1XJ4A

Co-bound structure of bjfixlh
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords Sensor protein fixL
publication title Crystal Structures of Deoxy and CO-Bound bjFixLH Reveal Details of Ligand Recognition and Signaling
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1xj4A00
1XJ2A 2W27A 4I3JA 3HJKA 5J3WA 2V1AA 5HDCA 3LI8A 2ZBBA 1XFNA 2VV8A 3PYPA 2W0NA 5EFWA 2Z6DA 1N9OA 3P7NA 5I5LA 3C2WA 5HSQA 1XJ4A 3UB7A 4HJ6A 4WUJA 4XT2B 1LSWA 3VOLA 4NXGA 1OJGA 3IS2B 2WKPA 2VV7A 1OT6A 3MFXA 5HDDA 3ZQ5A 1GSXA 2L4RA 4LPZA 2ZOHA 3NJAA 2QWSA 1V9ZA 1Y28A 3LYXA 3IS2A 4M4XA 5F68A 3D72A 4HJ4A 1X0OA 4HP4A 2OOLA 2BASA 1OTAA 2VLGA 1KOUA 2WKRA 4LRZE 2PR6A 1UWNX 1LSXA 2JHEA 3BY8A 1P0ZA 2YKFA 4JGOA 2YKHA 1XJ6A 2KDKA 3LIDA 4GS9A 1T1BA 3VE4A 5HWVA 2VEAA 1S4SA 3G6OA 4HI4A 4KUOA 4RQ9A 2JN7A 5IS1A 4L9FA 4EW7A 3H9WA 5HZHA 4EXOA 2OWHA 4DJ3A 3K3DA 4BBVA 4GHIB 3IBRA 4F3LB 3CWFA 4HQAA 3MR0A 5F5YA 2WKQA 5DKLA 1OT9A 4BBUA 3LUQA 4EQ1A 1OTBA 2EA9A 4R38A 1WA9A 1S4RA 4NXFA 4H6JB 3T50A 3SW1A 5G4ZA 2L1MA 4I3AA 1ODVA 3LICA 3UMEA 4H6JA 1N9NA 2INWA 2PDRA 2QKPA 3B33A 1OTIA 5AVEA 1N9LA 2QJ5A 5HD5A 3RTYA 4GCZA 3VE3A 3LIEA 2KX6A 4JGRA 3HJIA 2ZOIA 2GJ3A 3UB6A 3UMDA 1XJ3A 2B02A 2M1CA 3MQOA 2J80A 3FG8A 4HIAA 4HHDA 1TS8A 3H7WA 3LIAA 1T1AA 1NWZA 2QJ7A 2H28A 4HH3A 4GS9B 2V9AA 3ULFA 4KQDA 5G4YA 1GSVA 2A24A 1JNUA 1BYWA 4I39A 3F1PB 3UB9A 1LL8A 3NOPC 2HV1A 4EEPA 2Z6CA 1G28A 3LIBA 4LRYC 4BBTA 3F1PA 4MN6A 2L0WA 4R3AA 5F6AA 3MQQA 4I3IA 2PYPA 5DKKA 1XFQA 1UWPX 5J4EA 5KIZA 3F1OA 1GSWA 5IU1A 4HOIA 2CMNA 3A0SA 4LLOB 3KX0X 4I38A 2PR5A 4R6LA 1TS0A 3ICYA 4WN5A 4DJ2A 5HD3A 3PHYA 5F69A 3NOTC 4B9OA 3CAXA 4EETB 3F1NB 4WLAA 3LIFA 4K08A 2QHKA 4LRXC 1OTDA 1TS6A 4HP9A 1F9IA 4E04A 3F1NA 4PKYA 4HJ3A 4HY8A 3MXQA 1S1ZA 2V0WA 3UE6A 4JGPA 5HWWA 3H82B 2D02A 4L9EA 4NXEA 4HH2A 2D01A 3EWKA 3H7WB 1F98A 2OWJA 3BWLA 4WF0A 2I9VA 3H82A 1MZUA 5DJTA 4I5SA 4WL9A 3E4PA 2K7SA 4L9GA 2V1BA 2A24B 1T19A 3EEHA 3C8CA 5A8BA 3E4OA 2VV6A 3GDIA 4XT2A 1EW0A 3K3CA 1S66L 5J7EA 1DP6A 1D06A 2R78A 3NOUC 1S67L 5HWTA 1P97A 5TBMB 4GW9A 4HNBA 3GECA 4PKYG 3NHQA 4EEUA 1T18A 5TBMA 4MN5A 1UGUA 3F1OB 3A0RA 3LI9A 1OJ5A 3UB8A 5HDSA 3MJQA 4JGQA 4KUKA 3CLOA 3OLOA 4NXBA 4EESA 2V0UA 3E4QA 2PD7A 1OTEA 3FC7A 1V9YA 1TS7A 1LSVA 2PYRA 1T1CA 4EERA 1DP8A 3BY9A 4R70A 1DP9A 1DRMA 3RH8B 2PHYA 5AVFA 1S1YA 2PD8A 1D7EA 4YWZA 5DJUA 4GHIA 4F3LA 3A0VA 1VB6A 2P7JA 1LT0A
chains in the Genus database with same CATH superfamily
3NIAA 5J3WA 2V1AA 4S2JA 1MBLA 3DTMA 1CI8A 3LR0A 3S1YA 3VMAA 2ZBBA 2VV8A 3T4KA 3OC2A 3CHWP 1ALQA 2ZM0A 1ONHA 1H8YA 2LB9A 1BLCA 4OP5A 2BG1A 3V5MA 1Q2QA 1N9OA 4R3JA 5FQKA 1PWCA 1LL5A 2HPBA 4WUJA 1LSWA 1G6AA 4DXCA 3IH9A 1OJGA 4DDSA 5EVEA 4OVDA 5E2GA 3ITAA 1STZA 4QY6A 4OLGA 4X1LA 3ZQ5A 3PAGA 1XPBA 1V9ZA 3LYXA 2ZD8A 4KZAA 1X0OA 2OOLA 4FH4A 2ZC5B 4FH2A 5IT5A 4LRZE 3D4FA 2ZM2A 3W4OA 3EGXC 1LSXA 2JHEA 3BEBA 3O88A 4JGOA 2JKFA 1I2WA 3NY4A 1XJ6A 1ONGA 3DAVA 4M3KA 2WGWA 2WKEA 3VV4A 3V50A 4R4SA 2W3EA 4KQOA 4GB7A 1YLYA 4UEYA 1NRFA 5EOOA 3IF6C 4RQ9A 2JN7A 5IS1A 4ZAMA 4L9FA 4JXVA 3A3EA 4LFUA 3A3JA 3EQUA 4JXWA 5G18A 3IXGA 4MBHA 5K5BA 3OPHA 5JYPA 5L09A 5DVAA 3HUMA 3IHAA 1IYPA 1JWPA 4RA7A 4UA6A 3TJZC 1XGJA 3CWFA 4U0XA 4HQAA 1LI9A 4WMCD 2P04A 2V8CA 4IBRA 5F5YA 5DKLA 3G34A 1I5QA 4C75A 4QPRA 4Q0IA 5EUAA 4EQ1A 4E3MA 2EA9A 2WK0A 5A91A 1U60A 3FWLA 2FFYA 4NXFA 4H6JB 3ZG8B 1G6OA 4UA7A 3SW1A 3VOZA 2Q9MA 5FEFA 2EX9A 1SZVA 2QZ6A 3PBRA 3N6IA 3E2LA 2P08A 1W79A 2INWA 1KDSA 3B33A 1MXOA 2MJ6A 5HD5A 2IWDA 4GCZA 1VHMA 3VE3A 2WKIA 1CJFA 2FZ0A 3MQ0A 2GJ3A 3UPNA 3PTEA 2Z2LB 3WS2A 1IYQA 1TEMA 2B02A 2W1TA 3KYZA 3FG8A 3MF0A 3VP3A 4HIAA 1S6RA 3E0YA 4KZ5A 5GHZA 4GZBA 1YPRA 3TG9A 1NZUA 1KDWA 4N1XA 4E3OA 2VX8A 2XFTA 2PU4A 3ULFA 1YLZA 3A3DA 1MWTA 2ZMVA 3JVUA 1GSVA 2J9OA 4FTXA 3ZVTA 2ZC6B 1RP5A 3ZFZA 1CEFA 1K25A 2H0YA 4EEPA 2C5WB 1LL9A 3R7WB 4RX3A 4UQIS 4LRYC 2WGVA 2IA2A 3HCYA 3UNWA 4MN6A 3ZG9B 4R0QA 4XUXA 1FOFA 4Z1WA 4LCLA 5DKKA 2OAP1 3K2NA 4PPRA 2ZMAA 4WZ5A 1XFQA 2WADA 1UWPX 3KYQA 2OLUA 1GSWA 3C7VA 1K56D 4HOIA 2EXBA 3I7JA 2CMNA 4HBUA 5DTKA 3A0SA 1PZOA 2J8YA 4LLOB 5KSHA 4S2NC 2J7VA 5BOHA 4R6LA 1TS0A 1TDLA 3PHYA 1I2SA 5F69A 2BLSA 3VP4A 1W63M 2H10A 1VETA 1IFQA 1KE4A 4DF6A 2XF3A 3NC8A 5FI7A 1YMXA 3LY3A 3SH9A 1KVMA 3EQVA 2Y55A 1W7FA 3MMHA 4K08A 4U0TA 5DF7A 1TS6A 5DTTA 4G3KA 3NDEA 4RX2A 4HJ3A 1GA0A 4Y3IA 1CEGA 1MWSA 2CC1A 2V0WA 4OPQA 4GJ4A 3N8LA 1CI9A 4BWIA 4L0LA 2D02A 4S2IA 4NXEA 3T4LA 1F98A 1VEUB 1Z09A 3BWLA 3QP6A 1EROA 2QMIA 3MSHA 1MZUA 3H82A 4WL9A 1LHYA 4L9GA 2A24B 1GHIA 5C5KA 1H3QA 5DF8A 1L2SA 1W8QA 4GOGA 3W8KA 3OCLA 2HDSA 3IXBA 1F2KA 1EW0A 5M18A 3K3CA 4ZDXA 3PR6A 1RCJA 1Y4OA 3BECA 3KSGA 1DP6A 1KE3A 3UE0A 1VM1A 4MDZA 4OPRA 1S67L 4S2LA 1YLTA 4FSFA 5AQ7A 3N7WA 2NUPC 2A49A 2HP6A 3W2ZA 4PKYG 2GNXA 3QP8A 5TBMA 2HGVA 4MN5A 3U4LP 3LI9A 1C3BA 3WRZA 3BFDA 4KZ9A 3GSGA 4LENA 3MJQA 2ZQDA 3TRCA 2V0UA 2V20A 5HAIA 3VP1A 4P87A 5TJJA 1H8ZA 1K4EA 3LEZA 4JPMA 1LSVA 1FIKA 1MY8A 1NRJA 4R70A 3DBAA 2PHYA 5AQ9A 1F5MA 3IH8A 1TDGA 5CXWA 5FDSA 1TF1A 3N4IA 4WM9A 4E6WA 1SKFA 