1XJ4A

Co-bound structure of bjfixlh
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj4A00
4HP9A 3H9WA 3FG8A 3UMDA 2PDRA 1T18A 3C2WA 1S67L 3LI9A 5HWVA 4K08A 4HNBA 4EESA 4GS9A 4F3LB 1OT9A 4GS9B 5DJTA 3LI8A 5HDCA 4HH3A 1XJ2A 3RH8B 4I5SA 2VEAA 3NJAA 3ICYA 4R38A 5J3WA 2QKPA 4HJ6A 3UB7A 3VOLA 3D72A 4GHIA 4YWZA 4HOIA 4EERA 1XFNA 1TS0A 1X0OA 2VLGA 5TBMA 3CWFA 4HH2A 2YKFA 5TBMB 4E04A 5G4YA 3MXQA 1LT0A 4R70A 3ZQ5A 4HJ3A 4EW7A 4R6LA 4HIAA 5DKKA 4LPZA 2PHYA 2W27A 3FC7A 2P7JA 4I39A 3NOUC 3EWKA 3A0VA 5G4ZA 1VB6A 1XJ3A 3IBRA 4I3AA 3CAXA 5A8BA 2PD7A 2A24B 1EW0A 4XT2B 4WL9A 4JGOA 4PKYG 5DJUA 2OWHA 4JGQA 4I38A 3E4PA 4I3IA 3LIAA 3LIDA 1GSWA 4BBUA 5HD3A 5IS1A 3MFXA 3K3CA 3NOTC 1OTDA 5I5LA 2QHKA 2VV6A 2VV7A 5IU1A 4MN6A 1DP9A 1D06A 2INWA 3F1NA 3GECA 1NWZA 2QWSA 2JN7A 2PYRA 3H82B 2ZBBA 2L4RA 3F1NB 3MQQA 4F3LA 5J7EA 1LSVA 1OTEA 3VE3A 3LIBA 2HV1A 4HP4A 2VV8A 2PR5A 3C8CA 4EQ1A 1MZUA 3IS2B 2PR6A 1P97A 4EETB 2L1MA 4GCZA 3KX0X 2GJ3A 2D02A 2I9VA 1DRMA 4B9OA 4L9EA 1LSWA 2OOLA 3OLOA 4GW9A 4DJ3A 3LIFA 5HDDA 1LL8A 1N9LA 2V9AA 2QJ5A 4JGRA 5HWWA 1DP6A 3UE6A 2KX6A 1Y28A 4HY8A 5KIZA 2H28A 1GSXA 2W0NA 1S4RA 2EA9A 4RQ9A 4LRXC 4WN5A 2J80A 3HJIA 4LRYC 3MQOA 2A24A 4XT2A 4WUJA 3H7WB 1S4SA 1T1CA 2YKHA 3F1OB 3E4OA 4KUKA 4DJ2A 3LIEA 4WLAA 4L9GA 3PHYA 2WKPA 3A0SA 2B02A 3PYPA 5DKLA 1JNUA 3B33A 1V9ZA 1LSXA 5HDSA 3NOPC 3EEHA 5HSQA 3SW1A 2OWJA 4KQDA 1OTBA 1F98A 3RTYA 1GSVA 2V0UA 4BBTA 4EEUA 4KUOA 3H82A 4NXGA 1UWNX 3BY9A 4HQAA 1T1AA 1UWPX 5F6AA 1TS8A 4JGPA 3GDIA 1DP8A 2V0WA 3UB8A 3IS2A 4BBVA 1N9NA 1XFQA 5F68A 1XJ4A 2Z6DA 3HJKA 4L9FA 5HZHA 1S66L 3T50A 5EFWA 2WKRA 2V1BA 3ULFA 2PYPA 4HJ4A 4LRZE 4MN5A 3A0RA 4R3AA 3VE4A 2PD8A 2V1AA 1V9YA 2ZOHA 4H6JA 4EXOA 1UGUA 2R78A 1OJGA 2CMNA 4WF0A 3MR0A 2M1CA 1OT6A 4H6JB 3UB6A 4GHIB 2KDKA 2QJ7A 5F5YA 5HWTA 1N9OA 5AVFA 1D7EA 1KOUA 1WA9A 1OTAA 3CLOA 2Z6CA 4HI4A 3E4QA 2WKQA 3NHQA 3G6OA 3H7WA 3LUQA 3LYXA 3LICA 3F1OA 3BWLA 1T19A 3UMEA 1G28A 2ZOIA 5F69A 2D01A 1ODVA 1BYWA 1TS6A 2K7SA 4PKYA 1F9IA 1T1BA 5HD5A 1S1ZA 4LLOB 4M4XA 2L0WA 4NXEA 2BASA 4HHDA 3UB9A 3MJQA 1XJ6A 1P0ZA 3K3DA 3F1PA 5AVEA 4I3JA 3BY8A 4NXFA 1S1YA 4EEPA 4NXBA 1OTIA 3F1PB 1OJ5A 3P7NA 5J4EA 2JHEA 1TS7A
chains in the Genus database with same CATH superfamily
2VZWA 3GVBA 2LB9A 4K0WA 5A93A 5E2GA 1GA9A 3H9WA 4E3OA 4WZ5C 3Q81A 4GJ4A 4LV2A 3ZYTA 2I72A 4C6YA 2MJ6A 4OONA 1W5DA 3LFVA 2Y91A 3LI9A 4GB7A 2FH5A 2HJEA 3RXXA 2RCXA 2BG1A 2V8CA 3EGXC 4GS9B 5CEDA 4ZRRA 4S2PA 2ZC5B 4I5SA 5G18A 3GMWA 4YINA 2VEAA 1PWCA 1CI9A 4R38A 2ZMAA 1SDNA 1EROA 3D72A 4YWZA 4S2JA 3VSKA 3TRCA 2J9PA 4YNRA 1Q2QA 1VEUB 3HL9A 1YPRA 4CJNA 4R70A 3HLWA 3ITBA 3E2LA 3ZQ5A 2VJWA 4JF6A 3A3DA 1MWRA 2WYXA 3NULA 3IX3A 4R0QA 5AQ7A 2Y4AA 4XUZA 3MMHA 1JTDA 2EWVA 3NOUC 3EWKA 4ZBEA 3S22A 2DRWA 5AQ9A 5HX9A 3G2ZA 1FR6A 2GZAA 4Y3IA 4S2OA 2PD7A 4P6ZS 4XT2B 4JGOA 3DTMA 3RJUA 2ZM2A 1CI8A 2J9OA 1NJ4A 4HEFA 1XP4A 2GNXA 4BBUA 3M6BA 1CQAA 2E8JA 1LHYA 2J7VA 3NOTC 1OTDA 5TFQA 3IF6C 5I5LA 2QHKA 3LR5A 2OAP1 2WAEA 2VV7A 1K38A 4IUHA 3WS2A 4R23A 3VOYA 3ZG0A 3UN7A 4NK3A 1NXYA 4KZ4A 1NWZA 2PYRA 4JF4A 5EVEA 3PBNA 4FH4A 3F1NB 4QB8A 1BLSA 4IUKA 5FDSA 5DTSA 3OPRA 3LIBA 3IH8A 3Q7VB 1K57A 1JTGA 1KGGA 2OLVA 1NZOA 3C8CA 4O8GA 2PR6A 5FQJA 4Y13A 3AGEA 1F2KA 1JWZA 2Z2LB 3KX0X 4X68A 4WEKA 1VEUA 1NZUA 5TR7A 1W63M 3C4OA 2I9VA 4MBKA 4GD6A 1M40A 2JCHA 4L9EA 2OOLA 3OLOA 4GW9A 5I94A 4DJ3A 1GHIA 3ZVWA 4OKPA 4BD1A 2B95A 5HDDA 1LL8A 3MS6A 1ZKJA 2ZM0A 1MWSA 2ZM8A 5EM1A 5HWWA 1DP6A 2WKEA 1MY8A 3CJMA 1PIOA 4HY8A 2H28A 1GSXA 2Y2LA 2W0NA 1S4RA 2EA9A 3BM6A 4JKTA 2Y79A 1NRJA 3NECA 1I2WA 5FASA 2J80A 4LRYC 4XT2A 4KQRA 4JBFA 5JYPA 5JYOA 4KUKA 2XRNA 4FOFA 4KZ9A 5EOEA 2WKPA 3UO9A 2B02A 3BQ8A 2RL3A 5CHJA 3K2NA 5HDSA 3LEZA 3NOPC 3OC2A 1HD8A 4OP5A 1ACFA 5HSQA 3HLCA 1OTBA 1F98A 4L0LA 2V0UA 3PAGA 4BBTA 1YT4A 4UEYA 5EECA 1GHMA 1UWNX 1KVMA 3DWZA 2K31A 3CG5A 4ESPA 4IHQA 3Q7VA 1TS8A 3UDXA 3ZCZA 1GHPA 4Y17A 3IF6B 5FAOA 4LV3A 3N6IA 3ZG9B 4JXGA 2V0WA 3IHAA 3RXWA 3N7WA 4UA7A 4WZ5A 1YMXA 4BBVA 2IWCA 1XFQA 5CXWA 1L0DA 5F68A 5FA7A 2ZJ9A 4WYYA 3KYEA 2Z6DA 2V20A 5HZHA 3T50A 5EFWA 1J9MA 2V1BA 5MC7A 4U0XA 5L8MA 3FPWA 2PYPA 3QP6A 4E3KA 3IF5A 3A0RA 3QP4A 3OPLA 3EQUA 3GV9A 2J3TD 2V1AA 1P9RA 5FI6A 1NLYA 3PTEA 4EBNA 2CMNA 4WF0A 3R7WA 2M1CA 2EX6A 1OT6A 2H0TA 2NUTC 3DAVA 4QWOA 3PBOA 2KDKA 4R4RA 1N9OA 3DBAA 3TSGA 4UAAA 1KOUA 4UHUA 3ZFZA 3CLOA 2Z6CA 4DE0A 4HI4A 4WMCD 3NIAA 3FZCA 2HP9A 3KSIA 3G6OA 2JBFA 1KDSA 3QP2A 3LYXA 2WK0A 4NG2A 5F1GA 4BD0A 3VV4A 1PW1A 2XA7M 5FL3A 4FD8A 2H10A 4MDZA 4G3WA 1TDLA 4B4ZA 2W3EA 1T19A 3MBZA 3IWQA 1YLPA 2ZL1B 5F69A 1I2SA 3T1RA 2J3WA 5A90A 2WKHA 4YFMA 5A92A 4K0XA 4QHCA 4DE1A 2K7SA 3C7VA 4PKYA 5M19A 5EVLA 2KOIA 3V5MA 3FKWA 4P0MA 4ZJ3A 2IWDA 4HHDA 1NYMA 1XJ6A 1P0ZA 5J8XA 5L09A 3IF6A 5CHMA 1S1YA 4NXBA 3EOIA 3F1PB 5HPIA 1IEMA 1OJ5A 3U2AA 3BJNA 2JKTM 3N8LA 1TS7A 3MZFA 4NEED 5HL6A 2VK3A 2BTFP 4HP9A 1IYQA 3FG8A 3LGOA 3UMDA 4BL2A 2W3FA 1Q2PA 2V1ZA 3WRTA 4HNBA 4YOFA 4OOMA 1S0WA 2VX8A 2B5RA 5DJTA 2FZ0A 4OQIA 3ZDJA 3LI8A 4RA7A 5HDCA 2WUQA 