3V5M A;  5CHU A;  3G31 A;  3BFE A;  4HEF A;  4JF6 A;  4OKP A;  2WZZ A;  1M6K A;  4WBG A;  5CGS A;  4BJP A;  4DDY A;  3O86 A;  3HUN A;  4JXV A;  1K4E A;  4QB8 A;  5GLC A;  3OCL A;  5DTS A;  1TVF A;  3AGF A;  2JBF A;  3HLC A;  2GDN A;  3DWK A;  3SOI A;  1FSW A;  1PIO A;  3OC2 A;  2ZQA A;  3CMZ A;  2Y2H A;  4Y0T A;  4OPY A;  3UN7 A;  1XKZ A;  3VP4 A;  2EXB A;  4U3T A;  1CI8 A;  5TR7 A;  3UPN A;  5CTN A;  4M3K A;  3MKE A;  1W8Q A;  4IBX A;  3ZVT A;  2VGK A;  4C75 A;  1IEM A;  1MPL A;  2XQZ A;  3MFD A;  3NI9 A;  3P98 A;  4U0T A;  3VP1 A;  1NJ4 A;  3N8S A;  3IXB A;  2Y2I A;  3WS4 A;  5BOH A;  1TEM A;  1JTD A;  3G35 A;  4E3O A;  3C4P A;  3V3R A;  4S2M A;  4DE2 A;  1KE4 A;  4P0M A;  1N4O A;  1DJC A;  3G2Y A;  3PAE A;  1YLT A;  2C6W B;  1CK3 A;  2RCX A;  2WAF A;  3SH8 A;  3BLS A;  1K56 A;  3MZF A;  3CG5 A;  4KZ6 A;  4DF6 A;  2Y2M A;  1JWZ A;  4MLL A;  4S2J A;  4K0X A;  3MXR A;  5A92 A;  3SH7 A;  4YIN A;  2XR0 A;  4E3I A;  1H8Z A;  1M40 A;  5F83 A;  5HW3 A;  1H8Y A;  1KDW A;  3OZH A;  1WE4 A;  1MY8 A;  4OLD A;  1BUL A;  4UA6 A;  2DNS A;  1LL5 A;  5HX9 A;  3GR2 A;  1XPB A;  4E3M A;  3G32 A;  4WZ5 A;  3RXW A;  4JKT A;  4Y7P A;  3IH9 A;  4B88 A;  3NC8 A;  3FYZ A;  3VFF A;  3BFF A;  5EVI A;  4N9L A;  3A3I A;  1IYO A;  3S22 A;  2QPN A;  1PYY A;  2UWX A;  5FQK A;  1SDE A;  4LV1 A;  2QMI A;  3PTE A;  4YFM A;  2PBY A;  3PBS A;  4S2I A;  1W79 A;  1S0W A;  2H5S A;  3Q82 A;  4OPZ A;  1K4F A;  3UE3 A;  4DE0 A;  2R9W A;  2ZQ9 A;  4ZJ3 A;  5GLD A;  5TGF A;  4JF4 A;  3O88 A;  3W4O A;  5J8X A;  3N8L A;  1QMF A;  3ZFZ A;  1GHP A;  3CZD A;  1DY6 A;  1HD8 A;  1TDL A;  2H10 A;  3MZE A;  1MWU A;  1FCM A;  2X71 A;  3OPP A;  4PM7 A;  2IWC A;  5CER A;  4PMA A;  3IF6 C;  4WEL A;  4Z9Q A;  3GSG A;  3BEB A;  2JCH A;  2DCF A;  2ZD8 A;  1ALQ A;  1IKI A;  1I2W A;  1YLY A;  1JWP A;  4KG6 A;  4WYY A;  5GL9 A;  4R1G A;  1ESI A;  1NZU A;  2EX6 A;  4XXR A;  2JC7 A;  4E3K A;  2B5R A;  3BYD A;  4WZ5 C;  3G34 A;  4LV2 A;  4MBH A;  1GA0 A;  1K57 C;  2WAD A;  1PWG A;  1Y54 A;  2WAE A;  3N4I A;  5DTK A;  3IQA A;  2XEP A;  4GKU A;  4OH0 A;  3BFC A;  5GLB A;  3C7U A;  3UNW A;  2XF3 A;  4B4X A;  1IYQ A;  3LCE A;  1RP5 A;  4EUZ A;  3IXH A;  4WEJ A;  3MZD A;  2J9O A;  1GHI A;  1ZKJ A;  1MWT A;  3BRM A;  2J7V A;  1FR1 A;  2ZC3 B;  4U0X A;  5CED A;  1ES5 A;  4JLF A;  5A90 A;  2H0T A;  3DW0 A;  4S2N A;  4IVK A;  4IVI A;  3WS0 A;  1U60 A;  2HDR A;  3GMW A;  3BM6 A;  1ESU A;  1I2S A;  3A3E A;  3B3X A;  3HVF A;  3OCN A;  4UHU A;  4RX3 A;  3AGD A;  4GN2 A;  3OPH A;  5HFO A;  5TFQ A;  5KZH A;  1EI5 A;  2ZC5 B;  1ZG4 A;  1VM1 A;  2ZLY A;  4FH2 A;  4KQR A;  4LV0 A;  4BEN A;  3QNC A;  3M2J A;  2EX8 A;  2ZQ7 A;  4FCF A;  1XA7 A;  4NET A;  3D4F A;  5JYO A;  4CJN A;  1NZO A;  3HLG A;  4GNU A;  4R3J A;  1ES4 A;  3UDF A;  3BFD A;  5EEC A;  4B4Z A;  4QU3 A;  4ZTK A;  3WS5 A;  3AGE A;  5EOO A;  3C7V A;  1BTL A;  1FSY A;  1S6R A;  1BLP A;  3ZGA B;  3ZNT A;  3IXG A;  3MXS A;  3HLF A;  4ZJ2 A;  3FV7 A;  1SKF A;  3VP0 A;  2WKH A;  4WM9 A;  3Q7Z A;  4HBT A;  2PU2 A;  3M2K A;  4KZ3 A;  5HAP A;  3BEC A;  2IWD A;  1NYM A;  3N7W A;  4KG5 A;  1G68 A;  4P6B A;  1K55 A;  1JWV A;  3GTC A;  4PM6 A;  4GZB A;  3FKW A;  4UAA A;  4X6T A;  3S4X A;  4EWF A;  4JBF A;  2HP6 A;  4MEZ A;  4PM5 A;  2JE5 A;  5DF9 A;  3V3S A;  1ERQ A;  2WGV A;  3GRJ A;  2FFF B;  3HLE A;  2G2W A;  2WK0 A;  4K0W A;  1HVB A;  4S2N C;  2Y2N A;  5EE8 A;  1BLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...