1XJ4A

Co-bound structure of bjfixlh
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
molecule keywords Sensor protein fixL
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj4A00
4MN5A 1LT0A 3LIFA 2CMNA 3MR0A 1XJ2A 3IS2A 2HV1A 4I3JA 5DKLA 2Z6DA 3CLOA 1V9ZA 4HQAA 2PD8A 4MN6A 3LIEA 1BYWA 1ODVA 1UWNX 2WKQA 2L4RA 1OT6A 3B33A 2B02A 5IS1A 3EEHA 1OTBA 4L9EA 2KDKA 1LSWA 1P0ZA 1T1CA 4EQ1A 4EXOA 2VLGA 4HJ4A 4I5SA 4LRXC 4EERA 1S1YA 4M4XA 3A0RA 4JGRA 2ZBBA 3KX0X 2QKPA 3E4QA 4DJ2A 4EESA 3NOPC 5HD5A 2A24B 4HI4A 3FC7A 1OT9A 1XJ3A 2JN7A 3UB9A 1P97A 4F3LB 4GCZA 3LI8A 4PKYG 1TS8A 2VV7A 3E4PA 3H82A 1WA9A 1DP9A 3LI9A 2EA9A 4I38A 1EW0A 5HSQA 2VV6A 2OWHA 3P7NA 3MFXA 4NXBA 4HH3A 5J4EA 3UB6A 1XFQA 4L9FA 5J7EA 1GSWA 2P7JA 1Y28A 2PD7A 5TBMB 4BBTA 4WLAA 4BBUA 4WUJA 4HIAA 5HDCA 5AVFA 5F68A 2J80A 2QWSA 2GJ3A 4R3AA 4JGQA 3UMDA 4L9GA 2I9VA 1LSXA 3F1NA 3HJKA 5EFWA 3ICYA 1GSVA 3G6OA 2WKPA 2V1BA 2BASA 3E4OA 3MXQA 3NOTC 3IBRA 5HDDA 5HD3A 1S4SA 3ZQ5A 4LLOB 2YKFA 1NWZA 1OTDA 1T1AA 2OWJA 1LL8A 3GECA 1V9YA 4YWZA 4PKYA 2V1AA 3EWKA 1T19A 1OJ5A 1TS7A 1VB6A 2H28A 2L0WA 3LIDA 3NJAA 3NOUC 3VE4A 4EEPA 4EEUA 3LUQA 4HHDA 4K08A 3UE6A 1N9LA 1S66L 2VV8A 2R78A 1TS0A 3BY8A 2V0WA 1OTIA 3OLOA 5F5YA 5IU1A 4WL9A 2PDRA 3LICA 2V0UA 4KQDA 2ZOIA 1X0OA 2VEAA 3H7WB 4NXGA 5HZHA 1T1BA 3GDIA 4KUKA 1MZUA 3K3CA 5HDSA 1UWPX 2L1MA 4HOIA 3ULFA 2PYRA 3A0VA 1S1ZA 3C2WA 4NXEA 3BY9A 4WN5A 3VE3A 3F1PB 2D01A 5AVEA 5F6AA 2PYPA 3F1NB 4EW7A 2PHYA 4HH2A 1GSXA 3H7WA 5I5LA 3H82B 3UB8A 3F1OA 3SW1A 3UMEA 2W27A 4DJ3A 4H6JB 2Z6CA 1DRMA 4B9OA 1JNUA 5G4YA 5G4ZA 1XJ6A 4HP9A 2OOLA 3LYXA 3PYPA 4GW9A 5KIZA 2PR5A 2PR6A 1DP6A 4XT2A 2WKRA 3UB7A 1TS6A 1F98A 2INWA 4JGPA 4LPZA 5HWWA 1N9NA 3D72A 2ZOHA 4HY8A 3PHYA 5DJUA 5J3WA 2QJ7A 3RH8B 4LRYC 4I3AA 5HWVA 2D02A 2KX6A 1DP8A 2A24A 3CAXA 2V9AA 4GHIA 2QHKA 4HNBA 3T50A 4E04A 2QJ5A 1KOUA 5HWTA 4EETB 3A0SA 4F3LA 4HP4A 1D06A 3LIAA 3LIBA 4JGOA 3RTYA 3K3DA 4R6LA 4R38A 4WF0A 3MQOA 4HJ6A 2JHEA 1T18A 4KUOA 1S67L 3VOLA 4RQ9A 1XJ4A 3H9WA 2K7SA 1UGUA 3BWLA 3MJQA 4XT2B 5F69A 1OJGA 1S4RA 5A8BA 4I3IA 3CWFA 4GHIB 2M1CA 1OTEA 4LRZE 5DJTA 1G28A 4GS9A 3HJIA 1XFNA 3IS2B 3F1OB 2W0NA 1D7EA 4GS9B 4HJ3A 4I39A 1LSVA 4H6JA 4NXFA 4R70A 5TBMA 1F9IA 5DKKA 3FG8A 2YKHA 3NHQA 4BBVA 3C8CA 3MQQA 1OTAA 1N9OA 3F1PA
chains in the Genus database with same CATH superfamily
3BYDA 4CPKA 5HAIA 3MR0A 2H0YA 3S22A 1O7EA 2LB9A 4P87A 3ZG7B 2WKQA 3NDEA 5FASA 2KDKA 5EOOA 1PZOA 4YOFA 4CQHA 3VFHA 5EPHA 4OVDA 1K25A 1A0KA 5HD5A 2GNXA 4F3LB 4R3JA 4EQIA 1ONHA 4Y0UA 4KG2A 1PNEA 5HSQA 4IEDA 3U4LP 4WM9A 1XFQA 4R3BA 5J7EA 1XA1A 5AQBA 4MBKA 3C38A 4YFMA 5A92A 4R3AA 5IT5A 4L9GA 3HLFA 1GCEA 4Y5FA 3UE3A 2WKPA 1K55A 3MBZA 1T1AA 5FA7A 1PWDA 3BW6A 4U0TA 2ZMVA 4BL3A 4N92A 3BY8A 2OAP1 2V0UA 1IELA 4MDZA 4OQHA 4MEZA 1FCNA 1L0FA 3WS0A 3ULFA 5FSRA 2IWCA 2XRNA 5F6AA 3H7WA 1MPLA 2W27A 3DBAA 3QP2A 1VETB 2PR5A 3HVFA 3N8LA 2XQZA 3TJZC 4HBTA 4WZ4A 3IF6B 1KOUA 2LB5A 4HESA 3VMAA 1K54C 1S67L 2XA7M 3VOLA 1K4FA 1L0EA 3WRTA 3HUNA 4I3IA 5DTTA 5FI2A 3BFCA 1F9IA 2OLUA 3ISGA 4UA7A 5GHYA 2HJ9C 4KZ7A 3UDFA 2Y2LA 3CLOA 5CECA 2EWVA 4BMWA 1UWNX 4NK3A 4NETA 4L9EA 3GR2A 1XKZA 3VSLA 3KSGA 2MJ6A 1F2KA 4PM7A 4A5RA 2QPNA 5DFYA 3C4PA 1L0DA 5HFOA 3M6HA 4S2NC 1OMEA 1H8ZA 3IF5A 2O9CA 5EFWA 2Y2IA 3ZQ5A 1PWGA 2XR0A 1N9LA 5EOEA 3V39A 4CLCC 4E3LA 4Y2FA 4OOYA 5KSCA 4JF6A 3Q7VA 1ERQA 4DE0A 3H82B 3TW8A 3UMEA 4H6JB 3OPRA 4CJNA 3GTCA 4N1HA 3LR0A 5HL6A 1PI5A 3Q7ZA 5DFXA 4HNBA 1H3QA 4X1LA 4WMCD 4HP4A 3QNBA 3ZG5A 3VP3A 1MKMA 4M3KA 4WEKA 3H9WA 1K57C 4U0XA 1D7EA 1RGYA 2WK0A 4G3VA 3HREA 1KDWA 3WS4A 1FSWA 1HZOA 2C5WB 4I3JA 3ZG9B 2ZL1B 4YNRA 1CI8A 4FH4A 1TD5A 5AQ9A 4EXOA 2VLGA 2PRFA 1L2SA 1VETA 2UV0E 4N9LA 4D60A 3H82A 4GD8A 1VHMA 4Y15A 3BQAA 3IBJA 5F1GA 5HX9A 3EEAA 2XDMA 1W5DA 5HDCA 4GDBA 1VM1A 1W63Q 4Y3IA 4OQ0A 3UNWA 3S4XA 2OSUA 5K5BA 5FL3A 3QP6A 4YWZA 3EWKA 2H28A 3KO6A 2GDNA 1J3WA 2ZQDA 4JXSA 1BULA 5TJJA 2R78A 3E2LA 2HDQA 2VJWA 3NCKA 2ZOIA 4X25A 3LEZA 5E2HA 3P98A 4JF5A 1S1ZA 3PBNA 3SS3A 4EW7A 4GOGA 3HL9A 3GRJA 1Y54A 1YLWA 2INWA 3OBFA 4H8RA 3BFEA 1SCWA 4JXVA 3BRMA 1PIOA 3PTEA 2NUPC 4EETB 1FR1A 5FQQA 4FD8A 3MMHA 3FWLA 3UPNA 3T4JA 2ZQAA 5FATA 2G7UA 3BLSA 3CPTB 5F82A 5DJTA 3BEBA 4QD4A 5EVIA 1ZTUA 3C8CA 1NRJA 3HLWA 3DAVA 4QY5A 2CMNA 5EUAA 3MKEA 3IHBA 4KZ4A 2HPBA 1T1CA 1NLZA 3SS5A 4ETXA 1YLJA 3WS2A 3NIAA 3NC8A 1ES2A 1MXOA 2P7JA 2PAVP 2QWSA 4JGQA 2V1BA 1NYMA 1W7FA 5DF7A 3BFFA 2V1AA 3BJNA 4EEPA 4EUVA 4HHDA 3I7JA 3DW0A 5TGFA 5TFQA 5A91A 1FOFA 2WGWA 2WUQA 1LHYA 3Q81A 4DE1A 2PYRA 2Y55A 4K91A 2C6WB 4E3KA 2VGLS 1ESUA 5KIZA 5EECA 3CZDA 2M7VA 2ZOHA 3FPWA 4HEFA 3RJUA 3IH8A 5D3OA 5L8MA 2IWDA 2V9AA 4UQIM 4KQOA 3LIAA 3PXPA 3KSFA 2JKRM 3MQOA 4QPRA 3CG5A 3MJQA 3B47A 3GMWA 3CWFA 1OTEA 5TBMB 1G28A 3HJIA 4GS9A 4MLLA 3F1OB 1LI9A 1BZAA 4Q0IA 4FCFA 3ZFZA 4XXRA 3BM6A 4BLMA 2PBDP 1VQQA 4N1XA 2L4RA 3EEHA 4IUHA 5EVEA 1WYCA 3N7WA 1ZKJA 4OP5A 3NOPC 5KSHA 4E3NA 2JC7A 2Y59A 3P7NA 3MFXA 1E3UD 3W4QA 4B88A 3UDIA 1D1JA 4JXGA 1SDEA 3AGEA 3HLEA 2I9VA 1NRFA 4PPRA 1O07A 4KQQA 4FTXA 