3A0VA 1PNEA 4S2MA 1Z6FA 2ZC4B 4KZ4A 1XJ2A 1XA7A 2W27A 4B4ZA 1YQSA 2P74A 3S22A 5CHUA 3T12B 1XXMA 3LI8A 5FQQA 4ZJ3A 2C6WB 3TE8A 3WWXA 2G2UA 3PYPA 5EECA 4GD8A 2Y2LA 3MFDA 1QMFA 2Z6DA 3C2WA 4LV3A 3S7OA 5HSQA 1XJ4A 2E8JA 2M7UA 5FA7A 2Z2MB 3PBTA 3HBRA 4XT2B 1VQQA 3IS2B 4C6YA 4NG2A 3M2JA 3NCKA 4LPZA 3OPPA 2UWXA 4X69A 4M4XA 3D72A 5HFOA 2XROA 4HJ4A 4DN0A 4CJNA 4HP4A 1S0WA 3BFGA 3OOVA 2VLGA 2WKRA 4GLQA 5EV0A 2ZL1B 5CGXA 3BY8A 3PAEA 2YKFA 1P9WA 3T4SA 3WS4A 2HDUA 2YKHA 1WYCA 3V3SA 2ZM8A 3CMZA 2GX5A 1T1BA 4D60A 3HLCA 1IKIA 1J9MA 5HWVA 1JWZA 1PWDA 5JYOA 4IJGA 4E3JA 3R4KA 4KUOA 3CUEC 1LI0A 3QP4A 4O8GA 2HJ9C 4BLMA 4EW7A 3UDXA 4EXOA 3AGEA 2OWHA 3LO7A 4B4XA 5TR7A 1ESIA 4S2OA 3DWKA 3M6BA 1K6RA 1JTDA 1PWGA 3E2KA 3MR0A 4B93A 4WBGA 5CGWA 2WKQA 3SZTA 4O0PA 3V39A 5LBRA 5EOEA 1ES2A 3E98A 1KGGA 1ZTUA 3CPTA 1YAXA 4F94A 3QP2A 1WA9A 1YLWA 5FASA 1FCOA 4QB8A 3DTIA 4R1GA 3HLBA 1SDNA 2Y8HA 3BM6A 4KQQA 4EUZA 2L1MA 1FR1A 4KQRA 4I3AA 3IXHA 1ODVA 1XKZA 5F82A 3UMEA 5HAQA 1IYOA 1H8MA 4DRTA 3C5AA 2QKPA 5CERA 1OTIA 5AVEA 2HF6A 1ERMA 4IBXA 4MBFA 2QJ5A 3W4QA 3L7HA 3O3VA 1PI5A 2W3FA 3RTYA 4ETZA 1LLBA 3LIEA 3EEAA 3TW8A 4ZRRA 3UB6A 3IF6B 3ZNYA 4DE0A 3MQOA 2J80A 4WEJA 1TS8A 3D9YA 3IX4A 1VEUA 1T1AA 1NLZA 1GA9A 4GS9B 1K54A 4R23A 4KQDA 1BUEA 5G4YA 3Q7VB 2PU2A 3IBJA 2PRFA 2A24A 4ARZB 1JNUA 2ZLYA 3L9KA 3F1PB 1YKDA 3UB9A 4QY5A 2Z6CA 2V8FA 2DNSA 4QHCA 1G28A 2P9VA 4LV1A 4OP8A 1K55C 3LFVA 3NBLA 1CQAA 3S7QA 5F6AA 3MQQA 4I3IA 1HLUP 1BZAA 4X1MA 4KZBA 1E4DA 4CLCD 3KSFA 3OBFA 2Y4AA 1K4FA 1K6SA 4JXGA 1YM1A 5J4EA 5KIZA 1DJBA 5GLAA 4MCWA 2EWVA 4GKUA 4CLCB 4WN5A 3G30A 5HD3A 2GDNA 3A3IA 4E3NA 1N9BA 4B9OA 2EX8A 3CAXA 2W3HA 4WLAA 3GMWA 5DFXA 5EVID 3G35A 3UDFA 4HP9A 1F9IA 3VOYA 2AVXA 3QNBA 2VK3A 3F1NA 2WGIA 1PRQA 3MXQA 1S1ZA 2OAQ1 3BFFA 5F83A 1MKMA 3WRTA 1HZOA 2WZXA 1FCMA 1BULA 5CGSA 3LCEA 4CLCC 1JVJA 3KO6A 3VSLA 2ZQ7A 4HH2A 2D01A 2Q0OA 2OWJA 4FOFA 1E3UA 3HLGA 3OPLA 4R4RA 1Y54A 2K7SA 2Q9NA 4UQIM 4P6ZS 2ZQCA 1EI5A 3EEHA 1BLHA 5GLCA 1SHVA 2JKGA 3FPWA 2ZJ9A 5L8MA 2VV6A 2Y79A 4Z9QA 5FDHA 4XT2A 4E3IA 2JKRI 3WS1A 3MZDA 2EFXA 2PAVP 5EVIC 3UPPA 4OOLA 2EWWA 4EU0A 2R78A 4WZ4A 3MZFA 2J9PA 1P97A 4PM6A 2Y2PA 5FQ9A 1DJAA 5F1GA 3Q1FA 4Y0OA 3T1SA 4IUHA 5KMWA 3DW0A 3A3FA 3GVBA 4EEUA 2QYBA 3F1OB 1O07A 2XLNA 2Y2KA 2EFUA 1CK3A 1K57A 3IXDA 4EV4A 4ZJ1A 4NXBA 4EESA 5D3OA 2PD7A 1SKOB 2XH9A 4KG2A 1OTEA 1V9YA 5HPFA 5FI6A 4ETXA 3ZG7B 2PYRA 3ITBA 2X02A 3VFHA 2Y2IA 1DRMA 3RH8B 2J3WA 4D2OA 3C7UA 4OQGA 1Q2PA 1QMEA 1J3WA 3IX8A 5DJUA 3ZVWA 4ESPA 3IF5A 3IWIA 5A90A 2EX2A 1VB6A 2ZC7A 3GR2A 5HPIA 3IX3A 4OPYA 3Q82A 3LR5A 4MN7A 4E3LA 1L3LA 1MWUA 4ZJ2A 3ZHHA 4YFMA 5DTSA 3IQAA 4CQHA 1W5DA 5EFWA 2Y2OA 3MBZA 4GD6A 2G7UA 4K0XA 4OOMA 4WELA 5E2HA 2OV5A 3MXRA 2B5RA 4RYEA 4MEZA 5GLDA 4X6TA 3VOLA 4NXGA 1IEMA 5AQBA 2RCXA 2J3TD 1H5XA 5HDDA 1EWZA 2HZ5A 3KSHA 2Y2QA 1GSXA 4BJPA 2XD1A 3BLSA 4GNUA 4FUWA 1W8YA 1Y28A 4DMZA 5F68A 5TGFA 3IF6A 5GLBA 2BASA 3QP5A 3JYIA 3UY6A 4HEFA 1KOUA 1K38A 2VGLS 2PR6A 4FCFA 4Q0JA 1UWNX 2E8IA 2EXAA 3Q81A 1JTGA 3V3RA 3MKEA 3HL9A 2KDKA 2H5SA 4GS9A 4UHUA 2Y2GA 3VE4A 3MZEA 4EBPA 1S4SA 3G6OA 3EGDC 1HTZA 1ZC2A 4HI4A 3G2ZA 1NXYA 4JF6A 1H0MA 5HZHA 2KLIA 4DJ3A 4Y13A 2RL3A 5CRFA 3K3DA 4NEED 4DE2A 5KSCA 4KZ7A 1IKGA 3ZCZA 3BRMA 4BBVA 3MS6A 3IBRA 3PXPA 4NKPA 2IWCA 3S7PA 3ZG5A 1TD5A 4KZ8A 4N1HA 2W1RA 1OT9A 5CEDA 3UE3A 4Y15A 5DFYA 5M1AA 2JBFA 3LUQA 4A5RA 5U47A 3C4OA 3KYEA 3W4PA 4E6XA 3Q7ZA 1N4OA 2XRNA 4R3BA 1OPXA 3PBNA 3UO9A 3JPUA 3T50A 1XA1A 3CZDA 4UA9A 2VGJA 5G4ZA 2BTFP 3V67A 3G32A 1NLYA 4WMCA 5FQIA 1BSGA 5IHVA 3LICA 4H6JA 1N9NA 3GQZA 1JWVA 3BQAA 3O5YA 2XGNA 3OPRA 1N9LA 5DF9A 4Q8IA 3RFBA 3UN7A 1MKIA 2W1TB 1WE4A 2XSSA 3UPOA 4JGRA 3M2KA 1AXBA 1AWIA 1XP4A 2QPNA 1XJ3A 4IHQA 1KGEA 1NZOA 2JKTI 4G3WA 4DXBA 3SS4A 4IVKA 4HHDA 3O87A 2JC7A 5AQAA 5EPHA 2HDQA 3LIAA 2QJ7A 2V2FF 3IWOA 2V9AA 1ERQA 2O9CA 1RGYA 3TSGA 3ZNTA 3RXWA 3FV7A 5CHMA 4EBNA 1P9RA 5AJGA 1BT5A 1LL8A 2HV1A 2OLVA 1ZG6A 4C3QA 3SH7A 3LIBA 4Q0HA 5CTNA 2LB5A 4R3AA 3SH8A 3FKVA 3VFFA 3G4PA 3R7WA 4QU3A 4S2NA 1W63Q 3C38A 2PYPA 4CPKA 2R9WA 2DCFA 3F1OA 2VKSA 5FATA 3HLFA 2WZZA 5CX7A 1VETB 4OPZA 2XEPA 4H8RA 2XDMA 3KX0X 4I38A 4DJ2A 2Y2HA 2Y91A 5FQMA 4MBKA 4OQHA 1FR6A 2V1ZA 3SS3A 1L0EA 4WZ5C 4Y0UA 2VJWA 1BTLA 5EE8A 3LIFA 4JKTA 4IVIA 5L07A 4BL2A 1OTDA 3GRJA 1NJ4A 1K56A 3MXSA 4E04A 3P98A 4KZ6A 4PKYA 2R9XA 4OH0A 2XA7S 4JBFA 4Y17A 1PI4A 4KG6A 1GHMA 2W3GA 2K2NA 1FSWA 3HLWA 5L10A 5HWWA 3VP0A 4ZBEA 3H82B 3G2YA 5CHJA 4KZ3A 1ESUA 2XK1A 3EWKA 3H7WB 1KVLA 4OLDA 4WF0A 2I9VA 1MPLA 4O7DA 4CLCE 5DJTA 5FEGA 1E25A 1FILA 2V1BA 5FAQA 4EWFA 4NK3A 3B47A 2HDRA 5A8BA 5FQJA 3GDIA 1A0KA 4DE1A 3BFEA 4BL3A 3LR4A 5J7EA 1ES4A 5FAOA 3O86A 4ID4A 1D06A 3NOUC 4BQMA 2G2WA 5HWTA 5TBMB 2NUTC 4QJGA 1GCEA 4HNBA 2XR0A 4YOFA 3GV9A 3BYDA 2ZQ9A 5FAPA 5TFQA 2X01A 1T18A 1UGUA 1ZG4A 3A0RA 4IUKA 1PW8A 1YT4A 3CJMA 1MC0A 3NDGA 4RVAA 4XUZA 3QHYA 4KUKA 3PBQA 4JLFA 1YLPA 4X55A 3P09A 3E4QA 2FH5A 3FC7A 3FYZA 1PFLA 2XQZA 3HLEA 3PBOA 4N9KA 3N8SA 4QD4A 4P6BA 5AVFA 5CTMA 2PD8A 1D7EA 4OQIA 4NETA 4DKIA 4X53A 1XGIA 5GHXA 