2L1MA

Solution structure of the eag domain of the herg (kv11.1) k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
b'MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l1mA00
4HY8A 4HHDA 2PD8A 5G4YA 1UGUA 3H82A 2VV8A 3ZQ5A 2V0UA 3T50A 3NOTC 3F1NA 1S1ZA 2D02A 4EEPA 2A24B 1XJ3A 2B02A 5HD5A 4NXFA 4KUKA 1WA9A 1P0ZA 4WLAA 1N9NA 3UB7A 1DRMA 1T1AA 1D06A 1N9LA 5DJUA 3LIEA 5DJTA 3IS2A 2WKPA 1V9ZA 3CLOA 1V9YA 2W27A 4JGRA 4L9FA 4LRZE 3E4OA 4JGOA 3MJQA 2YKFA 2M1CA 3MQOA 2QWSA 4BBTA 4DJ3A 5HZHA 5HWTA 4E04A 3PHYA 1S4RA 2JHEA 1GSXA 4H6JB 4NXGA 1XJ6A 3HJKA 1LSXA 3NOUC 4XT2A 1P97A 3FG8A 5J7EA 4GS9B 1OJ5A 5HSQA 3LICA 3LYXA 2ZBBA 3E4PA 3UB6A 3IBRA 5F68A 1JNUA 1OTAA 5EFWA 3P7NA 4BBUA 5KIZA 1EW0A 4F3LA 1S67L 4LPZA 3H9WA 3LI8A 2W0NA 1BYWA 5AVFA 4HJ3A 4PKYA 5TBMA 4I3JA 1DP8A 4HQAA 2ZOHA 1T18A 3UMDA 3UB9A 2R78A 4B9OA 4HJ6A 3MQQA 4HOIA 3RH8B 4MN6A 5F5YA 2YKHA 2PYRA 3F1PB 3LUQA 2QKPA 3BWLA 2VV7A 4PKYG 2P7JA 4R70A 3G6OA 3ICYA 4LRYC 4YWZA 3BY8A 3H82B 3VE4A 5HWWA 3NOPC 4JGQA 3E4QA 3UB8A 3CWFA 2L0WA 2V1BA 3C8CA 3F1NB 2HV1A 2L1MA 2L4RA 1GSVA 3LIBA 2KX6A 4HI4A 4EQ1A 2PHYA 1UWPX 2QJ7A 2D01A 3NHQA 1TS0A 3D72A 3MR0A 1N9OA 2H28A 4LRXC 3IS2B 2Z6CA 3BY9A 3F1OA 1XFQA 3LIFA 5HWVA 1OT6A 3C2WA 3H7WA 4L9GA 1UWNX 3RTYA 4I3AA 3VOLA 3A0RA 4HP4A 3EEHA 4R38A 1XJ4A 2V0WA 4XT2B 1TS7A 2VEAA 2ZOIA 1DP6A 4LLOB 3K3DA 5F6AA 4KUOA 1S1YA 2A24A 3EWKA 1F9IA 3F1OB 2EA9A 3K3CA 1S4SA 3LI9A 5AVEA 2QHKA 4EETB 2WKQA 3GDIA 3SW1A 3MFXA 1LL8A 1XFNA 4WL9A 4HP9A 2I9VA 4DJ2A 1OTDA 1F98A 1VB6A 1TS8A 1T1CA 2QJ5A 4F3LB 4GHIA 4R6LA 2V9AA 4I3IA 4HNBA 5HDSA 2PR5A 4HJ4A 4HH3A 5IU1A 4WUJA 3VE3A 4GW9A 4WF0A 5TBMB 4H6JA 4EEUA 4K08A 1T1BA 2OWHA 1OT9A 1XJ2A 2INWA 3CAXA 3UMEA 1LSVA 4GS9A 4MN5A 2PR6A 1LT0A 3OLOA 4I38A 1OTEA 3PYPA 4GHIB 3ULFA 5HDCA 4GCZA 2WKRA 4L9EA 2JN7A 2OOLA 5G4ZA 4NXBA 1OTBA 4EW7A 1NWZA 3FC7A 5F69A 5HDDA 2K7SA 1DP9A 4HIAA 1MZUA 5DKLA 2BASA 2KDKA 5HD3A 3LIAA 1ODVA 2Z6DA 3LIDA 4RQ9A 2GJ3A 4HH2A 1KOUA 5DKKA 2PYPA 1OTIA 1S66L 1Y28A 4R3AA 2OWJA 2V1AA 4KQDA 3HJIA 4JGPA 4EXOA 4I39A 2PD7A 3KX0X 1X0OA 2J80A 1OJGA 1GSWA 5A8BA 3A0SA 4I5SA 5J3WA 3UE6A 4WN5A 3B33A 1LSWA 3NJAA 1G28A 5I5LA 2VV6A 5IS1A 1D7EA 2VLGA 2CMNA 4M4XA 3F1PA 1TS6A 3H7WB 5J4EA 4BBVA 1T19A 3A0VA 4NXEA 3GECA 4EESA 3MXQA 4EERA 2PDRA
chains in the Genus database with same CATH superfamily
3UDIA 3VFFA 2PD8A 5GLCA 4CLCC 5G4YA 3T1RA 1UGUA 2VV8A 2JE5A 2V0UA 3E98A 4E3JA 1YPRA 4KG5A 4QJGA 3CUEA 1MXOA 2IWDA 4OQHA 4IUKA 2D02A 3MZDA 1DY6A 1CJFA 3C38A 4QY6A 1XJ3A 1RGZA 3IX8A 4KUKA 1P0ZA 4WLAA 2ZC6B 4KG6A 3RFBA 3ITAA 1N9LA 1NLZA 3OPPA 4JLFA 5TJJA 2G2WA 2XLNA 2QMIA 4EV4A 3W4QA 1V9YA 5FA7A 5KZHA 4L9FA 2ZC5B 1LI9A 3MJQA 1M40A 1YLWA 3PBQA 2WYXA 3WS1A 2QPNA 1IYSA 4OOYA 4DE0A 1YLTA 1NZUA 2LB9A 3CZDA 1PW1A 4H6JB 3HJKA 4KENB 3PAGA 1LSXA 2O9BA 5J7EA 1PZOA 4GS9B 2KLIA 1OJ5A 3EQVA 2W1RA 3G35A 2PU2A 2E8JA 3N8LA 3IWOA 2A3UA 1IYQA 1MY8A 1L0FA 3UY6A 4H8RA 5CHMA 5F68A 4MLLA 3CPTA 5DF8A 4IHQA 5KIZA 1EW0A 5HARA 4LPZA 1F5MA 3LI8A 2HF6A 2XD5A 3TRCA 1BYWA 1YAXA 1SKFA 5AVFA 5EVEA 4KZ4A 5JYOA 3HLWA 1AXBA 4KG2A 1O7EA 4YOFA 1XKZA 2XFTA 3W2ZA 4ZTKA 5FQKA 3IF6B 3LGOA 3LR5A 1NZOA 2WGIA 1MKMA 2WUQA 4OPRA 1ZG6A 4B9OA 3MQQA 4ARZB 4O8GA 3QP8A 4WEKA 5FATA 5F5YA 3N4IA 4YNRA 2Y2NA 1IEMA 1E3UA 3F1PB 1JWPA 2HJ9C 3FZCA 3Q7VB 4HESA 3UPNA 2P7JA 1P9RA 3DTEA 4X1LA 3HUOA 4PPRA 3LR0A 3G34A 3NOPC 4ESPA 4U0XA 3UPPA 4DDSA 1ESIA 3E4QA 1FOFA 3UO9A 2B18A 5L07A 4FH2A 4GOGA 5G18A 4E3MA 4ME4A 4PM7A 5EVID 1K54C 2QJ7A 2Y2QA 5FDHA 3T4SA 1EROA 1Q2PA 1ONHA 1TS0A 4ZAMA 3D72A 4QY5A 5AJGA 1N9OA 1YMXA 1YSQA 5E2FA 3IS2B 1JTGA 3QP1A 2WGVA 3F1OA 1NLYA 3LR4A 3CG5A 3C2WA 4LV0A 4L9GA 4C6YA 1W63M 3RTYA 3UN7A 3ZG9B 2Y4AA 3VP0A 5F82A 2V8CA 2EX6A 3DW0A 4KQRA 3MXSA 3QP2A 1H8MA 3IXDA 2H0YA 2XEPA 2V0WA 5E2HA 1ES4A 3SH7A 3OBFA 3MF0A 1MBLA 3IQAA 4Y15A 3V3SA 4NG2A 4LLOB 4R23A 4IEDA 5GHYA 4GB7A 5EUAA 1N9BA 3IHAA 3K3CA 2QHKA 3G30A 2XD1A 1KGFA 3SW1A 3MFXA 3RXXA 4P6BA 1BSGA 3GR2A 1PIOA 4HP9A 4DJ2A 1F98A 3WS4A 1FILA 4U0TA 3S4XA 2QJ5A 4F3LB 4DDYA 3E0YA 3ZYTA 4FH4A 4FCFA 4IVKA 4R6LA 2V9AA 3CUEC 3P01A 2OAP1 4R1GA 2XH9A 4HJ4A 3M6BA 2CC1A 2Y59A 2VA0A 3WS2A 4K08A 4NK3A 5L09A 2VK3A 1NYYA 3BQ8A 3DTMA 3UMEA 3MS6A 1LSVA 4E6XA 1LLBA 1LT0A 2K2NA 4OP5A 1SDEA 1K6SA 2W1TA 3NI9A 5DTSA 4OPYA 4GHIB 3ZVWA 5HDCA 4GCZA 2C6WB 5MC7A 3ZG8B 4ZDXA 2E8IA 2JN7A 2VZWA 4OKPA 1GHMA 4JXWA 3WRZA 3PTEA 3R7WA 1NWZA 4EW7A 4BL3A 2V1ZA 3B3XA 3MMHA 1PWDA 5HDDA 3JVUA 2PT7A 1FQGA 4HIAA 2H10A 2EX2A 5K5BA 4Y13A 3FV7A 2GNXA 2ACGA 2C5WB 5HD3A 2VGJA 4EBLA 3SS4A 2GJ3A 4R0QA 2W3FA 5CXWA 3UE1A 2O9AA 2PAVP 2FZ0A 3ZDJA 4Q8IA 3T4TA 1Y28A 1W8YA 4OLDA 4R3AA 1K57A 2ZL1B 4KZ9A 1KGGA 3HJIA 3TG9A 1L0GA 3HLBA 4EXOA 4I39A 3QP6A 5TR7A 4WELA 5EM0A 1BLSA 1BUEA 1KE3A 1H8ZA 5L10A 3IXGA 3A0SA 3ZVTA 4I5SA 4FTXA 3UE6A 3IHBA 1JVJA 4Y5FA 1ZC2A 3B33A 3OCNA 4LFUA 1CI8A 1K0KA 3MZEA 2HJEA 4N92A 1PWGA 1AWIA 4R3JA 4P6ZS 4GDNA 1FR6A 3MXQA 2PDRA 3BFCA 4HY8A 2V2FF 1SZVA 4X25A 2P9VB 4GNUA 2EX9A 4AFIA 3G2ZA 5AQ9A 3B42A 4G3WA 2J3TD 3A3FA 5DFXA 1G6AA 5EECA 