3MXQA

Crystal structure of sensory box sensor histidine kinase from vibrio cholerae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
126
Chain Sequence
FQSNAMAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETMQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPFEQMYQNLEVIPIHSEDGTIEHVCLCVYDVTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title Crystal structure of sensory box sensor histidine kinase from Vibrio cholerae
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 33
structure length 126
sequence length 136
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mxqA00
4GHIA 4HP4A 4L9GA 2BASA 1OT9A 3NOUC 1UGUA 4L9FA 2VEAA 4BBVA 3NOTC 3K3CA 1LSWA 1T1BA 2D02A 4R3AA 2VV6A 3BY8A 5G4YA 5KIZA 3H7WA 2J80A 4I3IA 3LIAA 2VLGA 4R6LA 3LUQA 1OT6A 2ZOHA 5IU1A 3IS2B 3E4PA 3A0RA 1TS8A 2WKPA 3E4OA 1T19A 4XT2B 2VV7A 2W0NA 5TBMB 1LT0A 4BBTA 2PD7A 1DRMA 3C2WA 4HP9A 1XFQA 5AVEA 3FC7A 3UMDA 3H82A 3LYXA 2YKFA 1OTEA 1XJ2A 3F1NA 1UWPX 2QWSA 4NXGA 3VE4A 2Z6DA 3MQOA 4JGOA 1OTDA 3GDIA 3IBRA 4R70A 3ICYA 3CLOA 3SW1A 4EXOA 1OJGA 5I5LA 1S4SA 5DJUA 4YWZA 4I5SA 4EEUA 5AVFA 3LI9A 1T1AA 4R38A 5HDCA 2W27A 4HH2A 3NOPC 5IS1A 2L1MA 3A0VA 3F1OA 1S1ZA 2V1AA 3LIDA 3MQQA 3MJQA 1N9OA 1T18A 3UB7A 4LPZA 2PDRA 5HDSA 4KUOA 3PYPA 5HSQA 1MZUA 3UB6A 3RTYA 3GECA 3ZQ5A 4HJ6A 3KX0X 2WKRA 4JGPA 2B02A 2CMNA 1D7EA 2L4RA 2ZBBA 5HZHA 3MFXA 2QJ5A 1WA9A 1V9ZA 2OWHA 2PD8A 3HJKA 4NXEA 3IS2A 5HD3A 5DKKA 5HWTA 1D06A 3D72A 4MN5A 1S1YA 4HOIA 2INWA 4XT2A 4KQDA 4H6JB 5TBMA 4HJ3A 2JHEA 1XJ4A 4H6JA 2V9AA 3C8CA 2PR5A 3UMEA 1NWZA 5HWVA 4PKYG 1XJ3A 4I39A 1X0OA 3UB9A 3UE6A 1S4RA 2I9VA 3NJAA 2EA9A 2YKHA 1ODVA 3BY9A 3MR0A 1S67L 2OWJA 2QKPA 5F5YA 3EEHA 4MN6A 3LIFA 1BYWA 3LICA 3BWLA 4WLAA 1LL8A 2H28A 4LLOB 1P0ZA 1V9YA 3G6OA 3ULFA 2HV1A 4DJ3A 4BBUA 5F68A 2R78A 4JGQA 1TS7A 2L0WA 3T50A 4B9OA 3EWKA 3PHYA 3F1PB 1UWNX 3VE3A 4HQAA 3VOLA 2PR6A 2P7JA 2QHKA 3F1PA 3LIEA 2QJ7A 4HIAA 4GW9A 5HD5A 4HI4A 4HH3A 4K08A 2PHYA 4JGRA 1N9LA 4LRXC 4DJ2A 3UB8A 2D01A 2JN7A 2ZOIA 3OLOA 5G4ZA 3H7WB 1GSVA 4L9EA 3CWFA 1T1CA 5EFWA 4HY8A 4LRYC 3CAXA 4M4XA 1S66L 2V0UA 1GSWA 4EW7A 4WUJA 4EQ1A 2WKQA 4E04A 4GCZA 3NHQA 3RH8B 4KUKA 1OTBA 1KOUA 4EERA 5A8BA 4F3LB 3LIBA 1EW0A 3FG8A 1LSVA 4I3AA 2A24B 4HNBA 4I3JA 4NXBA 2K7SA 2KDKA 3H82B 3HJIA 1TS0A 3E4QA 4F3LA 5F6AA 1LSXA 5HDDA 5DJTA 4EEPA 2A24A 2GJ3A 5DKLA 3F1NB 2PYPA 1VB6A 4LRZE 4EESA 4EETB 5F69A 3P7NA 1F98A 1TS6A 4HJ4A 1XJ6A 4WF0A 1P97A 2V0WA 3K3DA 2V1BA 4GS9B 5J4EA 1G28A 2KX6A 3MXQA 2VV8A 4I38A 4WL9A 1OJ5A 4RQ9A 4GS9A 5J3WA 4NXFA 1F9IA 1DP6A 5HWWA 4WN5A 1JNUA 1XFNA 2M1CA 3LI8A 5J7EA 1GSXA 1DP9A 4HHDA 3B33A 1Y28A 1DP8A 2PYRA 4GHIB 1N9NA 2Z6CA 3H9WA 2OOLA 4PKYA 1OTAA 1OTIA 3F1OB 3A0SA
chains in the Genus database with same CATH superfamily
3KSGA 3IH8A 5CERA 2HDRA 3PXPA 3WS4A 1AXBA 4WEJA 3BLMA 1OT9A 3NOUC 1AWIA 4FUWA 5CEBA 1FR6A 3DTMA 3D3OA 1JTGA 1D1JA 4ETZA 4BBVA 5EVID 3LY3A 2B18A 1YLTA 1VHMA 1LSWA 4OPZA 1TVFA 1CI8A 4I3IA 4LCMA 1SHVA 3HUOA 2XH9A 2W1RA 4G3WA 2A49A 4S2LA 3DTIA 1FSYA 5EUAA 2HJ9C 4BENA 5HAQA 3FKVA 1TS8A 1RP5A 2EXAA 4RYEA 3UB5P 3ZFZA 1FCOA 1ZKJA 4QWOA 2VV7A 3VFFA 5BOHA 2B95A 5CEDA 5TBMB 5TGFA 4GLQA 2Z2LB 2PD7A 4S2OA 1RGYA 5AVEA 5L8MA 1LLBA 4UA9A 3FC7A 4E3LA 4OQGA 2PT7A 5FQKA 2VGLM 3G31A 5FI2A 1OTEA 1XJ2A 1UWPX 2ZC4B 3N7WA 3UPNA 4OH0A 5DF8A 2HDUA 3BECA 3VE4A 2RCXA 3EGXC 4B4XA 4FSFA 3T4KA 1GHMA 1YSQA 1OTDA 5AQ9A 4NKPA 5IHVA 4N9LA 3IBRA 4IHQA 3ZYTA 3IF6C 1IELA 5MC7A 2EFXA 3MS6A 1F2KA 2FFYA 1JWPA 4Y7PA 4P6ZM 2Y2NA 1RGZA 1T1AA 5HDCA 1O07A 4OP5A 3IH9A 2W27A 4HH2A 1YAXA 3OBFA 3NBLA 2FFFB 5IS1A 1MWRA 5K5BA 3A0VA 3OZHA 3B3XA 5D3OA 3V50A 2V1AA 5EOEA 3IX8A 4X6TA 2H10A 1K54C 3MQQA 5L09A 3FYZA 1G5UA 1N9OA 4R1GA 3TG9A 4OOYA 3T1QB 2Y2OA 4LPZA 2PDRA 1H8MA 4KUOA 1YQSA 3UB6A 3RTYA 3ZQ5A 3KX0X 2Y55A 4JGPA 3WS1A 1D7EA 4PMAA 2QJ5A 3S7OA 5FI6A 4IBRA 4N1HA 4LV2A 3QP6A 5M1AA 3OPHA 3PAGA 2DNSA 1Z6FA 5U47A 2G2WA 2XR0A 4WMCA 1H8YA 2O9AA 1PNEA 2INWA 4XT2A 1CF0A 3V39A 3NULA 3NI9A 1FR1A 3IF6B 2C6WB 3C8CA 1K38A 1NRJA 1K6SA 3GMWA 4K0WA 3SS4A 1ZG4A 2V8CA 1L3LA 1CI9A 2P08A 3PBNA 4GN2A 4ARZA 5CX7A 5TR7A 1HZOA 3QP4A 4IBXA 4NETA 3HUNA 3SZTA 5LBRA 3UB9A 3UE6A 4S2MA 2I9VA 3NJAA 4DE1A 3LR5A 1PIOA 4Y0OA 3BM6A 3V3RA 1S67L 3ZNTA 1HVBA 4FOFA 1MWTA 4PM6A 3O88A 3CHWP 3EEHA 2Y2PA 1BYWA 1NLYA 3LICA 4WLAA 5E2EA 3VMAA 4LLOB 1P0ZA 1SKOA 3OC2A 2ZC5B 2HDQA 2HV1A 4HBUA 5A92A 4OKPA 1TS7A 5FDSA 2L0WA 3T50A 3EWKA 4E3JA 1VETB 1QMEA 3PBQA 3Q1FA 2O9BA 3VE3A 3OPPA 1BT5A 5JYPA 2P7JA 3IXDA 1OPXA 2VGKA 4EQIA 4OPYA 2O0YA 5CGSA 4IEDA 4HIAA 4GW9A 3OCLA 1EI5A 5HPIA 4EUVA 1J9MA 5TJJA 2Y2LA 1NJ4A 2ZQCA 2KOIA 2JN7A 3HUMA 1FSWA 5CRFA 2GNXA 3HREA 3H7WB 3N4IA 3OCNA 3Q7VB 1T1CA 5EFWA 4UA6A 5G18A 4WZ5C 3T4OA 2Y79A 4Z9QA 3S1YA 3TW8A 3CAXA 1Q2QA 1LL9A 3GV9A 3ZVWA 4E3MA 3HLBA 4WUJA 1YM1A 4EQ1A 2JKTI 3BJNA 1YLZA 4UEYA 3LO7A 3SS5A 3TRCA 4LV0A 2HP9A 5EE8A 4F3LB 4MNRA 1TEMA 3FG8A 1MPLA 3MQ0A 1YMSA 2PU4A 4I3JA 2EWVA 5FATA 1VEUA 5E2FA 1YLPA 5GL9A 3IBJA 1YPRA 2GJ3A 4EEPA 3F1NB 3CZDA 4B4ZA 4OLDA 3GR2A 5AJGA 4N92A 2Q9MA 5HX9A 2EX6A 2MJ6A 4LRZE 1SCWA 