2P7JA 3G31A 1HD8A 3WS5A 1LT0A 1YSQA 4I3JA 4DDYA 3HJKA 5E43A 3SOIA 3VP2A 4P6ZM 5HDCA 2PBYA 2O99A 3HVFA 5EVIB 1XFNA 5HARA 3ZYTA 3B42A 2W0NA 2WKHA 5A92A 1MWRA 5HX9A 3IWQA 3P7NA 5I5LA 2VZWA 3NI9A 3ISGA 2K31A 3UB7A 1ES5A 4HJ6A 4Y0TA 4GN2A 3AGDA 4UAAA 2WKPA 2VV7A 1OT6A 5L2FA 4LGWA 3MFXA 5FI2A 3NULA 5FSRA 3MKFA 2L4RA 4Y7PA 2ZOHA 3NJAA 2QWSA 3T1RA 4PAUA 1GHPA 2EX6A 3IS2A 3LR3A 4BMWA 3DWZA 1OTAA 2H0TA 2A3UA 2VGKA 3CUEA 2HJEA 4OONA 4X25A 1L0DA 4KG5A 3ZG0A 3OCNA 5M19A 1P0ZA 2PBDP 3LIDA 3HLDA 2ZL1A 3U2AA 2Y2NA 4ME4A 2GZAA 3C30A 2VEAA 3OZHA 4HESA 2JKTM 4PM5A 3UB5P 4II7A 2M7VA 2WAEA 3S4XA 3H9WA 4N9LA 4Y5FA 3IT9A 4N92A 2FFFB 3LGOA 4KENB 1TVFA 5A93A 1PZPA 1D1JA 4GHIB 4F3LB 3JVVA 3FZCA 3CPTB 1NYYA 3M6HA 4MLLA 4S2KA 2ZC3B 4PM9A 3WS0A 4BBUA 5E2EA 1M6KA 4PM8A 1OTBA 2UV0E 4R38A 1OMEA 1S4RA 3C4PA 3QP1A 5FL3A 5CEBA 4K91A 2Y2JA 2HP9A 4B88A 3LY4A 1CF0A 3AGFA 3D3OA 4BD1A 2ACGA 4EUVA 3KSIA 4JXSA 2PDRA 2JCHA 2KOIA 2Y59A 4BD0A 1ES3A 1FQGA 4JF5A 4DE3A 2VGLM 2KX6A 5GL9A 3HJIA 5E2FA 2ZOIA 1BLPA 2A2LA 4WEKA 3UMDA 4P0MA 4X68A 1PYYA 3P01A 5EM0A 2Y2MA 1PW1A 2M1CA 4K0WA 5HL1A 3RXXA 1FSYA 3H7WA 1NWZA 3B3XA 3BFCA 2ZMFA 1K55A 4FD8A 2H28A 2WGWB 4HH3A 3VSKA 4LCMA 3BLMA 2O0YA 5F1FA 2X71A 1BYWA 2P9VB 4I39A 4ZTKA 3BJNA 1ZKJA 3NOPC 3Q7VA 4E3KA 1HVBA 1YLJA 4ARZA 3T4OA 5HL6A 2ZQ8A 4OOYA 4BBTA 3F1PA 1K54C 1YMSA 4HBTA 2L0WA 4PM7A 2DMWA 4Y2FA 3S7NA 3SS5A 4U3TA 4EQIA 2O9AA 2J3TC 2VA0A 1KE0A 1NYMA 3CITA 5CECA 4YNRA 4OQ0A 4P85A 4O01A 5IU1A 2DRWA 5HAPA 2XFSA 1WYBA 3CI6A 2WUQA 1L0FA 2PR5A 4BENA 3ICYA 4OKPA 3NOTC 2B95A 2W3DA 4MNRA 4JF4A 1NY0A 4PMAA 4EETB 3F1NB 4CLCA 1E3UD 1PIOA 4GDBA 3LEQA 3BW6A 4S2PA 4MMNA 4LV0A 2QHKA 3BQ8A 3TOIA 1BLSA 4LRXC 2WAFA 4XXRA 1YSPA 1G68A 4HY8A 3T4QA 1ZHHB 2WYXA 3UDIA 5GHYA 1M40A 3UE6A 4JGPA 1SCWA 3T4TA 4GDNA 1G5UA 4L9EA 1XX2A 3PBSA 4EBLA 5EVIA 3T1QB 4IEDA 4LV2A 4G3VA 4I5SA 3E4PA 2PT7A 5EVLA 3HREA 2I72A 1ACFA 1T19A 3C8CA 3E4OA 1KGFA 2IWBA 3T1XA 3EOIA 3QNCA 3Q07A 5EM1A 4AFIA 1S66L 4QWOA 2O9BA 4X56A 3RJUA 3UE1A 1IOUA 4GW9A 5I94A 2OSUA 3HUOA 3ZGAB 1DY6A 3DTKA 1FCNA 1IYSA 3GECA 3NHQA 5HW3A 1SDEA 4WYYA 1OJ5A 3UB8A 5HDSA 5KZHA 1O7EA 4JGQA 3CG5A 2JKRM 3CLOA 2JE5A 3OLOA 4PHTA 3N8RA 3FKWA 2ZQAA 1TS7A 1L0GA 1T1CA 2HP5A 4EERA 1DP8A 3T4JA 3BY9A 2XA7M 5MC7A 4YINA 1DP9A 3DTEA 2B18A 1SKOA 1DJCA 1K0KA 1K57C 1S1YA 3HUNA 3ZDJA 4YWZA 3IHBA 3GTCA 1RGZA 3FPVA 4GHIA 4F3LA 2XD5A 1IELA 5J8XA 3NECA
chains in the Genus database with same CATH topology
1XJ2A 2W27A 3LR5A 4I3JA 3HJKA 4MN7A 5J3WA 2V1AA 4P6ZM 5HDCA 3LR0A 2O99A 3LI8A 2ZBBA 1XFNA 2VV8A 3T4KA 3OC2A 3TE8A 4CQHA 3PYPA 3ZYTA 3B42A 2W0NA 2LB9A 5EFWA 2G7UA 4OOMA 4WELA 2Z6DA 1N9OA 3P7NA 5I5LA 3C2WA 2VZWA 3S7OA 5HSQA 1XJ4A 2M7UA 2K31A 3UB7A 3PBTA 4HJ6A 4WUJA 4XT2B 1LSWA 3VOLA 4NXGA 1OJGA 3IS2B 1STZA 2WKPA 2VV7A 1OT6A 2J3TD 3MFXA 5HDDA 3ZQ5A 3KSHA 1GSXA 2L4RA 4BJPA 4LPZA 2ZOHA 3NJAA 2QWSA 1V9ZA 4PAUA 1Y28A 3LYXA 3IS2A 3LR3A 4M4XA 4DMZA 5F68A 3D72A 2XROA 4HJ4A 1X0OA 4DN0A 4HP4A 4BMWA 2OOLA 2BASA 3OOVA 1OTAA 3CUEA 2VLGA 1KOUA 5IT5A 2HJEA 2WKRA 4GLQA 4LRZE 2VGLS 2PR6A 4Q0JA 3EGXC 1UWNX 3OCNA 1LSXA 2JHEA 3BY8A 1P0ZA 2YKFA 1P9WA 4JGOA 3T4SA 2YKHA 1XJ6A 2KDKA 3LIDA 4GS9A 3VV4A 2GX5A 1T1BA 3U2AA 4ME4A 2GZAA 3VE4A 5HWVA 3C30A 2W3EA 2VEAA 4KQOA 4UEYA 4IJGA 2JKTM 1S4SA 3G6OA 4II7A 3EGDC 3R4KA 2M7VA 4HI4A 4KUOA 3CUEC 4RQ9A 4O8GA 2JN7A 5IS1A 4L9FA 2HJ9C 4EW7A 3H9WA 3EQUA 4Y5FA 5HZHA 4EXOA 2KLIA 2OWHA 4DJ3A 3K3DA 4NEED 5K5BA 4BBVA 4GHIB 3IBRA 3PXPA 4NKPA 4F3LB 3JVVA 3TJZC 3CWFA 4HQAA 3S7PA 1TD5A 3MR0A 4B93A 2P04A 5F5YA 2WKQA 5DKLA 2W1RA 1OT9A 4O0PA 4BBUA 5LBRA 3UE3A 5DFYA 4QPRA 4Q0IA 3E98A 1ZTUA 3LUQA 4EQ1A 1OTBA 1YAXA 2EA9A 4R38A 1WA9A 2XRNA 1OPXA 3PBNA 1S4RA 5FL3A 4NXFA 4H6JB 3T50A 3D3OA 1G6OA 2Y8HA 3SW1A 5G4ZA 2L1MA 3V67A 1NLYA 4I3AA 4EUVA 3KSIA 3PBRA 1ODVA 3LICA 3UMEA 4H6JA 2P08A 1H8MA 1N9NA 2INWA 2PDRA 2KOIA 2QKPA 3B33A 1OTIA 5AVEA 2HF6A 2MJ6A 3BQAA 3O5YA 1N9LA 5DF9A 2QJ5A 5HD5A 3RFBA 2W3FA 3RTYA 4ETZA 2W1TB 1VHMA 2VGLM 2XSSA 4GCZA 3VE3A 3LIEA 2KX6A 2FZ0A 3MQ0A 3EEAA 4JGRA 3HJIA 2ZOIA 2GJ3A 3TW8A 4ZRRA 2A2LA 3UB6A 4WEKA 3UMDA 1XJ3A 4IHQA 3P01A 2JKTI 2B02A 2W1TA 3KYZA 4G3WA 2M1CA 3MQOA 2J80A 3FG8A 3MF0A 4HIAA 4WEJA 4HHDA 3E0YA 1TS8A 3H7WA 3LIAA 1T1AA 1NWZA 1NLZA 2QJ7A 2ZMFA 2H28A 4HH3A 4GS9B 2VX8A 2V9AA 3ULFA 2O0YA 4KQDA 2O9CA 5G4YA 3IBJA 2ZMVA 3JVUA 1GSVA 2A24A 4ARZB 1JNUA 1BYWA 1P9RA 4I39A 5AJGA 3F1PB 3BJNA 1YKDA 3UB9A 1LL8A 3NOPC 2HV1A 4EEPA 2Z6CA 3R7WB 4ARZA 1G28A 3LIBA 4Q0HA 4UQIS 3T4OA 4LRYC 5HL6A 2IA2A 3LFVA 2LB5A 3HCYA 4BBTA 3F1PA 4MN6A 2L0WA 4R3AA 3S7QA 2DMWA 4Y2FA 5F6AA 3S7NA 3R7WA 3MQQA 4I3IA 1W63Q 3C38A 2PYPA 4Z1WA 2O9AA 5DKKA 2OAP1 2J3TC 2VA0A 3K2NA 4CLCD 3CITA 3KSFA 3OBFA 1XFQA 4YNRA 1UWPX 5J4EA 3KYQA 3F1OA 5KIZA 2VKSA 1GSWA 5CX7A 4O01A 5IU1A 4HOIA 2CMNA 3A0SA 3CI6A 4LLOB 4MCWA 5KSHA 2EWVA 3KX0X 2PR5A 4I38A 4R6LA 1TS0A 3ICYA 4WN5A 4CLCB 4DJ2A 5HD3A 3PHYA 5F69A 3NOTC 1W63M 2W3DA 1IFQA 4B9OA 3CAXA 4EETB 3F1NB 2W3HA 2VJWA 4CLCA 4WLAA 3LIFA 3EQVA 3BW6A 5DFXA 3MMHA 4MMNA 4K08A 2QHKA 3BQ8A 4LRXC 