3IWQA

X-ray crystal structure of the extended-spectrum ampc e219k mutant beta-lactamase at 1.84 angstrom resolution
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
353
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAKAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
total genus 116
structure length 353
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3iwqA00
5GLAA 1I2SA 1JWPA 2EX8A 1BLCA 2I72A 1LL9A 3HBRA 4KG2A 3BECA 1BLSA 1FR6A 1XGIA 5AQAA 5TR7A 1J9MA 1CEFA 1KVMA 1HD8A 3OCLA 5FAOA 1TVFA 5FI7A 1XPBA 2HDSA 3P09A 2Z2LB 2FFYA 3BFDA 4PM8A 5FAQA 3HLEA 1IYOA 3AGDA 2J9PA 2Y2NA 4P87A 3E2LA 3G30A 5DF7A 5CTNA 1BLPA 2EFXA 1K54C 5KSCA 3NI9A 1LLBA 3G4PA 5DF9A 3UDXA 2ZQ9A 1S6RA 5CXWA 1LL5A 3G34A 5GHXA 3UY6A 3HLBA 4X69A 1TDGA 3O3VA 2J7VA 4K0XA 4GOGA 5TFQA 3PTEA 4Y0UA 1XA1A 1IKGA 2Y4AA 3PAEA 3QNBA 3IH8A 1NY0A 1BZAA 3RJUA 1CK3A 1K4EA 3VSKA 4KZ9A 4CPKA 3Q07A 5CHUA 4GDNA 3SS4A 4BQMA 4U0TA 1K6RA 4WMCD 5F83A 2XF3A 1PWCA 1DY6A 2G2UA 3E2KA 4DDYA 3OPLA 5A90A 4EUZA 1YQSA 4JF4A 3IWOA 3UDFA 2ZC7A 4ZJ2A 3OCNA 4LV3A 5E2FA 2HP6A 3UNWA 2XK1A 2Y59A 3V50A 2WKHA 5FQMA 2EXAA 4KZ3A 1Z6FA 2WZZA 3A3EA 1SDEA 3HLDA 3O86A 5CEDA 2V20A 4LCLA 2R9XA 3MXSA 1ZKJA 1HVBA 1W5DA 4BL3A 1DJAA 1MWSA 3IHBA 4Y7PA 3WS1A 4QB8A 1H8ZA 3ISGA 5GL9A 5EECA 1YMSA 4QU3A 3EQUA 4ZJ1A 1PW8A 1Q2QA 2ZJ9A 4S2PA 2BLSA 3AGFA 4GNUA 1K25A 4OPYA 5U47A 4DE2A 2V1ZA 1JWVA 1SDNA 2HDUA 3UO9A 1PW1A 4S2NA 1N4OA 2HP5A 3PBRA 3OPPA 3VP0A 2J9OA 3IF6B 3FZCA 5FQIA 2JE5A 3S22A 3V39A 5EVID 3DWZA 1XKZA 5F1FA 1PYYA 3PBQA 4OKPA 1K54A 2EXBA 3FWLA 1YLPA 3ZHHA 4DXCA 2Y2LA 4OQGA 1K56A 2ZMAA 1RCJA 5F82A 1YLTA 4P0MA 4X55A 1K6SA 4X53A 3DWKA 3IXGA 1L0GA 3QNCA 4RX3A 1CI8A 3BFCA 2BG1A 3S4XA 3S1YA 2WK0A 4EBNA 4UA7A 4R23A 4OQIA 5JYOA 1MXOA 2Y2KA 3A3DA 3O87A 3V5MA 1FCNA 3IXDA 4KZ5A 2HDRA 3GVBA 3AGEA 2H0YA 3IH9A 4GDBA 5EOEA 5CECA 2XH9A 1G6AA 1K4FA 1YT4A 4EQIA 3FYZA 5GLCA 2PBYA 3ZFZA 4ID4A 2P9VB 2WGWB 2XFTA 4C75A 1HTZA 3SH8A 4WEKA 2WUQA 1ZC2A 4GKUA 1L0FA 2G2WA 4N1XA 2HDQA 4S2MA 4B4XA 5FQ9A 3G31A 1YM1A 2C6WB 3HREA 1LI9A 3RXXA 2WAEA 5E2HA 4PMAA 4X6TA 3UE0A 1K55C 4MEZA 4XUZA 4MBKA 4MLLA 4E6XA 4YINA 1GHPA 4IVKA 1NXYA 2EX9A 1BTLA 4GD6A 4DE0A 2C5WB 4LENA 5J8XA 1XGJA 3VSLA 3BFGA 3OPHA 5A91A 4R0QA 1DJBA 2QZ6A 4P6BA 3WS0A 2OLUA 4S2NC 4XXRA 1IYQA 1QMFA 1SKFA 2Y2OA 3C7UA 1E4DA 3RXWA 1L2SA 4N1HA 1IKIA 3HUMA 3MZDA 5FQJA 3GQZA 4K91A 1SHVA 1KDWA 1PI4A 3PAGA 5HW3A 5M18A 4M3KA 4WYYA 2XGNA 5EVLA 4FSFA 4E3JA 2VGJA 5DTTA 4H8RA 3ZVWA 5M1AA 4GZBA 2Y91A 1ES3A 5F1GA 4R4RA 4E3NA 4PM9A 4C3QA 2IWCA 3CMZA 1YLYA 4E3IA 1Q2PA 3NC8A 4RVAA 1NZUA 3UDIA 3ZG0A 3A3IA 1VM1A 4JXSA 4UAAA 1KGGA 4QY6A 1ESUA 1BT5A 4BLMA 3NIAA 3TSGA 4WMCA 1M40A 1GHMA 5HAIA 3V3SA 2XLNA 4S2OA 4OONA 1PZOA 3IWQA 4OLGA 4UA6A 3HL9A 3VFHA 4DRTA 3C7VA 4S2JA 5GHYA 1FOFA 3UPNA 1DJCA 3SOIA 3CJMA 2XR0A 5HARA 5FQQA 1LHYA 1K38A 3PBSA 4JF5A 4OPQA 4WEJA 5FAPA 5CEBA 4L0LA 3WRTA 4KZ6A 4HEFA 3N4IA 4UA9A 2Y55A 2J8YA 1WE4A 4IEDA 5FQKA 4LV1A 1GHIA 5FDHA 4O7DA 3IF6A 4E6WA 4QY5A 4IVIA 1K55A 2Y2QA 4EBLA 4EWFA 5FATA 2QPNA 3LEZA 4EBPA 5KMWA 3M6BA 4P85A 3W8KA 3MKFA 4E3LA 1C3BA 2Q9MA 4KQOA 1TEMA 3GSGA 1KGEA 1PIOA 2UWXA 2XD5A 1XX2A 4DKIA 2JBFA 4X56A 4B4ZA 1XA7A 3GV9A 5L2FA 3OZHA 1IYPA 3JYIA 2H10A 4FCFA 4S2LA 3ZG7B 2DRWA 2OLVA 1FR1A 2ZC3B 3Q7VB 4OLDA 1E3UA 4GD8A 1H8YA 2RL3A 3UPOA 1NYYA 1KGFA 1KE0A 2WKIA 4KG6A 5EVIA 3MBZA 3ZNYA 4B88A 1LI0A 1K57A 2EX6A 3C4PA 5DTKA 4HBUA 3GMWA 4U0XA 4RA7A 3BLMA 1MY8A 3G2ZA 4PM7A 3EQVA 2XFSA 4U3TA 3WWXA 5AQBA 3HLWA 1RGZA 3BLSA 3GRJA 3HLCA 4MBFA 5M19A 4QD4A 2P9VA 2WGWA 1BULA 2PU2A 3LY3A 3G2YA 5AQ9A 2WYXA 1H5XA 5E2GA 3NDEA 1MBLA 1M6KA 2OSUA 3HUNA 3FKVA 4JBFA 1JVJA 5EVIB 5HFOA 2VGKA 3VP2A 1SCWA 3D4FA 4LV2A 3OPRA 1O7EA 3NY4A 1FSYA 5GLBA 2ZQCA 3OC2A 3IF5A 2DCFA 3IHAA 3A3JA 1KE4A 5JYPA 4OOLA 5GLDA 3Q1FA 1FCOA 3HLGA 3VP1A 3VOZA 2EX2A 2ZQ7A 3ITAA 3MZEA 4JLFA 2HP9A 3UPPA 1NRFA 5A93A 3W4PA 3W4QA 4ZDXA 1MWUA 1ALQA 5KSHA 4JKTA 4ZJ3A 2RCXA 3IF6C 3N7WA 3BEBA 4OP5A 5EUAA 4C6YA 1GA9A 4BENA 1JWZA 3BRMA 4MNRA 1JTGA 1YMXA 3UE1A 3ZG8B 4S2KA 3BFFA 3Q7ZA 5BOHA 3M2KA 3O88A 1BLHA 5E2EA 4A5RA 3I7JA 2QMIA 5GHZA 4FD8A 5E43A 4S2IA 3VP3A 4NK3A 1S0WA 4HBTA 4ZTKA 1PI5A 4N9LA 3WS4A 1IYSA 2H5SA 3M2JA 4KENB 5EVIC 1YLJA 5AQ7A 4DE3A 3MZFA 1K57C 4FH4A 2V2FF 4PM6A 5G18A 1CEGA 2Y2MA 2XQZA 4E3MA 1TDLA 5CGXA 1YLWA 3HUOA 3Q81A 4EV4A 3QHYA 2JCHA 3SS5A 1EROA 1YLZA 3CZDA 3IXHA 4JXGA 2X02A 3GTCA 3N8LA 2XD1A 2XDMA 2X71A 3N8SA 3PBOA 3IQAA 3ZVTA 3ZCZA 1WYCA 5A92A 1L0DA 2ZC4B 3TOIA 4KZBA 5I94A 2DNSA 4BL2A 4WELA 2ZM0A 5CGWA 3PBNA 3C5AA 4BJPA 1ES2A 3LY4A 2FFFB 3ZGAB 1W79A 1MKIA 1KE3A 4R4SA 2R9WA 2IWBA 4JXWA 1KDSA 3VOYA 3B3XA 3DW0A 2ZQ8A 3IXBA 3WRZA 3NBLA 3UN7A 1W8QA 1FSWA 2ZD8A 2WKEA 5CRFA 4IBRA 2E8IA 3FV7A 3HLFA 4KQQA 4MBHA 3LCEA 4ZBEA 4DE1A 5D3OA 4PPRA 3V3RA 1IEMA 1Y54A 3ITBA 2Y2IA 2GDNA 3N6IA 4OH0A 4E3OA 4UHUA 4PM5A 2ZLYA 1PZPA 1ZG6A 3SH7A 3Q7VA 3G35A 2WZXA 1WYBA 4OQ0A 3NDGA 5DF8A 2ZC6B 4JXVA 1FCMA 3UE3A 4LV0A 1G68A 2Y2PA 5DVAA 1XXMA 1ESIA 3MKEA 1N9BA 3Q82A 1O07A 1ZG4A 1ONGA 4OOYA 5EE8A 1VQQA 4DDSA 2Y2GA 4CJNA 4RX2A 5HAPA 1OMEA 4R3JA 4ZAMA 4KG5A 2WADA 3BYDA 3MXRA 1RP5A 3P98A 2X01A 2A3UA 1NZOA 2A49A 2WGIA 5CHJA 3VP4A 4Y0TA 4KZ7A 4OOMA 5TGFA 1IELA 4WM9A 2WGVA 4WZ5A 4XUXA 1QMEA 4JF6A 2ZM2A 2ZQDA 5IHVA 4DXBA 4OPZA 3VMAA 2EFUA 3M6HA 4Y0OA 1AXBA 5FI2A 5CTMA 1ERQA 3W4OA 2Q9NA 4QJGA 3ZNTA 1HZOA 1ONHA 3PBTA 5FSRA 3SH9A 2B5RA 1ES5A 1MWRA 4DF6A 4F94A 5CHMA 1E3UD 5HL1A 1BUEA 3CG5A 5EOOA 4BD0A 1PWGA 1FQGA 4WZ4A 5DTSA 5HAQA 1KVLA 4WBGA 4YFMA 4GB7A 1CI9A 3G32A 5KZHA 3NCKA 2WAFA 4N92A 1K56D 4KZAA 1JTDA 4LCMA 2Y2JA 1ES4A 1GA0A 2Z2MB 3FKWA 4KZ4A 1ERMA 2OV5A 1MWTA 2CC1A 3BM6A 4OP8A 3BFEA 5CGSA 1GCEA 2Y2HA 3ZDJA 4D2OA 1W8YA 2P74A 4KZ8A 1E25A 1I5QA 2XEPA 1MPLA 2PU4A 4OVDA 1W7FA 4BD1A 4X68A 3LO7A 1EI5A 4GN2A 3IT9A 1U60A 3DTMA 4RYEA 3TG9A 3SS3A 3WS2A 1L0EA 2JC7A 4FH2A 2H0TA 3HVFA 1I2WA 4NETA 4QHCA 4KQRA 4Q8IA 1NJ4A 2ZQAA 4IBXA 5CERA 3VFFA 1EWZA 3MFDA 4Z9QA 4K0WA 3WS5A 3GR2A 4N9KA 1NYMA 4R3BA 1PWDA 1BSGA 3C4OA 4E3KA 3ZG9B 3N8RA 5FASA 2ZC5B 2HPBA 4OQHA 5HX9A 1XP4A 2IWDA 1RGYA 3IWIA 2ZM8A 4OPRA 5EPHA 4HESA 3ZG5A 4R1GA 4WZ5C 3A3FA 4JPMA 5FI6A 5FA7A
chains in the Genus database with same CATH superfamily
