2L1MA

Solution structure of the eag domain of the herg (kv11.1) k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 2
publication title Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 32
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l1mA00
3G6OA 3UE6A 3UB7A 4HP9A 1MZUA 3CLOA 3C2WA 1N9LA 3F1NA 5HZHA 2QJ7A 5DJUA 4M4XA 1VB6A 4HQAA 3D72A 3VE4A 2WKRA 2Z6DA 2OWJA 5DKLA 1GSWA 3FC7A 4HNBA 3NHQA 2BASA 5AVFA 5HDCA 3A0RA 2ZBBA 1LSVA 1XFQA 3HJIA 3LIEA 3F1OB 4I3IA 1GSVA 2ZOHA 4DJ3A 2L0WA 4WLAA 1OT9A 1LT0A 4BBVA 2YKHA 4EW7A 4BBTA 4HI4A 4LRZE 1T18A 2HV1A 5F5YA 1S4RA 1T1AA 1OTBA 3NJAA 4LLOB 5DKKA 3K3CA 3PYPA 5I5LA 4HJ4A 2P7JA 2VV7A 4PKYG 1T19A 1KOUA 1N9OA 4HH2A 2KDKA 4HJ6A 1T1CA 5G4ZA 1XJ2A 1XJ4A 1T1BA 5TBMA 4I5SA 1LSWA 1OTIA 3NOPC 2J80A 2PHYA 1XJ3A 3NOTC 1F98A 4L9FA 4WUJA 1NWZA 4H6JA 4H6JB 3MXQA 1OTEA 4KQDA 2WKQA 4L9EA 3NOUC 5HWVA 1P97A 2V1BA 2PR5A 2I9VA 3H82A 4B9OA 4LRYC 2VLGA 3E4PA 4HOIA 1GSXA 1Y28A 3F1PA 4JGQA 3F1NB 3P7NA 4KUOA 3LIBA 2ZOIA 4KUKA 1TS7A 3BY8A 1V9ZA 4LRXC 3HJKA 2A24A 4K08A 5HWTA 1UWPX 3UB9A 1S4SA 1WA9A 2QHKA 3RH8B 4EEUA 5HDSA 5A8BA 3MR0A 4EESA 2R78A 5J3WA 1S1ZA 3H9WA 2V0UA 3LIAA 2W0NA 5HD3A 4MN5A 2V1AA 3SW1A 4EERA 2INWA 2VV8A 2QWSA 4F3LA 4I3AA 4HY8A 1OT6A 5KIZA 4JGRA 5HSQA 1G28A 2V0WA 3T50A 4E04A 3OLOA 1DP9A 5F69A 3A0VA 2OOLA 4NXBA 3PHYA 2CMNA 3LUQA 3A0SA 4EEPA 5F6AA 1OJ5A 4R3AA 5TBMB 2PYRA 4MN6A 1S1YA 3UB8A 2PR6A 2PDRA 2EA9A 3EEHA 2D01A 5HWWA 5IU1A 3UMDA 2QKPA 3KX0X 4DJ2A 3C8CA 3BWLA 1DRMA 3MQQA 4YWZA 3H82B 4JGPA 3VOLA 5F68A 3GDIA 2V9AA 4HHDA 2OWHA 4GCZA 2Z6CA 4LPZA 4JGOA 5HD5A 3IS2A 3IS2B 3RTYA 1UWNX 1UGUA 3F1PB 3ULFA 4WF0A 1XJ6A 5G4YA 1JNUA 1XFNA 5AVEA 5IS1A 2M1CA 3B33A 1N9NA 3LI9A 4EETB 2K7SA 5J4EA 4HP4A 4BBUA 4HIAA 3K3DA 2A24B 2GJ3A 2QJ5A 3LICA 1P0ZA 3IBRA 5HDDA 3CWFA 4PKYA 2JHEA 2W27A 5J7EA 3CAXA 1TS0A 2PD7A 4EQ1A 3UMEA 5DJTA 2KX6A 3LYXA 4GHIA 3ICYA 4GHIB 4R38A 1S67L 4L9GA 4RQ9A 1S66L 3E4QA 2JN7A 1TS6A 3LIFA 3VE3A 1ODVA 3LIDA 3MFXA 2L4RA 3F1OA 3GECA 4WN5A 4NXEA 1OJGA 4F3LB 4GW9A 1LSXA 3MJQA 3UB6A 1D7EA 2PD8A 2D02A 3H7WA 3H7WB 1V9YA 4I39A 4EXOA 2VEAA 2H28A 1DP6A 1OTAA 2L1MA 5EFWA 1BYWA 2B02A 1LL8A 4NXFA 4R70A 3E4OA 1DP8A 4GS9A 4GS9B 2PYPA 1F9IA 1D06A 2YKFA 3ZQ5A 1X0OA 4HH3A 1OTDA 2VV6A 1EW0A 3MQOA 3EWKA 4XT2B 2WKPA 4NXGA 4XT2A 4HJ3A 3LI8A 4I3JA 3FG8A 4I38A 4R6LA 3BY9A 4WL9A 1TS8A
chains in the Genus database with same CATH superfamily
2JKGA 3RXWA 4BD0A 4G3VA 3V50A 1XP4A 4JF6A 2OAP1 4DE3A 4CJNA 1YLTA 4HQAA 1W63Q 2J3WA 4OQIA 5CXWA 3S7OA 2ZQCA 1GCEA 3ZG0A 2Z6DA 3OC2A 4Q0HA 1I2WA 5DKLA 1CEGA 1O07A 1L0FA 1PWGA 4N1XA 4Y0TA 3IF5A 2BASA 2JC7A 4GJ4A 1N9BA 5AVFA 1CK3A 4U3TA 2ZBBA 4RVAA 1LSVA 1XFQA 2M7VA 5U47A 4I3IA 4S2OA 3W2ZA 1SKOB 1KDWA 3GVBA 3NY4A 2ZOHA 3EQVA 3SS5A 4DJ3A 4CLCD 2V20A 3GMWA 1BSGA 1EWZA 1IKGA 2EX9A 4UEYA 1KVMA 1T18A 1SDEA 5F5YA 2ZQ7A 1S4RA 3MBZA 1T1AA 2ZMAA 1OTBA 3MF0A 2KOIA 4MEZA 4FSFA 3IXGA 2VGLM 4LLOB 5DKKA 3K3CA 3PYPA 4UAAA 3SH7A 5E2HA 2EWVA 3ITBA 4YNRA 1TVFA 4PMAA 1KOUA 3D4FA 3IHBA 1N9OA 4HJ6A 4GD8A 5L09A 5G4ZA 2O0YA 3FPVA 4WM9A 3MQ0A 1XJ4A 1ES3A 4N9LA 5CEDA 3TG9A 4RX3A 5TBMA 1BZAA 2HP6A 3C30A 4EWFA 2R9XA 3V5MA 3C7UA 1PRQA 4PM8A 4L9FA 2EX6A 2PAVP 3C4OA 3BLSA 2XLNA 3O86A 2K31A 3T4OA 3HBRA 2QZ6A 2PR5A 5F1FA 3H82A 2VLGA 1Z09A 3E4PA 4P0MA 3Q07A 2JBFA 1GSXA 3N7WA 4S2NC 3HLBA 4JGQA 1JWPA 3UDIA 4OPRA 3F1NB 1MWUA 2WKIA 2J9PA 3Q7VB 5KSHA 2Y79A 5GHZA 2WZXA 1TS7A 3S4XA 3QHYA 2A24A 3LFVA 3A3FA 4JLFA 3P98A 2H0YA 1S4SA 2PBYA 5HL6A 4C6YA 1WA9A 3A3EA 2QHKA 3UDXA 1ONHA 5LBRA 2VGJA 4QD4A 1ESUA 3JYIA 3HLFA 1PW1A 3MR0A 1L0EA 2AVXA 1CJFA 2ZQAA 4DXBA 4ME4A 1MPLA 3M6HA 3FKVA 2G7UA 4DE0A 3A3DA 2V1AA 2BTFP 3WS1A 1XX2A 4E3IA 4S2PA 4EERA 2INWA 1TDGA 2XD1A 2Q9NA 3CPTA 4F3LA 2HGVA 2Q9MA 3IH9A 5KIZA 1ES2A 1MC0A 4Y2FA 3ISGA 1H5XA 2PBDP 3A0VA 3MXRA 1K25A 3UNWA 4NXBA 3T12B 1P9WA 1YT4A 4DRTA 4UA6A 1BLPA 1HLUP 3LUQA 2ZQDA 4EEPA 3BM6A 3PBOA 1S1YA 1VHMA 4BJPA 2PDRA 3MXSA 4IVIA 2D01A 5CHMA 1BLCA 5HWWA 4DN0A 1ERMA 2QKPA 3KX0X 5CTNA 1IYSA 2HDRA 1FCOA 3LR5A 3MQQA 3QNCA 4OOYA 3UE3A 3VOYA 2EXBA 3NDEA 3BFCA 2XFSA 5F68A 3D9YA 4HHDA 4LPZA 4XXRA 1I5QA 5HD5A 3RTYA 1UGUA 2W1TA 3ULFA 3EGDC 5FEGA 5CGSA 5G4YA 5AVEA 3HLGA 5EVIB 4IBXA 1HTZA 5J4EA 4HP4A 4HIAA 4YINA 3K3DA 2GJ3A 4JKTA 2GZAA 4KZ6A 3M2JA 5BOHA 2A49A 3ZNYA 2LB9A 4Z1WA 3CAXA 1ONGA 2HPBA 3G32A 4S2KA 3O87A 2RL3A 2PD7A 4EQ1A 3UMEA 3PXPA 1RCJA 4DDSA 4QJGA 4OPQA 5CGXA 4R38A 3BLMA 1S67L 4UQIS 5FAOA 1S66L 4KG5A 4OQGA 4O7DA 4EQIA 2ZL1B 3W4QA 4P6ZM 5FDHA 1HVBA 3QP6A 2OAQ1 2L4RA 3GECA 5FDSA 3B47A 1VETA 1D1JA 4FUWA 5CHJA 3CHWP 1LSXA 3UB6A 4E3OA 1D7EA 4JXSA 3LR0A 1H3QA 1F2KA 2JKTM 1K54C 1XGJA 1G68A 1WYCA 4EXOA 2ZM0A 1OTAA 5EUAA 3N8LA 4KZAA 5GHYA 1LL8A 4BENA 5G18A 3VP2A 1GA9A 4ZAMA 1IYQA 2VA0A 3E4OA 2GNXA 2ZD8A 3TOIA 3SZTA 1VEUB 2PYPA 1D06A 4P87A 2P9VB 3ZQ5A 1K4FA 1STZA 4CLCE 4OOLA 3IWIA 4R3BA 1BULA 2C5WB 1E25A 2VV6A 4PM6A 3Q1FA 3OPLA 3SS3A 4ARZA 3EWKA 4GZBA 4PPRA 1SZVA 5DTSA 4R6LA 3FV7A 2HDUA 1IEMA 1LLBA 4WYYA 1TS8A 2GDNA 4GB7A 1ZG4A 4KENB 2OLVA 3G6OA 4IHQA 