2L1MA

Solution structure of the eag domain of the herg (kv11.1) k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 2
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l1mA00
3LIFA 3A0SA 2PD8A 3NOUC 4EEPA 2JHEA 4EXOA 3F1NA 2PD7A 3ULFA 2W27A 4HJ4A 1DP6A 3OLOA 4I5SA 2INWA 3C8CA 5TBMB 4DJ3A 4GHIA 3IS2B 5HWTA 5HWWA 4NXFA 2D02A 1TS0A 3A0VA 3UB9A 4BBUA 4EESA 4HJ3A 3HJKA 5DKLA 1JNUA 1S66L 1P97A 4L9GA 1D06A 3RTYA 3LI9A 3FG8A 4JGQA 3NHQA 2M1CA 4I38A 4R6LA 3H7WA 4I39A 2WKPA 1KOUA 1XFNA 2GJ3A 1WA9A 3UMDA 3ZQ5A 5HDDA 3SW1A 4JGPA 3BY9A 4H6JB 1NWZA 1LSWA 1OTAA 1X0OA 1OJ5A 2KDKA 3IBRA 2VEAA 1T1AA 1OTIA 2ZOIA 2YKFA 1LSVA 1ODVA 3MJQA 1N9LA 2L4RA 2V9AA 3C2WA 3LYXA 3NOTC 4DJ2A 3PYPA 2QJ7A 4HH2A 4LPZA 4MN5A 2W0NA 1N9NA 3UB6A 3MR0A 2V0WA 3VE3A 2KX6A 3FC7A 3B33A 4E04A 1GSWA 5J7EA 1XJ3A 3LI8A 1XJ4A 3H82B 2CMNA 3MQQA 4M4XA 5F68A 4GS9B 4MN6A 3MXQA 1OTEA 1XJ6A 5DJUA 4F3LA 3H9WA 1OT6A 2JN7A 4YWZA 3T50A 2K7SA 2L1MA 2V1AA 4XT2A 3UB8A 4GS9A 2Z6DA 4HI4A 2VV8A 4JGRA 4BBVA 1OT9A 2WKQA 3LIAA 2PHYA 4GW9A 2OWJA 2V1BA 4F3LB 2A24B 3F1OB 1XJ2A 4HJ6A 2ZBBA 3UMEA 4I3AA 3KX0X 4EQ1A 1TS6A 2QHKA 3UB7A 2J80A 3F1PB 3MFXA 2OWHA 3BY8A 1T1CA 1P0ZA 4GCZA 4KUOA 4I3JA 4KQDA 2WKRA 5F5YA 1GSVA 3CAXA 5IU1A 1BYWA 4EEUA 2QKPA 3LICA 3IS2A 1G28A 2YKHA 4NXBA 4WUJA 5HZHA 4PKYG 3NJAA 5KIZA 1TS8A 1UGUA 1F98A 4HP9A 3CLOA 1S4RA 2VV6A 4LLOB 2Z6CA 5EFWA 2PYRA 4RQ9A 5G4YA 1OTBA 1S4SA 5J4EA 4HP4A 2PR5A 4R38A 5HD3A 1LT0A 3LIDA 1V9ZA 1XFQA 3EWKA 3H7WB 3MQOA 3NOPC 5A8BA 3G6OA 5DJTA 3RH8B 4HHDA 1LL8A 5HDSA 5TBMA 1MZUA 5G4ZA 3K3DA 4R3AA 5DKKA 4JGOA 4WL9A 4HH3A 1UWPX 3GDIA 5HDCA 3GECA 4EETB 2QWSA 2PR6A 5HD5A 5HWVA 3P7NA 2ZOHA 1S1YA 3LUQA 4KUKA 1S67L 3E4QA 5F69A 4HQAA 4WLAA 2P7JA 1V9YA 4L9EA 4NXGA 4HNBA 4H6JA 3D72A 3H82A 1OTDA 1Y28A 3PHYA 4B9OA 1N9OA 1OJGA 1UWNX 2I9VA 3CWFA 5F6AA 1DP8A 1TS7A 4HY8A 5AVEA 2L0WA 2V0UA 2H28A 2HV1A 4WF0A 4XT2B 2PDRA 1T18A 2VV7A 4EW7A 3VE4A 3LIBA 2QJ5A 1DRMA 1EW0A 1T1BA 2D01A 3E4OA 4EERA 3HJIA 1D7EA 2A24A 2B02A 2OOLA 1VB6A 3E4PA 2EA9A 3UE6A 4HOIA 2R78A 3BWLA 3EEHA 1LSXA 4K08A 3F1PA 5IS1A 1DP9A 4LRYC 1T19A 5HSQA 1F9IA 2VLGA 3A0RA 4BBTA 4LRXC 1GSXA 5I5LA 4HIAA 2PYPA 4NXEA 4LRZE 3LIEA 3K3CA 4R70A 3F1NB 2BASA 1S1ZA 4L9FA 4PKYA 3ICYA 5J3WA 5AVFA 3VOLA 3F1OA 4I3IA 4GHIB 4WN5A
chains in the Genus database with same CATH superfamily
1DY6A 1HLUP 2PD8A 4CQHA 3BFGA 4I5SA 2XA7M 3BW6A 5TBMB 1M6KA 4KENB 1J9MA 1P97A 3NI9A 1LL9A 4KZ5A 4JLFA 5GHXA 5DVAA 2PBYA 5EECA 1LSVA 3BECA 2XLNA 3PYPA 1IELA 4DMZA 2P9VA 1MC0A 2PBDP 2Y2KA 3GR2A 2ZL1A 1K38A 4X1LA 2B95A 4JGRA 5FASA 4BL3A 3BFEA 1YLZA 1CI8A 4PM6A 2OWHA 5IU1A 1KGFA 1VEUA 3SOIA 1PI5A 5J4EA 3EWKA 3ZVTA 1VEUB 4X53A 5HDSA 1TEMA 4RVAA 2EXBA 4HH3A 5HDCA 2VX8A 2WGVA 5CECA 1PW8A 1BULA 3LUQA 1SHVA 3C38A 3DTEA 1ACFA 1ES5A 3N7WA 5FI6A 2X01A 4CLCB 3DW0A 1L0GA 2HV1A 5EM1A 3QP6A 3SH8A 2VV7A 5HAPA 3VE4A 3CUEC 2G7UA 2J9OA 5AQAA 5L09A 3LFVA 4RX2A 5FATA 4BMWA 3VFHA 3HLDA 3MQ0A 2V8CA 3F1NB 1BLPA 1PZPA 4I3IA 3A0SA 4EXOA 4EBPA 3F1NA 3TJZC 4KG5A 4O0PA 3IHAA 2J8YA 4D60A 4EESA 3WS1A 5GHZA 3RTYA 4Y0OA 5FEFA 3QP1A 3IF5A 1KE3A 3PAGA 4IBRA 3G32A 3HREA 4PHTA 1CI9A 4MN5A 3DTMA 4U0TA 2V0WA 1JWPA 1BZAA 4E3IA 3VP0A 2IWBA 3SZTA 5DJUA 2P08A 4GS9A 1SKOB 4BJPA 3LIAA 2XROA 2ZQ9A 1XJ2A 2ZC5B 4X6TA 3SH9A 4WEKA 1P0ZA 3IQAA 3IS2A 3UDXA 4PKYG 4ETZA 2Y55A 1G5UA 4WMCA 1IKIA 4ARZA 2E8JA 5TBMA 5G4ZA 1KGGA 4ARZB 4BLMA 3JVUA 5FEGA 2XD5A 1G68A 4KZBA 4H6JA 3ZG7B 4CJNA 5A92A 2HDRA 4UA6A 4FH2A 3CMZA 3E0YA 4HY8A 5IT5A 2Y8HA 2H28A 4E3JA 2ZQ7A 1MY8A 2KOIA 3C4OA 4IBXA 3R7WA 4EERA 3TRCA 3BWLA 2BTFP 4ESPA 2EFUA 4BBTA 4NETA 3PBOA 5U47A 5J3WA 3VOLA 2ZD8A 4Y2FA 2Q0OA 4QHCA 4DJ3A 4UHUA 4UQIM 5EVIB 3KYZA 5HWWA 4X69A 2A2LA 1YSPA 3CJMA 4ZJ1A 4OPQA 4BQMA 1KOUA 1NYMA 5LBRA 2DNSA 4WZ4A 3U4LP 2ZJ9A 5M1AA 4DE1A 4KQRA 3JPUA 1OTEA 4OOLA 5CRFA 4LENA 1MXOA 3UMEA 4N1XA 1H8YA 5KZHA 5F5YA 1NY0A 4NXBA 4B93A 1G28A 4KZ8A 3EGXC 1YT4A 4OP5A 1UGUA 1S4RA 3E2LA 5DF8A 1LT0A 3NBLA 3NOPC 3G6OA 4GD6A 3HLFA 1HTZA 4FH4A 1XA1A 4R3AA 4WZ5C 3E98A 5KSHA 3LR4A 2PR6A 3NCKA 4MDZA 1SCWA 2Y2IA 2ZQAA 3PHYA 4B9OA 3Q81A 2HDQA 4HBUA 5FQIA 2D01A 4IVIA 4XUXA 1IKGA 2R78A 1LSXA 2UWXA 4MNRA 3P09A 1ZG4A 4NXEA 3ITBA 4S2KA 4XUZA 5IHVA 3LO7A 3MS6A 3CITA 2W27A 3OLOA 1WYBA 3KYEA 1W5DA 1PWGA 4ZDXA 4R6LA 1ONHA 4K0WA 4R23A 1MWRA 3IBRA 4Z9QA 2YKFA 4WZ5A 4UA9A 2ZQCA 1AXBA 5CGSA 2WKEA 3MQQA 5E43A 3VSKA 2L1MA 3Q7VA 4RA7A 4U3TA 4GW9A 2V1BA 2O9AA 3Q82A 2W1RA 3BY8A 4ZAMA 1FCMA 1Q2QA 1NRFA 3IWOA 4OPZA 4LLOB 5JYOA 2PYRA 5GLAA 4ZBEA 4HP4A 1XFQA 1LI0A 4Y5FA 4EUVA 3QNCA 2QPNA 4Q0HA 4CLCE 4PM9A 3G2YA 1YLPA 3GECA 2QWSA 3BQAA 4NXGA 4MEZA 1U60A 4OPYA 3H82A 3HLGA 5AVEA 5CXWA 3T1QB 2EWVA 5EVLA 3EEAA 3VOYA 1IYQA 1T18A 2BLSA 5FDHA 3NIAA 4PM7A 2A24A 2Y2HA 4K08A 4OQGA 5FI2A 2ZMFA 4GOGA 1O07A 1PZOA 3MFDA 2ZMVA 2VGLS 2WKHA 3ISGA 5EVIC 3RXWA 3N8SA 4NXFA 5CTMA 4YFMA 1YQSA 3NHQA 1CEFA 1K6SA 1ZTUA 3G2ZA 4H6JB 2FH5A 1JTGA 1T1AA 3UNWA 2Y2OA 5EUAA 1IFQA 3FC7A 4R4SA 1XX2A 3WRTA 1W63M 3IF6C 4M4XA 3KYQA 4CLCA 2JKRM 5EVID 4O8GA 3FZCA 5EE8A 