2XGNA 4X68A 4PKYA 3V50A 3MZEA 1VB6A 1KE0A 3LEQA 3ZHHA 3ZCZA 3VP2A 1HLUP 2JKRI 2BG1A 1UWPX 1HVBA 4P6ZM 2A2LA 5FI7A 3S7PA 1RGZA 5F1FA 2ZC7A 3ZVWA 3B42A 4UQIS 3DWKA 3BLMA 2PR6A 1KGFA 1H8MA 3UE0A 1TS6A 4PM8A 4KZ9A 5IHVA 4C3QA 4HY8A 3ZDJA 4Q0HA 3D4FA 4LCMA 1IYSA 4OPYA 5AJGA 2ZL1A 4GLQA 3VP4A 1YSQA 3T12B 4Q0JA 2J9PA 4WF0A 5FAOA 4XT2B 1TF1A 2Y2KA 1JWPA 4OLGA 4O0PA 2JKTI 3LR3A 1PFLA 4ESPA 4L0LA 4BBVA 2A49A 1N9OA 3N8SA 5FQKA 1ZC2A 2E8IA 2ZM2A 2ZJ9A 1K6RA 1Z09A 3IX4A 3IWQA 4JGRA 4FSFA 4X55A 4UA9A 1XJ3A 3UB9A 1MWTA 1P97A 4DKIA 1DP9A 1BT5A 3SH9A 1MBLA 4E3OA 5HAQA 4BBTA 4RX2A 3S7OA 5AVFA 5F68A 2P04A 3UMDA 1BLSA 3F1NA 3QP4A 3E4OA 3MXQA 4EV4A 1JVJA 2AVXA 1NWZA 2OWJA 2H10A 3FPVA 1SKOB 3LIDA 4Z1WA 3PBTA 3C5AA 2O9BA 3UE6A 3G2YA 5FDHA 2ZM8A 3W4PA 4X1MA 1Z6FA 2DMWA 2PU2A 4LFUA 3SH7A 4GKUA 3D9YA 1PZPA 2HP6A 2QMIA 1YT4A 5FI6A 2Q0OA 1K0KA 3PYPA 4E6XA 1G6AA 4DE2A 4FOFA 1CK3A 4C6YA 4DF6A 4GHIA 1BUEA 4F3LA 1VEUA 3A0SA 5CRFA 5CEDA 4ETZA 3P01A 1RCJA 5E2FA 5F69A 4LV3A 3IF6C 3TG9A 4P6BA 3EQUA 2Y2GA 4EBPA 4OQIA 3VFFA 2W1TA 3LIFA 4IUKA 5TR7A 1Q2PA 4LV0A 2V8FA 3PAEA 5IS1A 3O87A 2WZZA 4ID4A 1MWRA 2Y2HA 4HI4A 1K6SA 5FQJA 1WA9A 3LI9A 2R9WA 3QNCA 4NXBA 1GA9A 4IBXA 3MF0A 4IHQA 4DDSA 2O9AA 1XGJA 4NG2A 4E3MA 1GSVA 2JKGA 1YAXA 1IKGA 1SHVA 3PBOA 3ZG0A 4LLOB 2VGLM 4Y13A 5KZHA 2Y2QA 4WYYA 3T4OA 3G31A 4DRTA 4WL9A 3N6IA 3H7WB 2G2UA 1XA7A 4CLCB 5EM0A 4KZ6A 3F1PB 4P6ZS 2PHYA 4ME4A 5AQAA 2WAFA 3LYXA 2J3TD 3MKFA 1CF0A 5EVID 4ZTKA 1HTZA 1NZUA 5L07A 1Q2QA 2PBYA 1K56A 2IWBA 4JGOA 4S2KA 3N4IA 3A3EA 1ERMA 1XJ4A 4GJ4A 3V5MA 2ZM0A 3M6BA 1NJ4A 4R70A 5DKKA 2Y8HA 2OAQ1 3SW1A 1OTAA 2VKSA 3IWIA 2DRWA 3LR4A 3MS6A 1V9ZA 3G2ZA 1M6KA 2HZ5A 5F83A 4X6TA 1KE3A 2ZQ8A 4LRXC 3ITBA 3NI9A 2R9XA 1FR6A 3RXWA 3HLGA 4EESA 3B3XA 3SH8A 4S2MA 1NZOA 3LI8A 1W79A 1TS8A 3E4PA 4WELA 2Y2NA 4UA6A 4EBNA 3MXRA 1RP5A 3IT9A 2J80A 2VX8A 1JWZA 5FQMA 1LSXA 1YLZA 3LY3A 3CMZA 4KQRA 3UPPA 3ICYA 5HDDA 1E4DA 3PBRA 1OTDA 1LL8A 1K55C 5EV0A 2L0WA 3GVBA 3HUMA 5FEFA 2X02A 4OOLA 4OPRA 2Q9NA 4WZ5A 2P9VB 3EOIA 3JVUA 2WKHA 3VP1A 2XA7S 5AVEA 3S7QA 1CI9A 1GSXA 3O88A 5E2EA 3BFDA 3W4OA 4PMAA 3R4KA 3OC2A 3UB7A 3E2KA 4ZBEA 4Y0TA 3PHYA 4D2OA 1TDGA 4GB7A 4E04A 1K38A 3T4KA 3MQ0A 3DTKA 3RTYA 1EROA 2HGVA 2XEPA 5A8BA 2W0NA 3SZTA 3OPHA 3T1XA 3OOVA 1EW0A 3W8KA 2HDRA 2DCFA 1YLPA 4WMCA 1ZG4A 4KZ8A 2Y79A 4GN2A 4O8GA 4II7A 4EQ1A 3ZNYA 2XH9A 4EWFA 3N8RA 1STZA 5CEBA 3T1SA 2X01A 1NLYA 2OV5A 4PHTA 4B4XA 4JBFA 4QB8A 1GSWA 1ONGA 1FIKA 4ARZB 2W3GA 4UEYA 3T4LA 4JXWA 2XF3A 3FV7A 2P9VA 4OPZA 3A3DA 4JF4A 4KZ5A 2VZWA 3PR6A 1KDSA 4K08A 4Q8IA 3EGXC 2JKFA 4Y0OA 3OPPA 3CHWP 2W1RA 4BD0A 1GA0A 3IXBA 1NYYA 1XX2A 3F1NB 4YINA 4BJPA 1G68A 4MBFA 3RXXA 4IJGA 4LV2A 4MBHA 3UE1A 4Y17A 5CHMA 3BQ8A 3M2KA 3ITAA 4DXCA 5GLCA 2QJ5A 3G32A 2FFYA 3K3DA 3IF6A 4PAUA 1TEMA 1CEFA 1T18A 3RFBA 5HAPA 1G6OA 1SZVA 4R4SA 4ZRRA 3G34A 3Q1FA 3UO9A 3G35A 4QJGA 1YM1A 3FG8A 3NHQA 3DTIA 3G4PA 1EI5A 1XGIA 2PU4A 3QP5A 3E98A 3B33A 5L10A 4OH0A 1IOUA 4PM5A 1P0ZA 3OPLA 4EERA 3SS4A 3IX8A 1KVLA 1NXYA 2A24B 2XD1A 4PKYG 1G5UA 2VV6A 1BSGA 4WZ5C 4HH3A 4XUXA 2VK3A 2Y2JA 3E0YA 5DTSA 3ZNTA 3CJMA 2EXBA 2WGVA 5GLBA 2WGIA 4DDYA 1FCOA 2J3WA 1FQGA 3K2NA 2YKFA 3GECA 2GX5A 4NEED 1JWVA 3EGDC 1YQSA 2EX2A 4P85A 4UAAA 1QMFA 3R7WB 4S2IA 2WZXA 3LO7A 1PYYA 5F5YA 2HP9A 2V2FF 4NXGA 5CGWA 5HZHA 3K3CA 2V1ZA 2Q9MA 2VA0A 5BOHA 2WADA 4CLCD 2Y4AA 4BD1A 4MN7A 4ZJ2A 4B9OA 1U60A 5G4YA 1DP6A 5CTMA 3RH8B 4E3IA 5DVAA 1K54A 1YKDA 3DTMA 5FAQA 2DNSA 2V20A 3IWOA 4S2OA 1CJFA 1UGUA 5U47A 1OJGA 1MWSA 2M1CA 1M40A 4LRZE 1DJBA 1YLTA 4MMNA 2B18A 4QU3A 1W8YA 4E3JA 3MQQA 1LI0A 2WYXA 5HW3A 3MSHA 4JPMA 2Z2MB 5DKLA 5EVIC 4FH2A 4XUZA 3LIEA 3A3IA 3HLDA 3AGDA 2W3DA 4X53A 2W3EA 3D3OA 3P09A 3A0RA 4DJ2A 2QKPA 3UN7A 4ARZA 4OLDA 3O86A 3MZDA 1YMXA 1BLCA 4S2JA 2OWHA 2VGJA 3HUOA 1TDLA 4LCLA 5MC7A 4BBUA 4HIAA 3HCYA 4X56A 4O01A 5GHXA 1DJAA 3IXHA 1WE4A 2BASA 4E6WA 1ZG6A 1ACFA 3BFGA 1ZHHB 3JPUA 1MY8A 3AGFA 4BWIA 1ALQA 2HP5A 2V0WA 1OTIA 1XPBA 5DTKA 4Y7PA 2EFUA 4KQDA 2EXAA 3GDIA 3C7VA 1K56D 1DJCA 5CXWA 4HH2A 2EX9A 3UB8A 3CITA 3F1OA 4OP8A 3T4SA 2P74A 5M19A 2OOLA 2XLNA 3T1RA 4BQMA 3PAGA 3IH9A 3D72A 5CHUA 2G2WA 2Y2OA 3WS1A 2D02A 5GLDA 3T50A 2QHKA 2JE5A 5FQ9A 3FYZA 1D06A 3LIBA 1K57A 4HJ6A 5G18A 5C5KA 1Y4OA 4P0MA 3JVVA 4RA7A 3EQVA 3BWLA 1IYOA 3LCEA 3IS2B 5TBMA 4GS9B 4H6JA 4NXFA 3NULA 3CPTA 3IQAA 5J8XA 5HPFA 3S7NA 3F1PA 1LL9A 4EU0A 1GHPA 2EX8A 5EE8A 1S1YA 2PT7A 4MCWA 3FZCA 4GCZA 3WRZA 3C7UA 1L3LA 4L9FA 1IKIA 2WAEA 4KZBA 2QZ6A 1XXMA 5CX7A 5DF9A 3SOIA 3Q82A 3HJKA 3KSHA 4KG6A 1W63M 4KG5A 5HD3A 1S4SA 1GHIA 2BTFP 1MC0A 2W1TB 4DN0A 1ES3A 3LUQA 3M2JA 3OLOA 2FZ0A 1JTDA 1KVMA 1PW8A 4NKPA 1T1BA 1MZUA 2ZC4B 4NXEA 4ZDXA 5I5LA 2ZQ7A 4DJ3A 1NY0A 5G4ZA 4HP9A 1LL5A 3QP8A 4LPZA 1DP8A 1SDNA 3CAXA 1FILA 3ZVTA 5L2FA 4RQ9A 3NDGA 4IVIA 2WGWB 1LSVA 1GHMA 2HF6A 4RX3A 2XK1A 1FCMA 2W3FA 4KZ3A 3UPOA 3GV9A 1SKOA 1LT0A 2ZC5B 1XJ2A 4EBLA 4MNRA 1N9BA 3HBRA 5EM1A 5A93A 1OTBA 1LSWA 4HJ4A 3LFVA 4IBRA 2J3TC 3E4QA 3FC7A 5M18A 3NBLA 2VV7A 3O5YA 3OCLA 5HPIA 1ES5A 4WLAA 