5EVEA 1JWPA 2EX8A 3HBRA 3B42A 3KSGA 1XGIA 1KVMA 1TVFA 3P09A 1IYOA 2Y2NA 4II7A 3E4OA 4LRXC 5CTNA 1F2KA 3F1NB 3H9WA 2W27A 1XJ2A 2PD8A 3KYEA 2NUPC 3UY6A 3HLBA 3BQ8A 4X69A 1TDGA 3O3VA 4UQIS 3PTEA 1IKGA 2OAP1 2EWVA 3QNBA 3IH8A 3MXQA 3RJUA 3VSKA 4CPKA 4EUVA 1K6RA 4WMCD 5F83A 4EQ1A 3T4LA 3IX3A 5F5YA 4JF4A 4WUJA 1G6OA 4YOFA 1MZUA 2KDKA 5E2FA 2HP6A 2JKTI 4KZ3A 2WZZA 3KSIA 4MMNA 3O86A 1OTAA 3NHQA 4LCLA 5CEDA 2KOIA 1ODVA 4BL3A 1HVBA 3F1OA 2JKTM 1LSXA 1PW8A 4OPYA 1K25A 4DE2A 1JWVA 1PW1A 1N4OA 3PBRA 3OPPA 3S22A 4BMWA 1YLPA 4DXCA 1K56A 1K6SA 4X53A 3DWKA 2W3HA 3IXGA 3QNCA 2HGVA 2VV6A 3UMDA 2BG1A 3QP8A 5G4YA 3IXDA 1G28A 5EOEA 1N9LA 2XH9A 1K4FA 4PKYG 4EQIA 5HWTA 2WGWB 4IJGA 2XFTA 4WEKA 1YM1A 2WAEA 4HJ4A 4PMAA 3NULA 4YINA 5EFWA 5KIZA 2ACGA 4DE0A 1P0ZA 3DTKA 4P6BA 2OLUA 3C7UA 4N1HA 4Z1WA 3VE4A 5HW3A 1PI4A 3PAGA 2PYRA 2VGJA 3G6OA 1PFLA 1NWZA 4GZBA 5M1AA 2HJ9C 4PM9A 2J3TD 1YLYA 2JN7A 2A24A 4XT2A 4RVAA 1NZUA 3A3IA 4JXSA 4UAAA 1T1BA 4QY6A 1BT5A 3NIAA 3TSGA 4WMCA 3LFVA 2YKFA 4HIAA 4DRTA 3C7VA 4S2JA 1P9WA 4NEED 4M4XA 1DJCA 3CJMA 4XT2B 5HARA 5FQQA 4WEJA 3PBSA 3VV4A 5CEBA 2PBDP 3WRTA 4ESPA 3N4IA 2Y55A 1WE4A 4IEDA 3HJKA 5L10A 1UGUA 4Q0IA 5FDHA 4E6WA 4WLAA 4QY5A 3M6BA 4P85A 3MKFA 1XX2A 3PXPA 4DKIA 4HHDA 3LIDA 4G3WA 3T50A 4FCFA 2OLVA 2EWWA 1KGFA 2WKIA 1K57A 3C4PA 4RA7A 3BLMA 3EQVA 3TE8A 3WWXA 5AQBA 3HLWA 2O99A 5M19A 4LGWA 4QD4A 1BULA 5AQ9A 2G7UA 1H5XA 1M6KA 1JVJA 1ZHHB 2VGKA 3VP2A 4CLCA 3BJNA 3B33A 3A3JA 5JYPA 4OOLA 3Q1FA 3VP1A 2LB9A 3MZEA 2FH5A 3ITAA 4JLFA 5A93A 4ARZB 1MWUA 1ALQA 5KSHA 4Q0HA 4ZJ3A 1A0KA 2RCXA 4C6YA 3UE1A 4S2KA 2OWJA 4FD8A 4NK3A 3KSFA 2V2FF 1CEGA 2Y2MA 4E3MA 5CGXA 4EV4A 2ZMVA 3QHYA 3PBOA 1WYCA 2M7UA 4KZBA 5I94A 3BY8A 5I5LA 3UB9A 3PBNA 1UWPX 1SZVA 1MKIA 4R4SA 4JXWA 3H82B 3D9YA 4MCWA 3WRZA 5IS1A 3K3CA 4KQQA 1FIKA 4PPRA 4JGPA 3ITBA 4Y15A 4OH0A 4E3OA 2ZLYA 1WYBA 3KSHA 4X1MA 3EGDC 3S7PA 4DN0A 4DDSA 2Z6CA 3TJZC 4MN6A 2A49A 2VJWA 4O0PA 4WZ5A 2ZM2A 4OPZA 5FI2A 2PDRA 3W4OA 3ZNTA 1HZOA 3SW1A 1MWRA 1Y4OA 2V1AA 1CI9A 5KZHA 3NCKA 4KZAA 4I38A 4F3LA 1IOUA 3DAVA 1GCEA 3C8CA 4D2OA 1I5QA 2PU4A 4OVDA 3LO7A 4WF0A 3SS3A 3UB6A 3WS2A 4Q8IA 3HVFA 1I2WA 4I5SA 3JVVA 4F3LB 4EERA 3WS5A 5DJTA 3LR4A 3E4PA 2NUTC 4E3KA 3ZG9B 2HPBA 4OQHA 5HX9A 1XP4A 3QP5A 3A3FA 4JPMA 4HNBA 5FA7A 1XFQA 3IBRA 4L9FA 1LL9A 2W1TB 3BECA 2Z6DA 4Y17A 1J9MA 3T4SA 3OCLA 5FAOA 5FAQA 3AGDA 2J9PA 3NECA 1FILA 5DF7A 1VEUA 1BLPA 4GS9A 2XA7M 1LLBA 2QYBA 3UDXA 3V67A 2VLGA 1LL5A 2J7VA 1XA1A 2Y4AA 3PAEA 1CK3A 1OT9A 3Q07A 4BQMA 2M7VA 1DY6A 2YKHA 4EUZA 4GHIA 1YQSA 1OTEA 4KUKA 1DRMA 3UDFA 2ZC7A 3UNWA 1W63M 5FQMA 5AVFA 4HI4A 3LI8A 3RH8B 3UE6A 3UB5P 1DJAA 2J3TC 3IHBA 4GHIB 3WS1A 1H8ZA 3ISGA 5GL9A 5EECA 2XA7S 4QU3A 4BBTA 5U47A 2V1ZA 1SDNA 1V9ZA 1G5UA 3UO9A 3MQ0A 2PT7A 3IF6B 5L8MA 1K54A 3FWLA 3ZHHA 4Y5FA 2Y2LA 4OQGA 1RCJA 3OBFA 4P0MA 4X55A 1L0GA 4RX3A 3A0SA 3S1YA 4EBNA 3CWFA 4OQIA 2ZL1A 2Y2KA 3A3DA 5TBMB 5F69A 2HDRA 5G4ZA 1T1AA 1G6AA 4B9OA 5GLCA 3R4KA 4ID4A 2P9VB 4C75A 3T1RA 3SH8A 1L0FA 4S2MA 5FQ9A 4ME4A 3HREA 1LI9A 2I9VA 3OOVA 5HD5A 3UE0A 1K55C 4MBKA 4MLLA 3F1NA 3UMEA 2EX9A 3CPTA 2C5WB 5J8XA 2L1MA 3VSLA 3BFGA 4WL9A 3OPHA 3P7NA 2QZ6A 1OTIA 3WS0A 4XXRA 1IYQA 4PAUA 5HD3A 1E4DA 5HSQA 1IKIA 3HUMA 4E3JA 1STZA 1OTDA 3CPTB 2Y91A 1ES3A 4WN5A 1W63Q 4R4RA 4E3NA 4C3QA 5LBRA 2IWCA 3CMZA 4E3IA 1Q2PA 1VB6A 4KQDA 3HCYA 3UDIA 2K31A 4Q0JA 5HDDA 4S2OA 2V1BA 1FOFA 3RFBA 1NRJA 2XR0A 2P7JA 2J8YA 3LIAA 5FQKA 4CQHA 4O7DA 3OLOA 4I3AA 3VE3A 3LEZA 4EBPA 5KMWA 3T1SA 2INWA 1C3BA 3CUEC 2WKPA 1TEMA 2ZOIA 3GSGA 1KGEA 2UWXA 3T1QB 4FOFA 2JBFA 4P6ZM 5HPIA 5L09A 1IYPA 4S2LA 3ZG7B 1WA9A 1E3UA 4GD8A 1H8YA 5F6AA 1S1ZA 1NYYA 5DTKA 3GMWA 2L0WA 2VGLM 3G2ZA 2XFSA 5FL3A 4U3TA 1OTBA 2B18A 5DFXA 3F1PB 3QP1A 2WGWA 2PU2A 3LY3A 3G2YA 2D01A 3L7HA 2WYXA 4LFUA 5E2GA 1OJGA 4IUHA 3FKVA 5DKKA 2W0NA 1SCWA 3OPRA 1Y28A 3NY4A 3OC2A 3IF5A 3IHAA 3JVUA 3VOZA 4RQ9A 2D02A 3CI6A 4JKTA 3IF6C 3O5YA 3BEBA 4PHTA 3CHWP 2PHYA 3BRMA 2PR6A 1JTGA 1YMXA 1AWIA 2P08A 2PD7A 3NOPC 3Q7ZA 5BOHA 3M2KA 3O88A 1BLHA 1IFQA 4A5RA 3D3OA 2QMIA 5GHZA 4S2IA 1S0WA 1F98A 4G3VA 3WS4A 1IYSA 4DE3A 1YLWA 3HUOA 3CZDA 3N8LA 2X71A 3N8SA 2Y79A 1EW0A 1DP9A 4Y2FA 4HH2A 4BL2A 4WELA 2ZM0A 3TW8A 1ES2A 3MMHA 2E8JA 2FFFB 1W79A 1KE3A 2R9WA 3VOYA 1KDSA 2FZ0A 3DW0A 3NBLA 3UN7A 4IBRA 4ZBEA 4KUOA 2Y2IA 2GDNA 1F9IA 4PM5A 2M1CA 4LRZE 5MC7A 1H3QA 2WZXA 3LR3A 4OQ0A 1CF0A 2ZC6B 1FCMA 3IS2A 3UE3A 4LV0A 5DVAA 5AVEA 5HL6A 1ONGA 4OOYA 4L9GA 2XRNA 2OWHA 1NZOA 3VP4A 5CHJA 3IS2B 5TGFA 1IELA 4AFIA 2WGVA 4YNRA 2BASA 1QMEA 2J80A 2UV0E 4PKYA 4K08A 3LR5A 2EFUA 4QPRA 1ERQA 4ARZA 4F94A 2PRFA 1XJ4A 3CG5A 5EOOA 3LUQA 4WZ4A 5DTSA 1KVLA 4YFMA 3G32A 2WAFA 1ES4A 4KZ4A 1MWTA 2CC1A 3UB7A 4OP8A 2W3EA 5CGSA 4NG2A 1JNUA 2Y2HA 1W8YA 4KZ8A 2XEPA 1MPLA 3PHYA 4GN2A 3DTMA 3TG9A 1L0EA 4FH2A 4FTXA 5CERA 4IBXA 3MFDA 4N9KA 3HJIA 4H6JA 4X25A 3N8RA 2QJ5A 1D7EA 1RGYA 2ZM8A 5EPHA 4HESA 2VV7A 4HP4A 4R1GA 5GLAA 4MN7A 3H82A 2I72A 4KG2A 4D60A 1BLSA 1CEFA 2JKGA 4H6JB 1HD8A 1XPBA 2Z2LB 3HLEA 1DP8A 3P01A 3G30A 4I3IA 2EFXA 5KSCA 3NI9A 3G4PA 2ZQ9A 1S6RA 5CXWA 3G34A 5IT5A 5GHXA 4K0XA 4GOGA 5TFQA 4Y0UA 3PR6A 3FG8A 1BZAA 3ZQ5A 2QKPA 4EESA 4KZ9A 2GX5A 4GDNA 3DTIA 4U0TA 2G2UA 3OPLA 2K2NA 4FUWA 3IWOA 4ZJ2A 3ZYTA 3V50A 2EXAA 1Z6FA 4HY8A 3BW6A 3A3EA 1SDEA 5J4EA 3MXSA 1ZKJA 1MWSA 4QB8A 5L07A 3QP2A 1YMSA 3EQUA 2ZJ9A 2BLSA 4GNUA 4BBUA 3LIBA 3EEAA 2QHKA 3VP0A 3FZCA 2JE5A 1MKMA 3DWZA 1XKZA 1S4RA 2EXBA 1GSWA 2ZOHA 2V0WA 5F82A 4EU0A 1YLTA 1TS8A 3R7WA 4HH3A 4R23A 3V5MA 3TRCA 2O9AA 4KZ5A 1K0KA 3LICA 3IH9A 4GDBA 3CAXA 5CECA 1YT4A 1GSVA 3FYZA 3K3DA 3ZFZA 2W1TA 3R7WB 2WUQA 1ZC2A 4B4XA 2G2WA 4N1XA 2C6WB 4I3JA 5E2HA 3D72A 4MEZA 4R70A 3B47A 4GD6A 1XGJA 3MFXA 5A91A 4R0QA 1H0MA 3T4OA 4HOIA 4S2NC 3LIFA 4BWIA 1QMFA 1SKFA 2Y2OA 2P04A 4K91A 1SHVA 5AJGA 5M18A 5EVLA 4FSFA 4H8RA 5F1GA 5HDSA 5DKLA 2V0UA 1XFNA 3MSHA 5EV0A 3ZG0A 1VM1A 2HF6A 1ESUA 1M40A 3E98A 4CLCC 4O8GA 2XLNA 3IWQA 3VFHA 3HL9A 3UPNA 4MN5A 3A0RA 2W3DA 4JF5A 5FAPA 4L0LA 2L4RA 4HEFA 3L9KA 3IF6A 4IVIA 2Y2QA 3LEQA 5FATA 2QPNA 4HJ6A 3W8KA 4E3LA 4KQOA 1T19A 1J3WA 2W3GA 2XD5A 3U2AA 4HJ3A 1TD5A 4X56A 3S7QA 4B4ZA 1XA7A 3GV9A 5L2FA 3OZHA 4ETZA 3JYIA 2H10A 5HWVA 3Q7VB 4OLDA 3UPOA 4B88A 1KE0A 3MBZA 5TBMA 4HBUA 1S1YA 1MY8A 4PM7A 2ZBBA 1RGZA 3BLSA 3HLCA 4YWZA 2P9VA 3E0YA 3NDEA 3JPUA 3ULFA 2XROA 4LLOB 3HUNA 4JBFA 5HFOA 3D4FA 5EM0A 3KYZA 2ZQCA 2DCFA 2GNXA 3NJAA 2GZAA 5GLDA 3HLGA 1OPXA 2EX2A 2HP9A 3W4PA 2Y8HA 4ZDXA 4LRYC 3N7WA 1S66L 4OP5A 5EUAA 3T4QA 1BYWA 1HLUP 3MF0A 1S67L 4UQIM 2QJ7A 5E2EA 3I7JA 1LL8A 5E43A 4R3AA 5HDCA 1PNEA 4HBTA 2CMNA 4ZTKA 1KOUA 3A0VA 4N9LA 3UB8A 3IX8A 2KX6A 5EVIC 1YLJA 2K7SA 3MZFA 2VZWA 4PM6A 3VOLA 2XQZA 3Q81A 4E04A 3C38A 1EROA 1YLZA 3IXHA 4JXGA 2BTFP 1VETB 2VK3A 2X02A 4G3KA 3S7OA 3ZVTA 3IQAA 3ZCZA 2V9AA 2ZC4B 3TOIA 2JKRI 1DP6A 3H7WA 3C5AA 4EEPA 4EEUA 2JKRM 3B3XA 2QWSA 4JGQA 1W8QA 2ZD8A 5CRFA 3HLFA 5F68A 3T12B 3MJQA 1IEMA 3FC7A 3C30A 1Y54A 3V3RA 2VEAA 3H7WB 4UHUA 1ZG6A 3G35A 2W1RA 4NXBA 4JXVA 3Q82A 5EE8A 3F1PA 4RX2A 1OMEA 2Q0OA 3FPVA 4KG5A 2WADA 3MXRA 1RP5A 2H28A 2X01A 2A3UA 4GW9A 2WGIA 4KZ7A 4OOMA 4WM9A 4R6LA 4JF6A 5C5KA 5IHVA 4DXBA 3VMAA 3M6HA 2Q9NA 4QJGA 3PBTA 5FSRA 3SH9A 2B5RA 1ES5A 4DF6A 2VX8A 4BD0A 2WKQA 1FQGA 5HAQA 3F1OB 4GB7A 5FEFA 2J3WA 5IU1A 1N9OA 3NOTC 1JTDA 1GA0A 3FKWA 3E4QA 3ZDJA 2P74A 3BQAA 4P6ZS 1W7FA 2W3FA 4X68A 1D06A 4CLCD 3IT9A 4RYEA 5TJJA 2JC7A 2ZQAA 5K5BA 3VFFA 1EWZA 1MC0A 4NXGA 4R3BA 1PWDA 2VGLS 3C4OA 