4YWZA 4EUZA 1FCNA 4BBVA 3T4TA 3PXPA 3KX0X 1PWCA 3UB7A 4DE2A 4N92A 3NDEA 4FTXA 5F1GA 4I3JA 2ZC4B 4KZ4A 3LICA 1Y54A 3BFFA 3NY4A 1TS8A 5E2HA 2W3EA 3OC2A 1DJAA 5EPHA 3G35A 4RX3A 4EU0A 3BJNA 4EBLA 5HPIA 5J8XA 2XR0A 1P9RA 3T1RA 3BM6A 4LV0A 5F69A 4HQAA 1LLBA 5M18A 3CWFA 1BLHA 1PYYA 1ESUA 3C4PA 2Y91A 3OCNA 1SDNA 3UE6A 4HOIA 2E8IA 4GJ4A 3HBRA 3A3EA 3S7PA 3K2NA 2BASA 3VP2A 3O5YA 3V39A 4PM8A 4EEPA 4S2NA 4M3KA 4IUKA 1ZC2A 3ITAA 4O01A 1LI9A 1W63Q 3BLSA 1A0KA 5TFQA 1E3UA 3LEQA 1MKMA 4UA7A 3T4KA 3NOTC 4Z1WA 4HH2A 4CPKA 2ZLYA 2J3TC 1K57C 3B33A 3MSHA 4UEYA 2ZC7A 3SH7A 4Y0UA 1YKDA 2JN7A 3S7OA 2X02A 1FIKA 2EFXA 4N9LA 2VV8A 3GQZA 4Y3IA 3UO9A 2OWJA 5HAQA 3IX8A 2W3GA 4QU3A 3C7VA 3MFXA 3BRMA 3M2JA 4S2JA 4X68A 2Y2QA 2I72A 4ZTKA 3QHYA 1RGYA 2A3UA 1YLWA 1E3UD 1H8MA 5MC7A 3ZG0A 5JYPA 1V9ZA 5HX9A 3DWZA 1ALQA 1YMXA 2BG1A 5DTTA 4WM9A 3BLMA 3CPTA 4L9EA 3V5MA 2HP9A 4HNBA 4II7A 2I9VA 3OPHA 4FSFA 1PIOA 3HUOA 1L0EA 1GA0A 3MKEA 1BLCA 3DTIA 3S1YA 3HJIA 2NUPC 3KSGA 5CGWA 5FQKA 3L7HA 5HSQA 2B5RA 3DBAA 2WGWA 5I5LA 4P6ZM 4LRZE 5DTSA 4Q8IA 3K3CA 2XH9A 2XF3A 3T12B 2JHEA 5EV0A 2W1TB 3C8CA 3IXGA 1MWUA 3TSGA 3M6HA 4HJ3A 4OQ0A 3UB6A 1STZA 5EVEA 5FQJA 2Y4AA 4OLGA 4F94A 1TD5A 3FYZA 1P9WA 1S0WA 1OJ5A 4DRTA 1OTIA 3MJQA 5I94A 2HGVA 3V50A 5HW3A 4IVKA 5GLBA 4XXRA 3MZEA 2P9VB 4XT2A 3UB8A 2EX2A 4S2OA 4KZ7A 2OLVA 2UV0E 4R1GA 3A3JA 1AWIA 2FFFB 2WKIA 4NK3A 2J9PA 2MJ6A 4WBGA 3NJAA 1VM1A 2LB9A 5GL9A 2VV6A 1K25A 3W4PA 2PR5A 5M19A 1E25A 4HHDA 1IYPA 3U2AA 3HCYA 5A91A 5HD5A 1VHMA 4HESA 2Q9MA 4S2PA 4WLAA 2JC7A 3N8LA 3O86A 3D72A 2V2FF 1OTDA 1Y28A 1K54C 4JBFA 3HLBA 3ZG9B 4X1MA 4RYEA 5HFOA 1BTLA 2DRWA 4LRYC 1W8QA 1PNEA 1F9IA 4K91A 4PMAA 3T4SA 1Q2PA 1NLYA 1XA7A 1YAXA 4ZRRA 2VK3A 4S2NC 4KQQA 5FSRA 3LIFA 4G3VA 4HJ4A 1DP6A 1MPLA 3UY6A 1FCOA 2D02A 3UB9A 2HJ9C 3B3XA 2O99A 4I38A 3SS5A 4OKPA 4I39A 2AVXA 3KSHA 2R9XA 1KVLA 2ZM8A 2W0NA 4C3QA 3W8KA 3S7NA 3NC8A 5F68A 4GDNA 1FR6A 3PR6A 3MXQA 4F3LA 1EWZA 1PFLA 3JYIA 3GVBA 1YMSA 4JXVA 4X55A 1MKIA 2A24B 3A3FA 2IWDA 3IF6A 4S2IA 4E3NA 4EQ1A 4QJGA 4MBFA 4WEJA 2J3WA 3UPOA 1ES3A 2QKPA 3MZDA 2GNXA 3CUEA 5FAPA 4HP9A 4IJGA 3LGOA 1ZG6A 4YNRA 2OSUA 4EQIA 5A8BA 1LHYA 3RH8B 4DE0A 3VV4A 2H5SA 4WL9A 4JF5A 1MBLA 3GDIA 4CLCD 2RCXA 2WK0A 1KE0A 1N9BA 4QWOA 1JVJA 2JKGA 1BUEA 3ZCZA 3UB5P 1OJGA 1OMEA 4E3KA 1TS7A 5AJGA 3UE0A 2V0UA 5HL1A 2ZQDA 2PDRA 4P6BA 4EW7A 1DRMA 4NKPA 1T1BA 3E4OA 3E4PA 1VB6A 1H3QA 2W3DA 2X71A 1TVFA 2DCFA 5CHJA 2J3TD 4MCWA 1HD8A 3IHBA 3NULA 3NECA 1OPXA 3PTEA 3IBJA 2WGWB 2V20A 5CX7A 2K31A 2VA0A 5KSCA 4FD8A 1I2WA 1BSGA 1YLTA 5CHUA 3WWXA 4BD1A 4JGQA 3FG8A 5EVIA 1FSYA 4KZAA 2GJ3A 3UMDA 1L0FA 2NUTC 3G4PA 5L8MA 2L4RA 1H5XA 4DF6A 4QB8A 3UPPA 1RGZA 5DTKA 4ZJ3A 3A3IA 3OOVA 5E2EA 1NJ4A 3C30A 4R3JA 5TGFA 4OONA 3FPWA 2PHYA 3G30A 4B88A 4HJ6A 3OPPA 1ZKJA 1F2KA 2ZC3B 3CZDA 4JXWA 3T4LA 4E6WA 5EOEA 1S4SA 1H8ZA 4R38A 2HF6A 5DJTA 3B42A 2C5WB 3ZVWA 2O9BA 1YSQA 3K3DA 3KSIA 4JGOA 3GRJA 1NZUA 4HBTA 4P87A 1G6OA 2Z2MB 4GB7A 3ZHHA 3P01A 1ERQA 2R9WA 3WS4A 5CTNA 1FSWA 3V3SA 1D1JA 3EEHA 2B18A 5IS1A 3LIEA 4GHIB 4WN5A 2DMWA 3TOIA 4R4RA 4EWFA 1ES2A 2O9CA 4X25A 5GLCA 2C6WB 3MXSA 4BD0A 3VP1A 1QMEA 1KE4A 2OV5A 4JF6A 3D9YA 3HUNA 2XQZA 3TW8A 1HZOA 4MN7A 5FQMA 5HPFA 3QP8A 4GDBA 1YM1A 4E3MA 2H0TA 2XEPA 3BQ8A 4OP8A 3HUMA 1GHPA 3EGDC 3UE1A 3CG5A 1OT9A 4F3LB 1EI5A 1VQQA 3Q7VB 3UDFA 3P98A 1VETA 4KUOA 3CAXA 5KIZA 3QP5A 3CLOA 4RQ9A 5G18A 4OLDA 1JWZA 3MXRA 1DJBA 1IEMA 4WELA 4KZ9A 2Y59A 4P6ZS 5FL3A 2VGKA 1NRJA 2XFTA 2P74A 3M2KA 2GDNA 5HWVA 4N9KA 1S1YA 3E4QA 4GNUA 4DXBA 2P7JA 1V9YA 4OVDA 5F1FA 5FDSA 3G34A 4KG6A 2CC1A 4QPRA 1D7EA 4EBNA 4P0MA 3FKVA 2GZAA 3GSGA 3LY3A 4CLCC 5HARA 4R70A 3KO6A 1S1ZA 1NZOA 3ICYA 3ZFZA 1E4DA 2EX9A 3T1SA 1K56A 1L0DA 2K2NA 1ESIA 3TG9A 1O7EA 3FV7A 4PAUA 3OCLA 1TS0A 3A0VA 5E2GA 3C5AA 4GN2A 3EOIA 4LCMA 4Y15A 1XFNA 3SW1A 3UPNA 5HDDA 2QZ6A 3OBFA 1LSWA 3T4JA 4DXCA 1PI4A 2VEAA 1JTDA 1ODVA 3HLCA 5CHMA 4WYYA 4DJ2A 5FI7A 3W4QA 3T4OA 1XJ4A 3IXDA 1G6AA 3V3RA 5BOHA 4IEDA 4NEED 4B4XA 3EQUA 1DJCA 1MWTA 2QHKA 4YOFA 1GA9A 2VJWA 4OQIA 3OZHA 3BFCA 4UQIS 3MZFA 2Z6CA 2XSSA 4HEFA 1OTBA 5DFYA 2XD1A 2M7VA 3RJUA 4LFUA 1YLJA 5DKKA 4GKUA 4EETB 1UWPX 4C6YA 2ZOHA 5E2FA 4K0XA 1K55A 2Y2PA 1F5MA 1N9OA 2EX8A 1UWNX 5F6AA 2WZZA 1SKFA 3OPLA 5FAOA 1RCJA 2JKFA 1JWVA 2WUQA 2OOLA 4BL2A 5A90A 2EX6A 2ZMAA 3PBRA 3N4IA 1L2SA 3UE3A 3IF6B 1GHMA 1VETB 3ULFA 4GHIA 5HWTA 5FQ9A 1M40A 2G2WA 5F82A 4LV2A 2VKSA 3VOZA 3HVFA 3D3OA 1BLSA 2KLIA 4OQHA 2IWCA 2WZXA 3C2WA 3RXXA 3KSFA 3MR0A 1K0KA 2OAP1 2EXAA 3H82B 3WS0A 4GS9B 2O0YA 2ZM0A 3BYDA 3T50A 4E3LA 2Z2LB 2HDSA 2JKTM 2WKQA 3VP3A 2ZBBA 3AGEA 1L3LA 2ACGA 4OPRA 3R4KA 2PAVP 4KZ6A 4EEUA 5HZHA 1TDGA 1K55C 3S7QA 4QD4A 1F98A 5HAIA 3S22A 4DDYA 3QNBA 3H7WB 3MQOA 5CEDA 1LL8A 3EQVA 3MBZA 4PPRA 4FUWA 4ID4A 1CK3A 2Y79A 2H10A 4OH0A 5FQQA 3VSLA 1DP8A 2HPBA 3M6BA 3IX3A 1CQAA 1FR1A 1ZHHB 2Y2NA 1XPBA 3AGFA 1DP9A 3LCEA 4X56A 3AGDA 3IWIA 2XK1A 3ZNYA 4Y7PA 4YINA 3ZYTA 1ERMA 3WS2A 3NOUC 3CHWP 3W2ZA 2JKTI 2W1TA 1S66L 3VMAA 4L9GA 2QYBA 2M1CA 3DWKA 2JKRI 3ZQ5A 1WA9A 