2L1MA

Solution structure of the eag domain of the herg (kv11.1) k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
b'MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
molecule tags Transport protein
source organism Homo sapiens
publication title Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
pubmed doi rcsb
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l1mA00
4HOIA 3VE3A 3BWLA 1OTEA 2JHEA 3LYXA 3MXQA 4MN6A 5IU1A 1OTDA 4HH3A 4R38A 2A24A 1ODVA 1LSWA 5AVFA 2YKHA 2I9VA 1DP9A 4BBTA 1T18A 1OTIA 1F98A 3IBRA 4HP9A 2PD7A 4LRYC 2J80A 3ULFA 1T1AA 4NXFA 1KOUA 1UGUA 1OJ5A 2A24B 3F1NB 4WF0A 1VB6A 5TBMB 1Y28A 2PYRA 2B02A 1MZUA 3CLOA 3F1PA 1LSVA 3NOUC 3MFXA 1BYWA 2VV8A 3D72A 4F3LB 1XJ4A 1N9NA 4KQDA 4GHIB 3H7WB 4PKYG 5G4YA 2QHKA 1OJGA 3HJKA 3PYPA 3A0SA 1XFQA 2L0WA 2PD8A 3E4OA 4HQAA 3UB9A 4EESA 2QWSA 3H9WA 1JNUA 2PR6A 4MN5A 5F68A 4EEUA 2OWHA 2Z6DA 4RQ9A 3F1OB 4NXEA 4XT2A 2W27A 5DJTA 3C8CA 2Z6CA 4HJ6A 4I3AA 4L9EA 3LIEA 3ZQ5A 1P97A 5IS1A 3FG8A 3MQOA 3LIBA 2BASA 3A0VA 3MQQA 4I3JA 5HWWA 2D02A 1S1YA 4LRZE 3IS2B 1D7EA 3LUQA 1XJ2A 1N9LA 3MJQA 3P7NA 4EQ1A 2WKQA 1TS8A 3H7WA 3UMEA 4B9OA 5HWTA 3FC7A 2H28A 1N9OA 4GS9B 4HY8A 4JGPA 4KUKA 5DKLA 3UB8A 2VV6A 4BBUA 3UB7A 5A8BA 1GSXA 4WLAA 2YKFA 5F69A 2GJ3A 2R78A 4I3IA 2ZOIA 3VE4A 4DJ3A 1X0OA 5J4EA 2CMNA 1EW0A 2M1CA 4GS9A 4XT2B 3RH8B 2PR5A 3UMDA 1LSXA 4I39A 4JGRA 4R6LA 4EXOA 2QKPA 2OOLA 3F1PB 1UWNX 3EWKA 4E04A 1S66L 1T1BA 2ZBBA 4H6JB 1DRMA 1TS6A 5J3WA 4HI4A 4LPZA 1OT6A 2WKPA 3UB6A 2PYPA 4NXBA 2QJ5A 4KUOA 4I38A 4YWZA 2V1BA 3G6OA 1T19A 5DJUA 1XJ6A 2K7SA 2L4RA 1TS7A 2VV7A 2ZOHA 4HJ4A 4K08A 1DP6A 3LIAA 4BBVA 2V9AA 4M4XA 1XFNA 3K3DA 2JN7A 2L1MA 1OT9A 2QJ7A 1DP8A 2KX6A 1OTBA 3H82B 3HJIA 3E4PA 3LIDA 4JGOA 3EEHA 4GHIA 3MR0A 1T1CA 4HH2A 2HV1A 4L9GA 4LLOB 5HDDA 4JGQA 4EETB 4HNBA 4NXGA 4H6JA 4EERA 5HSQA 4WN5A 3LIFA 5J7EA 4WL9A 3LICA 3GECA 5HD3A 3B33A 5TBMA 4HHDA 5EFWA 5F6AA 5HDCA 2EA9A 5KIZA 1D06A 3NOTC 4HP4A 3C2WA 3BY8A 5DKKA 1LL8A 3BY9A 4DJ2A 3ICYA 4HIAA 3IS2A 3SW1A 5HDSA 1G28A 3E4QA 1P0ZA 4GCZA 1NWZA 4HJ3A 2PHYA 1WA9A 2W0NA 3LI9A 1LT0A 2P7JA 4EEPA 2VEAA 3F1OA 3NJAA 3NOPC 4L9FA 4LRXC 4WUJA 3UE6A 4F3LA 3LI8A 1F9IA 2V1AA 2KDKA 2PDRA 3CWFA 5AVEA 5G4ZA 5HD5A 3T50A 4I5SA 3RTYA 1V9YA 1TS0A 2INWA 3GDIA 5HZHA 5HWVA 3A0RA 1S67L 1S1ZA 1GSWA 2VLGA 3KX0X 2V0UA 4PKYA 5I5LA 1S4RA 2WKRA 3OLOA 4R3AA 1UWPX 3VOLA 3H82A 4GW9A 5F5YA 2D01A 3CAXA 3F1NA 3NHQA 1V9ZA 2V0WA 4EW7A 3K3CA 1OTAA 4R70A 1XJ3A 3PHYA 2OWJA 1GSVA 1S4SA
chains in the Genus database with same CATH superfamily
1W8QA 2Y2LA 1ZTUA 1RCJA 1S6RA 1OTIA 4OP5A 4GDNA 4HEFA 1KVMA 1K55A 4C3QA 4U0XA 1ERMA 1L2SA 2PBDP 3MBZA 2XFTA 4UA6A 1XXMA 2HDSA 3IHAA 2JKFA 3BRMA 4RQ9A 2W27A 1ZKJA 4BLMA 5IS1A 1YM1A 1W63M 1WE4A 2HDRA 4MBHA 1ZC2A 4P6BA 2PT7A 3UB8A 3ZFZA 4WLAA 3C38A 5FDSA 1L3LA 3KYQA 3DTKA 1PI4A 1LSXA 5CERA 3F1PB 3O5YA 5CX7A 2PYPA 3T1SA 3WRZA 3IWIA 2ZOHA 1TS7A 3BEBA 1NJ4A 2AVXA 3JVVA 1XFNA 2JN7A 3MSHA 5J4EA 2JE5A 3WRTA 4X55A 4C75A 2ZC4B 3NDGA 4PAUA 2G7UA 5HD3A 4MDZA 2XK1A 1ERQA 2ACGA 3WS0A 5EM1A 3OPPA 2P7JA 3NJAA 4OQGA 3QP1A 5L8MA 3RTYA 1SKOB 4WZ4A 3EGDC 4O7DA 2PAVP 4KENB 2HJEA 3KYZA 2Y91A 2OAP1 2J3TD 4MEZA 3S7NA 3JYIA 1V9ZA 3BLSA 4KQQA 5AQ7A 3VV4A 3IQAA 5FI6A 2VX8A 4GN2A 3CUEA 5E2FA 2PD7A 3T4LA 3T1QB 4GLQA 1SZVA 1FSWA 5DTKA 4KQDA 3VP2A 1E4DA 4R4RA 2WGIA 3B47A 4AFIA 3FG8A 2VKSA 4I3JA 4S2MA 3IHBA 3EOIA 3SH8A 4GD8A 1K54C 4GD6A 4JKTA 5AQBA 5EOEA 3OPLA 5HARA 4NETA 4ESPA 4H6JB 1IKGA 3PAGA 3OCNA 2H5SA 3IWOA 5FAQA 3VE4A 3HJIA 1DP8A 2KX6A 3NCKA 4OP8A 2WAEA 4HNBA 3C30A 3IXDA 1LL8A 4JXSA 2PHYA 2PU4A 3DWKA 2B95A 5HD5A 3MKEA 2V0UA 2WKRA 5F82A 3HLGA 1UWPX 3ITAA 5CEBA 3FPVA 1WYCA 4CQHA 4QJGA 3FYZA 4FSFA 2Y55A 1HZOA 2V1BA 4E3OA 5EV0A 1TEMA 3C7VA 2HZ5A 3I7JA 5IU1A 4P85A 1PNEA 4OLGA 1CJFA 4NXFA 1K6RA 2JKRI 1UGUA 2J8YA 1VB6A 5A90A 3HLWA 1LSVA 1NZOA 2WUQA 3DWZA 3A0SA 2J3TC 4IUKA 1JWZA 1Z09A 5JYOA 3TOIA 3C8CA 4HJ6A 3BFGA 4I3AA 2Y2PA 3PAEA 3V39A 4EQ1A 2WKQA 1E3UD 1GCEA 4KZ5A 3MKFA 2ZMVA 4F94A 2GJ3A 2ZOIA 5EM0A 4DRTA 3R7WB 3RH8B 3UMDA 2W3GA 5M19A 5HWVA 4OPZA 4II7A 4Q0HA 4HI4A 1RGYA 1IFQA 4KUOA 4HBUA 4YFMA 5M1AA 2VV7A 3ZVTA 4OH0A 1VEUA 3LIAA 4N1XA 1EROA 2L1MA 1OT9A 3LIDA 3H82B 5E2EA 3C5AA 3MR0A 2Y8HA 3BFFA 1BTLA 1ONGA 2EFXA 3CHWP 1L0EA 5DF9A 1ESIA 1TF1A 2M7UA 3K2NA 1CI8A 4DJ2A 5EE8A 3E4QA 3T4TA 4GCZA 3M6BA 2W3DA 1BLSA 3HVFA 1JVJA 4BQMA 1G5UA 1L0GA 3SH9A 4I5SA 4QB8A 5HZHA 5I5LA 5GLBA 1K25A 1PRQA 1D1JA 5GLAA 1ONHA 2HGVA 5EVIB 2XEPA 3PHYA 4L0LA 3IF6B 4BMWA 2BG1A 4OOYA 1HVBA 3M2JA 1LSWA 2EX2A 1IYSA 3IXHA 3PBQA 3TSGA 1T18A 1NYYA 2Y2KA 3U2AA 5IT5A 4OKPA 2PYRA 3ZDJA 2VV8A 1VQQA 3ITBA 1S0WA 3H7WB 4IJGA 3HJKA 3BM6A 3E4OA 3UDXA 3A0VA 2D02A 3FPWA 4RVAA 2DNSA 4GJ4A 2GNXA 2JKRM 3UB7A 2M7VA 1K56A 5EUAA 4OOLA 4BL3A 4XT2B 3JPUA 5HL1A 4DKIA 3ZNTA 5GHYA 2XDMA 3A3DA 1VHMA 2ZM8A 3N8SA 4DXCA 3AGFA 2WZZA 3G6OA 5DJUA 1MWUA 4LCLA 1K4FA 4MCWA 2J7VA 1ES5A 2QMIA 4LLOB 4JGQA 5HDDA 3IH8A 1O07A 3LIFA 4E6WA 3M2KA 4O0PA 4FTXA 4EBPA 1PWCA 3QNCA 2JBFA 3IWQA 4M3KA 3E2KA 3T50A 5G4ZA 1J3WA 1TS0A 2XFSA 2P9VA 4KZ6A 4GKUA 4E6XA 3M6HA 3BECA 1JTGA 5FQJA 5GLCA 4S2NA 1CI9A 4EBNA 4BWIA 1GSVA 1RGZA 1S4SA 4MN7A 3BWLA 2JHEA 3ZNYA 2BLSA 3W4OA 3UDFA 1FR1A 2XF3A 3IF6A 2YKHA 1FILA 4GZBA 4ZRRA 4KZ7A 4OONA 3Q7VB 3A3JA 3BFCA 4UEYA 3QP2A 3BQAA 5F68A 2OWHA 1KGGA 4Y13A 3NDEA 2WADA 5BOHA 5A93A 5L09A 4KQRA 5FEGA 3N6IA 1N9OA 4X25A 1YLWA 2M1CA 1XPBA 5L10A 1XA7A 4K91A 1S66L 2P74A 4WYYA 1OPXA 1OT6A 3UB6A 3OPHA 2R9XA 4FCFA 1LLBA 3LCEA 4IBXA 2E8IA 1K6SA 2LB9A 4HH2A 3G2ZA 5KZHA 3EGXC 1CK3A 4S2IA 3UNWA 2EA9A 3KYEA 4MMNA 2HP5A 4YINA 1OMEA 3T1XA 1ES3A 2Q9NA 3G31A 2HPBA 1LL9A 4R23A 3LI8A 2A49A 1CQAA 1S4RA 1YLPA 3CPTA 4RYEA 3BYDA 5EVEA 2A2LA 4EW7A 4IHQA 3HUOA 4ETZA 2C5WB 4JLFA 5FQ9A 5E2HA 4WEKA 5AVFA 1BLCA 4NK3A 3RFBA 2XD5A 3QP6A 2IWBA 1Y28A 1YLZA 4E3LA 1XJ4A 1STZA 2K2NA 4ZJ2A 4JXWA 2V2FF 3MXRA 2H0TA 1K56D 4HQAA 4LGWA 4JF6A 2QWSA 1MY8A 3E98A 3IX3A 4BL2A 1H8MA 3V5MA 3HLBA 5LBRA 1EWZA 5J8XA 1C3BA 3S4XA 2ZLYA 1GSXA 2GX5A 3N7WA 2ZQ9A 4I39A 5GL9A 5FQKA 4LPZA 2OLVA 5DTSA 1YSQA 2X01A 4K08A 4KG5A 3T4SA 2RL3A 1K57C 1Z6FA 3HL9A 3V50A 3NBLA 3W2ZA 4WL9A 2HDQA 4UA7A 4ZBEA 2W1RA 4R0QA 3QP5A 3FWLA 3ZHHA 2Y2HA 1LT0A 4KQOA 2Y2JA 4OPQA 3JVUA 3BFDA 3TW8A 3HBRA 4DE2A 3T4OA 5MC7A 2QZ6A 2PBYA 3LGOA 3CAXA 4KG6A 3N8RA 1OTAA 2Y2QA 3WS4A 1O7EA 3UPNA 2Q0OA 1K38A 3TRCA 3UB5P 1KDSA 3UE3A 1YMXA 1K54A 4GOGA 3IH9A 1TD5A 2JC7A 4WEJA 1QMFA 1XP4A 5CRFA 1BYWA 3N8LA 5FSRA 4O8GA 3E0YA 1ZHHB 4S2NC 2Z6DA 4LV0A 1ZG4A 2A3UA 4L9EA 1N4OA 2WYXA 2BASA 5HWWA 3UO9A 4QU3A 3P7NA 4S2OA 5HWTA 3FC7A 4GS9B 4BBUA 4Y0UA 4IBRA 2Z2LB 2VV6A 5FL3A 4I3IA 2CMNA 3LR5A 3PBOA 4BJPA 1NYMA 2WKPA 4PPRA 1W5DA 2QJ5A 4OQIA 1SKOA 2ZMFA 1HTZA 3B42A 2G2WA 3HUNA 3S1YA 1YSPA 3A3IA 2W1TA 2JKGA 2V1ZA 5EFWA 4S2JA 2JKTM 1YLYA 3ZG7B 5CGXA 3IS2A 3SOIA 2EX8A 2XA7S 3T12B 5KSHA 3QP8A 3MZDA 4WZ5C 3T4QA 4F3LA 3B3XA 4LRXC 1F9IA 5AVEA 1Y4OA 2O9BA 4P6ZM 1YQSA 2INWA 3GDIA 3PXPA 2D01A 3PBNA 2BTFP 1J9MA 4IVKA 4IUHA 1OTEA 4DXBA 2Y4AA 2Y79A 2I9VA 2FH5A 1BLHA 4KZ8A 3GMWA 2J80A 1T1AA 1OJ5A 3TJZC 1JWVA 1OJGA 2O99A 4JBFA 1XFQA 2GZAA 1JWPA 4NXEA 2E8JA 4Q8IA 3GVBA 1P97A 3EQUA 5CTMA 2VGLM 3W8KA 2H28A 4KUKA 4G3KA 2H10A 3OZHA 4GS9A 2PR5A 5EOOA 1VM1A 4G3VA 4EXOA 2XA7M 2ZBBA 5DF8A 4ARZA 4YWZA 2ZL1B 1DJAA 5GHXA 4X6TA 4JGOA 3E4PA 4LENA 4GHIA 1VEUB 1FSYA 3PR6A 5JYPA 3VOYA 1IYOA 4L9GA 1KE4A 5FQQA 3SS3A 2WGWA 3IX8A 4OPRA 5TBMA 3GR2A 3SH7A 2Y2MA 4UQIS 2ZC6B 4Q0JA 3T4JA 4EUZA 2XRNA 5L07A 2FZ0A 5KIZA 1LI9A 3C2WA 2OV5A 2EXAA 3MFDA 5HDSA 1PZPA 3NOPC 2ZC5B 3IT9A 3VOLA 5F5YA 3OPRA 2J9PA 4LFUA 3F1NA 1H8ZA 3LYXA 4P6ZS 4BBTA 2V8FA 3ULFA 1YPRA 1G6AA 4WF0A 5TBMB 2XQZA 3NIAA 5A91A 4IEDA 3UPOA 1H0MA 1BT5A 3S7OA 3H9WA 4XXRA 3G30A 2OLUA 1FCNA 3AGDA 1SCWA 4X68A 2ZM0A 3KSFA 2R78A 2ZC3B 2ZM2A 4X56A 3CPTB 5E2GA 3HLDA 2W3FA 3A3FA 3HREA 3Q81A 1KGFA 3FZCA 2GDNA 2O9AA 1IYQA 4JF4A 5EECA 1QMEA 1VETA 4FD8A 2V20A 4HHDA 1LL5A 2J3WA 2OAQ1 2Y2OA 4EEPA 1MBLA 1IKIA 2V1AA 1FOFA 2PRFA 4DDYA 4A5RA 4Y2FA 2IA2A 2EXBA 2WGVA 1Q2QA 5FAOA 4EUVA 4KZAA 3IXGA 2WKEA 4PM9A 1MWRA 4FUWA 4Y15A 2EX6A 2FFFB 3DBAA 3Q1FA 3VE3A 3PBRA 4D60A 3UE1A 1SKFA 1F98A 2ZQCA 5TGFA 3MFXA 4N9KA 1E3UA 5FQIA 4MNRA 3ZYTA 1G68A 1YMSA 5FDHA 2JKTI 4LV2A 3DW0A 3KSHA 3EEAA 3T1RA 3Q82A 3LIBA 2EFUA 1IEMA 2H0YA 3KSIA 1D7EA 3C7UA 5F83A 4OQ0A 1LHYA 2HDUA 3W4PA 4HY8A 5A8BA 2KOIA 4CLCA 1IELA 2YKFA 3P09A 1H8YA 1ALQA 5DFXA 1T1BA 4UQIM 1DJBA 3LR0A 1HLUP 1T19A 3SS5A 3WS1A 2VGLS 1YAXA 2VJWA 3LEQA 4ZJ1A 4FH4A 3VP1A 5F1FA 2RCXA 2HV1A 4KG2A 4H6JA 1HD8A 3PBTA 1I2WA 4QD4A 3GV9A 2X71A 1NY0A 5CHMA 3W4QA 1H5XA 1G28A 2IWDA 4NEED 2VK3A 1MWTA 4GDBA 2FFYA 4L9FA 3VFFA 3GQZA 4ME4A 2CC1A 1SDNA 1H3QA 2VZWA 3NI9A 1KE3A 1W79A 2IWCA 1L0FA 2XROA 2P08A 5CGWA 4PHTA 5AQ9A 4HJ3A 3O86A 3MXQA 4K0WA 1OTDA 4HH3A 4B4XA 5CHUA 4OPYA 5GLDA 1E25A 1DP9A 3IBRA 2DRWA 1F2KA 3OOVA 3Q07A 3HLFA 4NG2A 1PI5A 4B4ZA 3F1PA 1KDWA 2I72A 3HLCA 2LB5A 4P87A 4PKYG 4G3WA 3PYPA 4MN5A 4E3NA 1JNUA 2HP9A 3KO6A 2Z6CA 3LR3A 3R7WA 1A0KA 1XA1A 1S1YA 3IS2B 3MJQA 2WKHA 1TS8A 2ZJ9A 2V8CA 5G18A 3BFEA 4B93A 4ZTKA 1PYYA 2XH9A 4GNUA 1MPLA 5HAQA 5HL6A 1BUEA 3EWKA 1M40A 1TDLA 3G35A 3G32A 1FCMA 2ZQAA 3NC8A 3EQVA 2K7SA 1XGIA 3LEZA 4OVDA 1FIKA 2ZQ7A 3L9KA 1L0DA 4EETB 3LICA 4C6YA 1AXBA 5C5KA 3SW1A 3MMHA 5K5BA 3C4PA 4EQIA 3CWFA 3LY3A 2W1TB 4OLDA 4PM8A 2VLGA 3VFHA 1AWIA 4R3AA 4R4SA 4RA7A 3KSGA 1GHMA 4XUZA 1PW8A 2XGNA 3K3CA 4KZ9A 4QHCA 2EWVA 2A24A 3HCYA 3OC2A 5E43A 5DTTA 1K55C 2Z2MB 2X02A 4YOFA 4LRYC 3E2LA 5DF7A 1YLTA 3GTCA 4GHIB 2PU2A 3D3OA 1TDGA 4EWFA 4ZJ3A 2PD8A 5EVID 2PR6A 3F1OB 3VP0A 4RX2A 2J9OA 5FATA 4DE0A 5CTNA 4X53A 2VA0A 3H7WA 1XGJA 5TFQA 3NECA 3ZVWA 5DKLA 4EV4A 4DJ3A 3O3VA 2DMWA 3D4FA 5HW3A 1UWNX 3V67A 4UAAA 1ES4A 3O88A 3S7QA 4HJ4A 4M4XA 1ZG6A 3CZDA 3OBFA 2QJ7A 4WM9A 1PW1A 5EVLA 4NXGA 3B33A 4KZ3A 4R3JA 4S2KA 5F6AA 2ZL1A 3WS2A 5HDCA 4MLLA 4UHUA 4JPMA 3BY9A 4HIAA 4WELA 4GB7A 2Q9MA 2W0NA 5FQMA 5FI7A 4WUJA 4EU0A 3SZTA 1FQGA 3KX0X 4PKYA 5HFOA 1I5QA 2WKIA 3PBSA 1YT4A 1ESUA 5CECA 4WBGA 3BQ8A 1Y54A 3ZG0A 4NKPA 4P0MA 2OWJA 4CPKA 4E3JA 2W3HA 2ZMAA 4N9LA 4IVIA 1ODVA 3ZG9B 1BLPA 2A24B 3F1NB 3S7PA 3CLOA 2QPNA 