5FASA 3IWIA 4OPRA 1ACFA 3ZG5A 4NXFA 1I2SA 4DJ2A 3RTYA 1BLCA 2PYPA 1FR6A 5TR7A 5AQAA 3PYPA 5FI7A 2HDSA 2IA2A 4PM8A 2FFYA 3BFDA 1XJ3A 3E2LA 4P87A 5HZHA 1K54C 1CQAA 2LB5A 2OAQ1 5DF9A 1TS6A 2AVXA 1P97A 1NY0A 1K4EA 5CHUA 3SS4A 5CX7A 2XF3A 1PWCA 3E2KA 4DDYA 5A90A 1VHMA 2A24B 3OCNA 4LV3A 4B93A 2XK1A 2Y59A 2WKHA 3HLDA 2V20A 2R9XA 1W5DA 4Y7PA 1ZTUA 1YPRA 4ZJ1A 4IHQA 1Q2QA 4S2PA 3AGFA 1PRQA 3LR0A 2HDUA 2O0YA 4X1LA 4S2NA 2HP5A 2J9OA 5FQIA 3V39A 4EW7A 5EVID 2KLIA 5F1FA 1PYYA 3PBQA 4OKPA 2ZMAA 5DJUA 1CI8A 3BFCA 4O01A 3S4XA 2PR5A 2WK0A 4UA7A 5JYOA 1MXOA 3O87A 1FCNA 3GVBA 3AGEA 2H0YA 4GCZA 4EXOA 4HP9A 2PBYA 4QWOA 4DMZA 1HTZA 4GKUA 2HDQA 3G31A 2JKFA 1D1JA 3MQOA 3RXXA 4X6TA 4XUZA 4ZRRA 4CLCB 4E6XA 1P9RA 3QP6A 4ETXA 1GHPA 4IVKA 1NXYA 1BTLA 4LENA 1GSXA 1XJ6A 1OJ5A 4Y3IA 1DJBA 3RXWA 1L2SA 3DTEA 3MZDA 5FQJA 3GQZA 1KDWA 4M3KA 4WYYA 2XGNA 5DTTA 3ZVWA 3NC8A 2JHEA 4MDZA 1OT6A 1KGGA 5HWWA 3QP4A 4BLMA 1GHMA 3FPWA 5HAIA 3V3SA 1H8MA 1PZOA 4OLGA 4OONA 4UA6A 2HJEA 2PAVP 5GHYA 1LT0A 3SOIA 2WKRA 3EGXC 1LHYA 1K38A 1T1CA 4OPQA 1TF1A 4KZ6A 4UA9A 2ZMFA 2DMWA 4LV1A 3MS6A 4Y13A 1GHIA 3IBJA 1SKOA 1K55A 4EWFA 4EBLA 3T1XA 2Q9MA 2VV8A 3W2ZA 1PIOA 2XSSA 3U4LP 1X0OA 2V8FA 2DRWA 2O9CA 3LYXA 1FR1A 2ZC3B 1YKDA 2RL3A 1SKOB 4KG6A 5EVIA 3ZNYA 1LI0A 2EX6A 3C2WA 4U0XA 2VA0A 4LPZA 3GECA 3GRJA 4MBFA 2R78A 1LSVA 1MBLA 2OSUA 5EVIB 1NLZA 1V9YA 1S4SA 4LV2A 1O7EA 1UWNX 5J7EA 1FSYA 5GLBA 5FEGA 4R38A 1TS0A 1KE4A 2B02A 1N9NA 1FCOA 2HZ5A 4I39A 2ZQ7A 3UPPA 1NRFA 3EEHA 3W4QA 3BY9A 1GA9A 4BENA 2O9BA 1JWZA 4MNRA 3EWKA 3ZG8B 4CLCE 4IUKA 3BFFA 5DFYA 3T4TA 4HQAA 3CUEA 3VP3A 1PI5A 3CLOA 1L3LA 2VKSA 2H5SA 3M2JA 4KENB 4NKPA 5AQ7A 1K57C 4FH4A 5G18A 1TDLA 5A8BA 2JCHA 3SS5A 3GTCA 2XD1A 2XDMA 3LIEA 5A92A 1L0DA 4GLQA 2DNSA 1CJFA 5EM1A 5CGWA 4NXEA 4BJPA 3LY4A 3ZGAB 1T18A 2IWBA 3CITA 3LGOA 2ZQ8A 3IXBA 1FSWA 2WKEA 2E8IA 3FV7A 3GDIA 4MBHA 3LCEA 4DE1A 5D3OA 2GJ3A 4EETB 3N6IA 5FDSA 1PZPA 3SH7A 3Q7VA 1VEUB 4GS9B 5DF8A 3NDGA 1G68A 2Y2PA 3MR0A 1XXMA 3KO6A 3KYQA 1ESIA 3MKEA 1N9BA 1YSPA 3SZTA 1O07A 1ZG4A 1VQQA 2Y2GA 4CJNA 5HAPA 4R3JA 4ZAMA 3T4JA 3BYDA 3K2NA 3P98A 1TS7A 2OOLA 4Y0TA 4XUXA 4JGOA 3DBAA 3ICYA 2ZQDA 2V8CA 4Y0OA 3S7NA 1AXBA 5CTMA 1ONHA 5J3WA 1NLYA 5HPFA 3MQQA 5CHMA 1E3UD 5HL1A 1BUEA 1F5MA 4BBVA 4JGRA 1PWGA 4GJ4A 3T4KA 4WBGA 1YSQA 3EOIA 4N92A 1K56D 1LSWA 4LCMA 3BWLA 2Y2JA 4DJ3A 2Z2MB 2OV5A 1ERMA 2HV1A 3BM6A 4UEYA 3BFEA 2A2LA 1E25A 4L9EA 2B95A 2MJ6A 1Z09A 4BD1A 1EI5A 1U60A 4NETA 2H0TA 3IX4A 4QHCA 1YAXA 2EA9A 4KQRA 1VETA 1NJ4A 4Z9QA 4K0WA 3GR2A 1NYMA 1BSGA 3LI9A 2ZC5B 2ZL1B 2IWDA 3NOUC 3KX0X 4WZ5C 5FI6A
chains in the Genus database with same CATH topology
5GLAA 1I2SA 1JWPA 2EX8A 1BLCA 2I72A 1LL9A 3HBRA 4KG2A 3BECA 1BLSA 1FR6A 1XGIA 5AQAA 5TR7A 1J9MA 1CEFA 1KVMA 1HD8A 3OCLA 5FAOA 1TVFA 5FI7A 1XPBA 2HDSA 3P09A 2Z2LB 2FFYA 3BFDA 4PM8A 5FAQA 3HLEA 1IYOA 3AGDA 2J9PA 2Y2NA 4P87A 3E2LA 3G30A 5DF7A 5CTNA 1BLPA 2EFXA 1K54C 5KSCA 3NI9A 1LLBA 3G4PA 5DF9A 3UDXA 2ZQ9A 1S6RA 5CXWA 1LL5A 3G34A 5GHXA 3UY6A 3HLBA 4X69A 1TDGA 3O3VA 2J7VA 4K0XA 4GOGA 5TFQA 3PTEA 4Y0UA 1XA1A 1IKGA 2Y4AA 3PAEA 3QNBA 3IH8A 1NY0A 1BZAA 3RJUA 1CK3A 1K4EA 3VSKA 4KZ9A 4CPKA 3Q07A 5CHUA 4GDNA 3SS4A 4BQMA 4U0TA 1K6RA 4WMCD 5F83A 2XF3A 1PWCA 1DY6A 2G2UA 3E2KA 4DDYA 3OPLA 5A90A 4EUZA 1YQSA 4JF4A 3IWOA 3UDFA 2ZC7A 4ZJ2A 3OCNA 4LV3A 5E2FA 2HP6A 3UNWA 2XK1A 2Y59A 3V50A 2WKHA 5FQMA 2EXAA 4KZ3A 1Z6FA 2WZZA 3A3EA 1SDEA 3HLDA 3O86A 5CEDA 2V20A 4LCLA 2R9XA 3MXSA 1ZKJA 1HVBA 1W5DA 4BL3A 1DJAA 1MWSA 3IHBA 4Y7PA 3WS1A 4QB8A 1H8ZA 3ISGA 5GL9A 5EECA 1YMSA 4QU3A 3EQUA 4ZJ1A 1PW8A 1Q2QA 2ZJ9A 4S2PA 2BLSA 3AGFA 4GNUA 1K25A 4OPYA 5U47A 4DE2A 2V1ZA 1JWVA 1SDNA 2HDUA 3UO9A 1PW1A 4S2NA 1N4OA 2HP5A 3PBRA 3OPPA 3VP0A 2J9OA 3IF6B 3FZCA 5FQIA 2JE5A 3S22A 3V39A 5EVID 3DWZA 1XKZA 5F1FA 1PYYA 3PBQA 4OKPA 1K54A 2EXBA 3FWLA 1YLPA 3ZHHA 4DXCA 2Y2LA 4OQGA 1K56A 2ZMAA 1RCJA 5F82A 1YLTA 4P0MA 4X55A 1K6SA 4X53A 3DWKA 3IXGA 1L0GA 3QNCA 4RX3A 1CI8A 3BFCA 2BG1A 3S4XA 3S1YA 2WK0A 4EBNA 4UA7A 4R23A 4OQIA 5JYOA 1MXOA 2Y2KA 3A3DA 3O87A 3V5MA 1FCNA 3IXDA 4KZ5A 2HDRA 3GVBA 3AGEA 2H0YA 3IH9A 4GDBA 5EOEA 5CECA 2XH9A 1G6AA 1K4FA 1YT4A 4EQIA 3FYZA 5GLCA 2PBYA 3ZFZA 4ID4A 2P9VB 2WGWB 2XFTA 4C75A 1HTZA 3SH8A 4WEKA 2WUQA 1ZC2A 4GKUA 1L0FA 2G2WA 4N1XA 2HDQA 4S2MA 4B4XA 5FQ9A 3G31A 1YM1A 2C6WB 3HREA 1LI9A 3RXXA 2WAEA 5E2HA 4PMAA 4X6TA 3UE0A 1K55C 4MEZA 4XUZA 4MBKA 4MLLA 4E6XA 4YINA 1GHPA 4IVKA 1NXYA 2EX9A 1BTLA 4GD6A 4DE0A 2C5WB 4LENA 5J8XA 1XGJA 3VSLA 3BFGA 3OPHA 5A91A 4R0QA 1DJBA 2QZ6A 4P6BA 3WS0A 2OLUA 4S2NC 4XXRA 1IYQA 1QMFA 1SKFA 2Y2OA 3C7UA 1E4DA 3RXWA 1L2SA 4N1HA 1IKIA 3HUMA 3MZDA 5FQJA 3GQZA 4K91A 1SHVA 1KDWA 1PI4A 3PAGA 5HW3A 5M18A 4M3KA 4WYYA 2XGNA 5EVLA 4FSFA 4E3JA 2VGJA 5DTTA 4H8RA 3ZVWA 5M1AA 4GZBA 2Y91A 1ES3A 5F1GA 4R4RA 4E3NA 4PM9A 4C3QA 2IWCA 3CMZA 1YLYA 4E3IA 1Q2PA 3NC8A 4RVAA 1NZUA 3UDIA 3ZG0A 3A3IA 1VM1A 4JXSA 4UAAA 1KGGA 4QY6A 1ESUA 1BT5A 4BLMA 3NIAA 3TSGA 4WMCA 1M40A 1GHMA 5HAIA 3V3SA 2XLNA 4S2OA 4OONA 1PZOA 3IWQA 4OLGA 4UA6A 3HL9A 3VFHA 4DRTA 3C7VA 4S2JA 5GHYA 1FOFA 3UPNA 1DJCA 3SOIA 3CJMA 2XR0A 5HARA 5FQQA 1LHYA 1K38A 3PBSA 4JF5A 4OPQA 4WEJA 5FAPA 5CEBA 4L0LA 3WRTA 4KZ6A 4HEFA 3N4IA 4UA9A 2Y55A 2J8YA 1WE4A 4IEDA 5FQKA 4LV1A 1GHIA 5FDHA 4O7DA 3IF6A 4E6WA 4QY5A 4IVIA 1K55A 2Y2QA 4EBLA 4EWFA 5FATA 2QPNA 3LEZA 4EBPA 5KMWA 3M6BA 4P85A 3W8KA 3MKFA 4E3LA 1C3BA 2Q9MA 4KQOA 1TEMA 3GSGA 1KGEA 1PIOA 2UWXA 2XD5A 1XX2A 4DKIA 2JBFA 4X56A 4B4ZA 1XA7A 3GV9A 5L2FA 3OZHA 1IYPA 3JYIA 2H10A 4FCFA 4S2LA 3ZG7B 2DRWA 2OLVA 1FR1A 2ZC3B 3Q7VB 4OLDA 1E3UA 4GD8A 1H8YA 2RL3A 3UPOA 1NYYA 1KGFA 1KE0A 2WKIA 4KG6A 5EVIA 3MBZA 3ZNYA 4B88A 1LI0A 1K57A 2EX6A 3C4PA 5DTKA 4HBUA 3GMWA 4U0XA 4RA7A 3BLMA 1MY8A 3G2ZA 4PM7A 3EQVA 2XFSA 4U3TA 3WWXA 5AQBA 3HLWA 1RGZA 3BLSA 3GRJA 3HLCA 4MBFA 5M19A 4QD4A 2P9VA 2WGWA 1BULA 2PU2A 3LY3A 3G2YA 5AQ9A 2WYXA 1H5XA 5E2GA 3NDEA 1MBLA 1M6KA 2OSUA 3HUNA 3FKVA 4JBFA 1JVJA 5EVIB 5HFOA 2VGKA 3VP2A 1SCWA 3D4FA 4LV2A 3OPRA 1O7EA 3NY4A 1FSYA 5GLBA 2ZQCA 3OC2A 3IF5A 2DCFA 3IHAA 3A3JA 1KE4A 5JYPA 4OOLA 5GLDA 3Q1FA 1FCOA 3HLGA 3VP1A 3VOZA 2EX2A 2ZQ7A 3ITAA 3MZEA 4JLFA 2HP9A 3UPPA 1NRFA 5A93A 3W4PA 3W4QA 4ZDXA 1MWUA 1ALQA 5KSHA 4JKTA 4ZJ3A 2RCXA 3IF6C 3N7WA 3BEBA 4OP5A 5EUAA 4C6YA 1GA9A 4BENA 1JWZA 3BRMA 4MNRA 1JTGA 1YMXA 3UE1A 3ZG8B 4S2KA 3BFFA 3Q7ZA 5BOHA 3M2KA 3O88A 1BLHA 5E2EA 4A5RA 3I7JA 2QMIA 5GHZA 4FD8A 5E43A 4S2IA 3VP3A 4NK3A 1S0WA 4HBTA 4ZTKA 1PI5A 4N9LA 3WS4A 1IYSA 2H5SA 3M2JA 4KENB 5EVIC 1YLJA 5AQ7A 4DE3A 3MZFA 1K57C 4FH4A 2V2FF 4PM6A 5G18A 1CEGA 2Y2MA 2XQZA 4E3MA 1TDLA 5CGXA 1YLWA 3HUOA 3Q81A 4EV4A 3QHYA 2JCHA 3SS5A 1EROA 1YLZA 3CZDA 3IXHA 4JXGA 2X02A 3GTCA 3N8LA 2XD1A 2XDMA 2X71A 3N8SA 3PBOA 3IQAA 3ZVTA 3ZCZA 1WYCA 5A92A 1L0DA 2ZC4B 3TOIA 4KZBA 5I94A 2DNSA 4BL2A 4WELA 2ZM0A 5CGWA 3PBNA 3C5AA 4BJPA 1ES2A 