1OTDA 1TS6A 4HP9A 1F9IA 4G3KA 4E04A 3F1NA 4PKYA 1YSPA 4HJ3A 4HY8A 2XA7S 3MXQA 1S1ZA 2OAQ1 3T4QA 1ZHHB 2W3GA 4Y3IA 2K2NA 1MKMA 2V0WA 3UE6A 4GJ4A 4JGPA 5HWWA 3H82B 4L0LA 2D02A 4BWIA 3T4TA 4CLCC 3KO6A 4L9EA 4NXEA 4HH2A 3T4LA 2D01A 3EWKA 3PBSA 3H7WB 1F98A 2OWJA 4FOFA 3BWLA 4WF0A 2I9VA 4CLCE 3H82A 1MZUA 5DJTA 4G3VA 4I5SA 4WL9A 3E4PA 2PT7A 2K7SA 4L9GA 2V1BA 2A24B 4UQIM 4P6ZS 3B47A 1T19A 5C5KA 3EEHA 1H3QA 3C8CA 3FPWA 3E4OA 3OCLA 5A8BA 5L8MA 2VV6A 3GDIA 2Y79A 3EOIA 4XT2A 1EW0A 2JKRI 3K3CA 3PR6A 4AFIA 3LR4A 1S66L 3KSGA 5J7EA 2O9BA 4OOLA 2EWWA 1DP6A 1D06A 4EU0A 2R78A 3NOUC 4MDZA 1S67L 5HWTA 1IOUA 1P97A 5TBMB 4GW9A 4FSFA 2NUTC 4HNBA 2NUPC 4IUHA 4YOFA 3W2ZA 3GECA 4PKYG 2GNXA 3NHQA 4EEUA 1T18A 2QYBA 2HGVA 4MN5A 5TBMA 1UGUA 3F1OB 3A0RA 3LI9A 1OJ5A 4IUKA 3UB8A 1MC0A 5HDSA 3MJQA 3PBQA 4JGQA 4KUKA 2JKRM 3CLOA 3OLOA 4NXBA 3TRCA 4EESA 2V0UA 4PHTA 5TJJA 3E4QA 2PD7A 1OTEA 2FH5A 3FC7A 1V9YA 5HPFA 4ETXA 1TS7A 1LSVA 2PYRA 1T1CA 4EERA 1DP8A 3T4JA 3BY9A 1NRJA 2XA7M 4R70A 5MC7A 1DP9A 3DBAA 3PBOA 1DRMA 2B18A 3RH8B 2PHYA 2J3WA 1F5MA 5AVFA 1S1YA 2PD8A 1D7EA 4YWZA 5DJUA 3FPVA 4GHIA 1TF1A 4F3LA 3A0VA 1VB6A 2P7JA 5HPIA 1LT0A 1YSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ2 A;  2W27 A;  4I3J A;  3HJK A;  5J3W A;  2V1A A;  5HDC A;  3LI8 A;  2ZBB A;  1XFN A;  2VV8 A;  3PYP A;  2W0N A;  5EFW A;  2Z6D A;  1N9O A;  3P7N A;  5I5L A;  3C2W A;  5HSQ A;  1XJ4 A;  3UB7 A;  4HJ6 A;  4WUJ A;  4XT2 B;  1LSW A;  3VOL A;  4NXG A;  1OJG A;  3IS2 B;  2WKP A;  2VV7 A;  1OT6 A;  3MFX A;  5HDD A;  3ZQ5 A;  1GSX A;  2L4R A;  4LPZ A;  2ZOH A;  3NJA A;  2QWS A;  1V9Z A;  1Y28 A;  3LYX A;  3IS2 A;  4M4X A;  5F68 A;  3D72 A;  4HJ4 A;  1X0O A;  4HP4 A;  2OOL A;  2BAS A;  1OTA A;  2VLG A;  1KOU A;  2WKR A;  4LRZ E;  2PR6 A;  1UWN X;  1LSX A;  2JHE A;  3BY8 A;  1P0Z A;  2YKF A;  4JGO A;  2YKH A;  1XJ6 A;  2KDK A;  3LID A;  4GS9 A;  1T1B A;  3VE4 A;  5HWV A;  2VEA A;  1S4S A;  3G6O A;  4HI4 A;  4KUO A;  4RQ9 A;  2JN7 A;  5IS1 A;  4L9F A;  4EW7 A;  3H9W A;  5HZH A;  4EXO A;  2OWH A;  4DJ3 A;  3K3D A;  4BBV A;  4GHI B;  3IBR A;  4F3L B;  3CWF A;  4HQA A;  3MR0 A;  5F5Y A;  2WKQ A;  5DKL A;  1OT9 A;  4BBU A;  3LUQ A;  4EQ1 A;  1OTB A;  2EA9 A;  4R38 A;  1WA9 A;  1S4R A;  4NXF A;  4H6J B;  3T50 A;  3SW1 A;  5G4Z A;  2L1M A;  4I3A A;  1ODV A;  3LIC A;  3UME A;  4H6J A;  1N9N A;  2INW A;  2PDR A;  2QKP A;  3B33 A;  1OTI A;  5AVE A;  1N9L A;  2QJ5 A;  5HD5 A;  3RTY A;  4GCZ A;  3VE3 A;  3LIE A;  2KX6 A;  4JGR A;  3HJI A;  2ZOI A;  2GJ3 A;  3UB6 A;  3UMD A;  1XJ3 A;  2B02 A;  2M1C A;  3MQO A;  2J80 A;  3FG8 A;  4HIA A;  4HHD A;  1TS8 A;  3H7W A;  3LIA A;  1T1A A;  1NWZ A;  2QJ7 A;  2H28 A;  4HH3 A;  4GS9 B;  2V9A A;  3ULF A;  4KQD A;  5G4Y A;  1GSV A;  2A24 A;  1JNU A;  1BYW A;  4I39 A;  3F1P B;  3UB9 A;  1LL8 A;  3NOP C;  2HV1 A;  4EEP A;  2Z6C A;  1G28 A;  3LIB A;  4LRY C;  4BBT A;  3F1P A;  4MN6 A;  2L0W A;  4R3A A;  5F6A A;  3MQQ A;  4I3I A;  2PYP A;  5DKK A;  1XFQ A;  1UWP X;  5J4E A;  5KIZ A;  3F1O A;  1GSW A;  5IU1 A;  4HOI A;  2CMN A;  3A0S A;  4LLO B;  3KX0 X;  4I38 A;  2PR5 A;  4R6L A;  1TS0 A;  3ICY A;  4WN5 A;  4DJ2 A;  5HD3 A;  3PHY A;  5F69 A;  3NOT C;  4B9O A;  3CAX A;  4EET B;  3F1N B;  4WLA A;  3LIF A;  4K08 A;  2QHK A;  4LRX C;  1OTD A;  1TS6 A;  4HP9 A;  1F9I A;  4E04 A;  3F1N A;  4PKY A;  4HJ3 A;  4HY8 A;  3MXQ A;  1S1Z A;  2V0W A;  3UE6 A;  4JGP A;  5HWW A;  3H82 B;  2D02 A;  4L9E A;  4NXE A;  4HH2 A;  2D01 A;  3EWK A;  3H7W B;  1F98 A;  2OWJ A;  3BWL A;  4WF0 A;  2I9V A;  3H82 A;  1MZU A;  5DJT A;  4I5S A;  4WL9 A;  3E4P A;  2K7S A;  4L9G A;  2V1B A;  2A24 B;  1T19 A;  3EEH A;  3C8C A;  5A8B A;  3E4O A;  2VV6 A;  3GDI A;  4XT2 A;  1EW0 A;  3K3C A;  1S66 L;  5J7E A;  1DP6 A;  1D06 A;  2R78 A;  3NOU C;  1S67 L;  5HWT A;  1P97 A;  5TBM B;  4GW9 A;  4HNB A;  3GEC A;  4PKY G;  3NHQ A;  4EEU A;  1T18 A;  5TBM A;  4MN5 A;  1UGU A;  3F1O B;  3A0R A;  3LI9 A;  1OJ5 A;  3UB8 A;  5HDS A;  3MJQ A;  4JGQ A;  4KUK A;  3CLO A;  3OLO A;  4NXB A;  4EES A;  2V0U A;  3E4Q A;  2PD7 A;  1OTE A;  3FC7 A;  1V9Y A;  1TS7 A;  1LSV A;  2PYR A;  1T1C A;  4EER A;  1DP8 A;  3BY9 A;  4R70 A;  1DP9 A;  1DRM A;  3RH8 B;  2PHY A;  5AVF A;  1S1Y A;  2PD8 A;  1D7E A;  4YWZ A;  5DJU A;  4GHI A;  4F3L A;  3A0V A;  1VB6 A;  2P7J A;  1LT0 A; 
#chains in the Genus database with same CATH topology