4ZAMA 2DCFA 4DF6A 5G4YA 5CGSA 2QHKA 1SDEA 1M6KA 1NRFA 2Y2IA 3IXBA 4Y0OA 4EEUA 3BW6A 3LIEA 4DE1A 2B5RA 4LRZE 1N9LA 4N1HA 3CUEC 4RX3A 1YLJA 2P04A 4JGPA 4X1LA 2QYBA 4CJNA 3IX4A 3MZEA 2HP6A 3P01A 4JGRA 4EESA 3ZG5A 5DVAA 1TS6A 3DTIA 4LV1A 1GA0A 1NZUA 4I38A 4MBKA 4Q0IA 1XJ6A 3V3SA 4N92A 4BBVA 3WWXA 2K31A 5M18A 4X69A 4Y17A 4JF5A 3L7HA 3ZGAB 1XX2A 5EVIA 5HSQA 4X1MA 4EERA 1I2SA 3VMAA 3GECA 4LCMA 2WAFA 3MZFA 1PZOA 1NLZA 4HP4A 1KGEA 2JCHA 5DKKA 4LV3A 2XSSA 1DY6A 1NWZA 3LI9A 2PDRA 3VP3A 4FOFA 1BULA 3UE0A 1IOUA 4Y7PA 1MKMA 4FH2A 3H82A 1DJCA 1GHPA 4E3IA 2G2UA 4CLCB 1U60A 3GRJA 1CF0A 2EWWA 4HOIA 3DAVA 4MN6A 3FKVA 3G34A 3D9YA 5F1GA 5FA7A 4BD0A 3T4KA 3RJUA 1N9BA 3NOUC 1MZUA 3VOZA 4F3LB 1IYPA 3N4IA 4EBLA 2VGJA 2HJ9C 3TG9A 4ARZB 4CLCD 2OSUA 4HESA 3LFVA 1SHVA 1Q2PA 4S2LA 3Q7ZA 4KZ4A 3CMZA 5CXWA 3MQQA 3WS5A 3ISGA 3LUQA 1TVFA 1F5MA 5EPHA 4BENA 4JXVA 3A3EA 5HX9A 4U0TA 2ZD8A 3VSLA 1FCOA 4R6LA 4U3TA 1PWGA 5J3WA 5FASA 1FR6A 3CJMA 4PMAA 3IF6C 1NLYA 1DP6A 4PM7A 3NY4A 4H8RA 3EEHA 4BD1A 2Y59A 3BJNA 4DE3A 4WN5A 1VETB 3O87A 1D06A 4JXGA 1W63Q 3BY8A 3BLMA 4DN0A 1ES2A 1K4EA 1PWDA 4R1GA 1K57A 5D3OA 3U4LP 3QHYA 4KZBA 1G6OA 3OLOA 2EX9A 3RXWA 3NHQA 2MJ6A 5HAPA 5AQAA 4R70A 4ID4A 2ZQ8A 2W3EA 4QY6A 5HPIA 4ETXA 4YNRA 2ZC7A 1MXOA 5IHVA 2B02A 4Y5FA 4K0XA 3S22A 1MC0A 3G2YA 2P9VB 2L0WA 2B18A 2ZQDA 3UB9A 5HAIA 4PM5A 3ZG8B 3G4PA 4S2PA 5DJTA 3ZQ5A 5A92A 2Y2GA 3MQOA 4MBFA 5FEFA 1NRJA 3LY4A 4B9OA 2O0YA 1KVLA 2XD1A 1PIOA 4WZ5A 1X0OA 1RP5A 2WK0A 4Y0TA 5KMWA 3OCLA 1CEFA 4E04A 3CI6A 2O9CA 5U47A 5L2FA 3CITA 3QP4A 3C4OA 2XR0A 2VGKA 1W8YA 3IBJA 3UN7A 1BSGA 4WMCA 3UE6A 4HBTA 4E3KA 1P9RA 1OTBA 4O01A 3FKWA 4OOMA 5AJGA 5J7EA 1K0KA 4DMZA 3MF0A 2HF6A 3VP4A 3MQ0A 3LO7A 3NOTC 4CLCE 3V3RA 3ICYA 3AGEA 2NUTC 5I94A 3F1OA 4OQHA 2KDKA 4E3MA 4Z9QA 1S67L 3PTEA 4GW9A 5CEDA 1NXYA 3DTEA 5KSCA 3LR4A 4XUXA 1PFLA 4ZDXA 3DTMA 2OOLA 3IF5A 5TJJA 1P9WA 3RXXA 4R38A 3QNBA 3UPPA 1MWSA 4HP9A 3Q7VA 1KOUA 2R9WA 2Y2NA 5GHZA 3UDIA 3CG5A 3D72A 4B88A 1N9NA 4CLCC 1BZAA 4QPRA 1CEGA 3GSGA 4XT2A 1EI5A 3P98A 4QWOA 4DDSA 1XJ2A 3UMEA 1GA9A 5TR7A 1JTDA 3MS6A 4WMCD 3VSKA 4QY5A 5F69A 5FAPA 3TE8A 2NUPC 1EW0A 5HPFA 1KE0A 3HLEA 2QKPA 2WZXA 3R4KA 2UWXA 1DRMA 2WGWB 3FV7A 3NULA 4NXBA 1YKDA 2L4RA 1MKIA 1WYBA 2V9AA 3K3DA 2UV0E 5CHJA 4Y3IA 1T1CA 4D2OA 4Z1WA 1XKZA 3HUMA 3UY6A 2XLNA 5DFYA 1P0ZA 5FI2A 1WA9A 2VEAA 1LI0A 1W7FA 1V9YA 4R3BA 4UA9A 3ZCZA 3A0RA 1GHIA 1S1ZA 1GSWA 4PM6A 3SS4A 3MXSA 5EVIC 2V0WA 2C6WB 1ACFA 1XJ3A 2KLIA
chains in the Genus database with same CATH topology
2W3HA 4MN7A 3BWLA 2JHEA 3LYXA 1ZTUA 4P6ZS 1ODVA 2YKHA 4BBTA 1OTIA 3ULFA 2A24B 3F1NB 4WF0A 5TBMB 3S7PA 3CLOA 4ZRRA 4UEYA 5G4YA 2QHKA 3S7OA 3BQAA 3H9WA 5F68A 4EEUA 2OWHA 3BW6A 4RQ9A 2W27A 3LIEA 5IS1A 1W63M 4LRZE 1N9LA 2PT7A 3CUEC 2P04A 1N9OA 4JGPA 3UB8A 4WLAA 3KSFA 3C38A 2R78A 3KYQA 2M1CA 2QYBA 1LSXA 3P01A 4JGRA 3F1PB 4EESA 3O5YA 1S66L 1TS6A 5CX7A 2W3FA 1OPXA 1OT6A 3UB6A 2PYPA 4I38A 4Q0IA 1XJ6A 2ZOHA 1TS7A 2O9AA 4BBVA 3JVVA 1XFNA 2JN7A 2K31A 5J4EA 2LB9A 4HH2A 5HSQA 4PAUA 4EERA 2G7UA 3GECA 5HD3A 4HHDA 3EGXC 4MDZA 2EA9A 1NLZA 4HP4A 4MMNA 5DKKA 2J3WA 2OAQ1 2XSSA 1NWZA 3LI9A 2P7JA 4EEPA 3NJAA 5L8MA 3LI8A 2V1AA 2PDRA 4FOFA 3RTYA 3EGDC 4Y2FA 1IOUA 1S4RA 2IA2A 2HJEA 1MKMA 3KYZA 3H82A 2OAP1 2J3TD 2A2LA 3S7NA 4EUVA 4CLCB 1V9ZA 4EW7A 4IHQA 2EWWA 4ETZA 3DBAA 3VV4A 4HOIA 3VE3A 3PBRA 4MN6A 2VX8A 4WEKA 5AVFA 3CUEA 3RFBA 1F98A 2PD7A 3T4LA 3T4KA 4GLQA 1Y28A 3NOUC 1MZUA 4F3LB 3MFXA 1XJ4A 1STZA 2HJ9C 2K2NA 4KQDA 3ZYTA 4ARZB 2JKTI 4CLCD 3B47A 4HQAA 2QWSA 3LFVA 3KSHA 3E98A 3EEAA 4AFIA 3FG8A 2VKSA 3LIBA 3MQQA 1H8MA 4I3JA 3KSIA 1D7EA 3EOIA 3LUQA 5LBRA 1F5MA 4HY8A 5A8BA 2KOIA 1GSXA 4CLCA 2YKFA 2GX5A 4I39A 4R6LA 5DFXA 1T1BA 5J3WA 4H6JB 4UQIM 4LPZA 1YSQA 3LR0A 3OCNA 1NLYA 1T19A 2VGLS 4K08A 1YAXA 1DP6A 2VJWA 3T4SA 3VE4A 3HJIA 1DP8A 2KX6A 3EEHA 2HV1A 3BJNA 4HNBA 4H6JA 4WN5A 3W2ZA 3PBTA 4WL9A 2W1RA 3C30A 1D06A 1W63Q 3BY8A 4DN0A 1LL8A 1G28A 4NEED 2PHYA 1LT0A 4KQOA 4L9FA 3JVUA 5HD5A 4ME4A 3TW8A 1G6OA 2V0UA 3T4OA 1H3QA 2WKRA 2VZWA 3OLOA 5MC7A 1UWPX 3CAXA 3FPVA 4CQHA 3NHQA 2MJ6A 4FSFA 2XROA 2P08A 1OTAA 4PHTA 4R70A 2V1BA 4HJ3A 2W3EA 5HPIA 3MXQA 3TRCA 5IU1A 1OTDA 4HH3A 4ETXA 4YNRA 3UE3A 1DP9A 3IBRA 3OOVA 1TD5A 4NXFA 2JKRI 1UGUA 4WEJA 1VB6A 2B02A 4Y5FA 3F1PA 1LSVA 1BYWA 1MC0A 2LB5A 4PKYG 4G3WA 4O8GA 3PYPA 3A0SA 2J3TC 2L0WA 2B18A 3E0YA 3UB9A 4IUKA 4MN5A 1JNUA 1ZHHB 2Z6DA 3KO6A 5DJTA 3C8CA 2Z6CA 3LR3A 4HJ6A 4I3AA 4L9EA 3R7WA 3ZQ5A 3MQOA 2BASA 5HWWA 1S1YA 1NRJA 3IS2B 3MJQA 3P7NA 4EQ1A 2WKQA 1TS8A 4B9OA 5HWTA 2O0YA 3FC7A 4GS9B 4BBUA 4B93A 2VV6A 2ZMVA 5FL3A 2GJ3A 4I3IA 2ZOIA 5HL6A 1X0OA 2CMNA 3LR5A 3OCLA 3R7WB 3RH8B 3UMDA 3PBOA 2W3GA 5HWVA 4II7A 4Q0HA 3EWKA 4E04A 3CI6A 4HI4A 2O9CA 4BJPA 2WKPA 1IFQA 2QJ5A 4KUOA 3CITA 2ZMFA 3EQVA 2K7SA 2VV7A 3IBJA 3LIAA 3B42A 3UE6A 2L1MA 1OT9A 3LIDA 1P9RA 1OTBA 3H82B 4O01A 3MR0A 2Y8HA 4OOMA 1YSPA 5AJGA 5J7EA 4EETB 4DMZA 3LICA 3MF0A 2HF6A 2W1TA 5EFWA 5DF9A 3MQ0A 2JKTM 3NOTC 4CLCE 1TF1A 2M7UA 5C5KA 3K2NA 4DJ2A 3ICYA 3IS2A 3SW1A 3MMHA 3E4QA 3T4TA 5K5BA 2NUTC 