2L1MA

Solution structure of the eag domain of the herg (kv11.1) k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 2
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l1mA00
3MJQA 4WUJA 3MXQA 5DJUA 2V1AA 1OT6A 3C8CA 2QJ7A 1GSXA 3H82A 1N9NA 4H6JA 5J3WA 2VEAA 4F3LB 3SW1A 1T19A 5HWVA 4HH2A 4HY8A 3MFXA 5HDDA 5IU1A 3LI9A 3MR0A 4GHIB 3F1OB 3OLOA 4GS9A 3UB7A 3VOLA 4GCZA 1S66L 5DKKA 3F1NB 4PKYG 3LIDA 1OT9A 2H28A 4EESA 3NOUC 3NJAA 4BBTA 4K08A 1OTEA 1MZUA 2QHKA 2OWJA 1LT0A 3A0VA 4JGOA 3D72A 1S67L 2VLGA 1XJ4A 1P97A 1GSVA 2L1MA 4HQAA 3H9WA 3ZQ5A 4HP9A 2WKRA 5HD3A 2OOLA 4KUOA 3NOPC 1X0OA 2D01A 2ZOIA 3H7WB 3HJIA 1XJ2A 5DKLA 5AVEA 2INWA 2Z6CA 2L0WA 4I3JA 4JGQA 3CLOA 3NOTC 4R3AA 1OTBA 2VV8A 1G28A 2J80A 1OTDA 3PYPA 2L4RA 2R78A 3BY8A 3MQQA 4GW9A 1N9LA 4HIAA 4PKYA 3UMDA 4BBUA 4EETB 5J4EA 3H82B 4LRXC 4L9EA 4M4XA 3K3CA 2V1BA 1S4RA 4LPZA 1BYWA 5HWWA 4E04A 2A24A 4GHIA 4GS9B 3F1OA 5J7EA 4MN5A 2WKPA 2PD8A 4HJ4A 3F1NA 3G6OA 5HDCA 2KX6A 2PD7A 3EEHA 2B02A 3C2WA 2K7SA 3LIEA 4LRYC 1S4SA 1DP8A 2QJ5A 3E4PA 3IS2A 1UGUA 3F1PA 1OJGA 1TS6A 2V0UA 4HH3A 4EEUA 2ZBBA 3BWLA 1LSXA 2ZOHA 3UE6A 4EW7A 2W27A 1TS0A 3LIAA 1DRMA 4WF0A 1S1ZA 1T1CA 5IS1A 4JGRA 2D02A 4NXBA 4EEPA 2QWSA 2EA9A 3F1PB 4F3LA 5G4ZA 1EW0A 1XJ6A 2W0NA 5HWTA 5A8BA 5HDSA 5I5LA 2GJ3A 2I9VA 4EQ1A 4EXOA 4L9FA 2V0WA 3H7WA 1KOUA 1LL8A 1OJ5A 2KDKA 2HV1A 1OTAA 2V9AA 2VV7A 4I3AA 1N9OA 5G4YA 3UB8A 3EWKA 5AVFA 5HSQA 1WA9A 4XT2A 1P0ZA 2YKHA 2VV6A 1LSVA 2JN7A 4YWZA 5TBMB 3RH8B 2PDRA 3T50A 5F68A 4DJ2A 3LUQA 1VB6A 1F9IA 3FC7A 4R38A 1LSWA 1V9ZA 1XJ3A 3PHYA 1V9YA 1UWPX 3K3DA 3GECA 2QKPA 3CWFA 1UWNX 4H6JB 4RQ9A 4XT2B 4HJ3A 4R70A 4HI4A 4NXFA 1DP9A 3RTYA 3ULFA 1Y28A 1S1YA 4HP4A 4I38A 1D7EA 4WN5A 5DJTA 1XFQA 5F6AA 4LLOB 3P7NA 2OWHA 4I5SA 2WKQA 3A0RA 4HHDA 5HZHA 5KIZA 2PYPA 1TS8A 2CMNA 3BY9A 4HOIA 2M1CA 4NXGA 5F69A 3MQOA 4L9GA 3UB9A 4EERA 1T1BA 1XFNA 4I3IA 2Z6DA 2YKFA 4KUKA 1OTIA 2P7JA 3LI8A 2PR5A 1GSWA 3CAXA 4KQDA 3VE3A 4JGPA 1D06A 1NWZA 3LIBA 3LICA 3LYXA 1ODVA 3GDIA 1TS7A 3B33A 2PHYA 4HJ6A 3IS2B 1T18A 4WL9A 5HD5A 5TBMA 3A0SA 3IBRA 4R6LA 3UB6A 3UMEA 1DP6A 5EFWA 4BBVA 4DJ3A 3HJKA 2BASA 5F5YA 3ICYA 4NXEA 3LIFA 1T1AA 1JNUA 4HNBA 2PR6A 3E4QA 3FG8A 3VE4A 4B9OA 4LRZE 4MN6A 4WLAA 3KX0X 2JHEA 2PYRA 4I39A 3NHQA 3E4OA 2A24B 1F98A
chains in the Genus database with same CATH superfamily
4E6XA 5IT5A 4QPRA 1RCJA 4Z1WA 3IHAA 3S22A 4P85A 3M6BA 3IXHA 3M2KA 3WS1A 1CJFA 5GL9A 3MS6A 3A3FA 3CLOA 2KLIA 2EX8A 3BLSA 4H8RA 2XFSA 1L3LA 2B18A 3BY8A 4BBUA 3UMDA 2VGLM 3H82B 4M4XA 3S7PA 2QYBA 4MN5A 4B88A 4UA6A 3SS4A 4PM7A 2KX6A 5DTKA 2O99A 5CXWA 2W1TA 4EUVA 2ZMFA 4OLDA 3UE6A 1DJAA 3LIAA 4LV2A 4OP8A 4EBLA 3T1QB 1ONGA 3G30A 4Y5FA 2EA9A 3UE1A 3PBRA 2Y4AA 1XGIA 5DF8A 2VV7A 1K55C 1N9OA 4S2KA 1P0ZA 2O0YA 2PDRA 4HEFA 2Y2JA 3FC7A 3OPPA 1NRFA 4DDYA 1V9YA 4KQQA 3V3RA 1NXYA 3GECA 4OVDA 4EQ1A 4NXFA 4A5RA 3BQAA 3JYIA 2VX8A 2OLVA 3EGXC 3BY9A 3UNWA 2M1CA 2XLNA 3ZG7B 1S0WA 3MZEA 3PR6A 3CAXA 3LYXA 4ZTKA 3A0SA 4IUKA 2GZAA 3UB6A 3N8LA 2WZZA 3QHYA 2WUQA 2BASA 4HNBA 3NY4A 4N1XA 1OT6A 3H82A 1XGJA 5HPFA 1XKZA 2Y55A 4OOLA 3UB7A 3F1OB 3OLOA 2GDNA 4HBUA 2XA7S 3SH7A 3B3XA 3EQVA 2OWJA 3LR4A 2P9VB 4YNRA 1U60A 5AVEA 3MZDA 4ARZA 4R3AA 1NZOA 4I3JA 5HAPA 3NOTC 2M7VA 4IBRA 3IF6C 3Q82A 1E3UA 3OCNA 4L9EA 5CEBA 3PAGA 4C75A 3BEBA 4LRYC 4NXBA 3E4PA 1W7FA 2Z2MB 1NYMA 3T4OA 2EXBA 4EEPA 5CX7A 3IX3A 2EWWA 4GD6A 4F3LA 3VOYA 1J9MA 3GR2A 2JKFA 4IJGA 2Y2KA 1OJ5A 2KDKA 4FUWA 3A3IA 5HSQA 1ZG6A 1WA9A 5TBMB 1LSVA 1F9IA 1HVBA 3PHYA 4KZ8A 2HP9A 2RL3A 3P98A 4CLCD 3MF0A 5DJTA 3HLEA 2AVXA 1FR1A 3V39A 3R7WA 2XSSA 1GSWA 5HAQA 3B42A 1K55A 4FOFA 2C6WB 2Q9MA 3IBRA 4BBVA 3JVVA 4KQRA 1YLTA 3LFVA 3CMZA 3C7VA 3E4OA 2A24B 3TG9A 4CLCE 1FSWA 4GN2A 3DTMA 4E3LA 4HY8A 2HPBA 1ZKJA 1IYOA 5J7EA 4Y0OA 5DF7A 1K0KA 4QY5A 4BBTA 4JBFA 2DCFA 4JGOA 4U3TA 4Q8IA 4KZ7A 4HQAA 4HP9A 5C5KA 3NOPC 1MWTA 1YSQA 1G28A 1Z09A 1ZG4A 4LRXC 3E2KA 5EVIA 1NZUA 4GS9B 4OP5A 2A49A 1IEMA 3EEHA 3C2WA 2O9AA 4LGWA 3VFFA 1MKMA 1K57A 3BECA 3MMHA 4ETZA 3PAEA 4E6WA 1KE4A 3LCEA 2XROA 4MMNA 2I9VA 1H8ZA 2ZQCA 4BJPA 1PW8A 2W3EA 2ZC5B 4E3IA 3RXXA 2J9OA 2V20A 2VV6A 4DJ2A 3TW8A 5GHZA 4LV3A 2BLSA 3HLCA 2W1TB 3RTYA 4LCLA 4NKPA 1S1YA 4LLOB 2OWHA 1SKOA 1H3QA 4KG6A 1NJ4A 4KZ4A 3LI8A 5HX9A 2UV0E 4WBGA 2P9VA 2WGIA 3UMEA 2EFUA 3SH8A 4CLCB 2XF3A 3W4OA 4XXRA 5DTTA 2PYRA 2Q9NA 2XQZA 2V1AA 4LFUA 5J3WA 2B95A 3ZNYA 1WYBA 5DKKA 3Q07A 1OT9A 4P6ZS 2ZD8A 5AQ7A 5AQ9A 1H0MA 4JF5A 3A0VA 1L0EA 1ESIA 4LV1A 3IXGA 4X1MA 2OOLA 3ZG9B 4F3LB 1EROA 3QP1A 2R78A 2ZM8A 4EETB 2ZM2A 2V1BA 3DWZA 3CITA 1XPBA 3FPVA 4UHUA 1QMEA 4JXVA 4S2OA 5FDHA 3DWKA 3KO6A 4DE3A 3LY4A 1DRMA 3HUOA 2QWSA 2ZQAA 1YSPA 1JTGA 2W0NA 3PBSA 4HESA 4R4SA 4EV4A 5G4YA 1XP4A 4OKPA 1L0FA 4OOYA 2YKHA 3LGOA 3HREA 1PIOA 3N7WA 2QKPA 5I94A 4HP4A 3M2JA 4DE2A 4Y7PA 3QP6A 4GNUA 3D3OA 4Y2FA 3W2ZA 5F69A 4I3IA 4IBXA 1XXMA 4WL9A 1ODVA 5E2FA 5EFWA 4DJ3A 4G3WA 1JWVA 1T1AA 3VE4A 3C8CA 5DFXA 1G5UA 1E25A 3DTIA 3MFXA 4RX2A 1RGYA 1YLYA 5CERA 2KOIA 1GCEA 4AFIA 3HCYA 3PBTA 4P87A 3VFHA 4QY6A 5EPHA 4BL3A 