3NCKA 3UE6A 2Y59A 2WZZA 4A5RA 4OPYA 3P01A 3Q7ZA 4B4ZA 1W7FA 3C2WA 3ZG8B 3TE8A 4CLCA 2IA2A 2QJ7A 5DJUA 1VB6A 2Y8HA 3D72A 4Y13A 1P9RA 2EFXA 2Y2PA 1GSWA 3MKFA 5GLCA 3NHQA 4OP5A 5CECA 4ZJ1A 3A0RA 4O01A 5FI6A 2XF3A 5EM1A 3U4LP 2E8IA 1BT5A 1DJCA 2OSUA 2Y2OA 3ZFZA 4DE1A 2WAEA 3HUMA 3F1OB 3GSGA 4DF6A 2ZM8A 4IUHA 1IKIA 2L0WA 2Y2JA 4WLAA 3T4SA 3G4PA 4BBVA 3TJZC 4EW7A 3ZGAB 4HI4A 4LRZE 5A93A 5CERA 2QYBA 1J3WA 5HW3A 4KQRA 3EGXC 2HV1A 1I2SA 1W5DA 1MWSA 2Y91A 2O9CA 4GLQA 3DTIA 3C38A 3IQAA 1FOFA 1NZUA 3BFDA 3T4JA 1MXOA 5CEBA 3N4IA 4PKYG 5FASA 3KSIA 4RA7A 4HH2A 1YSPA 5A90A 4LENA 5EOOA 5KSCA 1T1BA 4G3WA 4EBLA 3VP4A 4FOFA 3UE1A 1LSWA 4Y0UA 2J80A 3P09A 2FZ0A 1LI0A 2W3FA 1F98A 3IF6A 4EV4A 4FH4A 5CTMA 1OTEA 4X56A 3UDFA 1RGYA 4KQDA 1IELA 5GLBA 2WKQA 3WS0A 3NOUC 1P97A 3LY3A 4E6XA 2I9VA 3BFGA 2B95A 1Q2QA 2ZC6B 1U60A 4K0XA 2R9WA 4MBKA 4OQHA 3UPNA 4FD8A 3G34A 3T1XA 4HOIA 5EE8A 5FQMA 3M6BA 2WYXA 4R4SA 4X25A 4M3KA 4EUZA 4X6TA 3W4PA 3P7NA 3S7QA 4KUOA 2HP5A 3MS6A 2ZOIA 4KZ8A 1BLSA 2Y2NA 4KUKA 3EEAA 5E43A 5HAIA 3BY8A 2M7UA 5DFXA 1GHMA 4LRXC 1ERQA 2HP9A 5DF7A 4GDNA 3G2ZA 3OBFA 3IBJA 2K2NA 3UB9A 4Y7PA 4IVKA 3JPUA 5EVIC 1K55A 5HDSA 1PZOA 5A8BA 3T4KA 3ZNTA 4OOMA 5HFOA 2V0UA 3VFHA 2W3GA 5K5BA 4MN5A 4Y0OA 5EVID 4WZ4A 1YQSA 2W3HA 5HAPA 2XFTA 4JGRA 2W3EA 5HSQA 1H8YA 1ESIA 3E0YA 1S0WA 2FFYA 1SDNA 5FQ9A 3MKEA 1MY8A 2ZC3B 2XEPA 3PHYA 3SOIA 2CMNA 4KZBA 2Y55A 2HF6A 3A0SA 5F6AA 2A2LA 5EPHA 4OQ0A 2PYRA 3IX4A 3NI9A 5TR7A 3PR6A 1KE4A 3UY6A 1OMEA 3BQAA 1KVLA 5M1AA 4LGWA 1OPXA 3LR4A 1PNEA 4DJ2A 3C8CA 4OKPA 4WZ5A 5FQJA 3G31A 3LGOA 4YWZA 2ACGA 4ZBEA 3VOLA 1FQGA 5CHUA 3NIAA 3GDIA 3R4KA 4ZRRA 5HARA 3DTMA 2OWHA 3BEBA 1H8ZA 2GX5A 4KZ3A 2X71A 2RCXA 1UWNX 2JKRI 4XUXA 3F1PB 2W1TB 2ZQ8A 1HD8A 4WF0A 1A0KA 1XJ6A 3I7JA 1FSYA 3GV9A 3LI9A 2J3TC 5F1GA 3CITA 2FH5A 2K7SA 4JPMA 1GHIA 1ZHHB 4JXWA 3AGDA 1YLZA 2PT7A 3UPOA 1MWRA 5HDDA 3G35A 1XGIA 4JF5A 4KZ4A 3R7WB 1EI5A 2NUTC 3Q81A 1CQAA 5J7EA 4MBHA 3VSLA 3VP0A 2XDMA 4HBTA 4LCLA 3LYXA 3K2NA 4GHIA 3OCNA 4L9GA 4RQ9A 2WGVA 4LV2A 3E4QA 3LIFA 3VE3A 1PWDA 4O0PA 2Y2KA 4NXEA 3HLEA 1NY0A 1SKOA 5FI2A 4U0XA 2P74A 5HL1A 5M18A 3MJQA 4IEDA 2D02A 3H7WA 1V9YA 1SKFA 3TW8A 4ZJ3A 3QNBA 1YLPA 3IH8A 1FR1A 4WBGA 4I39A 1YLWA 4IUKA 2OV5A 5DFYA 3WS2A 3C5AA 1K6RA 1JTGA 5EFWA 2J9OA 1BYWA 2DMWA 1Y4OA 3V39A 1KE3A 4NXFA 4R0QA 1DP8A 2PU4A 2FFFB 3Q82A 1EROA 1NYYA 3BFEA 2BLSA 3HCYA 3T4LA 5TFQA 3S7PA 1K57A 3IX8A 3OCLA 2O9BA 4AFIA 1PFLA 4GNUA 1TEMA 5DTTA 1X0OA 1OTDA 5EVEA 4ARZB 3GR2A 3MQOA 2WKEA 1ZC2A 4B4XA 4FCFA 1NXYA 4H8RA 4U0TA 1YKDA 4I38A 2W1RA 3KO6A 4DXCA 2VK3A 3T4TA 3VSKA 3C4PA 1Y54A 3GQZA 4QY5A 1L2SA 1LL5A 5TJJA 3UB7A 4P6ZS 1MZUA 1KGEA 1PWCA 4Q0IA 3CLOA 2EX8A 4ESPA 4CLCB 3F1NA 5HZHA 3DWZA 4M4XA 3Q7VA 3OPHA 1FR6A 3LR3A 3W4OA 2V1ZA 2OWJA 2HJEA 2P08A 3DW0A 3DTKA 3CUEA 1NLZA 4HNBA 2XQZA 4OONA 3CI6A 1PIOA 2WADA 4OH0A 1KDSA 4LV0A 3QP1A 2DNSA 3LIEA 5J8XA 2DCFA 3DTEA 2EFUA 3U2AA 1DY6A 5EV0A 4OP8A 4BLMA 5CGWA 3E2KA 2X01A 3OPPA 4BL3A 2Y2MA 3BECA 3PAGA 1OT9A 1LT0A 2WGWB 4XUZA 4BBTA 1TDLA 2IWCA 3HVFA 4JXGA 1XA7A 2XK1A 4C75A 4HJ4A 2VV7A 1PZPA 1M6KA 3PBRA 2KDKA 4UHUA 1T1CA 3CJMA 4QHCA 2XA7M 1K6SA 2ZLYA 5DTKA 1NRJA 3N8RA 4I5SA 1CI8A 4PM5A 1RP5A 5M19A 3IT9A 1GA0A 2PHYA 3UN7A 1XJ3A 3NOTC 4R1GA 2W3DA 5EVLA 1E3UD 1NWZA 4H6JA 3T4QA 3MXQA 5IT5A 3MMHA 3BYDA 3IWQA 3HL9A 4WEKA 2V1BA 3A3JA 1QMEA 4B9OA 1G6OA 2QMIA 2C6WB 1MKIA 3HREA 3RJUA 3S1YA 3ZDJA 2VX8A 3UPPA 2B5RA 1TD5A 1DJBA 4BQMA 5EVIA 4ID4A 5A91A 4OPZA 3N6IA 3B3XA 3NBLA 3LCEA 4OLDA 3HJKA 3VV4A 4K08A 5L2FA 2O9AA 5FI7A 2ZQ9A 2G2WA 5FQIA 2JE5A 3RH8B 3ZYTA 4EEUA 3KSHA 3IXBA 3OOVA 5EOEA 2XR0A 4EESA 4R23A 5FAPA 3H9WA 3B42A 3LIAA 3E98A 4DE2A 3LEZA 5MC7A 4HBUA 3SW1A 1CF0A 2EXAA 1YAXA 1H8MA 2H5SA 4R4RA 3BRMA 4QB8A 2VV8A 2QWSA 4FH2A 4HY8A 2EWWA 2V0WA 5F82A 5A92A 3T50A 3FKWA 3OLOA 1DP9A 1SCWA 1L0DA 1YM1A 4UA7A 1XA1A 2OOLA 5I94A 2OLUA 2V8CA 4Q8IA 4LV3A 1PW8A 1ZKJA 3PBQA 4R3AA 3QP2A 5TBMB 1IFQA 3NC8A 4MN6A 3VP3A 3TSGA 5FA7A 3UB8A 2PR6A 2EA9A 3EEHA 5FATA 3EOIA 5GLAA 2IWBA 4KG6A 1AXBA 3S7NA 1VEUA 3UMDA 4S2NA 2P9VA 1DRMA 3PBTA 2Q0OA 4ZDXA 1C3BA 1O7EA 3H82B 5FQQA 2ZC4B 2V9AA 3V3RA 2Z6CA 3L7HA 1PI5A 2EX2A 3HUOA 4KQQA 3IS2A 4HESA 3IXDA 4Y15A 4MDZA 1ALQA 1JNUA 1XFNA 2J8YA 2M1CA 2VGKA 3PBNA 3SH9A 5F83A 1N9NA 4OVDA 4BBUA 1ES4A 2A24B 1P0ZA 3MZEA 5TGFA 3IBRA 3ITAA 2VJWA 3CWFA 3IXHA 2H10A 1PYYA 3T1QB 2JHEA 2VGLS 2W27A 1FSWA 1TS0A 2ZMFA 4D60A 2A3UA 3AGFA 3KSGA 3JVUA 2LB5A 2ZJ9A 1F5MA 3O5YA 1K4EA 3SH8A 5DJTA 1K0KA 4CLCC 4GHIB 1L0GA 1YPRA 4YOFA 4KZ7A 4BD1A 1RGZA 2JN7A 5HAQA 3FPWA 3LIDA 1PI4A 3KYQA 3HUNA 3F1OA 3CPTB 1OJGA 3WRZA 4F3LB 4EU0A 4E3LA 2PD8A 1NJ4A 2JKTI 3H7WB 3WS5A 4GN2A 4QWOA 5D3OA 5EM0A 3WRTA 4E6WA 3UO9A 2VEAA 4MN7A 2O99A 4E3KA 3QP8A 2H28A 1DP6A 3ZG5A 3MZFA 3UE0A 1L3LA 2L1MA 1NRFA 2B02A 4E3NA 5L10A 2PU2A 4QY6A 3OPRA 2XSSA 4P6BA 1K56D 4DDYA 1IYOA 4NEED 2HZ5A 4GS9A 2UWXA 4F94A 4II7A 3BW6A 4GOGA 2YKFA 5E2GA 4QPRA 4B93A 4IBRA 5L07A 1Q2PA 1YMSA 4HH3A 1EW0A 2G2UA 1K38A 4XT2A 3SS4A 4NXGA 1YSQA 4HJ3A 4I3JA 2HJ9C 3FG8A 3LEQA 