2GX5A 4GZBA 1K6RA 1Y4OA 1BT5A 5CERA 2QJ7A 4LPZA 2Q9NA 1XJ3A 2FZ0A 1I2SA 2ZQ8A 2WYXA 1K54A 3H9WA 3ZG5A 4BWIA 2Z6DA 2WADA 4LV3A 3E2KA 1XGIA 2ZL1B 3SS3A 3A3DA 2XDMA 1CEGA 3BFDA 4MMNA 3ZDJA 4GCZA 3IX4A 2EWWA 1KDSA 1BYWA 4WUJA 2YKHA 1EROA 3T4QA 3UDIA 2XA7S 2V8FA 1ES4A 5HD3A 3TE8A 2OAQ1 4FOFA 4JKTA 4N1HA 4G3WA 1MZUA 4Q0IA 4O7DA 4R0QA 4Y0TA 2Y2GA 4C75A 1FQGA 2ZM2A 2JCHA 3P7NA 2QMIA 3ZNTA 2H0YA 1J3WA 1K4FA 4ZJ2A 1RP5A 3LIBA 1EW0A 3CI6A 3WRZA 3B47A 3RFBA 1XGJA 2EA9A 1H0MA 5A93A 5DF7A 3QP2A 1WYCA 5TJJA 4JPMA 5KMWA 4PKYA 3ZG8B 3IXHA 1KVMA 3GMWA 2PD7A 4OOMA 5L07A 2INWA 2J7VA 5AQBA 4UAAA 4KG2A 4KZ3A 3HJKA 1JNUA 2HDUA 3H7WA 3PBTA 4JXSA 2WKPA 4Q0JA 4JGPA 3BY9A 2JE5A 4S2MA 1TDLA 5L10A 1NYYA 1N9LA 4QY6A 3HLEA 3VP4A 1K57A 1N9NA 3CPTB 2PRFA 2KX6A 1YPRA 4E04A 1S6RA 1IYSA 4MN6A 1KDWA 2PU4A 1XJ6A 4GLQA 4B4ZA 4MBHA 3ZGAB 2FFYA 1QMFA 1IYOA 2LB5A 1T1CA 1PW1A 1GSVA 1PRQA 2Y2MA 3OPRA 5EOOA 4EV4A 5C5KA 2P04A 4QY5A 1NLZA 3HL9A 1GHIA 3MMHA 3N6IA 3O88A 2HJEA 4KUKA 1S67L 5GHYA 4E3OA 4MLLA 2VGJA 3G31A 3IT9A 2L0WA 3O87A 4WF0A 2OLUA 3LR3A 3MKFA 3GV9A 3F1PA 4NG2A 1T19A 3Q7ZA 2VLGA 3PBNA 4LRXC 4DN0A 2PYPA 5FAQA 3VFFA 4L0LA 3O3VA 3FKWA 3C7UA 2HZ5A 4BBUA 3L9KA 5AQ7A 4IHQA 5GLDA 5TR7A 2VGLM 2W3FA 3LR0A 1OTAA 4H8RA 2KDKA 4I3AA 1SDEA 3I7JA 4Y13A 1K4EA 3JVVA 4DDSA 3VE3A 5J7EA 2XRNA 2RL3A 5D3OA 3N8RA 2XFSA 3IWQA 2VZWA 3Q1FA 2K7SA 4HI4A 4LV1A 4ME4A 3F1OB 1W7FA 1TS6A 2J80A 1Z09A 2Y2JA 1XKZA 4U0XA 3PBSA 2PT7A 5EFWA 2A49A 1KGEA 3FPVA 5G4YA 3LIDA 4WMCD 1TF1A 3IXBA 5CGXA 5HL6A 3WS5A 4JXGA 1XP4A 3QP4A 4XT2B 4DKIA 2QJ5A 4A5RA 3IH9A 1N4OA 3A0RA 3T1XA 2HP5A 1WE4A 4Y17A 5FA7A 4L9FA 4JF4A 4BENA 4G3KA 4R3BA 2IA2A 1FILA 3GTCA 4FCFA 3LR5A 3IS2B 3PAEA 4DE3A 1W79A 5DKLA 1I5QA 4AFIA 1D06A 4E6XA 3LI9A 4D2OA 1NWZA 1X0OA 1LL5A 2ZOIA 5L2FA 2V9AA 3LYXA 4PM5A 1GSWA 3LI8A 4S2LA 1HVBA 1W8YA 2CMNA 5AQ9A 4LCLA 1IOUA 3SS4A 1K56D 1OT6A 2V1AA 3W4OA 3HLWA 4OOYA 3Q07A 4GD8A 2WGIA 5DFXA 2Y2LA 3F1PB 1FOFA 2W3HA 1ONGA 3UN7A 1YLYA 2WAEA 2WKRA 4KQDA 4LGWA 3PBQA 1XXMA 3IH8A 1C3BA 3NDGA 3DTKA 4KQOA 3LY4A 5EM0A 1CF0A 2XGNA 1PWDA 1NXYA 5F83A 3MF0A 5CEBA 3S4XA 4P85A 1Z6FA 3FWLA 2G2UA 4IUHA 2ZC6B 5K5BA 2PU2A 3R7WB 3D4FA 2V1ZA 1GCEA 3V67A 1SKOA 2B02A 3DAVA 1MWSA 1CJFA 2WAFA 1GSXA 2HP6A 3BEBA 4HIAA 4MBKA 5DF9A 4ETXA 2JBFA 1SZVA 5AVFA 3F1OA 2M7UA 3LEZA
chains in the Genus database with same CATH topology
5CX7A 2K31A 2VA0A 2PD8A 3NOUC 4CQHA 4I5SA 3W2ZA 2XA7M 3BW6A 5TBMB 4NXFA 2JKTI 2W1TA 1S66L 1P97A 4L9GA 4JGQA 2QYBA 3FG8A 3NHQA 2M1CA 2JKRI 1ZTUA 2GJ3A 3UMDA 1WA9A 3ZQ5A 4H6JB 2NUTC 2GX5A 2FH5A 1T1AA 1LSVA 5L8MA 2L4RA 3PYPA 2QJ7A 4LPZA 1IFQA 3FC7A 4DMZA 1XJ3A 1W63M 3OOVA 4M4XA 1MC0A 3KYQA 2FZ0A 4CLCA 2JKRM 4O8GA 3C30A 3H9WA 4YWZA 4BWIA 2Z6DA 4JGRA 4BBVA 3FPWA 2PHYA 3T4TA 4HJ6A 3PXPA 3KX0X 3UB7A 4MMNA 2OWHA 4GCZA 2EWWA 4I3JA 5IU1A 1BYWA 3LICA 4WUJA 3T4LA 2YKHA 1TS8A 3T4QA 2W3EA 3OC2A 2XA7S 5J4EA 1S4SA 4R38A 5HD3A 2HF6A 3TE8A 3EWKA 2OAQ1 4FOFA 5DJTA 3B42A 4EU0A 3BJNA 2O9BA 4G3WA 1MZUA 5HDSA 4Q0IA 5HPIA 1YSQA 3K3DA 3KSIA 1P9RA 4JGOA 4HH3A 5HDCA 2VX8A 3P7NA 3LUQA 5F69A 3C38A 4HQAA 1G6OA 3P01A 4CLCB 3CWFA 2HV1A 2VV7A 3VE4A 3LIBA 3CUEC 1EW0A 2G7UA 3CI6A 3OCNA 3B47A 3RFBA 2EA9A 3LFVA 4HOIA 3UE6A 3EEHA 2B18A 4GJ4A 5IS1A 5TJJA 4BMWA 3MQ0A 3S7PA 3K2NA 3LIEA 3F1NB 2BASA 4PKYA 4I3IA 3O5YA 4GHIB 4WN5A 2DMWA 3A0SA 4EEPA 4EXOA 3F1NA 2PD7A 4IUKA 4OOMA 3TJZC 2INWA 2O9CA 4O0PA 4O01A 4EESA 3HJKA 1JNUA 1W63Q 3RTYA 3H7WA 3PBTA 2WKPA 4Q0JA 4JGPA 3BY9A 3TW8A 4PHTA 4Z1WA 1MKMA 1N9LA 3T4KA 3NOTC 4MN7A 4HH2A 4MN5A 5HPFA 1N9NA 2V0WA 2KX6A 2J3TC 3B33A 4E04A 4UEYA 3BQ8A 4MN6A 1XJ6A 5DJUA 1YKDA 2P08A 3EGDC 2JN7A 4GLQA 3S7OA 4GS9A 4BJPA 2VV8A 4Y3IA 1OT9A 3LIAA 2XROA 2OWJA 4F3LB 1XJ2A 2W3GA 2LB5A 3MFXA 4WEKA 1T1CA 1P0ZA 4KUOA 1GSVA 3CAXA 3IS2A 5KIZA 4PKYG 4ETZA 3CLOA 1H8MA 4RQ9A 5MC7A 1V9ZA 4ARZA 5C5KA 5TBMA 5G4ZA 2P04A 4WELA 1NLZA 4P6ZS 5FL3A 4ARZB 3MMHA 1NRJA 3JVUA 5HWVA 1S1YA 2HJEA 4KUKA 1S67L 3E4QA 2P7JA 1V9YA 4L9EA 4HNBA 4H6JA 4II7A 2I9VA 3E0YA 4HY8A 4FSFA 2Y8HA 2L0WA 5IT5A 2H28A 4WF0A 2KOIA 3R7WA 4QPRA 4EERA 3HJIA 1D7EA 3LR3A 2NUPC 3TRCA 3BWLA 3KSGA 3F1PA 2GZAA 1T19A 4CLCC 5HSQA 4BBTA 2VLGA 3DBAA 3PBNA 4LRXC 4DN0A 5I5LA 3PBOA 2PYPA 4P6ZM 4LRZE 3K3CA 4R70A 3KO6A 1S1ZA 5J3WA 3ICYA 3VOLA 4L0LA 4Y2FA 2JHEA 2K2NA 2W1TB 3C8CA 4DJ3A 4PAUA 4UQIM 3KYZA 5HWWA 3OCLA 1TS0A 3A0VA 4BBUA 2A2LA 4HJ3A 1YSPA 4IHQA 3UB6A 1STZA 3EOIA 2VGLM 2W3FA 1KOUA 1XFNA 1TD5A 3SW1A 3LR0A 5HDDA 3OBFA 1P9WA 1LSWA 1OTAA 3T4JA 1OJ5A 2KDKA 4I3AA 2VEAA 1OTIA 3MJQA 1ODVA 5LBRA 4DJ2A 2HGVA 3JVVA 3VE3A 3T4OA 5J7EA 2XRNA 1XJ4A 1OTEA 2VZWA 4OOLA 2K7SA 4NEED 4XT2A 3UB8A 3EQUA 4HI4A 4ME4A 3F1OB 3UMEA 1TS6A 2QHKA 4YOFA 2J80A 2VJWA 5F5YA 2MJ6A 4NXBA 4B93A 1G28A 3EGXC 3NJAA 3PBSA 2PT7A 2LB9A 1UGUA 4UQIS 5EFWA 1S4RA 2VV6A 2Z6CA 3FPVA 2XSSA 5DFYA 1OTBA 5G4YA 2PR5A 2M7VA 1LT0A 3LIDA 3NOPC 3G6OA 1TF1A 4HHDA 4R3AA 3U2AA 3E98A 3HCYA 5DKKA 5KSHA 4EETB 1UWPX 3LR4A 2PR6A 5HD5A 1VHMA 2ZOHA 4MDZA 5HL6A 4WLAA 3D72A 1OTDA 1Y28A 3PHYA 4B9OA 1F5MA 1N9OA 1UWNX 