3V3SA 5JYOA 1CQAA 2CC1A 4RYEA 3C30A 4IVKA 1ES4A 1I2SA 2O99A 3TRCA 3VOZA 2QYBA 4OPQA 3R7WA 3ZGAB 3QP1A 1S66L 1TS0A 3T4TA 4O7DA 3DTEA 3VP0A 4DXBA 5GLAA 3UB5P 2ZLYA 4KUKA 2XSSA 1MWUA 5CGXA 1YMSA 4R0QA 5EVLA 2PYPA 3FKVA 2KLIA 2Z6CA 1SKFA 2WKRA 2ZC6B 3ZG8B 1N9NA 5FEGA 3CUEA 5DJUA 4I3AA 4JKTA 5HWVA 5E43A 2I72A 2KX6A 4S2PA 5I94A 5FAPA 3L9KA 2ZQCA 4ZJ1A 3MZFA 1XFNA 3TSGA 5L09A 3G30A 1F5MA 4GDNA 4MN5A 2M7UA 1LLBA 1ESIA 3IS2A 2HV1A 2JBFA 2Z6DA 2HDSA 2Y2PA 2W3HA 2XFTA 1WYBA 4M4XA 3KX0X 2ZC3B 1IYQA 2EA9A 2H5SA 1OPXA 4B93A 3BECA 5J4EA 1I2WA 4GD6A 1L0GA 2EWWA 3G6OA 4K0XA 4OONA 3U2AA 3NOTC 1PRQA 3MXSA 4GNUA 1T19A 1OJ5A 5M1AA 3T1QB 3VE4A 4WEJA 2KOIA 2VV8A 1KGEA 5IU1A 1YSPA 2PDRA 2H0TA 3LICA 3VV4A 3C4OA 1X0OA 2VEAA 4DMZA 5HDSA 2L1MA 3A3JA 1H5XA 4WN5A 2D01A 2B5RA 2Z2LB 3Q07A 1XP4A 4FUWA 4GW9A 2ZQ9A 1BLHA 3QHYA 5J3WA 1C3BA 3GSGA 1KGGA 1BLPA 3ZYTA 3TE8A 3O3VA 4R6LA 1AWIA 1FSYA 4KUOA 4AFIA 2K7SA 3LR5A 1S4RA 4GHIB 1J9MA 1PW1A 4S2LA 3KYEA 3PBSA 2B95A 4DE3A 1QMEA 3GQZA 2O0YA 1YPRA 1E3UA 4HQAA 2PD8A 4KZAA 1BYWA 5CHJA 4KENB 2B02A 3A3FA 5E2GA 1PWCA 4I5SA 2ZMFA 3IXGA 1TVFA 2EX6A 4I38A 2J7VA 2UWXA 3UB6A 2PD7A 4WBGA 4WUJA 3IX3A 4PM6A 2BLSA 2GJ3A 3V3RA 5HARA 4S2NA 3DWZA 2K31A 2HDUA 3KSIA 5HL1A 1W8QA 3IBRA 4ZJ3A 3W2ZA 4CLCE 1P9RA 4R1GA 2FH5A 1V9YA 3NOUC 4GZBA 1TS7A 4F94A 1HD8A 1EWZA 4LENA 3CI6A 3KYZA 4OQGA 3V67A 2J9OA 1N4OA 3IHAA 4HOIA 1E25A 4UHUA 3A0VA 4RVAA 1YLYA 2A3UA 4QY6A 2K2NA 4X69A 4ZAMA 2FFFB 3KYQA 4G3WA 3OZHA 2JCHA 4R4RA 2P08A 3FKWA 4JGPA 3S1YA 1DY6A 1CEGA 1I5QA 4QWOA 2A24A 3NECA 4OKPA 1MKIA 3VSKA 4C75A 4OOMA 3PBQA 2IA2A 1P9WA 1H0MA 2ACGA 2E8JA 1KE4A 1JTGA 3MFDA 2J8YA 4I39A 3VOYA 4HJ3A 4N9KA 2HJEA 4EUZA 3JYIA 4JLFA 3L7HA 2YKHA 4MN6A 5AQ7A 3UY6A 1ODVA 1OT6A 5JYPA 2X71A 2Y2MA 2ZBBA 4QHCA 3LY4A 1OT9A 2JN7A 1S6RA 2JKTM 3WWXA 2GZAA 2ZD8A 2VGKA 5DF8A 1Y28A 1VEUB 4Z9QA 4K0WA 2WKIA 2EFXA 3T4QA 5A90A 3OCNA 2XFSA 4R23A 1K4EA 3NJAA 5GHZA 4EEUA 4LGWA 2XROA 1H8YA 1PI4A 2RCXA 3HLCA 4U3TA 2NUTC 4LV1A 3VE3A 3C2WA 3BY9A 3TOIA 2Y91A 4PM9A 4G3KA 3UDXA 1DRMA 3HLBA 1JNUA 2V8CA 1XJ6A 3CUEC 5CTNA 4XT2A 3IXDA 1F98A 5CGSA 5HWWA 2QJ7A 4LRYC 1AXBA 4BL2A 4HBUA 5CERA 5HWTA 3LGOA 1IEMA 4R38A 5LBRA 1IFQA 2JHEA 4CLCA 1BTLA 4BENA 1IYPA 3WS5A 4B4ZA 1S0WA 3NY4A 2RL3A 5FDSA 5FQIA 2OLVA 2ZMAA 2XD5A 2WKEA 5GL9A 5KMWA 5EVIB 3Q7VB
chains in the Genus database with same CATH topology
1LT0A 3MR0A 1XJ2A 2LB9A 2WKQA 2Y79A 2L4RA 4O8GA 3EEHA 1OTBA 4IUHA 2KDKA 1LSWA 4II7A 4EQ1A 4HJ4A 4YOFA 3LFVA 4CQHA 2J3TC 3E4QA 3NOPC 5HD5A 1STZA 2GNXA 3FC7A 4F3LB 5KSHA 2VV7A 5HSQA 3O5YA 3P7NA 3OCLA 1NLYA 3MFXA 5HPIA 1XFQA 4PHTA 5J7EA 1GSWA 4WLAA 4ARZB 3C38A 2W3GA 4UEYA 4R3AA 5IT5A 4L9GA 2I9VA 3T4LA 3C30A 4Y5FA 3UE3A 2WKPA 2O99A 3TRCA 2VZWA 1T1AA 3PR6A 2QYBA 4PKYA 1VB6A 3R7WA 4K08A 3BW6A 2ZMVA 1S66L 1TS0A 3T4TA 3EGXC 3BY8A 2OAP1 2V0UA 4MDZA 2W1RA 4KUKA 2JKRI 1UWPX 4P6ZM 2A2LA 3ULFA 2XSSA 3S7PA 2XRNA 5F6AA 2PYPA 3F1NB 3H7WA 2KLIA 3B42A 4BJPA 2W27A 2Z6CA 3DBAA 4UQIS 2PR5A 4IJGA 2PR6A 1H8MA 2WKRA 1TS6A 1N9NA 4HY8A 3CUEA 4Q0HA 5DJUA 3TJZC 4I3AA 3BQ8A 5HWVA 5AJGA 2KX6A 4GLQA 1YSQA 2QJ5A 1KOUA 2LB5A 3K3DA 4Q0JA 4WF0A 4PAUA 3RFBA 1T18A 3VOLA 1S67L 2XA7M 1G6OA 4XT2B 1TF1A 4I3IA 4ZRRA 1XFNA 4O0PA 2JKTI 3LR3A 1F9IA 3FG8A 4L0LA 3NHQA 4BBVA 1N9OA 2HJ9C 1F5MA 4MN5A 2M7UA 3E98A 3IS2A 2HV1A 2Z6DA 3CLOA 2EWVA 2W3HA 1UWNX 4BMWA 3B33A 1IOUA 4L9EA 1P0ZA 4EERA 4M4XA 3KSGA 4JGRA 2MJ6A 3KX0X 4FSFA 2A24B 1XJ3A 3UB9A 1P97A 4PKYG 1DP9A 2EA9A 1OPXA 4B93A 2VV6A 4HH3A 5J4EA 5DFYA 4BBTA 3E0YA 3S7OA 5AVFA 5F68A 2P04A 3UMDA 2EWWA 3F1NA 2O9CA 5EFWA 3G6OA 3E4OA 3MXQA 3U2AA 3NOTC 2J3WA 3ZQ5A 3K2NA 2YKFA 1NWZA 2OWJA 3GECA 2GX5A 3FPVA 1T19A 1OJ5A 3LIDA 4NEED 3EGDC 4Z1WA 3VE4A 3PBTA 2O9BA 3UE6A 1N9LA 3R7WB 4WEJA 2KOIA 2VV8A 5F5YA 5IU1A 1YSPA 2PDRA 3LICA 3VV4A 4CLCC 1X0OA 2VEAA 4NXGA 4DMZA 5HZHA 2DMWA 5HDSA 3K3CA 2L1MA 4Y2FA 2VA0A 4WN5A 2D01A 4CLCD 3H82B 3TW8A 3UMEA 4H6JB 4MN7A 4B9OA 5G4YA 3PYPA 4GW9A 1DP6A 4FOFA 3LR0A 5J3WA 3RH8B 5HL6A 5DFXA 3ZYTA 1YKDA 1H3QA 4GHIA 4HNBA 4F3LA 3A0SA 4HP4A 3TE8A 4R6LA 4ETZA 3P01A 4KUOA 1MKMA 4AFIA 4WEKA 3H9WA 2K7SA 3LR5A 1UGUA 5F69A 1OJGA 1S4RA 4GHIB 2M1CA 4LRZE 4MMNA 1D7EA 2B18A 3EQUA 3PBSA 4G3VA 3MQQA 2O0YA 2W1TA 3LIFA 4IUKA 5DKLA 4I3JA 4HQAA 2PD8A 3LIEA 1BYWA 4YNRA 2W3DA 2B02A 5IS1A 1TD5A 4EXOA 2W3EA 2VLGA 4I5SA 3D3OA 2ZMFA 3A0RA 4DJ2A 2QKPA 4HI4A 4ARZA 4I38A 3H82A 1WA9A 3LI9A 1VHMA 2OWHA 3BQAA 4NXBA 3UB6A 5MC7A 3IBJA 2PD7A 3EEAA 4BBUA 4WUJA 4HIAA 3HCYA 3MF0A 5HDCA 4IHQA 4O01A 2O9AA 2GJ3A 1W63Q 4Y3IA 2K31A 1GSVA 3KSIA 2BASA 1YAXA 3IBRA 3W2ZA 5K5BA 4CLCE 1P9RA 3PBOA 4LLOB 2VGLM 5FL3A 2FH5A 1V9YA 4YWZA 3EWKA 3NOUC 1ZHHB 1TS7A 3T4OA 2H28A 3KO6A 4BWIA 5TJJA 2R78A 3CI6A 3KYZA 2V0WA 1OTIA 3V67A 2VJWA 4WL9A 4KQDA 2ZOIA 3H7WB 3GDIA 4CLCB 4HOIA 3A0VA 1S1ZA 3PBNA 3F1PB 4P6ZS 2K2NA 4EW7A 2PHYA 4HH2A 3UB8A 3CITA 3F1OA 4ME4A 3T4SA 2OOLA 3LYXA 3KYQA 4G3WA 2J3TD 2INWA 2P08A 4JGPA 3OBFA 3D72A 2D02A 2A24A 3T50A 2NUPC 2QHKA 4EETB 1D06A 3LIBA 3MMHA 4JGOA 4OOMA 3PBQA 2IA2A 4HJ6A 5C5KA 