3S7OA 1XJ2A 3RH8B 3PBRA 1TEMA 3TOIA 4Y0TA 3FPVA 4HJ6A 3UB7A 4OQHA 1E3UD 2Y2QA 2Q9MA 4WZ4A 5FI2A 1KGFA 2VGLS 2VLGA 4ZJ1A 4JLFA 1PI4A 4ZDXA 1LT0A 3OCNA 3VFFA 4G3KA 2WZXA 4Y7PA 2ZL1A 5KSCA 4ME4A 4P6BA 5DKKA 2Y2JA 4LPZA 2OSUA 2W27A 3FC7A 3TJZC 2P7JA 4I39A 4N9KA 1Y4OA 4S2IA 5D3OA 5A91A 1H0MA 1STZA 1BT5A 4JPMA 5L2FA 4ZAMA 1VB6A 1XJ3A 2JKGA 3IBRA 3WRZA 3B3XA 5A8BA 4LCLA 3HREA 1EW0A 4WL9A 4XUXA 4DKIA 3AGFA 2XGNA 3T4OA 3E4PA 4I3IA 3GRJA 1RGZA 5AQAA 3Q07A 3LIDA 5FAPA 3QNBA 3MFXA 4UA6A 2ZQDA 2PBYA 1FILA 2VV6A 4OPRA 4FCFA 4OQ0A 3UE1A 4MN6A 1DP9A 2INWA 5KMWA 2QWSA 2JN7A 3V67A 3ZGAB 2L4RA 1TD5A 1ERMA 1RP5A 1XXMA 4HBTA 3HLBA 5GLAA 2HDRA 1LSVA 3Q82A 3ZG8B 2ACGA 2HP6A 5DFYA 4P6ZM 1PFLA 1PWGA 2Q9NA 2PR5A 2ZD8A 3IS2B 4BQMA 4EETB 4DE3A 1ES3A 1MWUA 4LV0A 3UDIA 1W63Q 4ARZB 3G30A 2WGWB 1FCMA 2GJ3A 3GSGA 3OOVA 4RX2A 4KG6A 3HLDA 2WGIA 5DF7A 5FQQA 1XA7A 5M18A 1L3LA 1N9LA 2QJ5A 1ESIA 3G35A 3O86A 3UE6A 1MBLA 1K56D 2X71A 5KIZA 2NUPC 3T4SA 1ERQA 1QMEA 4FTXA 5E2FA 2J8YA 2PT7A 3WWXA 3VOZA 5EM0A 3TG9A 2ZQCA 3BECA 5L10A 2A3UA 3MZEA 5EVID 4Y0UA 2YKHA 3IXGA 1H3QA 4L9GA 2CC1A 3A0SA 2FFFB 1JNUA 3B33A 3V39A 1V9ZA 4GLQA 5F1FA 3EEHA 2PRFA 4DE2A 3BFGA 3DWKA 2HF6A 4WMCA 3PBTA 1ZC2A 1IFQA 1PYYA 4KUOA 4MMNA 1SKOA 2XQZA 2Y2GA 4X25A 3BY9A 3ZHHA 1FR1A 1W8QA 3OZHA 5EVIC 3DTEA 1UWPX 1Z6FA 3A3JA 2C5WB 1BLHA 1DP8A 1O7EA 3UB5P 3IH9A 3UB8A 1KGEA 3S4XA 3IS2A 4N1HA 2M7VA 4GD8A 1JWPA 2H5SA 1YLTA 2EX9A 4BL3A 3N8SA 4AFIA 4ARZA 5DF8A 3HUNA 2WGWA 3T1XA 4L9FA 5DTTA 4CQHA 2IA2A 5HAPA 3W4QA 2JE5A 3VSLA 3LEQA 2P08A 3ULFA 4LRZE 1H8ZA 5TJJA 2HPBA 1LI0A 5EV0A 4KZ8A 3C30A 3VE4A 2PD8A 2Z2MB 1ZG4A 2VA0A 3V3SA 4F94A 3P98A 4DXCA 4JXSA 3IBJA 5HW3A 1OJGA 3MR0A 3FV7A 4ID4A 5FATA 3BLSA 2B18A 3C7UA 3UB6A 3D3OA 4GZBA 4E6WA 5IT5A 3BFCA 2WADA 4QD4A 3R7WB 4E3MA 2QJ7A 5F5YA 4NKPA 2ZLYA 5K5BA 5CX7A 4ETXA 1G68A 4OQGA 1FOFA 3IQAA 2JKRI 4MBHA 3LICA 3O3VA 2DNSA 4II7A 5EOOA 3AGDA 1HTZA 2O9BA 5CECA 1QMFA 4NETA 1E3UA 4GDBA 4EWFA 1KVLA 3CPTB 1TS6A 2HGVA 1F9IA 1S1ZA 3N4IA 3KSHA 2L0WA 5GLDA 3Q7ZA 3MJQA 3T4QA 5AVEA 1YSPA 4NXFA 4U3TA 4QY5A 1VQQA 2XH9A 1FSYA 4H8RA 1ONHA 3P7NA 3UPNA 4EUZA 5J4EA 1YLJA 2PU2A 5HARA 3ZVTA 1CEGA 1FCOA 4CLCD 1T18A 5EVIB 1RGYA 4BWIA 1HLUP 1FQGA 5FQ9A 4F3LB 2P9VB 2FFYA 3T4KA 1LI9A 1K4FA 4OOLA 4WELA 5L07A 2HDQA 2Y2HA 4Q0HA 1ES4A 4IEDA 3ICYA 4CLCC 3IXBA 3HLFA 4EERA 1IOUA 4R3JA 1YKDA 3O5YA 2JKFA 1X0OA 1K6SA 5CGXA 2WAFA 5TBMA 3CWFA 4HH2A 2P04A 3EQVA 4C3QA 3NDGA 2G7UA 2XEPA 2HDSA 4E04A 5G4YA 4O01A 5TGFA 3JVVA 2P74A 3MFDA 1YLWA 4HJ3A 4EW7A 1Z09A 1FIKA 3U4LP 5DTKA 2XROA 3WS4A 4RVAA 2J3TC 1F5MA 1CF0A 4G3VA 2PHYA 5HAIA 1L0EA 4U0TA 1C3BA 3Q1FA 3MZDA 4Y5FA 5G4ZA 3CPTA 4QY6A 3L9KA 1MC0A 1VHMA 4I3AA 4EU0A 2A24B 4PM7A 4PM5A 2VGLM 3IXHA 5DJUA 1BTLA 2OWHA 5KZHA 2A49A 1PW8A 4JGQA 4O0PA 1W8YA 3LIAA 1GSWA 4PPRA 1K4EA 5HD3A 1PRQA 4Q8IA 4FUWA 3K3CA 3HVFA 3NBLA 5CGSA 5CTMA 3MSHA 3BLMA 1XGJA 2OLUA 5IU1A 3SZTA 5GLCA 2LB5A 4E3IA 1DJCA 5EVIA 1K0KA 4IVKA 3H82B 2ZBBA 3V3RA 3MQQA 4S2KA 4BMWA 2VGJA 1WYBA 2P9VA 2R9WA 4PHTA 4F3LA 5J7EA 4OPQA 4JXWA 3UDFA 4D2OA 4DDYA 1OPXA 4X55A 2HV1A 3VP0A 4HP4A 3QP1A 1JWVA 2XD1A 5EUAA 4PM8A 4EQ1A 1MZUA 1NLZA 1BLPA 4MNRA 3BEBA 2UWXA 4GNUA 3O87A 2L1MA 4GCZA 5FAQA 1L0GA 4BJPA 1K25A 2D02A 4Q0IA 2EX8A 1DJBA 1PZOA 1CJFA 2H0YA 1DRMA 4OPYA 3KYQA 3LY3A 3QP8A 1CEFA 4EUVA 3UPOA 1LSWA 3A3EA 3LIFA 1SZVA 3T4TA 1YAXA 3IWIA 3B42A 2V9AA 3BFEA 3SH7A 4ZJ2A 4OLGA 3CMZA 4CLCB 1L0FA 2W1TB 4LFUA 3CITA 4MLLA 2VGKA 3EEAA 1NY0A 2EFUA 2V8FA 2O0YA 4B88A 2W3DA 2ZC7A 1BSGA 4IJGA 4N1XA 3L7HA 4RQ9A 4A5RA 4X69A 3PAEA 1XKZA 3O88A 3CHWP 2DCFA 3HJIA 3MQOA 2A24A 1BUEA 4KZAA 4IBXA 2PU4A 2M7UA 3F1OB 3MXRA 5HFOA 4OH0A 3IWOA 5F83A 4DJ2A 3LIEA 3PHYA 4RYEA 2PAVP 5GHZA 2XFTA 1EWZA 2ZQ9A 3UNWA 4EQIA 1HZOA 5LBRA 3BW6A 4X56A 3FYZA 3OBFA 4O7DA 2O9CA 3PXPA 3UPPA 3FWLA 1OMEA 2Q0OA 5U47A 3RTYA 3D9YA 4Z1WA 1YM1A 4EEUA 3OPHA 3TE8A 1SHVA 5GLBA 3H82A 1O07A 3MQ0A 5CGWA 2DMWA 4DN0A 1SKOB 4BLMA 4DDSA 1T1AA 2EXAA 5FEFA 5F6AA 1E25A 5EPHA 1ALQA 4X1MA 1G6AA 3G4PA 4WBGA 1ES2A 3UY6A 4D60A 1N9NA 3SH8A 3GQZA 3VP4A 3LY4A 4DRTA 4E6XA 5KSHA 3IX4A 1S66L 4OVDA 3BYDA 5GHXA 4KZ7A 4X1LA 2HJ9C 3ZG7B 4MN5A 3P01A 3HCYA 4OLDA 3KO6A 3P09A 2O9AA 3JVUA 4S2NC 4UQIS 3SS4A 1V9YA 4CLCA 2W1TA 4H6JA 1TF1A 1P9WA 2R78A 5HAQA 2W3HA 1KE0A 1DJAA 3CZDA 4RX3A 1ZTUA 2UV0E 4GHIB 4CLCE 5HWTA 5AVFA 4GN2A 3QHYA 1WA9A 3QNCA 4C75A 2GX5A 1CK3A 2KLIA 3E4QA 3VP2A 3NHQA 3LO7A 1ZG6A 3HUMA 3VP3A 3F1OA 1ONGA 5DVAA 1WYCA 5CEBA 4EBLA 3BWLA 4XXRA 4KQQA 3UMEA 3CUEC 3WS5A 1KE3A 3NDEA 3OPPA 4IVIA 1KDWA 3D4FA 3OCLA 2GDNA 2D01A 1ODVA 4GOGA 1BYWA 5AJGA 1N9BA 2EWWA 3UE3A 1SKFA 4R1GA 1K54C 3T1SA 1NRFA 1LLBA 5F82A 3HLGA 4P85A 3W2ZA 2ZC3B 1T1BA 1PNEA 4LLOB 3JPUA 4S2MA 2BASA 4OPZA 3MKEA 4PM6A 3S7PA 2V2FF 2W1RA 4GKUA 4OOYA 4EEPA 3G32A 1L2SA 3PBQA 3BFFA 3M2JA 1ESUA 1MWTA 3ITAA 2Y8HA 3E2KA 2PDRA 1IYOA 1IYSA 3HUOA 3C2WA 2ZMFA 1S67L 3WS0A 4DXBA 5HWVA 4K08A 2ZC4B 2Y59A 4EESA 4GS9A 5FQKA 3BFDA 3B47A 5E2EA 1G6OA 1ES5A 5BOHA 1OT9A 1HVBA 1H8MA 4IBRA 2BLSA 2XLNA 4HH3A 