2B5RA 2A24B 4S2LA 3GVBA 4OH0A 1WA9A 1IKIA 1N9NA 4DE3A 1T1AA 2XQZA 5DTKA 1XGJA 3M2JA 5DJTA 5FQMA 2ZC3B 4P0MA 2ZD8A 1J9MA 2WKPA 1DJCA 2X71A 2W27A 3Q1FA 1CEFA 4LRZE 3QP5A 5AQ7A 4JGOA 2M1CA 3OPRA 5EVIA 2JBFA 4OQGA 3CHWP 1K55A 2VJWA 2Q0OA 4OQIA 4NEED 4UHUA 3SH8A 1ACFA 1P97A 5GLDA 5GHXA 4K0XA 1IOUA 2V8FA 1GA0A 5HSQA 3LICA 1FSYA 4KZBA 3P09A 3UPOA 4QWOA 1KVMA 4G3KA 1Y4OA 3T1XA 4JF4A 1OTAA 4MBKA 4BD1A 4PM9A 2JKFA 4BBUA 3T4OA 4S2OA 1FCMA 3C4OA 1KE0A 3LY3A 4E3IA 4L0LA 1CI9A 2ZC7A 1BLHA 4BMWA 1QMFA 4JBFA 5KSCA 3QNCA 1JWZA 4HJ3A 1ONGA 3UE0A 3PBNA 4O0PA 1ERQA 5TBMA 4I3JA 2Q9MA 4X69A 4UA7A 1XXMA 2GX5A 3W4OA 2O9CA 1DP8A 2ZQ8A 1VETB 4HQAA 3UB9A 2R78A 3N7WA 3IWIA 1H3QA 2WAEA 3N8RA 3JVVA 3RH8B 1NY0A 3DAVA 3NC8A 3UNWA 4JF6A 1FSWA 4WZ4A 4MBFA 1ERMA 2YKHA 4WMCD 3Q82A 3LEZA 4QD4A 5KSHA 2QKPA 2UV0E 3VSLA 2WZZA 3EQUA 4LV3A 3KSHA 3T1QB 4LGWA 3G6OA 4YWZA 4S2IA 3BY8A 3H82B 4DXBA 2BG1A 2OAQ1 5HWWA 4CPKA 3E2LA 5CGSA 2L0WA 2NUPC 2V1BA 3F1NB 2HV1A 2XR0A 3KYEA 4WZ5A 2BLSA 4CJNA 3PXPA 4EQ1A 2Y2MA 3ITBA 2G2UA 3AGDA 1TVFA 5GLAA 3I7JA 2PBYA 2HP6A 2HPBA 4DN0A 5FQJA 5E2GA 1SKOA 3BY9A 4B4XA 3U4LP 3LIFA 5HWVA 3ZG0A 4UA9A 2G7UA 4UEYA 1PI4A 1UWNX 3W8KA 2HZ5A 3D3OA 1MC0A 3IH9A 4ETXA 4I3AA 1K57C 4Y0UA 4S2NC 1I2WA 1K56D 1TEMA 1KVLA 5HL6A 4XT2B 1PI5A 3BRMA 3NCKA 1DP6A 5A90A 2VX8A 4WEJA 3IF5A 4KUOA 3BFGA 5DVAA 3HLDA 2RCXA 1H0MA 3F1OB 4JXSA 3LO7A 3LI9A 4QB8A 2JKRI 3BEBA 4EETB 2EFXA 4E3NA 3T1SA 1XGIA 2ZQ9A 4ZBEA 2ZC4B 1IKGA 1BLPA 4YINA 4X53A 3TSGA 1T1CA 2OLVA 4RYEA 3SZTA 1OPXA 4EBNA 3VP4A 4EWFA 2EWVA 1GHPA 3G2YA 5M1AA 3DWZA 4P85A 4H6JA 5FDSA 4Y7PA 5CHJA 4CLCB 1OT9A 3HLGA 3E2KA 2EXBA 3NULA 3TW8A 3K2NA 4GS9A 3BYDA 4X68A 1OTEA 3ZCZA 4MDZA 2WKRA 2WKHA 5DTTA 2H0TA 5G4ZA 4BWIA 3FC7A 2UWXA 5EVIC 1MKIA 5CRFA 2O99A 2K7SA 4Y2FA 1L0DA 4GLQA 3U2AA 3EOIA 4X6TA 1IYOA 2BASA 4OOMA 2KOIA 2WGWA 4EU0A 1ODVA 2EFUA 5M19A 2BTFP 3UDXA 4HH2A 1PWCA 4O01A 1OTIA 3O87A 2H5SA 4S2MA 1PFLA 2V1AA 4KQDA 4R4RA 4JGPA 4DE2A 4DKIA 1DJAA 4KQQA 3IF6A 2J80A 4OLGA 5A8BA 2ZM0A 5J3WA 1MPLA 4E3OA 4ARZA 5FQQA 1LSWA 5EM1A 3NJAA 4IBXA 4OOLA 1G28A 5IS1A 5EOOA 4M4XA 5FI2A 3T4LA 3F1PA 3H7WB 4N9KA 1LL5A 4BBVA 3Q7VA 1ZKJA 5A93A 5CECA 3A0VA 3GECA 4OP8A 4C3QA 4BJPA 4EERA 5FASA 3BLSA 4WM9A 3SS3A 4HHDA 2J3WA 1TD5A 1W63Q 3PAEA 3ZQ5A 2Z2MB 3GMWA 2Y2LA 2W3DA 4GD8A 4UAAA 3IBJA 3T50A 5KMWA 1BT5A 4DXCA 3S1YA 1K38A 4UQIM 3IXBA 4WMCA 4UQIS 3M2KA 3NBLA 3SOIA 3UB7A 4BD0A 3LFVA 3LY4A 1BZAA 1D06A 1A0KA 3LIEA 3CI6A 2WAFA 3PBOA 1S6RA 3L7HA 4KZ8A 2M7VA 3DWKA 3IS2A 1FR1A 4B88A 2WKIA 2Y2IA 3V50A 1SHVA 3S7OA 1XPBA 2YKFA 1ES3A 3LCEA 4EQIA 1STZA 3MQOA 4BBTA 4DJ3A 1VEUB 2XDMA 5HWTA 4PM5A 4WZ5C 5GHZA 3PBTA 1NYMA 1G68A 2JHEA 4NXGA 4N9LA 3Q7ZA 3V39A 3FG8A 4IUHA 2EXAA 1GCEA 4LV2A 4P87A 1PZPA 5F83A 5DFYA 3GV9A 2Y2PA 1BULA 1LHYA 2JKGA 2ZBBA 3OC2A 5IT5A 4FUWA 3MKEA 3UDFA 4N1XA 3V3RA 1KDSA 3UB6A 3EGXC 4PM8A 1VHMA 1HTZA 1JNUA 5EVIB 4Q0JA 2Y91A 5EFWA 3TJZC 3S7QA 5I94A 2QZ6A 1K56A 2W3HA 4F3LA 1S67L 1L2SA 4P6ZM 2W0NA 4WYYA 5FEFA 1GA9A 3OZHA 2ZMFA 2JKTI 4K0WA 5HAQA 4MBHA 2B95A 5DF9A 1IELA 2VGKA 2Y2HA 1U60A 1RCJA 3ZG7B 1L3LA 1ESUA 3MKFA 1TDLA 2EWWA 2ZQ7A 1YSPA 4Z9QA 3UMDA 2VGLS 3FPVA 4QHCA 3T4JA 1SDNA 3HCYA 3DTKA 2DRWA 3HVFA 3WS0A 3GSGA 3O3VA 4RVAA 4MN6A 5EV0A 2I72A 2FFYA 2J3TC 2HDRA 4F94A 4S2KA 3O5YA 3LUQA 4MN7A 3VSKA 1NRJA 4PKYG 4R3BA 1XP4A 2OLUA 4D2OA 4HBTA 1E4DA 3ZHHA 4UA6A 1N4OA 3A3JA 5HFOA 3FYZA 2M7UA 1XA1A 3UB8A 3C7UA 3NDGA 3C8CA 3CITA 2ZL1A 2L4RA 4BLMA 2KX6A 4HI4A 3NHQA 1ALQA 3IH8A 2QYBA 3MR0A 3EGDC 5EOEA 4DMZA 2H28A 2X02A 4LRXC 5J8XA 3PBRA 3BJNA 4HEFA 5A91A 3MQ0A 1JWVA 4FSFA 3CJMA 2XROA 2WK0A 4B4ZA 3G32A 2ZQCA 3VOLA 3GRJA 3A0RA 3DTIA 4IBRA 4YFMA 1HVBA 4R38A 2P9VA 5TGFA 2P74A 2XFSA 1MWUA 2ZOIA 3QP4A 2DMWA 1NXYA 5HPFA 5A92A 3D4FA 4QPRA 1YKDA 1M6KA 1Q2QA 4E6WA 2A24A 3EWKA 1SKOB 2K31A 1F9IA 3MFDA 2EA9A 5AVEA 2XA7S 4JXGA 3GDIA 4Q0IA 1CF0A 1XA7A 1XFNA 4CLCD 3NDEA 1NJ4A 3FKVA 3CPTB 1W8QA 1W5DA 2I9VA 1OTDA 1VB6A 1FIKA 3IT9A 3WRTA 3HL9A 1L0EA 1ES2A 3JPUA 3AGFA 3A3EA 3VMAA 3PR6A 1EWZA 3NECA 5EPHA 3SH9A 3EEAA 5HDSA 2X01A 3MZFA 4WBGA 2WZXA 5L8MA 5LBRA 1NRFA 2HDUA 4MMNA 4WUJA 3V5MA 3QNBA 3VE3A 4GW9A 4WF0A 1CQAA 3A3DA 1SCWA 5JYPA 1T1BA 3HBRA 5TFQA 4BQMA 4ETZA 1PRQA 2INWA 5HPIA 4K91A 2W3EA 4MN5A 5BOHA 3OLOA 2GDNA 4I38A 4ZJ2A 3PYPA 3PBSA 1K4EA 4MNRA 4L9EA 2AVXA 3HUNA 2DCFA 2XF3A 1DP9A 4D60A 1K25A 2JKTM 1DJBA 1TF1A 2PU4A 3LIAA 4BL2A 4XUXA 1KDWA 2XRNA 3LIDA 4RQ9A 3P98A 5DKKA 2PYPA 4HBUA 5FAQA 3DBAA 5CEBA 4Q0HA 4GKUA 2OWJA 1K4FA 2R9XA 3BW6A 1KE4A 3KX0X 4KZ3A 1VETA 1GSWA 2XSSA 2MJ6A 2DNSA 1HZOA 4XUZA 5HX9A 1LI0A 1QMEA 3RXWA 2JCHA 2ZQAA 1CK3A 1ZTUA 3VP3A 1D1JA 5I5LA 5CHUA 4O7DA 2WGWB 3TE8A 4PMAA 2VLGA 1TS6A 5E43A 1I5QA 1CEGA 1T19A 4NXEA 4EESA 3KO6A 2LB5A 2ZMVA 1PNEA 2FFFB 3C7VA 3ISGA 1F2KA 3LR3A 3H82A 2Y8HA 5D3OA 1VM1A 3T4KA 1O07A 3NOTC 1KGEA 3KSGA 3F1NA 1S1ZA 3HREA 4MCWA 2Y2OA 4EEPA 1JTDA 1E25A 4RX2A 3KSFA 2B02A 5HD5A 4NXFA 2Y2JA 2IA2A 2ZQDA 4C75A 1I2SA 1DRMA 2RL3A 1P9WA 5DJUA 4JF5A 3OPHA 3D9YA 2ZM8A 1V9ZA 3CLOA 5CX7A 4GDBA 