2XA7S 4GCZA 2W3DA 5KSHA 3T4QA 3F1OA 4F3LA 4LRXC 1F9IA 3CWFA 2KDKA 5AVEA 2O9BA 4I5SA 4P6ZM 2W1TB 5HZHA 2INWA 3GDIA 1S67L 2VLGA 5I5LA 3PXPA 4R3AA 3KSGA 4GW9A 2D01A 3PBNA 3LR4A 2HGVA 3K3CA 3PHYA 4L0LA 4IUHA 2OOLA 5TJJA 1P9WA 1OTEA 2EWVA 4BMWA 4R38A 2A24A 3HCYA 1LSWA 3OC2A 2Y79A 2I9VA 3PBQA 1T18A 2FH5A 4HP9A 4YOFA 4LRYC 2J80A 1T1AA 1KOUA 1OJ5A 3U2AA 5IT5A 2PYRA 2VV8A 3D72A 3TJZC 1N9NA 4GHIB 4CLCC 3H7WB 4IJGA 1OJGA 2O99A 3HJKA 3D3OA 4QPRA 3E4OA 1XFQA 2PD8A 2GZAA 2PR6A 3F1OB 4NXEA 4XT2A 1P97A 3A0VA 2D02A 3FPWA 1XJ2A 3EQUA 3UMEA 2VA0A 2VGLM 3H7WA 4GJ4A 2H28A 2GNXA 4KUKA 2JKRM 4G3KA 5DKLA 3UB7A 2M7VA 5F69A 3TE8A 4OOLA 2NUPC 4DJ3A 1EW0A 4GS9A 4XT2B 5HPFA 2PR5A 2DMWA 4G3VA 4EXOA 2QKPA 1UWNX 3R4KA 2XA7M 2ZBBA 3V67A 1DRMA 1VHMA 4ARZA 4NXBA 1YKDA 4YWZA 3G6OA 5DJUA 2L4RA 3S7QA 4HJ4A 2V9AA 4M4XA 3K3DA 2QJ7A 3OBFA 4JGOA 3E4PA 4MCWA 4GHIA 4Y3IA 3PR6A 1T1CA 4Z1WA 4L9GA 4LLOB 5HDDA 4JGQA 4NXGA 3LIFA 3B33A 5TBMA 4UQIS 5F6AA 4Q0JA 3T4JA 2XRNA 5HDCA 2FZ0A 5KIZA 4O0PA 3C2WA 3BY9A 4HIAA 5DFYA 4WELA 5HDSA 1P0ZA 1WA9A 2W0NA 2VEAA 3NOPC 4WUJA 4EU0A 3T50A 5G4ZA 1V9YA 1TS0A 3A0RA 1S1ZA 1GSWA 3KX0X 4PKYA 3VOLA 5F5YA 3PBSA 3F1NA 2V0WA 3BQ8A 4NKPA 4BWIA 1XJ3A 2OWJA 1GSVA 2KLIA 1S4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HOI A;  3VE3 A;  3BWL A;  1OTE A;  2JHE A;  3LYX A;  3MXQ A;  4MN6 A;  5IU1 A;  1OTD A;  4HH3 A;  4R38 A;  2A24 A;  1ODV A;  1LSW A;  5AVF A;  2YKH A;  2I9V A;  1DP9 A;  4BBT A;  1T18 A;  1OTI A;  1F98 A;  3IBR A;  4HP9 A;  2PD7 A;  4LRY C;  2J80 A;  3ULF A;  1T1A A;  4NXF A;  1KOU A;  1UGU A;  1OJ5 A;  2A24 B;  3F1N B;  4WF0 A;  1VB6 A;  5TBM B;  1Y28 A;  2PYR A;  2B02 A;  1MZU A;  3CLO A;  3F1P A;  1LSV A;  3NOU C;  3MFX A;  1BYW A;  2VV8 A;  3D72 A;  4F3L B;  1XJ4 A;  1N9N A;  4KQD A;  4GHI B;  3H7W B;  4PKY G;  5G4Y A;  2QHK A;  1OJG A;  3HJK A;  3PYP A;  3A0S A;  1XFQ A;  2L0W A;  2PD8 A;  3E4O A;  4HQA A;  3UB9 A;  4EES A;  2QWS A;  3H9W A;  1JNU A;  2PR6 A;  4MN5 A;  5F68 A;  4EEU A;  2OWH A;  2Z6D A;  4RQ9 A;  3F1O B;  4NXE A;  4XT2 A;  2W27 A;  5DJT A;  3C8C A;  2Z6C A;  4HJ6 A;  4I3A A;  4L9E A;  3LIE A;  3ZQ5 A;  1P97 A;  5IS1 A;  3FG8 A;  3MQO A;  3LIB A;  2BAS A;  3A0V A;  3MQQ A;  4I3J A;  5HWW A;  2D02 A;  1S1Y A;  4LRZ E;  3IS2 B;  1D7E A;  3LUQ A;  1XJ2 A;  1N9L A;  3MJQ A;  3P7N A;  4EQ1 A;  2WKQ A;  1TS8 A;  3H7W A;  3UME A;  4B9O A;  5HWT A;  3FC7 A;  2H28 A;  1N9O A;  4GS9 B;  4HY8 A;  4JGP A;  4KUK A;  5DKL A;  3UB8 A;  2VV6 A;  4BBU A;  3UB7 A;  5A8B A;  1GSX A;  4WLA A;  2YKF A;  5F69 A;  2GJ3 A;  2R78 A;  4I3I A;  2ZOI A;  3VE4 A;  4DJ3 A;  1X0O A;  5J4E A;  2CMN A;  1EW0 A;  2M1C A;  4GS9 A;  4XT2 B;  3RH8 B;  2PR5 A;  3UMD A;  1LSX A;  4I39 A;  4JGR A;  4R6L A;  4EXO A;  2QKP A;  2OOL A;  3F1P B;  1UWN X;  3EWK A;  4E04 A;  1S66 L;  1T1B A;  2ZBB A;  4H6J B;  1DRM A;  1TS6 A;  5J3W A;  4HI4 A;  4LPZ A;  1OT6 A;  2WKP A;  3UB6 A;  2PYP A;  4NXB A;  2QJ5 A;  4KUO A;  4I38 A;  4YWZ A;  2V1B A;  3G6O A;  1T19 A;  5DJU A;  1XJ6 A;  2K7S A;  2L4R A;  1TS7 A;  2VV7 A;  2ZOH A;  4HJ4 A;  4K08 A;  1DP6 A;  3LIA A;  4BBV A;  2V9A A;  4M4X A;  1XFN A;  3K3D A;  2JN7 A;  2L1M A;  1OT9 A;  2QJ7 A;  1DP8 A;  2KX6 A;  1OTB A;  3H82 B;  3HJI A;  3E4P A;  3LID A;  4JGO A;  3EEH A;  4GHI A;  3MR0 A;  1T1C A;  4HH2 A;  2HV1 A;  4L9G A;  4LLO B;  5HDD A;  4JGQ A;  4EET B;  4HNB A;  4NXG A;  4H6J A;  4EER A;  5HSQ A;  4WN5 A;  3LIF A;  5J7E A;  4WL9 A;  3LIC A;  3GEC A;  5HD3 A;  3B33 A;  5TBM A;  4HHD A;  5EFW A;  5F6A A;  5HDC A;  2EA9 A;  5KIZ A;  1D06 A;  3NOT C;  4HP4 A;  3C2W A;  3BY8 A;  5DKK A;  1LL8 A;  3BY9 A;  4DJ2 A;  3ICY A;  4HIA A;  3IS2 A;  3SW1 A;  5HDS A;  1G28 A;  3E4Q A;  1P0Z A;  4GCZ A;  1NWZ A;  4HJ3 A;  2PHY A;  1WA9 A;  2W0N A;  3LI9 A;  1LT0 A;  2P7J A;  4EEP A;  2VEA A;  3F1O A;  3NJA A;  3NOP C;  4L9F A;  4LRX C;  4WUJ A;  3UE6 A;  4F3L A;  3LI8 A;  1F9I A;  2V1A A;  2KDK A;  2PDR A;  3CWF A;  5AVE A;  5G4Z A;  5HD5 A;  3T50 A;  4I5S A;  3RTY A;  1V9Y A;  1TS0 A;  2INW A;  3GDI A;  5HZH A;  5HWV A;  3A0R A;  1S67 L;  1S1Z A;  1GSW A;  2VLG A;  3KX0 X;  2V0U A;  4PKY A;  5I5L A;  1S4R A;  2WKR A;  3OLO A;  4R3A A;  1UWP X;  3VOL A;  3H82 A;  4GW9 A;  5F5Y A;  2D01 A;  3CAX A;  3F1N A;  3NHQ A;  1V9Z A;  2V0W A;  4EW7 A;  3K3C A;  1OTA A;  4R70 A;  1XJ3 A;  3PHY A;  2OWJ A;  1GSV A;  1S4S A; 
#chains in the Genus database with same CATH topology