1VB6A 4IVKA 5EV0A 1ESUA 2J7VA 3IXBA 3M6BA 1BUEA 3FZCA 4X55A 1MWSA 1E3UD 5HL6A 1L0FA 1G28A 1ESIA 1YMXA 3V67A 5CHMA 1LHYA 1OJ5A 2GX5A 1XA7A 4IUHA 1IKGA 1S0WA 2ZMFA 4O01A 4KENB 4R3BA 4S2KA 3PBSA 1F9IA 3E98A 4OQIA 2WAFA 4QB8A 1JNUA 2LB5A 5IT5A 3OPLA 2W1TB 3HBRA 3U4LP 3FPVA 4MDZA 5KZHA 3RXXA 2ZQ9A 1GHIA 3HLWA 2PYRA 3DTEA 3UE1A 2CC1A 4ETXA 1OTAA 3F1OB 5EM1A 3VP3A 3A0SA 3T4JA 1VM1A 4MBHA 4GHIA 4EWFA 3WS0A 5CGWA 2PBDP 1YLJA 4Y17A 3IXHA 5EVIA 2BASA 1IYPA 1UGUA 4L9FA 3BFEA 3PBRA 1NZOA 2VEAA 1PZOA 2PRFA 4HESA 3K3CA 3NDGA 4LCLA 2VV6A 2VGJA 3LY4A 3NC8A 2VLGA 2NUPC 2ZOHA 5IU1A 3L9KA 2ZD8A 3N8RA 2H0TA 2HGVA 4GJ4A 3E4OA 5A90A 4M3KA 1KDWA 1ZG6A 3BFCA 2WGWB 1H0MA 3BRMA 4PPRA 2OV5A 3UE0A 5DFXA 1YLWA 1MY8A 1FIKA 3C2WA 2J9OA 1HLUP 4MBFA 3MZDA 4MCWA 1QMFA 4P6BA 3H82A 3PBOA 4CPKA 2X01A 4NG2A 2YKFA 2UV0E 1G68A 2OLVA 4NXGA 3Q82A 5HPFA 1YT4A 4GNUA 1I2SA 3NY4A 4JF4A 2Y2JA 4C3QA 4Y0UA 3GDIA 1YLYA 5AQAA 4GOGA 4R70A 4CQHA 3ICYA 2JKFA 2OLUA 4PM5A 1OMEA 1MKMA 4MEZA 3P98A 4KZ7A 1FOFA 3I7JA 5I5LA 1XX2A 1S4SA 4X68A 1Y4OA 1U60A 2X71A 5DJUA 1E25A 3FV7A 4X1MA 2PAVP 5AVFA 5DF7A 4D2OA 4PAUA 4QY6A 2W3GA 2Q9NA 3ISGA 1ZC2A 4OPQA 1KE4A 2Z2MB 2L1MA 3WRTA 4NEED 4EUZA 3IQAA 3MJQA 4XXRA 5J8XA 1T18A 3B42A 3P01A 3T1RA 3C4OA 1L0EA 2J3TD 3GECA 1IEMA 4BD0A 2EWWA 4K0XA 2B02A 2CMNA 4P6ZS 1FCMA 2L4RA 3NDEA 1ONHA 2P9VB 1VQQA 5GHZA 1K56D 1WA9A 2QMIA 4DKIA 3EQVA 3HJKA 3RJUA 4UHUA 2Y2MA 3IS2A 2B5RA 2OSUA 4KZAA 3T4SA 3D72A 1S1YA 4HOIA 3S7QA 1TD5A 4KQDA 2WUQA 4WEKA 5M19A 2LB9A 2JHEA 4E3NA 3ITAA 1NYYA 1XJ4A 2ZL1B 4KQQA 2Y2GA 2V9AA 3N6IA 2PR5A 4FH4A 4S2IA 3ZDJA 5HWVA 2E8IA 1W63Q 4FD8A 5FI7A 4ZTKA 1XJ3A 4I39A 2H0YA 2HP6A 4UQIM 3MKFA 2Y2IA 1X0OA 1KE0A 1ODVA 3BY9A 4A5RA 1DJAA 1Z09A 2VKSA 5F5YA 3Q07A 2QYBA 5GHYA 2WGVA 2NUTC 3C5AA 3GQZA 5HAPA 2Y4AA 2EFUA 4MN6A 1MC0A 3VV4A 3O3VA 3CUEA 2R9XA 1Q2PA 3IX4A 2XDMA 1K54A 3DTKA 4MLLA 5FSRA 4Y0TA 1KGFA 4LV3A 3IF5A 4JGQA 3UDIA 3F1PB 4LFUA 2JC7A 3VOLA 1K25A 1FQGA 4O0PA 2QHKA 1W63M 2WKHA 1BSGA 4GZBA 1WE4A 3W8KA 1W79A 4BWIA 1N9LA 5FAPA 3UB8A 4KG2A 2ZOIA 3EEAA 3OLOA 2IWCA 3V3SA 4KZBA 1ACFA 2ZMAA 1IYSA 4L9EA 4BJPA 3IT9A 1XP4A 4QJGA 3W4QA 5AQ7A 4RVAA 4LRYC 4N9KA 4M4XA 1S66L 1BLHA 4EW7A 3CI6A 3NHQA 1LL5A 3TE8A 1KGGA 4KUKA 3ZG5A 1OTBA 2VA0A 4OOMA 3VSKA 4JXSA 3HLGA 4RA7A 3BFFA 2XLNA 3LIBA 3ZNYA 3QHYA 5EOOA 4MN7A 1CEGA 5HW3A 1PFLA 2VJWA 4K91A 4HNBA 3VP1A 1TS0A 2JKTM 1PRQA 4F3LA 3LEZA 3HLCA 1F5MA 5DJTA 4S2NA 4GB7A 5DKLA 5DVAA 5CXWA 5DTSA 1E3UA 2Q0OA 4ZJ1A 3VP0A 2PYPA 4BQMA 1BLCA 5F69A 4R23A 2XROA 4OVDA 1M6KA 1XJ6A 2V0WA 3G35A 5AQBA 5J4EA 4ZJ3A 3O5YA 3GVBA 4QY5A 1IOUA 3MXQA 4BL3A 1NY0A 2ZMVA 5CTNA 3A3FA 5GHXA 4JXWA 2JCHA 5HWWA 4WN5A 1K55A 4L0LA 1XPBA 3G2YA 4XUZA 2FH5A 4E3KA 3H9WA 3HL9A 4YNRA 1K57A 2P04A 3CPTA 4QU3A 4KZ9A 1GHPA 4HP4A 3S22A 2EX9A 3T4TA 4UA7A 4PM7A 2JKRM 1MKIA 1GA0A 4OLGA 2G2UA 3LEQA 1GA9A 5EM0A 3WWXA 4OQHA 2OAQ1 3HLEA 1ALQA 2Y59A 3IHAA 5GLAA 5CECA 4G3KA 2HPBA 1ES3A 1T1BA 2D02A 3D9YA 4Z1WA 3BY8A 1FCNA 5KIZA 2J80A 1KVLA 2W3FA 3IWOA 3LIAA 4DF6A 1JTDA 1HD8A 1OT6A 4PM8A 4IJGA 4DXCA 4KG6A 3A0RA 4ESPA 2WKPA 2Y2QA 1T19A 1PZPA 2K31A 3FWLA 3VP2A 4XT2B 5KSCA 3SH7A 3AGEA 1LT0A 1PWGA 4BBTA 2A3UA 1W7FA 3KSHA 2I72A 1WYBA 4EBLA 4CLCC 3C30A 5FAQA 1KGEA 4Q0JA 3KYEA 2WGWA 4Y3IA 4X25A 4O8GA 2ZM8A 3VOYA 5L07A 1XXMA 1TDGA 2XK1A 4ARZB 1ERQA 2H5SA 3N8SA 3AGFA 2AVXA 4DXBA 5HARA 5FAOA 4JGOA 1S6RA 2HZ5A 2BG1A 4CJNA 4RX3A 3CLOA 3SW1A 2DRWA 3LFVA 2ZM2A 4EXOA 1ZTUA 2JE5A 4U3TA 1SKOB 3ZCZA 4OQ0A 4EEUA 2Y91A 2ZM0A 1NZUA 3BFGA 3R7WA 5HAIA 5F83A 3KYQA 1CQAA 2V1ZA 3LGOA 5HL1A 2PBYA 4BL2A 3IWQA 5F1FA 4B88A 1PW1A 1YSPA 5JYOA 1ERMA 3CJMA 4O7DA 1KDSA 1E4DA 5L10A 4WBGA 4ZRRA 1BTLA 2OAP1 3CG5A 3UB7A 4KZ5A 3G34A 1BLPA 4FTXA 3PYPA 5HSQA 4DRTA 1K56A 2M7UA 4CLCB 5GLDA 3V5MA 3T1SA 3U2AA 2ZBBA 3SH8A 3IXGA 3MFXA 2WAEA 5EVIC 4BMWA 2OWHA 2ACGA 4U0XA 4NXEA 5HD3A 5DKKA 2EXBA 1D06A 4WYYA 3L7HA 3K2NA 4NK3A 4II7A 1JWZA 3FPWA 2WZZA 4H6JB 4C6YA 1N9BA 1IYQA 5TBMA 3E2LA 1KE3A 4YOFA 3SOIA 2XA7M 3BQAA 4F94A 1ONGA 3Q7ZA 4ZAMA 1ES2A 3UMEA 2ZL1A 4U0TA 2WKEA 4DMZA 5FQJA 1PW8A 4GDNA 4D60A 4PKYG 4KZ3A 2O9CA 5DF9A 2WK0A 1S4RA 2DCFA 3E2KA 1IYOA 2WADA 3MSHA 3PR6A 3MR0A 3JVUA 2OWJA 2QKPA 3VOZA 3S7PA 1TDLA 1SZVA 3LIFA 2VGLS 4X56A 3PAEA 3BWLA 4JLFA 1XGJA 2WZXA 1V9YA 3PTEA 4E3IA 1XKZA 1PI4A 4DJ3A 2EX2A 4EV4A 2R78A 1CJFA 3FKWA 4OPRA 1C3BA 1UWNX 4IUKA 2W3HA 4JF5A 2EX8A 4YINA 3ZG0A 2Y2HA 3IWIA 2ZC3B 5EVIB 3MZFA 1PWCA 2XEPA 3F1PA 3LIEA 1CK3A 4DN0A 2QJ7A 5HD5A 2V2FF 4HI4A 5E43A 4HH3A 4K08A 5TFQA 2W3EA 4DJ2A 2WKIA 2D01A 3CITA 5G4ZA 3MZEA 1ES4A 5FQQA 2GZAA 5CGXA 5GLCA 1PWDA 3ZG7B 3OOVA 3CWFA 1NLZA 4KZ6A 1J3WA 2P74A 2ZJ9A 2XD1A 1GSWA 5F1GA 4E6WA 4E04A 3ZG8B 4GCZA 2JKGA 5A93A 3RH8B 3MFDA 4EERA 5A8BA 2Y2KA 1LSVA 4I3AA 2A24B 2HP5A 4NXBA 2K7SA 2KDKA 3H82B 3WS2A 1G6AA 5M18A 2J9PA 1JVJA 4ME4A 4H8RA 5FEGA 2WGIA 4LENA 3IF6A 4QPRA 4R0QA 5I94A 4E3OA 2ZQAA 4DDYA 1HTZA 3W2ZA 4OONA 4HJ4A 4WF0A 3KSIA 3K3DA 4XUXA 5CHUA 4GS9B 2KX6A 2ZQDA 3GRJA 2VV8A 1Y54A 4I38A 4WL9A 5J3WA 2VX8A 3S4XA 5FA7A 3WRZA 4HEFA 2J3WA 1TF1A 4MBKA 1LI9A 1GCEA 3UE3A 2IWDA 3N8LA 