5FQ9A 4Y0OA 4JGRA 3T12B 3E4OA 1W7FA 4LENA 3W4PA 2QWSA 3V67A 4FD8A 4BENA 4RX3A 5HZHA 3Q07A 1K55C 4E04A 3PHYA 3O88A 3IXHA 5GLBA 1S4RA 3BFFA 1GSXA 4EUVA 2J7VA 5FEGA 2Y2KA 3BQAA 1XJ6A 1G6OA 2VKSA 3ZFZA 4E3KA 3KSIA 3NOUC 4XT2A 5CGXA 1EI5A 3OOVA 4KZ5A 5C5KA 2XK1A 2W3GA 1ES5A 4GD6A 2W1TB 3SS5A 3LYXA 3IX3A 4Z1WA 1PYYA 3BLMA 2P08A 3E4PA 3VOYA 3MSHA 3RJUA 2WADA 3IBRA 3R7WB 1FCNA 3AGEA 3P7NA 1K6RA 3C30A 3HLEA 3O86A 4II7A 2EX8A 3H9WA 3NY4A 1YT4A 4Y0TA 1YM1A 2NUTC 5CTMA 2OSUA 1IFQA 4PKYA 2J9OA 1C3BA 1RGYA 4CLCA 4JXVA 1VQQA 3IX4A 2ZOHA 3S7PA 1T18A 2P04A 2A49A 4HJ6A 4HOIA 3WS5A 3B47A 4QU3A 2ZM2A 3VP1A 5F1GA 5F1FA 2PYRA 4GZBA 3HUMA 5FAOA 5FI7A 3BWLA 2ZLYA 3WWXA 2VV7A 4OVDA 3HLFA 1HLUP 4LCMA 1RP5A 3OPLA 5HL1A 3UB5P 3FKWA 4R70A 1Z09A 4EUZA 2PRFA 2Y79A 3ICYA 4LRYC 4X56A 4G3VA 1IYPA 3VE4A 4FOFA 2Y2GA 4JGQA 3A3IA 2A2LA 5HAIA 4OQ0A 2GZAA 2J8YA 4EBPA 3CWFA 5EVLA 4A5RA 4ZJ1A 4GJ4A 2L1MA 1GSVA 3LIBA 4R4SA 3FPWA 2FH5A 4KZAA 2PHYA 1UWPX 2D01A 5U47A 3C4PA 2OV5A 4MEZA 2JKRM 4OPQA 2J9PA 3BM6A 1YLJA 5CTNA 1YMSA 3S7NA 3MBZA 1WE4A 4DRTA 1OMEA 2Z6CA 4N1HA 3ZNTA 4GN2A 4JKTA 1XFQA 3JYIA 1OT6A 5L2FA 3H7WA 4IVIA 1HD8A 3ZGAB 2IWBA 3TOIA 3N8SA 3S22A 4HP4A 4LV1A 5AQAA 4S2NA 2HP5A 1MWTA 3BFDA 3EEHA 3CMZA 4Y3IA 1XJ4A 1S0WA 4CQHA 1YLYA 1TS7A 4U3TA 2VEAA 3L9KA 1TDGA 4NETA 4B93A 1GHIA 3UE3A 3K3DA 4Y17A 3Q81A 1ZHHB 1J3WA 5F6AA 4CLCE 3G4PA 1S1YA 5CERA 2Q9NA 4LCLA 3VP2A 1S4SA 2WKQA 2VGLM 1LL8A 4X55A 3VOZA 4WL9A 2O0YA 1FCOA 4KZ6A 4S2PA 1TS8A 4RA7A 4GHIA 2WKEA 1BLCA 3BFEA 1LL9A 4I3IA 4ID4A 4NKPA 4HNBA 3T4QA 4PAUA 1VEUA 4ZJ3A 1E3UD 2PR5A 2Y55A 4JPMA 3HLCA 2ZJ9A 4HH3A 3C5AA 4KQOA 5IU1A 1H5XA 5TBMB 4EEUA 3VFHA 3KYQA 5HAPA 4OPZA 4XXRA 2OWHA 5E2EA 1XJ2A 3QHYA 3BECA 4S2JA 3CAXA 2HP9A 2PR6A 1G5UA 4DE1A 1ZG4A 3ULFA 2ZMAA 3NIAA 1K54A 3OCLA 2V20A 2OOLA 4NXBA 2Z2LB 1OTBA 1XX2A 5HW3A 5F69A 2HDSA 5M18A 1PW8A 5FI6A 4E3LA 4PHTA 5FQIA 2JC7A 1MZUA 5DKLA 1YQSA 5AQBA 3R4KA 2KDKA 2HGVA 2HDQA 5FAPA 1W79A 2Z6DA 4DF6A 1KOUA 1Z6FA 3MXRA 5IHVA 1BTLA 5DF7A 3LEQA 5GL9A 1S66L 4ZRRA 3M6HA 2R9WA 1WYCA 3GTCA 3IF6C 1YLZA 2PD7A 1X0OA 1OJGA 5FL3A 2PBDP 3ZNYA 3FWLA 3GQZA 4PM6A 4WN5A 4X1MA 3G31A 1WYBA 5EE8A 1YLPA 2XGNA 3N6IA 1MWSA 5CEDA 5CGWA 3KYZA 2XA7M 4KZ7A 2VV6A 1D7EA 3ZG5A 1H8YA 1Y54A 2CMNA 5J4EA 4OONA 4IJGA 5FSRA 2IWCA 4M3KA 1MWRA 3VV4A 3IWQA
chains in the Genus database with same CATH topology
4HY8A 4HHDA 2J3WA 2PD8A 4CLCC 1TD5A 3LR3A 5G4YA 1W63Q 1UGUA 3H82A 2VV8A 2Y8HA 3ZQ5A 4AFIA 2W3DA 3B42A 2V0UA 3E98A 3IBJA 3T4KA 3T50A 3NOTC 3CUEA 4G3WA 3KSGA 2J3TD 3F1NA 1S1ZA 4IUKA 4UQIM 4MCWA 2D02A 5DFXA 4EEPA 3C38A 2A24B 4UQIS 1XJ3A 3KSFA 2B02A 5HD5A 4NXFA 4KUKA 1WA9A 1P0ZA 4WLAA 2IA2A 1N9NA 3UB7A 1DRMA 1T1AA 1P9WA 3LFVA 3RFBA 1D06A 1N9LA 5DJUA 1NLZA 3LIEA 3CI6A 5TJJA 3PBOA 5DJTA 2M7VA 3IS2A 2WKPA 1V9ZA 3CLOA 5CX7A 1V9YA 2W27A 4JGRA 4L9FA 4LRZE 3E4OA 4JGOA 3MJQA 3S7OA 2YKFA 2M1CA 1STZA 3MQOA 2QWSA 3V67A 4BBTA 4DJ3A 3PBQA 5HZHA 5HWTA 4E04A 3PHYA 1S4RA 2VJWA 2LB9A 3PBTA 2JHEA 1GSXA 4EUVA 4H6JB 4NXGA 3BQAA 1XJ6A 1G6OA 2VKSA 3HJKA 4NEED 1LSXA 3KSIA 3NOUC 4XT2A 1P97A 2O9BA 3FG8A 5J7EA 3OOVA 4IUHA 5C5KA 1IOUA 4GS9B 2KLIA 1OJ5A 3EQVA 2W3GA 5HSQA 5DFYA 2W1RA 3LICA 2W1TB 3LYXA 2ZBBA 3OC2A 5IT5A 4Z1WA 2P08A 3E4PA 3UB6A 3EGXC 4G3KA 3IBRA 1VHMA 5F68A 3R7WB 1JNUA 1OTAA 4Q0JA 5EFWA 3P7NA 3TJZC 3S7QA 3C30A 4BBUA 3T4OA 4IHQA 5KIZA 2W3HA 1EW0A 4II7A 4F3LA 1S67L 4LPZA 1F5MA 4L0LA 3H9WA 3LI8A 4P6ZM 4BMWA 2W0NA 2HF6A 3TRCA 1BYWA 1YAXA 5AVFA 2NUTC 2ZMFA 2JKTI 4HJ3A 3PBNA 1IFQA 4O0PA 4PKYA 5DF9A 5TBMA 4I3JA 4YOFA 2GX5A 2O9CA 2EWWA 1DP8A 3W2ZA 4CLCA 3LR5A 4HQAA 2ZOHA 3S7PA 1MKMA 1T18A 1YSPA 3UMDA 3UB9A 2R78A 2VGLS 2P04A 3FPVA 4B9OA 1H3QA 3T4JA 4HJ6A 3MQQA 3HCYA 4HOIA 4ARZB 3RH8B 3JVVA 3B47A 4O8GA 4WEKA 4MN6A 5F5YA 4YNRA 2J3TC 2YKHA 2PYRA 5KSHA 3F1PB 2HJ9C 3O5YA 3LUQA 4MN7A 2QKPA 3BWLA 1NRJA 2VV7A 4PKYG 3EQUA 2P7JA 1P9RA 3KSHA 4R70A 3G6OA 2Y79A 3ICYA 4LRYC 3LR0A 4YWZA 4G3VA 3BY8A 3H82B 3VE4A 4FOFA 2OAQ1 5HWWA 3NOPC 4JGQA 2A2LA 2GZAA 2M7UA 3E4QA 3UB8A 3CWFA 2L0WA 2NUPC 2V1BA 2B18A 3C8CA 3F1NB 2HV1A 4ME4A 4GJ4A 2L1MA 3CITA 2L4RA 1GSVA 3LIBA 3FPWA 2KX6A 4HI4A 2FH5A 3PXPA 4EQ1A 2PHYA 1UWPX 2QJ7A 2D01A 3NHQA 3T4SA 1TS0A 3D72A 2JKRM 2QYBA 3MR0A 3EGDC 3S7NA 4DMZA 5AJGA 4DN0A 1N9OA 2H28A 1YSQA 4LRXC 3PBRA 3IS2B 2Z6CA 3BJNA 3BY9A 3MQ0A 3F1OA 1XFQA 3LIFA 1NLYA 3LR4A 1OT6A 5HWVA 3C2WA 4FSFA 3H7WA 2XROA 2G7UA 4UEYA 4L9GA 1UWNX 3D3OA 1MC0A 1W63M 3RTYA 4ETXA 4I3AA 3VOLA 3A0RA 4HP4A 1H8MA 3EEHA 4R38A 4Y3IA 1XJ4A 2V0WA 5HL6A 3OBFA 4XT2B 3MF0A 4CQHA 1TS7A 2VEAA 2ZOIA 2DMWA 4B93A 1DP6A 5HPFA 4LLOB 2VX8A 3UE3A 3K3DA 4QPRA 4WEJA 1ZHHB 1YKDA 5F6AA 4KUOA 4CLCE 1S1YA 2A24A 3EWKA 2K31A 1F9IA 3F1OB 2EA9A 3K3CA 1S4SA 3LI9A 2JKRI 2XA7S 2QHKA 5AVEA 4EETB 2WKQA 2VGLM 3GDIA 4Q0IA 3SW1A 3MFXA 1LL8A 1XFNA 4WL9A 4CLCD 2O0YA 4HP9A 2I9VA 4DJ2A 1OTDA 1F98A 1VB6A 1TS8A 1T1CA 2QJ5A 4F3LB 4GHIA 3E0YA 3ZYTA 1OPXA 4R6LA 2V9AA 4I3IA 3PR6A 3CUEC 4NKPA 4HNBA 3P01A 3EEAA 2EWVA 4PAUA 5HDSA 3T4QA 2OAP1 2PR5A 4HJ4A 4HH3A 5L8MA 4KQOA 5IU1A 