 1W8Q A;  2Y2L A;  1ZTU A;  1RCJ A;  1S6R A;  1OTI A;  4OP5 A;  4GDN A;  4HEF A;  1KVM A;  1K55 A;  4C3Q A;  4U0X A;  1ERM A;  1L2S A;  2PBD P;  3MBZ A;  2XFT A;  4UA6 A;  1XXM A;  2HDS A;  3IHA A;  2JKF A;  3BRM A;  4RQ9 A;  2W27 A;  1ZKJ A;  4BLM A;  5IS1 A;  1YM1 A;  1W63 M;  1WE4 A;  2HDR A;  4MBH A;  1ZC2 A;  4P6B A;  2PT7 A;  3UB8 A;  3ZFZ A;  4WLA A;  3C38 A;  5FDS A;  1L3L A;  3KYQ A;  3DTK A;  1PI4 A;  1LSX A;  5CER A;  3F1P B;  3O5Y A;  5CX7 A;  2PYP A;  3T1S A;  3WRZ A;  3IWI A;  2ZOH A;  1TS7 A;  3BEB A;  1NJ4 A;  2AVX A;  3JVV A;  1XFN A;  2JN7 A;  3MSH A;  5J4E A;  2JE5 A;  3WRT A;  4X55 A;  4C75 A;  2ZC4 B;  3NDG A;  4PAU A;  2G7U A;  5HD3 A;  4MDZ A;  2XK1 A;  1ERQ A;  2ACG A;  3WS0 A;  5EM1 A;  3OPP A;  2P7J A;  3NJA A;  4OQG A;  3QP1 A;  5L8M A;  3RTY A;  1SKO B;  4WZ4 A;  3EGD C;  4O7D A;  2PAV P;  4KEN B;  2HJE A;  3KYZ A;  2Y91 A;  2OAP 1;  2J3T D;  4MEZ A;  3S7N A;  3JYI A;  1V9Z A;  3BLS A;  4KQQ A;  5AQ7 A;  3VV4 A;  3IQA A;  5FI6 A;  2VX8 A;  4GN2 A;  3CUE A;  5E2F A;  2PD7 A;  3T4L A;  3T1Q B;  4GLQ A;  1SZV A;  1FSW A;  5DTK A;  4KQD A;  3VP2 A;  1E4D A;  4R4R A;  2WGI A;  3B47 A;  4AFI A;  3FG8 A;  2VKS A;  4I3J A;  4S2M A;  3IHB A;  3EOI A;  3SH8 A;  4GD8 A;  1K54 C;  4GD6 A;  4JKT A;  5AQB A;  5EOE A;  3OPL A;  5HAR A;  4NET A;  4ESP A;  4H6J B;  1IKG A;  3PAG A;  3OCN A;  2H5S A;  3IWO A;  5FAQ A;  3VE4 A;  3HJI A;  1DP8 A;  2KX6 A;  3NCK A;  4OP8 A;  2WAE A;  4HNB A;  3C30 A;  3IXD A;  1LL8 A;  4JXS A;  2PHY A;  2PU4 A;  3DWK A;  2B95 A;  5HD5 A;  3MKE A;  2V0U A;  2WKR A;  5F82 A;  3HLG A;  1UWP X;  3ITA A;  5CEB A;  3FPV A;  1WYC A;  4CQH A;  4QJG A;  3FYZ A;  4FSF A;  2Y55 A;  1HZO A;  2V1B A;  4E3O A;  5EV0 A;  1TEM A;  3C7V A;  2HZ5 A;  3I7J A;  5IU1 A;  4P85 A;  1PNE A;  4OLG A;  1CJF A;  4NXF A;  1K6R A;  2JKR I;  1UGU A;  2J8Y A;  1VB6 A;  5A90 A;  3HLW A;  1LSV A;  1NZO A;  2WUQ A;  3DWZ A;  3A0S A;  2J3T C;  4IUK A;  1JWZ A;  1Z09 A;  5JYO A;  3TOI A;  3C8C A;  4HJ6 A;  3BFG A;  4I3A A;  2Y2P A;  3PAE A;  3V39 A;  4EQ1 A;  2WKQ A;  1E3U D;  1GCE A;  4KZ5 A;  3MKF A;  2ZMV A;  4F94 A;  2GJ3 A;  2ZOI A;  5EM0 A;  4DRT A;  3R7W B;  3RH8 B;  3UMD A;  2W3G A;  5M19 A;  5HWV A;  4OPZ A;  4II7 A;  4Q0H A;  4HI4 A;  1RGY A;  1IFQ A;  4KUO A;  4HBU A;  4YFM A;  5M1A A;  2VV7 A;  3ZVT A;  4OH0 A;  1VEU A;  3LIA A;  4N1X A;  1ERO A;  2L1M A;  1OT9 A;  3LID A;  3H82 B;  5E2E A;  3C5A A;  3MR0 A;  2Y8H A;  3BFF A;  1BTL A;  1ONG A;  2EFX A;  3CHW P;  1L0E A;  5DF9 A;  1ESI A;  1TF1 A;  2M7U A;  3K2N A;  1CI8 A;  4DJ2 A;  5EE8 A;  3E4Q A;  3T4T A;  4GCZ A;  3M6B A;  2W3D A;  1BLS A;  3HVF A;  1JVJ A;  4BQM A;  1G5U A;  1L0G A;  3SH9 A;  4I5S A;  4QB8 A;  5HZH A;  5I5L A;  5GLB A;  1K25 A;  1PRQ A;  1D1J A;  5GLA A;  1ONH A;  2HGV A;  5EVI B;  2XEP A;  3PHY A;  4L0L A;  3IF6 B;  4BMW A;  2BG1 A;  4OOY A;  1HVB A;  3M2J A;  1LSW A;  2EX2 A;  1IYS A;  3IXH A;  3PBQ A;  3TSG A;  1T18 A;  1NYY A;  2Y2K A;  3U2A A;  5IT5 A;  4OKP A;  2PYR A;  3ZDJ A;  2VV8 A;  1VQQ A;  3ITB A;  1S0W A;  3H7W B;  4IJG A;  3HJK A;  3BM6 A;  3E4O A;  3UDX A;  3A0V A;  2D02 A;  3FPW A;  4RVA A;  2DNS A;  4GJ4 A;  2GNX A;  2JKR M;  3UB7 A;  2M7V A;  1K56 A;  5EUA A;  4OOL A;  4BL3 A;  4XT2 B;  3JPU A;  5HL1 A;  4DKI A;  3ZNT A;  5GHY A;  2XDM A;  3A3D A;  1VHM A;  2ZM8 A;  3N8S A;  4DXC A;  3AGF A;  2WZZ A;  3G6O A;  5DJU A;  1MWU A;  4LCL A;  1K4F A;  4MCW A;  2J7V A;  1ES5 A;  2QMI A;  4LLO B;  4JGQ A;  5HDD A;  3IH8 A;  1O07 A;  3LIF A;  4E6W A;  3M2K A;  4O0P A;  4FTX A;  4EBP A;  1PWC A;  3QNC A;  2JBF A;  3IWQ A;  4M3K A;  3E2K A;  3T50 A;  5G4Z A;  1J3W A;  1TS0 A;  2XFS A;  2P9V A;  4KZ6 A;  4GKU A;  4E6X A;  3M6H A;  3BEC A;  1JTG A;  5FQJ A;  5GLC A;  4S2N A;  1CI9 A;  4EBN A;  4BWI A;  1GSV A;  1RGZ A;  1S4S A;  4MN7 A;  3BWL A;  2JHE A;  3ZNY A;  2BLS A;  3W4O A;  3UDF A;  1FR1 A;  2XF3 A;  3IF6 A;  2YKH A;  1FIL A;  4GZB A;  4ZRR A;  4KZ7 A;  4OON A;  3Q7V B;  3A3J A;  3BFC A;  4UEY A;  3QP2 A;  3BQA A;  5F68 A;  2OWH A;  1KGG A;  4Y13 A;  3NDE A;  2WAD A;  5BOH A;  5A93 A;  5L09 A;  4KQR A;  5FEG A;  3N6I A;  1N9O A;  4X25 A;  1YLW A;  2M1C A;  1XPB A;  5L10 A;  1XA7 A;  4K91 A;  1S66 L;  2P74 A;  4WYY A;  1OPX A;  1OT6 A;  3UB6 A;  3OPH A;  2R9X A;  4FCF A;  1LLB A;  3LCE A;  4IBX A;  2E8I A;  1K6S A;  2LB9 A;  4HH2 A;  3G2Z A;  5KZH A;  3EGX C;  1CK3 A;  4S2I A;  3UNW A;  2EA9 A;  3KYE A;  4MMN A;  2HP5 A;  4YIN A;  1OME A;  3T1X A;  1ES3 A;  2Q9N A;  3G31 A;  2HPB A;  1LL9 A;  4R23 A;  3LI8 A;  2A49 A;  1CQA A;  1S4R A;  1YLP A;  3CPT A;  4RYE A;  3BYD A;  5EVE A;  2A2L A;  4EW7 A;  4IHQ A;  3HUO A;  4ETZ A;  2C5W B;  4JLF A;  5FQ9 A;  5E2H A;  4WEK A;  5AVF A;  1BLC A;  4NK3 A;  3RFB A;  2XD5 A;  3QP6 A;  2IWB A;  1Y28 A;  1YLZ A;  4E3L A;  1XJ4 A;  1STZ A;  2K2N A;  4ZJ2 A;  4JXW A;  2V2F F;  3MXR A;  2H0T A;  1K56 D;  4HQA A;  4LGW A;  4JF6 A;  2QWS A;  1MY8 A;  3E98 A;  3IX3 A;  4BL2 A;  1H8M A;  3V5M A;  3HLB A;  5LBR A;  1EWZ A;  5J8X A;  1C3B A;  3S4X A;  2ZLY A;  1GSX A;  2GX5 A;  3N7W A;  2ZQ9 A;  4I39 A;  5GL9 A;  5FQK A;  4LPZ A;  2OLV A;  5DTS A;  1YSQ A;  2X01 A;  4K08 A;  4KG5 A;  3T4S A;  2RL3 A;  1K57 C;  1Z6F A;  3HL9 A;  3V50 A;  3NBL A;  3W2Z A;  4WL9 A;  2HDQ A;  4UA7 A;  4ZBE A;  2W1R A;  4R0Q A;  3QP5 A;  3FWL A;  3ZHH A;  2Y2H A;  1LT0 A;  4KQO A;  2Y2J A;  4OPQ A;  3JVU A;  3BFD A;  3TW8 A;  3HBR A;  4DE2 A;  3T4O A;  5MC7 A;  2QZ6 A;  2PBY A;  3LGO A;  3CAX A;  4KG6 A;  3N8R A;  1OTA A;  