 3NIA A;  5J3W A;  2V1A A;  4S2J A;  1MBL A;  3DTM A;  1CI8 A;  3LR0 A;  3S1Y A;  3VMA A;  2ZBB A;  2VV8 A;  3T4K A;  3OC2 A;  3CHW P;  1ALQ A;  2ZM0 A;  1ONH A;  1H8Y A;  2LB9 A;  1BLC A;  4OP5 A;  2BG1 A;  3V5M A;  1Q2Q A;  1N9O A;  4R3J A;  5FQK A;  1PWC A;  1LL5 A;  2HPB A;  4WUJ A;  1LSW A;  1G6A A;  4DXC A;  3IH9 A;  1OJG A;  4DDS A;  5EVE A;  4OVD A;  5E2G A;  3ITA A;  1STZ A;  4QY6 A;  4OLG A;  4X1L A;  3ZQ5 A;  3PAG A;  1XPB A;  1V9Z A;  3LYX A;  2ZD8 A;  4KZA A;  1X0O A;  2OOL A;  4FH4 A;  2ZC5 B;  4FH2 A;  5IT5 A;  4LRZ E;  3D4F A;  2ZM2 A;  3W4O A;  3EGX C;  1LSX A;  2JHE A;  3BEB A;  3O88 A;  4JGO A;  2JKF A;  1I2W A;  3NY4 A;  1XJ6 A;  1ONG A;  3DAV A;  4M3K A;  2WGW A;  2WKE A;  3VV4 A;  3V50 A;  4R4S A;  2W3E A;  4KQO A;  4GB7 A;  1YLY A;  4UEY A;  1NRF A;  5EOO A;  3IF6 C;  4RQ9 A;  2JN7 A;  5IS1 A;  4ZAM A;  4L9F A;  4JXV A;  3A3E A;  4LFU A;  3A3J A;  3EQU A;  4JXW A;  5G18 A;  3IXG A;  4MBH A;  5K5B A;  3OPH A;  5JYP A;  5L09 A;  5DVA A;  3HUM A;  3IHA A;  1IYP A;  1JWP A;  4RA7 A;  4UA6 A;  3TJZ C;  1XGJ A;  3CWF A;  4U0X A;  4HQA A;  1LI9 A;  4WMC D;  2P04 A;  2V8C A;  4IBR A;  5F5Y A;  5DKL A;  3G34 A;  1I5Q A;  4C75 A;  4QPR A;  4Q0I A;  5EUA A;  4EQ1 A;  4E3M A;  2EA9 A;  2WK0 A;  5A91 A;  1U60 A;  3FWL A;  2FFY A;  4NXF A;  4H6J B;  3ZG8 B;  1G6O A;  4UA7 A;  3SW1 A;  3VOZ A;  2Q9M A;  5FEF A;  2EX9 A;  1SZV A;  2QZ6 A;  3PBR A;  3N6I A;  3E2L A;  2P08 A;  1W79 A;  2INW A;  1KDS A;  3B33 A;  1MXO A;  2MJ6 A;  5HD5 A;  2IWD A;  4GCZ A;  1VHM A;  3VE3 A;  2WKI A;  1CJF A;  2FZ0 A;  3MQ0 A;  2GJ3 A;  3UPN A;  3PTE A;  2Z2L B;  3WS2 A;  1IYQ A;  1TEM A;  2B02 A;  2W1T A;  3KYZ A;  3FG8 A;  3MF0 A;  3VP3 A;  4HIA A;  1S6R A;  3E0Y A;  4KZ5 A;  5GHZ A;  4GZB A;  1YPR A;  3TG9 A;  1NZU A;  1KDW A;  4N1X A;  4E3O A;  2VX8 A;  2XFT A;  2PU4 A;  3ULF A;  1YLZ A;  3A3D A;  1MWT A;  2ZMV A;  3JVU A;  1GSV A;  2J9O A;  4FTX A;  3ZVT A;  2ZC6 B;  1RP5 A;  3ZFZ A;  1CEF A;  1K25 A;  2H0Y A;  4EEP A;  2C5W B;  1LL9 A;  3R7W B;  4RX3 A;  4UQI S;  4LRY C;  2WGV A;  2IA2 A;  3HCY A;  3UNW A;  4MN6 A;  3ZG9 B;  4R0Q A;  4XUX A;  1FOF A;  4Z1W A;  4LCL A;  5DKK A;  2OAP 1;  3K2N A;  4PPR A;  2ZMA A;  4WZ5 A;  1XFQ A;  2WAD A;  1UWP X;  3KYQ A;  2OLU A;  1GSW A;  3C7V A;  1K56 D;  4HOI A;  2EXB A;  3I7J A;  2CMN A;  4HBU A;  5DTK A;  3A0S A;  1PZO A;  2J8Y A;  4LLO B;  5KSH A;  4S2N C;  2J7V A;  5BOH A;  4R6L A;  1TS0 A;  1TDL A;  3PHY A;  1I2S A;  5F69 A;  2BLS A;  3VP4 A;  1W63 M;  2H10 A;  1VET A;  1IFQ A;  1KE4 A;  4DF6 A;  2XF3 A;  3NC8 A;  5FI7 A;  1YMX A;  3LY3 A;  3SH9 A;  1KVM A;  3EQV A;  2Y55 A;  1W7F A;  3MMH A;  4K08 A;  4U0T A;  5DF7 A;  1TS6 A;  5DTT A;  4G3K A;  3NDE A;  4RX2 A;  4HJ3 A;  1GA0 A;  4Y3I A;  1CEG A;  1MWS A;  2CC1 A;  2V0W A;  4OPQ A;  4GJ4 A;  3N8L A;  1CI9 A;  4BWI A;  4L0L A;  2D02 A;  4S2I A;  4NXE A;  3T4L A;  1F98 A;  1VEU B;  1Z09 A;  3BWL A;  3QP6 A;  1ERO A;  2QMI A;  3MSH A;  1MZU A;  3H82 A;  4WL9 A;  1LHY A;  4L9G A;  2A24 B;  1GHI A;  5C5K A;  1H3Q A;  5DF8 A;  1L2S A;  1W8Q A;  4GOG A;  3W8K A;  3OCL A;  2HDS A;  3IXB A;  1F2K A;  1EW0 A;  5M18 A;  3K3C A;  4ZDX A;  3PR6 A;  1RCJ A;  1Y4O A;  3BEC A;  3KSG A;  1DP6 A;  1KE3 A;  3UE0 A;  1VM1 A;  4MDZ A;  4OPR A;  1S67 L;  4S2L A;  1YLT A;  4FSF A;  5AQ7 A;  3N7W A;  2NUP C;  2A49 A;  2HP6 A;  3W2Z A;  4PKY G;  2GNX A;  3QP8 A;  5TBM A;  2HGV A;  4MN5 A;  3U4L P;  3LI9 A;  1C3B A;  3WRZ A;  3BFD A;  4KZ9 A;  3GSG A;  4LEN A;  3MJQ A;  2ZQD A;  3TRC A;  2V0U A;  2V20 A;  5HAI A;  3VP1 A;  4P87 A;  5TJJ A;  1H8Z A;  1K4E A;  3LEZ A;  4JPM A;  1LSV A;  1FIK A;  1MY8 A;  1NRJ A;  4R70 A;  3DBA A;  2PHY A;  5AQ9 A;  1F5M A;  3IH8 A;  1TDG A;  5CXW A;  5FDS A;  1TF1 A;  3N4I A;  4WM9 A;  4E6W A;  1SKF A;  3A0V A;  1PNE A;  4S2M A;  1Z6F A;  2ZC4 B;  4KZ4 A;  1XJ2 A;  1XA7 A;  2W27 A;  4B4Z A;  1YQS A;  2P74 A;  3S22 A;  5CHU A;  3T12 B;  1XXM A;  3LI8 A;  5FQQ A;  4ZJ3 A;  2C6W B;  3TE8 A;  3WWX A;  2G2U A;  3PYP A;  5EEC A;  4GD8 A;  2Y2L A;  3MFD A;  1QMF A;  2Z6D A;  3C2W A;  4LV3 A;  3S7O A;  5HSQ A;  1XJ4 A;  2E8J A;  2M7U A;  5FA7 A;  2Z2M B;  3PBT A;  3HBR A;  4XT2 B;  1VQQ A;  3IS2 B;  4C6Y A;  4NG2 A;  3M2J A;  3NCK A;  4LPZ A;  3OPP A;  2UWX A;  4X69 A;  4M4X A;  3D72 A;  5HFO A;  2XRO A;  4HJ4 A;  4DN0 A;  4CJN A;  4HP4 A;  1S0W A;  3BFG A;  3OOV A;  2VLG A;  2WKR A;  4GLQ A;  5EV0 A;  2ZL1 B;  5CGX A;  3BY8 A;  3PAE A;  2YKF A;  1P9W A;  3T4S A;  3WS4 A;  2HDU A;  2YKH A;  1WYC A;  3V3S A;  2ZM8 A;  3CMZ A;  2GX5 A;  1T1B A;  4D60 A;  3HLC A;  1IKI A;  1J9M A;  5HWV A;  1JWZ A;  1PWD A;  5JYO A;  4IJG A;  4E3J A;  3R4K A;  4KUO A;  3CUE C;  1LI0 A;  3QP4 A;  4O8G A;  2HJ9 C;  4BLM A;  4EW7 A;  3UDX A;  4EXO A;  3AGE A;  2OWH A;  3LO7 A;  4B4X A;  5TR7 A;  1ESI A;  4S2O A;  3DWK A;  3M6B A;  1K6R A;  1JTD A;  1PWG A;  3E2K A;  3MR0 A;  4B93 A;  4WBG A;  5CGW A;  2WKQ A;  3SZT A;  4O0P A;  3V39 A;  5LBR A;  5EOE A;  1ES2 A;  3E98 A;  1KGG A;  1ZTU A;  3CPT A;  1YAX A;  4F94 A;  3QP2 A;  1WA9 A;  1YLW A;  5FAS A;  1FCO A;  4QB8 A;  3DTI A;  4R1G A;  3HLB A;  1SDN A;  2Y8H A;  3BM6 A;  4KQQ A;  4EUZ A;  2L1M A;  1FR1 A;  4KQR A;  4I3A A;  3IXH A;  1ODV A;  1XKZ A;  5F82 A;  3UME A;  5HAQ A;  1IYO A;  1H8M A;  4DRT A;  3C5A A;  2QKP A;  5CER A;  1OTI A;  5AVE A;  2HF6 A;  1ERM A;  4IBX A;  4MBF A;  2QJ5 A;  3W4Q A;  3L7H A;  3O3V A;  1PI5 A;  2W3F A;  3RTY A;  4ETZ A;  1LLB A;  3LIE A;  3EEA A;  3TW8 A;  4ZRR A;  3UB6 A;  3IF6 B;  3ZNY A;  4DE0 A;  3MQO A;  2J80 A;  