5LBRA 4MMNA 4WUJA 2VA0A 3VE3A 4GW9A 4WF0A 5TBMB 4H6JA 4EEUA 4K08A 3KYQA 1T1BA 2OWHA 3BQ8A 4CLCB 4ETZA 1OT9A 1XJ2A 2INWA 5HPIA 3TW8A 3CAXA 3K2NA 3UMEA 1LSVA 2W3EA 4GS9A 4MN5A 2PR6A 1LT0A 2K2NA 3OLOA 4I38A 1OTEA 3PYPA 2W1TA 3PBSA 4MDZA 4GHIB 3ULFA 5HDCA 4GCZA 5MC7A 2WKRA 4L9EA 3OCLA 2JN7A 2VZWA 2OOLA 5G4ZA 4NXBA 4BWIA 1OTBA 3R7WA 1NWZA 3FC7A 4EW7A 3MMHA 5F69A 5HDDA 2O99A 3JVUA 2K7SA 2PT7A 4Y2FA 1DP9A 4HIAA 4GLQA 2JKTM 3U2AA 4PHTA 5K5BA 3EOIA 1MZUA 5DKLA 2BASA 4OOMA 1TF1A 2GNXA 2KOIA 3R4KA 2KDKA 5HD3A 3LIAA 4EU0A 2HGVA 1ODVA 2Z6DA 2XRNA 3LIDA 4RQ9A 2GJ3A 4HH2A 2W3FA 1KOUA 5DKKA 2PYPA 2O9AA 2FZ0A 4O01A 3DBAA 3T4TA 4Q0HA 1OTIA 1S66L 1Y28A 4R3AA 2OWJA 4ZRRA 2V1AA 4KQDA 3HJIA 4JGPA 3BW6A 4EXOA 4I39A 2PD7A 3KX0X 1X0OA 2J80A 1OJGA 4WELA 1GSWA 2XSSA 2MJ6A 5FL3A 5A8BA 3A0SA 4I5SA 5J3WA 3UE6A 4WN5A 4Y5FA 4ARZA 3B33A 1LSWA 3NJAA 3OCNA 4OOLA 2HJEA 3KYZA 1ZTUA 2XA7M 1G28A 5I5LA 2VV6A 5IS1A 1D7EA 3TE8A 2VLGA 2CMNA 4M4XA 3T4LA 3F1PA 1TS6A 3H7WB 4P6ZS 5J4EA 4IJGA 4BBVA 1T19A 3A0VA 4NXEA 3GECA 4EESA 3VV4A 3KO6A 4BJPA 3MXQA 2LB5A 4EERA 2ZMVA 2PDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HY8 A;  4HHD A;  2PD8 A;  5G4Y A;  1UGU A;  3H82 A;  2VV8 A;  3ZQ5 A;  2V0U A;  3T50 A;  3NOT C;  3F1N A;  1S1Z A;  2D02 A;  4EEP A;  2A24 B;  1XJ3 A;  2B02 A;  5HD5 A;  4NXF A;  4KUK A;  1WA9 A;  1P0Z A;  4WLA A;  1N9N A;  3UB7 A;  1DRM A;  1T1A A;  1D06 A;  1N9L A;  5DJU A;  3LIE A;  5DJT A;  3IS2 A;  2WKP A;  1V9Z A;  3CLO A;  1V9Y A;  2W27 A;  4JGR A;  4L9F A;  4LRZ E;  3E4O A;  4JGO A;  3MJQ A;  2YKF A;  2M1C A;  3MQO A;  2QWS A;  4BBT A;  4DJ3 A;  5HZH A;  5HWT A;  4E04 A;  3PHY A;  1S4R A;  2JHE A;  1GSX A;  4H6J B;  4NXG A;  1XJ6 A;  3HJK A;  1LSX A;  3NOU C;  4XT2 A;  1P97 A;  3FG8 A;  5J7E A;  4GS9 B;  1OJ5 A;  5HSQ A;  3LIC A;  3LYX A;  2ZBB A;  3E4P A;  3UB6 A;  3IBR A;  5F68 A;  1JNU A;  1OTA A;  5EFW A;  3P7N A;  4BBU A;  5KIZ A;  1EW0 A;  4F3L A;  1S67 L;  4LPZ A;  3H9W A;  3LI8 A;  2W0N A;  1BYW A;  5AVF A;  4HJ3 A;  4PKY A;  5TBM A;  4I3J A;  1DP8 A;  4HQA A;  2ZOH A;  1T18 A;  3UMD A;  3UB9 A;  2R78 A;  4B9O A;  4HJ6 A;  3MQQ A;  4HOI A;  3RH8 B;  4MN6 A;  5F5Y A;  2YKH A;  2PYR A;  3F1P B;  3LUQ A;  2QKP A;  3BWL A;  2VV7 A;  4PKY G;  2P7J A;  4R70 A;  3G6O A;  3ICY A;  4LRY C;  4YWZ A;  3BY8 A;  3H82 B;  3VE4 A;  5HWW A;  3NOP C;  4JGQ A;  3E4Q A;  3UB8 A;  3CWF A;  2L0W A;  2V1B A;  3C8C A;  3F1N B;  2HV1 A;  2L1M A;  2L4R A;  1GSV A;  3LIB A;  2KX6 A;  4HI4 A;  4EQ1 A;  2PHY A;  1UWP X;  2QJ7 A;  2D01 A;  3NHQ A;  1TS0 A;  3D72 A;  3MR0 A;  1N9O A;  2H28 A;  4LRX C;  3IS2 B;  2Z6C A;  3BY9 A;  3F1O A;  1XFQ A;  3LIF A;  5HWV A;  1OT6 A;  3C2W A;  3H7W A;  4L9G A;  1UWN X;  3RTY A;  4I3A A;  3VOL A;  3A0R A;  4HP4 A;  3EEH A;  4R38 A;  1XJ4 A;  2V0W A;  4XT2 B;  1TS7 A;  2VEA A;  2ZOI A;  1DP6 A;  4LLO B;  3K3D A;  5F6A A;  4KUO A;  1S1Y A;  2A24 A;  3EWK A;  1F9I A;  3F1O B;  2EA9 A;  3K3C A;  1S4S A;  3LI9 A;  5AVE A;  2QHK A;  4EET B;  2WKQ A;  3GDI A;  3SW1 A;  3MFX A;  1LL8 A;  1XFN A;  4WL9 A;  4HP9 A;  2I9V A;  4DJ2 A;  1OTD A;  1F98 A;  1VB6 A;  1TS8 A;  1T1C A;  2QJ5 A;  4F3L B;  4GHI A;  4R6L A;  2V9A A;  4I3I A;  4HNB A;  5HDS A;  2PR5 A;  4HJ4 A;  4HH3 A;  5IU1 A;  4WUJ A;  3VE3 A;  4GW9 A;  4WF0 A;  5TBM B;  4H6J A;  4EEU A;  4K08 A;  1T1B A;  2OWH A;  1OT9 A;  1XJ2 A;  2INW A;  3CAX A;  3UME A;  1LSV A;  4GS9 A;  4MN5 A;  2PR6 A;  1LT0 A;  3OLO A;  4I38 A;  1OTE A;  3PYP A;  4GHI B;  3ULF A;  5HDC A;  4GCZ A;  2WKR A;  4L9E A;  2JN7 A;  2OOL A;  5G4Z A;  4NXB A;  1OTB A;  4EW7 A;  1NWZ A;  3FC7 A;  5F69 A;  5HDD A;  2K7S A;  1DP9 A;  4HIA A;  1MZU A;  5DKL A;  2BAS A;  2KDK A;  5HD3 A;  3LIA A;  1ODV A;  2Z6D A;  3LID A;  4RQ9 A;  2GJ3 A;  4HH2 A;  1KOU A;  5DKK A;  2PYP A;  1OTI A;  1S66 L;  1Y28 A;  4R3A A;  2OWJ A;  2V1A A;  4KQD A;  3HJI A;  4JGP A;  4EXO A;  4I39 A;  2PD7 A;  3KX0 X;  1X0O A;  2J80 A;  1OJG A;  1GSW A;  5A8B A;  3A0S A;  4I5S A;  5J3W A;  3UE6 A;  4WN5 A;  3B33 A;  1LSW A;  3NJA A;  1G28 A;  5I5L A;  2VV6 A;  5IS1 A;  1D7E A;  2VLG A;  2CMN A;  4M4X A;  3F1P A;  1TS6 A;  3H7W B;  5J4E A;  4BBV A;  1T19 A;  3A0V A;  4NXE A;  3GEC A;  4EES A;  3MXQ A;  4EER A;  2PDR A; 
#chains in the Genus database with same CATH topology
