2L1MA

Solution structure of the eag domain of the herg (kv11.1) k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l1mA00
1OTDA 1D06A 3CLOA 2PR5A 3NOUC 4HI4A 3F1OB 1TS6A 3CWFA 5AVEA 3EWKA 1OJGA 4WUJA 4I38A 3FC7A 4WF0A 4DJ3A 3F1NB 4L9FA 5G4YA 1S4RA 4JGOA 1XJ6A 2OWHA 4F3LA 1OTIA 2M1CA 3OLOA 1S67L 4H6JA 2J80A 3C8CA 4F3LB 2R78A 4EXOA 4BBUA 4H6JB 4EESA 3GECA 3PYPA 4L9GA 3LI8A 2VLGA 2VEAA 4I39A 2GJ3A 3LIDA 1GSVA 1ODVA 4KUOA 4NXFA 2Z6DA 3KX0X 3BY9A 4HIAA 4EW7A 2VV7A 1P97A 3ULFA 1S1ZA 1LSVA 1OTAA 4WLAA 1T1AA 2HV1A 1LSWA 4R6LA 1TS8A 4HH2A 3PHYA 5J3WA 2PHYA 4HJ3A 2I9VA 4JGQA 4EETB 2QJ5A 4I5SA 4HP9A 1XJ3A 1UWNX 2QKPA 3NHQA 1GSXA 3G6OA 1DP9A 1T1BA 3VE3A 3H9WA 1UGUA 5EFWA 2PD7A 5HDCA 5HDDA 4KUKA 3MR0A 3K3DA 5F5YA 1S1YA 3ZQ5A 1OT9A 3F1OA 2W0NA 4DJ2A 4HNBA 3HJIA 4MN6A 1DRMA 2WKQA 4HY8A 5HDSA 5TBMA 1X0OA 2EA9A 3MJQA 3E4OA 3F1NA 3UB6A 5TBMB 1G28A 1V9ZA 1D7EA 2CMNA 3F1PA 5J7EA 3NOPC 2YKHA 3LI9A 4NXBA 3F1PB 3HJKA 2PD8A 3CAXA 1LSXA 2INWA 2PDRA 2ZBBA 3K3CA 4EEUA 5HWVA 1UWPX 3NOTC 4GHIA 4KQDA 2YKFA 3VE4A 2ZOHA 5HWWA 1S4SA 3MXQA 4GHIB 4XT2A 5F69A 2OWJA 1S66L 3B33A 2L1MA 3EEHA 1VB6A 1OJ5A 4XT2B 3SW1A 4R70A 5J4EA 1DP8A 2PYRA 1OTEA 4HJ6A 2L0WA 2V0WA 4EQ1A 2WKRA 4I3IA 2JN7A 1MZUA 3UB8A 1F98A 3E4QA 1T1CA 1TS7A 4JGPA 3VOLA 1V9YA 4BBTA 4E04A 3RTYA 5HZHA 1P0ZA 5AVFA 4NXEA 2Z6CA 1EW0A 2PR6A 2BASA 3A0VA 2PYPA 4L9EA 3T50A 1BYWA 3UE6A 5HWTA 2OOLA 4BBVA 2QHKA 2KDKA 4HH3A 3ICYA 5HD5A 3LIEA 4K08A 4LRYC 2A24A 2V9AA 4GW9A 3RH8B 3MFXA 3C2WA 1OTBA 4HQAA 5DKLA 3IS2A 2A24B 5F68A 1XFNA 5A8BA 4LRXC 3IS2B 4HP4A 5DJTA 1T18A 3BY8A 4PKYA 1Y28A 4LLOB 2W27A 1KOUA 2VV8A 3A0RA 4WL9A 5HD3A 3P7NA 1N9LA 2WKPA 1TS0A 2L4RA 5DKKA 1F9IA 4HJ4A 5KIZA 4R38A 4EERA 2B02A 5IS1A 5F6AA 2D02A 1XJ4A 1OT6A 1LT0A 4I3JA 4EEPA 4I3AA 5HSQA 1JNUA 1N9OA 2V0UA 4B9OA 3MQQA 1T19A 4NXGA 3UB9A 3FG8A 3LIBA 3LICA 4LPZA 3UMEA 3UB7A 3H82A 3LIFA 4HHDA 4LRZE 2V1AA 3H82B 1LL8A 3GDIA 4JGRA 3NJAA 4WN5A 2QWSA 4YWZA 3LIAA 5G4ZA 1XJ2A 3MQOA 3D72A 2VV6A 4PKYG 2QJ7A 2H28A 4GS9A 4M4XA 3E4PA 2K7SA 3BWLA 2ZOIA 3H7WA 3UMDA 3LUQA 3A0SA 4GS9B 2V1BA 3H7WB 1N9NA 1WA9A 2KX6A 1XFQA 5DJUA 1DP6A 4GCZA 5I5LA 4MN5A 4RQ9A 2D01A 3IBRA 5IU1A 1NWZA 1GSWA 2JHEA 4HOIA 2P7JA 3LYXA 4R3AA
chains in the Genus database with same CATH superfamily
3KSHA 2WUQA 2VX8A 3GMWA 3VP0A 3CLOA 3DTMA 2PR5A 3NOUC 4Y13A 1TS6A 2XH9A 3HLWA 4B88A 5E2GA 3PXPA 4WF0A 1FCNA 4E3MA 5DFYA 4X68A 2EX9A 3QP2A 4JGOA 2XD5A 2VA0A 3ZNTA 2OWHA 1OTIA 2ZC6B 2O9CA 5FI7A 2R78A 2XFSA 3LFVA 2XRNA 2J7VA 3IT9A 3ZDJA 4RX3A 3N6IA 2GDNA 3GECA 5KSCA 3PYPA 1CI9A 4L9GA 4ARZA 5EOOA 1JWPA 1MKMA 2W3FA 2GNXA 4PHTA 4KUOA 4NXFA 3U2AA 4ARZB 3BY9A 1Y4OA 2ZQCA 4EBNA 3OCNA 5HAIA 4WMCD 3A3DA 2R9XA 2HV1A 1LSWA 4R6LA 4HH2A 4KZAA 4PAUA 2VGKA 2PHYA 3WS2A 4RX2A 4EBLA 2O99A 3SZTA 2I9VA 4NKPA 5E2HA 2O0YA 4I5SA 4LV0A 3BFFA 4HP9A 1FIKA 4ZJ3A 2VKSA 2DNSA 3ZNYA 2QKPA 3LCEA 3GVBA 1JTGA 3T1RA 3H9WA 4R1GA 1UGUA 4WM9A 3CZDA 2M7VA 3SOIA 5CHUA 1EROA 1K54C 1FOFA 3BFCA 3BQ8A 2EX8A 1Y54A 4WZ5A 3MR0A 4X69A 3C5AA 4XUZA 4G3WA 3IHBA 3ZQ5A 4O8GA 2W0NA 2WKQA 5HDSA 4KZ5A 4IUHA 4FUWA 1TF1A 3F1NA 4WMCA 1PWGA 3Q7VA 4S2JA 3DWKA 2ZJ9A 3VP4A 3GV9A 3LEZA 3UB6A 4Z1WA 1V9ZA 4OQIA 1XGIA 1D7EA 2CMNA 3Q7VB 1W8QA 5J7EA 3NOPC 2YKHA 5AQ7A 3KO6A 4ZBEA 4BD0A 2PD8A 2CC1A 2Y59A 3IF5A 1ALQA 5K5BA 2ZBBA 4U0XA 4Q8IA 2IA2A 4G3VA 5HWVA 3HCYA 2UV0E 2OAQ1 4GD6A 4DE3A 2WKHA 5HWWA 1GCEA 1S4SA 4QPRA 3DW0A 5CHMA 2QMIA 4N1XA 3SS4A 1O07A 3E2LA 4KZBA 1W7FA 5F1GA 3V3SA 3ZYTA 2WAFA 5HPIA 4R70A 5J4EA 3OPPA 4KZ8A 2L0WA 2V0WA 3CPTA 4I3IA 2JN7A 1MZUA 1F98A 3DWZA 1XA7A 2WAEA 2K2NA 3G32A 1TS7A 3OC2A 2Y79A 4BBTA 4R4RA 5A92A 2Z2MB 3V39A 4HEFA 5CEBA 3O5YA 4P87A 2Y55A 3BECA 4ZDXA 2JKRM 3L7HA 3MZEA 1EW0A 3CMZA 3PBQA 2BASA 2ZQ7A 3T50A 4B93A 4GKUA 4CLCD 5HWTA 5GLCA 4FH2A 5DTKA 1NYMA 3PBOA 1DY6A 1K25A 4OVDA 2GX5A 3IH9A 5L10A 3NC8A 4GN2A 1L0GA 2Y2JA 3DTIA 3HLDA 4LRYC 1LI9A 3FPVA 3C2WA 3MSHA 3EOIA 3DTEA 1OTBA 3BW6A 5DKLA 3IS2A 1KGEA 3ZG5A 4WYYA 3WWXA 5F68A 3MXSA 4S2OA 5FL3A 3IS2B 3C38A 1RGYA 1T18A 4PKYA 3A0RA 5HD3A 2XSSA 2WKPA 1XX2A 2L4RA 1I5QA 4HJ4A 1H3QA 3GR2A 2O9BA 4BWIA 3Q7ZA 4R38A 1YAXA 2A2LA 2ZQ8A 3HUMA 3KYEA 1E4DA 2D02A 2DCFA 5EE8A 1L3LA 2BG1A 1QMFA 4CLCA 1XJ4A 1NZOA 3IF6A 1H0MA 5IT5A 1NRFA 4CLCB 1EI5A 3OOVA 5FEGA 5HSQA 3JPUA 3JVVA 3T4TA 3FYZA 1BULA 5GHXA 2XA7S 1T19A 5BOHA 3FG8A 3FPWA 3VMAA 3N7WA 3IXDA 3C4PA 3W2ZA 4DE0A 1CK3A 1K57A 3PAEA 4NK3A 4MEZA 5EPHA 3GRJA 4F94A 1W79A 2OAP1 3RFBA 2E8IA 3NJAA 3VSKA 4C6YA 2WADA 4YWZA 1D1JA 4ETZA 2W1TA 1S6RA 2GZAA 1XJ2A 3BM6A 4DMZA 5HARA 2QJ7A 2W1TB 2H28A 4GS9A 4WZ5C 4OOMA 2K7SA 4FD8A 1ERQA 4KZ7A 1H5XA 4GS9B 3I7JA 2V1BA 1N9NA 2WGWA 1TD5A 4DF6A 3EQVA 4IVKA 4N9LA 3TG9A 3UO9A 3ISGA 3UN7A 2WGWB 1NWZA 2JHEA 1K6RA 2P7JA 1KE3A 3T4KA 3L9KA 4R3AA 5EM0A 3Q82A 3UDXA 3F1OB 2OLUA 2QYBA 3CWFA 3KSFA 3OPRA 4RYEA 4I38A 1BUEA 3GTCA 1YLJA 5I94A 3U4LP 5FASA 5DF7A 1S4RA 3C7UA 4Y17A 3UPOA 3IQAA 2DMWA 1XJ6A 4UAAA 1FSYA 4H6JA 4R0QA 2J80A 3WS0A 1STZA 4Y0OA 4FTXA 4H6JB 3FKVA 5E2FA 1JTDA 3UPPA 4ZRRA 3VSLA 