4WEJ A;  1TS8 A;  3D9Y A;  3IX4 A;  1VEU A;  1T1A A;  1NLZ A;  1GA9 A;  4GS9 B;  1K54 A;  4R23 A;  4KQD A;  1BUE A;  5G4Y A;  3Q7V B;  2PU2 A;  3IBJ A;  2PRF A;  2A24 A;  4ARZ B;  1JNU A;  2ZLY A;  3L9K A;  3F1P B;  1YKD A;  3UB9 A;  4QY5 A;  2Z6C A;  2V8F A;  2DNS A;  4QHC A;  1G28 A;  2P9V A;  4LV1 A;  4OP8 A;  1K55 C;  3LFV A;  3NBL A;  1CQA A;  3S7Q A;  5F6A A;  3MQQ A;  4I3I A;  1HLU P;  1BZA A;  4X1M A;  4KZB A;  1E4D A;  4CLC D;  3KSF A;  3OBF A;  2Y4A A;  1K4F A;  1K6S A;  4JXG A;  1YM1 A;  5J4E A;  5KIZ A;  1DJB A;  5GLA A;  4MCW A;  2EWV A;  4GKU A;  4CLC B;  4WN5 A;  3G30 A;  5HD3 A;  2GDN A;  3A3I A;  4E3N A;  1N9B A;  4B9O A;  2EX8 A;  3CAX A;  2W3H A;  4WLA A;  3GMW A;  5DFX A;  5EVI D;  3G35 A;  3UDF A;  4HP9 A;  1F9I A;  3VOY A;  2AVX A;  3QNB A;  2VK3 A;  3F1N A;  2WGI A;  1PRQ A;  3MXQ A;  1S1Z A;  2OAQ 1;  3BFF A;  5F83 A;  1MKM A;  3WRT A;  1HZO A;  2WZX A;  1FCM A;  1BUL A;  5CGS A;  3LCE A;  4CLC C;  1JVJ A;  3KO6 A;  3VSL A;  2ZQ7 A;  4HH2 A;  2D01 A;  2Q0O A;  2OWJ A;  4FOF A;  1E3U A;  3HLG A;  3OPL A;  4R4R A;  1Y54 A;  2K7S A;  2Q9N A;  4UQI M;  4P6Z S;  2ZQC A;  1EI5 A;  3EEH A;  1BLH A;  5GLC A;  1SHV A;  2JKG A;  3FPW A;  2ZJ9 A;  5L8M A;  2VV6 A;  2Y79 A;  4Z9Q A;  5FDH A;  4XT2 A;  4E3I A;  2JKR I;  3WS1 A;  3MZD A;  2EFX A;  2PAV P;  5EVI C;  3UPP A;  4OOL A;  2EWW A;  4EU0 A;  2R78 A;  4WZ4 A;  3MZF A;  2J9P A;  1P97 A;  4PM6 A;  2Y2P A;  5FQ9 A;  1DJA A;  5F1G A;  3Q1F A;  4Y0O A;  3T1S A;  4IUH A;  5KMW A;  3DW0 A;  3A3F A;  3GVB A;  4EEU A;  2QYB A;  3F1O B;  1O07 A;  2XLN A;  2Y2K A;  2EFU A;  1CK3 A;  1K57 A;  3IXD A;  4EV4 A;  4ZJ1 A;  4NXB A;  4EES A;  5D3O A;  2PD7 A;  1SKO B;  2XH9 A;  4KG2 A;  1OTE A;  1V9Y A;  5HPF A;  5FI6 A;  4ETX A;  3ZG7 B;  2PYR A;  3ITB A;  2X02 A;  3VFH A;  2Y2I A;  1DRM A;  3RH8 B;  2J3W A;  4D2O A;  3C7U A;  4OQG A;  1Q2P A;  1QME A;  1J3W A;  3IX8 A;  5DJU A;  3ZVW A;  4ESP A;  3IF5 A;  3IWI A;  5A90 A;  2EX2 A;  1VB6 A;  2ZC7 A;  3GR2 A;  5HPI A;  3IX3 A;  4OPY A;  3Q82 A;  3LR5 A;  4MN7 A;  4E3L A;  1L3L A;  1MWU A;  4ZJ2 A;  3ZHH A;  4YFM A;  5DTS A;  3IQA A;  4CQH A;  1W5D A;  5EFW A;  2Y2O A;  3MBZ A;  4GD6 A;  2G7U A;  4K0X A;  4OOM A;  4WEL A;  5E2H A;  2OV5 A;  3MXR A;  2B5R A;  4RYE A;  4MEZ A;  5GLD A;  4X6T A;  3VOL A;  4NXG A;  1IEM A;  5AQB A;  2RCX A;  2J3T D;  1H5X A;  5HDD A;  1EWZ A;  2HZ5 A;  3KSH A;  2Y2Q A;  1GSX A;  4BJP A;  2XD1 A;  3BLS A;  4GNU A;  4FUW A;  1W8Y A;  1Y28 A;  4DMZ A;  5F68 A;  5TGF A;  3IF6 A;  5GLB A;  2BAS A;  3QP5 A;  3JYI A;  3UY6 A;  4HEF A;  1KOU A;  1K38 A;  2VGL S;  2PR6 A;  4FCF A;  4Q0J A;  1UWN X;  2E8I A;  2EXA A;  3Q81 A;  1JTG A;  3V3R A;  3MKE A;  3HL9 A;  2KDK A;  2H5S A;  4GS9 A;  4UHU A;  2Y2G A;  3VE4 A;  3MZE A;  4EBP A;  1S4S A;  3G6O A;  3EGD C;  1HTZ A;  1ZC2 A;  4HI4 A;  3G2Z A;  1NXY A;  4JF6 A;  1H0M A;  5HZH A;  2KLI A;  4DJ3 A;  4Y13 A;  2RL3 A;  5CRF A;  3K3D A;  4NEE D;  4DE2 A;  5KSC A;  4KZ7 A;  1IKG A;  3ZCZ A;  3BRM A;  4BBV A;  3MS6 A;  3IBR A;  3PXP A;  4NKP A;  2IWC A;  3S7P A;  3ZG5 A;  1TD5 A;  4KZ8 A;  4N1H A;  2W1R A;  1OT9 A;  5CED A;  3UE3 A;  4Y15 A;  5DFY A;  5M1A A;  2JBF A;  3LUQ A;  4A5R A;  5U47 A;  3C4O A;  3KYE A;  3W4P A;  4E6X A;  3Q7Z A;  1N4O A;  2XRN A;  4R3B A;  1OPX A;  3PBN A;  3UO9 A;  3JPU A;  3T50 A;  1XA1 A;  3CZD A;  4UA9 A;  2VGJ A;  5G4Z A;  2BTF P;  3V67 A;  3G32 A;  1NLY A;  4WMC A;  5FQI A;  1BSG A;  5IHV A;  3LIC A;  4H6J A;  1N9N A;  3GQZ A;  1JWV A;  3BQA A;  3O5Y A;  2XGN A;  3OPR A;  1N9L A;  5DF9 A;  4Q8I A;  3RFB A;  3UN7 A;  1MKI A;  2W1T B;  1WE4 A;  2XSS A;  3UPO A;  4JGR A;  3M2K A;  1AXB A;  1AWI A;  1XP4 A;  2QPN A;  1XJ3 A;  4IHQ A;  1KGE A;  1NZO A;  2JKT I;  4G3W A;  4DXB A;  3SS4 A;  4IVK A;  4HHD A;  3O87 A;  2JC7 A;  5AQA A;  5EPH A;  2HDQ A;  3LIA A;  2QJ7 A;  2V2F F;  3IWO A;  2V9A A;  1ERQ A;  2O9C A;  1RGY A;  3TSG A;  3ZNT A;  3RXW A;  3FV7 A;  5CHM A;  4EBN A;  1P9R A;  5AJG A;  1BT5 A;  1LL8 A;  2HV1 A;  2OLV A;  1ZG6 A;  4C3Q A;  3SH7 A;  3LIB A;  4Q0H A;  5CTN A;  2LB5 A;  4R3A A;  3SH8 A;  3FKV A;  3VFF A;  3G4P A;  3R7W A;  4QU3 A;  4S2N A;  1W63 Q;  3C38 A;  2PYP A;  4CPK A;  2R9W A;  2DCF A;  3F1O A;  2VKS A;  5FAT A;  3HLF A;  2WZZ A;  5CX7 A;  1VET B;  4OPZ A;  2XEP A;  4H8R A;  2XDM A;  3KX0 X;  4I38 A;  4DJ2 A;  2Y2H A;  2Y91 A;  5FQM A;  4MBK A;  4OQH A;  1FR6 A;  2V1Z A;  3SS3 A;  1L0E A;  4WZ5 C;  4Y0U A;  2VJW A;  1BTL A;  5EE8 A;  3LIF A;  4JKT A;  4IVI A;  5L07 A;  4BL2 A;  1OTD A;  3GRJ A;  1NJ4 A;  1K56 A;  3MXS A;  4E04 A;  3P98 A;  4KZ6 A;  4PKY A;  2R9X A;  4OH0 A;  2XA7 S;  4JBF A;  4Y17 A;  1PI4 A;  4KG6 A;  1GHM A;  2W3G A;  2K2N A;  1FSW A;  3HLW A;  5L10 A;  5HWW A;  3VP0 A;  4ZBE A;  3H82 B;  3G2Y A;  5CHJ A;  4KZ3 A;  1ESU A;  2XK1 A;  3EWK A;  3H7W B;  1KVL A;  4OLD A;  4WF0 A;  2I9V A;  1MPL A;  4O7D A;  4CLC E;  5DJT A;  5FEG A;  1E25 A;  1FIL A;  2V1B A;  5FAQ A;  4EWF A;  4NK3 A;  3B47 A;  2HDR A;  5A8B A;  5FQJ A;  3GDI A;  1A0K A;  4DE1 A;  3BFE A;  4BL3 A;  3LR4 A;  5J7E A;  1ES4 A;  5FAO A;  3O86 A;  4ID4 A;  1D06 A;  3NOU C;  4BQM A;  2G2W A;  5HWT A;  5TBM B;  2NUT C;  4QJG A;  1GCE A;  4HNB A;  2XR0 A;  4YOF A;  3GV9 A;  3BYD A;  2ZQ9 A;  5FAP A;  5TFQ A;  2X01 A;  1T18 A;  1UGU A;  1ZG4 A;  3A0R A;  4IUK A;  1PW8 A;  1YT4 A;  3CJM A;  1MC0 A;  3NDG A;  4RVA A;  4XUZ A;  3QHY A;  4KUK A;  3PBQ A;  4JLF A;  1YLP A;  4X55 A;  3P09 A;  3E4Q A;  2FH5 A;  3FC7 A;  3FYZ A;  1PFL A;  2XQZ A;  3HLE A;  3PBO A;  4N9K A;  3N8S A;  4QD4 A;  4P6B A;  5AVF A;  5CTM A;  2PD8 A;  1D7E A;  4OQI A;  4NET A;  4DKI A;  4X53 A;  1XGI A;  5GHX A;  2P7J A;  3G31 A;  1HD8 A;  3WS5 A;  1LT0 A;  1YSQ A;  4I3J A;  4DDY A;  3HJK A;  5E43 A;  3SOI A;  3VP2 A;  4P6Z M;  5HDC A;  2PBY A;  2O99 A;  3HVF A;  5EVI B;  1XFN A;  5HAR A;  3ZYT A;  3B42 A;  2W0N A;  2WKH A;  5A92 A;  1MWR A;  5HX9 A;  3IWQ A;  3P7N A;  5I5L A;  2VZW A;  3NI9 A;  3ISG A;  2K31 A;  3UB7 A;  1ES5 A;  4HJ6 A;  4Y0T A;  4GN2 A;  3AGD A;  4UAA A;  2WKP A;  2VV7 A;  1OT6 A;  5L2F A;  4LGW A;  3MFX A;  5FI2 A;  3NUL A;  5FSR A;  3MKF A;  2L4R A;  4Y7P A;  2ZOH A;  3NJA A;  2QWS A;  3T1R A;  4PAU A;  1GHP A;  2EX6 A;  3IS2 A;  3LR3 A;  4BMW A;  3DWZ A;  1OTA A;  2H0T A;  2A3U A;  2VGK A;  3CUE A;  2HJE A;  4OON A;  4X25 A;  1L0D A;  4KG5 A;  3ZG0 A;  3OCN A;  5M19 A;  1P0Z A;  2PBD P;  3LID A;  3HLD A;  2ZL1 A;  3U2A A;  2Y2N A;  4ME4 A;  2GZA A;  3C30 A;  2VEA A;  3OZH A;  4HES A;  2JKT M;  4PM5 A;  3UB5 P;  4II7 A;  2M7V A;  2WAE A;  3S4X A;  3H9W A;  4N9L A;  4Y5F A;  3IT9 A;  4N92 A;  2FFF B;  3LGO A;  4KEN B;  1TVF A;  5A93 A;  1PZP A;  1D1J A;  4GHI B;  4F3L B;  3JVV A;  3FZC A;  3CPT B;  1NYY A;  3M6H A;  4MLL A;  4S2K A;  2ZC3 B;  4PM9 A;  3WS0 A;  4BBU A;  5E2E A;  1M6K A;  4PM8 A;  1OTB A;  2UV0 E;  4R38 A;  1OME A;  1S4R A;  3C4P A;  3QP1 A;  5FL3 A;  5CEB A;  4K91 A;  2Y2J A;  2HP9 A;  4B88 A;  3LY4 A;  1CF0 A;  3AGF A;  3D3O A;  4BD1 A;  2ACG A;  4EUV A;  3KSI A;  4JXS A;  2PDR A;  2JCH A;  2KOI A;  2Y59 A;  4BD0 A;  1ES3 A;  1FQG A;  4JF5 A;  4DE3 A;  2VGL M;  2KX6 A;  5GL9 A;  3HJI A;  5E2F A;  2ZOI A;  1BLP A;  2A2L A;  4WEK A;  3UMD A;  4P0M A;  4X68 A;  1PYY A;  3P01 A;  5EM0 A;  2Y2M A;  1PW1 A;  2M1C A;  4K0W A;  5HL1 A;  3RXX A;  1FSY A;  3H7W A;  1NWZ A;  3B3X A;  3BFC A;  2ZMF A;  1K55 A;  4FD8 A;  2H28 A;  2WGW B;  4HH3 A;  3VSK A;  4LCM A;  3BLM A;  2O0Y A;  5F1F A;  2X71 A;  1BYW A;  2P9V B;  4I39 A;  4ZTK A;  3BJN A;  1ZKJ A;  3NOP C;  3Q7V A;  4E3K A;  1HVB A;  1YLJ A;  4ARZ A;  3T4O A;  5HL6 A;  2ZQ8 A;  4OOY A;  4BBT A;  3F1P A;  1K54 C;  1YMS A;  4HBT A;  2L0W A;  4PM7 A;  2DMW A;  4Y2F A;  3S7N A;  3SS5 A;  4U3T A;  4EQI A;  2O9A A;  2J3T C;  2VA0 A;  1KE0 A;  1NYM A;  3CIT A;  5CEC A;  4YNR A;  4OQ0 A;  4P85 A;  4O01 A;  5IU1 A;  2DRW A;  5HAP A;  2XFS A;  1WYB A;  3CI6 A;  2WUQ A;  1L0F A;  2PR5 A;  4BEN A;  3ICY A;  4OKP A;  3NOT C;  2B95 A;  2W3D A;  4MNR A;  4JF4 A;  1NY0 A;  4PMA A;  4EET B;  3F1N B;  4CLC A;  1E3U D;  1PIO A;  4GDB A;  3LEQ A;  3BW6 A;  4S2P A;  4MMN A;  4LV0 A;  2QHK A;  3BQ8 A;  3TOI A;  1BLS A;  4LRX C;  2WAF A;  4XXR A;  1YSP A;  1G68 A;  4HY8 A;  3T4Q A;  1ZHH B;  2WYX A;  3UDI A;  5GHY A;  1M40 A;  3UE6 A;  4JGP A;  1SCW A;  3T4T A;  4GDN A;  1G5U A;  4L9E A;  1XX2 A;  3PBS A;  4EBL A;  5EVI A;  3T1Q B;  4IED A;  4LV2 A;  4G3V A;  4I5S A;  3E4P A;  2PT7 A;  5EVL A;  3HRE A;  2I72 A;  1ACF A;  1T19 A;  3C8C A;  3E4O A;  1KGF A;  2IWB A;  3T1X A;  3EOI A;  3QNC A;  3Q07 A;  5EM1 A;  4AFI A;  1S66 L;  4QWO A;  2O9B A;  4X56 A;  3RJU A;  3UE1 A;  1IOU A;  4GW9 A;  5I94 A;  2OSU A;  3HUO A;  3ZGA B;  1DY6 A;  3DTK A;  1FCN A;  1IYS A;  3GEC A;  3NHQ A;  5HW3 A;  1SDE A;  4WYY A;  1OJ5 A;  3UB8 A;  5HDS A;  5KZH A;  1O7E A;  4JGQ A;  3CG5 A;  2JKR M;  3CLO A;  2JE5 A;  3OLO A;  4PHT A;  3N8R A;  3FKW A;  2ZQA A;  1TS7 A;  1L0G A;  1T1C A;  2HP5 A;  4EER A;  1DP8 A;  3T4J A;  3BY9 A;  2XA7 M;  5MC7 A;  4YIN A;  1DP9 A;  3DTE A;  2B18 A;  1SKO A;  1DJC A;  1K0K A;  1K57 C;  1S1Y A;  3HUN A;  3ZDJ A;  4YWZ A;  3IHB A;  3GTC A;  1RGZ A;  3FPV A;  4GHI A;  4F3L A;  2XD5 A;  1IEL A;  5J8X A;  3NEC A; 
#chains in the Genus database with same CATH homology