 3UDI A;  3VFF A;  2PD8 A;  5GLC A;  4CLC C;  5G4Y A;  3T1R A;  1UGU A;  2VV8 A;  2JE5 A;  2V0U A;  3E98 A;  4E3J A;  1YPR A;  4KG5 A;  4QJG A;  3CUE A;  1MXO A;  2IWD A;  4OQH A;  4IUK A;  2D02 A;  3MZD A;  1DY6 A;  1CJF A;  3C38 A;  4QY6 A;  1XJ3 A;  1RGZ A;  3IX8 A;  4KUK A;  1P0Z A;  4WLA A;  2ZC6 B;  4KG6 A;  3RFB A;  3ITA A;  1N9L A;  1NLZ A;  3OPP A;  4JLF A;  5TJJ A;  2G2W A;  2XLN A;  2QMI A;  4EV4 A;  3W4Q A;  1V9Y A;  5FA7 A;  5KZH A;  4L9F A;  2ZC5 B;  1LI9 A;  3MJQ A;  1M40 A;  1YLW A;  3PBQ A;  2WYX A;  3WS1 A;  2QPN A;  1IYS A;  4OOY A;  4DE0 A;  1YLT A;  1NZU A;  2LB9 A;  3CZD A;  1PW1 A;  4H6J B;  3HJK A;  4KEN B;  3PAG A;  1LSX A;  2O9B A;  5J7E A;  1PZO A;  4GS9 B;  2KLI A;  1OJ5 A;  3EQV A;  2W1R A;  3G35 A;  2PU2 A;  2E8J A;  3N8L A;  3IWO A;  2A3U A;  1IYQ A;  1MY8 A;  1L0F A;  3UY6 A;  4H8R A;  5CHM A;  5F68 A;  4MLL A;  3CPT A;  5DF8 A;  4IHQ A;  5KIZ A;  1EW0 A;  5HAR A;  4LPZ A;  1F5M A;  3LI8 A;  2HF6 A;  2XD5 A;  3TRC A;  1BYW A;  1YAX A;  1SKF A;  5AVF A;  5EVE A;  4KZ4 A;  5JYO A;  3HLW A;  1AXB A;  4KG2 A;  1O7E A;  4YOF A;  1XKZ A;  2XFT A;  3W2Z A;  4ZTK A;  5FQK A;  3IF6 B;  3LGO A;  3LR5 A;  1NZO A;  2WGI A;  1MKM A;  2WUQ A;  4OPR A;  1ZG6 A;  4B9O A;  3MQQ A;  4ARZ B;  4O8G A;  3QP8 A;  4WEK A;  5FAT A;  5F5Y A;  3N4I A;  4YNR A;  2Y2N A;  1IEM A;  1E3U A;  3F1P B;  1JWP A;  2HJ9 C;  3FZC A;  3Q7V B;  4HES A;  3UPN A;  2P7J A;  1P9R A;  3DTE A;  4X1L A;  3HUO A;  4PPR A;  3LR0 A;  3G34 A;  3NOP C;  4ESP A;  4U0X A;  3UPP A;  4DDS A;  1ESI A;  3E4Q A;  1FOF A;  3UO9 A;  2B18 A;  5L07 A;  4FH2 A;  4GOG A;  5G18 A;  4E3M A;  4ME4 A;  4PM7 A;  5EVI D;  1K54 C;  2QJ7 A;  2Y2Q A;  5FDH A;  3T4S A;  1ERO A;  1Q2P A;  1ONH A;  1TS0 A;  4ZAM A;  3D72 A;  4QY5 A;  5AJG A;  1N9O A;  1YMX A;  1YSQ A;  5E2F A;  3IS2 B;  1JTG A;  3QP1 A;  2WGV A;  3F1O A;  1NLY A;  3LR4 A;  3CG5 A;  3C2W A;  4LV0 A;  4L9G A;  4C6Y A;  1W63 M;  3RTY A;  3UN7 A;  3ZG9 B;  2Y4A A;  3VP0 A;  5F82 A;  2V8C A;  2EX6 A;  3DW0 A;  4KQR A;  3MXS A;  3QP2 A;  1H8M A;  3IXD A;  2H0Y A;  2XEP A;  2V0W A;  5E2H A;  1ES4 A;  3SH7 A;  3OBF A;  3MF0 A;  1MBL A;  3IQA A;  4Y15 A;  3V3S A;  4NG2 A;  4LLO B;  4R23 A;  4IED A;  5GHY A;  4GB7 A;  5EUA A;  1N9B A;  3IHA A;  3K3C A;  2QHK A;  3G30 A;  2XD1 A;  1KGF A;  3SW1 A;  3MFX A;  3RXX A;  4P6B A;  1BSG A;  3GR2 A;  1PIO A;  4HP9 A;  4DJ2 A;  1F98 A;  3WS4 A;  1FIL A;  4U0T A;  3S4X A;  2QJ5 A;  4F3L B;  4DDY A;  3E0Y A;  3ZYT A;  4FH4 A;  4FCF A;  4IVK A;  4R6L A;  2V9A A;  3CUE C;  3P01 A;  2OAP 1;  4R1G A;  2XH9 A;  4HJ4 A;  3M6B A;  2CC1 A;  2Y59 A;  2VA0 A;  3WS2 A;  4K08 A;  4NK3 A;  5L09 A;  2VK3 A;  1NYY A;  3BQ8 A;  3DTM A;  3UME A;  3MS6 A;  1LSV A;  4E6X A;  1LLB A;  1LT0 A;  2K2N A;  4OP5 A;  1SDE A;  1K6S A;  2W1T A;  3NI9 A;  5DTS A;  4OPY A;  4GHI B;  3ZVW A;  5HDC A;  4GCZ A;  2C6W B;  5MC7 A;  3ZG8 B;  4ZDX A;  2E8I A;  2JN7 A;  2VZW A;  4OKP A;  1GHM A;  4JXW A;  3WRZ A;  3PTE A;  3R7W A;  1NWZ A;  4EW7 A;  4BL3 A;  2V1Z A;  3B3X A;  3MMH A;  1PWD A;  5HDD A;  3JVU A;  2PT7 A;  1FQG A;  4HIA A;  2H10 A;  2EX2 A;  5K5B A;  4Y13 A;  3FV7 A;  2GNX A;  2ACG A;  2C5W B;  5HD3 A;  2VGJ A;  4EBL A;  3SS4 A;  2GJ3 A;  4R0Q A;  2W3F A;  5CXW A;  3UE1 A;  2O9A A;  2PAV P;  2FZ0 A;  3ZDJ A;  4Q8I A;  3T4T A;  1Y28 A;  1W8Y A;  4OLD A;  4R3A A;  1K57 A;  2ZL1 B;  4KZ9 A;  1KGG A;  3HJI A;  3TG9 A;  1L0G A;  3HLB A;  4EXO A;  4I39 A;  3QP6 A;  5TR7 A;  4WEL A;  5EM0 A;  1BLS A;  1BUE A;  1KE3 A;  1H8Z A;  5L10 A;  3IXG A;  3A0S A;  3ZVT A;  4I5S A;  4FTX A;  3UE6 A;  3IHB A;  1JVJ A;  4Y5F A;  1ZC2 A;  3B33 A;  3OCN A;  4LFU A;  1CI8 A;  1K0K A;  3MZE A;  2HJE A;  4N92 A;  1PWG A;  1AWI A;  4R3J A;  4P6Z S;  4GDN A;  1FR6 A;  3MXQ A;  2PDR A;  3BFC A;  4HY8 A;  2V2F F;  1SZV A;  4X25 A;  2P9V B;  4GNU A;  2EX9 A;  4AFI A;  3G2Z A;  5AQ9 A;  3B42 A;  4G3W A;  2J3T D;  3A3F A;  5DFX A;  1G6A A;  5EEC A;  2B5R A;  2A24 B;  4S2L A;  3GVB A;  4OH0 A;  1WA9 A;  1IKI A;  1N9N A;  4DE3 A;  1T1A A;  2XQZ A;  5DTK A;  1XGJ A;  3M2J A;  5DJT A;  5FQM A;  2ZC3 B;  4P0M A;  2ZD8 A;  1J9M A;  2WKP A;  1DJC A;  2X71 A;  2W27 A;  3Q1F A;  1CEF A;  4LRZ E;  3QP5 A;  5AQ7 A;  4JGO A;  2M1C A;  3OPR A;  5EVI A;  2JBF A;  4OQG A;  3CHW P;  1K55 A;  2VJW A;  2Q0O A;  4OQI A;  4NEE D;  4UHU A;  3SH8 A;  1ACF A;  1P97 A;  5GLD A;  5GHX A;  4K0X A;  1IOU A;  2V8F A;  1GA0 A;  5HSQ A;  3LIC A;  1FSY A;  4KZB A;  3P09 A;  3UPO A;  4QWO A;  1KVM A;  4G3K A;  1Y4O A;  3T1X A;  4JF4 A;  1OTA A;  4MBK A;  4BD1 A;  4PM9 A;  2JKF A;  4BBU A;  3T4O A;  4S2O A;  1FCM A;  3C4O A;  1KE0 A;  3LY3 A;  4E3I A;  4L0L A;  1CI9 A;  2ZC7 A;  1BLH A;  4BMW A;  1QMF A;  4JBF A;  5KSC A;  3QNC A;  1JWZ A;  4HJ3 A;  1ONG A;  3UE0 A;  3PBN A;  4O0P A;  1ERQ A;  5TBM A;  4I3J A;  2Q9M A;  4X69 A;  4UA7 A;  1XXM A;  2GX5 A;  3W4O A;  2O9C A;  1DP8 A;  2ZQ8 A;  1VET B;  4HQA A;  3UB9 A;  2R78 A;  3N7W A;  3IWI A;  1H3Q A;  2WAE A;  3N8R A;  3JVV A;  3RH8 B;  1NY0 A;  3DAV A;  3NC8 A;  3UNW A;  4JF6 A;  1FSW A;  4WZ4 A;  4MBF A;  1ERM A;  2YKH A;  4WMC D;  3Q82 A;  3LEZ A;  4QD4 A;  5KSH A;  2QKP A;  2UV0 E;  3VSL A;  2WZZ A;  3EQU A;  4LV3 A;  3KSH A;  3T1Q B;  4LGW A;  3G6O A;  4YWZ A;  4S2I A;  3BY8 A;  3H82 B;  4DXB A;  2BG1 A;  2OAQ 1;  5HWW A;  4CPK A;  3E2L A;  5CGS A;  2L0W A;  2NUP C;  2V1B A;  3F1N B;  2HV1 A;  2XR0 A;  3KYE A;  4WZ5 A;  2BLS A;  4CJN A;  3PXP A;  4EQ1 A;  2Y2M A;  3ITB A;  2G2U A;  3AGD A;  1TVF A;  5GLA A;  3I7J A;  2PBY A;  2HP6 A;  2HPB A;  4DN0 A;  5FQJ A;  5E2G A;  1SKO A;  3BY9 