5F6AA 4XT2B 2QJ5A 2D01A 2OOLA 2R78A 1LSXA 4LRYC 1F9IA 3A0RA 3T4SA 3PBRA 1NLYA 1YAXA 4NXEA 4L9FA 4ZRRA 3UE3A 3LIFA 4G3KA 2IA2A 3CITA 4G3VA 3ULFA 2W27A 4HJ4A 1DP6A 3OLOA 4GHIA 3LR5A 3IS2B 5HWTA 2D02A 3UB9A 5DKLA 2HJ9C 4AFIA 2VKSA 1D06A 3LI9A 4R6LA 2O99A 4I38A 3D3OA 4I39A 3KSHA 2KLIA 1NWZA 1X0OA 3IBRA 2ZOIA 2YKFA 2V9AA 3C2WA 3LYXA 3KSFA 2W0NA 3MR0A 2OAP1 3S7NA 1GSWA 3LI8A 3H82B 2CMNA 3MQQA 5F68A 4GS9B 1IOUA 2O0YA 3PR6A 3MXQA 4F3LA 3T50A 1OT6A 2L1MA 2V1AA 2JKTM 2WKQA 4GW9A 2V1BA 2A24B 2O9AA 5DFXA 2ZBBA 4EQ1A 2W1RA 3F1PB 2W3HA 3BY8A 4WEJA 2J3WA 4KQDA 2WKRA 3R4KA 4EEUA 2QKPA 5HZHA 3PBQA 2GNXA 3S7QA 3CUEA 1F98A 4HP9A 4LLOB 2PYRA 4IJGA 4HP4A 4YNRA 1XFQA 5A8BA 3H7WB 3MQOA 4Y5FA 3RH8B 4EUVA 1LL8A 3EQVA 4KQOA 4Q0HA 4CLCE 3VV4A 4WL9A 3GDIA 4CLCD 3GECA 2QWSA 3MF0A 3BQAA 2Y79A 4NXGA 3H82A 4IUHA 5K5BA 1OJGA 5AVEA 3R7WB 2EWVA 1DP8A 1TS7A 3EEAA 5AJGA 2V0UA 3V67A 2PDRA 1T18A 4EW7A 1ZHHB 1DRMA 4NKPA 1T1BA 3E4OA 2A24A 2B02A 3E4PA 1VB6A 4K08A 1H3QA 2W3DA 1DP9A 2J3TD 2ZMFA 1GSXA 4MCWA 4HIAA 5DF9A 4ETXA 1OPXA 5AVFA 3F1OA 3ZYTA 2ZMVA 2VGLS 3IBJA 2M7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIF A;  3A0S A;  2PD8 A;  3NOU C;  4EEP A;  2JHE A;  4EXO A;  3F1N A;  2PD7 A;  3ULF A;  2W27 A;  4HJ4 A;  1DP6 A;  3OLO A;  4I5S A;  2INW A;  3C8C A;  5TBM B;  4DJ3 A;  4GHI A;  3IS2 B;  5HWT A;  5HWW A;  4NXF A;  2D02 A;  1TS0 A;  3A0V A;  3UB9 A;  4BBU A;  4EES A;  4HJ3 A;  3HJK A;  5DKL A;  1JNU A;  1S66 L;  1P97 A;  4L9G A;  1D06 A;  3RTY A;  3LI9 A;  3FG8 A;  4JGQ A;  3NHQ A;  2M1C A;  4I38 A;  4R6L A;  3H7W A;  4I39 A;  2WKP A;  1KOU A;  1XFN A;  2GJ3 A;  1WA9 A;  3UMD A;  3ZQ5 A;  5HDD A;  3SW1 A;  4JGP A;  3BY9 A;  4H6J B;  1NWZ A;  1LSW A;  1OTA A;  1X0O A;  1OJ5 A;  2KDK A;  3IBR A;  2VEA A;  1T1A A;  1OTI A;  2ZOI A;  2YKF A;  1LSV A;  1ODV A;  3MJQ A;  1N9L A;  2L4R A;  2V9A A;  3C2W A;  3LYX A;  3NOT C;  4DJ2 A;  3PYP A;  2QJ7 A;  4HH2 A;  4LPZ A;  4MN5 A;  2W0N A;  1N9N A;  3UB6 A;  3MR0 A;  2V0W A;  3VE3 A;  2KX6 A;  3FC7 A;  3B33 A;  4E04 A;  1GSW A;  5J7E A;  1XJ3 A;  3LI8 A;  1XJ4 A;  3H82 B;  2CMN A;  3MQQ A;  4M4X A;  5F68 A;  4GS9 B;  4MN6 A;  3MXQ A;  1OTE A;  1XJ6 A;  5DJU A;  4F3L A;  3H9W A;  1OT6 A;  2JN7 A;  4YWZ A;  3T50 A;  2K7S A;  2L1M A;  2V1A A;  4XT2 A;  3UB8 A;  4GS9 A;  2Z6D A;  4HI4 A;  2VV8 A;  4JGR A;  4BBV A;  1OT9 A;  2WKQ A;  3LIA A;  2PHY A;  4GW9 A;  2OWJ A;  2V1B A;  4F3L B;  2A24 B;  3F1O B;  1XJ2 A;  4HJ6 A;  2ZBB A;  3UME A;  4I3A A;  3KX0 X;  4EQ1 A;  1TS6 A;  2QHK A;  3UB7 A;  2J80 A;  3F1P B;  3MFX A;  2OWH A;  3BY8 A;  1T1C A;  1P0Z A;  4GCZ A;  4KUO A;  4I3J A;  4KQD A;  2WKR A;  5F5Y A;  1GSV A;  3CAX A;  5IU1 A;  1BYW A;  4EEU A;  2QKP A;  3LIC A;  3IS2 A;  1G28 A;  2YKH A;  4NXB A;  4WUJ A;  5HZH A;  4PKY G;  3NJA A;  5KIZ A;  1TS8 A;  1UGU A;  1F98 A;  4HP9 A;  3CLO A;  1S4R A;  2VV6 A;  4LLO B;  2Z6C A;  5EFW A;  2PYR A;  4RQ9 A;  5G4Y A;  1OTB A;  1S4S A;  5J4E A;  4HP4 A;  2PR5 A;  4R38 A;  5HD3 A;  1LT0 A;  3LID A;  1V9Z A;  1XFQ A;  3EWK A;  3H7W B;  3MQO A;  3NOP C;  5A8B A;  3G6O A;  5DJT A;  3RH8 B;  4HHD A;  1LL8 A;  5HDS A;  5TBM A;  1MZU A;  5G4Z A;  3K3D A;  4R3A A;  5DKK A;  4JGO A;  4WL9 A;  4HH3 A;  1UWP X;  3GDI A;  5HDC A;  3GEC A;  4EET B;  2QWS A;  2PR6 A;  5HD5 A;  5HWV A;  3P7N A;  2ZOH A;  1S1Y A;  3LUQ A;  4KUK A;  1S67 L;  3E4Q A;  5F69 A;  4HQA A;  4WLA A;  2P7J A;  1V9Y A;  4L9E A;  4NXG A;  4HNB A;  4H6J A;  3D72 A;  3H82 A;  1OTD A;  1Y28 A;  3PHY A;  4B9O A;  1N9O A;  1OJG A;  1UWN X;  2I9V A;  3CWF A;  5F6A A;  1DP8 A;  1TS7 A;  4HY8 A;  5AVE A;  2L0W A;  2V0U A;  2H28 A;  2HV1 A;  4WF0 A;  4XT2 B;  2PDR A;  1T18 A;  2VV7 A;  4EW7 A;  3VE4 A;  3LIB A;  2QJ5 A;  1DRM A;  1EW0 A;  1T1B A;  2D01 A;  3E4O A;  4EER A;  3HJI A;  1D7E A;  2A24 A;  2B02 A;  2OOL A;  1VB6 A;  3E4P A;  2EA9 A;  3UE6 A;  4HOI A;  2R78 A;  3BWL A;  3EEH A;  1LSX A;  4K08 A;  3F1P A;  5IS1 A;  1DP9 A;  4LRY C;  1T19 A;  5HSQ A;  1F9I A;  2VLG A;  3A0R A;  4BBT A;  4LRX C;  1GSX A;  5I5L A;  4HIA A;  2PYP A;  4NXE A;  4LRZ E;  3LIE A;  3K3C A;  4R70 A;  3F1N B;  2BAS A;  1S1Z A;  4L9F A;  4PKY A;  3ICY A;  5J3W A;  5AVF A;  3VOL A;  3F1O A;  4I3I A;  4GHI B;  4WN5 A; 
#chains in the Genus database with same CATH topology