3LY4A 2FFFB 3ZGAB 1W79A 1MKIA 1KE3A 4R4SA 2R9WA 2IWBA 4JXWA 1KDSA 3VOYA 3B3XA 3DW0A 2ZQ8A 3IXBA 3WRZA 3NBLA 3UN7A 1W8QA 1FSWA 2ZD8A 2WKEA 5CRFA 4IBRA 2E8IA 3FV7A 3HLFA 4KQQA 4MBHA 3LCEA 4ZBEA 4DE1A 5D3OA 4PPRA 3V3RA 1IEMA 1Y54A 3ITBA 2Y2IA 2GDNA 3N6IA 4OH0A 4E3OA 4UHUA 4PM5A 2ZLYA 1PZPA 1ZG6A 3SH7A 3Q7VA 3G35A 2WZXA 1WYBA 4OQ0A 3NDGA 5DF8A 2ZC6B 4JXVA 1FCMA 3UE3A 4LV0A 1G68A 2Y2PA 5DVAA 1XXMA 1ESIA 3MKEA 1N9BA 3Q82A 1O07A 1ZG4A 1ONGA 4OOYA 5EE8A 1VQQA 4DDSA 2Y2GA 4CJNA 4RX2A 5HAPA 1OMEA 4R3JA 4ZAMA 4KG5A 2WADA 3BYDA 3MXRA 1RP5A 3P98A 2X01A 2A3UA 1NZOA 2A49A 2WGIA 5CHJA 3VP4A 4Y0TA 4KZ7A 4OOMA 5TGFA 1IELA 4WM9A 2WGVA 4WZ5A 4XUXA 1QMEA 4JF6A 2ZM2A 2ZQDA 5IHVA 4DXBA 4OPZA 3VMAA 2EFUA 3M6HA 4Y0OA 1AXBA 5FI2A 5CTMA 1ERQA 3W4OA 2Q9NA 4QJGA 3ZNTA 1HZOA 1ONHA 3PBTA 5FSRA 3SH9A 2B5RA 1ES5A 1MWRA 4DF6A 4F94A 5CHMA 1E3UD 5HL1A 1BUEA 3CG5A 5EOOA 4BD0A 1PWGA 1FQGA 4WZ4A 5DTSA 5HAQA 1KVLA 4WBGA 4YFMA 4GB7A 1CI9A 3G32A 5KZHA 3NCKA 2WAFA 4N92A 1K56D 4KZAA 1JTDA 4LCMA 2Y2JA 1ES4A 1GA0A 2Z2MB 3FKWA 4KZ4A 1ERMA 2OV5A 1MWTA 2CC1A 3BM6A 4OP8A 3BFEA 5CGSA 1GCEA 2Y2HA 3ZDJA 4D2OA 1W8YA 2P74A 4KZ8A 1E25A 1I5QA 2XEPA 1MPLA 2PU4A 4OVDA 1W7FA 4BD1A 4X68A 3LO7A 1EI5A 4GN2A 3IT9A 1U60A 3DTMA 4RYEA 3TG9A 3SS3A 3WS2A 1L0EA 2JC7A 4FH2A 2H0TA 3HVFA 1I2WA 4NETA 4QHCA 4KQRA 4Q8IA 1NJ4A 2ZQAA 4IBXA 5CERA 3VFFA 1EWZA 3MFDA 4Z9QA 4K0WA 3WS5A 3GR2A 4N9KA 1NYMA 4R3BA 1PWDA 1BSGA 3C4OA 4E3KA 3ZG9B 3N8RA 5FASA 2ZC5B 2HPBA 4OQHA 5HX9A 1XP4A 2IWDA 1RGYA 3IWIA 2ZM8A 4OPRA 5EPHA 4HESA 3ZG5A 4R1GA 4WZ5C 3A3FA 4JPMA 5FI6A 5FA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLA A;  1I2S A;  1JWP A;  2EX8 A;  1BLC A;  2I72 A;  1LL9 A;  3HBR A;  4KG2 A;  3BEC A;  1BLS A;  1FR6 A;  1XGI A;  5AQA A;  5TR7 A;  1J9M A;  1CEF A;  1KVM A;  1HD8 A;  3OCL A;  5FAO A;  1TVF A;  5FI7 A;  1XPB A;  2HDS A;  3P09 A;  2Z2L B;  2FFY A;  3BFD A;  4PM8 A;  5FAQ A;  3HLE A;  1IYO A;  3AGD A;  2J9P A;  2Y2N A;  4P87 A;  3E2L A;  3G30 A;  5DF7 A;  5CTN A;  1BLP A;  2EFX A;  1K54 C;  5KSC A;  3NI9 A;  1LLB A;  3G4P A;  5DF9 A;  3UDX A;  2ZQ9 A;  1S6R A;  5CXW A;  1LL5 A;  3G34 A;  5GHX A;  3UY6 A;  3HLB A;  4X69 A;  1TDG A;  3O3V A;  2J7V A;  4K0X A;  4GOG A;  5TFQ A;  3PTE A;  4Y0U A;  1XA1 A;  1IKG A;  2Y4A A;  3PAE A;  3QNB A;  3IH8 A;  1NY0 A;  1BZA A;  3RJU A;  1CK3 A;  1K4E A;  3VSK A;  4KZ9 A;  4CPK A;  3Q07 A;  5CHU A;  4GDN A;  3SS4 A;  4BQM A;  4U0T A;  1K6R A;  4WMC D;  5F83 A;  2XF3 A;  1PWC A;  1DY6 A;  2G2U A;  3E2K A;  4DDY A;  3OPL A;  5A90 A;  4EUZ A;  1YQS A;  4JF4 A;  3IWO A;  3UDF A;  2ZC7 A;  4ZJ2 A;  3OCN A;  4LV3 A;  5E2F A;  2HP6 A;  3UNW A;  2XK1 A;  2Y59 A;  3V50 A;  2WKH A;  5FQM A;  2EXA A;  4KZ3 A;  1Z6F A;  2WZZ A;  3A3E A;  1SDE A;  3HLD A;  3O86 A;  5CED A;  2V20 A;  4LCL A;  2R9X A;  3MXS A;  1ZKJ A;  1HVB A;  1W5D A;  4BL3 A;  1DJA A;  1MWS A;  3IHB A;  4Y7P A;  3WS1 A;  4QB8 A;  1H8Z A;  3ISG A;  5GL9 A;  5EEC A;  1YMS A;  4QU3 A;  3EQU A;  4ZJ1 A;  1PW8 A;  1Q2Q A;  2ZJ9 A;  4S2P A;  2BLS A;  3AGF A;  4GNU A;  1K25 A;  4OPY A;  5U47 A;  4DE2 A;  2V1Z A;  1JWV A;  1SDN A;  2HDU A;  3UO9 A;  1PW1 A;  4S2N A;  1N4O A;  2HP5 A;  3PBR A;  3OPP A;  3VP0 A;  2J9O A;  3IF6 B;  3FZC A;  5FQI A;  2JE5 A;  3S22 A;  3V39 A;  5EVI D;  3DWZ A;  1XKZ A;  5F1F A;  1PYY A;  3PBQ A;  4OKP A;  1K54 A;  2EXB A;  3FWL A;  1YLP A;  3ZHH A;  4DXC A;  2Y2L A;  4OQG A;  1K56 A;  2ZMA A;  1RCJ A;  5F82 A;  1YLT A;  4P0M A;  4X55 A;  1K6S A;  4X53 A;  3DWK A;  3IXG A;  1L0G A;  3QNC A;  4RX3 A;  1CI8 A;  3BFC A;  2BG1 A;  3S4X A;  3S1Y A;  2WK0 A;  4EBN A;  4UA7 A;  4R23 A;  4OQI A;  5JYO A;  1MXO A;  2Y2K A;  3A3D A;  3O87 A;  3V5M A;  1FCN A;  3IXD A;  4KZ5 A;  2HDR A;  3GVB A;  3AGE A;  2H0Y A;  3IH9 A;  4GDB A;  5EOE A;  5CEC A;  2XH9 A;  1G6A A;  1K4F A;  1YT4 A;  4EQI A;  3FYZ A;  5GLC A;  2PBY A;  3ZFZ A;  4ID4 A;  2P9V B;  2WGW B;  2XFT A;  4C75 A;  1HTZ A;  3SH8 A;  4WEK A;  2WUQ A;  1ZC2 A;  4GKU A;  1L0F A;  2G2W A;  4N1X A;  2HDQ A;  4S2M A;  4B4X A;  5FQ9 A;  3G31 A;  1YM1 A;  2C6W B;  3HRE A;  1LI9 A;  3RXX A;  2WAE A;  5E2H A;  4PMA A;  4X6T A;  3UE0 A;  1K55 C;  4MEZ A;  4XUZ A;  4MBK A;  4MLL A;  4E6X A;  4YIN A;  1GHP A;  4IVK A;  1NXY A;  2EX9 A;  1BTL A;  4GD6 A;  4DE0 A;  2C5W B;  4LEN A;  5J8X A;  1XGJ A;  3VSL A;  3BFG A;  3OPH A;  5A91 A;  4R0Q A;  1DJB A;  2QZ6 A;  4P6B A;  3WS0 A;  2OLU A;  4S2N C;  4XXR A;  1IYQ A;  1QMF A;  1SKF A;  2Y2O A;  3C7U A;  1E4D A;  3RXW A;  1L2S A;  4N1H A;  1IKI A;  3HUM A;  3MZD A;  5FQJ A;  3GQZ A;  4K91 A;  1SHV A;  1KDW A;  1PI4 A;  3PAG A;  5HW3 A;  5M18 A;  4M3K A;  4WYY A;  2XGN A;  5EVL A;  4FSF A;  4E3J A;  2VGJ A;  5DTT A;  4H8R A;  3ZVW A;  5M1A A;  4GZB A;  2Y91 A;  1ES3 A;  5F1G A;  4R4R A;  4E3N A;  4PM9 A;  4C3Q A;  2IWC A;  3CMZ A;  1YLY A;  4E3I A;  1Q2P A;  3NC8 A;  4RVA A;  1NZU A;  3UDI A;  3ZG0 A;  3A3I A;  1VM1 A;  4JXS A;  4UAA A;  1KGG A;  4QY6 A;  1ESU A;  1BT5 A;  4BLM A;  3NIA A;  3TSG A;  4WMC A;  1M40 A;  1GHM A;  5HAI A;  3V3S A;  2XLN A;  4S2O A;  4OON A;  1PZO A;  3IWQ A;  4OLG A;  4UA6 A;  3HL9 A;  3VFH A;  4DRT A;  3C7V A;  4S2J A;  5GHY A;  1FOF A;  3UPN A;  1DJC A;  3SOI A;  3CJM A;  2XR0 A;  5HAR A;  5FQQ A;  1LHY A;  1K38 A;  3PBS A;  4JF5 A;  4OPQ A;  4WEJ A;  5FAP A;  5CEB A;  4L0L A;  3WRT A;  4KZ6 A;  4HEF A;  3N4I A;  4UA9 A;  2Y55 A;  2J8Y A;  1WE4 A;  4IED A;  5FQK A;  4LV1 A;  1GHI A;  5FDH A;  4O7D A;  3IF6 A;  4E6W A;  4QY5 A;  4IVI A;  1K55 A;  2Y2Q A;  4EBL A;  4EWF A;  5FAT A;  2QPN A;  3LEZ A;  4EBP A;  5KMW A;  3M6B A;  4P85 A;  3W8K A;  3MKF A;  4E3L A;  1C3B A;  2Q9M A;  4KQO A;  1TEM A;  3GSG A;  1KGE A;  1PIO A;  2UWX A;  2XD5 A;  1XX2 A;  4DKI A;  2JBF A;  4X56 A;  4B4Z A;  1XA7 A;  3GV9 A;  5L2F A;  3OZH A;  1IYP A;  3JYI A;  2H10 A;  4FCF A;  4S2L A;  3ZG7 B;  2DRW A;  2OLV A;  1FR1 A;  2ZC3 B;  3Q7V B;  4OLD A;  1E3U A;  4GD8 A;  1H8Y A;  2RL3 A;  3UPO A;  1NYY A;  1KGF A;  1KE0 A;  2WKI A;  4KG6 A;  5EVI A;  3MBZ A;  3ZNY A;  4B88 A;  1LI0 A;  1K57 A;  2EX6 A;  3C4P A;  5DTK A;  4HBU A;  3GMW A;  4U0X A;  4RA7 A;  3BLM A;  1MY8 A;  3G2Z A;  4PM7 A;  3EQV A;  2XFS A;  4U3T A;  3WWX A;  5AQB A;  3HLW A;  1RGZ A;  3BLS A;  3GRJ A;  3HLC A;  4MBF A;  5M19 A;  4QD4 A;  2P9V A;  2WGW A;  1BUL A;  2PU2 A;  3LY3 A;  3G2Y A;  5AQ9 A;  2WYX A;  1H5X A;  5E2G A;  3NDE A;  1MBL A;  1M6K A;  2OSU A;  3HUN A;  3FKV A;  4JBF A;  1JVJ A;  5EVI B;  5HFO A;  2VGK A;  3VP2 A;  1SCW A;  3D4F A;  4LV2 A;  3OPR A;  1O7E A;  3NY4 A;  1FSY A;  5GLB A;  2ZQC A;  3OC2 A;  3IF5 A;  2DCF A;  3IHA A;  3A3J A;  1KE4 A;  5JYP A;  4OOL A;  5GLD A;  3Q1F A;  1FCO A;  3HLG A;  3VP1 A;  3VOZ A;  2EX2 A;  2ZQ7 A;  3ITA A;  