A;  4B4X A;  3U4L P;  3LIF A;  5HWV A;  3ZG0 A;  4UA9 A;  2G7U A;  4UEY A;  1PI4 A;  1UWN X;  3W8K A;  2HZ5 A;  3D3O A;  1MC0 A;  3IH9 A;  4ETX A;  4I3A A;  1K57 C;  4Y0U A;  4S2N C;  1I2W A;  1K56 D;  1TEM A;  1KVL A;  5HL6 A;  4XT2 B;  1PI5 A;  3BRM A;  3NCK A;  1DP6 A;  5A90 A;  2VX8 A;  4WEJ A;  3IF5 A;  4KUO A;  3BFG A;  5DVA A;  3HLD A;  2RCX A;  1H0M A;  3F1O B;  4JXS A;  3LO7 A;  3LI9 A;  4QB8 A;  2JKR I;  3BEB A;  4EET B;  2EFX A;  4E3N A;  3T1S A;  1XGI A;  2ZQ9 A;  4ZBE A;  2ZC4 B;  1IKG A;  1BLP A;  4YIN A;  4X53 A;  3TSG A;  1T1C A;  2OLV A;  4RYE A;  3SZT A;  1OPX A;  4EBN A;  3VP4 A;  4EWF A;  2EWV A;  1GHP A;  3G2Y A;  5M1A A;  3DWZ A;  4P85 A;  4H6J A;  5FDS A;  4Y7P A;  5CHJ A;  4CLC B;  1OT9 A;  3HLG A;  3E2K A;  2EXB A;  3NUL A;  3TW8 A;  3K2N A;  4GS9 A;  3BYD A;  4X68 A;  1OTE A;  3ZCZ A;  4MDZ A;  2WKR A;  2WKH A;  5DTT A;  2H0T A;  5G4Z A;  4BWI A;  3FC7 A;  2UWX A;  5EVI C;  1MKI A;  5CRF A;  2O99 A;  2K7S A;  4Y2F A;  1L0D A;  4GLQ A;  3U2A A;  3EOI A;  4X6T A;  1IYO A;  2BAS A;  4OOM A;  2KOI A;  2WGW A;  4EU0 A;  1ODV A;  2EFU A;  5M19 A;  2BTF P;  3UDX A;  4HH2 A;  1PWC A;  4O01 A;  1OTI A;  3O87 A;  2H5S A;  4S2M A;  1PFL A;  2V1A A;  4KQD A;  4R4R A;  4JGP A;  4DE2 A;  4DKI A;  1DJA A;  4KQQ A;  3IF6 A;  2J80 A;  4OLG A;  5A8B A;  2ZM0 A;  5J3W A;  1MPL A;  4E3O A;  4ARZ A;  5FQQ A;  1LSW A;  5EM1 A;  3NJA A;  4IBX A;  4OOL A;  1G28 A;  5IS1 A;  5EOO A;  4M4X A;  5FI2 A;  3T4L A;  3F1P A;  3H7W B;  4N9K A;  1LL5 A;  4BBV A;  3Q7V A;  1ZKJ A;  5A93 A;  5CEC A;  3A0V A;  3GEC A;  4OP8 A;  4C3Q A;  4BJP A;  4EER A;  5FAS A;  3BLS A;  4WM9 A;  3SS3 A;  4HHD A;  2J3W A;  1TD5 A;  1W63 Q;  3PAE A;  3ZQ5 A;  2Z2M B;  3GMW A;  2Y2L A;  2W3D A;  4GD8 A;  4UAA A;  3IBJ A;  3T50 A;  5KMW A;  1BT5 A;  4DXC A;  3S1Y A;  1K38 A;  4UQI M;  3IXB A;  4WMC A;  4UQI S;  3M2K A;  3NBL A;  3SOI A;  3UB7 A;  4BD0 A;  3LFV A;  3LY4 A;  1BZA A;  1D06 A;  1A0K A;  3LIE A;  3CI6 A;  2WAF A;  3PBO A;  1S6R A;  3L7H A;  4KZ8 A;  2M7V A;  3DWK A;  3IS2 A;  1FR1 A;  4B88 A;  2WKI A;  2Y2I A;  3V50 A;  1SHV A;  3S7O A;  1XPB A;  2YKF A;  1ES3 A;  3LCE A;  4EQI A;  1STZ A;  3MQO A;  4BBT A;  4DJ3 A;  1VEU B;  2XDM A;  5HWT A;  4PM5 A;  4WZ5 C;  5GHZ A;  3PBT A;  1NYM A;  1G68 A;  2JHE A;  4NXG A;  4N9L A;  3Q7Z A;  3V39 A;  3FG8 A;  4IUH A;  2EXA A;  1GCE A;  4LV2 A;  4P87 A;  1PZP A;  5F83 A;  5DFY A;  3GV9 A;  2Y2P A;  1BUL A;  1LHY A;  2JKG A;  2ZBB A;  3OC2 A;  5IT5 A;  4FUW A;  3MKE A;  3UDF A;  4N1X A;  3V3R A;  1KDS A;  3UB6 A;  3EGX C;  4PM8 A;  1VHM A;  1HTZ A;  1JNU A;  5EVI B;  4Q0J A;  2Y91 A;  5EFW A;  3TJZ C;  3S7Q A;  5I94 A;  2QZ6 A;  1K56 A;  2W3H A;  4F3L A;  1S67 L;  1L2S A;  4P6Z M;  2W0N A;  4WYY A;  5FEF A;  1GA9 A;  3OZH A;  2ZMF A;  2JKT I;  4K0W A;  5HAQ A;  4MBH A;  2B95 A;  5DF9 A;  1IEL A;  2VGK A;  2Y2H A;  1U60 A;  1RCJ A;  3ZG7 B;  1L3L A;  1ESU A;  3MKF A;  1TDL A;  2EWW A;  2ZQ7 A;  1YSP A;  4Z9Q A;  3UMD A;  2VGL S;  3FPV A;  4QHC A;  3T4J A;  1SDN A;  3HCY A;  3DTK A;  2DRW A;  3HVF A;  3WS0 A;  3GSG A;  3O3V A;  4RVA A;  4MN6 A;  5EV0 A;  2I72 A;  2FFY A;  2J3T C;  2HDR A;  4F94 A;  4S2K A;  3O5Y A;  3LUQ A;  4MN7 A;  3VSK A;  1NRJ A;  4PKY G;  4R3B A;  1XP4 A;  2OLU A;  4D2O A;  4HBT A;  1E4D A;  3ZHH A;  4UA6 A;  1N4O A;  3A3J A;  5HFO A;  3FYZ A;  2M7U A;  1XA1 A;  3UB8 A;  3C7U A;  3NDG A;  3C8C A;  3CIT A;  2ZL1 A;  2L4R A;  4BLM A;  2KX6 A;  4HI4 A;  3NHQ A;  1ALQ A;  3IH8 A;  2QYB A;  3MR0 A;  3EGD C;  5EOE A;  4DMZ A;  2H28 A;  2X02 A;  4LRX C;  5J8X A;  3PBR A;  3BJN A;  4HEF A;  5A91 A;  3MQ0 A;  1JWV A;  4FSF A;  3CJM A;  2XRO A;  2WK0 A;  4B4Z A;  3G32 A;  2ZQC A;  3VOL A;  3GRJ A;  3A0R A;  3DTI A;  4IBR A;  4YFM A;  1HVB A;  4R38 A;  2P9V A;  5TGF A;  2P74 A;  2XFS A;  1MWU A;  2ZOI A;  3QP4 A;  2DMW A;  1NXY A;  5HPF A;  5A92 A;  3D4F A;  4QPR A;  1YKD A;  1M6K A;  1Q2Q A;  4E6W A;  2A24 A;  3EWK A;  1SKO B;  2K31 A;  1F9I A;  3MFD A;  2EA9 A;  5AVE A;  2XA7 S;  4JXG A;  3GDI A;  4Q0I A;  1CF0 A;  1XA7 A;  1XFN A;  4CLC D;  3NDE A;  1NJ4 A;  3FKV A;  3CPT B;  1W8Q A;  1W5D A;  2I9V A;  1OTD A;  1VB6 A;  1FIK A;  3IT9 A;  3WRT A;  3HL9 A;  1L0E A;  1ES2 A;  3JPU A;  3AGF A;  3A3E A;  3VMA A;  3PR6 A;  1EWZ A;  3NEC A;  5EPH A;  3SH9 A;  3EEA A;  5HDS A;  2X01 A;  3MZF A;  4WBG A;  2WZX A;  5L8M A;  5LBR A;  1NRF A;  2HDU A;  4MMN A;  4WUJ A;  3V5M A;  3QNB A;  3VE3 A;  4GW9 A;  4WF0 A;  1CQA A;  3A3D A;  1SCW A;  5JYP A;  1T1B A;  3HBR A;  5TFQ A;  4BQM A;  4ETZ A;  1PRQ A;  2INW A;  5HPI A;  4K91 A;  2W3E A;  4MN5 A;  5BOH A;  3OLO A;  2GDN A;  4I38 A;  4ZJ2 A;  3PYP A;  3PBS A;  1K4E A;  4MNR A;  4L9E A;  2AVX A;  3HUN A;  2DCF A;  2XF3 A;  1DP9 A;  4D60 A;  1K25 A;  2JKT M;  1DJB A;  1TF1 A;  2PU4 A;  3LIA A;  4BL2 A;  4XUX A;  1KDW A;  2XRN A;  3LID A;  4RQ9 A;  3P98 A;  5DKK A;  2PYP A;  4HBU A;  5FAQ A;  3DBA A;  5CEB A;  4Q0H