3IF6B 2ZOIA 2L0WA 1M6KA 3VSLA 1OTBA 2EX2A 3IWQA 3G2ZA 5CTNA 1FCNA 4KZ6A 4WMCD 4ZBEA 1BYWA 4YFMA 3LO7A 2GNXA 5FEFA 1YPRA 4PM6A 3G6OA 5I5LA 4CLCC 1MPLA 1LSXA 1TS0A 3QP8A 4JLFA 3UDIA 4L0LA 4U0TA 3IH8A 4DMZA 1IFQA 3ZNTA 2V0WA 3H7WA 3FKWA 3LR3A 2HV1A 2V9AA 4U0XA 3T50A 5F68A 1JVJA 1XJ3A 2PBYA 3CWFA 2C5WB 1DP9A 3ZHHA 3BRMA 2WKQA 3VMAA 1TS8A 2CMNA 2H5SA 1JWZA 4G3KA 4KQDA 4F94A 3AGDA 3IS2B 1BLCA 3U4LP 3G31A 4PM5A 1KVMA 5L2FA 3KSHA 3LR5A 1CK3A 1STZA 4KG5A 3KX0X 5L09A 2ZM0A 3EWKA 4KZAA 5EVEA 3W4QA 1MC0A 1YKDA 4GS9A 3ZFZA 3UY6A 2I72A 4S2JA 2HP6A 2IWBA 5E2GA 1O07A 4OOMA 2Z2LB 4X25A 1YLZA 2W1RA 4OPQA 2VV8A 3KSIA 4PKYA 1NRJA 1W8YA 2JKRM 3C30A 1XA1A 3G4PA 2OAQ1 3R7WB 1VETA 2QZ6A 1L0GA 3LEQA 1IOUA 5CECA 1T1CA 2PT7A 1ZTUA 4KZ9A 5G4ZA 1N4OA 5HWTA 4ETXA 4MN7A 2JKRI 4FH4A 3GVBA 3M6HA 1V9ZA 4GD8A 4R0QA 4OLGA 2NUPC 4R70A 2WAFA 3ULFA 1DJBA 1HZOA 5EM1A 2E8IA 5MC7A 5HZHA 5TR7A 5FATA 4BWIA 1NWZA 1NYYA 3PXPA 3IH9A 4S2PA 4DRTA 4PAUA 3DTKA 4UAAA 2VGJA 3T1SA 2XGNA 4WM9A 4ARZB 5FAQA 3AGEA 2FFYA 3K3DA 4EBPA 5DJUA 3IF5A 4X1LA 3N4IA 3LI9A 1ERMA 3UPPA 3GTCA 2WAEA 2HJEA 2QHKA 4GZBA 3WS0A 2VLGA 3C38A 3G34A 2ZJ9A 3HJIA 5M18A 2Z6CA 4E3JA 5EVIC 4QD4A 5J8XA 4WEKA 4JKTA 2Y2HA 4II7A 4X53A 4LPZA 3RFBA 4OPYA 3UO9A 2PD8A 4HJ4A 3F1NA 3Q7VB 3KSGA 4Y0UA 1DP8A 2QJ5A 2G2WA 4EW7A 1KE0A 1IYPA 4D2OA 2EX9A 4QB8A 3C4OA 3TE8A 2QPNA 1K4FA 1FOFA 1XJ6A 4JXWA 1ONHA 1IKGA 5HAIA 5KMWA 2Y2QA 2Y79A 1K56D 1DJCA 5HARA 1MWRA 2ZLYA 2XA7M 4I5SA 5KZHA 5KIZA 3KYEA 4DN0A 3NC8A 3A3JA 4ZDXA 4JGPA 5F82A 3LICA 3GDIA 4RX3A 2FZ0A 1SKFA 4UA7A 3P09A 1KGEA 4DF6A 3HJKA 1HTZA 3MKEA 5FQ9A 3OCLA 3TRCA 4ZJ1A 2XEPA 2QJ7A 2EFXA 4H6JA 2VEAA 3QP2A 1M40A 1BZAA 3ZVWA 3UE0A 3NI9A 4Q0IA 3D72A 5E2HA 4JF6A 4CJNA 1KGFA 2NUTC 3WS2A 2K2NA 5FI2A 1YMSA 2ZQ9A 4GW9A 5CGXA 3BFCA 3RXWA 1FIKA 4E04A 1K6SA 4KZBA 2XD1A 3C7UA 3NDEA 1S4SA 4PM9A 4EEUA 4PMAA 5FI6A 1BLPA 2OLUA 5HFOA 3HBRA 1S1ZA 1W5DA 1H8YA 4JGRA 2EXAA 2OSUA 3LEZA 2J3TC 2WGWA 3F1PB 3CPTB 1TF1A 4D60A 1H8MA 3ZDJA 1PW1A 4Y17A 4YWZA 3UN7A 1LSWA 4OH0A 1KDSA 5F83A 4WELA 2JBFA 2PU4A 4NEED 2IWCA 4O01A 3N8RA 5FASA 3HUNA 4NXGA 4BD1A 4EERA 1NLYA 3G35A 4KUKA 3VE3A 1OTIA 2DRWA 3LIBA 4CLCA 3B33A 5CGWA 5FEGA 3TJZC 5A90A 3GRJA 1LHYA 4B4ZA 3UB5P 2WGWB 4PPRA 4I39A 4HBTA 3ITBA 3HL9A 4S2MA 4QU3A 1CI8A 3CZDA 4LENA 3PBNA 2ZL1B 3CUEC 1ES3A 2OAP1 1OTEA 5DF9A 2JCHA 4XUXA 3HLBA 3DAVA 2WKHA 4OPZA 3UPOA 4OQHA 1LI0A 4ZRRA 4HIAA 3FZCA 3NIAA 2ZL1A 5EOOA 3E98A 5HDCA 1YMXA 3Q7ZA 3VOZA 4HH3A 4M3KA 3NCKA 3S7OA 1AWIA 2D02A 4FD8A 4BQMA 4E3NA 2CC1A 3HLFA 5DTSA 1ZC2A 1BLSA 4EU0A 1SDNA 5FDSA 5TFQA 3IT9A 4PHTA 3TOIA 1PI5A 4HI4A 2IWDA 4WN5A 4BL2A 4RA7A 3ITAA 2HJ9C 2X02A 1GHMA 2W3FA 3U2AA 1TD5A 2VKSA 2J3TD 1MWSA 2ZC7A 3CHWP 4L9FA 1I2SA 3BJNA 3LR0A 5HD5A 3OPRA 2QMIA 1KVLA 2K31A 4MN6A 4YOFA 1GHIA 1MY8A 5KSCA 3BM6A 5HWVA 3SW1A 1S66L 2DMWA 3F1NB 5CHUA 1K56A 3Q1FA 1RP5A 5AJGA 4K0XA 4X68A 5GLAA 1YM1A 4Q0JA 2XFTA 3ZQ5A 4ZAMA 2JKTM 3PTEA 3MQ0A 4JPMA 3C5AA 2INWA 3IWIA 1MXOA 3BLMA 2LB5A 1BTLA 3R4KA 2XK1A 5F1FA 1I5QA 2XDMA 4GHIA 3BYDA 3IX8A 2ZQ7A 2PD7A 4ME4A 4DXCA 2ZMAA 1IKIA 1NLZA 1OJGA 5A92A 4DKIA 2W27A 3I7JA 2H0YA 1YT4A 5FL3A 3Q7VA 2WGVA 4S2LA 3V67A 3NULA 2E8JA 4YINA 3C4PA 1PZPA 1PRQA 4S2IA 1BULA 2V8CA 5EUAA 3T1XA 4R23A 1PWCA 3O86A 3KSFA 5AQBA 4FTXA 4N92A 5CEDA 4R1GA 5HL6A 1Y28A 1AXBA 3IF6A 3S7QA 5DVAA 4HOIA 3CPTA 1T1BA 1XFNA 4IEDA 1IYQA 3OPHA 2ZMVA 3BFFA 4KG2A 3GMWA 5TBMA 3HLGA 2EWVA 1Q2PA 2V8FA 3MFDA 3AGFA 1D1JA 1LL5A 2PR6A 2J7VA 2JHEA 1SHVA 5FAPA 3HUMA 1YLWA 3MR0A 1EI5A 1VETB 4RYEA 5FQKA 3LIDA 3FV7A 2Y2OA 4EESA 4WEJA 1MZUA 4O8GA 3MSHA 1XJ4A 1PFLA 1GSVA 3UDFA 1HD8A 2WKRA 1CEFA 2WADA 5DKLA 3FYZA 4GKUA 4JGQA 2RCXA 4GB7A 2Y2PA 3ZVTA 4WZ5A 1ES2A 2W3HA 3IBJA 4EQIA 1VHMA 2H10A 1S4RA 3FKVA 4S2NA 4X69A 2WKPA 4XUZA 1XA7A 4N9KA 4OQ0A 4UEYA 2B02A 3KYZA 4ID4A 3F1PA 3BWLA 3TSGA 5CTMA 1K4EA 3W4PA 4OONA 4WZ5C 4KQOA 3SS5A 2JKTI 4S2NC 5AQAA 4CPKA 3JPUA 1OTAA 1WYCA 5AVFA 2JN7A 4FSFA 1VB6A 4EUZA 3K2NA 2W3GA 1CEGA 5J4EA 1VEUA 4BD0A 3SS3A 3O87A 2MJ6A 1D7EA 1SDEA 2J9PA 5L8MA 4HHDA 1G6AA 3CUEA 5A91A 2YKFA 5FAOA 2G7UA 5FQIA 1KDWA 1T18A 3CG5A 4UQIS 1VQQA 2GX5A 1QMFA 3LIFA 1JNUA 3IQAA 4WLAA 1PZOA 3MJQA 3MXQA 1Y54A 3ZYTA 3IXBA 5M1AA 3UE3A 1IYSA 5K5BA 3VP1A 4R3BA 1GHPA 2ZC4B 1FILA 2HZ5A 5FSRA 3NBLA 1W8QA 3NJAA 2B5RA 4K08A 3IHBA 4B4XA 1NY0A 2L1MA 5GLDA 5EE8A 2HDQA 3H9WA 5HD3A 4IVKA 4KUOA 1X0OA 5LBRA 3EQUA 2JKGA 3OBFA 3K3CA 2X01A 1H5XA 3ZG0A 1PWDA 2WYXA 5M19A 3LIEA 5FQQA 2G2UA 2PRFA 3MKFA 1SKOB 4R3JA 3OPLA 3DTEA 5GLBA 4WF0A 1YLJA 1FCOA 5L07A 2O9BA 1P9RA 3JVUA 1J3WA 5HPIA 2GJ3A 3GQZA 1W63M 1K6RA 3LUQA 4JF4A 4RVAA 3O5YA 3A3DA 3D4FA 3UDXA 1ALQA 5F6AA 1BUEA 4Z9QA 5F1GA 2A3UA 2VGLS 4UQIM 1CF0A 1TVFA 4NETA 1YQSA 3MQOA 3MXSA 2P7JA 2A2LA 1TS7A 4P6BA 1GA0A 5HW3A 2VK3A 3CJMA 5EECA 4R6LA 4GLQA 3ICYA 5HL1A 3WRTA 3EEAA 1S6RA 4LRZE 2JC7A 2FFFB 2Q0OA 4MNRA 4KZ5A 4C6YA 3GSGA 4HH2A 4G3VA 5HDDA 4Y3IA 5IU1A 3T4LA 3VP2A 3OOVA 4GJ4A 3VP3A 4PKYG 3MBZA 4ZJ2A 3ZGAB 3WWXA 1S67L 1P97A 3BFDA 1KE3A 2P04A 3VV4A 4BLMA 4E3OA 3E2LA 