3NJAA 1ZHHB 4KZ6A 5J3WA 2QKPA 3VOLA 1K55C 3LR4A 1MKMA 4GHIA 4LV1A 4N92A 4KG5A 4HOIA 1XFNA 1TS0A 1XA1A 3QP5A 4X53A 5HL1A 5DFXA 4EV4A 2YKFA 1E4DA 5TBMB 1BLCA 2JKTI 3MXQA 3T12B 1PI5A 1YQSA 2QZ6A 5HPFA 3NY4A 2QMIA 4R6LA 4HIAA 2Y2PA 1SCWA 5GL9A 3G31A 1EI5A 1TDGA 1SDEA 4Y2FA 4ZTKA 3NI9A 3C4PA 3A0VA 5E43A 4UA9A 4QJGA 3T4LA 2OV5A 2W3GA 5AQBA 3CAXA 1PZPA 3DTKA 1I5QA 4MEZA 2R9XA 1DY6A 4PKYG 3LR3A 4HESA 4I38A 1LL5A 3IXDA 2WZZA 3JYIA 5IS1A 4B93A 3BRMA 4PMAA 4Z9QA 5FQMA 4CPKA 5CHUA 3E0YA 1MXOA 4LENA 1GCEA 3VP1A 1D06A 3T4JA 3W4OA 1K6RA 3F1NA 3GECA 3R4KA 2XSSA 3WS1A 1YLYA 1PWDA 1H5XA 1XGIA 4Q0JA 1H8YA 3G34A 3DTIA 2Y55A 1OTEA 3VE3A 2IWBA 2OAQ1 3SH9A 4DMZA 4R4SA 2VV8A 5C5KA 4ETZA 3G2YA 4JF5A 5IHVA 2Y2IA 3MXSA 2EX2A 1GA0A 1N4OA 1P97A 1J3WA 2ZMVA 1D1JA 3IHBA 2WKIA 4R3BA 1MPLA 4HBUA 4N9LA 3KSGA 4S2NA 4B9OA 4E3LA 2ZC6B 1BULA 3N8RA 3BQAA 4LGWA 3LCEA 3S7QA 2VKSA 4FSFA 5FSRA 2HP5A 4FH2A 3W4PA 1NYYA 3SS5A 4JGRA 1JVJA 2KX6A 1MKIA 1Y28A 3ZG5A 3UE0A 5M1AA 3S7NA 4X6TA 5CERA 4KG2A 2HZ5A 4LRXC 3IT9A 4KZ3A 2ZQAA 4WN5A 4QPRA 2X02A 3TW8A 1FCNA 4MCWA 4WUJA 3SS3A 4MBFA 4QU3A 3H7WB 1S4SA 1T1CA 4B4XA 1XPBA 3CUEA 2EXBA 3E4OA 1U60A 3C38A 2XF3A 4WLAA 3RFBA 5FEGA 1TVFA 3PYPA 5E2HA 2O99A 4PM9A 5DKLA 1K56A 1XX2A 1LSXA 1A0KA 5FI7A 1K54A 1M6KA 1YSQA 3SW1A 2AVXA 2OWJA 1IELA 4KQDA 4KQOA 1WE4A 2XD5A 4LCMA 3M6HA 3SOIA 1GSVA 3NC8A 1LL9A 1W7FA 2C6WB 3GTCA 2ZQ8A 2Y2OA 4NXGA 2JC7A 4KZ5A 4HQAA 4Y15A 2EFXA 3EGDC 4P87A 1S6RA 2A2LA 4JGPA 5FQIA 3GDIA 3MKFA 3PBSA 1VETB 4MN7A 2JKRM 2QPNA 1K57C 1XJ4A 2WGVA 4M3KA 3DW0A 3M2KA 2X01A 1IKIA 2XDMA 3HJKA 2HDUA 2WKRA 2XA7S 5GHYA 4HJ4A 4KZBA 2Y2KA 5DF9A 4DF6A 4R3AA 3HLEA 3VMAA 3KYZA 4WM9A 2ZQ7A 1K55A 2ZOHA 4EXOA 1UGUA 4Y0OA 1RCJA 1G5UA 3T1QB 4H6JB 4S2LA 1AXBA 3C5AA 4WEJA 1IKGA 1D7EA 3S1YA 1FSWA 1OTAA 2G2WA 2Y2NA 2WKQA 3H7WA 3LUQA 2XFSA 1YMSA 2XK1A 2K2NA 1W79A 3KSFA 5FDHA 2PBDP 4KENB 3HBRA 3A3FA 1IYPA 1G28A 2ZOIA 5CTNA 3NCKA 3V50A 2G2UA 4UQIM 1AWIA 3FKVA 3GR2A 4E3JA 3I7JA 3ZNTA 2Y2MA 3E98A 3ZNYA 1KE4A 3VFHA 4OP8A 4E3NA 3W8KA 4EBPA 5HD5A 1BZAA 3A3IA 4M4XA 4BENA 3LR0A 4NXEA 1VM1A 3MF0A 5EE8A 2QYBA 3UB9A 3ISGA 4K91A 5CRFA 3K3DA 3F1PA 4I3JA 3BY8A 3IX8A 1YLZA 3PR6A 3CI6A 1OTIA 1VETA 1Y54A 2XR0A 4GDNA 4JXVA 4PAUA 2JHEA 2E8IA
chains in the Genus database with same CATH topology
2VZWA 2LB9A 4NEED 5HL6A 4CLCD 2Y8HA 4HP9A 3H9WA 3FG8A 3UMDA 2PDRA 4GJ4A 1T18A 3ZYTA 3C2WA 2ZMFA 1S67L 2W3FA 2MJ6A 3LFVA 4BWIA 3LI9A 5HWVA 4K08A 2FH5A 2HJEA 4HNBA 4EESA 4GS9A 4YOFA 3B47A 4F3LB 1G6OA 4OOMA 3EGXC 3T4KA 2VX8A 1OT9A 4GS9B 5DJTA 2FZ0A 1H8MA 3LI8A 4OOLA 4ZRRA 5HDCA 3S7OA 4WELA 4HH3A 1XJ2A 3RH8B 4Q0HA 4I5SA 3PBRA 2VEAA 3NJAA 1ZHHB 3ICYA 3FPVA 4R38A 5J3WA 2QKPA 4HJ6A 3UB7A 3VOLA 4CLCC 3LR4A 3D72A 1MKMA 4GHIA 4YWZA 4HOIA 4EERA 1IOUA 3TRCA 1TS0A 1XFNA 1YKDA 3O5YA 1X0OA 2VGLS 4YNRA 2VLGA 5TBMA 3CWFA 4HH2A 2P04A 3EQVA 2G7UA 5DFXA 2YKFA 5TBMB 4E04A 2JKTI 5G4YA 4O01A 3MXQA 3JVVA 1LT0A 4R70A 3OCNA 4G3KA 5HPFA 3ZQ5A 2VJWA 4HJ3A 4EW7A 2XROA 4R6LA 4HIAA 4ME4A 2J3TC 5DKKA 1F5MA 4G3VA 4LPZA 2PHYA 2W27A 3FC7A 3TJZC 2P7JA 4Y2FA 4I39A 3MMHA 2EWVA 3NOUC 3EWKA 3A0VA 1STZA 4Y5FA 5G4ZA 1VB6A 1XJ3A 3T4LA 2GZAA 4Y3IA 3IBRA 1MC0A 1VHMA 2W3GA 4I3AA 4EU0A 3CAXA 5A8BA 2PD7A 2A24B 1EW0A 4P6ZS 4WL9A 4XT2B 4JGOA 2VGLM 4PKYG 5DJUA 2OWHA 3LR3A 3T4OA 4JGQA 4O0PA 4I38A 3E4PA 4I3IA 3LIAA 3LIDA 2GNXA 1GSWA 4BBUA 5HD3A 5IS1A 4B93A 3MFXA 3K3CA 3NOTC 1OTDA 5I5LA 2QHKA 3E0YA 3LR5A 2OAP1 2VV6A 2VV7A 5IU1A 4MN6A 1DP9A 1D06A 4IUHA 2LB5A 3T4JA 2INWA 3F1NA 3GECA 3R4KA 2XSSA 1NWZA 2QWSA 2JN7A 2PYRA 3H82B 2ZBBA 3V67A 2L4RA 1TD5A 3PBNA 4Q0JA 3F1NB 3MQQA 4BMWA 4F3LA 4PHTA 5J7EA 4IUKA 1LSVA 1OTEA 3VE3A 3LIBA 5DFYA 4P6ZM 2OAQ1 1OPXA 2HV1A 4DMZA 4HP4A 2VV8A 5C5KA 2PR5A 4ETZA 3C8CA 4EQ1A 1MZUA 3IS2B 4O8GA 1NLZA 2PR6A 1P97A 4EETB 2ZMVA 2L1MA 1W63Q 4GCZA 3KX0X 4ARZB 4BJPA 4WEKA 2GJ3A 2D02A 4Q0IA 3OOVA 1W63M 2I9VA 1DRMA 3KSGA 3KYQA 4EUVA 4B9OA 4L9EA 1LSWA 2OOLA 3OLOA 4GW9A 4DJ3A 3BQAA 3LIFA 3S7QA 3T4TA 2VKSA 4FSFA 5HDDA 1YAXA 1LL8A 3B42A 1N9LA 2V9AA 2QJ5A 4JGRA 5HWWA 1DP6A 4CLCB 3UE6A 2KX6A 2W1TB 3CITA 1Y28A 3EEAA 2O0YA 4HY8A 5KIZA 2W3DA 3S7NA 2NUPC 3T4SA 2H28A 1GSXA 2W0NA 4IJGA 1S4RA 2EA9A 4RQ9A 2Y79A 1NRJA 2PT7A 4LRXC 4WN5A 2J80A 4QPRA 3HJIA 4LRYC 3MQOA 3TW8A 2A24A 4MCWA 4XT2A 4WUJA 3H7WB 1S4SA 1T1CA 2M7UA 2YKHA 3CUEA 3E4OA 3F1OB 1H3QA 4KUKA 3C38A 2XRNA 4FOFA 4DJ2A 3LIEA 4WLAA 4L9GA 3RFBA 3PHYA 2WKPA 3A0SA 2B02A 3PYPA 2O99A 5DKLA 3BQ8A 1JNUA 3B33A 5LBRA 1V9ZA 3BW6A 4GLQA 1LSXA 3K2NA 5HDSA 3NOPC 3EEHA 3OC2A 3OBFA 1YSQA 2O9CA 3PXPA 5HSQA 3SW1A 2OWJA 4KQDA 4KQOA 2HF6A 1OTBA 1F98A 4L0LA 3PBTA 3RTYA 1GSVA 2V0UA 4Z1WA 1IFQA 4BBTA 4EEUA 4KUOA 4MMNA 3TE8A 3H82A 4UEYA 4NXGA 3MQ0A 1UWNX 3BY9A 4HQAA 2DMWA 4DN0A 1T1AA 3EGDC 1UWPX 5F6AA 2K31A 4IHQA 1TS8A 2A2LA 4JGPA 3GDIA 1DP8A 3PBSA 2V0WA 3UB8A 4MN7A 3IS2A 2JKRM 2M7VA 4BBVA 1N9NA 1XFQA 5F68A 1XJ4A 4AFIA 4ARZA 2Z6DA 3HJKA 4L9FA 5KSHA 5HZHA 1S66L 3T50A 4CQHA 5EFWA 2WKRA 2IA2A 2V1BA 2XA7S 5MC7A 2HJ9C 5L8MA 3FPWA 3ULFA 2P08A 2PYPA 