2DMWA 2J8YA 3LI8A 4CLCE 1XGIA 5J7EA 3NCKA 1DP9A 4EBNA 1W8YA 4DE0A 2M7VA 1N9NA 3DWKA 4QHCA 3UPPA 3KSFA 3Q81A 1VETA 4S2JA 1K0KA 1MWUA 4Y2FA 1W5DA 4P0MA 1EROA 4L9GA 3CUEC 1NYMA 4GD6A 3UNWA 4FCFA 4Y15A 2ZC6B 1WYCA 3UPOA 4OOLA 2KLIA 3NOTC 3TJZC 3SS3A 3P09A 4R3AA 5DTTA 2WYXA 5G4YA 3H7WA 3VSLA 5FASA 3T1XA 4R6LA 3LUQA 3B47A 3Q7VA 5C5KA 2X02A 4Y13A 3IS2B 3E4PA 3NIAA 3T4QA 2V20A 5EPHA 3LCEA 2G7UA 3DBAA 2BTFP 2XQZA 2W0NA 2XFTA 4PHTA 4YFMA 2ZQ7A 1DRMA 5F82A 4HP9A 1XFQA 3QNCA 3G4PA 3UMDA 3QNBA 3VP4A 4C75A 3LYXA 3C38A 4HBTA 4BD1A 3A3EA 2XFSA 3F1NA 3A3IA 2FZ0A 2QWSA 1H8ZA 3E0YA 3AGDA 4KZ8A 3QP5A 2Z6DA 3MQOA 1YKDA 2PU2A 1BLSA 2XSSA 3O86A 4EBPA 5DFYA 3TOIA 1NRFA 4KQOA 1XA1A 3ZVTA 4S2NC 5FDHA 5FQIA 3ZG9B 1OJGA 1JWVA 1O7EA 4YWZA 4I5SA 3LI9A 3CMZA 5FL3A 3S7NA 3JYIA 2W1TA 1DJCA 4R38A 3UO9A 4X69A 4X1LA 1SDNA 4IVIA 1N4OA 3QP1A 2QPNA 3NOPC 3C7VA 2VK3A 2IWBA 3UY6A 1ES5A 3F1OA 1S1ZA 4DDSA 1STZA 1K55C 4WZ5A 5EVEA 3LIDA 3JVVA 3MXRA 3QP2A 4P87A 1MBLA 2XD5A 4R3JA 1DJBA 1RCJA 4JPMA 4JXGA 5HDSA 1MZUA 2ZLYA 4HJ6A 2WKRA 5KSHA 1K4EA 1K57C 5FQ9A 3IX3A 5HZHA 1I5QA 1FILA 3LR0A 5A91A 1K6RA 2QZ6A 3M2KA 4CLCA 1V9ZA 3HLDA 2PD8A 3HLFA 4FH2A 3DW0A 3BEBA 1KVMA 1L0GA 5EECA 5HWTA 3EQUA 3EGDC 5FQMA 4MN5A 2O99A 3KYZA 2C5WB 2UWXA 4HJ3A 4JXVA 3D4FA 4UAAA 4WMCD 5E2HA 1G6OA 3HVFA 2RL3A 2ZQ8A 3C4PA 3UDFA 4H6JA 2V8FA 4JF6A 3LR3A 2K2NA 1NWZA 4R4RA 3MXSA 5CTMA 4P85A 4B93A 3UN7A 2HDSA 3R4KA 2R9WA 1W8QA 3IHBA 3A3JA 1BULA 2EA9A 4DE3A 3GTCA 5CHJA 2W3DA 4Q0HA 2YKHA 4G3VA 3MBZA 1A0KA 1NXYA 2XF3A 4X53A 5L2FA 1I2WA 2XA7S 4S2PA 3DAVA 3VFHA 2GDNA 1LL8A 5HFOA 1H5XA 2H28A 3EOIA 4QD4A 3PBTA 3BLSA 3GSGA 3G6OA 3JPUA 4PM9A 3ULFA 4BBUA 5F68A 3WS5A 4B9OA 3RXWA 2IA2A 3G2ZA 3PHYA 5EVLA 3KO6A 5E2GA 4GDBA 2JKRI 3BW6A 3CPTB 4HQAA 2PR6A 4DE2A 3MF0A 4GKUA 4ZDXA 1L2SA 4KZ4A 3O87A 1PI5A 1CEFA 1EWZA 3ZGAB 2A2LA 2HF6A 2HJEA 3MKEA 2PHYA 4JGRA 4LRXC 3UDXA 1IFQA 2VZWA 5GLBA 3BQ8A 4AFIA 1BZAA 3W4PA 4Q8IA 5KMWA 4OP8A 1K4FA 1GSVA 4WELA 4JBFA 4HY8A 2P9VA 2J3TC 2V0UA 3QP8A 2XGNA 3NECA 4CLCD 1M40A 3C7UA 2WKQA 5DTKA 3G32A 1DY6A 4R4SA 1KOUA 4JKTA 4N1XA 2BLSA 1EW0A 3BFDA 1VEUB 4E6XA 5FEFA 3RFBA 3ITBA 3HJIA 3DWZA 3E4QA 4ZJ2A 4BLMA 3G30A 4KG5A 5F6AA 1LSXA 5HDDA 4LGWA 2A24A 3T12B 1P9WA 2Y8HA 1MXOA 2E8JA 1SKFA 3LR4A 4EESA 4EETB 3P7NA 3OPRA 3M2JA 1F98A 1TS6A 3W4OA 3BYDA 1P97A 2XRNA 4LV1A 2V1BA 3M6HA 4WM9A 1PYYA 4Y5FA 1IKIA 4KQRA 4Q0IA 4GD8A 4MMNA 4RQ9A 4RX2A 1P9RA 1H3QA 4GS9A 4WZ4A 2JBFA 4NXFA 1DP6A 3HCYA 3MMHA 1XFNA 3SH9A 4ID4A 2M1CA 1SDEA 4ZBEA 1GSXA 3R7WB 2ZC7A 4HHDA 1L0DA 3T4LA 4EU0A 3B33A 3A3DA 1Y28A 4UQIS 1DP8A 4GHIB 3ZHHA 2Z6CA 3TSGA 2OOLA 4PKYA 1OTIA 1ZHHB 1LI0A
chains in the Genus database with same CATH topology
4Y2FA 4GHIA 4HP4A 3KSGA 4L9GA 3T4TA 3PXPA 2JKRM 3CUEC 4WEJA 2BASA 1OT9A 3NOUC 1UGUA 2OAQ1 4L9FA 3D3OA 3PBRA 4OOLA 2VEAA 4ETZA 4BBVA 2KLIA 3NOTC 3TJZC 4G3KA 2B18A 3K3CA 1VHMA 1LSWA 1T1BA 2D02A 4R3AA 2VV6A 4Z1WA 3BY8A 5G4YA 5KIZA 3H7WA 2J80A 4I3IA 2W3FA 3LIAA 2VLGA 2W1RA 4G3WA 4R6LA 3LUQA 1OT6A 3B47A 2NUPC 2ZOHA 4IJGA 5IU1A 5C5KA 2HJ9C 3IS2B 3E4PA 3A0RA 3T4QA 2HGVA 1TS8A 2G7UA 2WKPA 4GJ4A 3E4OA 3DBAA 1T19A 2K31A 4XT2B 2VV7A 2W0NA 5DFXA 5TBMB 1LT0A 4BBTA 4GLQA 4PHTA 3KSHA 2PD7A 1DRMA 4CLCC 3C2WA 4HP9A 1XFQA 3C30A 4MCWA 4Q0JA 5AVEA 5L8MA 4Y3IA 3FC7A 3UMDA 2PT7A 3H82A 3PBOA 4O8GA 2VGLM 3LYXA 2YKFA 3C38A 1OTEA 4ARZB 1XJ2A 3F1NA 1UWPX 2FZ0A 2QWSA 4NXGA 5HPFA 3E0YA 3VE4A 3EGXC 2Z6DA 3MQOA 4FSFA 1YKDA 3T4KA 4JGOA 1YSQA 1OTDA 2XSSA 3GDIA 4NKPA 5DFYA 4KQOA 3IBRA 4R70A 4CQHA 3ICYA 3CLOA 3SW1A 1MKMA 4IHQA 3ZYTA 5MC7A 3LFVA 4EXOA 1ZTUA 1OJGA 5I5LA 1S4SA 5DJUA 4YWZA 4I5SA 4EEUA 5AVFA 3LI9A 4PAUA 5FL3A 4P6ZM 3S7NA 2W1TA 1T1AA 4R38A 5HDCA 3R7WA 3KYQA 2W27A 2W3GA 4HH2A 3NOPC 1YAXA 3OBFA 5IS1A 5K5BA 2L1MA 3A0VA 3F1OA 1S1ZA 1STZA 4NEED 1YSPA 2V1AA 3LIDA 3JVVA 3MQQA 3MJQA 1N9OA 4ZRRA 1T18A 3B42A 2OAP1 3P01A 3UB7A 4LPZA 2PDRA 5HDSA 1H8MA 4KUOA 3PYPA 5HSQA 1MZUA 3UB6A 3RTYA 2J3TD 3GECA 3ZQ5A 4HJ6A 2M7UA 3KX0X 2EWWA 2WKRA 4CLCB 5KSHA 4JGPA 2B02A 2CMNA 4P6ZS 3U2AA 1D7EA 2L4RA 2ZBBA 5HZHA 3LR0A 3MFXA 2QJ5A 3S7OA 4CLCA 1WA9A 1V9ZA 4BMWA 2OWHA 2PD8A 3EQVA 3HJKA 4NXEA 3IS2A 5HD3A 5DKKA 5HWTA 1D06A 3EQUA 3EGDC 3T4SA 3D72A 3K2NA 4II7A 4MN5A 2O99A 3KYZA 1S1YA 3FPWA 2O9AA 4HOIA 2INWA 4XT2A 3S7QA 1TD5A 4KQDA 4H6JB 4WEKA 5TBMA 4HJ3A 2LB9A 4YOFA 2JHEA 2XA7M 1G6OA 1XJ4A 3BQAA 4H6JA 2V9AA 3C8CA 2PR5A 1NRJA 3LR3A 2K2NA 3UMEA 2P08A 1NWZA 3PBNA 4DMZA 4ARZA 5CX7A 5HWVA 1W63Q 4B93A 4PKYG 1XJ3A 4I39A 2O9CA 3R4KA 5DF9A 4UQIM 5LBRA 1X0OA 3UB9A 3UE6A 1S4RA 2I9VA 3NJAA 2EA9A 3LR5A 2W3DA 4Q0HA 3PR6A 2YKHA 1ODVA 3BY9A 3MR0A 3JVUA 4G3VA 1S67L 2VKSA 2OWJA 4FOFA 2QKPA 5F5YA 2QYBA 3S7PA 2NUTC 3EEHA 4MN6A 3LIFA 2VGLS 2XA7S 1MC0A 1BYWA 1NLYA 3LICA 3VV4A 3BWLA 4WLAA 1LL8A 2H28A 3EOIA 4LLOB 1P0ZA 1V9YA 3PBTA 3CUEA 3OC2A 3G6OA 3ULFA 2HV1A 4DJ3A 4BBUA 5F68A 2R78A 4JGQA 1TS7A 2L0WA 3T50A 4B9OA 3EWKA 2IA2A 3PHYA 3KO6A 3PBQA 3F1PB 2O9BA 1UWNX 4IUKA 2JKRI 2W3HA 3BW6A 4HQAA 2PR6A 3VE3A 2P7JA 3VOLA 4O0PA 1OPXA 2QHKA 3MF0A 1W63M 2O0YA 3F1PA 3LIEA 4DN0A 2QJ7A 4HIAA 2A2LA 4GW9A 