2WYXA 5HL6A 5U47A 1KGFA 2ZMFA 4GNUA 3MMHA 2VK3A 3RXXA 1TVFA 3HVFA 2Z6DA 3KX0X 2VV7A 2ZMVA 1G6AA 4UA6A 3ULFA 1JVJA 5L09A 3MZDA 1T1AA 3VP3A 1PNEA 1VETA 1YT4A 1ESUA 2PBYA 4H8RA 2EWVA 1Q2PA 3BEBA 1VETB 2J3WA 2QJ5A 1XJ3A 1MWRA 2XEPA 3TE8A 1UWNX 3G6OA 1DP9A 1PW1A 2HP9A 1HVBA 2P04A 3R7WA 5EFWA 2PD7A 2VJWA 2HDRA 3R7WB 3QHYA 3MZFA 1KVMA 2ZMAA 3K3DA 4GLQA 4GJ4A 2XGNA 1KDWA 2XQZA 2JKTM 3HJIA 4MN6A 5TBMA 4MBFA 5TBMB 5GLAA 2ZM8A 3WS1A 3F1PA 1PIOA 3T1SA 3NCKA 2XA7M 3F1PB 4CLCC 5F82A 3S7PA 4X1LA 3IF6C 5FQMA 4LENA 1LSXA 2PDRA 2HDUA 4S2PA 4OQHA 1NLZA 3QNBA 5DTSA 2W1RA 4MNRA 4GHIA 4KQDA 4MLLA 5DVAA 3MXQA 4GHIB 4JXSA 3QP4A 2HDSA 3CITA 2Y2NA 3Q1FA 3WRTA 4OLGA 1K57C 1S66L 4CLCE 4ZJ2A 1VQQA 2ZC5B 3HUNA 3EEHA 3S7NA 2C6WB 1VB6A 4YFMA 1OJ5A 3SW1A 4WBGA 1DP8A 3PBTA 4JF5A 3N4IA 2WGIA 2Y2OA 3ZG7B 2WKRA 5HPFA 4Q0JA 3NULA 1T1CA 3TSGA 5HFOA 2LB9A 5EVID 1ES2A 5FQJA 5CGWA 4WEKA 4KG6A 3NI9A 3M2KA 3D4FA 1PI5A 2HDQA 1WE4A 1XKZA 1CEGA 2ZL1A 3LO7A 2ZM0A 3O86A 1VHMA 4CQHA 1ERMA 3G4PA 3WS4A 2ZL1B 2PR6A 4HESA 5TR7A 4L9EA 3HLFA 3UE6A 5DF9A 3IXBA 4PM9A 3P09A 4GOGA 4BBVA 1YSQA 2QHKA 4ETXA 4HH3A 5A93A 3G30A 3ICYA 4M3KA 5HD5A 4C3QA 2BTFP 4Q0IA 3ITBA 2W3GA 4JXVA 2A24A 4Y0UA 1K6SA 3T4QA 3G2YA 1SDEA 2JBFA 4MDZA 2A24B 4QY6A 5EVIA 1ZG4A 3LR0A 3CG5A 1AWIA 3NBLA 4BJPA 4FCFA 5EVLA 4JBFA 4E3KA 3DAVA 5EVIB 3BY8A 5FA7A 1C3BA 1Y28A 3W4PA 1MXOA 3IXHA 1YSPA 2VV8A 3CJMA 4R3JA 3P7NA 1ES4A 1YPRA 4BMWA 3T4OA 4NETA 4DXBA 4ZAMA 1NRJA 2KOIA 4EERA 5TGFA 5HAPA 2B02A 5FATA 5F6AA 4IEDA 2FFFB 4OPYA 3CHWP 4GD8A 2V2FF 4OH0A 3M2JA 4WEJA 4QU3A 1DJCA 1OT6A 5GHZA 4I3JA 4N1HA 4EEPA 2HJ9C 1WYBA 2V8CA 3IXGA 2UWXA 4I3AA 1N9OA 5FQKA 4E6XA 1MBLA 4B9OA 3MQQA 3PBRA 2FFYA 4NXGA 3LICA 3UMEA 3UB7A 3S1YA 3NY4A 3O3VA 4JLFA 3EEAA 1LL8A 3IHAA 3GDIA 3IBJA 2Y4AA 1YQSA 3NIAA 4E3LA 3D72A 2VV6A 4PKYG 3OZHA 4HBUA 3DBAA 1LL5A 1FR6A 1LHYA 2XROA 3VP1A 3E4PA 2RL3A 1XXMA 3BWLA 1NYYA 3H7WA 3SH8A 3UMDA 3LUQA 3MBZA 5FQIA 2Y2MA 4RVAA 3G34A 3H7WB 1XFQA 4K91A 5DJUA 4GCZA 4MN5A 4OKPA 4WELA 2FZ0A 2D01A 4Y15A 2JKRI 1GSWA 3CUEA 4IBXA 3UY6A 2XFTA 4OQ0A 5M18A 5FEFA 2EX2A 2PU4A 1J3WA 3HUOA 1ZC2A 4JF4A 4QHCA 4EBPA 1OTDA 5EM1A 2Y2LA 5FQQA 4UHUA 4XXRA 1ZHHB 4OP8A 3HLEA 2WKEA 4QWOA 3CI6A 3EWKA 1PYYA 1PW8A 2KLIA 3FC7A 4DJ3A 4BLMA 1VEUA 2NUTC 3QP1A 5IHVA 1XGJA 3W8KA 1G6OA 1VEUB 1F5MA 2P08A 1BLHA 3OLOA 1L0EA 5AQBA 4ME4A 5CX7A 4Y3IA 4PMAA 2V20A 2MJ6A 5EV0A 2Y2GA 1NXYA 2WK0A 4HBTA 3IWQA 1VM1A 3HL9A 1ZKJA 3RJUA 3KYZA 3B47A 3FV7A 3LI8A 4EUVA 1E3UD 2JCHA 2VEAA 4YOFA 1K4EA 2GJ3A 4I39A 3LIDA 1GSVA 1ODVA 4HIAA 4EW7A 5M19A 4U3TA 3E2KA 1P97A 1LSVA 5EOEA 2VGLM 1OTAA 3IX8A 5TFQA 3LEQA 1TS8A 3ZG8B 4X53A 5HW3A 1ONHA 3AGFA 4HJ3A 4JGQA 4EETB 2K31A 5EVEA 2Y91A 3A3FA 3G35A 3PBSA 3NDGA 4E3IA 3EQUA 3VOYA 4O7DA 3LY4A 2AVXA 1HZOA 1FCMA 3TW8A 3UDFA 1IKIA 2R9WA 5HDCA 4KQRA 4NG2A 5E2EA 3IWIA 5GLBA 4KUKA 5G18A 1E3UA 4QD4A 5EVIC 1ES3A 1LI0A 3ZVWA 1IYOA 1OT9A 3F1OA 4DJ2A 4HNBA 4D60A 1DRMA 2E8JA 3S7OA 2B18A 3D9YA 4PM5A 1XPBA 5CRFA 3MJQA 2Z2LB 3KSIA 3E4OA 2EX6A 1G28A 3LR5A 4JF6A 1PWDA 1WYCA 4R23A 3V67A 1K4FA 3LI9A 3UPNA 2A49A 1CJFA 4BQMA 1TEMA 3HJKA 1SHVA 3T1QB 1J9MA 3ZG9B 1IELA 2WZZA 3T4LA 2JE5A 2ZC7A 1IYPA 4K0XA 1RP5A 4E3JA 3CAXA 3ZG0A 5FAOA 2INWA 3RXWA 3V3RA 2P9VA 4EUZA 4EEUA 4LGWA 3MKEA 3PTEA 4YINA 3VE4A 2P9VB 1BZAA 1BT5A 2Y2KA 4LCMA 4LCLA 4IJGA 1FQGA 4IHQA 1L0FA 5FAQA 1ACFA 4XT2A 2OWJA 4DE1A 2Q9NA 4ID4A 3KSGA 3SH7A 4Y7PA 2L1MA 3MXRA 3QP6A 4JXGA 4XT2B 5HX9A 2J9PA 3OPHA 2G7UA 1CF0A 3JVUA 2OSUA 4G3KA 2J3TC 3HLCA 2PYRA 4MN7A 4HJ6A 3ITAA 2QZ6A 3KYQA 1M40A 4RA7A 1BLPA 3GSGA 4UA9A 1E25A 4JGPA 3VOLA 3PR6A 3QP8A 4DE2A 1TDLA 1V9YA 2HP6A 1GHPA 4O0PA 4MBHA 1HLUP 2X01A 4CPKA 3SS3A 1L2SA 3MF0A 5HAQA 1DJBA 2LB5A 4NXEA 1HD8A 4B4XA 5L2FA 2Z6CA 3BJNA 2WKIA 2EFUA 2PYPA 5C5KA 3CUEC 2VGJA 4JXWA 3P98A 4E6WA 1BYWA 2W3HA 3NDEA 1MY8A 5L07A 4P6ZM 3MQ0A 2W3EA 3A3EA 1IYSA 1IFQA 3LIEA 3WS5A 4FSFA 2XR0A 1BLCA 4K08A 4ZTKA 4GW9A 3MFXA 2ZQDA 3UE3A 1PRQA 1NLYA 1YMXA 1W8YA 4JPMA 1XFNA 5A8BA 4LRXC 5DJTA 4R4SA 4X55A 5D3OA 1MPLA 4LLOB 4EV4A 2JKTI 1LLBA 2HPBA 4WL9A 1N9LA 4OONA 5F83A 5DKKA 2Y2QA 2X02A 1MWSA 5CHJA 2RCXA 5DFXA 2P74A 4EU0A 5CEDA 4BENA 1K56A 1I2WA 3P01A 2Y8HA 4Z9QA 1YLTA 3W4OA 1YLZA 1H8YA 4Q0HA 4QY5A 1KVLA 4KZ9A 4S2IA 4X25A 1LL9A 2V0UA 3UNWA 4OOLA 2PT7A 5FDHA 2EXAA 4LPZA 3TRCA 4PM7A 1YMSA 3PAGA 2XF3A 2XDMA 3LIFA 4HHDA 4GZBA 1BTLA 2C5WB 3FKWA 1RGZA 2V1AA 1TDGA 1FSWA 1CI8A 4S2MA 1H8MA 4WN5A 3LIAA 1XP4A 1YM1A 3BYDA 4X6TA 2HF6A 5G4ZA 3UB5P 2W3DA 3UDIA 2ZC4B 4PM6A 4M4XA 1G68A 1OMEA 4DN0A 4A5RA 2ZOIA 1W63M 3ZCZA 2VGLS 5DTTA 4BL3A 1A0KA 4IBRA 2KX6A 1AXBA 5I5LA 3ZVTA 4RQ9A 1GA9A 4JKTA 1N4OA 4HOIA 3TOIA 2OV5A 3LYXA 4UQIM 3C4OA 5FI6A 3V5MA 4OP5A 1D06A 4GDNA 1FILA 3G31A 4S2NA 4HI4A 1H8ZA 5MC7A 5CTMA 2J3TD 3TJZC 5AVEA 4AFIA 1OJGA 4WUJA 3R4KA 5CXWA 1F2KA 1S0WA 3F1NB 4L9FA 2ZQ9A 3ZGAB 5L8MA 5G4YA 2G2UA 3GQZA 2A3UA 4DXCA 3NECA 4F3LA 2M1CA 1MC0A 2M7UA 1IOUA 1S67L 5EECA 2H10A 1SKOA 4E3OA 2ZD8A 3C8CA 4F3LB 2PU2A 3BFGA 4EXOA 4BBUA 1SKOB 4EQIA 5HL1A 3BFDA 5E43A 