4HJ4A 4LRZE 5TJJA 4MN5A 5DF9A 3P01A 3A0RA 3HCYA 3C30A 4R3AA 3KO6A 3VE4A 2O9AA 3EQUA 2PD8A 3KYZA 2J3TD 3JVUA 2V1AA 2VA0A 1P9RA 4UQIS 1V9YA 4CLCA 2W1TA 2ZOHA 3IBJA 4H6JA 4EXOA 1TF1A 1NLYA 1P9WA 1UGUA 2R78A 1OJGA 2CMNA 4WF0A 2W3HA 3MR0A 3R7WA 2M1CA 1OT6A 2B18A 4H6JB 3UB6A 2NUTC 3D3OA 5IT5A 1ZTUA 4WEJA 4GHIB 3PBOA 2KDKA 3R7WB 2QJ7A 5F5YA 5HWTA 4NKPA 4CLCE 1N9OA 5AVFA 5K5BA 3DBAA 5CX7A 1D7EA 1KOUA 1WA9A 1OTAA 3CLOA 2GX5A 2Z6CA 4ETXA 4HI4A 2KLIA 3E4QA 2WKQA 3KSIA 3G6OA 3NHQA 3H7WA 3LUQA 2JKRI 3LYXA 3VV4A 3LICA 3F1OA 2K2NA 2XA7M 5FL3A 3KSFA 4II7A 4MDZA 4G3WA 3BWLA 2O9BA 2W3EA 1T19A 3UMEA 3CUEC 1G28A 2ZOIA 5F69A 4UQIM 2J3WA 3OCLA 2D01A 1ODVA 1BYWA 5AJGA 2EWWA 3UE3A 3E98A 1TS6A 2K7SA 3W2ZA 2HGVA 4PKYA 1F9IA 1T1BA 5HD5A 1S1ZA 4LLOB 4M4XA 3KSHA 2KOIA 3LR0A 2L0WA 4NXEA 2BASA 3MF0A 4HHDA 3UB9A 2QYBA 3MJQA 1XJ6A 1P0ZA 3T4QA 3K3DA 3F1PA 5AVEA 4I3JA 3BY8A 1YSPA 4NXFA 1S1YA 3S7PA 3PR6A 2W1RA 3CI6A 4EEPA 4NXBA 1OTIA 3EOIA 3F1PB 5HPIA 1OJ5A 3PBQA 3U2AA 3BJNA 3P7NA 2JKTM 4PAUA 5J4EA 2JHEA 1TS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP9 A;  3H9W A;  3FG8 A;  3UMD A;  2PDR A;  1T18 A;  3C2W A;  1S67 L;  3LI9 A;  5HWV A;  4K08 A;  4HNB A;  4EES A;  4GS9 A;  4F3L B;  1OT9 A;  4GS9 B;  5DJT A;  3LI8 A;  5HDC A;  4HH3 A;  1XJ2 A;  3RH8 B;  4I5S A;  2VEA A;  3NJA A;  3ICY A;  4R38 A;  5J3W A;  2QKP A;  4HJ6 A;  3UB7 A;  3VOL A;  3D72 A;  4GHI A;  4YWZ A;  4HOI A;  4EER A;  1XFN A;  1TS0 A;  1X0O A;  2VLG A;  5TBM A;  3CWF A;  4HH2 A;  2YKF A;  5TBM B;  4E04 A;  5G4Y A;  3MXQ A;  1LT0 A;  4R70 A;  3ZQ5 A;  4HJ3 A;  4EW7 A;  4R6L A;  4HIA A;  5DKK A;  4LPZ A;  2PHY A;  2W27 A;  3FC7 A;  2P7J A;  4I39 A;  3NOU C;  3EWK A;  3A0V A;  5G4Z A;  1VB6 A;  1XJ3 A;  3IBR A;  4I3A A;  3CAX A;  5A8B A;  2PD7 A;  2A24 B;  1EW0 A;  4XT2 B;  4WL9 A;  4JGO A;  4PKY G;  5DJU A;  2OWH A;  4JGQ A;  4I38 A;  3E4P A;  4I3I A;  3LIA A;  3LID A;  1GSW A;  4BBU A;  5HD3 A;  5IS1 A;  3MFX A;  3K3C A;  3NOT C;  1OTD A;  5I5L A;  2QHK A;  2VV6 A;  2VV7 A;  5IU1 A;  4MN6 A;  1DP9 A;  1D06 A;  2INW A;  3F1N A;  3GEC A;  1NWZ A;  2QWS A;  2JN7 A;  2PYR A;  3H82 B;  2ZBB A;  2L4R A;  3F1N B;  3MQQ A;  4F3L A;  5J7E A;  1LSV A;  1OTE A;  3VE3 A;  3LIB A;  2HV1 A;  4HP4 A;  2VV8 A;  2PR5 A;  3C8C A;  4EQ1 A;  1MZU A;  3IS2 B;  2PR6 A;  1P97 A;  4EET B;  2L1M A;  4GCZ A;  3KX0 X;  2GJ3 A;  2D02 A;  2I9V A;  1DRM A;  4B9O A;  4L9E A;  1LSW A;  2OOL A;  3OLO A;  4GW9 A;  4DJ3 A;  3LIF A;  5HDD A;  1LL8 A;  1N9L A;  2V9A A;  2QJ5 A;  4JGR A;  5HWW A;  1DP6 A;  3UE6 A;  2KX6 A;  1Y28 A;  4HY8 A;  5KIZ A;  2H28 A;  1GSX A;  2W0N A;  1S4R A;  2EA9 A;  4RQ9 A;  4LRX C;  4WN5 A;  2J80 A;  3HJI A;  4LRY C;  3MQO A;  2A24 A;  4XT2 A;  4WUJ A;  3H7W B;  1S4S A;  1T1C A;  2YKH A;  3F1O B;  3E4O A;  4KUK A;  4DJ2 A;  3LIE A;  4WLA A;  4L9G A;  3PHY A;  2WKP A;  3A0S A;  2B02 A;  3PYP A;  5DKL A;  1JNU A;  3B33 A;  1V9Z A;  1LSX A;  5HDS A;  3NOP C;  3EEH A;  5HSQ A;  3SW1 A;  2OWJ A;  4KQD A;  1OTB A;  1F98 A;  3RTY A;  1GSV A;  2V0U A;  4BBT A;  4EEU A;  4KUO A;  3H82 A;  4NXG A;  1UWN X;  3BY9 A;  4HQA A;  1T1A A;  1UWP X;  5F6A A;  1TS8 A;  4JGP A;  3GDI A;  1DP8 A;  2V0W A;  3UB8 A;  3IS2 A;  4BBV A;  1N9N A;  1XFQ A;  5F68 A;  1XJ4 A;  2Z6D A;  3HJK A;  4L9F A;  5HZH A;  1S66 L;  3T50 A;  5EFW A;  2WKR A;  2V1B A;  3ULF A;  2PYP A;  4HJ4 A;  4LRZ E;  4MN5 A;  3A0R A;  4R3A A;  3VE4 A;  2PD8 A;  2V1A A;  1V9Y A;  2ZOH A;  4H6J A;  4EXO A;  1UGU A;  2R78 A;  1OJG A;  2CMN A;  4WF0 A;  3MR0 A;  2M1C A;  1OT6 A;  4H6J B;  3UB6 A;  4GHI B;  2KDK A;  2QJ7 A;  5F5Y A;  5HWT A;  1N9O A;  5AVF A;  1D7E A;  1KOU A;  1WA9 A;  1OTA A;  3CLO A;  2Z6C A;  4HI4 A;  3E4Q A;  2WKQ A;  3NHQ A;  3G6O A;  3H7W A;  3LUQ A;  3LYX A;  3LIC A;  3F1O A;  3BWL A;  1T19 A;  3UME A;  1G28 A;  2ZOI A;  5F69 A;  2D01 A;  1ODV A;  1BYW A;  1TS6 A;  2K7S A;  4PKY A;  1F9I A;  1T1B A;  5HD5 A;  1S1Z A;  4LLO B;  4M4X A;  2L0W A;  4NXE A;  2BAS A;  4HHD A;  3UB9 A;  3MJQ A;  1XJ6 A;  1P0Z A;  3K3D A;  3F1P A;  5AVE A;  4I3J A;  3BY8 A;  4NXF A;  1S1Y A;  4EEP A;  4NXB A;  1OTI A;  3F1P B;  1OJ5 A;  3P7N A;  5J4E A;  2JHE A;  1TS7 A; 
#chains in the Genus database with same CATH topology