3OCLA 2HF6A 4HI4A 2HJEA 5HD5A 5HPIA 4HH3A 4K08A 4BWIA 2PHYA 4EUVA 4JGRA 5TJJA 1N9LA 4LRXC 2W3EA 4DJ2A 1IFQA 2VZWA 3UB8A 2D01A 2KOIA 2JN7A 3BQ8A 3CITA 4AFIA 2GNXA 2ZOIA 3EEAA 3OLOA 5G4ZA 3H7WB 2GZAA 3OCNA 1GSVA 4L9EA 3OOVA 3CWFA 1T1CA 4BJPA 1NLZA 5EFWA 3T4OA 4WELA 2Y79A 4HY8A 2J3TC 3TW8A 4LRYC 3CAXA 4M4XA 1S66L 2V0UA 1GSWA 4EW7A 4CLCD 4WUJA 4EQ1A 2WKQA 3CI6A 4E04A 2JKTI 3BJNA 4GCZA 3NHQA 3TE8A 4UEYA 3RH8B 4KUKA 3TRCA 1OTBA 2VA0A 4OOMA 1KOUA 4EERA 5A8BA 4F3LB 3LIBA 1EW0A 4MN7A 3FG8A 3MQ0A 1LSVA 4I3AA 2A24B 3RFBA 2VJWA 4HNBA 4I3JA 4NXBA 2K7SA 2KDKA 3H82B 3HJIA 1TS0A 2EWVA 2JKTM 3E4QA 4F3LA 5F6AA 1LSXA 1F5MA 5HDDA 5DJTA 3IBJA 2A24A 2GJ3A 5DKLA 4ME4A 3F1NB 4EEPA 1P9WA 2Y8HA 4QPRA 5AJGA 2MJ6A 2PYPA 1VB6A 3LR4A 4LRZE 4EESA 4EETB 5F69A 2XROA 3P7NA 3W2ZA 1F98A 1TS6A 4HJ4A 1XJ6A 4WF0A 1P97A 2V0WA 3KSIA 3K3DA 2XRNA 2V1BA 4GS9B 5HL6A 5J4EA 1G28A 3O5YA 2KX6A 3V67A 1IOUA 3MXQA 4Y5FA 2VV8A 2ZMVA 4I38A 4Q0IA 4WL9A 1OJ5A 2GX5A 4MMNA 4RQ9A 4IUHA 1P9RA 1H3QA 2ZMFA 4GS9A 4O01A 5J3WA 3PBSA 2VX8A 1F9IA 4NXFA 1DP6A 5HWWA 3E98A 4WN5A 3HCYA 3MMHA 1JNUA 1XFNA 2J3WA 1TF1A 2LB5A 4L0LA 5IT5A 3UE3A 2M1CA 2DMWA 2W1TB 3LI8A 4CLCE 5J7EA 1GSXA 3FPVA 4MDZA 3R7WB 1DP9A 4HHDA 3T4LA 4EU0A 3B33A 1Y28A 2FH5A 4UQIS 1DP8A 2PYRA 2M7VA 4GHIB 1N9NA 2Z6CA 3H9WA 2OOLA 4PKYA 1OTAA 1OTIA 4ETXA 3KSFA 1ZHHB 3F1OB 3A0SA 3T4JA 4YNRA 2P04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHI A;  4HP4 A;  4L9G A;  2BAS A;  1OT9 A;  3NOU C;  1UGU A;  4L9F A;  2VEA A;  4BBV A;  3NOT C;  3K3C A;  1LSW A;  1T1B A;  2D02 A;  4R3A A;  2VV6 A;  3BY8 A;  5G4Y A;  5KIZ A;  3H7W A;  2J80 A;  4I3I A;  3LIA A;  2VLG A;  4R6L A;  3LUQ A;  1OT6 A;  2ZOH A;  5IU1 A;  3IS2 B;  3E4P A;  3A0R A;  1TS8 A;  2WKP A;  3E4O A;  1T19 A;  4XT2 B;  2VV7 A;  2W0N A;  5TBM B;  1LT0 A;  4BBT A;  2PD7 A;  1DRM A;  3C2W A;  4HP9 A;  1XFQ A;  5AVE A;  3FC7 A;  3UMD A;  3H82 A;  3LYX A;  2YKF A;  1OTE A;  1XJ2 A;  3F1N A;  1UWP X;  2QWS A;  4NXG A;  3VE4 A;  2Z6D A;  3MQO A;  4JGO A;  1OTD A;  3GDI A;  3IBR A;  4R70 A;  3ICY A;  3CLO A;  3SW1 A;  4EXO A;  1OJG A;  5I5L A;  1S4S A;  5DJU A;  4YWZ A;  4I5S A;  4EEU A;  5AVF A;  3LI9 A;  1T1A A;  4R38 A;  5HDC A;  2W27 A;  4HH2 A;  3NOP C;  5IS1 A;  2L1M A;  3A0V A;  3F1O A;  1S1Z A;  2V1A A;  3LID A;  3MQQ A;  3MJQ A;  1N9O A;  1T18 A;  3UB7 A;  4LPZ A;  2PDR A;  5HDS A;  4KUO A;  3PYP A;  5HSQ A;  1MZU A;  3UB6 A;  3RTY A;  3GEC A;  3ZQ5 A;  4HJ6 A;  3KX0 X;  2WKR A;  4JGP A;  2B02 A;  2CMN A;  1D7E A;  2L4R A;  2ZBB A;  5HZH A;  3MFX A;  2QJ5 A;  1WA9 A;  1V9Z A;  2OWH A;  2PD8 A;  3HJK A;  4NXE A;  3IS2 A;  5HD3 A;  5DKK A;  5HWT A;  1D06 A;  3D72 A;  4MN5 A;  1S1Y A;  4HOI A;  2INW A;  4XT2 A;  4KQD A;  4H6J B;  5TBM A;  4HJ3 A;  2JHE A;  1XJ4 A;  4H6J A;  2V9A A;  3C8C A;  2PR5 A;  3UME A;  1NWZ A;  5HWV A;  4PKY G;  1XJ3 A;  4I39 A;  1X0O A;  3UB9 A;  3UE6 A;  1S4R A;  2I9V A;  3NJA A;  2EA9 A;  2YKH A;  1ODV A;  3BY9 A;  3MR0 A;  1S67 L;  2OWJ A;  2QKP A;  5F5Y A;  3EEH A;  4MN6 A;  3LIF A;  1BYW A;  3LIC A;  3BWL A;  4WLA A;  1LL8 A;  2H28 A;  4LLO B;  1P0Z A;  1V9Y A;  3G6O A;  3ULF A;  2HV1 A;  4DJ3 A;  4BBU A;  5F68 A;  2R78 A;  4JGQ A;  1TS7 A;  2L0W A;  3T50 A;  4B9O A;  3EWK A;  3PHY A;  3F1P B;  1UWN X;  3VE3 A;  4HQA A;  3VOL A;  2PR6 A;  2P7J A;  2QHK A;  3F1P A;  3LIE A;  2QJ7 A;  4HIA A;  4GW9 A;  5HD5 A;  4HI4 A;  4HH3 A;  4K08 A;  2PHY A;  4JGR A;  1N9L A;  4LRX C;  4DJ2 A;  3UB8 A;  2D01 A;  2JN7 A;  2ZOI A;  3OLO A;  5G4Z A;  3H7W B;  1GSV A;  4L9E A;  3CWF A;  1T1C A;  5EFW A;  4HY8 A;  4LRY C;  3CAX A;  4M4X A;  1S66 L;  2V0U A;  1GSW A;  4EW7 A;  4WUJ A;  4EQ1 A;  2WKQ A;  4E04 A;  4GCZ A;  3NHQ A;  3RH8 B;  4KUK A;  1OTB A;  1KOU A;  4EER A;  5A8B A;  4F3L B;  3LIB A;  1EW0 A;  3FG8 A;  1LSV A;  4I3A A;  2A24 B;  4HNB A;  4I3J A;  4NXB A;  2K7S A;  2KDK A;  3H82 B;  3HJI A;  1TS0 A;  3E4Q A;  4F3L A;  5F6A A;  1LSX A;  5HDD A;  5DJT A;  4EEP A;  2A24 A;  2GJ3 A;  5DKL A;  3F1N B;  2PYP A;  1VB6 A;  4LRZ E;  4EES A;  4EET B;  5F69 A;  3P7N A;  1F98 A;  1TS6 A;  4HJ4 A;  1XJ6 A;  4WF0 A;  1P97 A;  2V0W A;  3K3D A;  2V1B A;  4GS9 B;  5J4E A;  1G28 A;  2KX6 A;  3MXQ A;  2VV8 A;  4I38 A;  4WL9 A;  1OJ5 A;  4RQ9 A;  4GS9 A;  5J3W A;  4NXF A;  1F9I A;  1DP6 A;  5HWW A;  4WN5 A;  1JNU A;  1XFN A;  2M1C A;  3LI8 A;  5J7E A;  1GSX A;  1DP9 A;  4HHD A;  3B33 A;  1Y28 A;  1DP8 A;  2PYR A;  4GHI B;  1N9N A;  2Z6C A;  3H9W A;  2OOL A;  4PKY A;  1OTA A;  1OTI A;  3F1O B;  3A0S A; 
#chains in the Genus database with same CATH topology