1P9WA 3T4JA 3JVVA 2G7UA 1XJ4A 3EQVA 4GJ4A 3BWLA 5DJTA 3IS2B 4I39A 4GS9B 4HJ3A 4R70A 2HJEA 4H6JA 4NXFA 5TBMA 5DKKA 2YKHA 2Y8HA 1ZTUA 3C8CA 2OAQ1 3S7NA 2VKSA 1OTAA 5HPFA 3F1PA 3SW1A 1NRJA 4EU0A 2CMNA 3LR4A 1V9ZA 4MN6A 1ODVA 1OT6A 1T1CA 4LRXC 1NLZA 1S1YA 2PT7A 2ZBBA 4EESA 4MCWA 4ETXA 1OT9A 2JN7A 4GCZA 3LI8A 2JKTM 1TS8A 2GZAA 3E4PA 4WELA 4L9FA 2P7JA 1Y28A 2J80A 2QWSA 2VX8A 4JGQA 5CX7A 1LSXA 5DF9A 3HJKA 3KSHA 3ICYA 2V1BA 1W63M 5HDDA 3T4QA 5HD3A 1S4SA 3PBRA 3OCNA 1OTDA 1LL8A 1MC0A 2W1TB 2V1AA 3NJAA 2L0WA 3BJNA 4EEPA 4EEUA 4EUVA 4DN0A 3LUQA 4HHDA 4OOLA 3OLOA 2FZ0A 4NKPA 2XROA 3EOIA 3JVUA 1T1BA 1MZUA 2NUTC 2PYRA 3VE3A 3C2WA 4NXEA 3BY9A 2XA7S 5AVEA 3S7QA 1GSXA 5I5LA 4G3KA 4DJ3A 1DRMA 1JNUA 2VGLS 5G4ZA 3CUEC 1XJ6A 4HP9A 5KIZA 3R4KA 4XT2A 3OC2A 3UB7A 1F98A 4LPZA 2M7VA 5HWWA 2ZOHA 3PHYA 2QJ7A 4LRYC 3FPWA 5L8MA 1DP8A 3CAXA 2V9AA 4E04A 4UQIM 5HWTA 3T4KA 4KQOA 3LIAA 3PXPA 3MQ0A 3RTYA 3KSFA 5LBRA 2JKRM 4R38A 3MQOA 1IFQA 2JHEA 4QPRA 4CLCA 4RQ9A 2HGVA 3MJQA 5A8BA 3B47A 3CWFA 1OTEA 1G28A 4GS9A 3HJIA 5TBMB 3F1OB 2W0NA 1LSVA 2HF6A 3OOVA 4Q0IA 2W3FA 1EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN5 A;  1LT0 A;  3LIF A;  2CMN A;  3MR0 A;  1XJ2 A;  3IS2 A;  2HV1 A;  4I3J A;  5DKL A;  2Z6D A;  3CLO A;  1V9Z A;  4HQA A;  2PD8 A;  4MN6 A;  3LIE A;  1BYW A;  1ODV A;  1UWN X;  2WKQ A;  2L4R A;  1OT6 A;  3B33 A;  2B02 A;  5IS1 A;  3EEH A;  1OTB A;  4L9E A;  2KDK A;  1LSW A;  1P0Z A;  1T1C A;  4EQ1 A;  4EXO A;  2VLG A;  4HJ4 A;  4I5S A;  4LRX C;  4EER A;  1S1Y A;  4M4X A;  3A0R A;  4JGR A;  2ZBB A;  3KX0 X;  2QKP A;  3E4Q A;  4DJ2 A;  4EES A;  3NOP C;  5HD5 A;  2A24 B;  4HI4 A;  3FC7 A;  1OT9 A;  1XJ3 A;  2JN7 A;  3UB9 A;  1P97 A;  4F3L B;  4GCZ A;  3LI8 A;  4PKY G;  1TS8 A;  2VV7 A;  3E4P A;  3H82 A;  1WA9 A;  1DP9 A;  3LI9 A;  2EA9 A;  4I38 A;  1EW0 A;  5HSQ A;  2VV6 A;  2OWH A;  3P7N A;  3MFX A;  4NXB A;  4HH3 A;  5J4E A;  3UB6 A;  1XFQ A;  4L9F A;  5J7E A;  1GSW A;  2P7J A;  1Y28 A;  2PD7 A;  5TBM B;  4BBT A;  4WLA A;  4BBU A;  4WUJ A;  4HIA A;  5HDC A;  5AVF A;  5F68 A;  2J80 A;  2QWS A;  2GJ3 A;  4R3A A;  4JGQ A;  3UMD A;  4L9G A;  2I9V A;  1LSX A;  3F1N A;  3HJK A;  5EFW A;  3ICY A;  1GSV A;  3G6O A;  2WKP A;  2V1B A;  2BAS A;  3E4O A;  3MXQ A;  3NOT C;  3IBR A;  5HDD A;  5HD3 A;  1S4S A;  3ZQ5 A;  4LLO B;  2YKF A;  1NWZ A;  1OTD A;  1T1A A;  2OWJ A;  1LL8 A;  3GEC A;  1V9Y A;  4YWZ A;  4PKY A;  2V1A A;  3EWK A;  1T19 A;  1OJ5 A;  1TS7 A;  1VB6 A;  2H28 A;  2L0W A;  3LID A;  3NJA A;  3NOU C;  3VE4 A;  4EEP A;  4EEU A;  3LUQ A;  4HHD A;  4K08 A;  3UE6 A;  1N9L A;  1S66 L;  2VV8 A;  2R78 A;  1TS0 A;  3BY8 A;  2V0W A;  1OTI A;  3OLO A;  5F5Y A;  5IU1 A;  4WL9 A;  2PDR A;  3LIC A;  2V0U A;  4KQD A;  2ZOI A;  1X0O A;  2VEA A;  3H7W B;  4NXG A;  5HZH A;  1T1B A;  3GDI A;  4KUK A;  1MZU A;  3K3C A;  5HDS A;  1UWP X;  2L1M A;  4HOI A;  3ULF A;  2PYR A;  3A0V A;  1S1Z A;  3C2W A;  4NXE A;  3BY9 A;  4WN5 A;  3VE3 A;  3F1P B;  2D01 A;  5AVE A;  5F6A A;  2PYP A;  3F1N B;  4EW7 A;  2PHY A;  4HH2 A;  1GSX A;  3H7W A;  5I5L A;  3H82 B;  3UB8 A;  3F1O A;  3SW1 A;  3UME A;  2W27 A;  4DJ3 A;  4H6J B;  2Z6C A;  1DRM A;  4B9O A;  1JNU A;  5G4Y A;  5G4Z A;  1XJ6 A;  4HP9 A;  2OOL A;  3LYX A;  3PYP A;  4GW9 A;  5KIZ A;  2PR5 A;  2PR6 A;  1DP6 A;  4XT2 A;  2WKR A;  3UB7 A;  1TS6 A;  1F98 A;  2INW A;  4JGP A;  4LPZ A;  5HWW A;  1N9N A;  3D72 A;  2ZOH A;  4HY8 A;  3PHY A;  5DJU A;  5J3W A;  2QJ7 A;  3RH8 B;  4LRY C;  4I3A A;  5HWV A;  2D02 A;  2KX6 A;  1DP8 A;  2A24 A;  3CAX A;  2V9A A;  4GHI A;  2QHK A;  4HNB A;  3T50 A;  4E04 A;  2QJ5 A;  1KOU A;  5HWT A;  4EET B;  3A0S A;  4F3L A;  4HP4 A;  1D06 A;  3LIA A;  3LIB A;  4JGO A;  3RTY A;  3K3D A;  4R6L A;  4R38 A;  4WF0 A;  3MQO A;  4HJ6 A;  2JHE A;  1T18 A;  4KUO A;  1S67 L;  3VOL A;  4RQ9 A;  1XJ4 A;  3H9W A;  2K7S A;  1UGU A;  3BWL A;  3MJQ A;  4XT2 B;  5F69 A;  1OJG A;  1S4R A;  5A8B A;  4I3I A;  3CWF A;  4GHI B;  2M1C A;  1OTE A;  4LRZ E;  5DJT A;  1G28 A;  4GS9 A;  3HJI A;  1XFN A;  3IS2 B;  3F1O B;  2W0N A;  1D7E A;  4GS9 B;  4HJ3 A;  4I39 A;  1LSV A;  4H6J A;  4NXF A;  4R70 A;  5TBM A;  1F9I A;  5DKK A;  3FG8 A;  2YKH A;  3NHQ A;  4BBV A;  3C8C A;  3MQQ A;  1OTA A;  1N9O A;  3F1P A; 
#chains in the Genus database with same CATH topology