1FSYA 3MQQA 1E3UD 2V1ZA 2UWXA 5HWWA 3L7HA 2Y59A 3V50A 3ZG8B 4KENB 1UGUA 4CQHA 5EVID 3T4SA 5CGSA 4WZ4A 3VSKA 3ZG5A 5EM0A 1EW0A 5E2EA 1PWGA 4WYYA 5HDSA 1JWPA 2ZC3B 1O7EA 2LB9A 1HLUP 5FQJA 4XT2A 4GOGA 3RH8B 1XX2A 4OPRA 3PBQA 3W8KA 4P6ZM 4ESPA 4C3QA 4IUHA 1G6OA 5G18A 3QP5A 4FCFA 4I38A 4B93A 1TDGA 3MXRA 1K54A 3DW0A 3UB9A 1ES5A 5EVIB 1BLHA 3BFGA 4DE1A 2HDSA 4X6TA 3UPNA 4KZ3A 4DXBA 4HJ6A 1OPXA 2XRNA 3T4JA 3HVFA 2Y91A 1L2SA 3BFEA 5E43A 1FCMA 2XH9A 3NHQA 3DBAA 3OZHA 3T4TA 3SZTA 3N6IA 3VOLA 2WK0A 3VP4A 5IHVA 2V2FF 4BMWA 2WKIA 4OQIA 4LCMA 1XJ2A 3FPWA 2R9XA 4WMCA 2Y8HA 1PYYA 2L4RA 1CQAA 4FH2A 2O9CA 3BQ8A 3IS2A 3T4QA 1F5MA 4QHCA 2Y2MA 2ZBBA 3IX4A 3Q81A 4NG2A 4R4RA 5IS1A 1K57C 1DY6A 3HLWA 2HDRA 3ISGA 3KYQA 1EWZA 3T1RA 1KOUA 3UB8A 2HF6A 3A3EA 2IA2A 4GDNA 2VJWA 5FQMA 4X56A 1CI9A 5FA7A 1YAXA 1UWNX 4H6JB 4HJ3A 2P74A 4IHQA 3NECA 3P7NA 3WS5A 1Q2QA 2PYPA 3EGDC 5U47A 4LV0A 1F2KA 1P9WA 5CRFA 2PR5A 2PHYA 3V5MA 1MKIA 5CHJA 1KGGA 4QJGA 5F5YA 5GLCA 4NXEA 4DE0A 3FG8A 4JXSA 4BENA 1C3BA 3G32A 1K25A 2X71A 2Y2IA 4X55A 1FQGA 5A93A 1N9NA 1T19A 4O0PA 4N1HA 4GHIB 4GCZA 1ESUA 3OC2A 5EOEA 3MZFA 3EOIA 3NOUC 1LT0A 3S4XA 1FR6A 3VP0A 4K0WA 1ACFA 3T12B 1TEMA 5FI7A 1YLPA 2H0TA 2Y2NA 1LI9A 5L10A 2XD5A 2HDUA 5A8BA 3L9KA 2VA0A 1OTDA 1N9LA 1SZVA 2WKEA 2ZQDA 4IVIA 1VEUB 2K7SA 4Y13A 1K38A 2OV5A 1OMEA 1TDLA 2V0UA 3RJUA 1WE4A 2PU2A 1ES4A 3IXDA 3NDGA 4MBFA 4MBHA 1VM1A 4JXGA 1W63Q 4MLLA 1E4DA 1G68A 2J8YA 5D3OA 1SCWA 1LL8A 3O88A 4I3AA 2R9WA 2Y2GA 5GHYA 2HGVA 1MBLA 3BW6A 2DNSA 3P01A 1UWPX 3QNCA 4RQ9A 2M7UA 2W3DA 3PBOA 2JE5A 1XFQA 1JTDA 3V3SA 4Y15A 4L9GA 5TJJA 2Y2LA 4NK3A 3E0YA 3T4KA 4QWOA 2FH5A 4GDBA 5JYPA 2P08A 1MWUA 4DDSA 2ZQ8A 4OQGA 4MCWA 1BT5A 1BSGA 3IWOA 3E4QA 3SOIA 4B9OA 3LY3A 2EX6A 3WS4A 2BTFP 4WUJA 4EWFA 4K91A 1GSXA 3O3VA 4MEZA 4ZJ3A 2PBDP 4EBNA 1I2WA 3CI6A 2H28A 1L0DA 3N8SA 4E3KA 3G2YA 5CHMA 4E3MA 4PM8A 2D01A 3H7WB 2ZC6B 4MBKA 3ZCZA 3B47A 3PYPA 2J80A 1ZHHB 1N9BA 1Y4OA 2A24A 4UA9A 3F1OA 1LL9A 5JYOA 3GV9A 1ERQA 2J3WA 1PNEA 2PAVP 1TS6A 1LLBA 1IELA 2ZOHA 1Z6FA 4O7DA 2HP5A 3FWLA 2BG1A 5EVLA 2VGKA 1RGZA 4EXOA 5TGFA 4Q0HA 3HLDA 1K54C 4P0MA 3WRZA 2VZWA 5GHXA 2ACGA 3SH9A 2XR0A 5BOHA 4R38A 4Y0TA 4XT2B 3QP4A 3QNBA 5KSHA 4MDZA 3A0RA 3S1YA 2WZXA 3S7NA 2Z6DA 1GA9A 3D9YA 1PI4A 1D06A 1W79A 5EV0A 5DFYA 1DP6A 1A0KA 4N9LA 1F98A
chains in the Genus database with same CATH topology
5IT5A 3C8CA 4QPRA 5DFXA 4Z1WA 4HH2A 3PBNA 3MFXA 4G3VA 4Y3IA 5HDDA 5IU1A 3OOVA 3T4LA 4GJ4A 3CUEC 4PKYG 2KOIA 2OAP1 4AFIA 1OTEA 3HCYA 3PBTA 5DF9A 1S67L 1P97A 2P04A 2ZOIA 3VV4A 2L0WA 3CLOA 2KLIA 1OTBA 4ZRRA 2B18A 3BY8A 3MQQA 4HIAA 4BBUA 3UMDA 2VGLM 3H82B 4M4XA 1BYWA 5HWWA 3S7PA 2QYBA 3E98A 4MN5A 2GNXA 3G6OA 5HDCA 2KX6A 5I5LA 4CLCC 2O99A 2W1TA 1UGUA 4EUVA 4HH3A 2ZMFA 1LSXA 3UE6A 1TS0A 3LIAA 4CQHA 3S7OA 2D02A 3T4SA 4L0LA 4Y5FA 2EA9A 4DMZA 1EW0A 1IFQA 3PBRA 5HDSA 2V0WA 3H7WA 3LR3A 2LB9A 2HV1A 2V9AA 2VV7A 4EU0A 1N9OA 4XT2A 1P0ZA 2O0YA 3T50A 3RH8B 2PDRA 5F68A 3PBQA 3FC7A 1XJ3A 1V9YA 4P6ZM 4PHTA 3GECA 4IUHA 1G6OA 3CWFA 4EQ1A 4HI4A 4NXFA 1DP9A 4I38A 4B93A 4WN5A 3BQAA 2HJ9C 2VX8A 2WKQA 3EGXC 2W3FA 1TS8A 2CMNA 3BY9A 1TD5A 2M1CA 3U2AA 2VKSA 3UB9A 2J3TD 4G3KA 3PR6A 3CAXA 4KQDA 4L9FA 3LYXA 3BJNA 4HJ6A 3LR0A 3IS2B 5HD5A 1OPXA 2XRNA 3A0SA 4IUKA 2GZAA 3UB6A 2BASA 3T4JA 3KSHA 3LR5A 2K31A 4HNBA 1STZA 4MN6A 3KX0X 3NHQA 3EWKA 4YOFA 3DBAA 1OT6A 3H82A 3T4TA 5HPFA 1MC0A 5HWVA 3SW1A 3UB7A 4OOLA 1YKDA 4GS9A 3F1OB 3OLOA 3VOLA 1S66L 2DMWA 3F1NB 2XA7S 3EQVA 2OWJA 3LR4A 4OOMA 5AJGA 4YNRA 4BMWA 4Q0JA 3ZQ5A 2JKTM 3MQ0A 5AVEA 1XJ2A 2W1RA 4ARZA 2INWA 4R3AA 4I3JA 3FPWA 3NOTC 2M7VA 2Y8HA 2VV8A 2L4RA 3KSIA 4PKYA 1NRJA 2LB5A 2JKRM 3C30A 3OCNA 4L9EA 3R4KA 2OAQ1 4GHIA 3R7WB 2O9CA 2PD7A 4LRYC 4ME4A 4NXBA 3BQ8A 3E4PA 3IS2A 3T4QA 1F5MA 1NLZA 1OJGA 2ZBBA 2W27A 1IOUA 5FL3A 3T4OA 1T1CA 5IS1A 3V67A 4EEPA 5CX7A 2PT7A 1ZTUA 2EWWA 4F3LA 5G4ZA 3KYQA 4ETXA 5HWTA 4IJGA 4MN7A 2JKRI 1KOUA 1OJ5A 2KDKA 3UB8A 2HF6A 5HSQA 1WA9A 2IA2A 5TBMB 1LSVA 1F9IA 2VJWA 3KSFA 1V9ZA 3PHYA 1YAXA 1UWNX 4H6JB 2NUPC 4HJ3A 4R70A 4IHQA 5HL6A 3MF0A 3ULFA 4CLCD 1Y28A 5DJTA 3S7QA 3P7NA 5MC7A 5HZHA 2PYPA 4HOIA 3EGDC 1T1BA 1XFNA 4BWIA 3R7WA 1P9WA 2XSSA 2PR5A 1GSWA 1NWZA 3PXPA 2ZMVA 3B42A 2PHYA 4FOFA 4PAUA 5TBMA 3IBRA 4BBVA 2EWVA 3JVVA 5F5YA 4NXEA 4ARZB 3LFVA 2PR6A 3FG8A 2JHEA 3E4OA 2A24B 4CLCE 3K3DA 5DJUA 1N9NA 1T19A 4O0PA 4HY8A 5J7EA 3LI9A 3MR0A 4GHIB 4GCZA 3OC2A 3LIDA 4EESA 4WEJA 3EOIA 3NOUC 4BBTA 2HJEA 1MZUA 2QHKA 4JGOA 1LT0A 4O8GA 2VLGA 3C38A 1XJ4A 1GSVA 4HQAA 4HP9A 2WKRA 5C5KA 3NOPC 5A8BA 3HJIA 5DKLA 2Z6CA 4JGQA 1YSQA 1G28A 2VA0A 1OTDA 4WEKA 1N9LA 2W3HA 3IBJA 4II7A 4LRXC 1VHMA 4LPZA 1S4RA 3RFBA 4GS9B 2WKPA 2PD8A 4HJ4A 3F1NA 4UEYA 3KSGA 3EEHA 2B02A 3C2WA 2K7SA 3KYZA 1DP8A 2QJ5A 2O9AA 3F1PA 2V0UA 3BWLA 1MKMA 4EW7A 3MMHA 4ETZA 3TE8A 1XJ6A 4KQOA 2XROA 4MMNA 2JKTI 1W63Q 2I9VA 4BJPA 2W3EA 1LL8A 4I3AA 1OTAA 5AVFA 2HGVA 2VV6A 2JN7A 4DJ2A 4FSFA 1VB6A 3K2NA 3TW8A 3BW6A 2Y79A 3P01A 1UWPX 2W1TB 2W3GA 2XA7M 5J4EA 4RQ9A 3RTYA 2M7UA 2MJ6A 2W3DA 4NKPA 1S1YA 3PBOA 