 2VZW A;  3GVB A;  2LB9 A;  4K0W A;  5A93 A;  5E2G A;  1GA9 A;  3H9W A;  4E3O A;  4WZ5 C;  3Q81 A;  4GJ4 A;  4LV2 A;  3ZYT A;  2I72 A;  4C6Y A;  2MJ6 A;  4OON A;  1W5D A;  3LFV A;  2Y91 A;  3LI9 A;  4GB7 A;  2FH5 A;  2HJE A;  3RXX A;  2RCX A;  2BG1 A;  2V8C A;  3EGX C;  4GS9 B;  5CED A;  4ZRR A;  4S2P A;  2ZC5 B;  4I5S A;  5G18 A;  3GMW A;  4YIN A;  2VEA A;  1PWC A;  1CI9 A;  4R38 A;  2ZMA A;  1SDN A;  1ERO A;  3D72 A;  4YWZ A;  4S2J A;  3VSK A;  3TRC A;  2J9P A;  4YNR A;  1Q2Q A;  1VEU B;  3HL9 A;  1YPR A;  4CJN A;  4R70 A;  3HLW A;  3ITB A;  3E2L A;  3ZQ5 A;  2VJW A;  4JF6 A;  3A3D A;  1MWR A;  2WYX A;  3NUL A;  3IX3 A;  4R0Q A;  5AQ7 A;  2Y4A A;  4XUZ A;  3MMH A;  1JTD A;  2EWV A;  3NOU C;  3EWK A;  4ZBE A;  3S22 A;  2DRW A;  5AQ9 A;  5HX9 A;  3G2Z A;  1FR6 A;  2GZA A;  4Y3I A;  4S2O A;  2PD7 A;  4P6Z S;  4XT2 B;  4JGO A;  3DTM A;  3RJU A;  2ZM2 A;  1CI8 A;  2J9O A;  1NJ4 A;  4HEF A;  1XP4 A;  2GNX A;  4BBU A;  3M6B A;  1CQA A;  2E8J A;  1LHY A;  2J7V A;  3NOT C;  1OTD A;  5TFQ A;  3IF6 C;  5I5L A;  2QHK A;  3LR5 A;  2OAP 1;  2WAE A;  2VV7 A;  1K38 A;  4IUH A;  3WS2 A;  4R23 A;  3VOY A;  3ZG0 A;  3UN7 A;  4NK3 A;  1NXY A;  4KZ4 A;  1NWZ A;  2PYR A;  4JF4 A;  5EVE A;  3PBN A;  4FH4 A;  3F1N B;  4QB8 A;  1BLS A;  4IUK A;  5FDS A;  5DTS A;  3OPR A;  3LIB A;  3IH8 A;  3Q7V B;  1K57 A;  1JTG A;  1KGG A;  2OLV A;  1NZO A;  3C8C A;  4O8G A;  2PR6 A;  5FQJ A;  4Y13 A;  3AGE A;  1F2K A;  1JWZ A;  2Z2L B;  3KX0 X;  4X68 A;  4WEK A;  1VEU A;  1NZU A;  5TR7 A;  1W63 M;  3C4O A;  2I9V A;  4MBK A;  4GD6 A;  1M40 A;  2JCH A;  4L9E A;  2OOL A;  3OLO A;  4GW9 A;  5I94 A;  4DJ3 A;  1GHI A;  3ZVW A;  4OKP A;  4BD1 A;  2B95 A;  5HDD A;  1LL8 A;  3MS6 A;  1ZKJ A;  2ZM0 A;  1MWS A;  2ZM8 A;  5EM1 A;  5HWW A;  1DP6 A;  2WKE A;  1MY8 A;  3CJM A;  1PIO A;  4HY8 A;  2H28 A;  1GSX A;  2Y2L A;  2W0N A;  1S4R A;  2EA9 A;  3BM6 A;  4JKT A;  2Y79 A;  1NRJ A;  3NEC A;  1I2W A;  5FAS A;  2J80 A;  4LRY C;  4XT2 A;  4KQR A;  4JBF A;  5JYP A;  5JYO A;  4KUK A;  2XRN A;  4FOF A;  4KZ9 A;  5EOE A;  2WKP A;  3UO9 A;  2B02 A;  3BQ8 A;  2RL3 A;  5CHJ A;  3K2N A;  5HDS A;  3LEZ A;  3NOP C;  3OC2 A;  1HD8 A;  4OP5 A;  1ACF A;  5HSQ A;  3HLC A;  1OTB A;  1F98 A;  4L0L A;  2V0U A;  3PAG A;  4BBT A;  1YT4 A;  4UEY A;  5EEC A;  1GHM A;  1UWN X;  1KVM A;  3DWZ A;  2K31 A;  3CG5 A;  4ESP A;  4IHQ A;  3Q7V A;  1TS8 A;  3UDX A;  3ZCZ A;  1GHP A;  4Y17 A;  3IF6 B;  5FAO A;  4LV3 A;  3N6I A;  3ZG9 B;  4JXG A;  2V0W A;  3IHA A;  3RXW A;  3N7W A;  4UA7 A;  4WZ5 A;  1YMX A;  4BBV A;  2IWC A;  1XFQ A;  5CXW A;  1L0D A;  5F68 A;  5FA7 A;  2ZJ9 A;  4WYY A;  3KYE A;  2Z6D A;  2V20 A;  5HZH A;  3T50 A;  5EFW A;  1J9M A;  2V1B A;  5MC7 A;  4U0X A;  5L8M A;  3FPW A;  2PYP A;  3QP6 A;  4E3K A;  3IF5 A;  3A0R A;  3QP4 A;  3OPL A;  3EQU A;  3GV9 A;  2J3T D;  2V1A A;  1P9R A;  5FI6 A;  1NLY A;  3PTE A;  4EBN A;  2CMN A;  4WF0 A;  3R7W A;  2M1C A;  2EX6 A;  1OT6 A;  2H0T A;  2NUT C;  3DAV A;  4QWO A;  3PBO A;  2KDK A;  4R4R A;  1N9O A;  3DBA A;  3TSG A;  4UAA A;  1KOU A;  4UHU A;  3ZFZ A;  3CLO A;  2Z6C A;  4DE0 A;  4HI4 A;  4WMC D;  3NIA A;  3FZC A;  2HP9 A;  3KSI A;  3G6O A;  2JBF A;  1KDS A;  3QP2 A;  3LYX A;  2WK0 A;  4NG2 A;  5F1G A;  4BD0 A;  3VV4 A;  1PW1 A;  2XA7 M;  5FL3 A;  4FD8 A;  2H10 A;  4MDZ A;  4G3W A;  1TDL A;  4B4Z A;  2W3E A;  1T19 A;  3MBZ A;  3IWQ A;  1YLP A;  2ZL1 B;  5F69 A;  1I2S A;  3T1R A;  2J3W A;  5A90 A;  2WKH A;  4YFM A;  5A92 A;  4K0X A;  4QHC A;  4DE1 A;  2K7S A;  3C7V A;  4PKY A;  5M19 A;  5EVL A;  2KOI A;  3V5M A;  3FKW A;  4P0M A;  4ZJ3 A;  2IWD A;  4HHD A;  1NYM A;  1XJ6 A;  1P0Z A;  5J8X A;  5L09 A;  3IF6 A;  5CHM A;  1S1Y A;  4NXB A;  3EOI A;  3F1P B;  5HPI A;  1IEM A;  1OJ5 A;  3U2A A;  3BJN A;  2JKT M;  3N8L A;  1TS7 A;  3MZF A;  4NEE D;  5HL6 A;  2VK3 A;  2BTF P;  4HP9 A;  1IYQ A;  3FG8 A;  3LGO A;  3UMD A;  4BL2 A;  2W3F A;  1Q2P A;  2V1Z A;  3WRT A;  4HNB A;  4YOF A;  4OOM A;  1S0W A;  2VX8 A;  2B5R A;  5DJT A;  2FZ0 A;  4OQI A;  3ZDJ A;  3LI8 A;  4RA7 A;  5HDC A;  2WUQ A;  3S7O A;  1XJ2 A;  3RH8 B;  3PBR A;  1TEM A;  3TOI A;  4Y0T A;  3FPV A;  4HJ6 A;  3UB7 A;  4OQH A;  1E3U D;  2Y2Q A;  2Q9M A;  4WZ4 A;  5FI2 A;  1KGF A;  2VGL S;  2VLG A;  4ZJ1 A;  4JLF A;  1PI4 A;  4ZDX A;  1LT0 A;  3OCN A;  3VFF A;  4G3K A;  2WZX A;  4Y7P A;  2ZL1 A;  5KSC A;  4ME4 A;  4P6B A;  5DKK A;  2Y2J A;  4LPZ A;  2OSU A;  2W27 A;  3FC7 A;  3TJZ C;  2P7J A;  4I39 A;  4N9K A;  1Y4O A;  4S2I A;  5D3O A;  5A91 A;  1H0M A;  1STZ A;  1BT5 A;  4JPM A;  5L2F A;  4ZAM A;  1VB6 A;  1XJ3 A;  2JKG A;  3IBR A;  3WRZ A;  3B3X A;  5A8B A;  4LCL A;  3HRE A;  1EW0 A;  4WL9 A;  4XUX A;  4DKI A;  3AGF A;  2XGN A;  3T4O A;  3E4P A;  4I3I A;  3GRJ A;  1RGZ A;  5AQA A;  3Q07 A;  3LID A;  5FAP A;  3QNB A;  3MFX A;  4UA6 A;  2ZQD A;  2PBY A;  1FIL A;  2VV6 A;  4OPR A;  4FCF A;  4OQ0 A;  3UE1 A;  4MN6 A;  1DP9 A;  2INW A;  5KMW A;  2QWS A;  2JN7 A;  3V67 A;  3ZGA B;  2L4R A;  1TD5 A;  1ERM A;  1RP5 A;  1XXM A;  4HBT A;  3HLB A;  5GLA A;  2HDR A;  1LSV A;  3Q82 A;  3ZG8 B;  2ACG A;  2HP6 A;  5DFY A;  4P6Z M;  1PFL A;  1PWG A;  2Q9N A;  2PR5 A;  2ZD8 A;  3IS2 B;  4BQM A;  4EET B;  4DE3 A;  1ES3 A;  1MWU A;  4LV0 A;  3UDI A;  1W63 Q;  4ARZ B;  3G30 A;  2WGW B;  1FCM A;  2GJ3 A;  3GSG A;  3OOV A;  4RX2 A;  4KG6 A;  3HLD A;  2WGI A;  5DF7 A;  5FQQ A;  1XA7 A;  5M18 A;  1L3L A;  1N9L A;  2QJ5 A;  1ESI A;  3G35 A;  3O86 A;  3UE6 A;  1MBL A;  1K56 D;  2X71 A;  5KIZ A;  2NUP C;  3T4S A;  1ERQ A;  1QME A;  4FTX A;  5E2F A;  2J8Y A;  2PT7 A;  3WWX A;  3VOZ A;  5EM0 A;  3TG9 A;  2ZQC A;  3BEC A;  5L10 A;  2A3U A;  3MZE