3MZE A;  4JLF A;  2HP9 A;  3UPP A;  1NRF A;  5A93 A;  3W4P A;  3W4Q A;  4ZDX A;  1MWU A;  1ALQ A;  5KSH A;  4JKT A;  4ZJ3 A;  2RCX A;  3IF6 C;  3N7W A;  3BEB A;  4OP5 A;  5EUA A;  4C6Y A;  1GA9 A;  4BEN A;  1JWZ A;  3BRM A;  4MNR A;  1JTG A;  1YMX A;  3UE1 A;  3ZG8 B;  4S2K A;  3BFF A;  3Q7Z A;  5BOH A;  3M2K A;  3O88 A;  1BLH A;  5E2E A;  4A5R A;  3I7J A;  2QMI A;  5GHZ A;  4FD8 A;  5E43 A;  4S2I A;  3VP3 A;  4NK3 A;  1S0W A;  4HBT A;  4ZTK A;  1PI5 A;  4N9L A;  3WS4 A;  1IYS A;  2H5S A;  3M2J A;  4KEN B;  5EVI C;  1YLJ A;  5AQ7 A;  4DE3 A;  3MZF A;  1K57 C;  4FH4 A;  2V2F F;  4PM6 A;  5G18 A;  1CEG A;  2Y2M A;  2XQZ A;  4E3M A;  1TDL A;  5CGX A;  1YLW A;  3HUO A;  3Q81 A;  4EV4 A;  3QHY A;  2JCH A;  3SS5 A;  1ERO A;  1YLZ A;  3CZD A;  3IXH A;  4JXG A;  2X02 A;  3GTC A;  3N8L A;  2XD1 A;  2XDM A;  2X71 A;  3N8S A;  3PBO A;  3IQA A;  3ZVT A;  3ZCZ A;  1WYC A;  5A92 A;  1L0D A;  2ZC4 B;  3TOI A;  4KZB A;  5I94 A;  2DNS A;  4BL2 A;  4WEL A;  2ZM0 A;  5CGW A;  3PBN A;  3C5A A;  4BJP A;  1ES2 A;  3LY4 A;  2FFF B;  3ZGA B;  1W79 A;  1MKI A;  1KE3 A;  4R4S A;  2R9W A;  2IWB A;  4JXW A;  1KDS A;  3VOY A;  3B3X A;  3DW0 A;  2ZQ8 A;  3IXB A;  3WRZ A;  3NBL A;  3UN7 A;  1W8Q A;  1FSW A;  2ZD8 A;  2WKE A;  5CRF A;  4IBR A;  2E8I A;  3FV7 A;  3HLF A;  4KQQ A;  4MBH A;  3LCE A;  4ZBE A;  4DE1 A;  5D3O A;  4PPR A;  3V3R A;  1IEM A;  1Y54 A;  3ITB A;  2Y2I A;  2GDN A;  3N6I A;  4OH0 A;  4E3O A;  4UHU A;  4PM5 A;  2ZLY A;  1PZP A;  1ZG6 A;  3SH7 A;  3Q7V A;  3G35 A;  2WZX A;  1WYB A;  4OQ0 A;  3NDG A;  5DF8 A;  2ZC6 B;  4JXV A;  1FCM A;  3UE3 A;  4LV0 A;  1G68 A;  2Y2P A;  5DVA A;  1XXM A;  1ESI A;  3MKE A;  1N9B A;  3Q82 A;  1O07 A;  1ZG4 A;  1ONG A;  4OOY A;  5EE8 A;  1VQQ A;  4DDS A;  2Y2G A;  4CJN A;  4RX2 A;  5HAP A;  1OME A;  4R3J A;  4ZAM A;  4KG5 A;  2WAD A;  3BYD A;  3MXR A;  1RP5 A;  3P98 A;  2X01 A;  2A3U A;  1NZO A;  2A49 A;  2WGI A;  5CHJ A;  3VP4 A;  4Y0T A;  4KZ7 A;  4OOM A;  5TGF A;  1IEL A;  4WM9 A;  2WGV A;  4WZ5 A;  4XUX A;  1QME A;  4JF6 A;  2ZM2 A;  2ZQD A;  5IHV A;  4DXB A;  4OPZ A;  3VMA A;  2EFU A;  3M6H A;  4Y0O A;  1AXB A;  5FI2 A;  5CTM A;  1ERQ A;  3W4O A;  2Q9N A;  4QJG A;  3ZNT A;  1HZO A;  1ONH A;  3PBT A;  5FSR A;  3SH9 A;  2B5R A;  1ES5 A;  1MWR A;  4DF6 A;  4F94 A;  5CHM A;  1E3U D;  5HL1 A;  1BUE A;  3CG5 A;  5EOO A;  4BD0 A;  1PWG A;  1FQG A;  4WZ4 A;  5DTS A;  5HAQ A;  1KVL A;  4WBG A;  4YFM A;  4GB7 A;  1CI9 A;  3G32 A;  5KZH A;  3NCK A;  2WAF A;  4N92 A;  1K56 D;  4KZA A;  1JTD A;  4LCM A;  2Y2J A;  1ES4 A;  1GA0 A;  2Z2M B;  3FKW A;  4KZ4 A;  1ERM A;  2OV5 A;  1MWT A;  2CC1 A;  3BM6 A;  4OP8 A;  3BFE A;  5CGS A;  1GCE A;  2Y2H A;  3ZDJ A;  4D2O A;  1W8Y A;  2P74 A;  4KZ8 A;  1E25 A;  1I5Q A;  2XEP A;  1MPL A;  2PU4 A;  4OVD A;  1W7F A;  4BD1 A;  4X68 A;  3LO7 A;  1EI5 A;  4GN2 A;  3IT9 A;  1U60 A;  3DTM A;  4RYE A;  3TG9 A;  3SS3 A;  3WS2 A;  1L0E A;  2JC7 A;  4FH2 A;  2H0T A;  3HVF A;  1I2W A;  4NET A;  4QHC A;  4KQR A;  4Q8I A;  1NJ4 A;  2ZQA A;  4IBX A;  5CER A;  3VFF A;  1EWZ A;  3MFD A;  4Z9Q A;  4K0W A;  3WS5 A;  3GR2 A;  4N9K A;  1NYM A;  4R3B A;  1PWD A;  1BSG A;  3C4O A;  4E3K A;  3ZG9 B;  3N8R A;  5FAS A;  2ZC5 B;  2HPB A;  4OQH A;  5HX9 A;  1XP4 A;  2IWD A;  1RGY A;  3IWI A;  2ZM8 A;  4OPR A;  5EPH A;  4HES A;  3ZG5 A;  4R1G A;  4WZ5 C;  3A3F A;  4JPM A;  5FI6 A;  5FA7 A; 
#chains in the Genus database with same CATH topology
 5EVE A;  1JWP A;  2EX8 A;  3HBR A;  3B42 A;  3KSG A;  1XGI A;  1KVM A;  1TVF A;  3P09 A;  1IYO A;  2Y2N A;  4II7 A;  3E4O A;  4LRX C;  5CTN A;  1F2K A;  3F1N B;  3H9W A;  2W27 A;  1XJ2 A;  2PD8 A;  3KYE A;  2NUP C;  3UY6 A;  3HLB A;  3BQ8 A;  4X69 A;  1TDG A;  3O3V A;  4UQI S;  3PTE A;  1IKG A;  2OAP 1;  2EWV A;  3QNB A;  3IH8 A;  3MXQ A;  3RJU A;  3VSK A;  4CPK A;  4EUV A;  1K6R A;  4WMC D;  5F83 A;  4EQ1 A;  3T4L A;  3IX3 A;  5F5Y A;  4JF4 A;  4WUJ A;  1G6O A;  4YOF A;  1MZU A;  2KDK A;  5E2F A;  2HP6 A;  2JKT I;  4KZ3 A;  2WZZ A;  3KSI A;  4MMN A;  3O86 A;  1OTA A;  3NHQ A;  4LCL A;  5CED A;  2KOI A;  1ODV A;  4BL3 A;  1HVB A;  3F1O A;  2JKT M;  1LSX A;  1PW8 A;  4OPY A;  1K25 A;  4DE2 A;  1JWV A;  1PW1 A;  1N4O A;  3PBR A;  3OPP A;  3S22 A;  4BMW A;  1YLP A;  4DXC A;  1K56 A;  1K6S A;  4X53 A;  3DWK A;  2W3H A;  3IXG A;  3QNC A;  2HGV A;  2VV6 A;  3UMD A;  2BG1 A;  3QP8 A;  5G4Y A;  3IXD A;  1G28 A;  5EOE A;  1N9L A;  2XH9 A;  1K4F A;  4PKY G;  4EQI A;  5HWT A;  2WGW B;  4IJG A;  2XFT A;  4WEK A;  1YM1 A;  2WAE A;  4HJ4 A;  4PMA A;  3NUL A;  4YIN A;  5EFW A;  5KIZ A;  2ACG A;  4DE0 A;  1P0Z A;  3DTK A;  4P6B A;  2OLU A;  3C7U A;  4N1H A;  4Z1W A;  3VE4 A;  5HW3 A;  1PI4 A;  3PAG A;  2PYR A;  2VGJ A;  3G6O A;  1PFL A;  1NWZ A;  4GZB A;  5M1A A;  2HJ9 C;  4PM9 A;  2J3T D;  1YLY A;  2JN7 A;  2A24 A;  4XT2 A;  4RVA A;  1NZU A;  3A3I A;  4JXS A;  4UAA A;  1T1B A;  4QY6 A;  1BT5 A;  3NIA A;  3TSG A;  4WMC A;  3LFV A;  2YKF A;  4HIA A;  4DRT A;  3C7V A;  4S2J A;  1P9W A;  4NEE D;  4M4X A;  1DJC A;  3CJM A;  4XT2 B;  5HAR A;  5FQQ A;  4WEJ A;  3PBS A;  3VV4 A;  5CEB A;  2PBD P;  3WRT A;  4ESP A;  3N4I A;  2Y55 A;  1WE4 A;  4IED A;  3HJK A;  5L10 A;  1UGU A;  4Q0I A;  5FDH A;  4E6W A;  4WLA A;  4QY5 A;  3M6B A;  4P85 A;  3MKF A;  1XX2 A;  3PXP A;  4DKI A;  4HHD A;  3LID A;  4G3W A;  3T50 A;  4FCF A;  2OLV A;  2EWW A;  1KGF A;  2WKI A;  1K57 A;  3C4P A;  4RA7 A;  3BLM A;  3EQV A;  3TE8 A;  3WWX A;  5AQB A;  3HLW A;  2O99 A;  5M19 A;  4LGW A;  4QD4 A;  1BUL A;  5AQ9 A;  2G7U A;  1H5X A;  1M6K A;  1JVJ A;  1ZHH B;  2VGK A;  3VP2 A;  4CLC A;  3BJN A;  3B33 A;  3A3J A;  5JYP A;  4OOL A;  3Q1F A;  3VP1 A;  2LB9 A;  3MZE A;  2FH5 A;  3ITA A;  4JLF A;  5A93 A;  4ARZ B;  1MWU A;  1ALQ A;  5KSH A;  4Q0H A;  4ZJ3 A;  1A0K A;  2RCX A;  4C6Y A;  3UE1 A;  4S2K A;  2OWJ A;  4FD8 A;  4NK3 A;  3KSF A;  2V2F F;  1CEG A;  2Y2M A;  4E3M A;  5CGX A;  4EV4 A;  2ZMV A;  3QHY A;  3PBO A;  1WYC A;  2M7U A;  4KZB A;  5I94 A;  3BY8 A;  5I5L A;  3UB9 A;  3PBN A;  1UWP X;  1SZV A;  1MKI A;  4R4S A;  4JXW A;  3H82 B;  3D9Y A;  4MCW A;  3WRZ A;  5IS1 A;  3K3C A;  4KQQ A;  1FIK A;  4PPR A;  4JGP A;  3ITB A;  4Y15 A;  4OH0 A;  4E3O A;  2ZLY A;  1WYB A;  3KSH A;  4X1M A;  3EGD C;  3S7P A;  4DN0 A;  4DDS A;  2Z6C A;  3TJZ C;  4MN6 A;  2A49 A;  2VJW A;  4O0P A;  4WZ5 A;  2ZM2 A;  4OPZ A;  5FI2 A;  2PDR A;  3W4O A;  3ZNT A;  1HZO A;  3SW1 A;  1MWR A;  1Y4O A;  2V1A A;  1CI9 A;  5KZH A;  3NCK A;  4KZA A;  4I38 A;  4F3L A;  1IOU A;  3DAV A;  1GCE A;  3C8C A;  4D2O A;  1I5Q A;  2PU4 A;  4OVD A;  3LO7 A;  4WF0 A;  3SS3 A;  3UB6 A;  3WS2 A;  4Q8I A;  3HVF A;  1I2W A;  4I5S A;  3JVV A;  4F3L B;  4EER A;  3WS5 A;  5DJT A;  3LR4 A;  3E4P A;  2NUT C;  4E3K A;  3ZG9 B;  2HPB A;  4OQH A;  5HX9 A;  1XP4 A;  3QP5 A;  3A3F A;  4JPM A;  4HNB A;  5FA7 A;  1XFQ A;  3IBR A;  4L9F A;  1LL9 A;  2W1T B;  3BEC A;  2Z6D A;  4Y17 A;  1J9M A;  3T4S A;  3OCL A;  5FAO A;  5FAQ A;  3AGD A;  2J9P A;  3NEC A;  1FIL A;  5DF7 A;  1VEU A;  1BLP A;  4GS9 A;  2XA7 M;  1LLB A;  2QYB A;  3UDX A;  3V67 A;  2VLG A;  1LL5 A;  2J7V A;  1XA1 A;  2Y4A A;  3PAE A;  1CK3 A;  1OT9 A;  3Q07 A;  4BQM A;  2M7V A;  1DY6 A;  2YKH A;  4EUZ A;  4GHI A;  1YQS A;  1OTE A;  4KUK A;  1DRM A;  3UDF A;  2ZC7 A;  3UNW A;  1W63 M;  5FQM A;  5AVF A;  4HI4 A;  3LI8 A;  3RH8 B;  3UE6 A;  3UB5 P;  1DJA A;  2J3T C;  3IHB A;  4GHI B;  3WS1 A;  1H8Z A;  3ISG A;  5GL9 A;  5EEC A;  2XA7 S;  4QU3 A;  4BBT A;  5U47 A;  2V1Z A;  1SDN A;  1V9Z A;  1G5U A;  3UO9 A;  3MQ0 A;  2PT7 A;  3IF6 B;  5L8M A;  1K54 A;  3FWL A;  3ZHH A;  4Y5F A;  2Y2L A;  4OQG A;  1RCJ A;  3OBF A;  4P0M A;  4X55 A;  1L0G A;  4RX3 A;  3A0S A;  3S1Y A;  4EBN A;  3CWF A;  4OQI A;  2ZL1 A;  2Y2K A;  3A3D A;  5TBM B;  5F69 A;  2HDR A;  5G4Z A;  1T1A A;  1G6A A;  4B9O A;  5GLC A;  3R4K A;  4ID4 A;  2P9V B;  4C75 A;  3T1R A;  3SH8 A;  1L0F A;  4S2M A;  5FQ9 A;  4ME4 A;  3HRE A;  1LI9 A;  2I9V A;  3OOV A;  5HD5 A;  3UE0 A;  1K55 C;  4MBK A;  4MLL A;  3F1N A;  3UME A;  2EX9 A;  3CPT A;  2C5W B;  5J8X A;  2L1M A;  3VSL A;  3BFG A;  4WL9 A;  3OPH A;  3P7N A;  2QZ6 A;  1OTI A;  3WS0 A;  4XXR A;  1IYQ A;  4PAU A;  5HD3 A;  1E4D A;  5HSQ A;  1IKI A;  3HUM A;  4E3J A;  1STZ A;  1OTD A;  3CPT B;  2Y91 A;  1ES3 A;  4WN5 A;  1W63 Q;  4R4R A;  4E3N A;  4C3Q A;  5LBR A;  2IWC A;  3CMZ A;  4E3I A;  1Q2P A;  1VB6 A;  4KQD A;  3HCY A;  3UDI A;  2K31 A;  4Q0J A;  5HDD A;  4S2O A;  2V1B A;  1FOF A;  3RFB A;  1NRJ A;  2XR0 A;  2P7J A;  2J8Y A;  3LIA A;  5FQK A;  4CQH A;  4O7D A;  3OLO A;  4I3A A;  3VE3 A;  3LEZ A;  4EBP A;  5KMW A;  3T1S A;  2INW A;  1C3B A;  3CUE C;  2WKP A;  1TEM A;  2ZOI A;  3GSG A;  1KGE A;  2UWX A;  3T1Q B;  4FOF A;  2JBF A;  4P6Z M;  5HPI A;  5L09 A;  1IYP A;  4S2L A;  3ZG7 B;  1WA9 A;  1E3U A;  4GD8 A;  1H8Y A;  5F6A A;  1S1Z A;  1NYY A;  5DTK A;  3GMW A;  2L0W A;  2VGL M;  3G2Z A;  2XFS A;  5FL3 A;  4U3T A;  1OTB A;  2B18 A;  5DFX A;  3F1P B;  3QP1 A;  2WGW A;  2PU2 A;  3LY3 A;  3G2Y A;  2D01 A;  3L7H A;  2WYX A;  4LFU A;  5E2G A;  1OJG A;  4IUH A;  3FKV A;  5DKK A;  2W0N A;  1SCW A;  3OPR A;  1Y28 A;  3NY4 A;  3OC2 A;  3IF5 A;  3IHA A;  3JVU A;  3VOZ A;  4RQ9 A;  2D02 A;  3CI6 A;  4JKT A;  3IF6 C;  3O5Y A;  3BEB A;  4PHT A;  3CHW P;  2PHY A;  3BRM A;  2PR6 A;  1JTG A;  1YMX A;  1AWI A;  2P08 A;  2PD7 A;  3NOP C;  3Q7Z A;  5BOH A;  3M2K A;  3O88 A;  1BLH A;  1IFQ A;  4A5R A;  3D3O A;  2QMI A;  5GHZ A;  4S2I A;  1S0W A;  1F98 A;  4G3V A;  3WS4 A;  1IYS A;  4DE3 A;  1YLW A;  3HUO A;  3CZD A;  3N8L A;  2X71 A;  3N8S A;  2Y79 A;  1EW0 A;  1DP9 A;  4Y2F A;  4HH2 A;  4BL2 A;  4WEL A;  2ZM0 A;  3TW8 A;  1ES2 A;  3MMH A;  2E8J A;  2FFF B;  1W79 A;  1KE3 A;  2R9W A;  3VOY A;  1KDS A;  2FZ0 A;  3DW0 A;  3NBL A;  3UN7 A;  4IBR A;  4ZBE A;  4KUO A;  2Y2I A;  2GDN A;  1F9I A;  4PM5 A;  2M1C A;  4LRZ E;  5MC7 A;  1H3Q A;  2WZX A;  3LR3 A;  4OQ0 A;  1CF0 A;  2ZC6 B;  1FCM A;  3IS2 A;  3UE3 A;  4LV0 A;  5DVA A;  5AVE A;  5HL6 A;  1ONG A;  4OOY A;  4L9G A;  2XRN A;  2OWH A;  1NZO A;  3VP4 A;  5CHJ A;  3IS2 B;  5TGF A;  1IEL A;  4AFI A;  2WGV A;  4YNR A;  2BAS A;  1QME A;  2J80 A;  2UV0 E;  4PKY A;  4K08 A;  3LR5 A;  2EFU A;  4QPR A;  1ERQ A;  4ARZ A;  4F94 A;  2PRF A;  1XJ4 A;  3CG5 A;  5EOO A;  3LUQ A;  4WZ4 A;  5DTS A;  1KVL A;  4YFM A;  3G32 A;  2WAF A;  1ES4 A;  4KZ4 A;  1MWT A;  2CC1 A;  3UB7 A;  4OP8 A;  2W3E A;  5CGS A;  4NG2 A;  1JNU A;  2Y2H A;  1W8Y A;  4KZ8 A;  2XEP A;  1MPL A;  3PHY A;  4GN2 A;  3DTM A;  3TG9 A;  1L0E A;  4FH2 A;  4FTX A;  5CER A;  4IBX A;  3MFD A;  4N9K A;  3HJI A;  4H6J A;  4X25 A;  3N8R A;  2QJ5 A;  1D7E A;  1RGY A;  2ZM8 A;  5EPH A;  4HES A;  2VV7 A;  4HP4 A;  4R1G A;  5GLA A;  4MN7 A;  3H82 A;  2I72 A;  4KG2 A;  4D60 A;  1BLS A;  1CEF A;  2JKG A;  4H6J B;  1HD8 A;  1XPB A;  2Z2L B;  3HLE A;  1DP8 A;  3P01 A;  3G30 A;  4I3I A;  2EFX A;  5KSC A;  3NI9 A;  3G4P A;  2ZQ9 A;  1S6R A;  5CXW A;  3G34 A;  5IT5 A;  5GHX A;  4K0X A;  4GOG A;  5TFQ A;  4Y0U A;  3PR6 A;  3FG8 A;  1BZA A;  3ZQ5 A;  2QKP A;  4EES A;  4KZ9 A;  2GX5 A;  4GDN A;  3DTI A;  4U0T A;  2G2U A;  3OPL A;  2K2N A;  4FUW A;  3IWO A;  4ZJ2 A;  3ZYT A;  3V50 A;  2EXA A;  1Z6F A;  4HY8 A;  3BW6 A;  3A3E A;  1SDE A;  5J4E A;  3MXS A;  1ZKJ A;  1MWS A;  4QB8 A;  5L07 A;  3QP2 A;  1YMS A;  3EQU A;  2ZJ9 A;  2BLS A;  4GNU A;  4BBU A;  3LIB A;  3EEA A;  2QHK A;  3VP0 A;  3FZC A;  2JE5 A;  1MKM A;  3DWZ A;  1XKZ A;  1S4R A;  2EXB A;  1GSW A;  2ZOH A;  2V0W A;  5F82 A;  4EU0 A;  1YLT A;  1TS8 A;  3R7W A;  4HH3 A;  4R23 A;  3V5M A;  3TRC A;  2O9A A;  4KZ5 A;  1K0K A;  3LIC A;  3IH9 A;  4GDB A;  3CAX A;  5CEC A;  1YT4 A;  1GSV A;  3FYZ A;  3K3D A;  3ZFZ A;  2W1T A;  3R7W B;  2WUQ A;  1ZC2 A;  4B4X A;  2G2W A;  4N1X A;  2C6W B;  4I3J A;  5E2H A;  3D72 A;  4MEZ A;  4R70 A;  3B47 A;  4GD6 A;  1XGJ A;  3MFX A;  5A91 A;  4R0Q A;  1H0M A;  3T4O A;  4HOI A;  4S2N C;  3LIF A;  4BWI A;  1QMF A;  1SKF A;  2Y2O A;  2P04 A;  4K91 A;  1SHV A;  5AJG A;  5M18 A;  5EVL A;  4FSF A;  4H8R A;  5F1G A;  5HDS A;  5DKL A;  2V0U A;  1XFN A;  3MSH A;  5EV0 A;  3ZG0 A;  1VM1 A;  2HF6 A;  1ESU A;  1M40 A;  3E98 A;  4CLC C;  4O8G A;  2XLN A;  3IWQ A;  3VFH A;  3HL9 A;  3UPN A;  4MN5 A;  3A0R A;  2W3D A;  4JF5 A;  5FAP A;  4L0L A;  2L4R A;  4HEF A;  3L9K A;  3IF6 A;  4IVI A;  2Y2Q A;  3LEQ A;  5FAT A;  2QPN A;  4HJ6 A;  3W8K A;  4E3L A;  4KQO A;  1T19 A;  1J3W A;  2W3G A;  2XD5 A;  3U2A A;  4HJ3 A;  1TD5 A;  4X56 A;  3S7Q A;  4B4Z A;  1XA7 A;  3GV9 A;  5L2F A;  3OZH A;  4ETZ A;  3JYI A;  2H10 A;  5HWV A;  3Q7V B;  4OLD A;  3UPO A;  4B88 A;  1KE0 A;  3MBZ A;  5TBM A;  4HBU A;  1S1Y A;  1MY8 A;  4PM7 A;  2ZBB A;  1RGZ A;  3BLS A;  3HLC A;  4YWZ A;  2P9V A;  3E0Y A;  3NDE A;  3JPU A;  3ULF A;  2XRO A;  4LLO B;  3HUN A;  4JBF A;  5HFO A;  3D4F A;  5EM0 A;  3KYZ A;  2ZQC A;  2DCF A;  2GNX A;  3NJA A;  2GZA A;  5GLD A;  3HLG A;  1OPX A;  2EX2 A;  2HP9 A;  3W4P A;  2Y8H A;  4ZDX A;  4LRY C;  3N7W A;  1S66 L;  4OP5 A;  5EUA A;  3T4Q A;  1BYW A;  1HLU P;  3MF0 A;  1S67 L;  4UQI M;  2QJ7 A;  5E2E A;  3I7J A;  1LL8 A;  5E43 A;  4R3A A;  5HDC A;  1PNE A;  4HBT A;  2CMN A;  4ZTK A;  1KOU A;  3A0V A;  4N9L A;  3UB8 A;  3IX8 A;  2KX6 A;  5EVI C;  1YLJ A;  2K7S A;  3MZF A;  2VZW A;  4PM6 A;  3VOL A;  2XQZ A;  3Q81 A;  4E04 A;  3C38 A;  1ERO A;  1YLZ A;  3IXH A;  4JXG A;  2BTF P;  1VET B;  2VK3 A;  2X02 A;  4G3K A;  3S7O A;  3ZVT A;  3IQA A;  3ZCZ A;  2V9A