 3KSG A;  3IH8 A;  5CER A;  2HDR A;  3PXP A;  3WS4 A;  1AXB A;  4WEJ A;  3BLM A;  1OT9 A;  3NOU C;  1AWI A;  4FUW A;  5CEB A;  1FR6 A;  3DTM A;  3D3O A;  1JTG A;  1D1J A;  4ETZ A;  4BBV A;  5EVI D;  3LY3 A;  2B18 A;  1YLT A;  1VHM A;  1LSW A;  4OPZ A;  1TVF A;  1CI8 A;  4I3I A;  4LCM A;  1SHV A;  3HUO A;  2XH9 A;  2W1R A;  4G3W A;  2A49 A;  4S2L A;  3DTI A;  1FSY A;  5EUA A;  2HJ9 C;  4BEN A;  5HAQ A;  3FKV A;  1TS8 A;  1RP5 A;  2EXA A;  4RYE A;  3UB5 P;  3ZFZ A;  1FCO A;  1ZKJ A;  4QWO A;  2VV7 A;  3VFF A;  5BOH A;  2B95 A;  5CED A;  5TBM B;  5TGF A;  4GLQ A;  2Z2L B;  2PD7 A;  4S2O A;  1RGY A;  5AVE A;  5L8M A;  1LLB A;  4UA9 A;  3FC7 A;  4E3L A;  4OQG A;  2PT7 A;  5FQK A;  2VGL M;  3G31 A;  5FI2 A;  1OTE A;  1XJ2 A;  1UWP X;  2ZC4 B;  3N7W A;  3UPN A;  4OH0 A;  5DF8 A;  2HDU A;  3BEC A;  3VE4 A;  2RCX A;  3EGX C;  4B4X A;  4FSF A;  3T4K A;  1GHM A;  1YSQ A;  1OTD A;  5AQ9 A;  4NKP A;  5IHV A;  4N9L A;  3IBR A;  4IHQ A;  3ZYT A;  3IF6 C;  1IEL A;  5MC7 A;  2EFX A;  3MS6 A;  1F2K A;  2FFY A;  1JWP A;  4Y7P A;  4P6Z M;  2Y2N A;  1RGZ A;  1T1A A;  5HDC A;  1O07 A;  4OP5 A;  3IH9 A;  2W27 A;  4HH2 A;  1YAX A;  3OBF A;  3NBL A;  2FFF B;  5IS1 A;  1MWR A;  5K5B A;  3A0V A;  3OZH A;  3B3X A;  5D3O A;  3V50 A;  2V1A A;  5EOE A;  3IX8 A;  4X6T A;  2H10 A;  1K54 C;  3MQQ A;  5L09 A;  3FYZ A;  1G5U A;  1N9O A;  4R1G A;  3TG9 A;  4OOY A;  3T1Q B;  2Y2O A;  4LPZ A;  2PDR A;  1H8M A;  4KUO A;  1YQS A;  3UB6 A;  3RTY A;  3ZQ5 A;  3KX0 X;  2Y55 A;  4JGP A;  3WS1 A;  1D7E A;  4PMA A;  2QJ5 A;  3S7O A;  5FI6 A;  4IBR A;  4N1H A;  4LV2 A;  3QP6 A;  5M1A A;  3OPH A;  3PAG A;  2DNS A;  1Z6F A;  5U47 A;  2G2W A;  2XR0 A;  4WMC A;  1H8Y A;  2O9A A;  1PNE A;  2INW A;  4XT2 A;  1CF0 A;  3V39 A;  3NUL A;  3NI9 A;  1FR1 A;  3IF6 B;  2C6W B;  3C8C A;  1K38 A;  1NRJ A;  1K6S A;  3GMW A;  4K0W A;  3SS4 A;  1ZG4 A;  2V8C A;  1L3L A;  1CI9 A;  2P08 A;  3PBN A;  4GN2 A;  4ARZ A;  5CX7 A;  5TR7 A;  1HZO A;  3QP4 A;  4IBX A;  4NET A;  3HUN A;  3SZT A;  5LBR A;  3UB9 A;  3UE6 A;  4S2M A;  2I9V A;  3NJA A;  4DE1 A;  3LR5 A;  1PIO A;  4Y0O A;  3BM6 A;  3V3R A;  1S67 L;  3ZNT A;  1HVB A;  4FOF A;  1MWT A;  4PM6 A;  3O88 A;  3CHW P;  3EEH A;  2Y2P A;  1BYW A;  1NLY A;  3LIC A;  4WLA A;  5E2E A;  3VMA A;  4LLO B;  1P0Z A;  1SKO A;  3OC2 A;  2ZC5 B;  2HDQ A;  2HV1 A;  4HBU A;  5A92 A;  4OKP A;  1TS7 A;  5FDS A;  2L0W A;  3T50 A;  3EWK A;  4E3J A;  1VET B;  1QME A;  3PBQ A;  3Q1F A;  2O9B A;  3VE3 A;  3OPP A;  1BT5 A;  5JYP A;  2P7J A;  3IXD A;  1OPX A;  2VGK A;  4EQI A;  4OPY A;  2O0Y A;  5CGS A;  4IED A;  4HIA A;  4GW9 A;  3OCL A;  1EI5 A;  5HPI A;  4EUV A;  1J9M A;  5TJJ A;  2Y2L A;  1NJ4 A;  2ZQC A;  2KOI A;  2JN7 A;  3HUM A;  1FSW A;  5CRF A;  2GNX A;  3HRE A;  3H7W B;  3N4I A;  3OCN A;  3Q7V B;  1T1C A;  5EFW A;  4UA6 A;  5G18 A;  4WZ5 C;  3T4O A;  2Y79 A;  4Z9Q A;  3S1Y A;  3TW8 A;  3CAX A;  1Q2Q A;  1LL9 A;  3GV9 A;  3ZVW A;  4E3M A;  3HLB A;  4WUJ A;  1YM1 A;  4EQ1 A;  2JKT I;  3BJN A;  1YLZ A;  4UEY A;  3LO7 A;  3SS5 A;  3TRC A;  4LV0 A;  2HP9 A;  5EE8 A;  4F3L B;  4MNR A;  1TEM A;  3FG8 A;  1MPL A;  3MQ0 A;  1YMS A;  2PU4 A;  4I3J A;  2EWV A;  5FAT A;  1VEU A;  5E2F A;  1YLP A;  5GL9 A;  3IBJ A;  1YPR A;  2GJ3 A;  4EEP A;  3F1N B;  3CZD A;  4B4Z A;  4OLD A;  3GR2 A;  5AJG A;  4N92 A;  2Q9M A;  5HX9 A;  2EX6 A;  2MJ6 A;  4LRZ E;  1SCW A;  1VB6 A;  4IVK A;  5EV0 A;  1ESU A;  2J7V A;  3IXB A;  3M6B A;  1BUE A;  3FZC A;  4X55 A;  1MWS A;  1E3U D;  5HL6 A;  1L0F A;  1G28 A;  1ESI A;  1YMX A;  3V67 A;  5CHM A;  1LHY A;  1OJ5 A;  2GX5 A;  1XA7 A;  4IUH A;  1IKG A;  1S0W A;  2ZMF A;  4O01 A;  4KEN B;  4R3B A;  4S2K A;  3PBS A;  1F9I A;  3E98 A;  4OQI A;  2WAF A;  4QB8 A;  1JNU A;  2LB5 A;  5IT5 A;  3OPL A;  2W1T B;  3HBR A;  3U4L P;  3FPV A;  4MDZ A;  5KZH A;  3RXX A;  2ZQ9 A;  1GHI A;  3HLW A;  2PYR A;  3DTE A;  3UE1 A;  2CC1 A;  4ETX A;  1OTA A;  3F1O B;  5EM1 A;  3VP3 A;  3A0S A;  3T4J A;  1VM1 A;  4MBH A;  4GHI A;  4EWF A;  3WS0 A;  5CGW A;  2PBD P;  1YLJ A;  4Y17 A;  3IXH A;  5EVI A;  2BAS A;  1IYP A;  1UGU A;  4L9F A;  3BFE A;  3PBR A;  1NZO A;  2VEA A;  1PZO A;  2PRF A;  4HES A;  3K3C A;  3NDG A;  4LCL A;  2VV6 A;  2VGJ A;  3LY4 A;  3NC8 A;  2VLG A;  2NUP C;  2ZOH A;  5IU1 A;  3L9K A;  2ZD8 A;  3N8R A;  2H0T A;  2HGV A;  4GJ4 A;  3E4O A;  5A90 A;  4M3K A;  1KDW A;  1ZG6 A;  3BFC A;  2WGW B;  1H0M A;  3BRM A;  4PPR A;  2OV5 A;  3UE0 A;  5DFX A;  1YLW A;  1MY8 A;  1FIK A;  3C2W A;  2J9O A;  1HLU P;  4MBF A;  3MZD A;  4MCW A;  1QMF A;  4P6B A;  3H82 A;  3PBO A;  4CPK A;  2X01 A;  4NG2 A;  2YKF A;  2UV0 E;  1G68 A;  2OLV A;  4NXG A;  3Q82 A;  5HPF A;  1YT4 A;  4GNU A;  1I2S A;  3NY4 A;  4JF4 A;  2Y2J A;  4C3Q A;  4Y0U A;  3GDI A;  1YLY A;  5AQA A;  4GOG A;  4R70 A;  4CQH A;  3ICY A;  2JKF A;  2OLU A;  4PM5 A;  1OME A;  1MKM A;  4MEZ A;  3P98 A;  4KZ7 A;  1FOF A;  3I7J A;  5I5L A;  1XX2 A;  1S4S A;  4X68 A;  1Y4O A;  1U60 A;  2X71 A;  5DJU A;  1E25 A;  3FV7 A;  4X1M A;  2PAV P;  5AVF A;  5DF7 A;  4D2O A;  4PAU A;  4QY6 A;  2W3G A;  2Q9N A;  3ISG A;  1ZC2 A;  4OPQ A;  1KE4 A;  2Z2M B;  2L1M A;  3WRT A;  4NEE D;  4EUZ A;  3IQA A;  3MJQ A;  4XXR A;  5J8X A;  1T18 A;  3B42 A;  3P01 A;  3T1R A;  3C4O A;  1L0E A;  2J3T D;  3GEC A;  1IEM A;  4BD0 A;  2EWW A;  4K0X A;  2B02 A;  2CMN A;  4P6Z S;  1FCM A;  2L4R A;  3NDE A;  1ONH A;  2P9V B;  1VQQ A;  5GHZ A;  1K56 D;  1WA9 A;  2QMI A;  4DKI A;  3EQV