2PRFA 4EESA 2VLGA 2Q0OA 2IWBA 3O88A 4R3BA 1FCOA 2WGVA 5CTNA 2X71A 5AQAA 1S1ZA 1W5DA 2B95A 4WLAA 2FH5A 1CEFA 1M6KA 4OPQA 3AGDA 4P6BA 2IWCA 2OLVA 3PHYA 5J3WA 3CPTB 3VFHA 3D3OA 1KGGA 3VFFA 2EXBA 1GA0A 3NHQA 1ONGA 1GSXA 1T1BA 3BQAA 2Y2IA 3MKFA 3VE3A 5FQ9A 1K55A 2PBDP 3DTKA 5CERA 5HDDA 3VOZA 4FOFA 4MCWA 5F1FA 1KE0A 4CJNA 5GL9A 1P9RA 5F5YA 4N92A 1S1YA 3SS5A 2H0YA 3VP2A 1IKGA 4HY8A 4LV1A 1X0OA 2EA9A 4MBKA 3M6BA 2J9OA 4L0LA 4UEYA 2HGVA 3WRZA 3AGEA 3ZFZA 1L0DA 1N9BA 2NUPC 1HTZA 4KZ4A 3IWOA 5M1AA 1BLSA 3BRMA 1KDSA 4NXBA 5CGXA 3A3IA 1GHIA 1SDNA 4S2KA 5KMWA 4P6ZS 4KZ6A 1K0KA 5GLDA 1GHMA 1IEMA 2XD1A 3K3CA 4LV3A 2IWDA 1SCWA 1UWPX 3S22A 4X56A 1PZPA 3NOTC 5KSHA 1JWZA 4DDSA 2YKFA 1YKDA 2ZLYA 3B42A 3C7VA 2ZOHA 3FZCA 3HREA 4UA7A 1SZVA 1ZG6A 5F69A 2HJEA 3B33A 4WZ4A 1SKFA 4DDYA 2JC7A 3N8LA 3HLBA 3IF6B 5CECA 3MS6A 4XUXA 3S4XA 2PAVP 1OTEA 3T4JA 2HP5A 5AJGA 5TJJA 4EQ1A 3FWLA 1MKIA 4BD1A 3UB8A 1I2SA 1NY0A 4P85A 3E4QA 4EWFA 4II7A 5CGSA 4OOYA 3Q07A 1YLYA 2BLSA 4KENB 1PI4A 4D2OA 4E04A 4DKIA 3RTYA 4OPZA 5HZHA 1P0ZA 2ZC3B 1P9WA 2B5RA 1OPXA 4FH4A 4LFUA 5AVFA 1BSGA 3HBRA 3ZHHA 1Z6FA 4KQOA 3N8SA 2EWWA 2JKGA 2WZXA 4KZ3A 4KQQA 3LR3A 1ESIA 3A0VA 4QB8A 4S2LA 3O87A 3E0YA 1XA1A 5A90A 1PWCA 3V50A 3LR4A 1NJ4A 1IYQA 2V8FA 2OOLA 5J8XA 4S2NC 4KG5A 1YLWA 2KDKA 2G2WA 1EWZA 3T1XA 4B4ZA 2V9AA 3RH8B 1FR1A 1K54A 4OLDA 3BFEA 1Z09A 4QJGA 4HQAA 2XK1A 4Y2FA 3UE1A 4KG2A 2Q9MA 1NZUA 2Y2HA 1ZTUA 4Y0TA 3S7QA 3BLSA 1MWUA 4GDBA 4HP4A 1DJAA 4X1MA 3M6HA 1U60A 2JKFA 3OBFA 1MWTA 4LV2A 3EGXC 3N8RA 4OPRA 2W27A 1KOUA 1K38A 1RCJA 3LGOA 1TS0A 5AQ9A 1F9IA 2O9AA 3HLGA 4IUKA 4BL2A 4P0MA 1QMEA 4UQIS 5KIZA 5DF8A 5EUAA 5IS1A 3QNCA 4NEED 2DRWA 3C30A 3IX3A 1YLPA 4GB7A 3E98A 4ZJ1A 2EFXA 2ACGA 2V1ZA 3QP5A 3T4SA 5JYPA 1JWVA 1ES5A 1LT0A 4ESPA 3UE0A 4DRTA 3PBNA 1PFLA 1JNUA 4OQGA 3IX4A 2J8YA 3G2ZA 5A91A 4Y5FA 3UB9A 3BLMA 3LIBA 5JYOA 3VV4A 4E3NA 3H82A 4N9KA 3B3XA 4LRZE 3SH9A 3K2NA 3H82B 5GHYA 3Q81A 1O7EA 3OCLA 4JGRA 1CQAA 3W4QA 2H0TA 1Q2QA 2QWSA 1K55C 2Y2PA 3A3JA 3MQOA 4IVIA 4PM8A 2ZM2A 4U0TA 3LY3A 2HZ5A 3OPLA 2H5SA 1PZOA 4C75A 1K56D 2VZWA 3A0SA 1KE4A 3T12B 5FDSA 1W63Q 4O01A 1G5UA 4PPRA 5FSRA 2ZQAA 2XLNA 1WA9A 3JYIA 4YNRA 4MMNA 4K0WA 2I72A 3MFDA 3EGDC 5FAPA 1DP6A 5KZHA 2QPNA 3IH8A 3IBRA 5FI2A 5IU1A 5LBRA
chains in the Genus database with same CATH topology
3KSHA 1OTDA 2VX8A 1D06A 3CLOA 1ZHHB 2PR5A 3NOUC 4HI4A 5MC7A 3F1OB 1TS6A 2QYBA 3CI6A 3CWFA 3KSFA 2J3TD 3TJZC 5AVEA 3EWKA 4AFIA 1OJGA 4WUJA 4I38A 2KLIA 3PXPA 3R4KA 3FC7A 4WF0A 4DJ3A 3F1NB 4L9FA 5L8MA 5G4YA 5DFYA 1S4RA 2NUTC 4JGOA 1G6OA 2VA0A 1F5MA 2P08A 2DMWA 1XJ6A 2OWHA 4F3LA 1OTIA 2M1CA 3OLOA 1MC0A 2O9CA 2M7UA 1IOUA 1S67L 4ME4A 5CX7A 4H6JA 2J80A 4Y3IA 3C8CA 4F3LB 2R78A 3LFVA 4EXOA 2XRNA 1STZA 4BBUA 2MJ6A 4H6JB 4EESA 3GECA 3PYPA 3KYZA 3B47A 4L9GA 4ZRRA 3LI8A 4ARZA 2VLGA 4EUVA 1MKMA 5HL6A 2ZMFA 2VEAA 2W3FA 3MMHA 4YOFA 2GNXA 2GJ3A 4I39A 3LIDA 4PHTA 1GSVA 1ODVA 4KUOA 4NXFA 3U2AA 2Z6DA 3KX0X 4ARZB 3BY9A 4HIAA 4EW7A 2VV7A 2ZMVA 1P97A 3ULFA 3OCNA 1S1ZA 1LSVA 2VGLM 1OTAA 4WLAA 1T1AA 2FH5A 2HV1A 1LSWA 4R6LA 1TS8A 4HH2A 3PHYA 4PAUA 5J3WA 2PHYA 3D3OA 2EWVA 2O99A 4HJ3A 2I9VA 2J3WA 4JGQA 4EETB 2K31A 4NKPA 2O0YA 2QJ5A 4I5SA 4HP9A 1XJ3A 2VKSA 3PBSA 3TE8A 1UWNX 2QKPA 3EQUA 3NHQA 1GSXA 3G6OA 1DP9A 1T1BA 3BQAA 3TW8A 3VE3A 3H9WA 2P04A 3R7WA 1UGUA 5EFWA 2PD7A 5HDCA 5HDDA 2M7VA 2VJWA 4FOFA 4MCWA 3R7WB 4KUKA 3BQ8A 3MR0A 1P9RA 3K3DA 4GLQA 5F5YA 4G3WA 1S1YA 3ZQ5A 4GJ4A 4O8GA 1OT9A 3F1OA 2W0NA 4DJ2A 2JKTM 4HNBA 3HJIA 4MN6A 1DRMA 2WKQA 4HY8A 5HDSA 5TBMA 3S7OA 1X0OA 4IUHA 2B18A 2EA9A 3MJQA 3KSIA 1TF1A 3E4OA 3F1NA 4L0LA 4UEYA 2HGVA 3UB6A 5TBMB 4Z1WA 1G28A 1V9ZA 2NUPC 3LR5A 1D7EA 2CMNA 3F1PA 5J7EA 3NOPC 2YKHA 3V67A 3LI9A 4NXBA 2XA7M 3KO6A 3F1PB 3HJKA 4CLCC 4P6ZS 3S7PA 2PD8A 3T4LA 3CAXA 5K5BA 1LSXA 2INWA 2PDRA 2ZBBA 3K3CA 2IA2A 4EEUA 4G3VA 5HWVA 1NLZA 3HCYA 1UWPX 2W1RA 3NOTC 4GHIA 5KSHA 2OAQ1 4KQDA 2YKFA 3VE4A 1YKDA 3B42A 2ZOHA 5HWWA 1S4SA 4QPRA 3MXQA 4GHIB 4IJGA 4IHQA 4XT2A 5F69A 3CITA 2OWJA 2HJEA 4CLCE 1S66L 3KSGA 3B33A 2L1MA 3EEHA 3S7NA 1VB6A 3ZYTA 1OJ5A 4XT2B 2G7UA 3JVUA 3SW1A 5HPIA 4R70A 5J4EA 4G3KA 2J3TC 1DP8A 2PYRA 4MN7A 3PBTA 1OTEA 4HJ6A 3T4JA 2L0WA 2V0WA 5AJGA 3KYQA 5TJJA 4EQ1A 2WKRA 4I3IA 2JN7A 1MZUA 3UB8A 1F98A 5HPFA 4Q0JA 2K2NA 3E4QA 1T1CA 1TS7A 4II7A 4JGPA 3VOLA 3PR6A 3OC2A 1V9YA 2Y79A 2LB9A 4BBTA 4O0PA 4WEKA 4E04A 3RTYA 5HZHA 1P0ZA 3O5YA 3MF0A 1VHMA 1P9WA 4CQHA 1OPXA 5AVFA 2JKRM 2LB5A 4KQOA 4NXEA 2EWWA 2Z6CA 3BJNA 1EW0A 3PBQA 3LR3A 2PR6A 2BASA 3A0VA 2PYPA 5C5KA 3CUEC 4L9EA 3E0YA 3T50A 4B93A 1BYWA 2W3HA 3LR4A 4CLCD 3UE6A 5HWTA 5DF9A 2OOLA 4BBVA 4P6ZM 1YSQA 3MQ0A 2W3EA 3PBOA 2QHKA 4ETXA 2GX5A 2KDKA 4HH3A 1IFQA 3ICYA 5HD5A 4Q0IA 3LIEA 4FSFA 2W3GA 4K08A 4LRYC 2A24A 3FPVA 2V9AA 4GW9A 3RH8B 3MFXA 3UE3A 3C2WA 3EOIA 3T4QA 1OTBA 4HQAA 4Y2FA 1NLYA 3BW6A 5DKLA 3IS2A 4MDZA 2A24B 3LR0A 1ZTUA 3S7QA 4BJPA 5F68A 1XFNA 5FL3A 5A8BA 4LRXC 3IS2B 4HP4A 3C38A 5DJTA 1T18A 3BY8A 3OBFA 4PKYA 1Y28A 4LLOB 2JKTI 2W27A 3EGXC 1KOUA 1YSPA 2VV8A 3A0RA 