2Y2IA 5FL3A 1IOUA 2I72A 2XGNA 2Y2GA 3M2KA 4HEFA 1XXMA 1FCNA 4O8GA 1IYPA 4OLGA 3IF6C 3ZCZA 4KZ5A 5CX7A 4CQHA 4HP9A 3O88A 1CI9A 1N9LA 5JYOA 3ZVWA 4UA9A 4E3JA 2PRFA 5DF9A 3VMAA 4FTXA 3VE4A 4QU3A 2WKRA 1BTLA 4X69A 1W63M 2J3TD 1SHVA 3KSFA 3KYEA 3G30A 4Y17A 5L8MA 4X53A 3FC7A 2JCHA 1G6AA 2MJ6A 3RXXA 4G3KA 5HDCA 3IX3A 3MFDA 3W8KA 4PHTA 4WMCD 4X1MA 1JVJA 3HJIA 1M40A 5FSRA 3BQ8A 4YFMA 1K54A 1VETB 1GSVA 4Q0JA 1FCMA 3S22A 4DMZA 3GRJA 2WGIA 1K55C 2YKHA 1NLYA 5E2FA 1E3UA 4NK3A 3HLWA 4GD6A 4DKIA 4MLLA 3NJAA 3QP4A 2QPNA 5DVAA 5GL9A 5I5LA 2KLIA 2P7JA 2Y2HA 4B88A 1T19A 4ZTKA 3T1RA 1J9MA 1HZOA 2J7VA 1CEFA 1XJ2A 1W79A 2X02A 1YLJA 1OTIA 3NOPC 1NZOA 4L0LA 4S2MA 4WUJA 3D3OA 5AQBA 4H6JB 3VP1A 2WKHA 3E2LA 4L9EA 1E4DA 4LCMA 5HWVA 4CPKA 3VFFA 4X55A 3CG5A 1XPBA 5IHVA 4MMNA 2XROA 4LRYC 1S6RA 5FQKA 4BMWA 1Y28A 3NECA 3F1PA 4WZ5C 4PM7A 2XD5A 3OZHA 1MBLA 3LIBA 2Z2LB 1N4OA 2Y2LA 2JKFA 5EECA 1KE0A 3AGEA 2V2FF 1V9ZA 3V3SA 4PAUA 2P04A 4BWIA 5HWTA 1UWPX 3CZDA 3G2YA 3R7WA 4JBFA 1WE4A 1ZG6A 2H0TA 1KGFA 4P85A 2XH9A 5DF8A 4R3JA 3HLCA 1YLYA 2R78A 5J3WA 1S1ZA 5E2EA 4MBFA 2W0NA 2XA7S 5HD3A 4X68A 1GHPA 4X1LA 5FEFA 1Z6FA 2ZM2A 3FYZA 3V67A 4EBPA 4I3AA 1ACFA 1OT6A 5JYPA 1W8QA 1G28A 2CC1A 4N92A 3ZHHA 4E04A 5F69A 3VOZA 3N8SA 3WS4A 4EBNA 5CRFA 1BUEA 5AQAA 3DAVA 3MZDA 4UQIM 1MKMA 4GKUA 1OJ5A 3QP5A 2VZWA 5AQ7A 1LHYA 3LY4A 4ZJ2A 1W8YA 3MSHA 3IF6B 5GHXA 2B18A 2WAFA 5IU1A 4C3QA 2ZC5B 3GTCA 3ZG9B 4Y3IA 1LI9A 3A3IA 3BJNA 3BWLA 4KZ9A 3ZVTA 4JGPA 1WYBA 5KMWA 4S2JA 2Z2MB 4E3MA 3C7VA 4GCZA 4JGOA 3IS2B 1K57C 1JTDA 3CMZA 4WELA 5FAQA 5C5KA 2E8JA 5IS1A 2NUPC 4JXVA 3UB5P 2DRWA 2JKRM 3B33A 1VM1A 4EETB 1VQQA 3PAEA 4NKPA 3DWKA 3IHAA 2HDSA 3ZG7B 1LL9A 3L9KA 1XKZA 2QJ5A 3LICA 5HPFA 2UV0E 4S2LA 4LFUA 4PKYA 1MWTA 2VKSA 4K91A 3PTEA 2WUQA 4N1HA 4N9KA 5AQ9A 2KX6A 1H0MA 3ICYA 4PM9A 4NETA 1G5UA 4D2OA 1TS6A 2ZL1A 4KG2A 4S2IA 4RYEA 1K56A 1ODVA 3MFXA 4WEJA 4K0WA 4WN5A 2ZC7A 4ETXA 4RX2A 4NG2A 1TF1A 4MCWA 3CUEC 3IWOA 1FILA 5KZHA 4GW9A 3O3VA 3EQUA 4EUVA 1ZTUA 3T1SA 4LV1A 3NULA 2V8FA 2WGWA 1YMXA 2WK0A 1JWVA 4BL2A 5HX9A 1JWZA 3LO7A 4JF4A 1AWIA 1ES5A 4GDBA 2IWDA 1DJAA 4Y5FA 3FZCA 4R70A 1KGGA 3RFBA 3HLDA 4GS9B 3PBSA 4KQOA 1F9IA 2XRNA 2Y2QA 2Y4AA 5HPIA 3NDGA 1QMFA 2ZMVA 3DBAA 4Z9QA 4ETZA 1FIKA 1BLHA 4XT2B 2WKPA 3BFFA 3JVVA 3LI8A 2HDQA 4IJGA 5AJGA 3BY9A 4WL9A 5GLDA 3KYZA 4MNRA 1NYMA 3FWLA 2BG1A 3WWXA 3TRCA 4WMCA
chains in the Genus database with same CATH topology
4O8GA 4G3VA 3G6OA 4IHQA 5CX7A 4CQHA 3UE6A 5TJJA 3UB7A 4HP9A 4P6ZS 1MZUA 3P01A 2OAP1 4Q0IA 3CLOA 3C2WA 1N9LA 3TE8A 4CLCB 4CLCA 2IA2A 3F1NA 5HZHA 2QJ7A 5DJUA 4M4XA 1VB6A 4HQAA 5DF9A 1W63Q 2Y8HA 2J3WA 3D72A 3VE4A 3LR3A 3S7OA 1P9RA 2WKRA 2Z6DA 3OC2A 1W63M 2J3TD 2OWJA 3KSFA 2HJEA 4Q0HA 5DKLA 2P08A 5L8MA 1GSWA 3FC7A 2MJ6A 3CUEA 1NLZA 4HNBA 3NHQA 2BASA 3CI6A 4GJ4A 4G3KA 5AVFA 5HDCA 3A0RA 4O01A 4PHTA 2ZBBA 1LSVA 1XFQA 3HJIA 2M7VA 3LIEA 3F1OB 4I3IA 3U2AA 3BQ8A 3W2ZA 1GSVA 4IUHA 4Q0JA 2ZOHA 3EQVA 4DJ3A 2L0WA 4CLCD 4DMZA 4WLAA 3T4SA 1OT9A 1LT0A 4BBVA 3TJZC 2YKHA 4EW7A 1NLYA 4BBTA 4UEYA 4HI4A 4LRZE 1T18A 2QYBA 3EGXC 2HV1A 5F5YA 1S4RA 1T1AA 2O9CA 3MF0A 1OTBA 3NJAA 2KOIA 4GLQA 4FSFA 2VGLM 3C38A 4LLOB 5DKKA 3K3CA 3PYPA 5I5LA 2KLIA 4HJ4A 2P7JA 2VV7A 3T4JA 2EWVA 4PKYG 4YNRA 1T19A 1KOUA 3KSIA 1N9OA 3PBRA 4HH2A 2KDKA 4HJ6A 1T1CA 1YSPA 5G4ZA 2O0YA 3FPVA 2XA7M 1XJ2A 3MQ0A 1XJ4A 1NRJA 1T1BA 4G3WA 5TBMA 4I5SA 3C30A 4FOFA 1LSWA 1OTIA 3NOPC 4L0LA 2J80A 2PHYA 1XJ3A 2FZ0A 2W3FA 3NOTC 1F98A 4L9FA 2W3DA 4WUJA 1NWZA 3D3OA 4H6JA 4H6JB 3T4QA 3MXQA 5IT5A 1OTEA 3MMHA 4KQDA 2WKQA 4L9EA 3NOUC 2K31A 5HWVA 1P97A 3T4OA 4WEKA 2V1BA 2PR5A 2I9VA 3H82A 4B9OA 4MMNA 2XROA 4LRYC 2VLGA 1G6OA 3E4PA 4HOIA 1GSXA 4BMWA 1Y28A 3F1PA 4JGQA 2VX8A 3F1NB 3P7NA 1TD5A 3S7QA 4KUOA 5KSHA 2Y79A 3LIBA 2ZOIA 4KUKA 3EEAA 1TS7A 3BY8A 1V9ZA 2M7UA 5DFXA 4LRXC 3HJKA 4PAUA 2P04A 2A24A 3VV4A 4K08A 5HWTA 1UWPX 4BWIA 3LFVA 3OBFA 2O9AA 3IBJA 2K2NA 3UB9A 1S4SA 5HL6A 3R7WA 1WA9A 2QHKA 3RH8B 3ZYTA 4EEUA 3KSHA 5HDSA 5LBRA 3OOVA 5A8BA 3T4KA 3MR0A 4EESA 2R78A 5J3WA 4OOMA 1S1ZA 3H9WA 3B42A 4ME4A 2V0UA 3LIAA 2W3GA 2W0NA 3E98A 5K5BA 2XA7S 5HD3A 4MN5A 2G7UA 5MC7A 2V1AA 3SW1A 1YAXA 1H8MA 4EERA 2INWA 3V67A 2VV8A 2QWSA 4F3LA 4I3AA 2W3HA 2HGVA 4HY8A 1OT6A 5KIZA 2EWWA 4JGRA 1MC0A 1G28A 2W3EA 2V0WA 5HSQA 4Y2FA 3T50A 4E04A 3E0YA 3OLOA 1DP9A 5F69A 3A0VA 2OOLA 4NXBA 1P9WA 3PHYA 4UQIM 1MKMA 2CMNA 3LUQA 2HF6A 3A0SA 4EEPA 5F6AA 1OJ5A 2A2LA 3PBQA 2VZWA 4R3AA 5TBMB 1IFQA 2PYRA 3PBOA 4MN6A 1S1YA 1VHMA 3UB8A 3PR6A 4BJPA 2PR6A 2PDRA 2EA9A 3EEHA 3EOIA 2D01A 5HWWA 3BQAA 4DN0A 3S7NA 2B18A 1OPXA 5IU1A 3UMDA 3LR4A 2QKPA 3KX0X 4DJ2A 3C8CA 4Y3IA 3BJNA 1DRMA 3BWLA 3LR5A 3MQQA 3UE3A 3PBTA 4YWZA 3H82B 4JGPA 3VOLA 5F68A 3GDIA 3R4KA 4ZRRA 2V9AA 4HHDA 2OWHA 4GCZA 2Z6CA 2GX5A 4LPZA 4JGOA 5HD5A 3IS2A 3IS2B 3RTYA 1UWNX 2JKRI 1UGUA 2W1TA 2W1TB 3F1PB 3ULFA 4WELA 4WF0A 4MDZA 5C5KA 3EGDC 1XJ6A 5G4YA 1JNUA 1XFNA 5AVEA 5IS1A 2M1CA 3PBNA 2NUPC 2JKRM 3B33A 1N9NA 2J3TC 3LI9A 4EETB 3CITA 2FH5A 4NKPA 2K7SA 5J4EA 4HP4A 4HIAA 4BBUA 1ZHHB 3K3DA 