 1XJ2 A;  2W27 A;  3LR5 A;  4I3J A;  3HJK A;  4MN7 A;  5J3W A;  2V1A A;  4P6Z M;  5HDC A;  3LR0 A;  2O99 A;  3LI8 A;  2ZBB A;  1XFN A;  2VV8 A;  3T4K A;  3OC2 A;  3TE8 A;  4CQH A;  3PYP A;  3ZYT A;  3B42 A;  2W0N A;  2LB9 A;  5EFW A;  2G7U A;  4OOM A;  4WEL A;  2Z6D A;  1N9O A;  3P7N A;  5I5L A;  3C2W A;  2VZW A;  3S7O A;  5HSQ A;  1XJ4 A;  2M7U A;  2K31 A;  3UB7 A;  3PBT A;  4HJ6 A;  4WUJ A;  4XT2 B;  1LSW A;  3VOL A;  4NXG A;  1OJG A;  3IS2 B;  1STZ A;  2WKP A;  2VV7 A;  1OT6 A;  2J3T D;  3MFX A;  5HDD A;  3ZQ5 A;  3KSH A;  1GSX A;  2L4R A;  4BJP A;  4LPZ A;  2ZOH A;  3NJA A;  2QWS A;  1V9Z A;  4PAU A;  1Y28 A;  3LYX A;  3IS2 A;  3LR3 A;  4M4X A;  4DMZ A;  5F68 A;  3D72 A;  2XRO A;  4HJ4 A;  1X0O A;  4DN0 A;  4HP4 A;  4BMW A;  2OOL A;  2BAS A;  3OOV A;  1OTA A;  3CUE A;  2VLG A;  1KOU A;  5IT5 A;  2HJE A;  2WKR A;  4GLQ A;  4LRZ E;  2VGL S;  2PR6 A;  4Q0J A;  3EGX C;  1UWN X;  3OCN A;  1LSX A;  2JHE A;  3BY8 A;  1P0Z A;  2YKF A;  1P9W A;  4JGO A;  3T4S A;  2YKH A;  1XJ6 A;  2KDK A;  3LID A;  4GS9 A;  3VV4 A;  2GX5 A;  1T1B A;  3U2A A;  4ME4 A;  2GZA A;  3VE4 A;  5HWV A;  3C30 A;  2W3E A;  2VEA A;  4KQO A;  4UEY A;  4IJG A;  2JKT M;  1S4S A;  3G6O A;  4II7 A;  3EGD C;  3R4K A;  2M7V A;  4HI4 A;  4KUO A;  3CUE C;  4RQ9 A;  4O8G A;  2JN7 A;  5IS1 A;  4L9F A;  2HJ9 C;  4EW7 A;  3H9W A;  3EQU A;  4Y5F A;  5HZH A;  4EXO A;  2KLI A;  2OWH A;  4DJ3 A;  3K3D A;  4NEE D;  5K5B A;  4BBV A;  4GHI B;  3IBR A;  3PXP A;  4NKP A;  4F3L B;  3JVV A;  3TJZ C;  3CWF A;  4HQA A;  3S7P A;  1TD5 A;  3MR0 A;  4B93 A;  2P04 A;  5F5Y A;  2WKQ A;  5DKL A;  2W1R A;  1OT9 A;  4O0P A;  4BBU A;  5LBR A;  3UE3 A;  5DFY A;  4QPR A;  4Q0I A;  3E98 A;  1ZTU A;  3LUQ A;  4EQ1 A;  1OTB A;  1YAX A;  2EA9 A;  4R38 A;  1WA9 A;  2XRN A;  1OPX A;  3PBN A;  1S4R A;  5FL3 A;  4NXF A;  4H6J B;  3T50 A;  3D3O A;  1G6O A;  2Y8H A;  3SW1 A;  5G4Z A;  2L1M A;  3V67 A;  1NLY A;  4I3A A;  4EUV A;  3KSI A;  3PBR A;  1ODV A;  3LIC A;  3UME A;  4H6J A;  2P08 A;  1H8M A;  1N9N A;  2INW A;  2PDR A;  2KOI A;  2QKP A;  3B33 A;  1OTI A;  5AVE A;  2HF6 A;  2MJ6 A;  3BQA A;  3O5Y A;  1N9L A;  5DF9 A;  2QJ5 A;  5HD5 A;  3RFB A;  2W3F A;  3RTY A;  4ETZ A;  2W1T B;  1VHM A;  2VGL M;  2XSS A;  4GCZ A;  3VE3 A;  3LIE A;  2KX6 A;  2FZ0 A;  3MQ0 A;  3EEA A;  4JGR A;  3HJI A;  2ZOI A;  2GJ3 A;  3TW8 A;  4ZRR A;  2A2L A;  3UB6 A;  4WEK A;  3UMD A;  1XJ3 A;  4IHQ A;  3P01 A;  2JKT I;  2B02 A;  2W1T A;  3KYZ A;  4G3W A;  2M1C A;  3MQO A;  2J80 A;  3FG8 A;  3MF0 A;  4HIA A;  4WEJ A;  4HHD A;  3E0Y A;  1TS8 A;  3H7W A;  3LIA A;  1T1A A;  1NWZ A;  1NLZ A;  2QJ7 A;  2ZMF A;  2H28 A;  4HH3 A;  4GS9 B;  2VX8 A;  2V9A A;  3ULF A;  2O0Y A;  4KQD A;  2O9C A;  5G4Y A;  3IBJ A;  2ZMV A;  3JVU A;  1GSV A;  2A24 A;  4ARZ B;  1JNU A;  1BYW A;  1P9R A;  4I39 A;  5AJG A;  3F1P B;  3BJN A;  1YKD A;  3UB9 A;  1LL8 A;  3NOP C;  2HV1 A;  4EEP A;  2Z6C A;  3R7W B;  4ARZ A;  1G28 A;  3LIB A;  4Q0H A;  4UQI S;  3T4O A;  4LRY C;  5HL6 A;  2IA2 A;  3LFV A;  2LB5 A;  3HCY A;  4BBT A;  3F1P A;  4MN6 A;  2L0W A;  4R3A A;  3S7Q A;  2DMW A;  4Y2F A;  5F6A A;  3S7N A;  3R7W A;  3MQQ A;  4I3I A;  1W63 Q;  3C38 A;  2PYP A;  4Z1W A;  2O9A A;  5DKK A;  2OAP 1;  2J3T C;  2VA0 A;  3K2N A;  4CLC D;  3CIT A;  3KSF A;  3OBF A;  1XFQ A;  4YNR A;  1UWP X;  5J4E A;  3KYQ A;  3F1O A;  5KIZ A;  2VKS A;  1GSW A;  5CX7 A;  4O01 A;  5IU1 A;  4HOI A;  2CMN A;  3A0S A;  3CI6 A;  4LLO B;  4MCW A;  5KSH A;  2EWV A;  3KX0 X;  2PR5 A;  4I38 A;  4R6L A;  1TS0 A;  3ICY A;  4WN5 A;  4CLC B;  4DJ2 A;  5HD3 A;  3PHY A;  5F69 A;  3NOT C;  1W63 M;  2W3D A;  1IFQ A;  4B9O A;  3CAX A;  4EET B;  3F1N B;  2W3H A;  2VJW A;  4CLC A;  4WLA A;  3LIF A;  3EQV A;  3BW6 A;  5DFX A;  3MMH A;  4MMN A;  4K08 A;  2QHK A;  3BQ8 A;  4LRX C;  1OTD A;  1TS6 A;  4HP9 A;  1F9I A;  4G3K A;  4E04 A;  3F1N A;  4PKY A;  1YSP A;  4HJ3 A;  4HY8 A;  2XA7 S;  3MXQ A;  1S1Z A;  2OAQ 1;  3T4Q A;  1ZHH B;  2W3G A;  4Y3I A;  2K2N A;  1MKM A;  2V0W A;  3UE6 A;  4GJ4 A;  4JGP A;  5HWW A;  3H82 B;  4L0L A;  2D02 A;  4BWI A;  3T4T A;  4CLC C;  3KO6 A;  4L9E A;  4NXE A;  4HH2 A;  3T4L A;  2D01 A;  3EWK A;  3PBS A;  3H7W B;  1F98 A;  2OWJ A;  4FOF A;  3BWL A;  4WF0 A;  2I9V A;  4CLC E;  3H82 A;  1MZU A;  5DJT A;  4G3V A;  4I5S A;  4WL9 A;  3E4P A;  2PT7 A;  2K7S A;  4L9G A;  2V1B A;  2A24 B;  4UQI M;  4P6Z S;  3B47 A;  1T19 A;  5C5K A;  3EEH A;  1H3Q A;  3C8C A;  3FPW A;  3E4O A;  3OCL A;  5A8B A;  5L8M A;  2VV6 A;  3GDI A;  2Y79 A;  3EOI A;  4XT2 A;  1EW0 A;  2JKR I;  3K3C A;  3PR6 A;  4AFI A;  3LR4 A;  1S66 L;  3KSG A;  5J7E A;  2O9B A;  4OOL A;  2EWW A;  1DP6 A;  1D06 A;  4EU0 A;  2R78 A;  3NOU C;  4MDZ A;  1S67 L;  5HWT A;  1IOU A;  1P97 A;  5TBM B;  4GW9 A;  4FSF A;  2NUT C;  4HNB A;  2NUP C;  4IUH A;  4YOF A;  3W2Z A;  3GEC A;  4PKY G;  2GNX A;  3NHQ A;  4EEU A;  1T18 A;  2QYB A;  2HGV A;  4MN5 A;  5TBM A;  1UGU A;  3F1O B;  3A0R A;  3LI9 A;  1OJ5 A;  4IUK A;  3UB8 A;  1MC0 A;  5HDS A;  3MJQ A;  3PBQ A;  4JGQ A;  4KUK A;  2JKR M;  3CLO A;  3OLO A;  4NXB A;  3TRC A;  4EES A;  2V0U A;  4PHT A;  5TJJ A;  3E4Q A;  2PD7 A;  1OTE A;  2FH5 A;  3FC7 A;  1V9Y A;  5HPF A;  4ETX A;  1TS7 A;  1LSV A;  2PYR A;  1T1C A;  4EER A;  1DP8 A;  3T4J A;  3BY9 A;  1NRJ A;  2XA7 M;  4R70 A;  5MC7 A;  1DP9 A;  3DBA A;  3PBO A;  1DRM A;  2B18 A;  3RH8 B;  2PHY A;  2J3W A;  1F5M A;  5AVF A;  1S1Y A;  2PD8 A;  1D7E A;  4YWZ A;  5DJU A;  3FPV A;  4GHI A;  1TF1 A;  4F3L A;  3A0V A;  1VB6 A;  2P7J A;  5HPI A;  1LT0 A;  1YSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...