4WL9A 5HD3A 3P7NA 1N9LA 2XSSA 2WKPA 1TS0A 2L4RA 5DKKA 4BMWA 1F9IA 3T4OA 2O9AA 4HJ4A 1H3QA 4IUKA 2O9BA 4BWIA 4UQIS 1NRJA 5KIZA 4R38A 1YAXA 5DFXA 2KOIA 2A2LA 4EERA 2B02A 4EU0A 5IS1A 5F6AA 2D02A 4CLCA 4NEED 1XJ4A 3P01A 3C30A 4WEJA 2Y8HA 5IT5A 3E98A 3T4SA 1OT6A 4CLCB 1LT0A 4I3JA 4EEPA 2HJ9C 3PBNA 4Q0HA 3OOVA 4I3AA 5HSQA 1JNUA 3JVVA 1N9OA 3T4TA 2V0UA 4B9OA 3MQQA 3PBRA 2XA7S 1T19A 4NXGA 4Y5FA 3UB9A 4OOLA 2PT7A 3FG8A 3FPWA 3LIBA 3LICA 4LPZA 3TRCA 3UMEA 3W2ZA 3VV4A 3UB7A 3H82A 3LIFA 4HHDA 4LRZE 2V1AA 3H82B 3K2NA 3EEAA 1LL8A 2OAP1 3GDIA 3IBJA 3OCLA 4JGRA 3RFBA 3NJAA 1H8MA 4WN5A 2QWSA 4YWZA 3LIAA 4ETZA 2W1TA 2HF6A 5G4ZA 2GZAA 1XJ2A 3MQOA 3D72A 4DMZA 2VV6A 2W3DA 4PKYG 2QJ7A 2W1TB 3DBAA 2H28A 4GS9A 4M4XA 2XROA 4DN0A 3E4PA 4OOMA 2K7SA 3BWLA 2ZOIA 1W63M 3H7WA 3UMDA 3LUQA 2VZWA 3A0SA 4GS9B 2VGLS 1W63Q 4O01A 2V1BA 3H7WB 1N9NA 1WA9A 1TD5A 4YNRA 2KX6A 4MMNA 3EQVA 1XFQA 3EGDC 5DJUA 1DP6A 4GCZA 5I5LA 4MN5A 4WELA 2FZ0A 4RQ9A 2D01A 3IBRA 2JKRI 5IU1A 1NWZA 1GSWA 2JHEA 3CUEA 4HOIA 2P7JA 5LBRA 3T4KA 3LYXA 4UQIM 4R3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTD A;  1D06 A;  3CLO A;  2PR5 A;  3NOU C;  4HI4 A;  3F1O B;  1TS6 A;  3CWF A;  5AVE A;  3EWK A;  1OJG A;  4WUJ A;  4I38 A;  3FC7 A;  4WF0 A;  4DJ3 A;  3F1N B;  4L9F A;  5G4Y A;  1S4R A;  4JGO A;  1XJ6 A;  2OWH A;  4F3L A;  1OTI A;  2M1C A;  3OLO A;  1S67 L;  4H6J A;  2J80 A;  3C8C A;  4F3L B;  2R78 A;  4EXO A;  4BBU A;  4H6J B;  4EES A;  3GEC A;  3PYP A;  4L9G A;  3LI8 A;  2VLG A;  2VEA A;  4I39 A;  2GJ3 A;  3LID A;  1GSV A;  1ODV A;  4KUO A;  4NXF A;  2Z6D A;  3KX0 X;  3BY9 A;  4HIA A;  4EW7 A;  2VV7 A;  1P97 A;  3ULF A;  1S1Z A;  1LSV A;  1OTA A;  4WLA A;  1T1A A;  2HV1 A;  1LSW A;  4R6L A;  1TS8 A;  4HH2 A;  3PHY A;  5J3W A;  2PHY A;  4HJ3 A;  2I9V A;  4JGQ A;  4EET B;  2QJ5 A;  4I5S A;  4HP9 A;  1XJ3 A;  1UWN X;  2QKP A;  3NHQ A;  1GSX A;  3G6O A;  1DP9 A;  1T1B A;  3VE3 A;  3H9W A;  1UGU A;  5EFW A;  2PD7 A;  5HDC A;  5HDD A;  4KUK A;  3MR0 A;  3K3D A;  5F5Y A;  1S1Y A;  3ZQ5 A;  1OT9 A;  3F1O A;  2W0N A;  4DJ2 A;  4HNB A;  3HJI A;  4MN6 A;  1DRM A;  2WKQ A;  4HY8 A;  5HDS A;  5TBM A;  1X0O A;  2EA9 A;  3MJQ A;  3E4O A;  3F1N A;  3UB6 A;  5TBM B;  1G28 A;  1V9Z A;  1D7E A;  2CMN A;  3F1P A;  5J7E A;  3NOP C;  2YKH A;  3LI9 A;  4NXB A;  3F1P B;  3HJK A;  2PD8 A;  3CAX A;  1LSX A;  2INW A;  2PDR A;  2ZBB A;  3K3C A;  4EEU A;  5HWV A;  1UWP X;  3NOT C;  4GHI A;  4KQD A;  2YKF A;  3VE4 A;  2ZOH A;  5HWW A;  1S4S A;  3MXQ A;  4GHI B;  4XT2 A;  5F69 A;  2OWJ A;  1S66 L;  3B33 A;  2L1M A;  3EEH A;  1VB6 A;  1OJ5 A;  4XT2 B;  3SW1 A;  4R70 A;  5J4E A;  1DP8 A;  2PYR A;  1OTE A;  4HJ6 A;  2L0W A;  2V0W A;  4EQ1 A;  2WKR A;  4I3I A;  2JN7 A;  1MZU A;  3UB8 A;  1F98 A;  3E4Q A;  1T1C A;  1TS7 A;  4JGP A;  3VOL A;  1V9Y A;  4BBT A;  4E04 A;  3RTY A;  5HZH A;  1P0Z A;  5AVF A;  4NXE A;  2Z6C A;  1EW0 A;  2PR6 A;  2BAS A;  3A0V A;  2PYP A;  4L9E A;  3T50 A;  1BYW A;  3UE6 A;  5HWT A;  2OOL A;  4BBV A;  2QHK A;  2KDK A;  4HH3 A;  3ICY A;  5HD5 A;  3LIE A;  4K08 A;  4LRY C;  2A24 A;  2V9A A;  4GW9 A;  3RH8 B;  3MFX A;  3C2W A;  1OTB A;  4HQA A;  5DKL A;  3IS2 A;  2A24 B;  5F68 A;  1XFN A;  5A8B A;  4LRX C;  3IS2 B;  4HP4 A;  5DJT A;  1T18 A;  3BY8 A;  4PKY A;  1Y28 A;  4LLO B;  2W27 A;  1KOU A;  2VV8 A;  3A0R A;  4WL9 A;  5HD3 A;  3P7N A;  1N9L A;  2WKP A;  1TS0 A;  2L4R A;  5DKK A;  1F9I A;  4HJ4 A;  5KIZ A;  4R38 A;  4EER A;  2B02 A;  5IS1 A;  5F6A A;  2D02 A;  1XJ4 A;  1OT6 A;  1LT0 A;  4I3J A;  4EEP A;  4I3A A;  5HSQ A;  1JNU A;  1N9O A;  2V0U A;  4B9O A;  3MQQ A;  1T19 A;  4NXG A;  3UB9 A;  3FG8 A;  3LIB A;  3LIC A;  4LPZ A;  3UME A;  3UB7 A;  3H82 A;  3LIF A;  4HHD A;  4LRZ E;  2V1A A;  3H82 B;  1LL8 A;  3GDI A;  4JGR A;  3NJA A;  4WN5 A;  2QWS A;  4YWZ A;  3LIA A;  5G4Z A;  1XJ2 A;  3MQO A;  3D72 A;  2VV6 A;  4PKY G;  2QJ7 A;  2H28 A;  4GS9 A;  4M4X A;  3E4P A;  2K7S A;  3BWL A;  2ZOI A;  3H7W A;  3UMD A;  3LUQ A;  3A0S A;  4GS9 B;  2V1B A;  3H7W B;  1N9N A;  1WA9 A;  2KX6 A;  1XFQ A;  5DJU A;  1DP6 A;  4GCZ A;  5I5L A;  4MN5 A;  4RQ9 A;  2D01 A;  3IBR A;  5IU1 A;  1NWZ A;  1GSW A;  2JHE A;  4HOI A;  2P7J A;  3LYX A;  4R3A A; 
#chains in the Genus database with same CATH topology