 1DY6 A;  1HLU P;  2PD8 A;  4CQH A;  3BFG A;  4I5S A;  2XA7 M;  3BW6 A;  5TBM B;  1M6K A;  4KEN B;  1J9M A;  1P97 A;  3NI9 A;  1LL9 A;  4KZ5 A;  4JLF A;  5GHX A;  5DVA A;  2PBY A;  5EEC A;  1LSV A;  3BEC A;  2XLN A;  3PYP A;  1IEL A;  4DMZ A;  2P9V A;  1MC0 A;  2PBD P;  2Y2K A;  3GR2 A;  2ZL1 A;  1K38 A;  4X1L A;  2B95 A;  4JGR A;  5FAS A;  4BL3 A;  3BFE A;  1YLZ A;  1CI8 A;  4PM6 A;  2OWH A;  5IU1 A;  1KGF A;  1VEU A;  3SOI A;  1PI5 A;  5J4E A;  3EWK A;  3ZVT A;  1VEU B;  4X53 A;  5HDS A;  1TEM A;  4RVA A;  2EXB A;  4HH3 A;  5HDC A;  2VX8 A;  2WGV A;  5CEC A;  1PW8 A;  1BUL A;  3LUQ A;  1SHV A;  3C38 A;  3DTE A;  1ACF A;  1ES5 A;  3N7W A;  5FI6 A;  2X01 A;  4CLC B;  3DW0 A;  1L0G A;  2HV1 A;  5EM1 A;  3QP6 A;  3SH8 A;  2VV7 A;  5HAP A;  3VE4 A;  3CUE C;  2G7U A;  2J9O A;  5AQA A;  5L09 A;  3LFV A;  4RX2 A;  5FAT A;  4BMW A;  3VFH A;  3HLD A;  3MQ0 A;  2V8C A;  3F1N B;  1BLP A;  1PZP A;  4I3I A;  3A0S A;  4EXO A;  4EBP A;  3F1N A;  3TJZ C;  4KG5 A;  4O0P A;  3IHA A;  2J8Y A;  4D60 A;  4EES A;  3WS1 A;  5GHZ A;  3RTY A;  4Y0O A;  5FEF A;  3QP1 A;  3IF5 A;  1KE3 A;  3PAG A;  4IBR A;  3G32 A;  3HRE A;  4PHT A;  1CI9 A;  4MN5 A;  3DTM A;  4U0T A;  2V0W A;  1JWP A;  1BZA A;  4E3I A;  3VP0 A;  2IWB A;  3SZT A;  5DJU A;  2P08 A;  4GS9 A;  1SKO B;  4BJP A;  3LIA A;  2XRO A;  2ZQ9 A;  1XJ2 A;  2ZC5 B;  4X6T A;  3SH9 A;  4WEK A;  1P0Z A;  3IQA A;  3IS2 A;  3UDX A;  4PKY G;  4ETZ A;  2Y55 A;  1G5U A;  4WMC A;  1IKI A;  4ARZ A;  2E8J A;  5TBM A;  5G4Z A;  1KGG A;  4ARZ B;  4BLM A;  3JVU A;  5FEG A;  2XD5 A;  1G68 A;  4KZB A;  4H6J A;  3ZG7 B;  4CJN A;  5A92 A;  2HDR A;  4UA6 A;  4FH2 A;  3CMZ A;  3E0Y A;  4HY8 A;  5IT5 A;  2Y8H A;  2H28 A;  4E3J A;  2ZQ7 A;  1MY8 A;  2KOI A;  3C4O A;  4IBX A;  3R7W A;  4EER A;  3TRC A;  3BWL A;  2BTF P;  4ESP A;  2EFU A;  4BBT A;  4NET A;  3PBO A;  5U47 A;  5J3W A;  3VOL A;  2ZD8 A;  4Y2F A;  2Q0O A;  4QHC A;  4DJ3 A;  4UHU A;  4UQI M;  5EVI B;  3KYZ A;  5HWW A;  4X69 A;  2A2L A;  1YSP A;  3CJM A;  4ZJ1 A;  4OPQ A;  4BQM A;  1KOU A;  1NYM A;  5LBR A;  2DNS A;  4WZ4 A;  3U4L P;  2ZJ9 A;  5M1A A;  4DE1 A;  4KQR A;  3JPU A;  1OTE A;  4OOL A;  5CRF A;  4LEN A;  1MXO A;  3UME A;  4N1X A;  1H8Y A;  5KZH A;  5F5Y A;  1NY0 A;  4NXB A;  4B93 A;  1G28 A;  4KZ8 A;  3EGX C;  1YT4 A;  4OP5 A;  1UGU A;  1S4R A;  3E2L A;  5DF8 A;  1LT0 A;  3NBL A;  3NOP C;  3G6O A;  4GD6 A;  3HLF A;  1HTZ A;  4FH4 A;  1XA1 A;  4R3A A;  4WZ5 C;  3E98 A;  5KSH A;  3LR4 A;  2PR6 A;  3NCK A;  4MDZ A;  1SCW A;  2Y2I A;  2ZQA A;  3PHY A;  4B9O A;  3Q81 A;  2HDQ A;  4HBU A;  5FQI A;  2D01 A;  4IVI A;  4XUX A;  1IKG A;  2R78 A;  1LSX A;  2UWX A;  4MNR A;  3P09 A;  1ZG4 A;  4NXE A;  3ITB A;  4S2K A;  4XUZ A;  5IHV A;  3LO7 A;  3MS6 A;  3CIT A;  2W27 A;  3OLO A;  1WYB A;  3KYE A;  1W5D A;  1PWG A;  4ZDX A;  4R6L A;  1ONH A;  4K0W A;  4R23 A;  1MWR A;  3IBR A;  4Z9Q A;  2YKF A;  4WZ5 A;  4UA9 A;  2ZQC A;  1AXB A;  5CGS A;  2WKE A;  3MQQ A;  5E43 A;  3VSK A;  2L1M A;  3Q7V A;  4RA7 A;  4U3T A;  4GW9 A;  2V1B A;  2O9A A;  3Q82 A;  2W1R A;  3BY8 A;  4ZAM A;  1FCM A;  1Q2Q A;  1NRF A;  3IWO A;  4OPZ A;  4LLO B;  5JYO A;  2PYR A;  5GLA A;  4ZBE A;  4HP4 A;  1XFQ A;  1LI0 A;  4Y5F A;  4EUV A;  3QNC A;  2QPN A;  4Q0H A;  4CLC E;  4PM9 A;  3G2Y A;  1YLP A;  3GEC A;  2QWS A;  3BQA A;  4NXG A;  4MEZ A;  1U60 A;  4OPY A;  3H82 A;  3HLG A;  5AVE A;  5CXW A;  3T1Q B;  2EWV A;  5EVL A;  3EEA A;  3VOY A;  1IYQ A;  1T18 A;  2BLS A;  5FDH A;  3NIA A;  4PM7 A;  2A24 A;  2Y2H A;  4K08 A;  4OQG A;  5FI2 A;  2ZMF A;  4GOG A;  1O07 A;  1PZO A;  3MFD A;  2ZMV A;  2VGL S;  2WKH A;  3ISG A;  5EVI C;  3RXW A;  3N8S A;  4NXF A;  5CTM A;  4YFM A;  1YQS A;  3NHQ A;  1CEF A;  1K6S A;  1ZTU A;  3G2Z A;  4H6J B;  2FH5 A;  1JTG A;  1T1A A;  3UNW A;  2Y2O A;  5EUA A;  1IFQ A;  3FC7 A;  4R4S A;  1XX2 A;  3WRT A;  1W63 M;  3IF6 C;  4M4X A;  3KYQ A;  4CLC A;  2JKR M;  5EVI D;  4O8G A;  3FZC A;  5EE8 A;  4YWZ A;  4EUZ A;  1FCN A;  4BBV A;  3T4T A;  3PXP A;  3KX0 X;  1PWC A;  3UB7 A;  4DE2 A;  4N92 A;  3NDE A;  4FTX A;  5F1G A;  4I3J A;  2ZC4 B;  4KZ4 A;  3LIC A;  1Y54 A;  3BFF A;  3NY4 A;  1TS8 A;  5E2H A;  2W3E A;  3OC2 A;  1DJA A;  5EPH A;  3G35 A;  4RX3 A;  4EU0 A;  3BJN A;  4EBL A;  5HPI A;  5J8X A;  2XR0 A;  1P9R A;  3T1R A;  3BM6 A;  4LV0 A;  5F69 A;  4HQA A;  1LLB A;  5M18 A;  3CWF A;  1BLH A;  1PYY A;  1ESU A;  3C4P A;  2Y91 A;  3OCN A;  1SDN A;  3UE6 A;  4HOI A;  2E8I A;  4GJ4 A;  3HBR A;  3A3E A;  3S7P A;  3K2N A;  2BAS A;  3VP2 A;  3O5Y A;  3V39 A;  4PM8 A;  4EEP A;  4S2N A;  4M3K A;  4IUK A;  1ZC2 A;  3ITA A;  4O01 A;  1LI9 A;  1W63 Q;  3BLS A;  1A0K A;  5TFQ A;  1E3U A;  3LEQ A;  1MKM A;  4UA7 A;  3T4K A;  3NOT C;  4Z1W A;  4HH2 A;  4CPK A;  2ZLY A;  2J3T C;  1K57 C;  3B33 A;  3MSH A;  4UEY A;  2ZC7 A;  3SH7 A;  4Y0U A;  1YKD A;  2JN7 A;  3S7O A;  2X02 A;  1FIK A;  2EFX A;  4N9L A;  2VV8 A;  3GQZ A;  4Y3I A;  3UO9 A;  2OWJ A;  5HAQ A;  3IX8 A;  2W3G A;  4QU3 A;  3C7V A;  3MFX A;  3BRM A;  3M2J A;  4S2J A;  4X68 A;  2Y2Q A;  2I72 A;  4ZTK A;  3QHY A;  1RGY A;  2A3U A;  1YLW A;  1E3U D;  1H8M A;  5MC7 A;  3ZG0 A;  5JYP A;  1V9Z A;  5HX9 A;  3DWZ A;  1ALQ A;  1YMX A;  2BG1 A;  5DTT A;  4WM9 A;  3BLM A;  3CPT A;  4L9E A;  3V5M A;  2HP9 A;  4HNB A;  4II7 A;  2I9V A;  3OPH A;  4FSF A;  1PIO A;  3HUO A;  1L0E A;  1GA0 A;  3MKE A;  1BLC A;  3DTI A;  3S1Y A;  3HJI A;  2NUP C;  3KSG A;  5CGW A;  5FQK A;  3L7H A;  5HSQ A;  2B5R A;  3DBA A;  2WGW A;  5I5L A;  4P6Z M;  4LRZ E;  5DTS A;  4Q8I A;  3K3C A;  2XH9 A;  2XF3 A;  3T12 B;  2JHE A;  5EV0 A;  2W1T B;  3C8C