2A24B 2GJ3A 2QJ5A 3LICA 2GZAA 1P0ZA 5HPFA 3IBRA 2PT7A 2VJWA 3CWFA 4PKYA 5HDDA 2JHEA 2VGLS 2LB9A 3R7WB 2NUTC 4Z1WA 2W27A 5J7EA 3CAXA 1TS0A 2VKSA 2ZMFA 2PD7A 3KSGA 4EQ1A 3JVUA 2LB5A 1F5MA 3UMEA 3PXPA 3O5YA 5DJTA 2KX6A 3LYXA 4CLCC 3K2NA 3ICYA 4GHIB 4GHIA 4R38A 3OCNA 1S67L 4L9GA 4RQ9A 4UQIS 4YOFA 1S66L 3E4QA 2JN7A 1TS6A 3LIFA 3VE3A 4P6ZM 1ODVA 4O0PA 3FPWA 3LIDA 3MFXA 4WEJA 2OAQ1 3KYQA 2L4RA 3F1OA 3GECA 4WN5A 4ETXA 4NXEA 1OJGA 3B47A 4F3LB 1TF1A 4EU0A 4MCWA 3CUEC 4GW9A 1LSXA 3MJQA 3UB6A 1D7EA 2PD8A 2D02A 3EQUA 4EUVA 2JKTI 3H7WA 1ZTUA 3H7WB 3LR0A 1V9YA 3TW8A 1H3QA 4I39A 2JKTM 4IUKA 5DFYA 4EXOA 2VEAA 4MN7A 2O99A 2H28A 1DP6A 1OTAA 2L1MA 5EFWA 1BYWA 2DMWA 2B02A 1LL8A 4NXFA 4Y5FA 2XSSA 2VA0A 4R70A 3E4OA 2GNXA 3RFBA 1DP8A 4NEED 4GS9A 4GS9B 3PBSA 4KQOA 4II7A 3HCYA 3T4LA 3BW6A 2PYPA 1F9IA 2XRNA 1D06A 3S7PA 2YKFA 3ZQ5A 3OCLA 2O9BA 1STZA 5HPIA 4AFIA 4CLCE 4QPRA 4OOLA 4B93A 2ZMVA 1X0OA 4HH3A 1OTDA 2VV6A 3DBAA 1EW0A 4ETZA 4ARZA 4ARZB 3MQOA 3EWKA 4XT2B 2WKPA 4NXGA 1YSQA 4XT2A 4HJ3A 3JVVA 3LI8A 4I3JA 2HJ9C 3FG8A 1YKDA 4I38A 2W1RA 3KO6A 4R6LA 4IJGA 5AJGA 3BY9A 4WL9A 5FL3A 3KYZA 1IOUA 1TS8A 3T4TA 3TRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6O A;  3UE6 A;  3UB7 A;  4HP9 A;  1MZU A;  3CLO A;  3C2W A;  1N9L A;  3F1N A;  5HZH A;  2QJ7 A;  5DJU A;  4M4X A;  1VB6 A;  4HQA A;  3D72 A;  3VE4 A;  2WKR A;  2Z6D A;  2OWJ A;  5DKL A;  1GSW A;  3FC7 A;  4HNB A;  3NHQ A;  2BAS A;  5AVF A;  5HDC A;  3A0R A;  2ZBB A;  1LSV A;  1XFQ A;  3HJI A;  3LIE A;  3F1O B;  4I3I A;  1GSV A;  2ZOH A;  4DJ3 A;  2L0W A;  4WLA A;  1OT9 A;  1LT0 A;  4BBV A;  2YKH A;  4EW7 A;  4BBT A;  4HI4 A;  4LRZ E;  1T18 A;  2HV1 A;  5F5Y A;  1S4R A;  1T1A A;  1OTB A;  3NJA A;  4LLO B;  5DKK A;  3K3C A;  3PYP A;  5I5L A;  4HJ4 A;  2P7J A;  2VV7 A;  4PKY G;  1T19 A;  1KOU A;  1N9O A;  4HH2 A;  2KDK A;  4HJ6 A;  1T1C A;  5G4Z A;  1XJ2 A;  1XJ4 A;  1T1B A;  5TBM A;  4I5S A;  1LSW A;  1OTI A;  3NOP C;  2J80 A;  2PHY A;  1XJ3 A;  3NOT C;  1F98 A;  4L9F A;  4WUJ A;  1NWZ A;  4H6J A;  4H6J B;  3MXQ A;  1OTE A;  4KQD A;  2WKQ A;  4L9E A;  3NOU C;  5HWV A;  1P97 A;  2V1B A;  2PR5 A;  2I9V A;  3H82 A;  4B9O A;  4LRY C;  2VLG A;  3E4P A;  4HOI A;  1GSX A;  1Y28 A;  3F1P A;  4JGQ A;  3F1N B;  3P7N A;  4KUO A;  3LIB A;  2ZOI A;  4KUK A;  1TS7 A;  3BY8 A;  1V9Z A;  4LRX C;  3HJK A;  2A24 A;  4K08 A;  5HWT A;  1UWP X;  3UB9 A;  1S4S A;  1WA9 A;  2QHK A;  3RH8 B;  4EEU A;  5HDS A;  5A8B A;  3MR0 A;  4EES A;  2R78 A;  5J3W A;  1S1Z A;  3H9W A;  2V0U A;  3LIA A;  2W0N A;  5HD3 A;  4MN5 A;  2V1A A;  3SW1 A;  4EER A;  2INW A;  2VV8 A;  2QWS A;  4F3L A;  4I3A A;  4HY8 A;  1OT6 A;  5KIZ A;  4JGR A;  5HSQ A;  1G28 A;  2V0W A;  3T50 A;  4E04 A;  3OLO A;  1DP9 A;  5F69 A;  3A0V A;  2OOL A;  4NXB A;  3PHY A;  2CMN A;  3LUQ A;  3A0S A;  4EEP A;  5F6A A;  1OJ5 A;  4R3A A;  5TBM B;  2PYR A;  4MN6 A;  1S1Y A;  3UB8 A;  2PR6 A;  2PDR A;  2EA9 A;  3EEH A;  2D01 A;  5HWW A;  5IU1 A;  3UMD A;  2QKP A;  3KX0 X;  4DJ2 A;  3C8C A;  3BWL A;  1DRM A;  3MQQ A;  4YWZ A;  3H82 B;  4JGP A;  3VOL A;  5F68 A;  3GDI A;  2V9A A;  4HHD A;  2OWH A;  4GCZ A;  2Z6C A;  4LPZ A;  4JGO A;  5HD5 A;  3IS2 A;  3IS2 B;  3RTY A;  1UWN X;  1UGU A;  3F1P B;  3ULF A;  4WF0 A;  1XJ6 A;  5G4Y A;  1JNU A;  1XFN A;  5AVE A;  5IS1 A;  2M1C A;  3B33 A;  1N9N A;  3LI9 A;  4EET B;  2K7S A;  5J4E A;  4HP4 A;  4BBU A;  4HIA A;  3K3D A;  2A24 B;  2GJ3 A;  2QJ5 A;  3LIC A;  1P0Z A;  3IBR A;  5HDD A;  3CWF A;  4PKY A;  2JHE A;  2W27 A;  5J7E A;  3CAX A;  1TS0 A;  2PD7 A;  4EQ1 A;  3UME A;  5DJT A;  2KX6 A;  3LYX A;  4GHI A;  3ICY A;  4GHI B;  4R38 A;  1S67 L;  4L9G A;  4RQ9 A;  1S66 L;  3E4Q A;  2JN7 A;  1TS6 A;  3LIF A;  3VE3 A;  1ODV A;  3LID A;  3MFX A;  2L4R A;  3F1O A;  3GEC A;  4WN5 A;  4NXE A;  1OJG A;  4F3L B;  4GW9 A;  1LSX A;  3MJQ A;  3UB6 A;  1D7E A;  2PD8 A;  2D02 A;  3H7W A;  3H7W B;  1V9Y A;  4I39 A;  4EXO A;  2VEA A;  2H28 A;  1DP6 A;  1OTA A;  2L1M A;  5EFW A;  1BYW A;  2B02 A;  1LL8 A;  4NXF A;  4R70 A;  3E4O A;  1DP8 A;  4GS9 A;  4GS9 B;  2PYP A;  1F9I A;  1D06 A;  2YKF A;  3ZQ5 A;  1X0O A;  4HH3 A;  1OTD A;  2VV6 A;  1EW0 A;  3MQO A;  3EWK A;  4XT2 B;  2WKP A;  4NXG A;  4XT2 A;  4HJ3 A;  3LI8 A;  4I3J A;  3FG8 A;  4I38 A;  4R6L A;  3BY9 A;  4WL9 A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 2JKG A;  3RXW A;  4BD0 A;  4G3V A;  3V50 A;  1XP4 A;  4JF6 A;  2OAP 1;  4DE3 A;  4CJN A;  1YLT A;  4HQA A;  1W63 Q;  2J3W A;  4OQI A;  5CXW A;  3S7O A;  2ZQC A;  1GCE A;  3ZG0 A;  2Z6D A;  3OC2 A;  4Q0H A;  1I2W A;  5DKL A;  1CEG A;  1O07 A;  1L0F A;  1PWG A;  4N1X A;  4Y0T A;  3IF5 A;  2BAS A;  2JC7 A;  4GJ4 A;  1N9B A;  5AVF A;  1CK3 A;  4U3T A;  2ZBB A;  4RVA A;  1LSV A;  1XFQ A;  2M7V A;  5U47 A;  4I3I A;  4S2O A;  3W2Z A;  1SKO B;  1KDW A;  3GVB A;  3NY4 A;  2ZOH A;  3EQV A;  3SS5 A;  4DJ3 A;  4CLC D;  2V20 A;  3GMW A;  1BSG A;  1EWZ A;  1IKG A;  2EX9 A;  4UEY A;  1KVM A;  1T18 A;  1SDE A;  5F5Y