A;  5EVI D;  4Y0U A;  2YKH A;  3IXG A;  1H3Q A;  4L9G A;  2CC1 A;  3A0S A;  2FFF B;  1JNU A;  3B33 A;  3V39 A;  1V9Z A;  4GLQ A;  5F1F A;  3EEH A;  2PRF A;  4DE2 A;  3BFG A;  3DWK A;  2HF6 A;  4WMC A;  3PBT A;  1ZC2 A;  1IFQ A;  1PYY A;  4KUO A;  4MMN A;  1SKO A;  2XQZ A;  2Y2G A;  4X25 A;  3BY9 A;  3ZHH A;  1FR1 A;  1W8Q A;  3OZH A;  5EVI C;  3DTE A;  1UWP X;  1Z6F A;  3A3J A;  2C5W B;  1BLH A;  1DP8 A;  1O7E A;  3UB5 P;  3IH9 A;  3UB8 A;  1KGE A;  3S4X A;  3IS2 A;  4N1H A;  2M7V A;  4GD8 A;  1JWP A;  2H5S A;  1YLT A;  2EX9 A;  4BL3 A;  3N8S A;  4AFI A;  4ARZ A;  5DF8 A;  3HUN A;  2WGW A;  3T1X A;  4L9F A;  5DTT A;  4CQH A;  2IA2 A;  5HAP A;  3W4Q A;  2JE5 A;  3VSL A;  3LEQ A;  2P08 A;  3ULF A;  4LRZ E;  1H8Z A;  5TJJ A;  2HPB A;  1LI0 A;  5EV0 A;  4KZ8 A;  3C30 A;  3VE4 A;  2PD8 A;  2Z2M B;  1ZG4 A;  2VA0 A;  3V3S A;  4F94 A;  3P98 A;  4DXC A;  4JXS A;  3IBJ A;  5HW3 A;  1OJG A;  3MR0 A;  3FV7 A;  4ID4 A;  5FAT A;  3BLS A;  2B18 A;  3C7U A;  3UB6 A;  3D3O A;  4GZB A;  4E6W A;  5IT5 A;  3BFC A;  2WAD A;  4QD4 A;  3R7W B;  4E3M A;  2QJ7 A;  5F5Y A;  4NKP A;  2ZLY A;  5K5B A;  5CX7 A;  4ETX A;  1G68 A;  4OQG A;  1FOF A;  3IQA A;  2JKR I;  4MBH A;  3LIC A;  3O3V A;  2DNS A;  4II7 A;  5EOO A;  3AGD A;  1HTZ A;  2O9B A;  5CEC A;  1QMF A;  4NET A;  1E3U A;  4GDB A;  4EWF A;  1KVL A;  3CPT B;  1TS6 A;  2HGV A;  1F9I A;  1S1Z A;  3N4I A;  3KSH A;  2L0W A;  5GLD A;  3Q7Z A;  3MJQ A;  3T4Q A;  5AVE A;  1YSP A;  4NXF A;  4U3T A;  4QY5 A;  1VQQ A;  2XH9 A;  1FSY A;  4H8R A;  1ONH A;  3P7N A;  3UPN A;  4EUZ A;  5J4E A;  1YLJ A;  2PU2 A;  5HAR A;  3ZVT A;  1CEG A;  1FCO A;  4CLC D;  1T18 A;  5EVI B;  1RGY A;  4BWI A;  1HLU P;  1FQG A;  5FQ9 A;  4F3L B;  2P9V B;  2FFY A;  3T4K A;  1LI9 A;  1K4F A;  4OOL A;  4WEL A;  5L07 A;  2HDQ A;  2Y2H A;  4Q0H A;  1ES4 A;  4IED A;  3ICY A;  4CLC C;  3IXB A;  3HLF A;  4EER A;  1IOU A;  4R3J A;  1YKD A;  3O5Y A;  2JKF A;  1X0O A;  1K6S A;  5CGX A;  2WAF A;  5TBM A;  3CWF A;  4HH2 A;  2P04 A;  3EQV A;  4C3Q A;  3NDG A;  2G7U A;  2XEP A;  2HDS A;  4E04 A;  5G4Y A;  4O01 A;  5TGF A;  3JVV A;  2P74 A;  3MFD A;  1YLW A;  4HJ3 A;  4EW7 A;  1Z09 A;  1FIK A;  3U4L P;  5DTK A;  2XRO A;  3WS4 A;  4RVA A;  2J3T C;  1F5M A;  1CF0 A;  4G3V A;  2PHY A;  5HAI A;  1L0E A;  4U0T A;  1C3B A;  3Q1F A;  3MZD A;  4Y5F A;  5G4Z A;  3CPT A;  4QY6 A;  3L9K A;  1MC0 A;  1VHM A;  4I3A A;  4EU0 A;  2A24 B;  4PM7 A;  4PM5 A;  2VGL M;  3IXH A;  5DJU A;  1BTL A;  2OWH A;  5KZH A;  2A49 A;  1PW8 A;  4JGQ A;  4O0P A;  1W8Y A;  3LIA A;  1GSW A;  4PPR A;  1K4E A;  5HD3 A;  1PRQ A;  4Q8I A;  4FUW A;  3K3C A;  3HVF A;  3NBL A;  5CGS A;  5CTM A;  3MSH A;  3BLM A;  1XGJ A;  2OLU A;  5IU1 A;  3SZT A;  5GLC A;  2LB5 A;  4E3I A;  1DJC A;  5EVI A;  1K0K A;  4IVK A;  3H82 B;  2ZBB A;  3V3R A;  3MQQ A;  4S2K A;  4BMW A;  2VGJ A;  1WYB A;  2P9V A;  2R9W A;  4PHT A;  4F3L A;  5J7E A;  4OPQ A;  4JXW A;  3UDF A;  4D2O A;  4DDY A;  1OPX A;  4X55 A;  2HV1 A;  3VP0 A;  4HP4 A;  3QP1 A;  1JWV A;  2XD1 A;  5EUA A;  4PM8 A;  4EQ1 A;  1MZU A;  1NLZ A;  1BLP A;  4MNR A;  3BEB A;  2UWX A;  4GNU A;  3O87 A;  2L1M A;  4GCZ A;  5FAQ A;  1L0G A;  4BJP A;  1K25 A;  2D02 A;  4Q0I A;  2EX8 A;  1DJB A;  1PZO A;  1CJF A;  2H0Y A;  1DRM A;  4OPY A;  3KYQ A;  3LY3 A;  3QP8 A;  1CEF A;  4EUV A;  3UPO A;  1LSW A;  3A3E A;  3LIF A;  1SZV A;  3T4T A;  1YAX A;  3IWI A;  3B42 A;  2V9A A;  3BFE A;  3SH7 A;  4ZJ2 A;  4OLG A;  3CMZ A;  4CLC B;  1L0F A;  2W1T B;  4LFU A;  3CIT A;  4MLL A;  2VGK A;  3EEA A;  1NY0 A;  2EFU A;  2V8F A;  2O0Y A;  4B88 A;  2W3D A;  2ZC7 A;  1BSG A;  4IJG A;  4N1X A;  3L7H A;  4RQ9 A;  4A5R A;  4X69 A;  3PAE A;  1XKZ A;  3O88 A;  3CHW P;  2DCF A;  3HJI A;  3MQO A;  2A24 A;  1BUE A;  4KZA A;  4IBX A;  2PU4 A;  2M7U A;  3F1O B;  3MXR A;  5HFO A;  4OH0 A;  3IWO A;  5F83 A;  4DJ2 A;  3LIE A;  3PHY A;  4RYE A;  2PAV P;  5GHZ A;  2XFT A;  1EWZ A;  2ZQ9 A;  3UNW A;  4EQI A;  1HZO A;  5LBR A;  3BW6 A;  4X56 A;  3FYZ A;  3OBF A;  4O7D A;  2O9C A;  3PXP A;  3UPP A;  3FWL A;  1OME A;  2Q0O A;  5U47 A;  3RTY A;  3D9Y A;  4Z1W A;  1YM1 A;  4EEU A;  3OPH A;  3TE8 A;  1SHV A;  5GLB A;  3H82 A;  1O07 A;  3MQ0 A;  5CGW A;  2DMW A;  4DN0 A;  1SKO B;  4BLM A;  4DDS A;  1T1A A;  2EXA A;  5FEF A;  5F6A A;  1E25 A;  5EPH A;  1ALQ A;  4X1M A;  1G6A A;  3G4P A;  4WBG A;  1ES2 A;  3UY6 A;  4D60 A;  1N9N A;  3SH8 A;  3GQZ A;  3VP4 A;  3LY4 A;  4DRT A;  4E6X A;  5KSH A;  3IX4 A;  1S66 L;  4OVD A;  3BYD A;  5GHX A;  4KZ7 A;  4X1L A;  2HJ9 C;  3ZG7 B;  4MN5 A;  3P01 A;  3HCY A;  4OLD A;  3KO6 A;  3P09 A;  2O9A A;  3JVU A;  4S2N C;  4UQI S;  3SS4 A;  1V9Y A;  4CLC A;  2W1T A;  4H6J A;  1TF1 A;  1P9W A;  2R78 A;  5HAQ A;  2W3H A;  1KE0 A;  1DJA A;  3CZD A;  4RX3 A;  1ZTU A;  2UV0 E;  4GHI B;  4CLC E;  5HWT A;  5AVF A;  4GN2 A;  3QHY A;  1WA9 A;  3QNC A;  4C75 A;  2GX5 A;  1CK3 A;  2KLI A;  3E4Q A;  3VP2 A;  3NHQ A;  3LO7 