A;  3IXG A;  1MWU A;  3TSG A;  3M6H A;  4HJ3 A;  4OQ0 A;  3UB6 A;  1STZ A;  5EVE A;  5FQJ A;  2Y4A A;  4OLG A;  4F94 A;  1TD5 A;  3FYZ A;  1P9W A;  1S0W A;  1OJ5 A;  4DRT A;  1OTI A;  3MJQ A;  5I94 A;  2HGV A;  3V50 A;  5HW3 A;  4IVK A;  5GLB A;  4XXR A;  3MZE A;  2P9V B;  4XT2 A;  3UB8 A;  2EX2 A;  4S2O A;  4KZ7 A;  2OLV A;  2UV0 E;  4R1G A;  3A3J A;  1AWI A;  2FFF B;  2WKI A;  4NK3 A;  2J9P A;  2MJ6 A;  4WBG A;  3NJA A;  1VM1 A;  2LB9 A;  5GL9 A;  2VV6 A;  1K25 A;  3W4P A;  2PR5 A;  5M19 A;  1E25 A;  4HHD A;  1IYP A;  3U2A A;  3HCY A;  5A91 A;  5HD5 A;  1VHM A;  4HES A;  2Q9M A;  4S2P A;  4WLA A;  2JC7 A;  3N8L A;  3O86 A;  3D72 A;  2V2F F;  1OTD A;  1Y28 A;  1K54 C;  4JBF A;  3HLB A;  3ZG9 B;  4X1M A;  4RYE A;  5HFO A;  1BTL A;  2DRW A;  4LRY C;  1W8Q A;  1PNE A;  1F9I A;  4K91 A;  4PMA A;  3T4S A;  1Q2P A;  1NLY A;  1XA7 A;  1YAX A;  4ZRR A;  2VK3 A;  4S2N C;  4KQQ A;  5FSR A;  3LIF A;  4G3V A;  4HJ4 A;  1DP6 A;  1MPL A;  3UY6 A;  1FCO A;  2D02 A;  3UB9 A;  2HJ9 C;  3B3X A;  2O99 A;  4I38 A;  3SS5 A;  4OKP A;  4I39 A;  2AVX A;  3KSH A;  2R9X A;  1KVL A;  2ZM8 A;  2W0N A;  4C3Q A;  3W8K A;  3S7N A;  3NC8 A;  5F68 A;  4GDN A;  1FR6 A;  3PR6 A;  3MXQ A;  4F3L A;  1EWZ A;  1PFL A;  3JYI A;  3GVB A;  1YMS A;  4JXV A;  4X55 A;  1MKI A;  2A24 B;  3A3F A;  2IWD A;  3IF6 A;  4S2I A;  4E3N A;  4EQ1 A;  4QJG A;  4MBF A;  4WEJ A;  2J3W A;  3UPO A;  1ES3 A;  2QKP A;  3MZD A;  2GNX A;  3CUE A;  5FAP A;  4HP9 A;  4IJG A;  3LGO A;  1ZG6 A;  4YNR A;  2OSU A;  4EQI A;  5A8B A;  1LHY A;  3RH8 B;  4DE0 A;  3VV4 A;  2H5S A;  4WL9 A;  4JF5 A;  1MBL A;  3GDI A;  4CLC D;  2RCX A;  2WK0 A;  1KE0 A;  1N9B A;  4QWO A;  1JVJ A;  2JKG A;  1BUE A;  3ZCZ A;  3UB5 P;  1OJG A;  1OME A;  4E3K A;  1TS7 A;  5AJG A;  3UE0 A;  2V0U A;  5HL1 A;  2ZQD A;  2PDR A;  4P6B A;  4EW7 A;  1DRM A;  4NKP A;  1T1B A;  3E4O A;  3E4P A;  1VB6 A;  1H3Q A;  2W3D A;  2X71 A;  1TVF A;  2DCF A;  5CHJ A;  2J3T D;  4MCW A;  1HD8 A;  3IHB A;  3NUL A;  3NEC A;  1OPX A;  3PTE A;  3IBJ A;  2WGW B;  2V20 A;  5CX7 A;  2K31 A;  2VA0 A;  5KSC A;  4FD8 A;  1I2W A;  1BSG A;  1YLT A;  5CHU A;  3WWX A;  4BD1 A;  4JGQ A;  3FG8 A;  5EVI A;  1FSY A;  4KZA A;  2GJ3 A;  3UMD A;  1L0F A;  2NUT C;  3G4P A;  5L8M A;  2L4R A;  1H5X A;  4DF6 A;  4QB8 A;  3UPP A;  1RGZ A;  5DTK A;  4ZJ3 A;  3A3I A;  3OOV A;  5E2E A;  1NJ4 A;  3C30 A;  4R3J A;  5TGF A;  4OON A;  3FPW A;  2PHY A;  3G30 A;  4B88 A;  4HJ6 A;  3OPP A;  1ZKJ A;  1F2K A;  2ZC3 B;  3CZD A;  4JXW A;  3T4L A;  4E6W A;  5EOE A;  1S4S A;  1H8Z A;  4R38 A;  2HF6 A;  5DJT A;  3B42 A;  2C5W B;  3ZVW A;  2O9B A;  1YSQ A;  3K3D A;  3KSI A;  4JGO A;  3GRJ A;  1NZU A;  4HBT A;  4P87 A;  1G6O A;  2Z2M B;  4GB7 A;  3ZHH A;  3P01 A;  1ERQ A;  2R9W A;  3WS4 A;  5CTN A;  1FSW A;  3V3S A;  1D1J A;  3EEH A;  2B18 A;  5IS1 A;  3LIE A;  4GHI B;  4WN5 A;  2DMW A;  3TOI A;  4R4R A;  4EWF A;  1ES2 A;  2O9C A;  4X25 A;  5GLC A;  2C6W B;  3MXS A;  4BD0 A;  3VP1 A;  1QME A;  1KE4 A;  2OV5 A;  4JF6 A;  3D9Y A;  3HUN A;  2XQZ A;  3TW8 A;  1HZO A;  4MN7 A;  5FQM A;  5HPF A;  3QP8 A;  4GDB A;  1YM1 A;  4E3M A;  2H0T A;  2XEP A;  3BQ8 A;  4OP8 A;  3HUM A;  1GHP A;  3EGD C;  3UE1 A;  3CG5 A;  1OT9 A;  4F3L B;  1EI5 A;  1VQQ A;  3Q7V B;  3UDF A;  3P98 A;  1VET A;  4KUO A;  3CAX A;  5KIZ A;  3QP5 A;  3CLO A;  4RQ9 A;  5G18 A;  4OLD A;  1JWZ A;  3MXR A;  1DJB A;  1IEM A;  4WEL A;  4KZ9 A;  2Y59 A;  4P6Z S;  5FL3 A;  2VGK A;  1NRJ A;  2XFT A;  2P74 A;  3M2K A;  2GDN A;  5HWV A;  4N9K A;  1S1Y A;  3E4Q A;  4GNU A;  4DXB A;  2P7J A;  1V9Y A;  4OVD A;  5F1F A;  5FDS A;  3G34 A;  4KG6 A;  2CC1 A;  4QPR A;  1D7E A;  4EBN A;  4P0M A;  3FKV A;  2GZA A;  3GSG A;  3LY3 A;  4CLC C;  5HAR A;  4R70 A;  3KO6 A;  1S1Z A;  1NZO A;  3ICY A;  3ZFZ A;  1E4D A;  2EX9 A;  3T1S A;  1K56 A;  1L0D A;  2K2N A;  1ESI A;  3TG9 A;  1O7E A;  3FV7 A;  4PAU A;  3OCL A;  1TS0 A;  3A0V A;  5E2G A;  3C5A A;  4GN2 A;  3EOI A;  4LCM A;  4Y15 A;  1XFN A;  3SW1 A;  3UPN A;  5HDD A;  2QZ6 A;  3OBF A;  1LSW A;  3T4J A;  4DXC A;  1PI4 A;  2VEA A;  1JTD A;  1ODV A;  3HLC A;  5CHM A;  4WYY A;  4DJ2 A;  5FI7 A;  3W4Q A;  3T4O A;  1XJ4 A;  3IXD A;  1G6A A;  3V3R A;  5BOH A;  4IED A;  4NEE D;  4B4X A;  3EQU A;  1DJC A;  1MWT A;  2QHK A;  4YOF A;  1GA9 A;  2VJW A;  4OQI A;  3OZH A;  3BFC A;  4UQI S;  3MZF A;  2Z6C A;  2XSS A;  4HEF A;  1OTB A;  5DFY A;  2XD1 A;  2M7V A;  3RJU A;  4LFU A;  1YLJ A;  5DKK A;  4GKU A;  4EET B;  1UWP X;  4C6Y A;  2ZOH A;  5E2F A;  4K0X A;  1K55 A;  2Y2P A;  1F5M A;  1N9O A;  2EX8 A;  1UWN X;  5F6A A;  2WZZ A;  1SKF A;  3OPL A;  5FAO A;  1RCJ A;  2JKF A;  1JWV A;  2WUQ A;  2OOL A;  4BL2 A;  5A90 A;  2EX6 A;  2ZMA A;  3PBR A;  3N4I A;  1L2S A;  3UE3 A;  3IF6 B;  1GHM A;  1VET B;  3ULF A;  4GHI A;  5HWT A;  5FQ9 A;  1M40 A;  2G2W A;  5F82 A;  4LV2 A;  2VKS A;  3VOZ A;  3HVF A;  3D3O A;  1BLS A;  2KLI A;  4OQH A;  2IWC A;  2WZX A;  3C2W A;  3RXX A;  3KSF