2Y2Q A;  3WS4 A;  1O7E A;  3UPN A;  2Q0O A;  1K38 A;  3TRC A;  3UB5 P;  1KDS A;  3UE3 A;  1YMX A;  1K54 A;  4GOG A;  3IH9 A;  1TD5 A;  2JC7 A;  4WEJ A;  1QMF A;  1XP4 A;  5CRF A;  1BYW A;  3N8L A;  5FSR A;  4O8G A;  3E0Y A;  1ZHH B;  4S2N C;  2Z6D A;  4LV0 A;  1ZG4 A;  2A3U A;  4L9E A;  1N4O A;  2WYX A;  2BAS A;  5HWW A;  3UO9 A;  4QU3 A;  3P7N A;  4S2O A;  5HWT A;  3FC7 A;  4GS9 B;  4BBU A;  4Y0U A;  4IBR A;  2Z2L B;  2VV6 A;  5FL3 A;  4I3I A;  2CMN A;  3LR5 A;  3PBO A;  4BJP A;  1NYM A;  2WKP A;  4PPR A;  1W5D A;  2QJ5 A;  4OQI A;  1SKO A;  2ZMF A;  1HTZ A;  3B42 A;  2G2W A;  3HUN A;  3S1Y A;  1YSP A;  3A3I A;  2W1T A;  2JKG A;  2V1Z A;  5EFW A;  4S2J A;  2JKT M;  1YLY A;  3ZG7 B;  5CGX A;  3IS2 A;  3SOI A;  2EX8 A;  2XA7 S;  3T12 B;  5KSH A;  3QP8 A;  3MZD A;  4WZ5 C;  3T4Q A;  4F3L A;  3B3X A;  4LRX C;  1F9I A;  5AVE A;  1Y4O A;  2O9B A;  4P6Z M;  1YQS A;  2INW A;  3GDI A;  3PXP A;  2D01 A;  3PBN A;  2BTF P;  1J9M A;  4IVK A;  4IUH A;  1OTE A;  4DXB A;  2Y4A A;  2Y79 A;  2I9V A;  2FH5 A;  1BLH A;  4KZ8 A;  3GMW A;  2J80 A;  1T1A A;  1OJ5 A;  3TJZ C;  1JWV A;  1OJG A;  2O99 A;  4JBF A;  1XFQ A;  2GZA A;  1JWP A;  4NXE A;  2E8J A;  4Q8I A;  3GVB A;  1P97 A;  3EQU A;  5CTM A;  2VGL M;  3W8K A;  2H28 A;  4KUK A;  4G3K A;  2H10 A;  3OZH A;  4GS9 A;  2PR5 A;  5EOO A;  1VM1 A;  4G3V A;  4EXO A;  2XA7 M;  2ZBB A;  5DF8 A;  4ARZ A;  4YWZ A;  2ZL1 B;  1DJA A;  5GHX A;  4X6T A;  4JGO A;  3E4P A;  4LEN A;  4GHI A;  1VEU B;  1FSY A;  3PR6 A;  5JYP A;  3VOY A;  1IYO A;  4L9G A;  1KE4 A;  5FQQ A;  3SS3 A;  2WGW A;  3IX8 A;  4OPR A;  5TBM A;  3GR2 A;  3SH7 A;  2Y2M A;  4UQI S;  2ZC6 B;  4Q0J A;  3T4J A;  4EUZ A;  2XRN A;  5L07 A;  2FZ0 A;  5KIZ A;  1LI9 A;  3C2W A;  2OV5 A;  2EXA A;  3MFD A;  5HDS A;  1PZP A;  3NOP C;  2ZC5 B;  3IT9 A;  3VOL A;  5F5Y A;  3OPR A;  2J9P A;  4LFU A;  3F1N A;  1H8Z A;  3LYX A;  4P6Z S;  4BBT A;  2V8F A;  3ULF A;  1YPR A;  1G6A A;  4WF0 A;  5TBM B;  2XQZ A;  3NIA A;  5A91 A;  4IED A;  3UPO A;  1H0M A;  1BT5 A;  3S7O A;  3H9W A;  4XXR A;  3G30 A;  2OLU A;  1FCN A;  3AGD A;  1SCW A;  4X68 A;  2ZM0 A;  3KSF A;  2R78 A;  2ZC3 B;  2ZM2 A;  4X56 A;  3CPT B;  5E2G A;  3HLD A;  2W3F A;  3A3F A;  3HRE A;  3Q81 A;  1KGF A;  3FZC A;  2GDN A;  2O9A A;  1IYQ A;  4JF4 A;  5EEC A;  1QME A;  1VET A;  4FD8 A;  2V20 A;  4HHD A;  1LL5 A;  2J3W A;  2OAQ 1;  2Y2O A;  4EEP A;  1MBL A;  1IKI A;  2V1A A;  1FOF A;  2PRF A;  4DDY A;  4A5R A;  4Y2F A;  2IA2 A;  2EXB A;  2WGV A;  1Q2Q A;  5FAO A;  4EUV A;  4KZA A;  3IXG A;  2WKE A;  4PM9 A;  1MWR A;  4FUW A;  4Y15 A;  2EX6 A;  2FFF B;  3DBA A;  3Q1F A;  3VE3 A;  3PBR A;  4D60 A;  3UE1 A;  1SKF A;  1F98 A;  2ZQC A;  5TGF A;  3MFX A;  4N9K A;  1E3U A;  5FQI A;  4MNR A;  3ZYT A;  1G68 A;  1YMS A;  5FDH A;  2JKT I;  4LV2 A;  3DW0 A;  3KSH A;  3EEA A;  3T1R A;  3Q82 A;  3LIB A;  2EFU A;  1IEM A;  2H0Y A;  3KSI A;  1D7E A;  3C7U A;  5F83 A;  4OQ0 A;  1LHY A;  2HDU A;  3W4P A;  4HY8 A;  5A8B A;  2KOI A;  4CLC A;  1IEL A;  2YKF A;  3P09 A;  1H8Y A;  1ALQ A;  5DFX A;  1T1B A;  4UQI M;  1DJB A;  3LR0 A;  1HLU P;  1T19 A;  3SS5 A;  3WS1 A;  2VGL S;  1YAX A;  2VJW A;  3LEQ A;  4ZJ1 A;  4FH4 A;  3VP1 A;  5F1F A;  2RCX A;  2HV1 A;  4KG2 A;  4H6J A;  1HD8 A;  3PBT A;  1I2W A;  4QD4 A;  3GV9 A;  2X71 A;  1NY0 A;  5CHM A;  3W4Q A;  1H5X A;  1G28 A;  2IWD A;  4NEE D;  2VK3 A;  1MWT A;  4GDB A;  2FFY A;  4L9F A;  3VFF A;  3GQZ A;  4ME4 A;  2CC1 A;  1SDN A;  1H3Q A;  2VZW A;  3NI9 A;  1KE3 A;  1W79 A;  2IWC A;  1L0F A;  2XRO A;  2P08 A;  5CGW A;  4PHT A;  5AQ9 A;  4HJ3 A;  3O86 A;  3MXQ A;  4K0W A;  1OTD A;  4HH3 A;  4B4X A;  5CHU A;  4OPY A;  5GLD A;  1E25 A;  1DP9 A;  3IBR A;  2DRW A;  1F2K A;  3OOV A;  3Q07 A;  3HLF A;  4NG2 A;  1PI5 A;  4B4Z A;  3F1P A;  1KDW A;  2I72 A;  3HLC A;  2LB5 A;  4P87 A;  4PKY G;  4G3W A;  3PYP A;  4MN5 A;  4E3N A;  1JNU A;  2HP9 A;  3KO6 A;  2Z6C A;  3LR3 A;  3R7W A;  1A0K A;  1XA1 A;  1S1Y A;  3IS2 B;  3MJQ A;  2WKH A;  1TS8 A;  2ZJ9 A;  2V8C A;  5G18 A;  3BFE A;  4B93 A;  4ZTK A;  1PYY A;  2XH9 A;  4GNU A;  1MPL A;  5HAQ A;  5HL6 A;  1BUE A;  3EWK A;  1M40 A;  1TDL A;  3G35 A;  3G32 A;  1FCM A;  2ZQA A;  3NC8 A;  3EQV A;  2K7S A;  1XGI A;  3LEZ A;  4OVD A;  1FIK A;  2ZQ7 A;  3L9K A;  1L0D A;  4EET B;  3LIC A;  4C6Y A;  1AXB A;  5C5K A;  3SW1 A;  3MMH A;  5K5B A;  3C4P A;  4EQI A;  3CWF A;  3LY3 A;  2W1T B;  4OLD A;  4PM8 A;  2VLG A;  3VFH A;  1AWI A;  4R3A A;  4R4S A;  4RA7 A;  3KSG A;  1GHM A;  4XUZ A;  1PW8 A;  2XGN A;  3K3C A;  4KZ9 A;  4QHC A;  2EWV A;  2A24 A;  3HCY A;  3OC2 A;  5E43 A;  5DTT A;  1K55 C;  2Z2M B;  2X02 A;  4YOF A;  4LRY C;  3E2L A;  5DF7 A;  1YLT A;  3GTC A;  4GHI B;  2PU2 A;  3D3O A;  1TDG A;  4EWF A;  4ZJ3 A;  2PD8 A;  5EVI D;  2PR6 A;  3F1O B;  3VP0 A;  4RX2 A;  2J9O A;  5FAT A;  4DE0 A;  5CTN A;  4X53 A;  2VA0 A;  3H7W A;  1XGJ A;  5TFQ A;  3NEC A;  3ZVW A;  5DKL A;  4EV4 A;  4DJ3 A;  3O3V A;  2DMW A;  3D4F A;  5HW3 A;  1UWN X;  3V67 A;  4UAA A;  1ES4 A;  3O88 A;  3S7Q A;  4HJ4 A;  4M4X A;  1ZG6 A;  3CZD A;  3OBF A;  2QJ7 A;  4WM9 A;  1PW1 A;  5EVL A;  4NXG A;  3B33 A;  4KZ3 A;  4R3J A;  4S2K A;  5F6A A;  2ZL1 A;  3WS2 A;  5HDC A;  4MLL A;  4UHU A;  4JPM A;  3BY9 A;  4HIA A;  4WEL A;  4GB7 A;  2Q9M A;  2W0N A;  5FQM A;  5FI7 A;  4WUJ A;  4EU0 A;  3SZT A;  1FQG A;  3KX0 X;  4PKY A;  5HFO A;  1I5Q A;  2WKI A;  3PBS A;  1YT4 A;  1ESU A;  5CEC A;  4WBG A;  3BQ8 A;  1Y54 A;  3ZG0 A;  4NKP A;  4P0M A;  2OWJ A;  4CPK A;  4E3J A;  2W3H A;  2ZMA A;  4N9L A;  4IVI A;  1ODV A;  3ZG9 B;  1BLP A;  2A24 B;  3F1N B;  3S7P A;  3CLO A;  2QPN A;  4ZAM A;  2DCF A;  4DF6 A;  5G4Y A;  5CGS A;  2QHK A;  1SDE A;  1M6K A;  1NRF A;  2Y2I A;  3IXB A;  4Y0O A;  4EEU A;  3BW6 A;  3LIE A;  4DE1 A;  2B5R A;  4LRZ E;  1N9L A;  4N1H A;  3CUE C;  4RX3 A;  1YLJ A;  2P04 A;  4JGP A;  4X1L A;  2QYB A;  4CJN A;  3IX4 A;  3MZE A;  2HP6 A;  3P01 A;  4JGR A;  4EES A;  3ZG5 A;  5DVA A;  1TS6 A;  3DTI A;  4LV1 A;  1GA0 A;  1NZU A;  4I38 A;  4MBK A;  4Q0I A;  1XJ6 A;  3V3S A;  4N92 A;  4BBV A;  3WWX A;  2K31 A;  5M18 A;  4X69 A;  4Y17 A;  4JF5 A;  3L7H A;  3ZGA B;  1XX2 A;  5EVI A;  5HSQ A;  4X1M A;  4EER A;  1I2S A;  3VMA A;  3GEC A;  4LCM A;  2WAF A;  3MZF A;  1PZO A;  1NLZ A;  4HP4 A;  1KGE A;  2JCH A;  5DKK A;  4LV3 A;  2XSS A;  1DY6 A;  1NWZ A;  3LI9 A;  2PDR A;  3VP3 A;  4FOF A;  1BUL A;  3UE0 A;  1IOU A;  4Y7P A;  1MKM A;  4FH2 A;  3H82 A;  1DJC A;  1GHP A;  4E3I A;  2G2U A;  4CLC B;  1U60 A;  3GRJ A;  1CF0 A;  2EWW A;  4HOI A;  3DAV A;  4MN6 A;  3FKV A;  3G34 A;  3D9Y A;  5F1G A;  5FA7 A;  4BD0 A;  3T4K A;  3RJU A;  1N9B A;  3NOU C;  1MZU A;  3VOZ A;  4F3L B;  1IYP A;  3N4I A;  4EBL A;  2VGJ A;  2HJ9 C;  3TG9 A;  4ARZ B;  4CLC D;  2OSU A;  4HES A;  3LFV A;  1SHV A;  1Q2P A;  4S2L A;  3Q7Z A;  4KZ4 A;  3CMZ A;  5CXW A;  3MQQ A;  3WS5 A;  3ISG A;  3LUQ A;  1TVF A;  1F5M A;  5EPH A;  4BEN A;  4JXV A;  3A3E A;  5HX9 A;  4U0T A;  2ZD8 A;  3VSL A;  1FCO A;  4R6L A;  4U3T A;  1PWG A;  5J3W A;  5FAS A;  1FR6 A;  3CJM A;  4PMA A;  3IF6 C;  1NLY A;  1DP6 A;  4PM7 A;  3NY4 A;  4H8R A;  3EEH A;  4BD1 A;  2Y59 A;  3BJN A;  4DE3 A;  4WN5 A;  1VET B;  3O87 A;  1D06 A;  4JXG A;  1W63 Q;  3BY8 A;  3BLM A;  4DN0 A;  1ES2 A;  1K4E A;  1PWD A;  4R1G A;  1K57 A;  5D3O A;  3U4L P;  3QHY A;  4KZB A;  1G6O A;  3OLO A;  2EX9 A;  3RXW A;  3NHQ A;  2MJ6 A;  5HAP A;  5AQA A;  4R70 A;  4ID4 A;  2ZQ8 A;  2W3E A;  4QY6 A;  5HPI A;  4ETX A;  4YNR A;  2ZC7 A;  1MXO A;  5IHV A;  2B02 A;  4Y5F A;  4K0X A;  3S22 A;  1MC0 A;  3G2Y A;  2P9V B;  2L0W A;  2B18 A;  2ZQD A;  3UB9 A;  5HAI A;  4PM5 A;  3ZG8 B;  3G4P A;  4S2P A;  5DJT A;  3ZQ5 A;  5A92 A;  2Y2G A;  3MQO A;  4MBF A;  5FEF A;  1NRJ A;  3LY4 A;  4B9O A;  2O0Y A;  1KVL A;  2XD1 A;  1PIO A;  4WZ5 A;  1X0O A;  1RP5 A;  2WK0 A;  4Y0T A;  5KMW A;  3OCL A;  1CEF A;  4E04 A;  3CI6 A;  2O9C A;  5U47 A;  5L2F A;  3CIT A;  3QP4 A;  3C4O A;  2XR0 A;  2VGK A;  1W8Y A;  3IBJ A;  3UN7 A;  1BSG A;  4WMC A;  3UE6 A;  4HBT A;  4E3K A;  1P9R A;  1OTB A;  4O01 A;  3FKW A;  4OOM A;  5AJG A;  5J7E A;  1K0K A;  4DMZ A;  3MF0 A;  2HF6 A;  3VP4 A;  3MQ0 A;  3LO7 A;  3NOT C;  4CLC E;  3V3R A;  3ICY A;  3AGE A;  2NUT C;  5I94 A;  3F1O A;  4OQH A;  2KDK A;  4E3M A;  4Z9Q A;  1S67 L;  3PTE A;  4GW9 A;  5CED A;  1NXY A;  3DTE A;  5KSC A;  3LR4 A;  4XUX A;  1PFL A;  4ZDX A;  3DTM A;  2OOL A;  3IF5 A;  5TJJ A;  1P9W A;  3RXX A;  4R38 A;  3QNB A;  3UPP A;  1MWS A;  4HP9 A;  3Q7V A;  1KOU A;  2R9W A;  2Y2N A;  5GHZ A;  3UDI A;  3CG5 A;  3D72 A;  4B88 A;  1N9N A;  4CLC C;  1BZA A;  4QPR A;  1CEG A;  3GSG A;  4XT2 A;  1EI5 A;  3P98 A;  4QWO A;  4DDS A;  1XJ2 A;  3UME A;  1GA9 A;  5TR7 A;  1JTD A;  3MS6 A;  4WMC D;  3VSK A;  4QY5 A;  5F69 A;  5FAP A;  3TE8 A;  2NUP C;  1EW0 A;  5HPF A;  1KE0 A;  3HLE A;  2QKP A;  2WZX A;  3R4K A;  2UWX A;  1DRM A;  2WGW B;  3FV7 A;  3NUL A;  4NXB A;  1YKD A;  2L4R A;  1MKI A;  1WYB A;  2V9A A;  3K3D A;  2UV0 E;  5CHJ A;  4Y3I A;  1T1C A;  4D2O A;  4Z1W A;  1XKZ A;  3HUM A;  3UY6 A;  2XLN A;  5DFY A;  1P0Z A;  5FI2 A;  1WA9 A;  2VEA A;  1LI0 A;  1W7F A;  1V9Y A;  4R3B A;  4UA9 A;  3ZCZ A;  3A0R A;  1GHI A;  1S1Z A;  1GSW A;  4PM6 A;  3SS4 A;  3MXS A;  5EVI C;  2V0W A;  2C6W B;  1ACF A;  1XJ3 A;  2KLI A; 
#chains in the Genus database with same CATH homology