 3BYD A;  4CPK A;  5HAI A;  3MR0 A;  2H0Y A;  3S22 A;  1O7E A;  2LB9 A;  4P87 A;  3ZG7 B;  2WKQ A;  3NDE A;  5FAS A;  2KDK A;  5EOO A;  1PZO A;  4YOF A;  4CQH A;  3VFH A;  5EPH A;  4OVD A;  1K25 A;  1A0K A;  5HD5 A;  2GNX A;  4F3L B;  4R3J A;  4EQI A;  1ONH A;  4Y0U A;  4KG2 A;  1PNE A;  5HSQ A;  4IED A;  3U4L P;  4WM9 A;  1XFQ A;  4R3B A;  5J7E A;  1XA1 A;  5AQB A;  4MBK A;  3C38 A;  4YFM A;  5A92 A;  4R3A A;  5IT5 A;  4L9G A;  3HLF A;  1GCE A;  4Y5F A;  3UE3 A;  2WKP A;  1K55 A;  3MBZ A;  1T1A A;  5FA7 A;  1PWD A;  3BW6 A;  4U0T A;  2ZMV A;  4BL3 A;  4N92 A;  3BY8 A;  2OAP 1;  2V0U A;  1IEL A;  4MDZ A;  4OQH A;  4MEZ A;  1FCN A;  1L0F A;  3WS0 A;  3ULF A;  5FSR A;  2IWC A;  2XRN A;  5F6A A;  3H7W A;  1MPL A;  2W27 A;  3DBA A;  3QP2 A;  1VET B;  2PR5 A;  3HVF A;  3N8L A;  2XQZ A;  3TJZ C;  4HBT A;  4WZ4 A;  3IF6 B;  1KOU A;  2LB5 A;  4HES A;  3VMA A;  1K54 C;  1S67 L;  2XA7 M;  3VOL A;  1K4F A;  1L0E A;  3WRT A;  3HUN A;  4I3I A;  5DTT A;  5FI2 A;  3BFC A;  1F9I A;  2OLU A;  3ISG A;  4UA7 A;  5GHY A;  2HJ9 C;  4KZ7 A;  3UDF A;  2Y2L A;  3CLO A;  5CEC A;  2EWV A;  4BMW A;  1UWN X;  4NK3 A;  4NET A;  4L9E A;  3GR2 A;  1XKZ A;  3VSL A;  3KSG A;  2MJ6 A;  1F2K A;  4PM7 A;  4A5R A;  2QPN A;  5DFY A;  3C4P A;  1L0D A;  5HFO A;  3M6H A;  4S2N C;  1OME A;  1H8Z A;  3IF5 A;  2O9C A;  5EFW A;  2Y2I A;  3ZQ5 A;  1PWG A;  2XR0 A;  1N9L A;  5EOE A;  3V39 A;  4CLC C;  4E3L A;  4Y2F A;  4OOY A;  5KSC A;  4JF6 A;  3Q7V A;  1ERQ A;  4DE0 A;  3H82 B;  3TW8 A;  3UME A;  4H6J B;  3OPR A;  4CJN A;  3GTC A;  4N1H A;  3LR0 A;  5HL6 A;  1PI5 A;  3Q7Z A;  5DFX A;  4HNB A;  1H3Q A;  4X1L A;  4WMC D;  4HP4 A;  3QNB A;  3ZG5 A;  3VP3 A;  1MKM A;  4M3K A;  4WEK A;  3H9W A;  1K57 C;  4U0X A;  1D7E A;  1RGY A;  2WK0 A;  4G3V A;  3HRE A;  1KDW A;  3WS4 A;  1FSW A;  1HZO A;  2C5W B;  4I3J A;  3ZG9 B;  2ZL1 B;  4YNR A;  1CI8 A;  4FH4 A;  1TD5 A;  5AQ9 A;  4EXO A;  2VLG A;  2PRF A;  1L2S A;  1VET A;  2UV0 E;  4N9L A;  4D60 A;  3H82 A;  4GD8 A;  1VHM A;  4Y15 A;  3BQA A;  3IBJ A;  5F1G A;  5HX9 A;  3EEA A;  2XDM A;  1W5D A;  5HDC A;  4GDB A;  1VM1 A;  1W63 Q;  4Y3I A;  4OQ0 A;  3UNW A;  3S4X A;  2OSU A;  5K5B A;  5FL3 A;  3QP6 A;  4YWZ A;  3EWK A;  2H28 A;  3KO6 A;  2GDN A;  1J3W A;  2ZQD A;  4JXS A;  1BUL A;  5TJJ A;  2R78 A;  3E2L A;  2HDQ A;  2VJW A;  3NCK A;  2ZOI A;  4X25 A;  3LEZ A;  5E2H A;  3P98 A;  4JF5 A;  1S1Z A;  3PBN A;  3SS3 A;  4EW7 A;  4GOG A;  3HL9 A;  3GRJ A;  1Y54 A;  1YLW A;  2INW A;  3OBF A;  4H8R A;  3BFE A;  1SCW A;  4JXV A;  3BRM A;  1PIO A;  3PTE A;  2NUP C;  4EET B;  1FR1 A;  5FQQ A;  4FD8 A;  3MMH A;  3FWL A;  3UPN A;  3T4J A;  2ZQA A;  5FAT A;  2G7U A;  3BLS A;  3CPT B;  5F82 A;  5DJT A;  3BEB A;  4QD4 A;  5EVI A;  1ZTU A;  3C8C A;  1NRJ A;  3HLW A;  3DAV A;  4QY5 A;  2CMN A;  5EUA A;  3MKE A;  3IHB A;  4KZ4 A;  2HPB A;  1T1C A;  1NLZ A;  3SS5 A;  4ETX A;  1YLJ A;  3WS2 A;  3NIA A;  3NC8 A;  1ES2 A;  1MXO A;  2P7J A;  2PAV P;  2QWS A;  4JGQ A;  2V1B A;  1NYM A;  1W7F A;  5DF7 A;  3BFF A;  2V1A A;  3BJN A;  4EEP A;  4EUV A;  4HHD A;  3I7J A;  3DW0 A;  5TGF A;  5TFQ A;  5A91 A;  1FOF A;  2WGW A;  2WUQ A;  1LHY A;  3Q81 A;  4DE1 A;  2PYR A;  2Y55 A;  4K91 A;  2C6W B;  4E3K A;  2VGL S;  1ESU A;  5KIZ A;  5EEC A;  3CZD A;  2M7V A;  2ZOH A;  3FPW A;  4HEF A;  3RJU A;  3IH8 A;  5D3O A;  5L8M A;  2IWD A;  2V9A A;  4UQI M;  4KQO A;  3LIA A;  3PXP A;  3KSF A;  2JKR M;  3MQO A;  4QPR A;  3CG5 A;  3MJQ A;  3B47 A;  3GMW A;  3CWF A;  1OTE A;  5TBM B;  1G28 A;  3HJI A;  4GS9 A;  4MLL A;  3F1O B;  1LI9 A;  1BZA A;  4Q0I A;  4FCF A;  3ZFZ A;  4XXR A;  3BM6 A;  4BLM A;  2PBD P;  1VQQ A;  4N1X A;  2L4R A;  3EEH A;  4IUH A;  5EVE A;  1WYC A;  3N7W A;  1ZKJ A;  4OP5 A;  3NOP C;  5KSH A;  4E3N A;  2JC7 A;  2Y59 A;  3P7N A;  3MFX A;  1E3U D;  3W4Q A;  4B88 A;  3UDI A;  1D1J A;  4JXG A;  1SDE A;  3AGE A;  3HLE A;  2I9V A;  1NRF A;  4PPR A;  1O07 A;  4KQQ A;  4FTX A;  2XGN A;  4X68 A;  4PKY A;  3V50 A;  3MZE A;  1VB6 A;  1KE0 A;  3LEQ A;  3ZHH A;  3ZCZ A;  3VP2 A;  1HLU P;  2JKR I;  2BG1 A;  1UWP X;  1HVB A;  4P6Z M;  2A2L A;  5FI7 A;  3S7P A;  1RGZ A;  5F1F A;  2ZC7 A;  3ZVW A;  3B42 A;  4UQI S;  3DWK A;  3BLM A;  2PR6 A;  1KGF A;  1H8M A;  3UE0 A;  1TS6 A;  4PM8 A;  4KZ9 A;  5IHV A;  4C3Q A;  4HY8 A;  3ZDJ A;  4Q0H A;  3D4F A;  4LCM A;  1IYS A;  4OPY A;  5AJG A;  2ZL1 A;  4GLQ A;  3VP4 A;  1YSQ A;  3T12 B;  4Q0J A;  2J9P A;  4WF0 A;  5FAO A;  4XT2 B;  1TF1 A;  2Y2K A;  1JWP A;  4OLG A;  4O0P A;  2JKT I;  3LR3 A;  1PFL A;  4ESP A;  4L0L A;  4BBV A;  2A49 A;  1N9O A;  3N8S A;  5FQK A;  1ZC2 A;  2E8I A;  2ZM2 A;  2ZJ9 A;  1K6R A;  1Z09 A;  3IX4 A;  3IWQ A;  4JGR A;  4FSF A;  4X55 A;  4UA9 A;  1XJ3 A;  3UB9 A;  1MWT A;  1P97 A;  4DKI A;  1DP9 A;  1BT5 A;  3SH9 A;  1MBL A;  4E3O A;  5HAQ A;  4BBT A;  4RX2 A;  3S7O A;  5AVF A;  5F68 A;  2P04 A;  3UMD A;  1BLS A;  3F1N A;  3QP4 A;  3E4O A;  3MXQ A;  4EV4 A;  1JVJ A;  2AVX A;  1NWZ A;  2OWJ A;  2H10 A;  3FPV A;  1SKO B;  3LID A;  4Z1W A;  3PBT A;  3C5A A;  2O9B A;  3UE6 A;  3G2Y A;  5FDH A;  2ZM8 A;  3W4P A;  4X1M A;  1Z6F A;  2DMW A;  2PU2 A;  4LFU A;  3SH7 A;  4GKU A;  3D9Y A;  1PZP A;  2HP6 A;  2QMI A;  1YT4 A;  5FI6 A;  2Q0O A;  1K0K A;  3PYP A;  4E6X A;  1G6A A;  4DE2 A;  4FOF A;  1CK3 A;  4C6Y A;  4DF6 A;  4GHI A;  1BUE A;  4F3L A;  1VEU A;  3A0S A;  5CRF A;  5CED A;  4ETZ A;  3P01 A;  1RCJ A;  5E2F A;  5F69 A;  4LV3 A;  3IF6 C;  3TG9 A;  4P6B A;  3EQU A;  2Y2G A;  4EBP A;  4OQI A;  3VFF A;  2W1T A;  3LIF A;  4IUK A;  5TR7 A;  1Q2P A;  4LV0 A;  2V8F A;  3PAE A;  5IS1 A;  3O87 A;  2WZZ A;  4ID4 A;  1MWR A;  2Y2H A;  4HI4 A;  1K6S A;  5FQJ A;  1WA9 A;  3LI9 A;  2R9W A;  3QNC A;  4NXB A;  1GA9 A;  4IBX A;  3MF0 A;  4IHQ A;  4DDS A;  2O9A A;  1XGJ A;  4NG2 A;  4E3M A;  1GSV A;  2JKG A;  1YAX A;  1IKG A;  1SHV A;  3PBO A;  3ZG0 A;  4LLO B;  2VGL M;  4Y13 A;  5KZH A;  2Y2Q A;  4WYY A;  3T4O A;  3G31 A;  4DRT A;  4WL9 A;  3N6I A;  3H7W B;  2G2U A;  1XA7 A;  4CLC B;  5EM0 A;  4KZ6 A;  3F1P B;  4P6Z S;  2PHY A;  4ME4 A;  5AQA A;  2WAF A;  3LYX A;  2J3T D;  3MKF A;  1CF0 A;  5EVI D;  4ZTK A;  1HTZ A;  1NZU A;  5L07 A;  1Q2Q A;  2PBY A;  1K56 A;  2IWB A;  4JGO A;  4S2K A;  3N4I A;  3A3E A;  1ERM A;  1XJ4 A;  4GJ4 A;  3V5M A;  2ZM0 A;  3M6B A;  1NJ4 A;  4R70 A;  5DKK A;  2Y8H A;  2OAQ 1;  3SW1 A;  1OTA A;  2VKS A;  3IWI A;  2DRW A;  3LR4 A;  3MS6 A;  1V9Z A;  3G2Z A;  1M6K A;  2HZ5 A;  5F83 A;  4X6T A;  1KE3 A;  2ZQ8 A;  4LRX C;  3ITB A;  3NI9 A;  2R9X A;  1FR6 A;  3RXW A;  3HLG A;  4EES A;  3B3X A;  3SH8 A;  4S2M A;  1NZO A;  3LI8 A;  1W79 A;  1TS8 A;  3E4P A;  4WEL A;  2Y2N A;  4UA6 A;  4EBN A;  3MXR A;  1RP5 A;  3IT9 A;  2J80 A;  2VX8 A;  1JWZ A;  5FQM A;  1LSX A;  1YLZ A;  3LY3 A;  3CMZ A;  4KQR A;  3UPP A;  3ICY A;  5HDD A;  1E4D A;  3PBR A;  1OTD A;  1LL8 A;  1K55 C;  5EV0 A;  2L0W A;  3GVB A;  3HUM A;  5FEF A;  2X02 A;  4OOL A;  4OPR A;  2Q9N A;  4WZ5 A;  2P9V B;  3EOI A;  3JVU A;  2WKH A;  3VP1 A;  2XA7 S;  5AVE A;  3S7Q A;  1CI9 A;  1GSX A;  3O88 A;  5E2E A;  3BFD A;  3W4O A;  4PMA A;  3R4K A;  3OC2 A;  3UB7 A;  3E2K A;  4ZBE A;  4Y0T A;  3PHY A;  4D2O A;  1TDG A;  4GB7 A;  4E04 A;  1K38 A;  3T4K A;  3MQ0 A;  3DTK A;  3RTY A;  1ERO A;  2HGV A;  2XEP A;  5A8B A;  2W0N A;  3SZT A;  3OPH A;  3T1X A;  3OOV A;  1EW0 A;  3W8K A;  2HDR A;  2DCF A;  1YLP A;  4WMC A;  1ZG4 A;  4KZ8 A;  2Y79 A;  4GN2 A;  4O8G A;  4II7 A;  4EQ1 A;  3ZNY A;  2XH9 A;  4EWF A;  3N8R A;  1STZ A;  5CEB A;  3T1S A;  2X01 A;  1NLY A;  2OV5 A;  4PHT A;  4B4X A;  4JBF A;  4QB8 A;  1GSW A;  1ONG A;  1FIK A;  4ARZ B;  2W3G A;  4UEY A;  3T4L A;  4JXW A;  2XF3 A;  3FV7 A;  2P9V A;  4OPZ A;  3A3D A;  4JF4 A;  4KZ5 A;  2VZW A;  3PR6 A;  1KDS A;  4K08 A;  4Q8I A;  3EGX C;  2JKF A;  4Y0O A;  3OPP A;  3CHW P;  2W1R A;  4BD0 A;  1GA0 A;  3IXB A;  1NYY A;  1XX2 A;  3F1N B;  4YIN A;  4BJP A;  1G68 A;  4MBF A;  3RXX A;  4IJG A;  4LV2 A;  4MBH A;  3UE1 A;  4Y17 A;  5CHM A;  3BQ8 A;  3M2K A;  3ITA A;  4DXC A;  5GLC A;  2QJ5 A;  3G32 A;  2FFY A;  3K3D A;  3IF6 A;  4PAU A;  1TEM A;  1CEF A;  1T18 A;  3RFB A;  5HAP A;  1G6O A;  1SZV A;  4R4S A;  4ZRR A;  3G34 A;  3Q1F A;  3UO9 A;  3G35 A;  4QJG A;  1YM1 A;  3FG8 A;  3NHQ A;  3DTI A;  3G4P A;  1EI5 A;  1XGI A;  2PU4 A;  3QP5 A;  3E98 A;  3B33 A;  5L10 A;  4OH0 A;  1IOU A;  4PM5 A;  1P0Z A;  3OPL A;  4EER A;  3SS4 A;  3IX8 A;  1KVL A;  1NXY A;  2A24 B;  2XD1 A;  4PKY G;  1G5U A;  2VV6 A;  1BSG A;  4WZ5 C;  4HH3 A;  4XUX A;  2VK3 A;  2Y2J A;  3E0Y A;  5DTS A;  3ZNT A;  3CJM A;  2EXB A;  2WGV A;  5GLB A;  2WGI A;  4DDY A;  1FCO A;  2J3W A;  1FQG A;  3K2N A;  2YKF A;  3GEC A;  2GX5 A;  4NEE D;  1JWV A;  3EGD C;  1YQS A;  2EX2 A;  4P85 A;  4UAA A;  1QMF A;  3R7W B;  4S2I A;  2WZX A;  3LO7 A;  1PYY A;  5F5Y A;  2HP9 A;  2V2F F;  4NXG A;  5CGW A;  5HZH A;  3K3C A;  2V1Z A;  2Q9M A;  2VA0 A;  5BOH A;  2WAD A;  4CLC D;  2Y4A A;  4BD1 A;  4MN7 A;  4ZJ2 A;  4B9O A;  1U60 A;  5G4Y A;  1DP6 A;  5CTM A;  3RH8 B;  4E3I A;  5DVA A;  1K54 A;  1YKD A;  3DTM A;  5FAQ A;  2DNS A;  2V20 A;  3IWO A;  4S2O A;  1CJF A;  1UGU A;  5U47 A;  1OJG A;  1MWS A;  2M1C A;  1M40 A;  4LRZ E;  1DJB A;  1YLT A;  4MMN A;  2B18 A;  4QU3 A;  1W8Y A;  4E3J A;  3MQQ A;  1LI0 A;  2WYX A;  5HW3 A;  3MSH A;  4JPM A;  2Z2M B;  5DKL A;  5EVI C;  4FH2 A;  4XUZ A;  3LIE A;  3A3I A;  3HLD A;  3AGD A;  2W3D A;  4X53 A;  2W3E A;  3D3O A;  3P09 A;  3A0R A;  4DJ2 A;  2QKP A;  3UN7 A;  4ARZ A;  4OLD A;  3O86 A;  3MZD A;  1YMX A;  1BLC A;  4S2J A;  2OWH A;  2VGJ A;  3HUO A;  1TDL A;  4LCL A;  5MC7 A;  4BBU A;  4HIA A;  3HCY A;  4X56 A;  4O01 A;  5GHX A;  1DJA A;  3IXH A;  1WE4 A;  2BAS A;  4E6W A;  1ZG6 A;  1ACF A;  3BFG A;  1ZHH B;  3JPU A;  1MY8 A;  3AGF A;  4BWI A;  1ALQ A;  2HP5 A;  2V0W A;  1OTI A;  1XPB A;  5DTK A;  4Y7P A;  2EFU A;  4KQD A;  2EXA A;  3GDI A;  3C7V A;  1K56 D;  1DJC A;  5CXW A;  4HH2 A;  2EX9 A;  3UB8 A;  3CIT A;  3F1O A;  4OP8 A;  3T4S A;  2P74 A;  5M19 A;  2OOL A;  2XLN A;  3T1R A;  4BQM A;  3PAG A;  3IH9 A;  3D72 A;  5CHU A;  2G2W A;  2Y2O A;  3WS1 A;  2D02 A;  5GLD A;  3T50 A;  2QHK A;  2JE5 A;  5FQ9 A;  3FYZ A;  1D06 A;  3LIB A;  1K57 A;  4HJ6 A;  5G18 A;  5C5K A;  1Y4O A;  4P0M A;  3JVV A;  4RA7 A;  3EQV A;  3BWL A;  1IYO A;  3LCE A;  3IS2 B;  5TBM A;  4GS9 B;  4H6J A;  4NXF A;  3NUL A;  3CPT A;  3IQA A;  5J8X A;  5HPF A;  3S7N A;  3F1P A;  1LL9 A;  4EU0 A;  1GHP A;  2EX8 A;  5EE8 A;  1S1Y A;  2PT7 A;  4MCW A;  3FZC A;  4GCZ A;  3WRZ A;  3C7U A;  1L3L A;  4L9F A;  1IKI A;  2WAE A;  4KZB A;  