A;  3HJK A;  3RJU A;  4UHU A;  2Y2M A;  3IS2 A;  2B5R A;  2OSU A;  4KZA A;  3T4S A;  3D72 A;  1S1Y A;  4HOI A;  3S7Q A;  1TD5 A;  4KQD A;  2WUQ A;  4WEK A;  5M19 A;  2LB9 A;  2JHE A;  4E3N A;  3ITA A;  1NYY A;  1XJ4 A;  2ZL1 B;  4KQQ A;  2Y2G A;  2V9A A;  3N6I A;  2PR5 A;  4FH4 A;  4S2I A;  3ZDJ A;  5HWV A;  2E8I A;  1W63 Q;  4FD8 A;  5FI7 A;  4ZTK A;  1XJ3 A;  4I39 A;  2H0Y A;  2HP6 A;  4UQI M;  3MKF A;  2Y2I A;  1X0O A;  1KE0 A;  1ODV A;  3BY9 A;  4A5R A;  1DJA A;  1Z09 A;  2VKS A;  5F5Y A;  3Q07 A;  2QYB A;  5GHY A;  2WGV A;  2NUT C;  3C5A A;  3GQZ A;  5HAP A;  2Y4A A;  2EFU A;  4MN6 A;  1MC0 A;  3VV4 A;  3O3V A;  3CUE A;  2R9X A;  1Q2P A;  3IX4 A;  2XDM A;  1K54 A;  3DTK A;  4MLL A;  5FSR A;  4Y0T A;  1KGF A;  4LV3 A;  3IF5 A;  4JGQ A;  3UDI A;  3F1P B;  4LFU A;  2JC7 A;  3VOL A;  1K25 A;  1FQG A;  4O0P A;  2QHK A;  1W63 M;  2WKH A;  1BSG A;  4GZB A;  1WE4 A;  3W8K A;  1W79 A;  4BWI A;  1N9L A;  5FAP A;  3UB8 A;  4KG2 A;  2ZOI A;  3EEA A;  3OLO A;  2IWC A;  3V3S A;  4KZB A;  1ACF A;  2ZMA A;  1IYS A;  4L9E A;  4BJP A;  3IT9 A;  1XP4 A;  4QJG A;  3W4Q A;  5AQ7 A;  4RVA A;  4LRY C;  4N9K A;  4M4X A;  1S66 L;  1BLH A;  4EW7 A;  3CI6 A;  3NHQ A;  1LL5 A;  3TE8 A;  1KGG A;  4KUK A;  3ZG5 A;  1OTB A;  2VA0 A;  4OOM A;  3VSK A;  4JXS A;  3HLG A;  4RA7 A;  3BFF A;  2XLN A;  3LIB A;  3ZNY A;  3QHY A;  5EOO A;  4MN7 A;  1CEG A;  5HW3 A;  1PFL A;  2VJW A;  4K91 A;  4HNB A;  3VP1 A;  1TS0 A;  2JKT M;  1PRQ A;  4F3L A;  3LEZ A;  3HLC A;  1F5M A;  5DJT A;  4S2N A;  4GB7 A;  5DKL A;  5DVA A;  5CXW A;  5DTS A;  1E3U A;  2Q0O A;  4ZJ1 A;  3VP0 A;  2PYP A;  4BQM A;  1BLC A;  5F69 A;  4R23 A;  2XRO A;  4OVD A;  1M6K A;  1XJ6 A;  2V0W A;  3G35 A;  5AQB A;  5J4E A;  4ZJ3 A;  3O5Y A;  3GVB A;  4QY5 A;  1IOU A;  3MXQ A;  4BL3 A;  1NY0 A;  2ZMV A;  5CTN A;  3A3F A;  5GHX A;  4JXW A;  2JCH A;  5HWW A;  4WN5 A;  1K55 A;  4L0L A;  1XPB A;  3G2Y A;  4XUZ A;  2FH5 A;  4E3K A;  3H9W A;  3HL9 A;  4YNR A;  1K57 A;  2P04 A;  3CPT A;  4QU3 A;  4KZ9 A;  1GHP A;  4HP4 A;  3S22 A;  2EX9 A;  3T4T A;  4UA7 A;  4PM7 A;  2JKR M;  1MKI A;  1GA0 A;  4OLG A;  2G2U A;  3LEQ A;  1GA9 A;  5EM0 A;  3WWX A;  4OQH A;  2OAQ 1;  3HLE A;  1ALQ A;  2Y59 A;  3IHA A;  5GLA A;  5CEC A;  4G3K A;  2HPB A;  1ES3 A;  1T1B A;  2D02 A;  3D9Y A;  4Z1W A;  3BY8 A;  1FCN A;  5KIZ A;  2J80 A;  1KVL A;  2W3F A;  3IWO A;  3LIA A;  4DF6 A;  1JTD A;  1HD8 A;  1OT6 A;  4PM8 A;  4IJG A;  4DXC A;  4KG6 A;  3A0R A;  4ESP A;  2WKP A;  2Y2Q A;  1T19 A;  1PZP A;  2K31 A;  3FWL A;  3VP2 A;  4XT2 B;  5KSC A;  3SH7 A;  3AGE A;  1LT0 A;  1PWG A;  4BBT A;  2A3U A;  1W7F A;  3KSH A;  2I72 A;  1WYB A;  4EBL A;  4CLC C;  3C30 A;  5FAQ A;  1KGE A;  4Q0J A;  3KYE A;  2WGW A;  4Y3I A;  4X25 A;  4O8G A;  2ZM8 A;  3VOY A;  5L07 A;  1XXM A;  1TDG A;  2XK1 A;  4ARZ B;  1ERQ A;  2H5S A;  3N8S A;  3AGF A;  2AVX A;  4DXB A;  5HAR A;  5FAO A;  4JGO A;  1S6R A;  2HZ5 A;  2BG1 A;  4CJN A;  4RX3 A;  3CLO A;  3SW1 A;  2DRW A;  3LFV A;  2ZM2 A;  4EXO A;  1ZTU A;  2JE5 A;  4U3T A;  1SKO B;  3ZCZ A;  4OQ0 A;  4EEU A;  2Y91 A;  2ZM0 A;  1NZU A;  3BFG A;  3R7W A;  5HAI A;  5F83 A;  3KYQ A;  1CQA A;  2V1Z A;  3LGO A;  5HL1 A;  2PBY A;  4BL2 A;  3IWQ A;  5F1F A;  4B88 A;  1PW1 A;  1YSP A;  5JYO A;  1ERM A;  3CJM A;  4O7D A;  1KDS A;  1E4D A;  5L10 A;  4WBG A;  4ZRR A;  1BTL A;  2OAP 1;  3CG5 A;  3UB7 A;  4KZ5 A;  3G34 A;  1BLP A;  4FTX A;  3PYP A;  5HSQ A;  4DRT A;  1K56 A;  2M7U A;  4CLC B;  5GLD A;  3V5M A;  3T1S A;  3U2A A;  2ZBB A;  3SH8 A;  3IXG A;  3MFX A;  2WAE A;  5EVI C;  4BMW A;  2OWH A;  2ACG A;  4U0X A;  4NXE A;  5HD3 A;  5DKK A;  2EXB A;  1D06 A;  4WYY A;  3L7H A;  3K2N A;  4NK3 A;  4II7 A;  1JWZ A;  3FPW A;  2WZZ A;  4H6J B;  4C6Y A;  1N9B A;  1IYQ A;  5TBM A;  3E2L A;  1KE3 A;  4YOF A;  3SOI A;  2XA7 M;  3BQA A;  4F94 A;  1ONG A;  3Q7Z A;  4ZAM A;  1ES2 A;  3UME A;  2ZL1 A;  4U0T A;  2WKE A;  4DMZ A;  5FQJ A;  1PW8 A;  4GDN A;  4D60 A;  4PKY G;  4KZ3 A;  2O9C A;  5DF9 A;  2WK0 A;  1S4R A;  2DCF A;  3E2K A;  1IYO A;  2WAD A;  3MSH A;  3PR6 A;  3MR0 A;  3JVU A;  2OWJ A;  2QKP A;  3VOZ A;  3S7P A;  1TDL A;  1SZV A;  3LIF A;  2VGL S;  4X56 A;  3PAE A;  3BWL A;  4JLF A;  1XGJ A;  2WZX A;  1V9Y A;  3PTE A;  4E3I A;  1XKZ A;  1PI4 A;  4DJ3 A;  2EX2 A;  4EV4 A;  2R78 A;  1CJF A;  3FKW A;  4OPR A;  1C3B A;  1UWN X;  4IUK A;  2W3H A;  4JF5 A;  2EX8 A;  4YIN A;  3ZG0 A;  2Y2H A;  3IWI A;  2ZC3 B;  5EVI B;  3MZF A;  1PWC A;  2XEP A;  3F1P A;  3LIE A;  1CK3 A;  4DN0 A;  2QJ7 A;  5HD5 A;  2V2F F;  4HI4 A;  5E43 A;  4HH3 A;  4K08 A;  5TFQ A;  2W3E A;  4DJ2 A;  2WKI A;  2D01 A;  3CIT A;  5G4Z A;  3MZE A;  1ES4 A;  5FQQ A;  2GZA A;  5CGX A;  5GLC A;  1PWD A;  3ZG7 B;  3OOV A;  3CWF A;  1NLZ A;  4KZ6 A;  1J3W A;  2P74 A;  2ZJ9 A;  2XD1 A;  1GSW A;  5F1G A;  4E6W A;  4E04 A;  3ZG8 B;  4GCZ A;  2JKG A;  5A93 A;  3RH8 B;  3MFD A;  4EER A;  5A8B A;  2Y2K A;  1LSV A;  4I3A A;  2A24 B;  2HP5 A;  4NXB A;  2K7S A;  2KDK A;  3H82 B;  3WS2 A;  