A;  1ZG6 A;  3HUM A;  3VP3 A;  3F1O A;  1ONG A;  5DVA A;  1WYC A;  5CEB A;  4EBL A;  3BWL A;  4XXR A;  4KQQ A;  3UME A;  3CUE C;  3WS5 A;  1KE3 A;  3NDE A;  3OPP A;  4IVI A;  1KDW A;  3D4F A;  3OCL A;  2GDN A;  2D01 A;  1ODV A;  4GOG A;  1BYW A;  5AJG A;  1N9B A;  2EWW A;  3UE3 A;  1SKF A;  4R1G A;  1K54 C;  3T1S A;  1NRF A;  1LLB A;  5F82 A;  3HLG A;  4P85 A;  3W2Z A;  2ZC3 B;  1T1B A;  1PNE A;  4LLO B;  3JPU A;  4S2M A;  2BAS A;  4OPZ A;  3MKE A;  4PM6 A;  3S7P A;  2V2F F;  2W1R A;  4GKU A;  4OOY A;  4EEP A;  3G32 A;  1L2S A;  3PBQ A;  3BFF A;  3M2J A;  1ESU A;  1MWT A;  3ITA A;  2Y8H A;  3E2K A;  2PDR A;  1IYO A;  1IYS A;  3HUO A;  3C2W A;  2ZMF A;  1S67 L;  3WS0 A;  4DXB A;  5HWV A;  4K08 A;  2ZC4 B;  2Y59 A;  4EES A;  4GS9 A;  5FQK A;  3BFD A;  3B47 A;  5E2E A;  1G6O A;  1ES5 A;  5BOH A;  1OT9 A;  1HVB A;  1H8M A;  4IBR A;  2BLS A;  2XLN A;  4HH3 A;  3NJA A;  1ZHH B;  4KZ6 A;  5J3W A;  2QKP A;  3VOL A;  1K55 C;  3LR4 A;  1MKM A;  4GHI A;  4LV1 A;  4N92 A;  4KG5 A;  4HOI A;  1XFN A;  1TS0 A;  1XA1 A;  3QP5 A;  4X53 A;  5HL1 A;  5DFX A;  4EV4 A;  2YKF A;  1E4D A;  5TBM B;  1BLC A;  2JKT I;  3MXQ A;  3T12 B;  1PI5 A;  1YQS A;  2QZ6 A;  5HPF A;  3NY4 A;  2QMI A;  4R6L A;  4HIA A;  2Y2P A;  1SCW A;  5GL9 A;  3G31 A;  1EI5 A;  1TDG A;  1SDE A;  4Y2F A;  4ZTK A;  3NI9 A;  3C4P A;  3A0V A;  5E43 A;  4UA9 A;  4QJG A;  3T4L A;  2OV5 A;  2W3G A;  5AQB A;  3CAX A;  1PZP A;  3DTK A;  1I5Q A;  4MEZ A;  2R9X A;  1DY6 A;  4PKY G;  3LR3 A;  4HES A;  4I38 A;  1LL5 A;  3IXD A;  2WZZ A;  3JYI A;  5IS1 A;  4B93 A;  3BRM A;  4PMA A;  4Z9Q A;  5FQM A;  4CPK A;  5CHU A;  3E0Y A;  1MXO A;  4LEN A;  1GCE A;  3VP1 A;  1D06 A;  3T4J A;  3W4O A;  1K6R A;  3F1N A;  3GEC A;  3R4K A;  2XSS A;  3WS1 A;  1YLY A;  1PWD A;  1H5X A;  1XGI A;  4Q0J A;  1H8Y A;  3G34 A;  3DTI A;  2Y55 A;  1OTE A;  3VE3 A;  2IWB A;  2OAQ 1;  3SH9 A;  4DMZ A;  4R4S A;  2VV8 A;  5C5K A;  4ETZ A;  3G2Y A;  4JF5 A;  5IHV A;  2Y2I A;  3MXS A;  2EX2 A;  1GA0 A;  1N4O A;  1P97 A;  1J3W A;  2ZMV A;  1D1J A;  3IHB A;  2WKI A;  4R3B A;  1MPL A;  4HBU A;  4N9L A;  3KSG A;  4S2N A;  4B9O A;  4E3L A;  2ZC6 B;  1BUL A;  3N8R A;  3BQA A;  4LGW A;  3LCE A;  3S7Q A;  2VKS A;  4FSF A;  5FSR A;  2HP5 A;  4FH2 A;  3W4P A;  1NYY A;  3SS5 A;  4JGR A;  1JVJ A;  2KX6 A;  1MKI A;  1Y28 A;  3ZG5 A;  3UE0 A;  5M1A A;  3S7N A;  4X6T A;  5CER A;  4KG2 A;  2HZ5 A;  4LRX C;  3IT9 A;  4KZ3 A;  2ZQA A;  4WN5 A;  4QPR A;  2X02 A;  3TW8 A;  1FCN A;  4MCW A;  4WUJ A;  3SS3 A;  4MBF A;  4QU3 A;  3H7W B;  1S4S A;  1T1C A;  4B4X A;  1XPB A;  3CUE A;  2EXB A;  3E4O A;  1U60 A;  3C38 A;  2XF3 A;  4WLA A;  3RFB A;  5FEG A;  1TVF A;  3PYP A;  5E2H A;  2O99 A;  4PM9 A;  5DKL A;  1K56 A;  1XX2 A;  1LSX A;  1A0K A;  5FI7 A;  1K54 A;  1M6K A;  1YSQ A;  3SW1 A;  2AVX A;  2OWJ A;  1IEL A;  4KQD A;  4KQO A;  1WE4 A;  2XD5 A;  4LCM A;  3M6H A;  3SOI A;  1GSV A;  3NC8 A;  1LL9 A;  1W7F A;  2C6W B;  3GTC A;  2ZQ8 A;  2Y2O A;  4NXG A;  2JC7 A;  4KZ5 A;  4HQA A;  4Y15 A;  2EFX A;  3EGD C;  4P87 A;  1S6R A;  2A2L A;  4JGP A;  5FQI A;  3GDI A;  3MKF A;  3PBS A;  1VET B;  4MN7 A;  2JKR M;  2QPN A;  1K57 C;  1XJ4 A;  2WGV A;  4M3K A;  3DW0 A;  3M2K A;  2X01 A;  1IKI A;  2XDM A;  3HJK A;  2HDU A;  2WKR A;  2XA7 S;  5GHY A;  4HJ4 A;  4KZB A;  2Y2K A;  5DF9 A;  4DF6 A;  4R3A A;  3HLE A;  3VMA A;  3KYZ A;  4WM9 A;  2ZQ7 A;  1K55 A;  2ZOH A;  4EXO A;  1UGU A;  4Y0O A;  1RCJ A;  1G5U A;  3T1Q B;  4H6J B;  4S2L A;  1AXB A;  3C5A A;  4WEJ A;  1IKG A;  1D7E A;  3S1Y A;  1FSW A;  1OTA A;  2G2W A;  2Y2N A;  2WKQ A;  3H7W A;  3LUQ A;  2XFS A;  1YMS A;  2XK1 A;  2K2N A;  1W79 A;  3KSF A;  5FDH A;  2PBD P;  4KEN B;  3HBR A;  3A3F A;  1IYP A;  1G28 A;  2ZOI A;  5CTN A;  3NCK A;  3V50 A;  2G2U A;  4UQI M;  1AWI A;  3FKV A;  3GR2 A;  4E3J A;  3I7J A;  3ZNT A;  2Y2M A;  3E98 A;  3ZNY A;  1KE4 A;  3VFH A;  4OP8 A;  4E3N A;  3W8K A;  4EBP A;  5HD5 A;  1BZA A;  3A3I A;  4M4X A;  4BEN A;  3LR0 A;  4NXE A;  1VM1 A;  3MF0 A;  5EE8 A;  2QYB A;  3UB9 A;  3ISG A;  4K91 A;  5CRF A;  3K3D A;  3F1P A;  4I3J A;  3BY8 A;  3IX8 A;  1YLZ A;  3PR6 A;  3CI6 A;  1OTI A;  1VET A;  1Y54 A;  2XR0 A;  4GDN A;  4JXV A;  4PAU A;  2JHE A;  2E8I A; 
#chains in the Genus database with same CATH homology