1D7EA 1XFQA 4LLOB 5L8MA 2OWHA 4I5SA 1H3QA 4HHDA 5KIZA 3CUEA 4L9GA 5TJJA 4DN0A 2YKFA 3LI8A 2G7UA 3E0YA 3T4KA 4JGPA 3LICA 3GDIA 2FH5A 1T18A 2FZ0A 4UQIS 2P08A 3UMEA 3HJKA 4MCWA 2GX5A 4CLCB 3LIFA 1JNUA 3E4QA 4B9OA 4WLAA 3OCLA 2PYRA 3TRCA 3MJQA 4WUJA 3MXQA 2V1AA 2QJ7A 1GSXA 4H6JA 5J3WA 2VEAA 3ZYTA 3UE3A 5K5BA 5DKKA 3CI6A 1OT9A 2H28A 4P6ZS 4Q0IA 3NJAA 4K08A 3A0VA 3D72A 2L1MA 2NUTC 3H9WA 5HD3A 2OOLA 4KUOA 2K2NA 1X0OA 2D01A 3H7WB 5LBRA 4F3LB 3EQUA 3B47A 3PYPA 2J80A 2R78A 1ZHHB 4EETB 4GW9A 3OBFA 3K3CA 2V1BA 4E04A 2A24A 3F1OA 3CITA 3FPVA 3LIEA 2J3WA 1S4SA 1TS6A 4EEUA 3KO6A 2ZOHA 1DRMA 4WF0A 1S1ZA 4JGRA 2J3TC 2QWSA 3F1PB 1YSPA 1P9RA 2O9BA 3JVUA 2W0NA 1TF1A 3PBSA 5HPIA 2GJ3A 1H8MA 4EXOA 4Q0HA 5G4YA 4YWZA 2VZWA 2YKHA 1W63M 3LUQA 4R38A 1LSWA 3O5YA 2QKPA 4XT2B 4HP4A 4WELA 5F6AA 5KSHA 4NEED 4MDZA 3D3OA 3A0RA 2VGLS 4O01A 4UQIM 4Y2FA 3W2ZA 5F69A 4NXGA 3MQOA 4EERA 1NLYA 4I3IA 3S7NA 2Z6DA 4KUKA 3VE3A 1OTIA 2P7JA 2A2LA 1D06A 3LIBA 4CLCA 4WL9A 1ODVA 1TS7A 3B33A 5DFYA 3TJZC 4R6LA 1DP6A 5EFWA 4GLQA 4DJ3A 4G3WA 3ICYA 1T1AA 3EEAA 3VE4A 4LRZE 4I39A 1F98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJQ A;  4WUJ A;  3MXQ A;  5DJU A;  2V1A A;  1OT6 A;  3C8C A;  2QJ7 A;  1GSX A;  3H82 A;  1N9N A;  4H6J A;  5J3W A;  2VEA A;  4F3L B;  3SW1 A;  1T19 A;  5HWV A;  4HH2 A;  4HY8 A;  3MFX A;  5HDD A;  5IU1 A;  3LI9 A;  3MR0 A;  4GHI B;  3F1O B;  3OLO A;  4GS9 A;  3UB7 A;  3VOL A;  4GCZ A;  1S66 L;  5DKK A;  3F1N B;  4PKY G;  3LID A;  1OT9 A;  2H28 A;  4EES A;  3NOU C;  3NJA A;  4BBT A;  4K08 A;  1OTE A;  1MZU A;  2QHK A;  2OWJ A;  1LT0 A;  3A0V A;  4JGO A;  3D72 A;  1S67 L;  2VLG A;  1XJ4 A;  1P97 A;  1GSV A;  2L1M A;  4HQA A;  3H9W A;  3ZQ5 A;  4HP9 A;  2WKR A;  5HD3 A;  2OOL A;  4KUO A;  3NOP C;  1X0O A;  2D01 A;  2ZOI A;  3H7W B;  3HJI A;  1XJ2 A;  5DKL A;  5AVE A;  2INW A;  2Z6C A;  2L0W A;  4I3J A;  4JGQ A;  3CLO A;  3NOT C;  4R3A A;  1OTB A;  2VV8 A;  1G28 A;  2J80 A;  1OTD A;  3PYP A;  2L4R A;  2R78 A;  3BY8 A;  3MQQ A;  4GW9 A;  1N9L A;  4HIA A;  4PKY A;  3UMD A;  4BBU A;  4EET B;  5J4E A;  3H82 B;  4LRX C;  4L9E A;  4M4X A;  3K3C A;  2V1B A;  1S4R A;  4LPZ A;  1BYW A;  5HWW A;  4E04 A;  2A24 A;  4GHI A;  4GS9 B;  3F1O A;  5J7E A;  4MN5 A;  2WKP A;  2PD8 A;  4HJ4 A;  3F1N A;  3G6O A;  5HDC A;  2KX6 A;  2PD7 A;  3EEH A;  2B02 A;  3C2W A;  2K7S A;  3LIE A;  4LRY C;  1S4S A;  1DP8 A;  2QJ5 A;  3E4P A;  3IS2 A;  1UGU A;  3F1P A;  1OJG A;  1TS6 A;  2V0U A;  4HH3 A;  4EEU A;  2ZBB A;  3BWL A;  1LSX A;  2ZOH A;  3UE6 A;  4EW7 A;  2W27 A;  1TS0 A;  3LIA A;  1DRM A;  4WF0 A;  1S1Z A;  1T1C A;  5IS1 A;  4JGR A;  2D02 A;  4NXB A;  4EEP A;  2QWS A;  2EA9 A;  3F1P B;  4F3L A;  5G4Z A;  1EW0 A;  1XJ6 A;  2W0N A;  5HWT A;  5A8B A;  5HDS A;  5I5L A;  2GJ3 A;  2I9V A;  4EQ1 A;  4EXO A;  4L9F A;  2V0W A;  3H7W A;  1KOU A;  1LL8 A;  1OJ5 A;  2KDK A;  2HV1 A;  1OTA A;  2V9A A;  2VV7 A;  4I3A A;  1N9O A;  5G4Y A;  3UB8 A;  3EWK A;  5AVF A;  5HSQ A;  1WA9 A;  4XT2 A;  1P0Z A;  2YKH A;  2VV6 A;  1LSV A;  2JN7 A;  4YWZ A;  5TBM B;  3RH8 B;  2PDR A;  3T50 A;  5F68 A;  4DJ2 A;  3LUQ A;  1VB6 A;  1F9I A;  3FC7 A;  4R38 A;  1LSW A;  1V9Z A;  1XJ3 A;  3PHY A;  1V9Y A;  1UWP X;  3K3D A;  3GEC A;  2QKP A;  3CWF A;  1UWN X;  4H6J B;  4RQ9 A;  4XT2 B;  4HJ3 A;  4R70 A;  4HI4 A;  4NXF A;  1DP9 A;  3RTY A;  3ULF A;  1Y28 A;  1S1Y A;  4HP4 A;  4I38 A;  1D7E A;  4WN5 A;  5DJT A;  1XFQ A;  5F6A A;  4LLO B;  3P7N A;  2OWH A;  4I5S A;  2WKQ A;  3A0R A;  4HHD A;  5HZH A;  5KIZ A;  2PYP A;  1TS8 A;  2CMN A;  3BY9 A;  4HOI A;  2M1C A;  4NXG A;  5F69 A;  3MQO A;  4L9G A;  3UB9 A;  4EER A;  1T1B A;  1XFN A;  4I3I A;  2Z6D A;  2YKF A;  4KUK A;  1OTI A;  2P7J A;  3LI8 A;  2PR5 A;  1GSW A;  3CAX A;  4KQD A;  3VE3 A;  4JGP A;  1D06 A;  1NWZ A;  3LIB A;  3LIC A;  3LYX A;  1ODV A;  3GDI A;  1TS7 A;  3B33 A;  2PHY A;  4HJ6 A;  3IS2 B;  1T18 A;  4WL9 A;  5HD5 A;  5TBM A;  3A0S A;  3IBR A;  4R6L A;  3UB6 A;  3UME A;  1DP6 A;  5EFW A;  4BBV A;  4DJ3 A;  3HJK A;  2BAS A;  5F5Y A;  3ICY A;  4NXE A;  3LIF A;  1T1A A;  1JNU A;  4HNB A;  2PR6 A;  3E4Q A;  3FG8 A;  3VE4 A;  4B9O A;  4LRZ E;  4MN6 A;  4WLA A;  3KX0 X;  2JHE A;  2PYR A;  4I39 A;  3NHQ A;  3E4O A;  2A24 B;  1F98 A; 
#chains in the Genus database with same CATH topology