A;  3MR0 A;  1K0K A;  2OAP 1;  2EXA A;  3H82 B;  3WS0 A;  4GS9 B;  2O0Y A;  2ZM0 A;  3BYD A;  3T50 A;  4E3L A;  2Z2L B;  2HDS A;  2JKT M;  2WKQ A;  3VP3 A;  2ZBB A;  3AGE A;  1L3L A;  2ACG A;  4OPR A;  3R4K A;  2PAV P;  4KZ6 A;  4EEU A;  5HZH A;  1TDG A;  1K55 C;  3S7Q A;  4QD4 A;  1F98 A;  5HAI A;  3S22 A;  4DDY A;  3QNB A;  3H7W B;  3MQO A;  5CED A;  1LL8 A;  3EQV A;  3MBZ A;  4PPR A;  4FUW A;  4ID4 A;  1CK3 A;  2Y79 A;  2H10 A;  4OH0 A;  5FQQ A;  3VSL A;  1DP8 A;  2HPB A;  3M6B A;  3IX3 A;  1CQA A;  1FR1 A;  1ZHH B;  2Y2N A;  1XPB A;  3AGF A;  1DP9 A;  3LCE A;  4X56 A;  3AGD A;  3IWI A;  2XK1 A;  3ZNY A;  4Y7P A;  4YIN A;  3ZYT A;  1ERM A;  3WS2 A;  3NOU C;  3CHW P;  3W2Z A;  2JKT I;  2W1T A;  1S66 L;  3VMA A;  4L9G A;  2QYB A;  2M1C A;  3DWK A;  2JKR I;  3ZQ5 A;  1WA9 A;  2GX5 A;  4GZB A;  1K6R A;  1Y4O A;  1BT5 A;  5CER A;  2QJ7 A;  4LPZ A;  2Q9N A;  1XJ3 A;  2FZ0 A;  1I2S A;  2ZQ8 A;  2WYX A;  1K54 A;  3H9W A;  3ZG5 A;  4BWI A;  2Z6D A;  2WAD A;  4LV3 A;  3E2K A;  1XGI A;  2ZL1 B;  3SS3 A;  3A3D A;  2XDM A;  1CEG A;  3BFD A;  4MMN A;  3ZDJ A;  4GCZ A;  3IX4 A;  2EWW A;  1KDS A;  1BYW A;  4WUJ A;  2YKH A;  1ERO A;  3T4Q A;  3UDI A;  2XA7 S;  2V8F A;  1ES4 A;  5HD3 A;  3TE8 A;  2OAQ 1;  4FOF A;  4JKT A;  4N1H A;  4G3W A;  1MZU A;  4Q0I A;  4O7D A;  4R0Q A;  4Y0T A;  2Y2G A;  4C75 A;  1FQG A;  2ZM2 A;  2JCH A;  3P7N A;  2QMI A;  3ZNT A;  2H0Y A;  1J3W A;  1K4F A;  4ZJ2 A;  1RP5 A;  3LIB A;  1EW0 A;  3CI6 A;  3WRZ A;  3B47 A;  3RFB A;  1XGJ A;  2EA9 A;  1H0M A;  5A93 A;  5DF7 A;  3QP2 A;  1WYC A;  5TJJ A;  4JPM A;  5KMW A;  4PKY A;  3ZG8 B;  3IXH A;  1KVM A;  3GMW A;  2PD7 A;  4OOM A;  5L07 A;  2INW A;  2J7V A;  5AQB A;  4UAA A;  4KG2 A;  4KZ3 A;  3HJK A;  1JNU A;  2HDU A;  3H7W A;  3PBT A;  4JXS A;  2WKP A;  4Q0J A;  4JGP A;  3BY9 A;  2JE5 A;  4S2M A;  1TDL A;  5L10 A;  1NYY A;  1N9L A;  4QY6 A;  3HLE A;  3VP4 A;  1K57 A;  1N9N A;  3CPT B;  2PRF A;  2KX6 A;  1YPR A;  4E04 A;  1S6R A;  1IYS A;  4MN6 A;  1KDW A;  2PU4 A;  1XJ6 A;  4GLQ A;  4B4Z A;  4MBH A;  3ZGA B;  2FFY A;  1QMF A;  1IYO A;  2LB5 A;  1T1C A;  1PW1 A;  1GSV A;  1PRQ A;  2Y2M A;  3OPR A;  5EOO A;  4EV4 A;  5C5K A;  2P04 A;  4QY5 A;  1NLZ A;  3HL9 A;  1GHI A;  3MMH A;  3N6I A;  3O88 A;  2HJE A;  4KUK A;  1S67 L;  5GHY A;  4E3O A;  4MLL A;  2VGJ A;  3G31 A;  3IT9 A;  2L0W A;  3O87 A;  4WF0 A;  2OLU A;  3LR3 A;  3MKF A;  3GV9 A;  3F1P A;  4NG2 A;  1T19 A;  3Q7Z A;  2VLG A;  3PBN A;  4LRX C;  4DN0 A;  2PYP A;  5FAQ A;  3VFF A;  4L0L A;  3O3V A;  3FKW A;  3C7U A;  2HZ5 A;  4BBU A;  3L9K A;  5AQ7 A;  4IHQ A;  5GLD A;  5TR7 A;  2VGL M;  2W3F A;  3LR0 A;  1OTA A;  4H8R A;  2KDK A;  4I3A A;  1SDE A;  3I7J A;  4Y13 A;  1K4E A;  3JVV A;  4DDS A;  3VE3 A;  5J7E A;  2XRN A;  2RL3 A;  5D3O A;  3N8R A;  2XFS A;  3IWQ A;  2VZW A;  3Q1F A;  2K7S A;  4HI4 A;  4LV1 A;  4ME4 A;  3F1O B;  1W7F A;  1TS6 A;  2J80 A;  1Z09 A;  2Y2J A;  1XKZ A;  4U0X A;  3PBS A;  2PT7 A;  5EFW A;  2A49 A;  1KGE A;  3FPV A;  5G4Y A;  3LID A;  4WMC D;  1TF1 A;  3IXB A;  5CGX A;  5HL6 A;  3WS5 A;  4JXG A;  1XP4 A;  3QP4 A;  4XT2 B;  4DKI A;  2QJ5 A;  4A5R A;  3IH9 A;  1N4O A;  3A0R A;  3T1X A;  2HP5 A;  1WE4 A;  4Y17 A;  5FA7 A;  4L9F A;  4JF4 A;  4BEN A;  4G3K A;  4R3B A;  2IA2 A;  1FIL A;  3GTC A;  4FCF A;  3LR5 A;  3IS2 B;  3PAE A;  4DE3 A;  1W79 A;  5DKL A;  1I5Q A;  4AFI A;  1D06 A;  4E6X A;  3LI9 A;  4D2O A;  1NWZ A;  1X0O A;  1LL5 A;  2ZOI A;  5L2F A;  2V9A A;  3LYX A;  4PM5 A;  1GSW A;  3LI8 A;  4S2L A;  1HVB A;  1W8Y A;  2CMN A;  5AQ9 A;  4LCL A;  1IOU A;  3SS4 A;  1K56 D;  1OT6 A;  2V1A A;  3W4O A;  3HLW A;  4OOY A;  3Q07 A;  4GD8 A;  2WGI A;  5DFX A;  2Y2L A;  3F1P B;  1FOF A;  2W3H A;  1ONG A;  3UN7 A;  1YLY A;  2WAE A;  2WKR A;  4KQD A;  4LGW A;  3PBQ A;  1XXM A;  3IH8 A;  1C3B A;  3NDG A;  3DTK A;  4KQO A;  3LY4 A;  5EM0 A;  1CF0 A;  2XGN A;  1PWD A;  1NXY A;  5F83 A;  3MF0 A;  5CEB A;  3S4X A;  4P85 A;  1Z6F A;  3FWL A;  2G2U A;  4IUH A;  2ZC6 B;  5K5B A;  2PU2 A;  3R7W B;  3D4F A;  2V1Z A;  1GCE A;  3V67 A;  1SKO A;  2B02 A;  3DAV A;  1MWS A;  1CJF A;  2WAF A;  1GSX A;  2HP6 A;  3BEB A;  4HIA A;  4MBK A;  5DF9 A;  4ETX A;  2JBF A;  1SZV A;  5AVF A;  3F1O A;  2M7U A;  3LEZ A; 
#chains in the Genus database with same CATH homology