1G6A A;  5M18 A;  2J9P A;  1JVJ A;  4ME4 A;  4H8R A;  5FEG A;  2WGI A;  4LEN A;  3IF6 A;  4QPR A;  4R0Q A;  5I94 A;  4E3O A;  2ZQA A;  4DDY A;  1HTZ A;  3W2Z A;  4OON A;  4HJ4 A;  4WF0 A;  3KSI A;  3K3D A;  4XUX A;  5CHU A;  4GS9 B;  2KX6 A;  2ZQD A;  3GRJ A;  2VV8 A;  1Y54 A;  4I38 A;  4WL9 A;  5J3W A;  2VX8 A;  3S4X A;  5FA7 A;  3WRZ A;  4HEF A;  2J3W A;  1TF1 A;  4MBK A;  1LI9 A;  1GCE A;  3UE3 A;  2IWD A;  3N8L A;  2DMW A;  2J8Y A;  3LI8 A;  4CLC E;  1XGI A;  5J7E A;  3NCK A;  1DP9 A;  4EBN A;  1W8Y A;  4DE0 A;  2M7V A;  1N9N A;  3DWK A;  4QHC A;  3UPP A;  3KSF A;  3Q81 A;  1VET A;  4S2J A;  1K0K A;  1MWU A;  4Y2F A;  1W5D A;  4P0M A;  1ERO A;  4L9G A;  3CUE C;  1NYM A;  4GD6 A;  3UNW A;  4FCF A;  4Y15 A;  2ZC6 B;  1WYC A;  3UPO A;  4OOL A;  2KLI A;  3NOT C;  3TJZ C;  3SS3 A;  3P09 A;  4R3A A;  5DTT A;  2WYX A;  5G4Y A;  3H7W A;  3VSL A;  5FAS A;  3T1X A;  4R6L A;  3LUQ A;  3B47 A;  3Q7V A;  5C5K A;  2X02 A;  4Y13 A;  3IS2 B;  3E4P A;  3NIA A;  3T4Q A;  2V20 A;  5EPH A;  3LCE A;  2G7U A;  3DBA A;  2BTF P;  2XQZ A;  2W0N A;  2XFT A;  4PHT A;  4YFM A;  2ZQ7 A;  1DRM A;  5F82 A;  4HP9 A;  1XFQ A;  3QNC A;  3G4P A;  3UMD A;  3QNB A;  3VP4 A;  4C75 A;  3LYX A;  3C38 A;  4HBT A;  4BD1 A;  3A3E A;  2XFS A;  3F1N A;  3A3I A;  2FZ0 A;  2QWS A;  1H8Z A;  3E0Y A;  3AGD A;  4KZ8 A;  3QP5 A;  2Z6D A;  3MQO A;  1YKD A;  2PU2 A;  1BLS A;  2XSS A;  3O86 A;  4EBP A;  5DFY A;  3TOI A;  1NRF A;  4KQO A;  1XA1 A;  3ZVT A;  4S2N C;  5FDH A;  5FQI A;  3ZG9 B;  1OJG A;  1JWV A;  1O7E A;  4YWZ A;  4I5S A;  3LI9 A;  3CMZ A;  5FL3 A;  3S7N A;  3JYI A;  2W1T A;  1DJC A;  4R38 A;  3UO9 A;  4X69 A;  4X1L A;  1SDN A;  4IVI A;  1N4O A;  3QP1 A;  2QPN A;  3NOP C;  3C7V A;  2VK3 A;  2IWB A;  3UY6 A;  1ES5 A;  3F1O A;  1S1Z A;  4DDS A;  1STZ A;  1K55 C;  4WZ5 A;  5EVE A;  3LID A;  3JVV A;  3MXR A;  3QP2 A;  4P87 A;  1MBL A;  2XD5 A;  4R3J A;  1DJB A;  1RCJ A;  4JPM A;  4JXG A;  5HDS A;  1MZU A;  2ZLY A;  4HJ6 A;  2WKR A;  5KSH A;  1K4E A;  1K57 C;  5FQ9 A;  3IX3 A;  5HZH A;  1I5Q A;  1FIL A;  3LR0 A;  5A91 A;  1K6R A;  2QZ6 A;  3M2K A;  4CLC A;  1V9Z A;  3HLD A;  2PD8 A;  3HLF A;  4FH2 A;  3DW0 A;  3BEB A;  1KVM A;  1L0G A;  5EEC A;  5HWT A;  3EQU A;  3EGD C;  5FQM A;  4MN5 A;  2O99 A;  3KYZ A;  2C5W B;  2UWX A;  4HJ3 A;  4JXV A;  3D4F A;  4UAA A;  4WMC D;  5E2H A;  1G6O A;  3HVF A;  2RL3 A;  2ZQ8 A;  3C4P A;  3UDF A;  4H6J A;  2V8F A;  4JF6 A;  3LR3 A;  2K2N A;  1NWZ A;  4R4R A;  3MXS A;  5CTM A;  4P85 A;  4B93 A;  3UN7 A;  2HDS A;  3R4K A;  2R9W A;  1W8Q A;  3IHB A;  3A3J A;  1BUL A;  2EA9 A;  4DE3 A;  3GTC A;  5CHJ A;  2W3D A;  4Q0H A;  2YKH A;  4G3V A;  3MBZ A;  1A0K A;  1NXY A;  2XF3 A;  4X53 A;  5L2F A;  1I2W A;  2XA7 S;  4S2P A;  3DAV A;  3VFH A;  2GDN A;  1LL8 A;  5HFO A;  1H5X A;  2H28 A;  3EOI A;  4QD4 A;  3PBT A;  3BLS A;  3GSG A;  3G6O A;  3JPU A;  4PM9 A;  3ULF A;  4BBU A;  5F68 A;  3WS5 A;  4B9O A;  3RXW A;  2IA2 A;  3G2Z A;  3PHY A;  5EVL A;  3KO6 A;  5E2G A;  4GDB A;  2JKR I;  3BW6 A;  3CPT B;  4HQA A;  2PR6 A;  4DE2 A;  3MF0 A;  4GKU A;  4ZDX A;  1L2S A;  4KZ4 A;  3O87 A;  1PI5 A;  1CEF A;  1EWZ A;  3ZGA B;  2A2L A;  2HF6 A;  2HJE A;  3MKE A;  2PHY A;  4JGR A;  4LRX C;  3UDX A;  1IFQ A;  2VZW A;  5GLB A;  3BQ8 A;  4AFI A;  1BZA A;  3W4P A;  4Q8I A;  5KMW A;  4OP8 A;  1K4F A;  1GSV A;  4WEL A;  4JBF A;  4HY8 A;  2P9V A;  2J3T C;  2V0U A;  3QP8 A;  2XGN A;  3NEC A;  4CLC D;  1M40 A;  3C7U A;  2WKQ A;  5DTK A;  3G32 A;  1DY6 A;  4R4S A;  1KOU A;  4JKT A;  4N1X A;  2BLS A;  1EW0 A;  3BFD A;  1VEU B;  4E6X A;  5FEF A;  3RFB A;  3ITB A;  3HJI A;  3DWZ A;  3E4Q A;  4ZJ2 A;  4BLM A;  3G30 A;  4KG5 A;  5F6A A;  1LSX A;  5HDD A;  4LGW A;  2A24 A;  3T12 B;  1P9W A;  2Y8H A;  1MXO A;  2E8J A;  1SKF A;  3LR4 A;  4EES A;  4EET B;  3P7N A;  3OPR A;  3M2J A;  1F98 A;  1TS6 A;  3W4O A;  3BYD A;  1P97 A;  2XRN A;  4LV1 A;  2V1B A;  3M6H A;  4WM9 A;  1PYY A;  4Y5F A;  1IKI A;  4KQR A;  4Q0I A;  4GD8 A;  4MMN A;  4RQ9 A;  4RX2 A;  1P9R A;  1H3Q A;  4GS9 A;  4WZ4 A;  2JBF A;  4NXF A;  1DP6 A;  3HCY A;  3MMH A;  1XFN A;  3SH9 A;  4ID4 A;  2M1C A;  1SDE A;  4ZBE A;  1GSX A;  3R7W B;  2ZC7 A;  4HHD A;  1L0D A;  3T4L A;  4EU0 A;  3B33 A;  3A3D A;  1Y28 A;  4UQI S;  1DP8 A;  4GHI B;  3ZHH A;  2Z6C A;  3TSG A;  2OOL A;  4PKY A;  1OTI A;  1ZHH B;  1LI0 A; 
#chains in the Genus database with same CATH homology