 4E6X A;  5IT5 A;  4QPR A;  1RCJ A;  4Z1W A;  3IHA A;  3S22 A;  4P85 A;  3M6B A;  3IXH A;  3M2K A;  3WS1 A;  1CJF A;  5GL9 A;  3MS6 A;  3A3F A;  3CLO A;  2KLI A;  2EX8 A;  3BLS A;  4H8R A;  2XFS A;  1L3L A;  2B18 A;  3BY8 A;  4BBU A;  3UMD A;  2VGL M;  3H82 B;  4M4X A;  3S7P A;  2QYB A;  4MN5 A;  4B88 A;  4UA6 A;  3SS4 A;  4PM7 A;  2KX6 A;  5DTK A;  2O99 A;  5CXW A;  2W1T A;  4EUV A;  2ZMF A;  4OLD A;  3UE6 A;  1DJA A;  3LIA A;  4LV2 A;  4OP8 A;  4EBL A;  3T1Q B;  1ONG A;  3G30 A;  4Y5F A;  2EA9 A;  3UE1 A;  3PBR A;  2Y4A A;  1XGI A;  5DF8 A;  2VV7 A;  1K55 C;  1N9O A;  4S2K A;  1P0Z A;  2O0Y A;  2PDR A;  4HEF A;  2Y2J A;  3FC7 A;  3OPP A;  1NRF A;  4DDY A;  1V9Y A;  4KQQ A;  3V3R A;  1NXY A;  3GEC A;  4OVD A;  4EQ1 A;  4NXF A;  4A5R A;  3BQA A;  3JYI A;  2VX8 A;  2OLV A;  3EGX C;  3BY9 A;  3UNW A;  2M1C A;  2XLN A;  3ZG7 B;  1S0W A;  3MZE A;  3PR6 A;  3CAX A;  3LYX A;  4ZTK A;  3A0S A;  4IUK A;  2GZA A;  3UB6 A;  3N8L A;  2WZZ A;  3QHY A;  2WUQ A;  2BAS A;  4HNB A;  3NY4 A;  4N1X A;  1OT6 A;  3H82 A;  1XGJ A;  5HPF A;  1XKZ A;  2Y55 A;  4OOL A;  3UB7 A;  3F1O B;  3OLO A;  2GDN A;  4HBU A;  2XA7 S;  3SH7 A;  3B3X A;  3EQV A;  2OWJ A;  3LR4 A;  2P9V B;  4YNR A;  1U60 A;  5AVE A;  3MZD A;  4ARZ A;  4R3A A;  1NZO A;  4I3J A;  5HAP A;  3NOT C;  2M7V A;  4IBR A;  3IF6 C;  3Q82 A;  1E3U A;  3OCN A;  4L9E A;  5CEB A;  3PAG A;  4C75 A;  3BEB A;  4LRY C;  4NXB A;  3E4P A;  1W7F A;  2Z2M B;  1NYM A;  3T4O A;  2EXB A;  4EEP A;  5CX7 A;  3IX3 A;  2EWW A;  4GD6 A;  4F3L A;  3VOY A;  1J9M A;  3GR2 A;  2JKF A;  4IJG A;  2Y2K A;  1OJ5 A;  2KDK A;  4FUW A;  3A3I A;  5HSQ A;  1ZG6 A;  1WA9 A;  5TBM B;  1LSV A;  1F9I A;  1HVB A;  3PHY A;  4KZ8 A;  2HP9 A;  2RL3 A;  3P98 A;  4CLC D;  3MF0 A;  5DJT A;  3HLE A;  2AVX A;  1FR1 A;  3V39 A;  3R7W A;  2XSS A;  1GSW A;  5HAQ A;  3B42 A;  1K55 A;  4FOF A;  2C6W B;  2Q9M A;  3IBR A;  4BBV A;  3JVV A;  4KQR A;  1YLT A;  3LFV A;  3CMZ A;  3C7V A;  3E4O A;  2A24 B;  3TG9 A;  4CLC E;  1FSW A;  4GN2 A;  3DTM A;  4E3L A;  4HY8 A;  2HPB A;  1ZKJ A;  1IYO A;  5J7E A;  4Y0O A;  5DF7 A;  1K0K A;  4QY5 A;  4BBT A;  4JBF A;  2DCF A;  4JGO A;  4U3T A;  4Q8I A;  4KZ7 A;  4HQA A;  4HP9 A;  5C5K A;  3NOP C;  1MWT A;  1YSQ A;  1G28 A;  1Z09 A;  1ZG4 A;  4LRX C;  3E2K A;  5EVI A;  1NZU A;  4GS9 B;  4OP5 A;  2A49 A;  1IEM A;  3EEH A;  3C2W A;  2O9A A;  4LGW A;  3VFF A;  1MKM A;  1K57 A;  3BEC A;  3MMH A;  4ETZ A;  3PAE A;  4E6W A;  1KE4 A;  3LCE A;  2XRO A;  4MMN A;  2I9V A;  1H8Z A;  2ZQC A;  4BJP A;  1PW8 A;  2W3E A;  2ZC5 B;  4E3I A;  3RXX A;  2J9O A;  2V20 A;  2VV6 A;  4DJ2 A;  3TW8 A;  5GHZ A;  4LV3 A;  2BLS A;  3HLC A;  2W1T B;  3RTY A;  4LCL A;  4NKP A;  1S1Y A;  4LLO B;  2OWH A;  1SKO A;  1H3Q A;  4KG6 A;  1NJ4 A;  4KZ4 A;  3LI8 A;  5HX9 A;  2UV0 E;  4WBG A;  2P9V A;  2WGI A;  3UME A;  2EFU A;  3SH8 A;  4CLC B;  2XF3 A;  3W4O A;  4XXR A;  5DTT A;  2PYR A;  2Q9N A;  2XQZ A;  2V1A A;  4LFU A;  5J3W A;  2B95 A;  3ZNY A;  1WYB A;  5DKK A;  3Q07 A;  1OT9 A;  4P6Z S;  2ZD8 A;  5AQ7 A;  5AQ9 A;  1H0M A;  4JF5 A;  3A0V A;  1L0E A;  1ESI A;  4LV1 A;  3IXG A;  4X1M A;  2OOL A;  3ZG9 B;  4F3L B;  1ERO A;  3QP1 A;  2R78 A;  2ZM8 A;  4EET B;  2ZM2 A;  2V1B A;  3DWZ A;  3CIT A;  1XPB A;  3FPV A;  4UHU A;  1QME A;  4JXV A;  4S2O A;  5FDH A;  3DWK A;  3KO6 A;  4DE3 A;  3LY4 A;  1DRM A;  3HUO A;  2QWS A;  2ZQA A;  1YSP A;  1JTG A;  2W0N A;  3PBS A;  4HES A;  4R4S A;  4EV4 A;  5G4Y A;  1XP4 A;  4OKP A;  1L0F A;  4OOY A;  2YKH A;  3LGO A;  3HRE A;  1PIO A;  3N7W A;  2QKP A;  5I94 A;  4HP4 A;  3M2J A;  4DE2 A;  4Y7P A;  3QP6 A;  4GNU A;  3D3O A;  4Y2F A;  3W2Z A;  5F69 A;  4I3I A;  4IBX A;  1XXM A;  4WL9 A;  1ODV A;  5E2F A;  5EFW A;  4DJ3 A;  4G3W A;  1JWV A;  1T1A A;  3VE4 A;  3C8C A;  5DFX A;  1G5U A;  1E25 A;  3DTI A;  3MFX A;  4RX2 A;  1RGY A;  1YLY A;  5CER A;  2KOI A;  1GCE A;  4AFI A;  3HCY A;  3PBT A;  4P87 A;  3VFH A;  4QY6 A;  5EPH A;  4BL3 A;  3IF6 B;  2ZOI A;  2L0W A;  1M6K A;  3VSL A;  1OTB A;  2EX2 A;  3IWQ A;  3G2Z A;  5CTN A;  1FCN A;  4KZ6 A;  4WMC D;  4ZBE A;  1BYW A;  4YFM A;  3LO7 A;  2GNX A;  5FEF A;  1YPR A;  4PM6 A;  3G6O A;  5I5L A;  4CLC C;  1MPL A;  1LSX A;  1TS0 A;  3QP8 A;  4JLF A;  3UDI A;  4L0L A;  4U0T A;  3IH8 A;  4DMZ A;  1IFQ A;  3ZNT A;  2V0W A;  3H7W A;  3FKW A;  3LR3 A;  2HV1 A;  2V9A A;  4U0X A;  3T50 A;  5F68 A;  1JVJ A;  1XJ3 A;  2PBY A;  3CWF A;  2C5W B;  1DP9 A;  3ZHH A;  3BRM A;  2WKQ A;  3VMA A;  1TS8 A;  2CMN A;  2H5S A;  1JWZ A;  4G3K A;  4KQD A;  4F94 A;  3AGD A;  3IS2 B;  1BLC A;  3U4L P;  3G31 A;  4PM5 A;  1KVM A;  5L2F A;  3KSH A;  3LR5 A;  1CK3 A;  1STZ A;  4KG5 A;  3KX0 X;  5L09 A;  2ZM0 A;  3EWK A;  4KZA A;  5EVE A;  3W4Q A;  1MC0 A;  1YKD A;  4GS9 A;  3ZFZ A;  3UY6 A;  2I72 A;  4S2J A;  2HP6 A;  2IWB A;  5E2G A;  1O07 A;  4OOM A;  2Z2L B;  4X25 A;  1YLZ A;  2W1R A;  4OPQ A;  2VV8 A;  3KSI A;  4PKY A;  1NRJ A;  1W8Y A;  2JKR M;  3C30 A;  1XA1 A;  3G4P A;  2OAQ 1;  3R7W B;  1VET A;  2QZ6 A;  1L0G A;  3LEQ A;  1IOU A;  5CEC A;  1T1C A;  2PT7 A;  1ZTU A;  4KZ9 A;  5G4Z A;  1N4O A;  5HWT A;  4ETX A;  4MN7 A;  2JKR I;  4FH4 A;  3GVB A;  3M6H A;  1V9Z A;  4GD8 A;  4R0Q A;  4OLG A;  2NUP C;  4R70 A;  2WAF A;  3ULF A;  1DJB A;  1HZO A;  5EM1 A;  2E8I A;  5MC7 A;  5HZH A;  5TR7 A;  5FAT A;  4BWI A;  1NWZ A;  1NYY A;  3PXP A;  3IH9 A;  4S2P A;  4DRT A;  4PAU A;  3DTK A;  4UAA A;  2VGJ A;  3T1S A;  2XGN A;  4WM9 A;  4ARZ B;  5FAQ A;  3AGE A;  2FFY A;  3K3D A;  4EBP A;  5DJU A;  3IF5 A;  4X1L A;  3N4I A;  3LI9 A;  1ERM A;  3UPP A;  3GTC A;  2WAE A;  2HJE A;  2QHK A;  4GZB