A;  2ZQ7 A;  1S4R A;  3MBZ A;  1T1A A;  2ZMA A;  1OTB A;  3MF0 A;  2KOI A;  4MEZ A;  4FSF A;  3IXG A;  2VGL M;  4LLO B;  5DKK A;  3K3C A;  3PYP A;  4UAA A;  3SH7 A;  5E2H A;  2EWV A;  3ITB A;  4YNR A;  1TVF A;  4PMA A;  1KOU A;  3D4F A;  3IHB A;  1N9O A;  4HJ6 A;  4GD8 A;  5L09 A;  5G4Z A;  2O0Y A;  3FPV A;  4WM9 A;  3MQ0 A;  1XJ4 A;  1ES3 A;  4N9L A;  5CED A;  3TG9 A;  4RX3 A;  5TBM A;  1BZA A;  2HP6 A;  3C30 A;  4EWF A;  2R9X A;  3V5M A;  3C7U A;  1PRQ A;  4PM8 A;  4L9F A;  2EX6 A;  2PAV P;  3C4O A;  3BLS A;  2XLN A;  3O86 A;  2K31 A;  3T4O A;  3HBR A;  2QZ6 A;  2PR5 A;  5F1F A;  3H82 A;  2VLG A;  1Z09 A;  3E4P A;  4P0M A;  3Q07 A;  2JBF A;  1GSX A;  3N7W A;  4S2N C;  3HLB A;  4JGQ A;  1JWP A;  3UDI A;  4OPR A;  3F1N B;  1MWU A;  2WKI A;  2J9P A;  3Q7V B;  5KSH A;  2Y79 A;  5GHZ A;  2WZX A;  1TS7 A;  3S4X A;  3QHY A;  2A24 A;  3LFV A;  3A3F A;  4JLF A;  3P98 A;  2H0Y A;  1S4S A;  2PBY A;  5HL6 A;  4C6Y A;  1WA9 A;  3A3E A;  2QHK A;  3UDX A;  1ONH A;  5LBR A;  2VGJ A;  4QD4 A;  1ESU A;  3JYI A;  3HLF A;  1PW1 A;  3MR0 A;  1L0E A;  2AVX A;  1CJF A;  2ZQA A;  4DXB A;  4ME4 A;  1MPL A;  3M6H A;  3FKV A;  2G7U A;  4DE0 A;  3A3D A;  2V1A A;  2BTF P;  3WS1 A;  1XX2 A;  4E3I A;  4S2P A;  4EER A;  2INW A;  1TDG A;  2XD1 A;  2Q9N A;  3CPT A;  4F3L A;  2HGV A;  2Q9M A;  3IH9 A;  5KIZ A;  1ES2 A;  1MC0 A;  4Y2F A;  3ISG A;  1H5X A;  2PBD P;  3A0V A;  3MXR A;  1K25 A;  3UNW A;  4NXB A;  3T12 B;  1P9W A;  1YT4 A;  4DRT A;  4UA6 A;  1BLP A;  1HLU P;  3LUQ A;  2ZQD A;  4EEP A;  3BM6 A;  3PBO A;  1S1Y A;  1VHM A;  4BJP A;  2PDR A;  3MXS A;  4IVI A;  2D01 A;  5CHM A;  1BLC A;  5HWW A;  4DN0 A;  1ERM A;  2QKP A;  3KX0 X;  5CTN A;  1IYS A;  2HDR A;  1FCO A;  3LR5 A;  3MQQ A;  3QNC A;  4OOY A;  3UE3 A;  3VOY A;  2EXB A;  3NDE A;  3BFC A;  2XFS A;  5F68 A;  3D9Y A;  4HHD A;  4LPZ A;  4XXR A;  1I5Q A;  5HD5 A;  3RTY A;  1UGU A;  2W1T A;  3ULF A;  3EGD C;  5FEG A;  5CGS A;  5G4Y A;  5AVE A;  3HLG A;  5EVI B;  4IBX A;  1HTZ A;  5J4E A;  4HP4 A;  4HIA A;  4YIN A;  3K3D A;  2GJ3 A;  4JKT A;  2GZA A;  4KZ6 A;  3M2J A;  5BOH A;  2A49 A;  3ZNY A;  2LB9 A;  4Z1W A;  3CAX A;  1ONG A;  2HPB A;  3G32 A;  4S2K A;  3O87 A;  2RL3 A;  2PD7 A;  4EQ1 A;  3UME A;  3PXP A;  1RCJ A;  4DDS A;  4QJG A;  4OPQ A;  5CGX A;  4R38 A;  3BLM A;  1S67 L;  4UQI S;  5FAO A;  1S66 L;  4KG5 A;  4OQG A;  4O7D A;  4EQI A;  2ZL1 B;  3W4Q A;  4P6Z M;  5FDH A;  1HVB A;  3QP6 A;  2OAQ 1;  2L4R A;  3GEC A;  5FDS A;  3B47 A;  1VET A;  1D1J A;  4FUW A;  5CHJ A;  3CHW P;  1LSX A;  3UB6 A;  4E3O A;  1D7E A;  4JXS A;  3LR0 A;  1H3Q A;  1F2K A;  2JKT M;  1K54 C;  1XGJ A;  1G68 A;  1WYC A;  4EXO A;  2ZM0 A;  1OTA A;  5EUA A;  3N8L A;  4KZA A;  5GHY A;  1LL8 A;  4BEN A;  5G18 A;  3VP2 A;  1GA9 A;  4ZAM A;  1IYQ A;  2VA0 A;  3E4O A;  2GNX A;  2ZD8 A;  3TOI A;  3SZT A;  1VEU B;  2PYP A;  1D06 A;  4P87 A;  2P9V B;  3ZQ5 A;  1K4F A;  1STZ A;  4CLC E;  4OOL A;  3IWI A;  4R3B A;  1BUL A;  2C5W B;  1E25 A;  2VV6 A;  4PM6 A;  3Q1F A;  3OPL A;  3SS3 A;  4ARZ A;  3EWK A;  4GZB A;  4PPR A;  1SZV A;  5DTS A;  4R6L A;  3FV7 A;  2HDU A;  1IEM A;  1LLB A;  4WYY A;  1TS8 A;  2GDN A;  4GB7 A;  1ZG4 A;  4KEN B;  2OLV A;  3G6O A;  4IHQ A;  3NCK A;  3UE6 A;  2Y59 A;  2WZZ A;  4A5R A;  4OPY A;  3P01 A;  3Q7Z A;  4B4Z A;  1W7F A;  3C2W A;  3ZG8 B;  3TE8 A;  4CLC A;  2IA2 A;  2QJ7 A;  5DJU A;  1VB6 A;  2Y8H A;  3D72 A;  4Y13 A;  1P9R A;  2EFX A;  2Y2P A;  1GSW A;  3MKF A;  5GLC A;  3NHQ A;  4OP5 A;  5CEC A;  4ZJ1 A;  3A0R A;  4O01 A;  5FI6 A;  2XF3 A;  5EM1 A;  3U4L P;  2E8I A;  1BT5 A;  1DJC A;  2OSU A;  2Y2O A;  3ZFZ A;  4DE1 A;  2WAE A;  3HUM A;  3F1O B;  3GSG A;  4DF6 A;  2ZM8 A;  4IUH A;  1IKI A;  2L0W A;  2Y2J A;  4WLA A;  3T4S A;  3G4P A;  4BBV A;  3TJZ C;  4EW7 A;  3ZGA B;  4HI4 A;  4LRZ E;  5A93 A;  5CER A;  2QYB A;  1J3W A;  5HW3 A;  4KQR A;  3EGX C;  2HV1 A;  1I2S A;  1W5D A;  1MWS A;  2Y91 A;  2O9C A;  4GLQ A;  3DTI A;  3C38 A;  3IQA A;  1FOF A;  1NZU A;  3BFD A;  3T4J A;  1MXO A;  5CEB A;  3N4I A;  4PKY G;  5FAS A;  3KSI A;  4RA7 A;  4HH2 A;  1YSP A;  5A90 A;  4LEN A;  5EOO A;  5KSC A;  1T1B A;  4G3W A;  4EBL A;  3VP4 A;  4FOF A;  3UE1 A;  1LSW A;  4Y0U A;  2J80 A;  3P09 A;  2FZ0 A;  1LI0 A;  2W3F A;  1F98 A;  3IF6 A;  4EV4 A;  4FH4 A;  5CTM A;  1OTE A;  4X56 A;  3UDF A;  1RGY A;  4KQD A;  1IEL A;  5GLB A;  2WKQ A;  3WS0 A;  3NOU C;  1P97 A;  3LY3 A;  4E6X A;  2I9V A;  3BFG A;  2B95 A;  1Q2Q A;  2ZC6 B;  1U60 A;  4K0X A;  2R9W A;  4MBK A;  4OQH A;  3UPN A;  4FD8 A;  3G34 A;  3T1X A;  4HOI A;  5EE8 A;  5FQM A;  3M6B A;  2WYX A;  4R4S A;  4X25 A;  4M3K A;  4EUZ A;  4X6T A;  3W4P A;  3P7N A;  3S7Q A;  4KUO A;  2HP5 A;  3MS6 A;  2ZOI A;  4KZ8 A;  1BLS A;  2Y2N A;  4KUK A;  3EEA A;  5E43 A;  5HAI A;  3BY8 A;  2M7U A;  5DFX A;  1GHM A;  4LRX C;  1ERQ A;  2HP9 A;  5DF7 A;  4GDN A;  3G2Z A;  3OBF A;  3IBJ A;  2K2N A;  3UB9 A;  4Y7P A;  4IVK A;  3JPU A;  5EVI C;  1K55 A;  