 2W3H A;  4MN7 A;  3BWL A;  2JHE A;  3LYX A;  1ZTU A;  4P6Z S;  1ODV A;  2YKH A;  4BBT A;  1OTI A;  3ULF A;  2A24 B;  3F1N B;  4WF0 A;  5TBM B;  3S7P A;  3CLO A;  4ZRR A;  4UEY A;  5G4Y A;  2QHK A;  3S7O A;  3BQA A;  3H9W A;  5F68 A;  4EEU A;  2OWH A;  3BW6 A;  4RQ9 A;  2W27 A;  3LIE A;  5IS1 A;  1W63 M;  4LRZ E;  1N9L A;  2PT7 A;  3CUE C;  2P04 A;  1N9O A;  4JGP A;  3UB8 A;  4WLA A;  3KSF A;  3C38 A;  2R78 A;  3KYQ A;  2M1C A;  2QYB A;  1LSX A;  3P01 A;  4JGR A;  3F1P B;  4EES A;  3O5Y A;  1S66 L;  1TS6 A;  5CX7 A;  2W3F A;  1OPX A;  1OT6 A;  3UB6 A;  2PYP A;  4I38 A;  4Q0I A;  1XJ6 A;  2ZOH A;  1TS7 A;  2O9A A;  4BBV A;  3JVV A;  1XFN A;  2JN7 A;  2K31 A;  5J4E A;  2LB9 A;  4HH2 A;  5HSQ A;  4PAU A;  4EER A;  2G7U A;  3GEC A;  5HD3 A;  4HHD A;  3EGX C;  4MDZ A;  2EA9 A;  1NLZ A;  4HP4 A;  4MMN A;  5DKK A;  2J3W A;  2OAQ 1;  2XSS A;  1NWZ A;  3LI9 A;  2P7J A;  4EEP A;  3NJA A;  5L8M A;  3LI8 A;  2V1A A;  2PDR A;  4FOF A;  3RTY A;  3EGD C;  4Y2F A;  1IOU A;  1S4R A;  2IA2 A;  2HJE A;  1MKM A;  3KYZ A;  3H82 A;  2OAP 1;  2J3T D;  2A2L A;  3S7N A;  4EUV A;  4CLC B;  1V9Z A;  4EW7 A;  4IHQ A;  2EWW A;  4ETZ A;  3DBA A;  3VV4 A;  4HOI A;  3VE3 A;  3PBR A;  4MN6 A;  2VX8 A;  4WEK A;  5AVF A;  3CUE A;  3RFB A;  1F98 A;  2PD7 A;  3T4L A;  3T4K A;  4GLQ A;  1Y28 A;  3NOU C;  1MZU A;  4F3L B;  3MFX A;  1XJ4 A;  1STZ A;  2HJ9 C;  2K2N A;  4KQD A;  3ZYT A;  4ARZ B;  2JKT I;  4CLC D;  3B47 A;  4HQA A;  2QWS A;  3LFV A;  3KSH A;  3E98 A;  3EEA A;  4AFI A;  3FG8 A;  2VKS A;  3LIB A;  3MQQ A;  1H8M A;  4I3J A;  3KSI A;  1D7E A;  3EOI A;  3LUQ A;  5LBR A;  1F5M A;  4HY8 A;  5A8B A;  2KOI A;  1GSX A;  4CLC A;  2YKF A;  2GX5 A;  4I39 A;  4R6L A;  5DFX A;  1T1B A;  5J3W A;  4H6J B;  4UQI M;  4LPZ A;  1YSQ A;  3LR0 A;  3OCN A;  1NLY A;  1T19 A;  2VGL S;  4K08 A;  1YAX A;  1DP6 A;  2VJW A;  3T4S A;  3VE4 A;  3HJI A;  1DP8 A;  2KX6 A;  3EEH A;  2HV1 A;  3BJN A;  4HNB A;  4H6J A;  4WN5 A;  3W2Z A;  3PBT A;  4WL9 A;  2W1R A;  3C30 A;  1D06 A;  1W63 Q;  3BY8 A;  4DN0 A;  1LL8 A;  1G28 A;  4NEE D;  2PHY A;  1LT0 A;  4KQO A;  4L9F A;  3JVU A;  5HD5 A;  4ME4 A;  3TW8 A;  1G6O A;  2V0U A;  3T4O A;  1H3Q A;  2WKR A;  2VZW A;  3OLO A;  5MC7 A;  1UWP X;  3CAX A;  3FPV A;  4CQH A;  3NHQ A;  2MJ6 A;  4FSF A;  2XRO A;  2P08 A;  1OTA A;  4PHT A;  4R70 A;  2V1B A;  4HJ3 A;  2W3E A;  5HPI A;  3MXQ A;  3TRC A;  5IU1 A;  1OTD A;  4HH3 A;  4ETX A;  4YNR A;  3UE3 A;  1DP9 A;  3IBR A;  3OOV A;  1TD5 A;  4NXF A;  2JKR I;  1UGU A;  4WEJ A;  1VB6 A;  2B02 A;  4Y5F A;  3F1P A;  1LSV A;  1BYW A;  1MC0 A;  2LB5 A;  4PKY G;  4G3W A;  4O8G A;  3PYP A;  3A0S A;  2J3T C;  2L0W A;  2B18 A;  3E0Y A;  3UB9 A;  4IUK A;  4MN5 A;  1JNU A;  1ZHH B;  2Z6D A;  3KO6 A;  5DJT A;  3C8C A;  2Z6C A;  3LR3 A;  4HJ6 A;  4I3A A;  4L9E A;  3R7W A;  3ZQ5 A;  3MQO A;  2BAS A;  5HWW A;  1S1Y A;  1NRJ A;  3IS2 B;  3MJQ A;  3P7N A;  4EQ1 A;  2WKQ A;  1TS8 A;  4B9O A;  5HWT A;  2O0Y A;  3FC7 A;  4GS9 B;  4BBU A;  4B93 A;  2VV6 A;  2ZMV A;  5FL3 A;  2GJ3 A;  4I3I A;  2ZOI A;  5HL6 A;  1X0O A;  2CMN A;  3LR5 A;  3OCL A;  3R7W B;  3RH8 B;  3UMD A;  3PBO A;  2W3G A;  5HWV A;  4II7 A;  4Q0H A;  3EWK A;  4E04 A;  3CI6 A;  4HI4 A;  2O9C A;  4BJP A;  2WKP A;  1IFQ A;  2QJ5 A;  4KUO A;  3CIT A;  2ZMF A;  3EQV A;  2K7S A;  2VV7 A;  3IBJ A;  3LIA A;  3B42 A;  3UE6 A;  2L1M A;  1OT9 A;  3LID A;  1P9R A;  1OTB A;  3H82 B;  4O01 A;  3MR0 A;  2Y8H A;  4OOM A;  1YSP A;  5AJG A;  5J7E A;  4EET B;  4DMZ A;  3LIC A;  3MF0 A;  2HF6 A;  2W1T A;  5EFW A;  5DF9 A;  3MQ0 A;  2JKT M;  3NOT C;  4CLC E;  1TF1 A;  2M7U A;  5C5K A;  3K2N A;  4DJ2 A;  3ICY A;  3IS2 A;  3SW1 A;  3MMH A;  3E4Q A;  3T4T A;  5K5B A;  2NUT C;  2XA7 S;  4GCZ A;  2W3D A;  5KSH A;  3T4Q A;  3F1O A;  4F3L A;  4LRX C;  1F9I A;  3CWF A;  2KDK A;  5AVE A;  2O9B A;  4I5S A;  4P6Z M;  2W1T B;  5HZH A;  2INW A;  3GDI A;  1S67 L;  2VLG A;  5I5L A;  3PXP A;  4R3A A;  3KSG A;  4GW9 A;  2D01 A;  3PBN A;  3LR4 A;  2HGV A;  3K3C A;  3PHY A;  4L0L A;  4IUH A;  2OOL A;  5TJJ A;  1P9W A;  1OTE A;  2EWV A;  4BMW A;  4R38 A;  2A24 A;  3HCY A;  1LSW A;  3OC2 A;  2Y79 A;  2I9V A;  3PBQ A;  1T18 A;  2FH5 A;  4HP9 A;  4YOF A;  4LRY C;  2J80 A;  1T1A A;  1KOU A;  1OJ5 A;  3U2A A;  5IT5 A;  2PYR A;  2VV8 A;  3D72 A;  3TJZ C;  1N9N A;  4GHI B;  4CLC C;  3H7W B;  4IJG A;  1OJG A;  2O99 A;  3HJK A;  3D3O A;  4QPR A;  3E4O A;  1XFQ A;  2PD8 A;  2GZA A;  2PR6 A;  3F1O B;  4NXE A;  4XT2 A;  1P97 A;  3A0V A;  2D02 A;  3FPW A;  1XJ2 A;  3EQU A;  3UME A;  2VA0 A;  2VGL M;  3H7W A;  4GJ4 A;  2H28 A;  2GNX A;  4KUK A;  2JKR M;  4G3K A;  5DKL A;  3UB7 A;  2M7V A;  5F69 A;  3TE8 A;  4OOL A;  2NUP C;  4DJ3 A;  1EW0 A;  4GS9 A;  4XT2 B;  5HPF A;  2PR5 A;  2DMW A;  4G3V A;  4EXO A;  2QKP A;  1UWN X;  3R4K A;  2XA7 M;  2ZBB A;  3V67 A;  1DRM A;  1VHM A;  4ARZ A;  4NXB A;  1YKD A;  4YWZ A;  3G6O A;  5DJU A;  2L4R A;  3S7Q A;  4HJ4 A;  2V9A A;  4M4X A;  3K3D A;  2QJ7 A;  3OBF A;  4JGO A;  3E4P A;  4MCW A;  4GHI A;  4Y3I A;  3PR6 A;  1T1C A;  4Z1W A;  4L9G A;  4LLO B;  5HDD A;  4JGQ A;  4NXG A;  3LIF A;  3B33 A;  5TBM A;  4UQI S;  5F6A A;  4Q0J A;  3T4J A;  2XRN A;  5HDC A;  2FZ0 A;  5KIZ A;  4O0P A;  3C2W A;  3BY9 A;  4HIA A;  5DFY A;  4WEL A;  5HDS A;  1P0Z A;  1WA9 A;  2W0N A;  2VEA A;  3NOP C;  4WUJ A;  4EU0 A;  3T50 A;  5G4Z A;  1V9Y A;  1TS0 A;  3A0R A;  1S1Z A;  1GSW A;  3KX0 X;  4PKY A;  3VOL A;  5F5Y A;  3PBS A;  3F1N A;  2V0W A;  3BQ8 A;  4NKP A;  4BWI A;  1XJ3 A;  2OWJ A;  1GSV A;  2KLI A;  1S4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...