A;  3WS0 A;  2VLG A;  3C38 A;  3G34 A;  2ZJ9 A;  3HJI A;  5M18 A;  2Z6C A;  4E3J A;  5EVI C;  4QD4 A;  5J8X A;  4WEK A;  4JKT A;  2Y2H A;  4II7 A;  4X53 A;  4LPZ A;  3RFB A;  4OPY A;  3UO9 A;  2PD8 A;  4HJ4 A;  3F1N A;  3Q7V B;  3KSG A;  4Y0U A;  1DP8 A;  2QJ5 A;  2G2W A;  4EW7 A;  1KE0 A;  1IYP A;  4D2O A;  2EX9 A;  4QB8 A;  3C4O A;  3TE8 A;  2QPN A;  1K4F A;  1FOF A;  1XJ6 A;  4JXW A;  1ONH A;  1IKG A;  5HAI A;  5KMW A;  2Y2Q A;  2Y79 A;  1K56 D;  1DJC A;  5HAR A;  1MWR A;  2ZLY A;  2XA7 M;  4I5S A;  5KZH A;  5KIZ A;  3KYE A;  4DN0 A;  3NC8 A;  3A3J A;  4ZDX A;  4JGP A;  5F82 A;  3LIC A;  3GDI A;  4RX3 A;  2FZ0 A;  1SKF A;  4UA7 A;  3P09 A;  1KGE A;  4DF6 A;  3HJK A;  1HTZ A;  3MKE A;  5FQ9 A;  3OCL A;  3TRC A;  4ZJ1 A;  2XEP A;  2QJ7 A;  2EFX A;  4H6J A;  2VEA A;  3QP2 A;  1M40 A;  1BZA A;  3ZVW A;  3UE0 A;  3NI9 A;  4Q0I A;  3D72 A;  5E2H A;  4JF6 A;  4CJN A;  1KGF A;  2NUT C;  3WS2 A;  2K2N A;  5FI2 A;  1YMS A;  2ZQ9 A;  4GW9 A;  5CGX A;  3BFC A;  3RXW A;  1FIK A;  4E04 A;  1K6S A;  4KZB A;  2XD1 A;  3C7U A;  3NDE A;  1S4S A;  4PM9 A;  4EEU A;  4PMA A;  5FI6 A;  1BLP A;  2OLU A;  5HFO A;  3HBR A;  1S1Z A;  1W5D A;  1H8Y A;  4JGR A;  2EXA A;  2OSU A;  3LEZ A;  2J3T C;  2WGW A;  3F1P B;  3CPT B;  1TF1 A;  4D60 A;  1H8M A;  3ZDJ A;  1PW1 A;  4Y17 A;  4YWZ A;  3UN7 A;  1LSW A;  4OH0 A;  1KDS A;  5F83 A;  4WEL A;  2JBF A;  2PU4 A;  4NEE D;  2IWC A;  4O01 A;  3N8R A;  5FAS A;  3HUN A;  4NXG A;  4BD1 A;  4EER A;  1NLY A;  3G35 A;  4KUK A;  3VE3 A;  1OTI A;  2DRW A;  3LIB A;  4CLC A;  3B33 A;  5CGW A;  5FEG A;  3TJZ C;  5A90 A;  3GRJ A;  1LHY A;  4B4Z A;  3UB5 P;  2WGW B;  4PPR A;  4I39 A;  4HBT A;  3ITB A;  3HL9 A;  4S2M A;  4QU3 A;  1CI8 A;  3CZD A;  4LEN A;  3PBN A;  2ZL1 B;  3CUE C;  1ES3 A;  2OAP 1;  1OTE A;  5DF9 A;  2JCH A;  4XUX A;  3HLB A;  3DAV A;  2WKH A;  4OPZ A;  3UPO A;  4OQH A;  1LI0 A;  4ZRR A;  4HIA A;  3FZC A;  3NIA A;  2ZL1 A;  5EOO A;  3E98 A;  5HDC A;  1YMX A;  3Q7Z A;  3VOZ A;  4HH3 A;  4M3K A;  3NCK A;  3S7O A;  1AWI A;  2D02 A;  4FD8 A;  4BQM A;  4E3N A;  2CC1 A;  3HLF A;  5DTS A;  1ZC2 A;  1BLS A;  4EU0 A;  1SDN A;  5FDS A;  5TFQ A;  3IT9 A;  4PHT A;  3TOI A;  1PI5 A;  4HI4 A;  2IWD A;  4WN5 A;  4BL2 A;  4RA7 A;  3ITA A;  2HJ9 C;  2X02 A;  1GHM A;  2W3F A;  3U2A A;  1TD5 A;  2VKS A;  2J3T D;  1MWS A;  2ZC7 A;  3CHW P;  4L9F A;  1I2S A;  3BJN A;  3LR0 A;  5HD5 A;  3OPR A;  2QMI A;  1KVL A;  2K31 A;  4MN6 A;  4YOF A;  1GHI A;  1MY8 A;  5KSC A;  3BM6 A;  5HWV A;  3SW1 A;  1S66 L;  2DMW A;  3F1N B;  5CHU A;  1K56 A;  3Q1F A;  1RP5 A;  5AJG A;  4K0X A;  4X68 A;  5GLA A;  1YM1 A;  4Q0J A;  2XFT A;  3ZQ5 A;  4ZAM A;  2JKT M;  3PTE A;  3MQ0 A;  4JPM A;  3C5A A;  2INW A;  3IWI A;  1MXO A;  3BLM A;  2LB5 A;  1BTL A;  3R4K A;  2XK1 A;  5F1F A;  1I5Q A;  2XDM A;  4GHI A;  3BYD A;  3IX8 A;  2ZQ7 A;  2PD7 A;  4ME4 A;  4DXC A;  2ZMA A;  1IKI A;  1NLZ A;  1OJG A;  5A92 A;  4DKI A;  2W27 A;  3I7J A;  2H0Y A;  1YT4 A;  5FL3 A;  3Q7V A;  2WGV A;  4S2L A;  3V67 A;  3NUL A;  2E8J A;  4YIN A;  3C4P A;  1PZP A;  1PRQ A;  4S2I A;  1BUL A;  2V8C A;  5EUA A;  3T1X A;  4R23 A;  1PWC A;  3O86 A;  3KSF A;  5AQB A;  4FTX A;  4N92 A;  5CED A;  4R1G A;  5HL6 A;  1Y28 A;  1AXB A;  3IF6 A;  3S7Q A;  5DVA A;  4HOI A;  3CPT A;  1T1B A;  1XFN A;  4IED A;  1IYQ A;  3OPH A;  2ZMV A;  3BFF A;  4KG2 A;  3GMW A;  5TBM A;  3HLG A;  2EWV A;  1Q2P A;  2V8F A;  3MFD A;  3AGF A;  1D1J A;  1LL5 A;  2PR6 A;  2J7V A;  2JHE A;  1SHV A;  5FAP A;  3HUM A;  1YLW A;  3MR0 A;  1EI5 A;  1VET B;  4RYE A;  5FQK A;  3LID A;  3FV7 A;  2Y2O A;  4EES A;  4WEJ A;  1MZU A;  4O8G A;  3MSH A;  1XJ4 A;  1PFL A;  1GSV A;  3UDF A;  1HD8 A;  2WKR A;  1CEF A;  2WAD A;  5DKL A;  3FYZ A;  4GKU A;  4JGQ A;  2RCX A;  4GB7 A;  2Y2P A;  3ZVT A;  4WZ5 A;  1ES2 A;  2W3H A;  3IBJ A;  4EQI A;  1VHM A;  2H10 A;  1S4R A;  3FKV A;  4S2N A;  4X69 A;  2WKP A;  4XUZ A;  1XA7 A;  4N9K A;  4OQ0 A;  4UEY A;  2B02 A;  3KYZ A;  4ID4 A;  3F1P A;  3BWL A;  3TSG A;  5CTM A;  1K4E A;  3W4P A;  4OON A;  4WZ5 C;  4KQO A;  3SS5 A;  2JKT I;  4S2N C;  5AQA A;  4CPK A;  3JPU A;  1OTA A;  1WYC A;  5AVF A;  2JN7 A;  4FSF A;  1VB6 A;  4EUZ A;  3K2N A;  2W3G A;  1CEG A;  5J4E A;  1VEU A;  4BD0 A;  3SS3 A;  3O87 A;  2MJ6 A;  1D7E A;  1SDE A;  2J9P A;  5L8M A;  4HHD A;  1G6A A;  3CUE A;  5A91 A;  2YKF A;  5FAO A;  2G7U A;  5FQI A;  1KDW A;  1T18 A;  3CG5 A;  4UQI S;  1VQQ A;  2GX5 A;  1QMF A;  3LIF A;  1JNU A;  3IQA A;  4WLA A;  1PZO A;  3MJQ A;  3MXQ A;  1Y54 A;  3ZYT A;  3IXB A;  5M1A A;  3UE3 A;  1IYS A;  5K5B A;  3VP1 A;  4R3B A;  1GHP A;  2ZC4 B;  1FIL A;  2HZ5 A;  5FSR A;  3NBL A;  1W8Q A;  3NJA A;  2B5R A;  4K08 A;  3IHB A;  4B4X A;  1NY0 A;  2L1M A;  5GLD A;  5EE8 A;  2HDQ A;  3H9W A;  5HD3 A;  4IVK A;  4KUO A;  1X0O A;  5LBR A;  3EQU A;  2JKG A;  3OBF A;  3K3C A;  2X01 A;  1H5X A;  3ZG0 A;  1PWD A;  2WYX A;  5M19 A;  3LIE A;  5FQQ A;  2G2U A;  2PRF A;  3MKF