2QZ6 A;  1XXM A;  5CX7 A;  5DF9 A;  3SOI A;  3Q82 A;  3HJK A;  3KSH A;  4KG6 A;  1W63 M;  4KG5 A;  5HD3 A;  1S4S A;  1GHI A;  2BTF P;  1MC0 A;  2W1T B;  4DN0 A;  1ES3 A;  3LUQ A;  3M2J A;  3OLO A;  2FZ0 A;  1JTD A;  1KVM A;  1PW8 A;  4NKP A;  1T1B A;  1MZU A;  2ZC4 B;  4NXE A;  4ZDX A;  5I5L A;  2ZQ7 A;  4DJ3 A;  1NY0 A;  5G4Z A;  4HP9 A;  1LL5 A;  3QP8 A;  4LPZ A;  1DP8 A;  1SDN A;  3CAX A;  1FIL A;  3ZVT A;  5L2F A;  4RQ9 A;  3NDG A;  4IVI A;  2WGW B;  1LSV A;  1GHM A;  2HF6 A;  4RX3 A;  2XK1 A;  1FCM A;  2W3F A;  4KZ3 A;  3UPO A;  3GV9 A;  1SKO A;  1LT0 A;  2ZC5 B;  1XJ2 A;  4EBL A;  4MNR A;  1N9B A;  3HBR A;  5EM1 A;  5A93 A;  1OTB A;  1LSW A;  4HJ4 A;  3LFV A;  4IBR A;  2J3T C;  3E4Q A;  3FC7 A;  5M18 A;  3NBL A;  2VV7 A;  3O5Y A;  3OCL A;  5HPI A;  1ES5 A;  4WLA A;  3V3S A;  5JYO A;  1CQA A;  2CC1 A;  4RYE A;  3C30 A;  4IVK A;  1ES4 A;  1I2S A;  2O99 A;  3TRC A;  3VOZ A;  2QYB A;  4OPQ A;  3R7W A;  3ZGA B;  3QP1 A;  1S66 L;  1TS0 A;  3T4T A;  4O7D A;  3DTE A;  3VP0 A;  4DXB A;  5GLA A;  3UB5 P;  2ZLY A;  4KUK A;  2XSS A;  1MWU A;  5CGX A;  1YMS A;  4R0Q A;  5EVL A;  2PYP A;  3FKV A;  2KLI A;  2Z6C A;  1SKF A;  2WKR A;  2ZC6 B;  3ZG8 B;  1N9N A;  5FEG A;  3CUE A;  5DJU A;  4I3A A;  4JKT A;  5HWV A;  5E43 A;  2I72 A;  2KX6 A;  4S2P A;  5I94 A;  5FAP A;  3L9K A;  2ZQC A;  4ZJ1 A;  3MZF A;  1XFN A;  3TSG A;  5L09 A;  3G30 A;  1F5M A;  4GDN A;  4MN5 A;  2M7U A;  1LLB A;  1ESI A;  3IS2 A;  2HV1 A;  2JBF A;  2Z6D A;  2HDS A;  2Y2P A;  2W3H A;  2XFT A;  1WYB A;  4M4X A;  3KX0 X;  2ZC3 B;  1IYQ A;  2EA9 A;  2H5S A;  1OPX A;  4B93 A;  3BEC A;  5J4E A;  1I2W A;  4GD6 A;  1L0G A;  2EWW A;  3G6O A;  4K0X A;  4OON A;  3U2A A;  3NOT C;  1PRQ A;  3MXS A;  4GNU A;  1T19 A;  1OJ5 A;  5M1A A;  3T1Q B;  3VE4 A;  4WEJ A;  2KOI A;  2VV8 A;  1KGE A;  5IU1 A;  1YSP A;  2PDR A;  2H0T A;  3LIC A;  3VV4 A;  3C4O A;  1X0O A;  2VEA A;  4DMZ A;  5HDS A;  2L1M A;  3A3J A;  1H5X A;  4WN5 A;  2D01 A;  2B5R A;  2Z2L B;  3Q07 A;  1XP4 A;  4FUW A;  4GW9 A;  2ZQ9 A;  1BLH A;  3QHY A;  5J3W A;  1C3B A;  3GSG A;  1KGG A;  1BLP A;  3ZYT A;  3TE8 A;  3O3V A;  4R6L A;  1AWI A;  1FSY A;  4KUO A;  4AFI A;  2K7S A;  3LR5 A;  1S4R A;  4GHI B;  1J9M A;  1PW1 A;  4S2L A;  3KYE A;  3PBS A;  2B95 A;  4DE3 A;  1QME A;  3GQZ A;  2O0Y A;  1YPR A;  1E3U A;  4HQA A;  2PD8 A;  4KZA A;  1BYW A;  5CHJ A;  4KEN B;  2B02 A;  3A3F A;  5E2G A;  1PWC A;  4I5S A;  2ZMF A;  3IXG A;  1TVF A;  2EX6 A;  4I38 A;  2J7V A;  2UWX A;  3UB6 A;  2PD7 A;  4WBG A;  4WUJ A;  3IX3 A;  4PM6 A;  2BLS A;  2GJ3 A;  3V3R A;  5HAR A;  4S2N A;  3DWZ A;  2K31 A;  2HDU A;  3KSI A;  5HL1 A;  1W8Q A;  3IBR A;  4ZJ3 A;  3W2Z A;  4CLC E;  1P9R A;  4R1G A;  2FH5 A;  1V9Y A;  3NOU C;  4GZB A;  1TS7 A;  4F94 A;  1HD8 A;  1EWZ A;  4LEN A;  3CI6 A;  3KYZ A;  4OQG A;  3V67 A;  2J9O A;  1N4O A;  3IHA A;  4HOI A;  1E25 A;  4UHU A;  3A0V A;  4RVA A;  1YLY A;  2A3U A;  4QY6 A;  2K2N A;  4X69 A;  4ZAM A;  2FFF B;  3KYQ A;  4G3W A;  3OZH A;  2JCH A;  4R4R A;  2P08 A;  3FKW A;  4JGP A;  3S1Y A;  1DY6 A;  1CEG A;  1I5Q A;  4QWO A;  2A24 A;  3NEC A;  4OKP A;  1MKI A;  3VSK A;  4C75 A;  4OOM A;  3PBQ A;  2IA2 A;  1P9W A;  1H0M A;  2ACG A;  2E8J A;  1KE4 A;  1JTG A;  3MFD A;  2J8Y A;  4I39 A;  3VOY A;  4HJ3 A;  4N9K A;  2HJE A;  4EUZ A;  3JYI A;  4JLF A;  3L7H A;  2YKH A;  4MN6 A;  5AQ7 A;  3UY6 A;  1ODV A;  1OT6 A;  5JYP A;  2X71 A;  2Y2M A;  2ZBB A;  4QHC A;  3LY4 A;  1OT9 A;  2JN7 A;  1S6R A;  2JKT M;  3WWX A;  2GZA A;  2ZD8 A;  2VGK A;  5DF8 A;  1Y28 A;  1VEU B;  4Z9Q A;  4K0W A;  2WKI A;  2EFX A;  3T4Q A;  5A90 A;  3OCN A;  2XFS A;  4R23 A;  1K4E A;  3NJA A;  5GHZ A;  4EEU A;  4LGW A;  2XRO A;  1H8Y A;  1PI4 A;  2RCX A;  3HLC A;  4U3T A;  2NUT C;  4LV1 A;  3VE3 A;  3C2W A;  3BY9 A;  3TOI A;  2Y91 A;  4PM9 A;  4G3K A;  3UDX A;  1DRM A;  3HLB A;  1JNU A;  2V8C A;  1XJ6 A;  3CUE C;  5CTN A;  4XT2 A;  3IXD A;  1F98 A;  5CGS A;  5HWW A;  2QJ7 A;  4LRY C;  1AXB A;  4BL2 A;  4HBU A;  5CER A;  5HWT A;  3LGO A;  1IEM A;  4R38 A;  5LBR A;  1IFQ A;  2JHE A;  4CLC A;  1BTL A;  4BEN A;  1IYP A;  3WS5 A;  4B4Z A;  1S0W A;  3NY4 A;  2RL3 A;  5FDS A;  5FQI A;  2OLV A;  2ZMA A;  2XD5 A;  2WKE A;  5GL9 A;  5KMW A;  5EVI B;  3Q7V B; 
#chains in the Genus database with same CATH homology