 2VZW A;  2LB9 A;  4NEE D;  5HL6 A;  4CLC D;  2Y8H A;  4HP9 A;  3H9W A;  3FG8 A;  3UMD A;  2PDR A;  4GJ4 A;  1T18 A;  3ZYT A;  3C2W A;  2ZMF A;  1S67 L;  2W3F A;  2MJ6 A;  3LFV A;  4BWI A;  3LI9 A;  5HWV A;  4K08 A;  2FH5 A;  2HJE A;  4HNB A;  4EES A;  4GS9 A;  4YOF A;  3B47 A;  4F3L B;  1G6O A;  4OOM A;  3EGX C;  3T4K A;  2VX8 A;  1OT9 A;  4GS9 B;  5DJT A;  2FZ0 A;  1H8M A;  3LI8 A;  4OOL A;  4ZRR A;  5HDC A;  3S7O A;  4WEL A;  4HH3 A;  1XJ2 A;  3RH8 B;  4Q0H A;  4I5S A;  3PBR A;  2VEA A;  3NJA A;  1ZHH B;  3ICY A;  3FPV A;  4R38 A;  5J3W A;  2QKP A;  4HJ6 A;  3UB7 A;  3VOL A;  4CLC C;  3LR4 A;  3D72 A;  1MKM A;  4GHI A;  4YWZ A;  4HOI A;  4EER A;  1IOU A;  3TRC A;  1TS0 A;  1XFN A;  1YKD A;  3O5Y A;  1X0O A;  2VGL S;  4YNR A;  2VLG A;  5TBM A;  3CWF A;  4HH2 A;  2P04 A;  3EQV A;  2G7U A;  5DFX A;  2YKF A;  5TBM B;  4E04 A;  2JKT I;  5G4Y A;  4O01 A;  3MXQ A;  3JVV A;  1LT0 A;  4R70 A;  3OCN A;  4G3K A;  5HPF A;  3ZQ5 A;  2VJW A;  4HJ3 A;  4EW7 A;  2XRO A;  4R6L A;  4HIA A;  4ME4 A;  2J3T C;  5DKK A;  1F5M A;  4G3V A;  4LPZ A;  2PHY A;  2W27 A;  3FC7 A;  3TJZ C;  2P7J A;  4Y2F A;  4I39 A;  3MMH A;  2EWV A;  3NOU C;  3EWK A;  3A0V A;  1STZ A;  4Y5F A;  5G4Z A;  1VB6 A;  1XJ3 A;  3T4L A;  2GZA A;  4Y3I A;  3IBR A;  1MC0 A;  1VHM A;  2W3G A;  4I3A A;  4EU0 A;  3CAX A;  5A8B A;  2PD7 A;  2A24 B;  1EW0 A;  4P6Z S;  4WL9 A;  4XT2 B;  4JGO A;  2VGL M;  4PKY G;  5DJU A;  2OWH A;  3LR3 A;  3T4O A;  4JGQ A;  4O0P A;  4I38 A;  3E4P A;  4I3I A;  3LIA A;  3LID A;  2GNX A;  1GSW A;  4BBU A;  5HD3 A;  5IS1 A;  4B93 A;  3MFX A;  3K3C A;  3NOT C;  1OTD A;  5I5L A;  2QHK A;  3E0Y A;  3LR5 A;  2OAP 1;  2VV6 A;  2VV7 A;  5IU1 A;  4MN6 A;  1DP9 A;  1D06 A;  4IUH A;  2LB5 A;  3T4J A;  2INW A;  3F1N A;  3GEC A;  3R4K A;  2XSS A;  1NWZ A;  2QWS A;  2JN7 A;  2PYR A;  3H82 B;  2ZBB A;  3V67 A;  2L4R A;  1TD5 A;  3PBN A;  4Q0J A;  3F1N B;  3MQQ A;  4BMW A;  4F3L A;  4PHT A;  5J7E A;  4IUK A;  1LSV A;  1OTE A;  3VE3 A;  3LIB A;  5DFY A;  4P6Z M;  2OAQ 1;  1OPX A;  2HV1 A;  4DMZ A;  4HP4 A;  2VV8 A;  5C5K A;  2PR5 A;  4ETZ A;  3C8C A;  4EQ1 A;  1MZU A;  3IS2 B;  4O8G A;  1NLZ A;  2PR6 A;  1P97 A;  4EET B;  2ZMV A;  2L1M A;  1W63 Q;  4GCZ A;  3KX0 X;  4ARZ B;  4BJP A;  4WEK A;  2GJ3 A;  2D02 A;  4Q0I A;  3OOV A;  1W63 M;  2I9V A;  1DRM A;  3KSG A;  3KYQ A;  4EUV A;  4B9O A;  4L9E A;  1LSW A;  2OOL A;  3OLO A;  4GW9 A;  4DJ3 A;  3BQA A;  3LIF A;  3S7Q A;  3T4T A;  2VKS A;  4FSF A;  5HDD A;  1YAX A;  1LL8 A;  3B42 A;  1N9L A;  2V9A A;  2QJ5 A;  4JGR A;  5HWW A;  1DP6 A;  4CLC B;  3UE6 A;  2KX6 A;  2W1T B;  3CIT A;  1Y28 A;  3EEA A;  2O0Y A;  4HY8 A;  5KIZ A;  2W3D A;  3S7N A;  2NUP C;  3T4S A;  2H28 A;  1GSX A;  2W0N A;  4IJG A;  1S4R A;  2EA9 A;  4RQ9 A;  2Y79 A;  1NRJ A;  2PT7 A;  4LRX C;  4WN5 A;  2J80 A;  4QPR A;  3HJI A;  4LRY C;  3MQO A;  3TW8 A;  2A24 A;  4MCW A;  4XT2 A;  4WUJ A;  3H7W B;  1S4S A;  1T1C A;  2M7U A;  2YKH A;  3CUE A;  3E4O A;  3F1O B;  1H3Q A;  4KUK A;  3C38 A;  2XRN A;  4FOF A;  4DJ2 A;  3LIE A;  4WLA A;  4L9G A;  3RFB A;  3PHY A;  2WKP A;  3A0S A;  2B02 A;  3PYP A;  2O99 A;  5DKL A;  3BQ8 A;  1JNU A;  3B33 A;  5LBR A;  1V9Z A;  3BW6 A;  4GLQ A;  1LSX A;  3K2N A;  5HDS A;  3NOP C;  3EEH A;  3OC2 A;  3OBF A;  1YSQ A;  2O9C A;  3PXP A;  5HSQ A;  3SW1 A;  2OWJ A;  4KQD A;  4KQO A;  2HF6 A;  1OTB A;  1F98 A;  4L0L A;  3PBT A;  3RTY A;  1GSV A;  2V0U A;  4Z1W A;  1IFQ A;  4BBT A;  4EEU A;  4KUO A;  4MMN A;  3TE8 A;  3H82 A;  4UEY A;  4NXG A;  3MQ0 A;  1UWN X;  3BY9 A;  4HQA A;  2DMW A;  4DN0 A;  1T1A A;  3EGD C;  1UWP X;  5F6A A;  2K31 A;  4IHQ A;  1TS8 A;  2A2L A;  4JGP A;  3GDI A;  1DP8 A;  3PBS A;  2V0W A;  3UB8 A;  4MN7 A;  3IS2 A;  2JKR M;  2M7V A;  4BBV A;  1N9N A;  1XFQ A;  5F68 A;  1XJ4 A;  4AFI A;  4ARZ A;  2Z6D A;  3HJK A;  4L9F A;  5KSH A;  5HZH A;  1S66 L;  3T50 A;  4CQH A;  5EFW A;  2WKR A;  2IA2 A;  2V1B A;  2XA7 S;  5MC7 A;  2HJ9 C;  5L8M A;  3FPW A;  3ULF A;  2P08 A;  2PYP A;  4HJ4 A;  4LRZ E;  5TJJ A;  4MN5 A;  5DF9 A;  3P01 A;  3A0R A;  3HCY A;  3C30 A;  4R3A A;  3KO6 A;  3VE4 A;  2O9A A;  3EQU A;  2PD8 A;  3KYZ A;  2J3T D;  3JVU A;  2V1A A;  2VA0 A;  1P9R A;  4UQI S;  1V9Y A;  4CLC A;  2W1T A;  2ZOH A;  3IBJ A;  4H6J A;  4EXO A;  1TF1 A;  1NLY A;  1P9W A;  1UGU A;  2R78 A;  1OJG A;  2CMN A;  4WF0 A;  2W3H A;  3MR0 A;  3R7W A;  2M1C A;  1OT6 A;  2B18 A;  4H6J B;  3UB6 A;  2NUT C;  3D3O A;  5IT5 A;  1ZTU A;  4WEJ A;  4GHI B;  3PBO A;  2KDK A;  3R7W B;  2QJ7 A;  5F5Y A;  5HWT A;  4NKP A;  4CLC E;  1N9O A;  5AVF A;  5K5B A;  3DBA A;  5CX7 A;  1D7E A;  1KOU A;  1WA9 A;  1OTA A;  3CLO A;  2GX5 A;  2Z6C A;  4ETX A;  4HI4 A;  2KLI A;  3E4Q A;  2WKQ A;  3KSI A;  3G6O A;  3NHQ A;  3H7W A;  3LUQ A;  2JKR I;  3LYX A;  3VV4 A;  3LIC A;  3F1O A;  2K2N A;  2XA7 M;  5FL3 A;  3KSF A;  4II7 A;  4MDZ A;  4G3W A;  3BWL A;  2O9B A;  2W3E A;  1T19 A;  3UME A;  3CUE C;  1G28 A;  2ZOI A;  5F69 A;  4UQI M;  2J3W A;  3OCL A;  2D01 A;  1ODV A;  1BYW A;  5AJG A;  2EWW A;  3UE3 A;  3E98 A;  1TS6 A;  2K7S A;  3W2Z A;  2HGV A;  4PKY A;  1F9I A;  1T1B A;  5HD5 A;  1S1Z A;  4LLO B;  4M4X A;  3KSH A;  2KOI A;  3LR0 A;  2L0W A;  4NXE A;  2BAS A;  3MF0 A;  4HHD A;  3UB9 A;  2QYB A;  3MJQ A;  1XJ6 A;  1P0Z A;  3T4Q A;  3K3D A;  3F1P A;  5AVE A;  4I3J A;  3BY8 A;  1YSP A;  4NXF A;  1S1Y A;  3S7P A;  3PR6 A;  2W1R A;  3CI6 A;  4EEP A;  4NXB A;  1OTI A;  3EOI A;  3F1P B;  5HPI A;  1OJ5 A;  3PBQ A;  3U2A A;  3BJN A;  3P7N A;  2JKT M;  4PAU A;  5J4E A;  2JHE A;  1TS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...