A;  1SKO B;  4R3J A;  3OPL A;  3DTE A;  5GLB A;  4WF0 A;  1YLJ A;  1FCO A;  5L07 A;  2O9B A;  1P9R A;  3JVU A;  1J3W A;  5HPI A;  2GJ3 A;  3GQZ A;  1W63 M;  1K6R A;  3LUQ A;  4JF4 A;  4RVA A;  3O5Y A;  3A3D A;  3D4F A;  3UDX A;  1ALQ A;  5F6A A;  1BUE A;  4Z9Q A;  5F1G A;  2A3U A;  2VGL S;  4UQI M;  1CF0 A;  1TVF A;  4NET A;  1YQS A;  3MQO A;  3MXS A;  2P7J A;  2A2L A;  1TS7 A;  4P6B A;  1GA0 A;  5HW3 A;  2VK3 A;  3CJM A;  5EEC A;  4R6L A;  4GLQ A;  3ICY A;  5HL1 A;  3WRT A;  3EEA A;  1S6R A;  4LRZ E;  2JC7 A;  2FFF B;  2Q0O A;  4MNR A;  4KZ5 A;  4C6Y A;  3GSG A;  4HH2 A;  4G3V A;  5HDD A;  4Y3I A;  5IU1 A;  3T4L A;  3VP2 A;  3OOV A;  4GJ4 A;  3VP3 A;  4PKY G;  3MBZ A;  4ZJ2 A;  3ZGA B;  3WWX A;  1S67 L;  1P97 A;  3BFD A;  1KE3 A;  2P04 A;  3VV4 A;  4BLM A;  4E3O A;  3E2L A;  1FSY A;  3MQQ A;  1E3U D;  2V1Z A;  2UWX A;  5HWW A;  3L7H A;  2Y59 A;  3V50 A;  3ZG8 B;  4KEN B;  1UGU A;  4CQH A;  5EVI D;  3T4S A;  5CGS A;  4WZ4 A;  3VSK A;  3ZG5 A;  5EM0 A;  1EW0 A;  5E2E A;  1PWG A;  4WYY A;  5HDS A;  1JWP A;  2ZC3 B;  1O7E A;  2LB9 A;  1HLU P;  5FQJ A;  4XT2 A;  4GOG A;  3RH8 B;  1XX2 A;  4OPR A;  3PBQ A;  3W8K A;  4P6Z M;  4ESP A;  4C3Q A;  4IUH A;  1G6O A;  5G18 A;  3QP5 A;  4FCF A;  4I38 A;  4B93 A;  1TDG A;  3MXR A;  1K54 A;  3DW0 A;  3UB9 A;  1ES5 A;  5EVI B;  1BLH A;  3BFG A;  4DE1 A;  2HDS A;  4X6T A;  3UPN A;  4KZ3 A;  4DXB A;  4HJ6 A;  1OPX A;  2XRN A;  3T4J A;  3HVF A;  2Y91 A;  1L2S A;  3BFE A;  5E43 A;  1FCM A;  2XH9 A;  3NHQ A;  3DBA A;  3OZH A;  3T4T A;  3SZT A;  3N6I A;  3VOL A;  2WK0 A;  3VP4 A;  5IHV A;  2V2F F;  4BMW A;  2WKI A;  4OQI A;  4LCM A;  1XJ2 A;  3FPW A;  2R9X A;  4WMC A;  2Y8H A;  1PYY A;  2L4R A;  1CQA A;  4FH2 A;  2O9C A;  3BQ8 A;  3IS2 A;  3T4Q A;  1F5M A;  4QHC A;  2Y2M A;  2ZBB A;  3IX4 A;  3Q81 A;  4NG2 A;  4R4R A;  5IS1 A;  1K57 C;  1DY6 A;  3HLW A;  2HDR A;  3ISG A;  3KYQ A;  1EWZ A;  3T1R A;  1KOU A;  3UB8 A;  2HF6 A;  3A3E A;  2IA2 A;  4GDN A;  2VJW A;  5FQM A;  4X56 A;  1CI9 A;  5FA7 A;  1YAX A;  1UWN X;  4H6J B;  4HJ3 A;  2P74 A;  4IHQ A;  3NEC A;  3P7N A;  3WS5 A;  1Q2Q A;  2PYP A;  3EGD C;  5U47 A;  4LV0 A;  1F2K A;  1P9W A;  5CRF A;  2PR5 A;  2PHY A;  3V5M A;  1MKI A;  5CHJ A;  1KGG A;  4QJG A;  5F5Y A;  5GLC A;  4NXE A;  4DE0 A;  3FG8 A;  4JXS A;  4BEN A;  1C3B A;  3G32 A;  1K25 A;  2X71 A;  2Y2I A;  4X55 A;  1FQG A;  5A93 A;  1N9N A;  1T19 A;  4O0P A;  4N1H A;  4GHI B;  4GCZ A;  1ESU A;  3OC2 A;  5EOE A;  3MZF A;  3EOI A;  3NOU C;  1LT0 A;  3S4X A;  1FR6 A;  3VP0 A;  4K0W A;  1ACF A;  3T12 B;  1TEM A;  5FI7 A;  1YLP A;  2H0T A;  2Y2N A;  1LI9 A;  5L10 A;  2XD5 A;  2HDU A;  5A8B A;  3L9K A;  2VA0 A;  1OTD A;  1N9L A;  1SZV A;  2WKE A;  2ZQD A;  4IVI A;  1VEU B;  2K7S A;  4Y13 A;  1K38 A;  2OV5 A;  1OME A;  1TDL A;  2V0U A;  3RJU A;  1WE4 A;  2PU2 A;  1ES4 A;  3IXD A;  3NDG A;  4MBF A;  4MBH A;  1VM1 A;  4JXG A;  1W63 Q;  4MLL A;  1E4D A;  1G68 A;  2J8Y A;  5D3O A;  1SCW A;  1LL8 A;  3O88 A;  4I3A A;  2R9W A;  2Y2G A;  5GHY A;  2HGV A;  1MBL A;  3BW6 A;  2DNS A;  3P01 A;  1UWP X;  3QNC A;  4RQ9 A;  2M7U A;  2W3D A;  3PBO A;  2JE5 A;  1XFQ A;  1JTD A;  3V3S A;  4Y15 A;  4L9G A;  5TJJ A;  2Y2L A;  4NK3 A;  3E0Y A;  3T4K A;  4QWO A;  2FH5 A;  4GDB A;  5JYP A;  2P08 A;  1MWU A;  4DDS A;  2ZQ8 A;  4OQG A;  4MCW A;  1BT5 A;  1BSG A;  3IWO A;  3E4Q A;  3SOI A;  4B9O A;  3LY3 A;  2EX6 A;  3WS4 A;  2BTF P;  4WUJ A;  4EWF A;  4K91 A;  1GSX A;  3O3V A;  4MEZ A;  4ZJ3 A;  2PBD P;  4EBN A;  1I2W A;  3CI6 A;  2H28 A;  1L0D A;  3N8S A;  4E3K A;  3G2Y A;  5CHM A;  4E3M A;  4PM8 A;  2D01 A;  3H7W B;  2ZC6 B;  4MBK A;  3ZCZ A;  3B47 A;  3PYP A;  2J80 A;  1ZHH B;  1N9B A;  1Y4O A;  2A24 A;  4UA9 A;  3F1O A;  1LL9 A;  5JYO A;  3GV9 A;  1ERQ A;  2J3W A;  1PNE A;  2PAV P;  1TS6 A;  1LLB A;  1IEL A;  2ZOH A;  1Z6F A;  4O7D A;  2HP5 A;  3FWL A;  2BG1 A;  5EVL A;  2VGK A;  1RGZ A;  4EXO A;  5TGF A;  4Q0H A;  3HLD A;  1K54 C;  4P0M A;  3WRZ A;  2VZW A;  5GHX A;  2ACG A;  3SH9 A;  2XR0 A;  5BOH A;  4R38 A;  4Y0T A;  4XT2 B;  3QP4 A;  3QNB A;  5KSH A;  4MDZ A;  3A0R A;  3S1Y A;  2WZX A;  3S7N A;  2Z6D A;  1GA9 A;  3D9Y A;  1PI4 A;  1D06 A;  1W79 A;  5EV0 A;  5DFY A;  1DP6 A;  1A0K A;  4N9L A;  1F98 A; 
#chains in the Genus database with same CATH homology