5HDS A;  1PZO A;  5A8B A;  3T4K A;  3ZNT A;  4OOM A;  5HFO A;  2V0U A;  3VFH A;  2W3G A;  5K5B A;  4MN5 A;  4Y0O A;  5EVI D;  4WZ4 A;  1YQS A;  2W3H A;  5HAP A;  2XFT A;  4JGR A;  2W3E A;  5HSQ A;  1H8Y A;  1ESI A;  3E0Y A;  1S0W A;  2FFY A;  1SDN A;  5FQ9 A;  3MKE A;  1MY8 A;  2ZC3 B;  2XEP A;  3PHY A;  3SOI A;  2CMN A;  4KZB A;  2Y55 A;  2HF6 A;  3A0S A;  5F6A A;  2A2L A;  5EPH A;  4OQ0 A;  2PYR A;  3IX4 A;  3NI9 A;  5TR7 A;  3PR6 A;  1KE4 A;  3UY6 A;  1OME A;  3BQA A;  1KVL A;  5M1A A;  4LGW A;  1OPX A;  3LR4 A;  1PNE A;  4DJ2 A;  3C8C A;  4OKP A;  4WZ5 A;  5FQJ A;  3G31 A;  3LGO A;  4YWZ A;  2ACG A;  4ZBE A;  3VOL A;  1FQG A;  5CHU A;  3NIA A;  3GDI A;  3R4K A;  4ZRR A;  5HAR A;  3DTM A;  2OWH A;  3BEB A;  1H8Z A;  2GX5 A;  4KZ3 A;  2X71 A;  2RCX A;  1UWN X;  2JKR I;  4XUX A;  3F1P B;  2W1T B;  2ZQ8 A;  1HD8 A;  4WF0 A;  1A0K A;  1XJ6 A;  3I7J A;  1FSY A;  3GV9 A;  3LI9 A;  2J3T C;  5F1G A;  3CIT A;  2FH5 A;  2K7S A;  4JPM A;  1GHI A;  1ZHH B;  4JXW A;  3AGD A;  1YLZ A;  2PT7 A;  3UPO A;  1MWR A;  5HDD A;  3G35 A;  1XGI A;  4JF5 A;  4KZ4 A;  3R7W B;  1EI5 A;  2NUT C;  3Q81 A;  1CQA A;  5J7E A;  4MBH A;  3VSL A;  3VP0 A;  2XDM A;  4HBT A;  4LCL A;  3LYX A;  3K2N A;  4GHI A;  3OCN A;  4L9G A;  4RQ9 A;  2WGV A;  4LV2 A;  3E4Q A;  3LIF A;  3VE3 A;  1PWD A;  4O0P A;  2Y2K A;  4NXE A;  3HLE A;  1NY0 A;  1SKO A;  5FI2 A;  4U0X A;  2P74 A;  5HL1 A;  5M18 A;  3MJQ A;  4IED A;  2D02 A;  3H7W A;  1V9Y A;  1SKF A;  3TW8 A;  4ZJ3 A;  3QNB A;  1YLP A;  3IH8 A;  1FR1 A;  4WBG A;  4I39 A;  1YLW A;  4IUK A;  2OV5 A;  5DFY A;  3WS2 A;  3C5A A;  1K6R A;  1JTG A;  5EFW A;  2J9O A;  1BYW A;  2DMW A;  1Y4O A;  3V39 A;  1KE3 A;  4NXF A;  4R0Q A;  1DP8 A;  2PU4 A;  2FFF B;  3Q82 A;  1ERO A;  1NYY A;  3BFE A;  2BLS A;  3HCY A;  3T4L A;  5TFQ A;  3S7P A;  1K57 A;  3IX8 A;  3OCL A;  2O9B A;  4AFI A;  1PFL A;  4GNU A;  1TEM A;  5DTT A;  1X0O A;  1OTD A;  5EVE A;  4ARZ B;  3GR2 A;  3MQO A;  2WKE A;  1ZC2 A;  4B4X A;  4FCF A;  1NXY A;  4H8R A;  4U0T A;  1YKD A;  4I38 A;  2W1R A;  3KO6 A;  4DXC A;  2VK3 A;  3T4T A;  3VSK A;  3C4P A;  1Y54 A;  3GQZ A;  4QY5 A;  1L2S A;  1LL5 A;  5TJJ A;  3UB7 A;  4P6Z S;  1MZU A;  1KGE A;  1PWC A;  4Q0I A;  3CLO A;  2EX8 A;  4ESP A;  4CLC B;  3F1N A;  5HZH A;  3DWZ A;  4M4X A;  3Q7V A;  3OPH A;  1FR6 A;  3LR3 A;  3W4O A;  2V1Z A;  2OWJ A;  2HJE A;  2P08 A;  3DW0 A;  3DTK A;  3CUE A;  1NLZ A;  4HNB A;  2XQZ A;  4OON A;  3CI6 A;  1PIO A;  2WAD A;  4OH0 A;  1KDS A;  4LV0 A;  3QP1 A;  2DNS A;  3LIE A;  5J8X A;  2DCF A;  3DTE A;  2EFU A;  3U2A A;  1DY6 A;  5EV0 A;  4OP8 A;  4BLM A;  5CGW A;  3E2K A;  2X01 A;  3OPP A;  4BL3 A;  2Y2M A;  3BEC A;  3PAG A;  1OT9 A;  1LT0 A;  2WGW B;  4XUZ A;  4BBT A;  1TDL A;  2IWC A;  3HVF A;  4JXG A;  1XA7 A;  2XK1 A;  4C75 A;  4HJ4 A;  2VV7 A;  1PZP A;  1M6K A;  3PBR A;  2KDK A;  4UHU A;  1T1C A;  3CJM A;  4QHC A;  2XA7 M;  1K6S A;  2ZLY A;  5DTK A;  1NRJ A;  3N8R A;  4I5S A;  1CI8 A;  4PM5 A;  1RP5 A;  5M19 A;  3IT9 A;  1GA0 A;  2PHY A;  3UN7 A;  1XJ3 A;  3NOT C;  4R1G A;  2W3D A;  5EVL A;  1E3U D;  1NWZ A;  4H6J A;  3T4Q A;  3MXQ A;  5IT5 A;  3MMH A;  3BYD A;  3IWQ A;  3HL9 A;  4WEK A;  2V1B A;  3A3J A;  1QME A;  4B9O A;  1G6O A;  2QMI A;  2C6W B;  1MKI A;  3HRE A;  3RJU A;  3S1Y A;  3ZDJ A;  2VX8 A;  3UPP A;  2B5R A;  1TD5 A;  1DJB A;  4BQM A;  5EVI A;  4ID4 A;  5A91 A;  4OPZ A;  3N6I A;  3B3X A;  3NBL A;  3LCE A;  4OLD A;  3HJK A;  3VV4 A;  4K08 A;  5L2F A;  2O9A A;  5FI7 A;  2ZQ9 A;  2G2W A;  5FQI A;  2JE5 A;  3RH8 B;  3ZYT A;  4EEU A;  3KSH A;  3IXB A;  3OOV A;  5EOE A;  2XR0 A;  4EES A;  4R23 A;  5FAP A;  3H9W A;  3B42 A;  3LIA A;  3E98 A;  4DE2 A;  3LEZ A;  5MC7 A;  4HBU A;  3SW1 A;  1CF0 A;  2EXA A;  1YAX A;  1H8M A;  2H5S A;  4R4R A;  3BRM A;  4QB8 A;  2VV8 A;  2QWS A;  4FH2 A;  4HY8 A;  2EWW A;  2V0W A;  5F82 A;  5A92 A;  3T50 A;  3FKW A;  3OLO A;  1DP9 A;  1SCW A;  1L0D A;  1YM1 A;  4UA7 A;  1XA1 A;  2OOL A;  5I94 A;  2OLU A;  2V8C A;  4Q8I A;  4LV3 A;  1PW8 A;  1ZKJ A;  3PBQ A;  4R3A A;  3QP2 A;  5TBM B;  1IFQ A;  3NC8 A;  4MN6 A;  3VP3 A;  3TSG A;  5FA7 A;  3UB8 A;  2PR6 A;  2EA9 A;  3EEH A;  5FAT A;  3EOI A;  5GLA A;  2IWB A;  4KG6 A;  1AXB A;  3S7N A;  1VEU A;  3UMD A;  4S2N A;  2P9V A;  1DRM A;  3PBT A;  2Q0O A;  4ZDX A;  1C3B A;  1O7E A;  3H82 B;  5FQQ A;  2ZC4 B;  2V9A A;  3V3R A;  2Z6C A;  3L7H A;  1PI5 A;  2EX2 A;  3HUO A;  4KQQ A;  3IS2 A;  4HES A;  3IXD A;  4Y15 A;  4MDZ A;  1ALQ A;  1JNU A;  1XFN A;  2J8Y A;  2M1C A;  2VGK A;  3PBN A;  3SH9 A;  5F83 A;  1N9N A;  4OVD A;  4BBU A;  1ES4 A;  2A24 B;  1P0Z A;  3MZE A;  5TGF A;  3IBR A;  3ITA A;  2VJW A;  3CWF A;  3IXH A;  2H10 A;  1PYY A;  3T1Q B;  2JHE A;  2VGL S;  2W27 A;  1FSW A;  1TS0 A;  2ZMF A;  4D60 A;  2A3U A;  3AGF A;  3KSG A;  3JVU A;  2LB5 A;  2ZJ9 A;  1F5M A;  3O5Y A;  1K4E A;  3SH8 A;  5DJT A;  1K0K A;  4CLC C;  4GHI B;  1L0G A;  1YPR A;  4YOF A;  4KZ7 A;  4BD1 A;  1RGZ A;  2JN7 A;  5HAQ A;  3FPW A;  3LID A;  1PI4 A;  3KYQ A;  3HUN A;  3F1O A;  3CPT B;  1OJG A;  3WRZ A;  4F3L B;  4EU0 A;  4E3L A;  2PD8 A;  1NJ4 A;  2JKT I;  3H7W B;  3WS5 A;  4GN2 A;  4QWO A;  5D3O A;  5EM0 A;  3WRT A;  4E6W A;  3UO9 A;  2VEA A;  4MN7 A;  2O99 A;  4E3K A;  3QP8 A;  2H28 A;  1DP6 A;  3ZG5 A;  3MZF A;  3UE0 A;  1L3L A;  2L1M A;  1NRF A;  2B02 A;  4E3N A;  5L10 A;  2PU2 A;  4QY6 A;  3OPR A;  2XSS A;  4P6B A;  1K56 D;  4DDY A;  1IYO A;  4NEE D;  2HZ5 A;  4GS9 A;  2UWX A;  4F94 A;  4II7 A;  3BW6 A;  4GOG A;  2YKF A;  5E2G A;  4QPR A;  4B93 A;  4IBR A;  5L07 A;  1Q2P A;  1YMS A;  4HH3 A;  1EW0 A;  2G2U A;  1K38 A;  4XT2 A;  3SS4 A;  4NXG A;  1YSQ A;  4HJ3 A;  4I3J A;  2HJ9 C;  3FG8 A;  3LEQ A;  2Y2I A;  5FL3 A;  1IOU A;  2I72 A;  2XGN A;  2Y2G A;  3M2K A;  4HEF A;  1XXM A;  1FCN A;  4O8G A;  1IYP A;  4OLG A;  3IF6 C;  3ZCZ A;  4KZ5 A;  5CX7 A;  4CQH A;  4HP9 A;  3O88 A;  1CI9 A;  1N9L A;  5JYO A;  3ZVW A;  4UA9 A;  4E3J A;  2PRF A;  5DF9 A;  3VMA A;  4FTX A;  3VE4 A;  4QU3 A;  2WKR A;  1BTL A;  4X69 A;  1W63 M;  2J3T D;  1SHV A;  3KSF A;  3KYE A;  3G30 A;  4Y17 A;  5L8M A;  4X53 A;  3FC7 A;  2JCH A;  1G6A A;  2MJ6 A;  3RXX A;  4G3K A;  5HDC A;  3IX3 A;  3MFD A;  3W8K A;  4PHT A;  4WMC D;  4X1M A;  1JVJ A;  3HJI A;  1M40 A;  5FSR A;  3BQ8 A;  4YFM A;  1K54 A;  1VET B;  1GSV A;  4Q0J A;  1FCM A;  3S22 A;  4DMZ A;  3GRJ A;  2WGI A;  1K55 C;  2YKH A;  1NLY A;  5E2F A;  1E3U A;  4NK3 A;  3HLW A;  4GD6 A;  4DKI A;  4MLL A;  3NJA A;  3QP4 A;  2QPN A;  5DVA A;  5GL9 A;  5I5L A;  2KLI A;  2P7J A;  2Y2H A;  4B88 A;  1T19 A;  4ZTK A;  3T1R A;  1J9M A;  1HZO A;  2J7V A;  1CEF A;  1XJ2 A;  1W79 A;  2X02 A;  1YLJ A;  1OTI A;  3NOP C;  1NZO A;  4L0L A;  4S2M A;  4WUJ A;  3D3O A;  5AQB A;  4H6J B;  3VP1 A;  2WKH A;  3E2L A;  4L9E A;  1E4D A;  4LCM A;  5HWV A;  4CPK A;  3VFF A;  4X55 A;  3CG5 A;  1XPB A;  5IHV A;  4MMN A;  2XRO A;  4LRY C;  1S6R A;  5FQK A;  4BMW A;  1Y28 A;  3NEC A;  3F1P A;  4WZ5 C;  4PM7 A;  2XD5 A;  3OZH A;  1MBL A;  3LIB A;  2Z2L B;  1N4O A;  2Y2L A;  2JKF A;  5EEC A;  1KE0 A;  3AGE A;  2V2F F;  1V9Z A;  3V3S A;  4PAU A;  2P04 A;  4BWI A;  5HWT A;  1UWP X;  3CZD A;  3G2Y A;  3R7W A;  4JBF A;  1WE4 A;  1ZG6 A;  2H0T A;  1KGF A;  4P85 A;  2XH9 A;  5DF8 A;  4R3J A;  3HLC A;  1YLY A;  2R78 A;  5J3W A;  1S1Z A;  5E2E A;  4MBF A;  2W0N A;  2XA7 S;  5HD3 A;  4X68 A;  1GHP A;  4X1L A;  5FEF A;  1Z6F A;  2ZM2 A;  3FYZ A;  3V67 A;  4EBP A;  4I3A A;  1ACF A;  1OT6 A;  5JYP A;  1W8Q A;  1G28 A;  2CC1 A;  4N92 A;  3ZHH A;  4E04 A;  5F69 A;  3VOZ A;  3N8S A;  3WS4 A;  4EBN A;  5CRF A;  1BUE A;  5AQA A;  3DAV A;  3MZD A;  4UQI M;  1MKM A;  4GKU A;  1OJ5 A;  3QP5 A;  2VZW A;  5AQ7 A;  1LHY A;  3LY4 A;  4ZJ2 A;  1W8Y A;  3MSH A;  3IF6 B;  5GHX A;  2B18 A;  2WAF A;  5IU1 A;  4C3Q A;  2ZC5 B;  3GTC A;  3ZG9 B;  4Y3I A;  1LI9 A;  3A3I A;  3BJN A;  3BWL A;  4KZ9 A;  3ZVT A;  4JGP A;  1WYB A;  5KMW A;  4S2J A;  2Z2M B;  4E3M A;  3C7V A;  4GCZ A;  4JGO A;  3IS2 B;  1K57 C;  1JTD A;  3CMZ A;  4WEL A;  5FAQ A;  5C5K A;  2E8J A;  5IS1 A;  2NUP C;  4JXV A;  3UB5 P;  2DRW A;  2JKR M;  3B33 A;  1VM1 A;  4EET B;  1VQQ A;  3PAE A;  4NKP A;  3DWK A;  3IHA A;  2HDS A;  3ZG7 B;  1LL9 A;  3L9K A;  1XKZ A;  2QJ5 A;  3LIC A;  5HPF A;  2UV0 E;  4S2L A;  4LFU A;  4PKY A;  1MWT A;  2VKS A;  4K91 A;  3PTE A;  2WUQ A;  4N1H A;  4N9K A;  5AQ9 A;  2KX6 A;  1H0M A;  3ICY A;  4PM9 A;  4NET A;  1G5U A;  4D2O A;  1TS6 A;  2ZL1 A;  4KG2 A;  4S2I A;  4RYE A;  1K56 A;  1ODV A;  3MFX A;  4WEJ A;  4K0W A;  4WN5 A;  2ZC7 A;  4ETX A;  4RX2 A;  4NG2 A;  1TF1 A;  4MCW A;  3CUE C;  3IWO A;  1FIL A;  5KZH A;  4GW9 A;  3O3V A;  3EQU A;  4EUV A;  1ZTU A;  3T1S A;  4LV1 A;  3NUL A;  2V8F A;  2WGW A;  1YMX A;  2WK0 A;  1JWV A;  4BL2 A;  5HX9 A;  1JWZ A;  3LO7 A;  4JF4 A;  1AWI A;  1ES5 A;  4GDB A;  2IWD A;  1DJA A;  4Y5F A;  3FZC A;  4R70 A;  1KGG A;  3RFB A;  3HLD A;  4GS9 B;  3PBS A;  4KQO A;  1F9I A;  2XRN A;  2Y2Q A;  2Y4A A;  5HPI A;  3NDG A;  1QMF A;  2ZMV A;  3DBA A;  4Z9Q A;  4ETZ A;  1FIK A;  1BLH A;  4XT2 B;  2WKP A;  3BFF A;  3JVV A;  3LI8 A;  2HDQ A;  4IJG A;  5AJG A;  3BY9 A;  4WL9 A;  5GLD A;  3KYZ A;  4MNR A;  1NYM A;  3FWL A;  2BG1 A;  3WWX A;  3TRC A;  4WMC A; 
#chains in the Genus database with same CATH homology