A;  4GKU A;  2OWJ A;  1K4F A;  2R9X A;  3BW6 A;  1KE4 A;  3KX0 X;  4KZ3 A;  1VET A;  1GSW A;  2XSS A;  2MJ6 A;  2DNS A;  1HZO A;  4XUZ A;  5HX9 A;  1LI0 A;  1QME A;  3RXW A;  2JCH A;  2ZQA A;  1CK3 A;  1ZTU A;  3VP3 A;  1D1J A;  5I5L A;  5CHU A;  4O7D A;  2WGW B;  3TE8 A;  4PMA A;  2VLG A;  1TS6 A;  5E43 A;  1I5Q A;  1CEG A;  1T19 A;  4NXE A;  4EES A;  3KO6 A;  2LB5 A;  2ZMV A;  1PNE A;  2FFF B;  3C7V A;  3ISG A;  1F2K A;  3LR3 A;  3H82 A;  2Y8H A;  5D3O A;  1VM1 A;  3T4K A;  1O07 A;  3NOT C;  1KGE A;  3KSG A;  3F1N A;  1S1Z A;  3HRE A;  4MCW A;  2Y2O A;  4EEP A;  1JTD A;  1E25 A;  4RX2 A;  3KSF A;  2B02 A;  5HD5 A;  4NXF A;  2Y2J A;  2IA2 A;  2ZQD A;  4C75 A;  1I2S A;  1DRM A;  2RL3 A;  1P9W A;  5DJU A;  4JF5 A;  3OPH A;  3D9Y A;  2ZM8 A;  1V9Z A;  3CLO A;  5CX7 A;  4GDB A;  5FQ9 A;  4Y0O A;  4JGR A;  3T12 B;  3E4O A;  1W7F A;  4LEN A;  3W4P A;  2QWS A;  3V67 A;  4FD8 A;  4BEN A;  4RX3 A;  5HZH A;  3Q07 A;  1K55 C;  4E04 A;  3PHY A;  3O88 A;  3IXH A;  5GLB A;  1S4R A;  3BFF A;  1GSX A;  4EUV A;  2J7V A;  5FEG A;  2Y2K A;  3BQA A;  1XJ6 A;  1G6O A;  2VKS A;  3ZFZ A;  4E3K A;  3KSI A;  3NOU C;  4XT2 A;  5CGX A;  1EI5 A;  3OOV A;  4KZ5 A;  5C5K A;  2XK1 A;  2W3G A;  1ES5 A;  4GD6 A;  2W1T B;  3SS5 A;  3LYX A;  3IX3 A;  4Z1W A;  1PYY A;  3BLM A;  2P08 A;  3E4P A;  3VOY A;  3MSH A;  3RJU A;  2WAD A;  3IBR A;  3R7W B;  1FCN A;  3AGE A;  3P7N A;  1K6R A;  3C30 A;  3HLE A;  3O86 A;  4II7 A;  2EX8 A;  3H9W A;  3NY4 A;  1YT4 A;  4Y0T A;  1YM1 A;  2NUT C;  5CTM A;  2OSU A;  1IFQ A;  4PKY A;  2J9O A;  1C3B A;  1RGY A;  4CLC A;  4JXV A;  1VQQ A;  3IX4 A;  2ZOH A;  3S7P A;  1T18 A;  2P04 A;  2A49 A;  4HJ6 A;  4HOI A;  3WS5 A;  3B47 A;  4QU3 A;  2ZM2 A;  3VP1 A;  5F1G A;  5F1F A;  2PYR A;  4GZB A;  3HUM A;  5FAO A;  5FI7 A;  3BWL A;  2ZLY A;  3WWX A;  2VV7 A;  4OVD A;  3HLF A;  1HLU P;  4LCM A;  1RP5 A;  3OPL A;  5HL1 A;  3UB5 P;  3FKW A;  4R70 A;  1Z09 A;  4EUZ A;  2PRF A;  2Y79 A;  3ICY A;  4LRY C;  4X56 A;  4G3V A;  1IYP A;  3VE4 A;  4FOF A;  2Y2G A;  4JGQ A;  3A3I A;  2A2L A;  5HAI A;  4OQ0 A;  2GZA A;  2J8Y A;  4EBP A;  3CWF A;  5EVL A;  4A5R A;  4ZJ1 A;  4GJ4 A;  2L1M A;  1GSV A;  3LIB A;  4R4S A;  3FPW A;  2FH5 A;  4KZA A;  2PHY A;  1UWP X;  2D01 A;  5U47 A;  3C4P A;  2OV5 A;  4MEZ A;  2JKR M;  4OPQ A;  2J9P A;  3BM6 A;  1YLJ A;  5CTN A;  1YMS A;  3S7N A;  3MBZ A;  1WE4 A;  4DRT A;  1OME A;  2Z6C A;  4N1H A;  3ZNT A;  4GN2 A;  4JKT A;  1XFQ A;  3JYI A;  1OT6 A;  5L2F A;  3H7W A;  4IVI A;  1HD8 A;  3ZGA B;  2IWB A;  3TOI A;  3N8S A;  3S22 A;  4HP4 A;  4LV1 A;  5AQA A;  4S2N A;  2HP5 A;  1MWT A;  3BFD A;  3EEH A;  3CMZ A;  4Y3I A;  1XJ4 A;  1S0W A;  4CQH A;  1YLY A;  1TS7 A;  4U3T A;  2VEA A;  3L9K A;  1TDG A;  4NET A;  4B93 A;  1GHI A;  3UE3 A;  3K3D A;  4Y17 A;  3Q81 A;  1ZHH B;  1J3W A;  5F6A A;  4CLC E;  3G4P A;  1S1Y A;  5CER A;  2Q9N A;  4LCL A;  3VP2 A;  1S4S A;  2WKQ A;  2VGL M;  1LL8 A;  4X55 A;  3VOZ A;  4WL9 A;  2O0Y A;  1FCO A;  4KZ6 A;  4S2P A;  1TS8 A;  4RA7 A;  4GHI A;  2WKE A;  1BLC A;  3BFE A;  1LL9 A;  4I3I A;  4ID4 A;  4NKP A;  4HNB A;  3T4Q A;  4PAU A;  1VEU A;  4ZJ3 A;  1E3U D;  2PR5 A;  2Y55 A;  4JPM A;  3HLC A;  2ZJ9 A;  4HH3 A;  3C5A A;  4KQO A;  5IU1 A;  1H5X A;  5TBM B;  4EEU A;  3VFH A;  3KYQ A;  5HAP A;  4OPZ A;  4XXR A;  2OWH A;  5E2E A;  1XJ2 A;  3QHY A;  3BEC A;  4S2J A;  3CAX A;  2HP9 A;  2PR6 A;  1G5U A;  4DE1 A;  1ZG4 A;  3ULF A;  2ZMA A;  3NIA A;  1K54 A;  3OCL A;  2V20 A;  2OOL A;  4NXB A;  2Z2L B;  1OTB A;  1XX2 A;  5HW3 A;  5F69 A;  2HDS A;  5M18 A;  1PW8 A;  5FI6 A;  4E3L A;  4PHT A;  5FQI A;  2JC7 A;  1MZU A;  5DKL A;  1YQS A;  5AQB A;  3R4K A;  2KDK A;  2HGV A;  2HDQ A;  5FAP A;  1W79 A;  2Z6D A;  4DF6 A;  1KOU A;  1Z6F A;  3MXR A;  5IHV A;  1BTL A;  5DF7 A;  3LEQ A;  5GL9 A;  1S66 L;  4ZRR A;  3M6H A;  2R9W A;  1WYC A;  3GTC A;  3IF6 C;  1YLZ A;  2PD7 A;  1X0O A;  1OJG A;  5FL3 A;  2PBD P;  3ZNY A;  3FWL A;  3GQZ A;  4PM6 A;  4WN5 A;  4X1M A;  3G31 A;  1WYB A;  5EE8 A;  1YLP A;  2XGN A;  3N6I A;  1MWS A;  5CED A;  5CGW A;  3KYZ A;  2XA7 M;  4KZ7 A;  2VV6 A;  1D7E A;  3ZG5 A;  1H8Y A;  1Y54 A;  2CMN A;  5J4E A;  4OON A;  4IJG A;  5FSR A;  2IWC A;  4M3K A;  1MWR A;  3VV4 A;  3IWQ A; 
#chains in the Genus database with same CATH homology