 5IT5 A;  3C8C A;  4QPR A;  5DFX A;  4Z1W A;  4HH2 A;  3PBN A;  3MFX A;  4G3V A;  4Y3I A;  5HDD A;  5IU1 A;  3OOV A;  3T4L A;  4GJ4 A;  3CUE C;  4PKY G;  2KOI A;  2OAP 1;  4AFI A;  1OTE A;  3HCY A;  3PBT A;  5DF9 A;  1S67 L;  1P97 A;  2P04 A;  2ZOI A;  3VV4 A;  2L0W A;  3CLO A;  2KLI A;  1OTB A;  4ZRR A;  2B18 A;  3BY8 A;  3MQQ A;  4HIA A;  4BBU A;  3UMD A;  2VGL M;  3H82 B;  4M4X A;  1BYW A;  5HWW A;  3S7P A;  2QYB A;  3E98 A;  4MN5 A;  2GNX A;  3G6O A;  5HDC A;  2KX6 A;  5I5L A;  4CLC C;  2O99 A;  2W1T A;  1UGU A;  4EUV A;  4HH3 A;  2ZMF A;  1LSX A;  3UE6 A;  1TS0 A;  3LIA A;  4CQH A;  3S7O A;  2D02 A;  3T4S A;  4L0L A;  4Y5F A;  2EA9 A;  4DMZ A;  1EW0 A;  1IFQ A;  3PBR A;  5HDS A;  2V0W A;  3H7W A;  3LR3 A;  2LB9 A;  2HV1 A;  2V9A A;  2VV7 A;  4EU0 A;  1N9O A;  4XT2 A;  1P0Z A;  2O0Y A;  3T50 A;  3RH8 B;  2PDR A;  5F68 A;  3PBQ A;  3FC7 A;  1XJ3 A;  1V9Y A;  4P6Z M;  4PHT A;  3GEC A;  4IUH A;  1G6O A;  3CWF A;  4EQ1 A;  4HI4 A;  4NXF A;  1DP9 A;  4I38 A;  4B93 A;  4WN5 A;  3BQA A;  2HJ9 C;  2VX8 A;  2WKQ A;  3EGX C;  2W3F A;  1TS8 A;  2CMN A;  3BY9 A;  1TD5 A;  2M1C A;  3U2A A;  2VKS A;  3UB9 A;  2J3T D;  4G3K A;  3PR6 A;  3CAX A;  4KQD A;  4L9F A;  3LYX A;  3BJN A;  4HJ6 A;  3LR0 A;  3IS2 B;  5HD5 A;  1OPX A;  2XRN A;  3A0S A;  4IUK A;  2GZA A;  3UB6 A;  2BAS A;  3T4J A;  3KSH A;  3LR5 A;  2K31 A;  4HNB A;  1STZ A;  4MN6 A;  3KX0 X;  3NHQ A;  3EWK A;  4YOF A;  3DBA A;  1OT6 A;  3H82 A;  3T4T A;  5HPF A;  1MC0 A;  5HWV A;  3SW1 A;  3UB7 A;  4OOL A;  1YKD A;  4GS9 A;  3F1O B;  3OLO A;  3VOL A;  1S66 L;  2DMW A;  3F1N B;  2XA7 S;  3EQV A;  2OWJ A;  3LR4 A;  4OOM A;  5AJG A;  4YNR A;  4BMW A;  4Q0J A;  3ZQ5 A;  2JKT M;  3MQ0 A;  5AVE A;  1XJ2 A;  2W1R A;  4ARZ A;  2INW A;  4R3A A;  4I3J A;  3FPW A;  3NOT C;  2M7V A;  2Y8H A;  2VV8 A;  2L4R A;  3KSI A;  4PKY A;  1NRJ A;  2LB5 A;  2JKR M;  3C30 A;  3OCN A;  4L9E A;  3R4K A;  2OAQ 1;  4GHI A;  3R7W B;  2O9C A;  2PD7 A;  4LRY C;  4ME4 A;  4NXB A;  3BQ8 A;  3E4P A;  3IS2 A;  3T4Q A;  1F5M A;  1NLZ A;  1OJG A;  2ZBB A;  2W27 A;  1IOU A;  5FL3 A;  3T4O A;  1T1C A;  5IS1 A;  3V67 A;  4EEP A;  5CX7 A;  2PT7 A;  1ZTU A;  2EWW A;  4F3L A;  5G4Z A;  3KYQ A;  4ETX A;  5HWT A;  4IJG A;  4MN7 A;  2JKR I;  1KOU A;  1OJ5 A;  2KDK A;  3UB8 A;  2HF6 A;  5HSQ A;  1WA9 A;  2IA2 A;  5TBM B;  1LSV A;  1F9I A;  2VJW A;  3KSF A;  1V9Z A;  3PHY A;  1YAX A;  1UWN X;  4H6J B;  2NUP C;  4HJ3 A;  4R70 A;  4IHQ A;  5HL6 A;  3MF0 A;  3ULF A;  4CLC D;  1Y28 A;  5DJT A;  3S7Q A;  3P7N A;  5MC7 A;  5HZH A;  2PYP A;  4HOI A;  3EGD C;  1T1B A;  1XFN A;  4BWI A;  3R7W A;  1P9W A;  2XSS A;  2PR5 A;  1GSW A;  1NWZ A;  3PXP A;  2ZMV A;  3B42 A;  2PHY A;  4FOF A;  4PAU A;  5TBM A;  3IBR A;  4BBV A;  2EWV A;  3JVV A;  5F5Y A;  4NXE A;  4ARZ B;  3LFV A;  2PR6 A;  3FG8 A;  2JHE A;  3E4O A;  2A24 B;  4CLC E;  3K3D A;  5DJU A;  1N9N A;  1T19 A;  4O0P A;  4HY8 A;  5J7E A;  3LI9 A;  3MR0 A;  4GHI B;  4GCZ A;  3OC2 A;  3LID A;  4EES A;  4WEJ A;  3EOI A;  3NOU C;  4BBT A;  2HJE A;  1MZU A;  2QHK A;  4JGO A;  1LT0 A;  4O8G A;  2VLG A;  3C38 A;  1XJ4 A;  1GSV A;  4HQA A;  4HP9 A;  2WKR A;  5C5K A;  3NOP C;  5A8B A;  3HJI A;  5DKL A;  2Z6C A;  4JGQ A;  1YSQ A;  1G28 A;  2VA0 A;  1OTD A;  4WEK A;  1N9L A;  2W3H A;  3IBJ A;  4II7 A;  4LRX C;  1VHM A;  4LPZ A;  1S4R A;  3RFB A;  4GS9 B;  2WKP A;  2PD8 A;  4HJ4 A;  3F1N A;  4UEY A;  3KSG A;  3EEH A;  2B02 A;  3C2W A;  2K7S A;  3KYZ A;  1DP8 A;  2QJ5 A;  2O9A A;  3F1P A;  2V0U A;  3BWL A;  1MKM A;  4EW7 A;  3MMH A;  4ETZ A;  3TE8 A;  1XJ6 A;  4KQO A;  2XRO A;  4MMN A;  2JKT I;  1W63 Q;  2I9V A;  4BJP A;  2W3E A;  1LL8 A;  4I3A A;  1OTA A;  5AVF A;  2HGV A;  2VV6 A;  2JN7 A;  4DJ2 A;  4FSF A;  1VB6 A;  3K2N A;  3TW8 A;  3BW6 A;  2Y79 A;  3P01 A;  1UWP X;  2W1T B;  2W3G A;  2XA7 M;  5J4E A;  4RQ9 A;  3RTY A;  2M7U A;  2MJ6 A;  2W3D A;  4NKP A;  1S1Y A;  3PBO A;  1D7E A;  1XFQ A;  4LLO B;  5L8M A;  2OWH A;  4I5S A;  1H3Q A;  4HHD A;  5KIZ A;  3CUE A;  4L9G A;  5TJJ A;  4DN0 A;  2YKF A;  3LI8 A;  2G7U A;  3E0Y A;  3T4K A;  4JGP A;  3LIC A;  3GDI A;  2FH5 A;  1T18 A;  2FZ0 A;  4UQI S;  2P08 A;  3UME A;  3HJK A;  4MCW A;  2GX5 A;  4CLC B;  3LIF A;  1JNU A;  3E4Q A;  4B9O A;  4WLA A;  3OCL A;  2PYR A;  3TRC A;  3MJQ A;  4WUJ A;  3MXQ A;  2V1A A;  2QJ7 A;  1GSX A;  4H6J A;  5J3W A;  2VEA A;  3ZYT A;  3UE3 A;  5K5B A;  5DKK A;  3CI6 A;  1OT9 A;  2H28 A;  4P6Z S;  4Q0I A;  3NJA A;  4K08 A;  3A0V A;  3D72 A;  2L1M A;  2NUT C;  3H9W A;  5HD3 A;  2OOL A;  4KUO A;  2K2N A;  1X0O A;  2D01 A;  3H7W B;  5LBR A;  4F3L B;  3EQU A;  3B47 A;  3PYP A;  2J80 A;  2R78 A;  1ZHH B;  4EET B;  4GW9 A;  3OBF A;  3K3C A;  2V1B A;  4E04 A;  2A24 A;  3F1O A;  3CIT A;  3FPV A;  3LIE A;  2J3W A;  1S4S A;  1TS6 A;  4EEU A;  3KO6 A;  2ZOH A;  1DRM A;  4WF0 A;  1S1Z A;  4JGR A;  2J3T C;  2QWS A;  3F1P B;  1YSP A;  1P9R A;  2O9B A;  3JVU A;  2W0N A;  1TF1 A;  3PBS A;  5HPI A;  2GJ3 A;  1H8M A;  4EXO A;  4Q0H A;  5G4Y A;  4YWZ A;  2VZW A;  2YKH A;  1W63 M;  3LUQ A;  4R38 A;  1LSW A;  3O5Y A;  2QKP A;  4XT2 B;  4HP4 A;  4WEL A;  5F6A A;  5KSH A;  4NEE D;  4MDZ A;  3D3O A;  3A0R A;  2VGL S;  4O01 A;  4UQI M;  4Y2F A;  3W2Z A;  5F69 A;  4NXG A;  3MQO A;  4EER A;  1NLY A;  4I3I A;  3S7N A;  2Z6D A;  4KUK A;  3VE3 A;  1OTI A;  2P7J A;  2A2L A;  1D06 A;  3LIB A;  4CLC A;  4WL9 A;  1ODV A;  1TS7 A;  3B33 A;  5DFY A;  3TJZ C;  4R6L A;  1DP6 A;  5EFW A;  4GLQ A;  4DJ3 A;  4G3W A;  3ICY A;  1T1A A;  3EEA A;  3VE4 A;  4LRZ E;  4I39 A;  1F98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...