A;  2ZC4 B;  3TOI A;  2JKR I;  1DP6 A;  3H7W A;  3C5A A;  4EEP A;  4EEU A;  2JKR M;  3B3X A;  2QWS A;  4JGQ A;  1W8Q A;  2ZD8 A;  5CRF A;  3HLF A;  5F68 A;  3T12 B;  3MJQ A;  1IEM A;  3FC7 A;  3C30 A;  1Y54 A;  3V3R A;  2VEA A;  3H7W B;  4UHU A;  1ZG6 A;  3G35 A;  2W1R A;  4NXB A;  4JXV A;  3Q82 A;  5EE8 A;  3F1P A;  4RX2 A;  1OME A;  2Q0O A;  3FPV A;  4KG5 A;  2WAD A;  3MXR A;  1RP5 A;  2H28 A;  2X01 A;  2A3U A;  4GW9 A;  2WGI A;  4KZ7 A;  4OOM A;  4WM9 A;  4R6L A;  4JF6 A;  5C5K A;  5IHV A;  4DXB A;  3VMA A;  3M6H A;  2Q9N A;  4QJG A;  3PBT A;  5FSR A;  3SH9 A;  2B5R A;  1ES5 A;  4DF6 A;  2VX8 A;  4BD0 A;  2WKQ A;  1FQG A;  5HAQ A;  3F1O B;  4GB7 A;  5FEF A;  2J3W A;  5IU1 A;  1N9O A;  3NOT C;  1JTD A;  1GA0 A;  3FKW A;  3E4Q A;  3ZDJ A;  2P74 A;  3BQA A;  4P6Z S;  1W7F A;  2W3F A;  4X68 A;  1D06 A;  4CLC D;  3IT9 A;  4RYE A;  5TJJ A;  2JC7 A;  2ZQA A;  5K5B A;  3VFF A;  1EWZ A;  1MC0 A;  4NXG A;  4R3B A;  1PWD A;  2VGL S;  3C4O A;  5FAS A;  3IWI A;  4OPR A;  1ACF A;  3ZG5 A;  4NXF A;  1I2S A;  4DJ2 A;  3RTY A;  1BLC A;  2PYP A;  1FR6 A;  5TR7 A;  5AQA A;  3PYP A;  5FI7 A;  2HDS A;  2IA2 A;  4PM8 A;  2FFY A;  3BFD A;  1XJ3 A;  3E2L A;  4P87 A;  5HZH A;  1K54 C;  1CQA A;  2LB5 A;  2OAQ 1;  5DF9 A;  1TS6 A;  2AVX A;  1P97 A;  1NY0 A;  1K4E A;  5CHU A;  3SS4 A;  5CX7 A;  2XF3 A;  1PWC A;  3E2K A;  4DDY A;  5A90 A;  1VHM A;  2A24 B;  3OCN A;  4LV3 A;  4B93 A;  2XK1 A;  2Y59 A;  2WKH A;  3HLD A;  2V20 A;  2R9X A;  1W5D A;  4Y7P A;  1ZTU A;  1YPR A;  4ZJ1 A;  4IHQ A;  1Q2Q A;  4S2P A;  3AGF A;  1PRQ A;  3LR0 A;  2HDU A;  2O0Y A;  4X1L A;  4S2N A;  2HP5 A;  2J9O A;  5FQI A;  3V39 A;  4EW7 A;  5EVI D;  2KLI A;  5F1F A;  1PYY A;  3PBQ A;  4OKP A;  2ZMA A;  5DJU A;  1CI8 A;  3BFC A;  4O01 A;  3S4X A;  2PR5 A;  2WK0 A;  4UA7 A;  5JYO A;  1MXO A;  3O87 A;  1FCN A;  3GVB A;  3AGE A;  2H0Y A;  4GCZ A;  4EXO A;  4HP9 A;  2PBY A;  4QWO A;  4DMZ A;  1HTZ A;  4GKU A;  2HDQ A;  3G31 A;  2JKF A;  1D1J A;  3MQO A;  3RXX A;  4X6T A;  4XUZ A;  4ZRR A;  4CLC B;  4E6X A;  1P9R A;  3QP6 A;  4ETX A;  1GHP A;  4IVK A;  1NXY A;  1BTL A;  4LEN A;  1GSX A;  1XJ6 A;  1OJ5 A;  4Y3I A;  1DJB A;  3RXW A;  1L2S A;  3DTE A;  3MZD A;  5FQJ A;  3GQZ A;  1KDW A;  4M3K A;  4WYY A;  2XGN A;  5DTT A;  3ZVW A;  3NC8 A;  2JHE A;  4MDZ A;  1OT6 A;  1KGG A;  5HWW A;  3QP4 A;  4BLM A;  1GHM A;  3FPW A;  5HAI A;  3V3S A;  1H8M A;  1PZO A;  4OLG A;  4OON A;  4UA6 A;  2HJE A;  2PAV P;  5GHY A;  1LT0 A;  3SOI A;  2WKR A;  3EGX C;  1LHY A;  1K38 A;  1T1C A;  4OPQ A;  1TF1 A;  4KZ6 A;  4UA9 A;  2ZMF A;  2DMW A;  4LV1 A;  3MS6 A;  4Y13 A;  1GHI A;  3IBJ A;  1SKO A;  1K55 A;  4EWF A;  4EBL A;  3T1X A;  2Q9M A;  2VV8 A;  3W2Z A;  1PIO A;  2XSS A;  3U4L P;  1X0O A;  2V8F A;  2DRW A;  2O9C A;  3LYX A;  1FR1 A;  2ZC3 B;  1YKD A;  2RL3 A;  1SKO B;  4KG6 A;  5EVI A;  3ZNY A;  1LI0 A;  2EX6 A;  3C2W A;  4U0X A;  2VA0 A;  4LPZ A;  3GEC A;  3GRJ A;  4MBF A;  2R78 A;  1LSV A;  1MBL A;  2OSU A;  5EVI B;  1NLZ A;  1V9Y A;  1S4S A;  4LV2 A;  1O7E A;  1UWN X;  5J7E A;  1FSY A;  5GLB A;  5FEG A;  4R38 A;  1TS0 A;  1KE4 A;  2B02 A;  1N9N A;  1FCO A;  2HZ5 A;  4I39 A;  2ZQ7 A;  3UPP A;  1NRF A;  3EEH A;  3W4Q A;  3BY9 A;  1GA9 A;  4BEN A;  2O9B A;  1JWZ A;  4MNR A;  3EWK A;  3ZG8 B;  4CLC E;  4IUK A;  3BFF A;  5DFY A;  3T4T A;  4HQA A;  3CUE A;  3VP3 A;  1PI5 A;  3CLO A;  1L3L A;  2VKS A;  2H5S A;  3M2J A;  4KEN B;  4NKP A;  5AQ7 A;  1K57 C;  4FH4 A;  5G18 A;  1TDL A;  5A8B A;  2JCH A;  3SS5 A;  3GTC A;  2XD1 A;  2XDM A;  3LIE A;  5A92 A;  1L0D A;  4GLQ A;  2DNS A;  1CJF A;  5EM1 A;  5CGW A;  4NXE A;  4BJP A;  3LY4 A;  3ZGA B;  1T18 A;  2IWB A;  3CIT A;  3LGO A;  2ZQ8 A;  3IXB A;  1FSW A;  2WKE A;  2E8I A;  3FV7 A;  3GDI A;  4MBH A;  3LCE A;  4DE1 A;  5D3O A;  2GJ3 A;  4EET B;  3N6I A;  5FDS A;  1PZP A;  3SH7 A;  3Q7V A;  1VEU B;  4GS9 B;  5DF8 A;  3NDG A;  1G68 A;  2Y2P A;  3MR0 A;  1XXM A;  3KO6 A;  3KYQ A;  1ESI A;  3MKE A;  1N9B A;  1YSP A;  3SZT A;  1O07 A;  1ZG4 A;  1VQQ A;  2Y2G A;  4CJN A;  5HAP A;  4R3J A;  4ZAM A;  3T4J A;  3BYD A;  3K2N A;  3P98 A;  1TS7 A;  2OOL A;  4Y0T A;  4XUX A;  4JGO A;  3DBA A;  3ICY A;  2ZQD A;  2V8C A;  4Y0O A;  3S7N A;  1AXB A;  5CTM A;  1ONH A;  5J3W A;  1NLY A;  5HPF A;  3MQQ A;  5CHM A;  1E3U D;  5HL1 A;  1BUE A;  1F5M A;  4BBV A;  4JGR A;  1PWG A;  4GJ4 A;  3T4K A;  4WBG A;  1YSQ A;  3EOI A;  4N92 A;  1K56 D;  1LSW A;  4LCM A;  3BWL A;  2Y2J A;  4DJ3 A;  2Z2M B;  2OV5 A;  1ERM A;  2HV1 A;  3BM6 A;  4UEY A;  3BFE A;  2A2L A;  1E25 A;  4L9E A;  2B95 A;  2MJ6 A;  1Z09 A;  4BD1 A;  1EI5 A;  1U60 A;  4NET A;  2H0T A;  3IX4 A;  4QHC A;  1YAX A;  2EA9 A;  4KQR A;  1VET A;  1NJ4 A;  4Z9Q A;  4K0W A;  3GR2 A;  1NYM A;  1BSG A;  3LI9 A;  2ZC5 B;  2ZL1 B;  2IWD A;  3NOU C;  3KX0 X;  4WZ5 C;  5FI6 A; 
#chains in the Genus database with same CATH homology
 5GLA A;  1I2S A;  1JWP A;  2EX8 A;  1BLC A;  2I72 A;  1LL9 A;  3HBR A;  4KG2 A;  3BEC A;  1BLS A;  1FR6 A;  1XGI A;  5AQA A;  5TR7 A;  1J9M A;  1CEF A;  1KVM A;  1HD8 A;  3OCL A;  5FAO A;  1TVF A;  5FI7 A;  1XPB A;  2HDS A;  3P09 A;  2Z2L B;  2FFY A;  3BFD A;  4PM8 A;  5FAQ A;  3HLE A;  1IYO A;  3AGD A;  2J9P A;  2Y2N A;  4P87 A;  3E2L A;  3G30 A;  5DF7 A;  5CTN A;  1BLP A;  2EFX A;  1K54 C;  5KSC A;  3NI9 A;  1LLB A;  3G4P A;  5DF9 A;  3UDX A;  2ZQ9 A;  1S6R A;  5CXW A;  1LL5 A;  3G34 A;  5GHX A;  3UY6 A;  3HLB A;  4X69 A;  1TDG A;  3O3V A;  2J7V A;  4K0X A;  4GOG A;  5TFQ A;  3PTE A;  4Y0U A;  1XA1 A;  1IKG A;  2Y4A A;  3PAE A;  3QNB A;  3IH8 A;  1NY0 A;  1BZA A;  3RJU A;  1CK3 A;  1K4E A;  3VSK A;  4KZ9 A;  4CPK A;  3Q07 A;  5CHU A;  4GDN A;  3SS4 A;  4BQM A;  4U0T A;  1K6R A;  4WMC D;  5F83 A;  2XF3 A;  1PWC A;  1DY6 A;  2G2U A;  3E2K A;  4DDY A;  3OPL A;  5A90 A;  4EUZ A;  1YQS A;  4JF4 A;  3IWO A;  3UDF A;  2ZC7 A;  4ZJ2 A;  3OCN A;  4LV3 A;  5E2F A;  2HP6 A;  3UNW A;  2XK1 A;  2Y59 A;  3V50 A;  2WKH A;  5FQM A;  2EXA A;  4KZ3 A;  1Z6F A;  2WZZ A;  3A3E A;  1SDE A;  3HLD A;  3O86 A;  5CED A;  2V20 A;  4LCL A;  2R9X A;  3MXS A;  1ZKJ A;  1HVB A;  1W5D A;  4BL3 A;  1DJA A;  1MWS A;  3IHB A;  4Y7P A;  3WS1 A;  4QB8 A;  1H8Z A;  3ISG A;  5GL9 A;  5EEC A;  1YMS A;  4QU3 A;  3EQU A;  4ZJ1 A;  1PW8 A;  1Q2Q A;  2ZJ9 A;  4S2P A;  2BLS A;  3AGF A;  4GNU A;  1K25 A;  4OPY A;  5U47 A;  4DE2 A;  2V1Z A;  1JWV A;  1SDN A;  2HDU A;  3UO9 A;  1PW1 A;  4S2N A;  1N4O A;  2HP5 A;  3PBR A;  3OPP A;  3VP0 A;  2J9O A;  3IF6 B;  3FZC A;  5FQI A;  2JE5 A;  3S22 A;  3V39 A;  5EVI D;  3DWZ A;  1XKZ A;  5F1F A;  1PYY A;  3PBQ A;  4OKP A;  1K54 A;  2EXB A;  3FWL A;  1YLP A;  3ZHH A;  4DXC A;  2Y2L A;  4OQG A;  1K56 A;  2ZMA A;  1RCJ A;  5F82 A;  1YLT A;  