 4HY8 A;  4HHD A;  2J3W A;  2PD8 A;  4CLC C;  1TD5 A;  3LR3 A;  5G4Y A;  1W63 Q;  1UGU A;  3H82 A;  2VV8 A;  2Y8H A;  3ZQ5 A;  4AFI A;  2W3D A;  3B42 A;  2V0U A;  3E98 A;  3IBJ A;  3T4K A;  3T50 A;  3NOT C;  3CUE A;  4G3W A;  3KSG A;  2J3T D;  3F1N A;  1S1Z A;  4IUK A;  4UQI M;  4MCW A;  2D02 A;  5DFX A;  4EEP A;  3C38 A;  2A24 B;  4UQI S;  1XJ3 A;  3KSF A;  2B02 A;  5HD5 A;  4NXF A;  4KUK A;  1WA9 A;  1P0Z A;  4WLA A;  2IA2 A;  1N9N A;  3UB7 A;  1DRM A;  1T1A A;  1P9W A;  3LFV A;  3RFB A;  1D06 A;  1N9L A;  5DJU A;  1NLZ A;  3LIE A;  3CI6 A;  5TJJ A;  3PBO A;  5DJT A;  2M7V A;  3IS2 A;  2WKP A;  1V9Z A;  3CLO A;  5CX7 A;  1V9Y A;  2W27 A;  4JGR A;  4L9F A;  4LRZ E;  3E4O A;  4JGO A;  3MJQ A;  3S7O A;  2YKF A;  2M1C A;  1STZ A;  3MQO A;  2QWS A;  3V67 A;  4BBT A;  4DJ3 A;  3PBQ A;  5HZH A;  5HWT A;  4E04 A;  3PHY A;  1S4R A;  2VJW A;  2LB9 A;  3PBT A;  2JHE A;  1GSX A;  4EUV A;  4H6J B;  4NXG A;  3BQA A;  1XJ6 A;  1G6O A;  2VKS A;  3HJK A;  4NEE D;  1LSX A;  3KSI A;  3NOU C;  4XT2 A;  1P97 A;  2O9B A;  3FG8 A;  5J7E A;  3OOV A;  4IUH A;  5C5K A;  1IOU A;  4GS9 B;  2KLI A;  1OJ5 A;  3EQV A;  2W3G A;  5HSQ A;  5DFY A;  2W1R A;  3LIC A;  2W1T B;  3LYX A;  2ZBB A;  3OC2 A;  5IT5 A;  4Z1W A;  2P08 A;  3E4P A;  3UB6 A;  3EGX C;  4G3K A;  3IBR A;  1VHM A;  5F68 A;  3R7W B;  1JNU A;  1OTA A;  4Q0J A;  5EFW A;  3P7N A;  3TJZ C;  3S7Q A;  3C30 A;  4BBU A;  3T4O A;  4IHQ A;  5KIZ A;  2W3H A;  1EW0 A;  4II7 A;  4F3L A;  1S67 L;  4LPZ A;  1F5M A;  4L0L A;  3H9W A;  3LI8 A;  4P6Z M;  4BMW A;  2W0N A;  2HF6 A;  3TRC A;  1BYW A;  1YAX A;  5AVF A;  2NUT C;  2ZMF A;  2JKT I;  4HJ3 A;  3PBN A;  1IFQ A;  4O0P A;  4PKY A;  5DF9 A;  5TBM A;  4I3J A;  4YOF A;  2GX5 A;  2O9C A;  2EWW A;  1DP8 A;  3W2Z A;  4CLC A;  3LR5 A;  4HQA A;  2ZOH A;  3S7P A;  1MKM A;  1T18 A;  1YSP A;  3UMD A;  3UB9 A;  2R78 A;  2VGL S;  2P04 A;  3FPV A;  4B9O A;  1H3Q A;  3T4J A;  4HJ6 A;  3MQQ A;  3HCY A;  4HOI A;  4ARZ B;  3RH8 B;  3JVV A;  3B47 A;  4O8G A;  4WEK A;  4MN6 A;  5F5Y A;  4YNR A;  2J3T C;  2YKH A;  2PYR A;  5KSH A;  3F1P B;  2HJ9 C;  3O5Y A;  3LUQ A;  4MN7 A;  2QKP A;  3BWL A;  1NRJ A;  2VV7 A;  4PKY G;  3EQU A;  2P7J A;  1P9R A;  3KSH A;  4R70 A;  3G6O A;  2Y79 A;  3ICY A;  4LRY C;  3LR0 A;  4YWZ A;  4G3V A;  3BY8 A;  3H82 B;  3VE4 A;  4FOF A;  2OAQ 1;  5HWW A;  3NOP C;  4JGQ A;  2A2L A;  2GZA A;  2M7U A;  3E4Q A;  3UB8 A;  3CWF A;  2L0W A;  2NUP C;  2V1B A;  2B18 A;  3C8C A;  3F1N B;  2HV1 A;  4ME4 A;  4GJ4 A;  2L1M A;  3CIT A;  2L4R A;  1GSV A;  3LIB A;  3FPW A;  2KX6 A;  4HI4 A;  2FH5 A;  3PXP A;  4EQ1 A;  2PHY A;  1UWP X;  2QJ7 A;  2D01 A;  3NHQ A;  3T4S A;  1TS0 A;  3D72 A;  2JKR M;  2QYB A;  3MR0 A;  3EGD C;  3S7N A;  4DMZ A;  5AJG A;  4DN0 A;  1N9O A;  2H28 A;  1YSQ A;  4LRX C;  3PBR A;  3IS2 B;  2Z6C A;  3BJN A;  3BY9 A;  3MQ0 A;  3F1O A;  1XFQ A;  3LIF A;  1NLY A;  3LR4 A;  1OT6 A;  5HWV A;  3C2W A;  4FSF A;  3H7W A;  2XRO A;  2G7U A;  4UEY A;  4L9G A;  1UWN X;  3D3O A;  1MC0 A;  1W63 M;  3RTY A;  4ETX A;  4I3A A;  3VOL A;  3A0R A;  4HP4 A;  1H8M A;  3EEH A;  4R38 A;  4Y3I A;  1XJ4 A;  2V0W A;  5HL6 A;  3OBF A;  4XT2 B;  3MF0 A;  4CQH A;  1TS7 A;  2VEA A;  2ZOI A;  2DMW A;  4B93 A;  1DP6 A;  5HPF A;  4LLO B;  2VX8 A;  3UE3 A;  3K3D A;  4QPR A;  4WEJ A;  1ZHH B;  1YKD A;  5F6A A;  4KUO A;  4CLC E;  1S1Y A;  2A24 A;  3EWK A;  2K31 A;  1F9I A;  3F1O B;  2EA9 A;  3K3C A;  1S4S A;  3LI9 A;  2JKR I;  2XA7 S;  2QHK A;  5AVE A;  4EET B;  2WKQ A;  2VGL M;  3GDI A;  4Q0I A;  3SW1 A;  3MFX A;  1LL8 A;  1XFN A;  4WL9 A;  4CLC D;  2O0Y A;  4HP9 A;  2I9V A;  4DJ2 A;  1OTD A;  1F98 A;  1VB6 A;  1TS8 A;  1T1C A;  2QJ5 A;  4F3L B;  4GHI A;  3E0Y A;  3ZYT A;  1OPX A;  4R6L A;  2V9A A;  4I3I A;  3PR6 A;  3CUE C;  4NKP A;  4HNB A;  3P01 A;  3EEA A;  2EWV A;  4PAU A;  5HDS A;  3T4Q A;  2OAP 1;  2PR5 A;  4HJ4 A;  4HH3 A;  5L8M A;  4KQO A;  5IU1 A;  5LBR A;  4MMN A;  4WUJ A;  2VA0 A;  3VE3 A;  4GW9 A;  4WF0 A;  5TBM B;  4H6J A;  4EEU A;  4K08 A;  3KYQ A;  1T1B A;  2OWH A;  3BQ8 A;  4CLC B;  4ETZ A;  1OT9 A;  1XJ2 A;  2INW A;  5HPI A;  3TW8 A;  3CAX A;  3K2N A;  3UME A;  1LSV A;  2W3E A;  4GS9 A;  4MN5 A;  2PR6 A;  1LT0 A;  2K2N A;  3OLO A;  4I38 A;  1OTE A;  3PYP A;  2W1T A;  3PBS A;  4MDZ A;  4GHI B;  3ULF A;  5HDC A;  4GCZ A;  5MC7 A;  2WKR A;  4L9E A;  3OCL A;  2JN7 A;  2VZW A;  2OOL A;  5G4Z A;  4NXB A;  4BWI A;  1OTB A;  3R7W A;  1NWZ A;  3FC7 A;  4EW7 A;  3MMH A;  5F69 A;  5HDD A;  2O99 A;  3JVU A;  2K7S A;  2PT7 A;  4Y2F A;  1DP9 A;  4HIA A;  4GLQ A;  2JKT M;  3U2A A;  4PHT A;  5K5B A;  3EOI A;  1MZU A;  5DKL A;  2BAS A;  4OOM A;  1TF1 A;  2GNX A;  2KOI A;  3R4K A;  2KDK A;  5HD3 A;  3LIA A;  4EU0 A;  2HGV A;  1ODV A;  2Z6D A;  2XRN A;  3LID A;  4RQ9 A;  2GJ3 A;  4HH2 A;  2W3F A;  1KOU A;  5DKK A;  2PYP A;  2O9A A;  2FZ0 A;  4O01 A;  3DBA A;  3T4T A;  4Q0H A;  1OTI A;  1S66 L;  1Y28 A;  4R3A A;  2OWJ A;  4ZRR A;  2V1A A;  4KQD A;  3HJI A;  4JGP A;  3BW6 A;  4EXO A;  4I39 A;  2PD7 A;  3KX0 X;  1X0O A;  2J80 A;  1OJG A;  4WEL A;  1GSW A;  2XSS A;  2MJ6 A;  5FL3 A;  5A8B A;  3A0S A;  4I5S A;  5J3W A;  3UE6 A;  4WN5 A;  4Y5F A;  4ARZ A;  3B33 A;  1LSW A;  3NJA A;  3OCN A;  4OOL A;  2HJE A;  3KYZ A;  1ZTU A;  2XA7 M;  1G28 A;  5I5L A;  2VV6 A;  5IS1 A;  1D7E A;  3TE8 A;  2VLG A;  2CMN A;  4M4X A;  3T4L A;  3F1P A;  1TS6 A;  3H7W B;  4P6Z S;  5J4E A;  4IJG A;  4BBV A;  1T19 A;  3A0V A;  4NXE A;  3GEC A;  4EES A;  3VV4 A;  3KO6 A;  4BJP A;  3MXQ A;  2LB5 A;  4EER A;  2ZMV A;  2PDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...