 5CX7 A;  2K31 A;  2VA0 A;  2PD8 A;  3NOU C;  4CQH A;  4I5S A;  3W2Z A;  2XA7 M;  3BW6 A;  5TBM B;  4NXF A;  2JKT I;  2W1T A;  1S66 L;  1P97 A;  4L9G A;  4JGQ A;  2QYB A;  3FG8 A;  3NHQ A;  2M1C A;  2JKR I;  1ZTU A;  2GJ3 A;  3UMD A;  1WA9 A;  3ZQ5 A;  4H6J B;  2NUT C;  2GX5 A;  2FH5 A;  1T1A A;  1LSV A;  5L8M A;  2L4R A;  3PYP A;  2QJ7 A;  4LPZ A;  1IFQ A;  3FC7 A;  4DMZ A;  1XJ3 A;  1W63 M;  3OOV A;  4M4X A;  1MC0 A;  3KYQ A;  2FZ0 A;  4CLC A;  2JKR M;  4O8G A;  3C30 A;  3H9W A;  4YWZ A;  4BWI A;  2Z6D A;  4JGR A;  4BBV A;  3FPW A;  2PHY A;  3T4T A;  4HJ6 A;  3PXP A;  3KX0 X;  3UB7 A;  4MMN A;  2OWH A;  4GCZ A;  2EWW A;  4I3J A;  5IU1 A;  1BYW A;  3LIC A;  4WUJ A;  3T4L A;  2YKH A;  1TS8 A;  3T4Q A;  2W3E A;  3OC2 A;  2XA7 S;  5J4E A;  1S4S A;  4R38 A;  5HD3 A;  2HF6 A;  3TE8 A;  3EWK A;  2OAQ 1;  4FOF A;  5DJT A;  3B42 A;  4EU0 A;  3BJN A;  2O9B A;  4G3W A;  1MZU A;  5HDS A;  4Q0I A;  5HPI A;  1YSQ A;  3K3D A;  3KSI A;  1P9R A;  4JGO A;  4HH3 A;  5HDC A;  2VX8 A;  3P7N A;  3LUQ A;  5F69 A;  3C38 A;  4HQA A;  1G6O A;  3P01 A;  4CLC B;  3CWF A;  2HV1 A;  2VV7 A;  3VE4 A;  3LIB A;  3CUE C;  1EW0 A;  2G7U A;  3CI6 A;  3OCN A;  3B47 A;  3RFB A;  2EA9 A;  3LFV A;  4HOI A;  3UE6 A;  3EEH A;  2B18 A;  4GJ4 A;  5IS1 A;  5TJJ A;  4BMW A;  3MQ0 A;  3S7P A;  3K2N A;  3LIE A;  3F1N B;  2BAS A;  4PKY A;  4I3I A;  3O5Y A;  4GHI B;  4WN5 A;  2DMW A;  3A0S A;  4EEP A;  4EXO A;  3F1N A;  2PD7 A;  4IUK A;  4OOM A;  3TJZ C;  2INW A;  2O9C A;  4O0P A;  4O01 A;  4EES A;  3HJK A;  1JNU A;  1W63 Q;  3RTY A;  3H7W A;  3PBT A;  2WKP A;  4Q0J A;  4JGP A;  3BY9 A;  3TW8 A;  4PHT A;  4Z1W A;  1MKM A;  1N9L A;  3T4K A;  3NOT C;  4MN7 A;  4HH2 A;  4MN5 A;  5HPF A;  1N9N A;  2V0W A;  2KX6 A;  2J3T C;  3B33 A;  4E04 A;  4UEY A;  3BQ8 A;  4MN6 A;  1XJ6 A;  5DJU A;  1YKD A;  2P08 A;  3EGD C;  2JN7 A;  4GLQ A;  3S7O A;  4GS9 A;  4BJP A;  2VV8 A;  4Y3I A;  1OT9 A;  3LIA A;  2XRO A;  2OWJ A;  4F3L B;  1XJ2 A;  2W3G A;  2LB5 A;  3MFX A;  4WEK A;  1T1C A;  1P0Z A;  4KUO A;  1GSV A;  3CAX A;  3IS2 A;  5KIZ A;  4PKY G;  4ETZ A;  3CLO A;  1H8M A;  4RQ9 A;  5MC7 A;  1V9Z A;  4ARZ A;  5C5K A;  5TBM A;  5G4Z A;  2P04 A;  4WEL A;  1NLZ A;  4P6Z S;  5FL3 A;  4ARZ B;  3MMH A;  1NRJ A;  3JVU A;  5HWV A;  1S1Y A;  2HJE A;  4KUK A;  1S67 L;  3E4Q A;  2P7J A;  1V9Y A;  4L9E A;  4HNB A;  4H6J A;  4II7 A;  2I9V A;  3E0Y A;  4HY8 A;  4FSF A;  2Y8H A;  2L0W A;  5IT5 A;  2H28 A;  4WF0 A;  2KOI A;  3R7W A;  4QPR A;  4EER A;  3HJI A;  1D7E A;  3LR3 A;  2NUP C;  3TRC A;  3BWL A;  3KSG A;  3F1P A;  2GZA A;  1T19 A;  4CLC C;  5HSQ A;  4BBT A;  2VLG A;  3DBA A;  3PBN A;  4LRX C;  4DN0 A;  5I5L A;  3PBO A;  2PYP A;  4P6Z M;  4LRZ E;  3K3C A;  4R70 A;  3KO6 A;  1S1Z A;  5J3W A;  3ICY A;  3VOL A;  4L0L A;  4Y2F A;  2JHE A;  2K2N A;  2W1T B;  3C8C A;  4DJ3 A;  4PAU A;  4UQI M;  3KYZ A;  5HWW A;  3OCL A;  1TS0 A;  3A0V A;  4BBU A;  2A2L A;  4HJ3 A;  1YSP A;  4IHQ A;  3UB6 A;  1STZ A;  3EOI A;  2VGL M;  2W3F A;  1KOU A;  1XFN A;  1TD5 A;  3SW1 A;  3LR0 A;  5HDD A;  3OBF A;  1P9W A;  1LSW A;  1OTA A;  3T4J A;  1OJ5 A;  2KDK A;  4I3A A;  2VEA A;  1OTI A;  3MJQ A;  1ODV A;  5LBR A;  4DJ2 A;  2HGV A;  3JVV A;  3VE3 A;  3T4O A;  5J7E A;  2XRN A;  1XJ4 A;  1OTE A;  2VZW A;  4OOL A;  2K7S A;  4NEE D;  4XT2 A;  3UB8 A;  3EQU A;  4HI4 A;  4ME4 A;  3F1O B;  3UME A;  1TS6 A;  2QHK A;  4YOF A;  2J80 A;  2VJW A;  5F5Y A;  2MJ6 A;  4NXB A;  4B93 A;  1G28 A;  3EGX C;  3NJA A;  3PBS A;  2PT7 A;  2LB9 A;  1UGU A;  4UQI S;  5EFW A;  1S4R A;  2VV6 A;  2Z6C A;  3FPV A;  2XSS A;  5DFY A;  1OTB A;  5G4Y A;  2PR5 A;  2M7V A;  1LT0 A;  3LID A;  3NOP C;  3G6O A;  1TF1 A;  4HHD A;  4R3A A;  3U2A A;  3E98 A;  3HCY A;  5DKK A;  5KSH A;  4EET B;  1UWP X;  3LR4 A;  2PR6 A;  5HD5 A;  1VHM A;  2ZOH A;  4MDZ A;  5HL6 A;  4WLA A;  3D72 A;  1OTD A;  1Y28 A;  3PHY A;  4B9O A;  1F5M A;  1N9O A;  1UWN X;  5F6A A;  4XT2 B;  2QJ5 A;  2D01 A;  2OOL A;  2R78 A;  1LSX A;  4LRY C;  1F9I A;  3A0R A;  3T4S A;  3PBR A;  1NLY A;  1YAX A;  4NXE A;  4L9F A;  4ZRR A;  3UE3 A;  3LIF A;  4G3K A;  2IA2 A;  3CIT A;  4G3V A;  3ULF A;  2W27 A;  4HJ4 A;  1DP6 A;  3OLO A;  4GHI A;  3LR5 A;  3IS2 B;  5HWT A;  2D02 A;  3UB9 A;  5DKL A;  2HJ9 C;  4AFI A;  2VKS A;  1D06 A;  3LI9 A;  4R6L A;  2O99 A;  4I38 A;  3D3O A;  4I39 A;  3KSH A;  2KLI A;  1NWZ A;  1X0O A;  3IBR A;  2ZOI A;  2YKF A;  2V9A A;  3C2W A;  3LYX A;  3KSF A;  2W0N A;  3MR0 A;  2OAP 1;  3S7N A;  1GSW A;  3LI8 A;  3H82 B;  2CMN A;  3MQQ A;  5F68 A;  4GS9 B;  1IOU A;  2O0Y A;  3PR6 A;  3MXQ A;  4F3L A;  3T50 A;  1OT6 A;  2L1M A;  2V1A A;  2JKT M;  2WKQ A;  4GW9 A;  2V1B A;  2A24 B;  2O9A A;  5DFX A;  2ZBB A;  4EQ1 A;  2W1R A;  3F1P B;  2W3H A;  3BY8 A;  4WEJ A;  2J3W A;  4KQD A;  2WKR A;  3R4K A;  4EEU A;  2QKP A;  5HZH A;  3PBQ A;  2GNX A;  3S7Q A;  3CUE A;  1F98 A;  4HP9 A;  4LLO B;  2PYR A;  4IJG A;  4HP4 A;  4YNR A;  1XFQ A;  5A8B A;  3H7W B;  3MQO A;  4Y5F A;  3RH8 B;  4EUV A;  1LL8 A;  3EQV A;  4KQO A;  4Q0H A;  4CLC E;  3VV4 A;  4WL9 A;  3GDI A;  4CLC D;  3GEC A;  2QWS A;  3MF0 A;  3BQA A;  2Y79 A;  4NXG A;  3H82 A;  4IUH A;  5K5B A;  1OJG A;  5AVE A;  3R7W B;  2EWV A;  1DP8 A;  1TS7 A;  3EEA A;  5AJG A;  2V0U A;  3V67 A;  2PDR A;  1T18 A;  4EW7 A;  1ZHH B;  1DRM A;  4NKP A;  1T1B A;  3E4O A;  2A24 A;  2B02 A;  3E4P A;  1VB6 A;  4K08 A;  1H3Q A;  2W3D A;  1DP9 A;  2J3T D;  2ZMF A;  1GSX A;  4MCW A;  4HIA A;  5DF9 A;  4ETX A;  1OPX A;  5AVF A;  3F1O A;  3ZYT A;  2ZMV A;  2VGL S;  3IBJ A;  2M7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...