 3KSH A;  2WUQ A;  2VX8 A;  3GMW A;  3VP0 A;  3CLO A;  3DTM A;  2PR5 A;  3NOU C;  4Y13 A;  1TS6 A;  2XH9 A;  3HLW A;  4B88 A;  5E2G A;  3PXP A;  4WF0 A;  1FCN A;  4E3M A;  5DFY A;  4X68 A;  2EX9 A;  3QP2 A;  4JGO A;  2XD5 A;  2VA0 A;  3ZNT A;  2OWH A;  1OTI A;  2ZC6 B;  2O9C A;  5FI7 A;  2R78 A;  2XFS A;  3LFV A;  2XRN A;  2J7V A;  3IT9 A;  3ZDJ A;  4RX3 A;  3N6I A;  2GDN A;  3GEC A;  5KSC A;  3PYP A;  1CI9 A;  4L9G A;  4ARZ A;  5EOO A;  1JWP A;  1MKM A;  2W3F A;  2GNX A;  4PHT A;  4KUO A;  4NXF A;  3U2A A;  4ARZ B;  3BY9 A;  1Y4O A;  2ZQC A;  4EBN A;  3OCN A;  5HAI A;  4WMC D;  3A3D A;  2R9X A;  2HV1 A;  1LSW A;  4R6L A;  4HH2 A;  4KZA A;  4PAU A;  2VGK A;  2PHY A;  3WS2 A;  4RX2 A;  4EBL A;  2O99 A;  3SZT A;  2I9V A;  4NKP A;  5E2H A;  2O0Y A;  4I5S A;  4LV0 A;  3BFF A;  4HP9 A;  1FIK A;  4ZJ3 A;  2VKS A;  2DNS A;  3ZNY A;  2QKP A;  3LCE A;  3GVB A;  1JTG A;  3T1R A;  3H9W A;  4R1G A;  1UGU A;  4WM9 A;  3CZD A;  2M7V A;  3SOI A;  5CHU A;  1ERO A;  1K54 C;  1FOF A;  3BFC A;  3BQ8 A;  2EX8 A;  1Y54 A;  4WZ5 A;  3MR0 A;  4X69 A;  3C5A A;  4XUZ A;  4G3W A;  3IHB A;  3ZQ5 A;  4O8G A;  2W0N A;  2WKQ A;  5HDS A;  4KZ5 A;  4IUH A;  4FUW A;  1TF1 A;  3F1N A;  4WMC A;  1PWG A;  3Q7V A;  4S2J A;  3DWK A;  2ZJ9 A;  3VP4 A;  3GV9 A;  3LEZ A;  3UB6 A;  4Z1W A;  1V9Z A;  4OQI A;  1XGI A;  1D7E A;  2CMN A;  3Q7V B;  1W8Q A;  5J7E A;  3NOP C;  2YKH A;  5AQ7 A;  3KO6 A;  4ZBE A;  4BD0 A;  2PD8 A;  2CC1 A;  2Y59 A;  3IF5 A;  1ALQ A;  5K5B A;  2ZBB A;  4U0X A;  4Q8I A;  2IA2 A;  4G3V A;  5HWV A;  3HCY A;  2UV0 E;  2OAQ 1;  4GD6 A;  4DE3 A;  2WKH A;  5HWW A;  1GCE A;  1S4S A;  4QPR A;  3DW0 A;  5CHM A;  2QMI A;  4N1X A;  3SS4 A;  1O07 A;  3E2L A;  4KZB A;  1W7F A;  5F1G A;  3V3S A;  3ZYT A;  2WAF A;  5HPI A;  4R70 A;  5J4E A;  3OPP A;  4KZ8 A;  2L0W A;  2V0W A;  3CPT A;  4I3I A;  2JN7 A;  1MZU A;  1F98 A;  3DWZ A;  1XA7 A;  2WAE A;  2K2N A;  3G32 A;  1TS7 A;  3OC2 A;  2Y79 A;  4BBT A;  4R4R A;  5A92 A;  2Z2M B;  3V39 A;  4HEF A;  5CEB A;  3O5Y A;  4P87 A;  2Y55 A;  3BEC A;  4ZDX A;  2JKR M;  3L7H A;  3MZE A;  1EW0 A;  3CMZ A;  3PBQ A;  2BAS A;  2ZQ7 A;  3T50 A;  4B93 A;  4GKU A;  4CLC D;  5HWT A;  5GLC A;  4FH2 A;  5DTK A;  1NYM A;  3PBO A;  1DY6 A;  1K25 A;  4OVD A;  2GX5 A;  3IH9 A;  5L10 A;  3NC8 A;  4GN2 A;  1L0G A;  2Y2J A;  3DTI A;  3HLD A;  4LRY C;  1LI9 A;  3FPV A;  3C2W A;  3MSH A;  3EOI A;  3DTE A;  1OTB A;  3BW6 A;  5DKL A;  3IS2 A;  1KGE A;  3ZG5 A;  4WYY A;  3WWX A;  5F68 A;  3MXS A;  4S2O A;  5FL3 A;  3IS2 B;  3C38 A;  1RGY A;  1T18 A;  4PKY A;  3A0R A;  5HD3 A;  2XSS A;  2WKP A;  1XX2 A;  2L4R A;  1I5Q A;  4HJ4 A;  1H3Q A;  3GR2 A;  2O9B A;  4BWI A;  3Q7Z A;  4R38 A;  1YAX A;  2A2L A;  2ZQ8 A;  3HUM A;  3KYE A;  1E4D A;  2D02 A;  2DCF A;  5EE8 A;  1L3L A;  2BG1 A;  1QMF A;  4CLC A;  1XJ4 A;  1NZO A;  3IF6 A;  1H0M A;  5IT5 A;  1NRF A;  4CLC B;  1EI5 A;  3OOV A;  5FEG A;  5HSQ A;  3JPU A;  3JVV A;  3T4T A;  3FYZ A;  1BUL A;  5GHX A;  2XA7 S;  1T19 A;  5BOH A;  3FG8 A;  3FPW A;  3VMA A;  3N7W A;  3IXD A;  3C4P A;  3W2Z A;  4DE0 A;  1CK3 A;  1K57 A;  3PAE A;  4NK3 A;  4MEZ A;  5EPH A;  3GRJ A;  4F94 A;  1W79 A;  2OAP 1;  3RFB A;  2E8I A;  3NJA A;  3VSK A;  4C6Y A;  2WAD A;  4YWZ A;  1D1J A;  4ETZ A;  2W1T A;  1S6R A;  2GZA A;  1XJ2 A;  3BM6 A;  4DMZ A;  5HAR A;  2QJ7 A;  2W1T B;  2H28 A;  4GS9 A;  4WZ5 C;  4OOM A;  2K7S A;  4FD8 A;  1ERQ A;  4KZ7 A;  1H5X A;  4GS9 B;  3I7J A;  2V1B A;  1N9N A;  2WGW A;  1TD5 A;  4DF6 A;  3EQV A;  4IVK A;  4N9L A;  3TG9 A;  3UO9 A;  3ISG A;  3UN7 A;  2WGW B;  1NWZ A;  2JHE A;  1K6R A;  2P7J A;  1KE3 A;  3T4K A;  3L9K A;  4R3A A;  5EM0 A;  3Q82 A;  3UDX A;  3F1O B;  2OLU A;  2QYB A;  3CWF A;  3KSF A;  3OPR A;  4RYE A;  4I38 A;  1BUE A;  3GTC A;  1YLJ A;  5I94 A;  3U4L P;  5FAS A;  5DF7 A;  1S4R A;  3C7U A;  4Y17 A;  3UPO A;  3IQA A;  2DMW A;  1XJ6 A;  4UAA A;  1FSY A;  4H6J A;  4R0Q A;  2J80 A;  3WS0 A;  1STZ A;  4Y0O A;  4FTX A;  4H6J B;  3FKV A;  5E2F A;  1JTD A;  3UPP A;  4ZRR A;  3VSL A;  2WYX A;  5HL6 A;  5U47 A;  1KGF A;  2ZMF A;  4GNU A;  3MMH A;  2VK3 A;  3RXX A;  1TVF A;  3HVF A;  2Z6D A;  3KX0 X;  2VV7 A;  2ZMV A;  1G6A A;  4UA6 A;  3ULF A;  1JVJ A;  5L09 A;  3MZD A;  1T1A A;  3VP3 A;  1PNE A;  1VET A;  1YT4 A;  1ESU A;  2PBY A;  4H8R A;  2EWV A;  1Q2P A;  3BEB A;  1VET B;  2J3W A;  2QJ5 A;  1XJ3 A;  1MWR A;  2XEP A;  3TE8 A;  1UWN X;  3G6O A;  1DP9 A;  1PW1 A;  2HP9 A;  1HVB A;  2P04 A;  3R7W A;  5EFW A;  2PD7 A;  2VJW A;  2HDR A;  3R7W B;  3QHY A;  3MZF A;  1KVM A;  2ZMA A;  3K3D A;  4GLQ A;  4GJ4 A;  2XGN A;  1KDW A;  2XQZ A;  2JKT M;  3HJI A;  4MN6 A;  5TBM A;  4MBF A;  5TBM B;  5GLA A;  2ZM8 A;  3WS1 A;  3F1P A;  1PIO A;  3T1S A;  3NCK A;  2XA7 M;  3F1P B;  4CLC C;  5F82 A;  3S7P A;  4X1L A;  3IF6 C;  5FQM A;  4LEN A;  1LSX A;  2PDR A;  2HDU A;  4S2P A;  4OQH A;  1NLZ A;  3QNB A;  5DTS A;  2W1R A;  4MNR A;  4GHI A;  4KQD A;  4MLL A;  5DVA A;  3MXQ A;  4GHI B;  4JXS A;  3QP4 A;  2HDS A;  3CIT A;  2Y2N A;  3Q1F A;  3WRT A;  4OLG A;  1K57 C;  1S66 L;  4CLC E;  4ZJ2 A;  1VQQ A;  2ZC5 B;  3HUN A;  3EEH A;  3S7N A;  2C6W B;  1VB6 A;  4YFM A;  1OJ5 A;  3SW1 A;  4WBG A;  1DP8 A;  3PBT A;  4JF5 A;  3N4I A;  2WGI A;  2Y2O A;  3ZG7 B;  2WKR A;  5HPF A;  4Q0J A;  3NUL A;  1T1C A;  3TSG A;  5HFO A;  2LB9 A;  5EVI D;  1ES2 A;  5FQJ A;  5CGW A;  4WEK A;  4KG6 A;  3NI9 A;  3M2K A;  3D4F A;  1PI5 A;  2HDQ A;  1WE4 A;  1XKZ A;  1CEG A;  2ZL1 A;  3LO7 A;  2ZM0 A;  3O86 A;  1VHM A;  4CQH A;  1ERM A;  3G4P A;  3WS4 A;  2ZL1 B;  2PR6 A;  4HES A;  5TR7 A;  4L9E A;  3HLF A;  3UE6 A;  5DF9 A;  3IXB A;  4PM9 A;  