4P0M A;  4X55 A;  1K6S A;  4X53 A;  3DWK A;  3IXG A;  1L0G A;  3QNC A;  4RX3 A;  1CI8 A;  3BFC A;  2BG1 A;  3S4X A;  3S1Y A;  2WK0 A;  4EBN A;  4UA7 A;  4R23 A;  4OQI A;  5JYO A;  1MXO A;  2Y2K A;  3A3D A;  3O87 A;  3V5M A;  1FCN A;  3IXD A;  4KZ5 A;  2HDR A;  3GVB A;  3AGE A;  2H0Y A;  3IH9 A;  4GDB A;  5EOE A;  5CEC A;  2XH9 A;  1G6A A;  1K4F A;  1YT4 A;  4EQI A;  3FYZ A;  5GLC A;  2PBY A;  3ZFZ A;  4ID4 A;  2P9V B;  2WGW B;  2XFT A;  4C75 A;  1HTZ A;  3SH8 A;  4WEK A;  2WUQ A;  1ZC2 A;  4GKU A;  1L0F A;  2G2W A;  4N1X A;  2HDQ A;  4S2M A;  4B4X A;  5FQ9 A;  3G31 A;  1YM1 A;  2C6W B;  3HRE A;  1LI9 A;  3RXX A;  2WAE A;  5E2H A;  4PMA A;  4X6T A;  3UE0 A;  1K55 C;  4MEZ A;  4XUZ A;  4MBK A;  4MLL A;  4E6X A;  4YIN A;  1GHP A;  4IVK A;  1NXY A;  2EX9 A;  1BTL A;  4GD6 A;  4DE0 A;  2C5W B;  4LEN A;  5J8X A;  1XGJ A;  3VSL A;  3BFG A;  3OPH A;  5A91 A;  4R0Q A;  1DJB A;  2QZ6 A;  4P6B A;  3WS0 A;  2OLU A;  4S2N C;  4XXR A;  1IYQ A;  1QMF A;  1SKF A;  2Y2O A;  3C7U A;  1E4D A;  3RXW A;  1L2S A;  4N1H A;  1IKI A;  3HUM A;  3MZD A;  5FQJ A;  3GQZ A;  4K91 A;  1SHV A;  1KDW A;  1PI4 A;  3PAG A;  5HW3 A;  5M18 A;  4M3K A;  4WYY A;  2XGN A;  5EVL A;  4FSF A;  4E3J A;  2VGJ A;  5DTT A;  4H8R A;  3ZVW A;  5M1A A;  4GZB A;  2Y91 A;  1ES3 A;  5F1G A;  4R4R A;  4E3N A;  4PM9 A;  4C3Q A;  2IWC A;  3CMZ A;  1YLY A;  4E3I A;  1Q2P A;  3NC8 A;  4RVA A;  1NZU A;  3UDI A;  3ZG0 A;  3A3I A;  1VM1 A;  4JXS A;  4UAA A;  1KGG A;  4QY6 A;  1ESU A;  1BT5 A;  4BLM A;  3NIA A;  3TSG A;  4WMC A;  1M40 A;  1GHM A;  5HAI A;  3V3S A;  2XLN A;  4S2O A;  4OON A;  1PZO A;  3IWQ A;  4OLG A;  4UA6 A;  3HL9 A;  3VFH A;  4DRT A;  3C7V A;  4S2J A;  5GHY A;  1FOF A;  3UPN A;  1DJC A;  3SOI A;  3CJM A;  2XR0 A;  5HAR A;  5FQQ A;  1LHY A;  1K38 A;  3PBS A;  4JF5 A;  4OPQ A;  4WEJ A;  5FAP A;  5CEB A;  4L0L A;  3WRT A;  4KZ6 A;  4HEF A;  3N4I A;  4UA9 A;  2Y55 A;  2J8Y A;  1WE4 A;  4IED A;  5FQK A;  4LV1 A;  1GHI A;  5FDH A;  4O7D A;  3IF6 A;  4E6W A;  4QY5 A;  4IVI A;  1K55 A;  2Y2Q A;  4EBL A;  4EWF A;  5FAT A;  2QPN A;  3LEZ A;  4EBP A;  5KMW A;  3M6B A;  4P85 A;  3W8K A;  3MKF A;  4E3L A;  1C3B A;  2Q9M A;  4KQO A;  1TEM A;  3GSG A;  1KGE A;  1PIO A;  2UWX A;  2XD5 A;  1XX2 A;  4DKI A;  2JBF A;  4X56 A;  4B4Z A;  1XA7 A;  3GV9 A;  5L2F A;  3OZH A;  1IYP A;  3JYI A;  2H10 A;  4FCF A;  4S2L A;  3ZG7 B;  2DRW A;  2OLV A;  1FR1 A;  2ZC3 B;  3Q7V B;  4OLD A;  1E3U A;  4GD8 A;  1H8Y A;  2RL3 A;  3UPO A;  1NYY A;  1KGF A;  1KE0 A;  2WKI A;  4KG6 A;  5EVI A;  3MBZ A;  3ZNY A;  4B88 A;  1LI0 A;  1K57 A;  2EX6 A;  3C4P A;  5DTK A;  4HBU A;  3GMW A;  4U0X A;  4RA7 A;  3BLM A;  1MY8 A;  3G2Z A;  4PM7 A;  3EQV A;  2XFS A;  4U3T A;  3WWX A;  5AQB A;  3HLW A;  1RGZ A;  3BLS A;  3GRJ A;  3HLC A;  4MBF A;  5M19 A;  4QD4 A;  2P9V A;  2WGW A;  1BUL A;  2PU2 A;  3LY3 A;  3G2Y A;  5AQ9 A;  2WYX A;  1H5X A;  5E2G A;  3NDE A;  1MBL A;  1M6K A;  2OSU A;  3HUN A;  3FKV A;  4JBF A;  1JVJ A;  5EVI B;  5HFO A;  2VGK A;  3VP2 A;  1SCW A;  3D4F A;  4LV2 A;  3OPR A;  1O7E A;  3NY4 A;  1FSY A;  5GLB A;  2ZQC A;  3OC2 A;  3IF5 A;  2DCF A;  3IHA A;  3A3J A;  1KE4 A;  5JYP A;  4OOL A;  5GLD A;  3Q1F A;  1FCO A;  3HLG A;  3VP1 A;  3VOZ A;  2EX2 A;  2ZQ7 A;  3ITA A;  3MZE A;  4JLF A;  2HP9 A;  3UPP A;  1NRF A;  5A93 A;  3W4P A;  3W4Q A;  4ZDX A;  1MWU A;  1ALQ A;  5KSH A;  4JKT A;  4ZJ3 A;  2RCX A;  3IF6 C;  3N7W A;  3BEB A;  4OP5 A;  5EUA A;  4C6Y A;  1GA9 A;  4BEN A;  1JWZ A;  3BRM A;  4MNR A;  1JTG A;  1YMX A;  3UE1 A;  3ZG8 B;  4S2K A;  3BFF A;  3Q7Z A;  5BOH A;  3M2K A;  3O88 A;  1BLH A;  5E2E A;  4A5R A;  3I7J A;  2QMI A;  5GHZ A;  4FD8 A;  5E43 A;  4S2I A;  3VP3 A;  4NK3 A;  1S0W A;  4HBT A;  4ZTK A;  1PI5 A;  4N9L A;  3WS4 A;  1IYS A;  2H5S A;  3M2J A;  4KEN B;  5EVI C;  1YLJ A;  5AQ7 A;  4DE3 A;  3MZF A;  1K57 C;  4FH4 A;  2V2F F;  4PM6 A;  5G18 A;  1CEG A;  2Y2M A;  2XQZ A;  4E3M A;  1TDL A;  5CGX A;  1YLW A;  3HUO A;  3Q81 A;  4EV4 A;  3QHY A;  2JCH A;  3SS5 A;  1ERO A;  1YLZ A;  3CZD A;  3IXH A;  4JXG A;  2X02 A;  3GTC A;  3N8L A;  2XD1 A;  2XDM A;  2X71 A;  3N8S A;  3PBO A;  3IQA A;  3ZVT A;  3ZCZ A;  1WYC A;  5A92 A;  1L0D A;  2ZC4 B;  3TOI A;  4KZB A;  5I94 A;  2DNS A;  4BL2 A;  4WEL A;  2ZM0 A;  5CGW A;  3PBN A;  3C5A A;  4BJP A;  1ES2 A;  3LY4 A;  2FFF B;  3ZGA B;  1W79 A;  1MKI A;  1KE3 A;  4R4S A;  2R9W A;  2IWB A;  4JXW A;  1KDS A;  3VOY A;  3B3X A;  3DW0 A;  2ZQ8 A;  3IXB A;  3WRZ A;  3NBL A;  3UN7 A;  1W8Q A;  1FSW A;  2ZD8 A;  2WKE A;  5CRF A;  4IBR A;  2E8I A;  3FV7 A;  3HLF A;  4KQQ A;  4MBH A;  3LCE A;  4ZBE A;  4DE1 A;  5D3O A;  4PPR A;  3V3R A;  1IEM A;  1Y54 A;  3ITB A;  2Y2I A;  2GDN A;  3N6I A;  4OH0 A;  4E3O A;  4UHU A;  4PM5 A;  2ZLY A;  1PZP A;  1ZG6 A;  3SH7 A;  3Q7V A;  3G35 A;  2WZX A;  1WYB A;  4OQ0 A;  3NDG A;  5DF8 A;  2ZC6 B;  4JXV A;  1FCM A;  3UE3 A;  4LV0 A;  1G68 A;  2Y2P A;  5DVA A;  1XXM A;  1ESI A;  3MKE A;  1N9B A;  3Q82 A;  1O07 A;  1ZG4 A;  1ONG A;  4OOY A;  5EE8 A;  1VQQ A;  4DDS A;  2Y2G A;  4CJN A;  4RX2 A;  5HAP A;  1OME A;  4R3J A;  4ZAM A;  4KG5 A;  2WAD A;  3BYD A;  3MXR A;  1RP5 A;  3P98 A;  2X01 A;  2A3U A;  1NZO A;  2A49 A;  2WGI A;  5CHJ A;  3VP4 A;  4Y0T A;  4KZ7 A;  4OOM A;  5TGF A;  1IEL A;  4WM9 A;  2WGV A;  4WZ5 A;  4XUX A;  1QME A;  4JF6 A;  2ZM2 A;  2ZQD A;  5IHV A;  4DXB A;  4OPZ A;  3VMA A;  2EFU A;  3M6H A;  4Y0O A;  1AXB A;  5FI2 A;  5CTM A;  1ERQ A;  3W4O A;  2Q9N A;  4QJG A;  3ZNT A;  1HZO A;  1ONH A;  3PBT A;  5FSR A;  3SH9 A;  2B5R A;  1ES5 A;  1MWR A;  4DF6 A;  4F94 A;  5CHM A;  1E3U D;  5HL1 A;  1BUE A;  3CG5 A;  5EOO A;  4BD0 A;  1PWG A;  1FQG A;  4WZ4 A;  5DTS A;  5HAQ A;  1KVL A;  4WBG A;  4YFM A;  4GB7 A;  1CI9 A;  3G32 A;  5KZH A;  3NCK A;  2WAF A;  4N92 A;  1K56 D;  4KZA A;  1JTD A;  4LCM A;  2Y2J A;  1ES4 A;  1GA0 A;  2Z2M B;  3FKW A;  4KZ4 A;  1ERM A;  2OV5 A;  1MWT A;  2CC1 A;  3BM6 A;  4OP8 A;  3BFE A;  5CGS A;  1GCE A;  2Y2H A;  3ZDJ A;  4D2O A;  1W8Y A;  2P74 A;  4KZ8 A;  1E25 A;  1I5Q A;  2XEP A;  1MPL A;  2PU4 A;  4OVD A;  1W7F A;  4BD1 A;  4X68 A;  3LO7 A;  1EI5 A;  4GN2 A;  3IT9 A;  1U60 A;  3DTM A;  4RYE A;  3TG9 A;  3SS3 A;  3WS2 A;  1L0E A;  2JC7 A;  4FH2 A;  2H0T A;  3HVF A;  1I2W A;  4NET A;  4QHC A;  4KQR A;  4Q8I A;  1NJ4 A;  2ZQA A;  4IBX A;  5CER A;  3VFF A;  1EWZ A;  3MFD A;  4Z9Q A;  4K0W A;  3WS5 A;  3GR2 A;  4N9K A;  1NYM A;  4R3B A;  1PWD A;  1BSG A;  3C4O A;  4E3K A;  3ZG9 B;  3N8R A;  5FAS A;  2ZC5 B;  2HPB A;  4OQH A;  5HX9 A;  1XP4 A;  2IWD A;  1RGY A;  3IWI A;  2ZM8 A;  4OPR A;  5EPH A;  4HES A;  3ZG5 A;  4R1G A;  4WZ5 C;  3A3F A;  4JPM A;  5FI6 A;  5FA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...