 4O8G A;  4G3V A;  3G6O A;  4IHQ A;  5CX7 A;  4CQH A;  3UE6 A;  5TJJ A;  3UB7 A;  4HP9 A;  4P6Z S;  1MZU A;  3P01 A;  2OAP 1;  4Q0I A;  3CLO A;  3C2W A;  1N9L A;  3TE8 A;  4CLC B;  4CLC A;  2IA2 A;  3F1N A;  5HZH A;  2QJ7 A;  5DJU A;  4M4X A;  1VB6 A;  4HQA A;  5DF9 A;  1W63 Q;  2Y8H A;  2J3W A;  3D72 A;  3VE4 A;  3LR3 A;  3S7O A;  1P9R A;  2WKR A;  2Z6D A;  3OC2 A;  1W63 M;  2J3T D;  2OWJ A;  3KSF A;  2HJE A;  4Q0H A;  5DKL A;  2P08 A;  5L8M A;  1GSW A;  3FC7 A;  2MJ6 A;  3CUE A;  1NLZ A;  4HNB A;  3NHQ A;  2BAS A;  3CI6 A;  4GJ4 A;  4G3K A;  5AVF A;  5HDC A;  3A0R A;  4O01 A;  4PHT A;  2ZBB A;  1LSV A;  1XFQ A;  3HJI A;  2M7V A;  3LIE A;  3F1O B;  4I3I A;  3U2A A;  3BQ8 A;  3W2Z A;  1GSV A;  4IUH A;  4Q0J A;  2ZOH A;  3EQV A;  4DJ3 A;  2L0W A;  4CLC D;  4DMZ A;  4WLA A;  3T4S A;  1OT9 A;  1LT0 A;  4BBV A;  3TJZ C;  2YKH A;  4EW7 A;  1NLY A;  4BBT A;  4UEY A;  4HI4 A;  4LRZ E;  1T18 A;  2QYB A;  3EGX C;  2HV1 A;  5F5Y A;  1S4R A;  1T1A A;  2O9C A;  3MF0 A;  1OTB A;  3NJA A;  2KOI A;  4GLQ A;  4FSF A;  2VGL M;  3C38 A;  4LLO B;  5DKK A;  3K3C A;  3PYP A;  5I5L A;  2KLI A;  4HJ4 A;  2P7J A;  2VV7 A;  3T4J A;  2EWV A;  4PKY G;  4YNR A;  1T19 A;  1KOU A;  3KSI A;  1N9O A;  3PBR A;  4HH2 A;  2KDK A;  4HJ6 A;  1T1C A;  1YSP A;  5G4Z A;  2O0Y A;  3FPV A;  2XA7 M;  1XJ2 A;  3MQ0 A;  1XJ4 A;  1NRJ A;  1T1B A;  4G3W A;  5TBM A;  4I5S A;  3C30 A;  4FOF A;  1LSW A;  1OTI A;  3NOP C;  4L0L A;  2J80 A;  2PHY A;  1XJ3 A;  2FZ0 A;  2W3F A;  3NOT C;  1F98 A;  4L9F A;  2W3D A;  4WUJ A;  1NWZ A;  3D3O A;  4H6J A;  4H6J B;  3T4Q A;  3MXQ A;  5IT5 A;  1OTE A;  3MMH A;  4KQD A;  2WKQ A;  4L9E A;  3NOU C;  2K31 A;  5HWV A;  1P97 A;  3T4O A;  4WEK A;  2V1B A;  2PR5 A;  2I9V A;  3H82 A;  4B9O A;  4MMN A;  2XRO A;  4LRY C;  2VLG A;  1G6O A;  3E4P A;  4HOI A;  1GSX A;  4BMW A;  1Y28 A;  3F1P A;  4JGQ A;  2VX8 A;  3F1N B;  3P7N A;  1TD5 A;  3S7Q A;  4KUO A;  5KSH A;  2Y79 A;  3LIB A;  2ZOI A;  4KUK A;  3EEA A;  1TS7 A;  3BY8 A;  1V9Z A;  2M7U A;  5DFX A;  4LRX C;  3HJK A;  4PAU A;  2P04 A;  2A24 A;  3VV4 A;  4K08 A;  5HWT A;  1UWP X;  4BWI A;  3LFV A;  3OBF A;  2O9A A;  3IBJ A;  2K2N A;  3UB9 A;  1S4S A;  5HL6 A;  3R7W A;  1WA9 A;  2QHK A;  3RH8 B;  3ZYT A;  4EEU A;  3KSH A;  5HDS A;  5LBR A;  3OOV A;  5A8B A;  3T4K A;  3MR0 A;  4EES A;  2R78 A;  5J3W A;  4OOM A;  1S1Z A;  3H9W A;  3B42 A;  4ME4 A;  2V0U A;  3LIA A;  2W3G A;  2W0N A;  3E98 A;  5K5B A;  2XA7 S;  5HD3 A;  4MN5 A;  2G7U A;  5MC7 A;  2V1A A;  3SW1 A;  1YAX A;  1H8M A;  4EER A;  2INW A;  3V67 A;  2VV8 A;  2QWS A;  4F3L A;  4I3A A;  2W3H A;  2HGV A;  4HY8 A;  1OT6 A;  5KIZ A;  2EWW A;  4JGR A;  1MC0 A;  1G28 A;  2W3E A;  2V0W A;  5HSQ A;  4Y2F A;  3T50 A;  4E04 A;  3E0Y A;  3OLO A;  1DP9 A;  5F69 A;  3A0V A;  2OOL A;  4NXB A;  1P9W A;  3PHY A;  4UQI M;  1MKM A;  2CMN A;  3LUQ A;  2HF6 A;  3A0S A;  4EEP A;  5F6A A;  1OJ5 A;  2A2L A;  3PBQ A;  2VZW A;  4R3A A;  5TBM B;  1IFQ A;  2PYR A;  3PBO A;  4MN6 A;  1S1Y A;  1VHM A;  3UB8 A;  3PR6 A;  4BJP A;  2PR6 A;  2PDR A;  2EA9 A;  3EEH A;  3EOI A;  2D01 A;  5HWW A;  3BQA A;  4DN0 A;  3S7N A;  2B18 A;  1OPX A;  5IU1 A;  3UMD A;  3LR4 A;  2QKP A;  3KX0 X;  4DJ2 A;  3C8C A;  4Y3I A;  3BJN A;  1DRM A;  3BWL A;  3LR5 A;  3MQQ A;  3UE3 A;  3PBT A;  4YWZ A;  3H82 B;  4JGP A;  3VOL A;  5F68 A;  3GDI A;  3R4K A;  4ZRR A;  2V9A A;  4HHD A;  2OWH A;  4GCZ A;  2Z6C A;  2GX5 A;  4LPZ A;  4JGO A;  5HD5 A;  3IS2 A;  3IS2 B;  3RTY A;  1UWN X;  2JKR I;  1UGU A;  2W1T A;  2W1T B;  3F1P B;  3ULF A;  4WEL A;  4WF0 A;  4MDZ A;  5C5K A;  3EGD C;  1XJ6 A;  5G4Y A;  1JNU A;  1XFN A;  5AVE A;  5IS1 A;  2M1C A;  3PBN A;  2NUP C;  2JKR M;  3B33 A;  1N9N A;  2J3T C;  3LI9 A;  4EET B;  3CIT A;  2FH5 A;  4NKP A;  2K7S A;  5J4E A;  4HP4 A;  4HIA A;  4BBU A;  1ZHH B;  3K3D A;  2A24 B;  2GJ3 A;  2QJ5 A;  3LIC A;  2GZA A;  1P0Z A;  5HPF A;  3IBR A;  2PT7 A;  2VJW A;  3CWF A;  4PKY A;  5HDD A;  2JHE A;  2VGL S;  2LB9 A;  3R7W B;  2NUT C;  4Z1W A;  2W27 A;  5J7E A;  3CAX A;  1TS0 A;  2VKS A;  2ZMF A;  2PD7 A;  3KSG A;  4EQ1 A;  3JVU A;  2LB5 A;  1F5M A;  3UME A;  3PXP A;  3O5Y A;  5DJT A;  2KX6 A;  3LYX A;  4CLC C;  3K2N A;  3ICY A;  4GHI B;  4GHI A;  4R38 A;  3OCN A;  1S67 L;  4L9G A;  4RQ9 A;  4UQI S;  4YOF A;  1S66 L;  3E4Q A;  2JN7 A;  1TS6 A;  3LIF A;  3VE3 A;  4P6Z M;  1ODV A;  4O0P A;  3FPW A;  3LID A;  3MFX A;  4WEJ A;  2OAQ 1;  3KYQ A;  2L4R A;  3F1O A;  3GEC A;  4WN5 A;  4ETX A;  4NXE A;  1OJG A;  3B47 A;  4F3L B;  1TF1 A;  4EU0 A;  4MCW A;  3CUE C;  4GW9 A;  1LSX A;  3MJQ A;  3UB6 A;  1D7E A;  2PD8 A;  2D02 A;  3EQU A;  4EUV A;  2JKT I;  3H7W A;  1ZTU A;  3H7W B;  3LR0 A;  1V9Y A;  3TW8 A;  1H3Q A;  4I39 A;  2JKT M;  4IUK A;  5DFY A;  4EXO A;  2VEA A;  4MN7 A;  2O99 A;  2H28 A;  1DP6 A;  1OTA A;  2L1M A;  5EFW A;  1BYW A;  2DMW A;  2B02 A;  1LL8 A;  4NXF A;  4Y5F A;  2XSS A;  2VA0 A;  4R70 A;  3E4O A;  2GNX A;  3RFB A;  1DP8 A;  4NEE D;  4GS9 A;  4GS9 B;  3PBS A;  4KQO A;  4II7 A;  3HCY A;  3T4L A;  3BW6 A;  2PYP A;  1F9I A;  2XRN A;  1D06 A;  3S7P A;  2YKF A;  3ZQ5 A;  3OCL A;  2O9B A;  1STZ A;  5HPI A;  4AFI A;  4CLC E;  4QPR A;  4OOL A;  4B93 A;  2ZMV A;  1X0O A;  4HH3 A;  1OTD A;  2VV6 A;  3DBA A;  1EW0 A;  4ETZ A;  4ARZ A;  4ARZ B;  3MQO A;  3EWK A;  4XT2 B;  2WKP A;  4NXG A;  1YSQ A;  4XT2 A;  4HJ3 A;  3JVV A;  3LI8 A;  4I3J A;  2HJ9 C;  3FG8 A;  1YKD A;  4I38 A;  2W1R A;  3KO6 A;  4R6L A;  4IJG A;  5AJG A;  3BY9 A;  4WL9 A;  5FL3 A;  3KYZ A;  1IOU A;  1TS8 A;  3T4T A;  3TRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...