3P09 A;  4GOG A;  4BBV A;  1YSQ A;  2QHK A;  4ETX A;  4HH3 A;  5A93 A;  3G30 A;  3ICY A;  4M3K A;  5HD5 A;  4C3Q A;  2BTF P;  4Q0I A;  3ITB A;  2W3G A;  4JXV A;  2A24 A;  4Y0U A;  1K6S A;  3T4Q A;  3G2Y A;  1SDE A;  2JBF A;  4MDZ A;  2A24 B;  4QY6 A;  5EVI A;  1ZG4 A;  3LR0 A;  3CG5 A;  1AWI A;  3NBL A;  4BJP A;  4FCF A;  5EVL A;  4JBF A;  4E3K A;  3DAV A;  5EVI B;  3BY8 A;  5FA7 A;  1C3B A;  1Y28 A;  3W4P A;  1MXO A;  3IXH A;  1YSP A;  2VV8 A;  3CJM A;  4R3J A;  3P7N A;  1ES4 A;  1YPR A;  4BMW A;  3T4O A;  4NET A;  4DXB A;  4ZAM A;  1NRJ A;  2KOI A;  4EER A;  5TGF A;  5HAP A;  2B02 A;  5FAT A;  5F6A A;  4IED A;  2FFF B;  4OPY A;  3CHW P;  4GD8 A;  2V2F F;  4OH0 A;  3M2J A;  4WEJ A;  4QU3 A;  1DJC A;  1OT6 A;  5GHZ A;  4I3J A;  4N1H A;  4EEP A;  2HJ9 C;  1WYB A;  2V8C A;  3IXG A;  2UWX A;  4I3A A;  1N9O A;  5FQK A;  4E6X A;  1MBL A;  4B9O A;  3MQQ A;  3PBR A;  2FFY A;  4NXG A;  3LIC A;  3UME A;  3UB7 A;  3S1Y A;  3NY4 A;  3O3V A;  4JLF A;  3EEA A;  1LL8 A;  3IHA A;  3GDI A;  3IBJ A;  2Y4A A;  1YQS A;  3NIA A;  4E3L A;  3D72 A;  2VV6 A;  4PKY G;  3OZH A;  4HBU A;  3DBA A;  1LL5 A;  1FR6 A;  1LHY A;  2XRO A;  3VP1 A;  3E4P A;  2RL3 A;  1XXM A;  3BWL A;  1NYY A;  3H7W A;  3SH8 A;  3UMD A;  3LUQ A;  3MBZ A;  5FQI A;  2Y2M A;  4RVA A;  3G34 A;  3H7W B;  1XFQ A;  4K91 A;  5DJU A;  4GCZ A;  4MN5 A;  4OKP A;  4WEL A;  2FZ0 A;  2D01 A;  4Y15 A;  2JKR I;  1GSW A;  3CUE A;  4IBX A;  3UY6 A;  2XFT A;  4OQ0 A;  5M18 A;  5FEF A;  2EX2 A;  2PU4 A;  1J3W A;  3HUO A;  1ZC2 A;  4JF4 A;  4QHC A;  4EBP A;  1OTD A;  5EM1 A;  2Y2L A;  5FQQ A;  4UHU A;  4XXR A;  1ZHH B;  4OP8 A;  3HLE A;  2WKE A;  4QWO A;  3CI6 A;  3EWK A;  1PYY A;  1PW8 A;  2KLI A;  3FC7 A;  4DJ3 A;  4BLM A;  1VEU A;  2NUT C;  3QP1 A;  5IHV A;  1XGJ A;  3W8K A;  1G6O A;  1VEU B;  1F5M A;  2P08 A;  1BLH A;  3OLO A;  1L0E A;  5AQB A;  4ME4 A;  5CX7 A;  4Y3I A;  4PMA A;  2V20 A;  2MJ6 A;  5EV0 A;  2Y2G A;  1NXY A;  2WK0 A;  4HBT A;  3IWQ A;  1VM1 A;  3HL9 A;  1ZKJ A;  3RJU A;  3KYZ A;  3B47 A;  3FV7 A;  3LI8 A;  4EUV A;  1E3U D;  2JCH A;  2VEA A;  4YOF A;  1K4E A;  2GJ3 A;  4I39 A;  3LID A;  1GSV A;  1ODV A;  4HIA A;  4EW7 A;  5M19 A;  4U3T A;  3E2K A;  1P97 A;  1LSV A;  5EOE A;  2VGL M;  1OTA A;  3IX8 A;  5TFQ A;  3LEQ A;  1TS8 A;  3ZG8 B;  4X53 A;  5HW3 A;  1ONH A;  3AGF A;  4HJ3 A;  4JGQ A;  4EET B;  2K31 A;  5EVE A;  2Y91 A;  3A3F A;  3G35 A;  3PBS A;  3NDG A;  4E3I A;  3EQU A;  3VOY A;  4O7D A;  3LY4 A;  2AVX A;  1HZO A;  1FCM A;  3TW8 A;  3UDF A;  1IKI A;  2R9W A;  5HDC A;  4KQR A;  4NG2 A;  5E2E A;  3IWI A;  5GLB A;  4KUK A;  5G18 A;  1E3U A;  4QD4 A;  5EVI C;  1ES3 A;  1LI0 A;  3ZVW A;  1IYO A;  1OT9 A;  3F1O A;  4DJ2 A;  4HNB A;  4D60 A;  1DRM A;  2E8J A;  3S7O A;  2B18 A;  3D9Y A;  4PM5 A;  1XPB A;  5CRF A;  3MJQ A;  2Z2L B;  3KSI A;  3E4O A;  2EX6 A;  1G28 A;  3LR5 A;  4JF6 A;  1PWD A;  1WYC A;  4R23 A;  3V67 A;  1K4F A;  3LI9 A;  3UPN A;  2A49 A;  1CJF A;  4BQM A;  1TEM A;  3HJK A;  1SHV A;  3T1Q B;  1J9M A;  3ZG9 B;  1IEL A;  2WZZ A;  3T4L A;  2JE5 A;  2ZC7 A;  1IYP A;  4K0X A;  1RP5 A;  4E3J A;  3CAX A;  3ZG0 A;  5FAO A;  2INW A;  3RXW A;  3V3R A;  2P9V A;  4EUZ A;  4EEU A;  4LGW A;  3MKE A;  3PTE A;  4YIN A;  3VE4 A;  2P9V B;  1BZA A;  1BT5 A;  2Y2K A;  4LCM A;  4LCL A;  4IJG A;  1FQG A;  4IHQ A;  1L0F A;  5FAQ A;  1ACF A;  4XT2 A;  2OWJ A;  4DE1 A;  2Q9N A;  4ID4 A;  3KSG A;  3SH7 A;  4Y7P A;  2L1M A;  3MXR A;  3QP6 A;  4JXG A;  4XT2 B;  5HX9 A;  2J9P A;  3OPH A;  2G7U A;  1CF0 A;  3JVU A;  2OSU A;  4G3K A;  2J3T C;  3HLC A;  2PYR A;  4MN7 A;  4HJ6 A;  3ITA A;  2QZ6 A;  3KYQ A;  1M40 A;  4RA7 A;  1BLP A;  3GSG A;  4UA9 A;  1E25 A;  4JGP A;  3VOL A;  3PR6 A;  3QP8 A;  4DE2 A;  1TDL A;  1V9Y A;  2HP6 A;  1GHP A;  4O0P A;  4MBH A;  1HLU P;  2X01 A;  4CPK A;  3SS3 A;  1L2S A;  3MF0 A;  5HAQ A;  1DJB A;  2LB5 A;  4NXE A;  1HD8 A;  4B4X A;  5L2F A;  2Z6C A;  3BJN A;  2WKI A;  2EFU A;  2PYP A;  5C5K A;  3CUE C;  2VGJ A;  4JXW A;  3P98 A;  4E6W A;  1BYW A;  2W3H A;  3NDE A;  1MY8 A;  5L07 A;  4P6Z M;  3MQ0 A;  2W3E A;  3A3E A;  1IYS A;  1IFQ A;  3LIE A;  3WS5 A;  4FSF A;  2XR0 A;  1BLC A;  4K08 A;  4ZTK A;  4GW9 A;  3MFX A;  2ZQD A;  3UE3 A;  1PRQ A;  1NLY A;  1YMX A;  1W8Y A;  4JPM A;  1XFN A;  5A8B A;  4LRX C;  5DJT A;  4R4S A;  4X55 A;  5D3O A;  1MPL A;  4LLO B;  4EV4 A;  2JKT I;  1LLB A;  2HPB A;  4WL9 A;  1N9L A;  4OON A;  5F83 A;  5DKK A;  2Y2Q A;  2X02 A;  1MWS A;  5CHJ A;  2RCX A;  5DFX A;  2P74 A;  4EU0 A;  5CED A;  4BEN A;  1K56 A;  1I2W A;  3P01 A;  2Y8H A;  4Z9Q A;  1YLT A;  3W4O A;  1YLZ A;  1H8Y A;  4Q0H A;  4QY5 A;  1KVL A;  4KZ9 A;  4S2I A;  4X25 A;  1LL9 A;  2V0U A;  3UNW A;  4OOL A;  2PT7 A;  5FDH A;  2EXA A;  4LPZ A;  3TRC A;  4PM7 A;  1YMS A;  3PAG A;  2XF3 A;  2XDM A;  3LIF A;  4HHD A;  4GZB A;  1BTL A;  2C5W B;  3FKW A;  1RGZ A;  2V1A A;  1TDG A;  1FSW A;  1CI8 A;  4S2M A;  1H8M A;  4WN5 A;  3LIA A;  