 1LT0 A;  3MR0 A;  1XJ2 A;  2LB9 A;  2WKQ A;  2Y79 A;  2L4R A;  4O8G A;  3EEH A;  1OTB A;  4IUH A;  2KDK A;  1LSW A;  4II7 A;  4EQ1 A;  4HJ4 A;  4YOF A;  3LFV A;  4CQH A;  2J3T C;  3E4Q A;  3NOP C;  5HD5 A;  1STZ A;  2GNX A;  3FC7 A;  4F3L B;  5KSH A;  2VV7 A;  5HSQ A;  3O5Y A;  3P7N A;  3OCL A;  1NLY A;  3MFX A;  5HPI A;  1XFQ A;  4PHT A;  5J7E A;  1GSW A;  4WLA A;  4ARZ B;  3C38 A;  2W3G A;  4UEY A;  4R3A A;  5IT5 A;  4L9G A;  2I9V A;  3T4L A;  3C30 A;  4Y5F A;  3UE3 A;  2WKP A;  2O99 A;  3TRC A;  2VZW A;  1T1A A;  3PR6 A;  2QYB A;  4PKY A;  1VB6 A;  3R7W A;  4K08 A;  3BW6 A;  2ZMV A;  1S66 L;  1TS0 A;  3T4T A;  3EGX C;  3BY8 A;  2OAP 1;  2V0U A;  4MDZ A;  2W1R A;  4KUK A;  2JKR I;  1UWP X;  4P6Z M;  2A2L A;  3ULF A;  2XSS A;  3S7P A;  2XRN A;  5F6A A;  2PYP A;  3F1N B;  3H7W A;  2KLI A;  3B42 A;  4BJP A;  2W27 A;  2Z6C A;  3DBA A;  4UQI S;  2PR5 A;  4IJG A;  2PR6 A;  1H8M A;  2WKR A;  1TS6 A;  1N9N A;  4HY8 A;  3CUE A;  4Q0H A;  5DJU A;  3TJZ C;  4I3A A;  3BQ8 A;  5HWV A;  5AJG A;  2KX6 A;  4GLQ A;  1YSQ A;  2QJ5 A;  1KOU A;  2LB5 A;  3K3D A;  4Q0J A;  4WF0 A;  4PAU A;  3RFB A;  1T18 A;  3VOL A;  1S67 L;  2XA7 M;  1G6O A;  4XT2 B;  1TF1 A;  4I3I A;  4ZRR A;  1XFN A;  4O0P A;  2JKT I;  3LR3 A;  1F9I A;  3FG8 A;  4L0L A;  3NHQ A;  4BBV A;  1N9O A;  2HJ9 C;  1F5M A;  4MN5 A;  2M7U A;  3E98 A;  3IS2 A;  2HV1 A;  2Z6D A;  3CLO A;  2EWV A;  2W3H A;  1UWN X;  4BMW A;  3B33 A;  1IOU A;  4L9E A;  1P0Z A;  4EER A;  4M4X A;  3KSG A;  4JGR A;  2MJ6 A;  3KX0 X;  4FSF A;  2A24 B;  1XJ3 A;  3UB9 A;  1P97 A;  4PKY G;  1DP9 A;  2EA9 A;  1OPX A;  4B93 A;  2VV6 A;  4HH3 A;  5J4E A;  5DFY A;  4BBT A;  3E0Y A;  3S7O A;  5AVF A;  5F68 A;  2P04 A;  3UMD A;  2EWW A;  3F1N A;  2O9C A;  5EFW A;  3G6O A;  3E4O A;  3MXQ A;  3U2A A;  3NOT C;  2J3W A;  3ZQ5 A;  3K2N A;  2YKF A;  1NWZ A;  2OWJ A;  3GEC A;  2GX5 A;  3FPV A;  1T19 A;  1OJ5 A;  3LID A;  4NEE D;  3EGD C;  4Z1W A;  3VE4 A;  3PBT A;  2O9B A;  3UE6 A;  1N9L A;  3R7W B;  4WEJ A;  2KOI A;  2VV8 A;  5F5Y A;  5IU1 A;  1YSP A;  2PDR A;  3LIC A;  3VV4 A;  4CLC C;  1X0O A;  2VEA A;  4NXG A;  4DMZ A;  5HZH A;  2DMW A;  5HDS A;  3K3C A;  2L1M A;  4Y2F A;  2VA0 A;  4WN5 A;  2D01 A;  4CLC D;  3H82 B;  3TW8 A;  3UME A;  4H6J B;  4MN7 A;  4B9O A;  5G4Y A;  3PYP A;  4GW9 A;  1DP6 A;  4FOF A;  3LR0 A;  5J3W A;  3RH8 B;  5HL6 A;  5DFX A;  3ZYT A;  1YKD A;  1H3Q A;  4GHI A;  4HNB A;  4F3L A;  3A0S A;  4HP4 A;  3TE8 A;  4R6L A;  4ETZ A;  3P01 A;  4KUO A;  1MKM A;  4AFI A;  4WEK A;  3H9W A;  2K7S A;  3LR5 A;  1UGU A;  5F69 A;  1OJG A;  1S4R A;  4GHI B;  2M1C A;  4LRZ E;  4MMN A;  1D7E A;  2B18 A;  3EQU A;  3PBS A;  4G3V A;  3MQQ A;  2O0Y A;  2W1T A;  3LIF A;  4IUK A;  5DKL A;  4I3J A;  4HQA A;  2PD8 A;  3LIE A;  1BYW A;  4YNR A;  2W3D A;  2B02 A;  5IS1 A;  1TD5 A;  4EXO A;  2W3E A;  2VLG A;  4I5S A;  3D3O A;  2ZMF A;  3A0R A;  4DJ2 A;  2QKP A;  4HI4 A;  4ARZ A;  4I38 A;  3H82 A;  1WA9 A;  3LI9 A;  1VHM A;  2OWH A;  3BQA A;  4NXB A;  3UB6 A;  5MC7 A;  3IBJ A;  2PD7 A;  3EEA A;  4BBU A;  4WUJ A;  4HIA A;  3HCY A;  3MF0 A;  5HDC A;  4IHQ A;  4O01 A;  2O9A A;  2GJ3 A;  1W63 Q;  4Y3I A;  2K31 A;  1GSV A;  3KSI A;  2BAS A;  1YAX A;  3IBR A;  3W2Z A;  5K5B A;  4CLC E;  1P9R A;  3PBO A;  4LLO B;  2VGL M;  5FL3 A;  2FH5 A;  1V9Y A;  4YWZ A;  3EWK A;  3NOU C;  1ZHH B;  1TS7 A;  3T4O A;  2H28 A;  3KO6 A;  4BWI A;  5TJJ A;  2R78 A;  3CI6 A;  3KYZ A;  2V0W A;  1OTI A;  3V67 A;  2VJW A;  4WL9 A;  4KQD A;  2ZOI A;  3H7W B;  3GDI A;  4CLC B;  4HOI A;  3A0V A;  1S1Z A;  3PBN A;  3F1P B;  4P6Z S;  2K2N A;  4EW7 A;  2PHY A;  4HH2 A;  3UB8 A;  3CIT A;  3F1O A;  4ME4 A;  3T4S A;  2OOL A;  3LYX A;  3KYQ A;  4G3W A;  2J3T D;  2INW A;  2P08 A;  4JGP A;  3OBF A;  3D72 A;  2D02 A;  2A24 A;  3T50 A;  2NUP C;  2QHK A;  4EET B;  1D06 A;  3LIB A;  3MMH A;  4JGO A;  4OOM A;  3PBQ A;  2IA2 A;  4HJ6 A;  5C5K A;  1P9W A;  3T4J A;  3JVV A;  2G7U A;  1XJ4 A;  3EQV A;  4GJ4 A;  3BWL A;  5DJT A;  3IS2 B;  4I39 A;  4GS9 B;  4HJ3 A;  4R70 A;  2HJE A;  4H6J A;  4NXF A;  5TBM A;  5DKK A;  2YKH A;  2Y8H A;  1ZTU A;  3C8C A;  2OAQ 1;  3S7N A;  2VKS A;  1OTA A;  5HPF A;  3F1P A;  3SW1 A;  1NRJ A;  4EU0 A;  2CMN A;  3LR4 A;  1V9Z A;  4MN6 A;  1ODV A;  1OT6 A;  1T1C A;  4LRX C;  1NLZ A;  1S1Y A;  2PT7 A;  2ZBB A;  4EES A;  4MCW A;  4ETX A;  1OT9 A;  2JN7 A;  4GCZ A;  3LI8 A;  2JKT M;  1TS8 A;  2GZA A;  3E4P A;  4WEL A;  4L9F A;  2P7J A;  1Y28 A;  2J80 A;  2QWS A;  2VX8 A;  4JGQ A;  5CX7 A;  1LSX A;  5DF9 A;  3HJK A;  3KSH A;  3ICY A;  2V1B A;  1W63 M;  5HDD A;  3T4Q A;  5HD3 A;  1S4S A;  3PBR A;  3OCN A;  1OTD A;  1LL8 A;  1MC0 A;  2W1T B;  2V1A A;  3NJA A;  2L0W A;  3BJN A;  4EEP A;  4EEU A;  4EUV A;  4DN0 A;  3LUQ A;  4HHD A;  4OOL A;  3OLO A;  2FZ0 A;  4NKP A;  2XRO A;  3EOI A;  3JVU A;  1T1B A;  1MZU A;  2NUT C;  2PYR A;  3VE3 A;  3C2W A;  4NXE A;  3BY9 A;  2XA7 S;  5AVE A;  3S7Q A;  1GSX A;  5I5L A;  4G3K A;  4DJ3 A;  1DRM A;  1JNU A;  2VGL S;  5G4Z A;  3CUE C;  1XJ6 A;  4HP9 A;  5KIZ A;  3R4K A;  4XT2 A;  3OC2 A;  3UB7 A;  1F98 A;  4LPZ A;  2M7V A;  5HWW A;  2ZOH A;  3PHY A;  2QJ7 A;  4LRY C;  3FPW A;  5L8M A;  1DP8 A;  3CAX A;  2V9A A;  4E04 A;  4UQI M;  5HWT A;  3T4K A;  4KQO A;  3LIA A;  3PXP A;  3MQ0 A;  3RTY A;  3KSF A;  5LBR A;  2JKR M;  4R38 A;  3MQO A;  1IFQ A;  2JHE A;  4QPR A;  4CLC A;  4RQ9 A;  2HGV A;  3MJQ A;  5A8B A;  3B47 A;  3CWF A;  1OTE A;  1G28 A;  4GS9 A;  3HJI A;  5TBM B;  3F1O B;  2W0N A;  1LSV A;  2HF6 A;  3OOV A;  4Q0I A;  2W3F A;  1EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...