 4Y2F A;  4GHI A;  4HP4 A;  3KSG A;  4L9G A;  3T4T A;  3PXP A;  2JKR M;  3CUE C;  4WEJ A;  2BAS A;  1OT9 A;  3NOU C;  1UGU A;  2OAQ 1;  4L9F A;  3D3O A;  3PBR A;  4OOL A;  2VEA A;  4ETZ A;  4BBV A;  2KLI A;  3NOT C;  3TJZ C;  4G3K A;  2B18 A;  3K3C A;  1VHM A;  1LSW A;  1T1B A;  2D02 A;  4R3A A;  2VV6 A;  4Z1W A;  3BY8 A;  5G4Y A;  5KIZ A;  3H7W A;  2J80 A;  4I3I A;  2W3F A;  3LIA A;  2VLG A;  2W1R A;  4G3W A;  4R6L A;  3LUQ A;  1OT6 A;  3B47 A;  2NUP C;  2ZOH A;  4IJG A;  5IU1 A;  5C5K A;  2HJ9 C;  3IS2 B;  3E4P A;  3A0R A;  3T4Q A;  2HGV A;  1TS8 A;  2G7U A;  2WKP A;  4GJ4 A;  3E4O A;  3DBA A;  1T19 A;  2K31 A;  4XT2 B;  2VV7 A;  2W0N A;  5DFX A;  5TBM B;  1LT0 A;  4BBT A;  4GLQ A;  4PHT A;  3KSH A;  2PD7 A;  1DRM A;  4CLC C;  3C2W A;  4HP9 A;  1XFQ A;  3C30 A;  4MCW A;  4Q0J A;  5AVE A;  5L8M A;  4Y3I A;  3FC7 A;  3UMD A;  2PT7 A;  3H82 A;  3PBO A;  4O8G A;  2VGL M;  3LYX A;  2YKF A;  3C38 A;  1OTE A;  4ARZ B;  1XJ2 A;  3F1N A;  1UWP X;  2FZ0 A;  2QWS A;  4NXG A;  5HPF A;  3E0Y A;  3VE4 A;  3EGX C;  2Z6D A;  3MQO A;  4FSF A;  1YKD A;  3T4K A;  4JGO A;  1YSQ A;  1OTD A;  2XSS A;  3GDI A;  4NKP A;  5DFY A;  4KQO A;  3IBR A;  4R70 A;  4CQH A;  3ICY A;  3CLO A;  3SW1 A;  1MKM A;  4IHQ A;  3ZYT A;  5MC7 A;  3LFV A;  4EXO A;  1ZTU A;  1OJG A;  5I5L A;  1S4S A;  5DJU A;  4YWZ A;  4I5S A;  4EEU A;  5AVF A;  3LI9 A;  4PAU A;  5FL3 A;  4P6Z M;  3S7N A;  2W1T A;  1T1A A;  4R38 A;  5HDC A;  3R7W A;  3KYQ A;  2W27 A;  2W3G A;  4HH2 A;  3NOP C;  1YAX A;  3OBF A;  5IS1 A;  5K5B A;  2L1M A;  3A0V A;  3F1O A;  1S1Z A;  1STZ A;  4NEE D;  1YSP A;  2V1A A;  3LID A;  3JVV A;  3MQQ A;  3MJQ A;  1N9O A;  4ZRR A;  1T18 A;  3B42 A;  2OAP 1;  3P01 A;  3UB7 A;  4LPZ A;  2PDR A;  5HDS A;  1H8M A;  4KUO A;  3PYP A;  5HSQ A;  1MZU A;  3UB6 A;  3RTY A;  2J3T D;  3GEC A;  3ZQ5 A;  4HJ6 A;  2M7U A;  3KX0 X;  2EWW A;  2WKR A;  4CLC B;  5KSH A;  4JGP A;  2B02 A;  2CMN A;  4P6Z S;  3U2A A;  1D7E A;  2L4R A;  2ZBB A;  5HZH A;  3LR0 A;  3MFX A;  2QJ5 A;  3S7O A;  4CLC A;  1WA9 A;  1V9Z A;  4BMW A;  2OWH A;  2PD8 A;  3EQV A;  3HJK A;  4NXE A;  3IS2 A;  5HD3 A;  5DKK A;  5HWT A;  1D06 A;  3EQU A;  3EGD C;  3T4S A;  3D72 A;  3K2N A;  4II7 A;  4MN5 A;  2O99 A;  3KYZ A;  1S1Y A;  3FPW A;  2O9A A;  4HOI A;  2INW A;  4XT2 A;  3S7Q A;  1TD5 A;  4KQD A;  4H6J B;  4WEK A;  5TBM A;  4HJ3 A;  2LB9 A;  4YOF A;  2JHE A;  2XA7 M;  1G6O A;  1XJ4 A;  3BQA A;  4H6J A;  2V9A A;  3C8C A;  2PR5 A;  1NRJ A;  3LR3 A;  2K2N A;  3UME A;  2P08 A;  1NWZ A;  3PBN A;  4DMZ A;  4ARZ A;  5CX7 A;  5HWV A;  1W63 Q;  4B93 A;  4PKY G;  1XJ3 A;  4I39 A;  2O9C A;  3R4K A;  5DF9 A;  4UQI M;  5LBR A;  1X0O A;  3UB9 A;  3UE6 A;  1S4R A;  2I9V A;  3NJA A;  2EA9 A;  3LR5 A;  2W3D A;  4Q0H A;  3PR6 A;  2YKH A;  1ODV A;  3BY9 A;  3MR0 A;  3JVU A;  4G3V A;  1S67 L;  2VKS A;  2OWJ A;  4FOF A;  2QKP A;  5F5Y A;  2QYB A;  3S7P A;  2NUT C;  3EEH A;  4MN6 A;  3LIF A;  2VGL S;  2XA7 S;  1MC0 A;  1BYW A;  1NLY A;  3LIC A;  3VV4 A;  3BWL A;  4WLA A;  1LL8 A;  2H28 A;  3EOI A;  4LLO B;  1P0Z A;  1V9Y A;  3PBT A;  3CUE A;  3OC2 A;  3G6O A;  3ULF A;  2HV1 A;  4DJ3 A;  4BBU A;  5F68 A;  2R78 A;  4JGQ A;  1TS7 A;  2L0W A;  3T50 A;  4B9O A;  3EWK A;  2IA2 A;  3PHY A;  3KO6 A;  3PBQ A;  3F1P B;  2O9B A;  1UWN X;  4IUK A;  2JKR I;  2W3H A;  3BW6 A;  4HQA A;  2PR6 A;  3VE3 A;  2P7J A;  3VOL A;  4O0P A;  1OPX A;  2QHK A;  3MF0 A;  1W63 M;  2O0Y A;  3F1P A;  3LIE A;  4DN0 A;  2QJ7 A;  4HIA A;  2A2L A;  4GW9 A;  3OCL A;  2HF6 A;  4HI4 A;  2HJE A;  5HD5 A;  5HPI A;  4HH3 A;  4K08 A;  4BWI A;  2PHY A;  4EUV A;  4JGR A;  5TJJ A;  1N9L A;  4LRX C;  2W3E A;  4DJ2 A;  1IFQ A;  2VZW A;  3UB8 A;  2D01 A;  2KOI A;  2JN7 A;  3BQ8 A;  3CIT A;  4AFI A;  2GNX A;  2ZOI A;  3EEA A;  3OLO A;  5G4Z A;  3H7W B;  2GZA A;  3OCN A;  1GSV A;  4L9E A;  3OOV A;  3CWF A;  1T1C A;  4BJP A;  1NLZ A;  5EFW A;  3T4O A;  4WEL A;  2Y79 A;  4HY8 A;  2J3T C;  3TW8 A;  4LRY C;  3CAX A;  4M4X A;  1S66 L;  2V0U A;  1GSW A;  4EW7 A;  4CLC D;  4WUJ A;  4EQ1 A;  2WKQ A;  3CI6 A;  4E04 A;  2JKT I;  3BJN A;  4GCZ A;  3NHQ A;  3TE8 A;  4UEY A;  3RH8 B;  4KUK A;  3TRC A;  1OTB A;  2VA0 A;  4OOM A;  1KOU A;  4EER A;  5A8B A;  4F3L B;  3LIB A;  1EW0 A;  4MN7 A;  3FG8 A;  3MQ0 A;  1LSV A;  4I3A A;  2A24 B;  3RFB A;  2VJW A;  4HNB A;  4I3J A;  4NXB A;  2K7S A;  2KDK A;  3H82 B;  3HJI A;  1TS0 A;  2EWV A;  2JKT M;  3E4Q A;  4F3L A;  5F6A A;  1LSX A;  1F5M A;  5HDD A;  5DJT A;  3IBJ A;  2A24 A;  2GJ3 A;  5DKL A;  4ME4 A;  3F1N B;  4EEP A;  1P9W A;  2Y8H A;  4QPR A;  5AJG A;  2MJ6 A;  2PYP A;  1VB6 A;  3LR4 A;  4LRZ E;  4EES A;  4EET B;  5F69 A;  2XRO A;  3P7N A;  3W2Z A;  1F98 A;  1TS6 A;  4HJ4 A;  1XJ6 A;  4WF0 A;  1P97 A;  2V0W A;  3KSI A;  3K3D A;  2XRN A;  2V1B A;  4GS9 B;  5HL6 A;  5J4E A;  1G28 A;  3O5Y A;  2KX6 A;  3V67 A;  1IOU A;  3MXQ A;  4Y5F A;  2VV8 A;  2ZMV A;  4I38 A;  4Q0I A;  4WL9 A;  1OJ5 A;  2GX5 A;  4MMN A;  4RQ9 A;  4IUH A;  1P9R A;  1H3Q A;  2ZMF A;  4GS9 A;  4O01 A;  5J3W A;  3PBS A;  2VX8 A;  1F9I A;  4NXF A;  1DP6 A;  5HWW A;  3E98 A;  4WN5 A;  3HCY A;  3MMH A;  1JNU A;  1XFN A;  2J3W A;  1TF1 A;  2LB5 A;  4L0L A;  5IT5 A;  3UE3 A;  2M1C A;  2DMW A;  2W1T B;  3LI8 A;  4CLC E;  5J7E A;  1GSX A;  3FPV A;  4MDZ A;  3R7W B;  1DP9 A;  4HHD A;  3T4L A;  4EU0 A;  3B33 A;  1Y28 A;  2FH5 A;  4UQI S;  1DP8 A;  2PYR A;  2M7V A;  4GHI B;  1N9N A;  2Z6C A;  3H9W A;  2OOL A;  4PKY A;  1OTA A;  1OTI A;  4ETX A;  3KSF A;  1ZHH B;  3F1O B;  3A0S A;  3T4J A;  4YNR A;  2P04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...