1XP4 A;  1YM1 A;  3BYD A;  4X6T A;  2HF6 A;  5G4Z A;  3UB5 P;  2W3D A;  3UDI A;  2ZC4 B;  4PM6 A;  4M4X A;  1G68 A;  1OME A;  4DN0 A;  4A5R A;  2ZOI A;  1W63 M;  3ZCZ A;  2VGL S;  5DTT A;  4BL3 A;  1A0K A;  4IBR A;  2KX6 A;  1AXB A;  5I5L A;  3ZVT A;  4RQ9 A;  1GA9 A;  4JKT A;  1N4O A;  4HOI A;  3TOI A;  2OV5 A;  3LYX A;  4UQI M;  3C4O A;  5FI6 A;  3V5M A;  4OP5 A;  1D06 A;  4GDN A;  1FIL A;  3G31 A;  4S2N A;  4HI4 A;  1H8Z A;  5MC7 A;  5CTM A;  2J3T D;  3TJZ C;  5AVE A;  4AFI A;  1OJG A;  4WUJ A;  3R4K A;  5CXW A;  1F2K A;  1S0W A;  3F1N B;  4L9F A;  2ZQ9 A;  3ZGA B;  5L8M A;  5G4Y A;  2G2U A;  3GQZ A;  2A3U A;  4DXC A;  3NEC A;  4F3L A;  2M1C A;  1MC0 A;  2M7U A;  1IOU A;  1S67 L;  5EEC A;  2H10 A;  1SKO A;  4E3O A;  2ZD8 A;  3C8C A;  4F3L B;  2PU2 A;  3BFG A;  4EXO A;  4BBU A;  1SKO B;  4EQI A;  5HL1 A;  3BFD A;  5E43 A;  2PRF A;  4EES A;  2VLG A;  2Q0O A;  2IWB A;  3O88 A;  4R3B A;  1FCO A;  2WGV A;  5CTN A;  2X71 A;  5AQA A;  1S1Z A;  1W5D A;  2B95 A;  4WLA A;  2FH5 A;  1CEF A;  1M6K A;  4OPQ A;  3AGD A;  4P6B A;  2IWC A;  2OLV A;  3PHY A;  5J3W A;  3CPT B;  3VFH A;  3D3O A;  1KGG A;  3VFF A;  2EXB A;  1GA0 A;  3NHQ A;  1ONG A;  1GSX A;  1T1B A;  3BQA A;  2Y2I A;  3MKF A;  3VE3 A;  5FQ9 A;  1K55 A;  2PBD P;  3DTK A;  5CER A;  5HDD A;  3VOZ A;  4FOF A;  4MCW A;  5F1F A;  1KE0 A;  4CJN A;  5GL9 A;  1P9R A;  5F5Y A;  4N92 A;  1S1Y A;  3SS5 A;  2H0Y A;  3VP2 A;  1IKG A;  4HY8 A;  4LV1 A;  1X0O A;  2EA9 A;  4MBK A;  3M6B A;  2J9O A;  4L0L A;  4UEY A;  2HGV A;  3WRZ A;  3AGE A;  3ZFZ A;  1L0D A;  1N9B A;  2NUP C;  1HTZ A;  4KZ4 A;  3IWO A;  5M1A A;  1BLS A;  3BRM A;  1KDS A;  4NXB A;  5CGX A;  3A3I A;  1GHI A;  1SDN A;  4S2K A;  5KMW A;  4P6Z S;  4KZ6 A;  1K0K A;  5GLD A;  1GHM A;  1IEM A;  2XD1 A;  3K3C A;  4LV3 A;  2IWD A;  1SCW A;  1UWP X;  3S22 A;  4X56 A;  1PZP A;  3NOT C;  5KSH A;  1JWZ A;  4DDS A;  2YKF A;  1YKD A;  2ZLY A;  3B42 A;  3C7V A;  2ZOH A;  3FZC A;  3HRE A;  4UA7 A;  1SZV A;  1ZG6 A;  5F69 A;  2HJE A;  3B33 A;  4WZ4 A;  1SKF A;  4DDY A;  2JC7 A;  3N8L A;  3HLB A;  3IF6 B;  5CEC A;  3MS6 A;  4XUX A;  3S4X A;  2PAV P;  1OTE A;  3T4J A;  2HP5 A;  5AJG A;  5TJJ A;  4EQ1 A;  3FWL A;  1MKI A;  4BD1 A;  3UB8 A;  1I2S A;  1NY0 A;  4P85 A;  3E4Q A;  4EWF A;  4II7 A;  5CGS A;  4OOY A;  3Q07 A;  1YLY A;  2BLS A;  4KEN B;  1PI4 A;  4D2O A;  4E04 A;  4DKI A;  3RTY A;  4OPZ A;  5HZH A;  1P0Z A;  2ZC3 B;  1P9W A;  2B5R A;  1OPX A;  4FH4 A;  4LFU A;  5AVF A;  1BSG A;  3HBR A;  3ZHH A;  1Z6F A;  4KQO A;  3N8S A;  2EWW A;  2JKG A;  2WZX A;  4KZ3 A;  4KQQ A;  3LR3 A;  1ESI A;  3A0V A;  4QB8 A;  4S2L A;  3O87 A;  3E0Y A;  1XA1 A;  5A90 A;  1PWC A;  3V50 A;  3LR4 A;  1NJ4 A;  1IYQ A;  2V8F A;  2OOL A;  5J8X A;  4S2N C;  4KG5 A;  1YLW A;  2KDK A;  2G2W A;  1EWZ A;  3T1X A;  4B4Z A;  2V9A A;  3RH8 B;  1FR1 A;  1K54 A;  4OLD A;  3BFE A;  1Z09 A;  4QJG A;  4HQA A;  2XK1 A;  4Y2F A;  3UE1 A;  4KG2 A;  2Q9M A;  1NZU A;  2Y2H A;  1ZTU A;  4Y0T A;  3S7Q A;  3BLS A;  1MWU A;  4GDB A;  4HP4 A;  1DJA A;  4X1M A;  3M6H A;  1U60 A;  2JKF A;  3OBF A;  1MWT A;  4LV2 A;  3EGX C;  3N8R A;  4OPR A;  2W27 A;  1KOU A;  1K38 A;  1RCJ A;  3LGO A;  1TS0 A;  5AQ9 A;  1F9I A;  2O9A A;  3HLG A;  4IUK A;  4BL2 A;  4P0M A;  1QME A;  4UQI S;  5KIZ A;  5DF8 A;  5EUA A;  5IS1 A;  3QNC A;  4NEE D;  2DRW A;  3C30 A;  3IX3 A;  1YLP A;  4GB7 A;  3E98 A;  4ZJ1 A;  2EFX A;  2ACG A;  2V1Z A;  3QP5 A;  3T4S A;  5JYP A;  1JWV A;  1ES5 A;  1LT0 A;  4ESP A;  3UE0 A;  4DRT A;  3PBN A;  1PFL A;  1JNU A;  4OQG A;  3IX4 A;  2J8Y A;  3G2Z A;  5A91 A;  4Y5F A;  3UB9 A;  3BLM A;  3LIB A;  5JYO A;  3VV4 A;  4E3N A;  3H82 A;  4N9K A;  3B3X A;  4LRZ E;  3SH9 A;  3K2N A;  3H82 B;  5GHY A;  3Q81 A;  1O7E A;  3OCL A;  4JGR A;  1CQA A;  3W4Q A;  2H0T A;  1Q2Q A;  2QWS A;  1K55 C;  2Y2P A;  3A3J A;  3MQO A;  4IVI A;  4PM8 A;  2ZM2 A;  4U0T A;  3LY3 A;  2HZ5 A;  3OPL A;  2H5S A;  1PZO A;  4C75 A;  1K56 D;  2VZW A;  3A0S A;  1KE4 A;  3T12 B;  5FDS A;  1W63 Q;  4O01 A;  1G5U A;  4PPR A;  5FSR A;  2ZQA A;  2XLN A;  1WA9 A;  3JYI A;  4YNR A;  4MMN A;  4K0W A;  2I72 A;  3MFD A;  3EGD C;  5FAP A;  1DP6 A;  5KZH A;  2QPN A;  3IH8 A;  3IBR A;  5FI2 A;  5IU1 A;  5LBR A; 
#chains in the Genus database with same CATH homology
 3KSH A;  1OTD A;  2VX8 A;  1D06 A;  3CLO A;  1ZHH B;  2PR5 A;  3NOU C;  4HI4 A;  5MC7 A;  3F1O B;  1TS6 A;  2QYB A;  3CI6 A;  3CWF A;  3KSF A;  2J3T D;  3TJZ C;  5AVE A;  3EWK A;  4AFI A;  1OJG A;  4WUJ A;  4I38 A;  2KLI A;  3PXP A;  3R4K A;  3FC7 A;  4WF0 A;  4DJ3 A;  3F1N B;  4L9F A;  5L8M A;  5G4Y A;  5DFY A;  1S4R A;  2NUT C;  4JGO A;  1G6O A;  2VA0 A;  1F5M A;  2P08 A;  2DMW A;  1XJ6 A;  2OWH A;  4F3L A;  1OTI A;  2M1C A;  3OLO A;  1MC0 A;  2O9C A;  2M7U A;  1IOU A;  1S67 L;  4ME4 A;  5CX7 A;  4H6J A;  2J80 A;  4Y3I A;  3C8C A;  4F3L B;  2R78 A;  3LFV A;  4EXO A;  2XRN A;  1STZ A;  4BBU A;  2MJ6 A;  4H6J B;  4EES A;  3GEC A;  3PYP A;  3KYZ A;  3B47 A;  4L9G A;  4ZRR A;  3LI8 A;  4ARZ A;  2VLG A;  4EUV A;  1MKM A;  5HL6 A;  2ZMF A;  2VEA A;  2W3F A;  3MMH A;  4YOF A;  2GNX A;  2GJ3 A;  4I39 A;  3LID A;  4PHT A;  1GSV A;  1ODV A;  4KUO A;  4NXF A;  3U2A A;  2Z6D A;  3KX0 X;  4ARZ B;  3BY9 A;  4HIA A;  4EW7 A;  2VV7 A;  2ZMV A;  1P97 A;  3ULF A;  3OCN A;  1S1Z A;  1LSV A;  2VGL M;  1OTA A;  4WLA A;  1T1A A;  2FH5 A;  2HV1 A;  1LSW A;  4R6L A;  1TS8 A;  4HH2 A;  3PHY A;  4PAU A;  5J3W A;  2PHY A;  3D3O A;  2EWV A;  2O99 A;  4HJ3 A;  2I9V A;  2J3W A;  4JGQ A;  4EET B;  2K31 A;  4NKP A;  2O0Y A;  2QJ5 A;  4I5S A;  4HP9 A;  1XJ3 A;  2VKS A;  3PBS A;  3TE8 A;  1UWN X;  2QKP A;  3EQU A;  3NHQ A;  1GSX A;  3G6O A;  1DP9 A;  1T1B A;  3BQA A;  3TW8 A;  3VE3 A;  3H9W A;  2P04 A;  3R7W A;  1UGU A;  5EFW A;  2PD7 A;  5HDC A;  5HDD A;  2M7V A;  2VJW A;  4FOF A;  4MCW A;  3R7W B;  4KUK A;  3BQ8 A;  3MR0 A;  1P9R A;  3K3D A;  4GLQ A;  5F5Y A;  4G3W A;  1S1Y A;  3ZQ5 A;  4GJ4 A;  4O8G A;  1OT9 A;  3F1O A;  2W0N A;  4DJ2 A;  2JKT M;  4HNB A;  3HJI A;  4MN6 A;  1DRM A;  2WKQ A;  4HY8 A;  5HDS A;  5TBM A;  3S7O A;  1X0O A;  4IUH A;  2B18 A;  2EA9 A;  3MJQ A;  3KSI A;  1TF1 A;  3E4O A;  3F1N A;  4L0L A;  4UEY A;  2HGV A;  3UB6 A;  5TBM B;  4Z1W A;  1G28 A;  1V9Z A;  2NUP C;  3LR5 A;  1D7E A;  2CMN A;  3F1P A;  5J7E A;  3NOP C;  2YKH A;  3V67 A;  3LI9 A;  4NXB A;  2XA7 M;  3KO6 A;  3F1P B;  3HJK A;  4CLC C;  4P6Z S;  3S7P A;  2PD8 A;  3T4L A;  3CAX A;  5K5B A;  1LSX A;  2INW A;  2PDR A;  2ZBB A;  3K3C A;  2IA2 A;  4EEU A;  4G3V A;  5HWV A;  1NLZ A;  3HCY A;  1UWP X;  2W1R A;  3NOT C;  4GHI A;  5KSH A;  2OAQ 1;  4KQD A;  2YKF A;  3VE4 A;  1YKD A;  3B42 A;  2ZOH A;  5HWW A;  1S4S A;  4QPR A;  3MXQ A;  4GHI B;  4IJG A;  4IHQ A;  4XT2 A;  5F69 A;  3CIT A;  2OWJ A;  2HJE A;  4CLC E;  1S66 L;  3KSG A;  3B33 A;  2L1M A;  3EEH A;  3S7N A;  1VB6 A;  3ZYT A;  1OJ5 A;  4XT2 B;  2G7U A;  3JVU A;  3SW1 A;  5HPI A;  4R70 A;  5J4E A;  4G3K A;  2J3T C;  1DP8 A;  2PYR A;  4MN7 A;  3PBT A;  1OTE A;  4HJ6 A;  3T4J A;  2L0W A;  2V0W A;  5AJG A;  3KYQ A;  5TJJ A;  4EQ1 A;  2WKR A;  4I3I A;  2JN7 A;  1MZU A;  3UB8 A;  1F98 A;  5HPF A;  4Q0J A;  2K2N A;  3E4Q A;  1T1C A;  1TS7 A;  4II7 A;  4JGP A;  3VOL A;  3PR6 A;  3OC2 A;  1V9Y A;  2Y79 A;  2LB9 A;  4BBT A;  4O0P A;  4WEK A;  4E04 A;  3RTY A;  5HZH A;  1P0Z A;  3O5Y A;  3MF0 A;  1VHM A;  1P9W A;  4CQH A;  1OPX A;  5AVF A;  2JKR M;  2LB5 A;  4KQO A;  4NXE A;  2EWW A;  2Z6C A;  3BJN A;  1EW0 A;  3PBQ A;  3LR3 A;  2PR6 A;  2BAS A;  3A0V A;  2PYP A;  5C5K A;  3CUE C;  4L9E A;  3E0Y A;  3T50 A;  4B93 A;  1BYW A;  2W3H A;  3LR4 A;  4CLC D;  3UE6 A;  5HWT A;  5DF9 A;  2OOL A;  4BBV A;  4P6Z M;  1YSQ A;  3MQ0 A;  2W3E A;  3PBO A;  2QHK A;  4ETX A;  2GX5 A;  2KDK A;  4HH3 A;  1IFQ A;  3ICY A;  5HD5 A;  4Q0I A;  3LIE A;  4FSF A;  2W3G A;  4K08 A;  4LRY C;  2A24 A;  3FPV A;  2V9A A;  4GW9 A;  3RH8 B;  3MFX A;  3UE3 A;  3C2W A;  3EOI A;  3T4Q A;  1OTB A;  4HQA A;  4Y2F A;  1NLY A;  3BW6 A;  5DKL A;  3IS2 A;  4MDZ A;  2A24 B;  3LR0 A;  1ZTU A;  3S7Q A;  4BJP A;  5F68 A;  1XFN A;  5FL3 A;  5A8B A;  4LRX C;  3IS2 B;  4HP4 A;  3C38 A;  5DJT A;  1T18 A;  3BY8 A;  3OBF A;  4PKY A;  1Y28 A;  4LLO B;  2JKT I;  2W27 A;  3EGX C;  1KOU A;  1YSP A;  2VV8 A;  3A0R A;  4WL9 A;  5HD3 A;  3P7N A;  1N9L A;  2XSS A;  2WKP A;  1TS0 A;  2L4R A;  5DKK A;  4BMW A;  1F9I A;  3T4O A;  2O9A A;  4HJ4 A;  1H3Q A;  4IUK A;  2O9B A;  4BWI A;  4UQI S;  1NRJ A;  5KIZ A;  4R38 A;  1YAX A;  5DFX A;  2KOI A;  2A2L A;  4EER A;  2B02 A;  4EU0 A;  5IS1 A;  5F6A A;  2D02 A;  4CLC A;  4NEE D;  1XJ4 A;  3P01 A;  3C30 A;  4WEJ A;  2Y8H A;  5IT5 A;  3E98 A;  3T4S A;  1OT6 A;  4CLC B;  1LT0 A;  4I3J A;  4EEP A;  2HJ9 C;  3PBN A;  4Q0H A;  3OOV A;  4I3A A;  5HSQ A;  1JNU A;  3JVV A;  1N9O A;  3T4T A;  2V0U A;  4B9O A;  3MQQ A;  3PBR A;  2XA7 S;  1T19 A;  4NXG A;  4Y5F A;  3UB9 A;  4OOL A;  2PT7 A;  3FG8 A;  3FPW A;  3LIB A;  3LIC A;  4LPZ A;  3TRC A;  3UME A;  3W2Z A;  3VV4 A;  3UB7 A;  3H82 A;  3LIF A;  4HHD A;  4LRZ E;  2V1A A;  3H82 B;  3K2N A;  3EEA A;  1LL8 A;  2OAP 1;  3GDI A;  3IBJ A;  3OCL A;  4JGR A;  3RFB A;  3NJA A;  1H8M A;  4WN5 A;  2QWS A;  4YWZ A;  3LIA A;  4ETZ A;  2W1T A;  2HF6 A;  5G4Z A;  2GZA A;  1XJ2 A;  3MQO A;  3D72 A;  4DMZ A;  2VV6 A;  2W3D A;  4PKY G;  2QJ7 A;  2W1T B;  3DBA A;  2H28 A;  4GS9 A;  4M4X A;  2XRO A;  4DN0 A;  3E4P A;  4OOM A;  2K7S A;  3BWL A;  2ZOI A;  1W63 M;  3H7W A;  3UMD A;  3LUQ A;  2VZW A;  3A0S A;  4GS9 B;  2VGL S;  1W63 Q;  4O01 A;  2V1B A;  3H7W B;  1N9N A;  1WA9 A;  1TD5 A;  4YNR A;  2KX6 A;  4MMN A;  3EQV A;  1XFQ A;  3EGD C;  5DJU A;  1DP6 A;  4GCZ A;  5I5L A;  4MN5 A;  4WEL A;  2FZ0 A;  4RQ9 A;  2D01 A;  3IBR A;  2JKR I;  5IU1 A;  1NWZ A;  1GSW A;  2JHE A;  3CUE A;  4HOI A;  2P7J A;  5LBR A;  3T4K A;  3LYX A;  4UQI M;  4R3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...