3QP5A

Crystal structure of cvir bound to antagonist chlorolactone (cl)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
251
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 59
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qp5A02
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp5A01
2H6BA 4ZYHA 5JHUA 1KYZA 1FOKA 5KVRA 1XCBA 4ZYGA 5E1ZB 3OOPA 5LLQA 3HHGA 1O7LA 1P4XA 2NYXA 3LFKA 2PMUA 2HR3A 1G3YA 2KJCA 1IN4A 4G94A 4YG2F 3IHUA 5F6FA 2QQ9A 2DW4A 1IRGA 3PQKA 3K69A 2O3FA 2V79A 4O3MA 2ZFWA 3WE2A 4LJZF 1K7AA 3F3XA 2MBFA 2ZMEB 2A5YB 2RQPA 1BJAA 4U0WA 2P8TA 1XSXA 4FX0A 1HKTA 2A07F 4BHPA 3E5XA 2DBBA 2PBIA 3GFMA 1P92A 1P4WA 2LSOA 1UB9A 2FMYA 1BI1A 5HLIA 4IF4A 4PZJA 1ZGAA 3G3ZA 1TW3A 4XLPF 3RJPA 3EYIA 4ESBA 5K5RA 3WGGA 3J81Z 3RIRA 3GFJA 2MLGA 2DQLA 1FWZA 1Y0UA 2K86A 3TGNA 4IJAA 2A6EF 1D8KA 3KFWX 4G7OF 1BC8C 2XAHA 3MAJA 1OYWA 4G7HF 3I54A 2IP2A 4GYIA 3SHFA 2UV0E 4KICA 4NG2A 2LKPA 3JW4A 2XHKA 4NB5A 2NRAC 2L4AA 4U7DA 1IN8A 4A2UA 3REOA 1MZBA 1ON2A 4L9JA 2FA5A 4IHTA 1S7AA 4CHUA 2V6CA 1EH7A 1IF1A 3F22A 3BDDA 4A6DA 2FBHA 4M73A 5E20A 3EQLF 1WI9A 2L4MA 4L5IA 4LLLA 3QP2A 5EEGA 3GEZA 4HLXA 3HOTA 1ZGJA 3F8CA 3ZMVA 1SFUA 2QM3A 3P9CA 2OZUA 4AWXB 2W25A 4ETSA 5ERIA 2DQRA 4P55A 4A5NA 3FMQA 4KMUX 2MD5A 3KP3A 4NHJA 2M45A 4IRIA 4HV5A 3LSTA 1O7FA 2FOKA 5CVJA 1R5GA 3O2PE 1HBXG 2HOEA 4HX8A 5AIPA 1SMTA 3C18A 5E18F 2KKOA 4PDKA 1QNTA 2JSCA 3HSEA 4I7HA 5DD4A 4UNOA 3BY6A 5BPIA 4XSXF 4HA8A 1OMIA 3JPUA 3HOSA 3WTWC 3ZQ7A 2X4HA 4FT8A 2M1BA 1U2WA 2XKOA 1ZHFA 2ISYA 2K4JA 3TQNA 1ZLJA 3T0YA 3V4GA 4QLCU 4HQEA 5CVRA 2ZBKA 4A12A 2HYGD 2VODA 3E3VA 1ULYA 2P6SA 5FLXK 3T8RA 4KYWA 3R0JA 4HBLA 1V3FA 5D5UB 2RGVA 4I02A 3C7JA 4YIFA 2Y48A 3WU1B 3CUQA 1RNLA 1ZAOA 4LFUA 4UVCA 3K1PA 1GVJA 3V8LA 2GQQA 4GGGA 3C1DA 2Q8KA 4Z2YA 3TO9A 5FO5A 5H6RA 3WU0A 2FEZA 3KEQA 3JAMK 4BH9A 3H3UA 1H9GA 2ETHA 4AIHA 1TBXA 2UXNA 5IT3A 3WTZA 4G6QA 3GUDA 1FSHA 2FE3A 1J75A 1LQ1A 5E1XA 3MCZA 1FSEA 2XAGA 4I01A 5HLHA 3WGIA 3V7CA 1W4MA 3QP4A 1LDJA 1FT9A 2EFOA 4UUVA 1QZZA 1ZRDA 3RDIA 3VOEA 5FD6A 2FMLA 2GIVA 3BROA 2EFQA 1E2XA 1J9IA 4B8XA 2DTRA 3W6JB 4DQ2A 4MTEA 2STWA 5CLSA 1O3SA 5TRDA 3F6VA 2ISZA 1UFMA 2WTEA 4EGYA 1KU7A 2HWVA 5DYMA 3ZPLA 2OBPA 2H6CA 1I6XA 4IPAA 3RYPA 3G73A 4O6JA 1Z05A 5LEKA 4OMZA 1OKRA 2XKPA 3V7SA 1W5SA 2EV0A 3F23A 1W7PB 1DDNA 1G3TA 1KQ9A 3HRTA 4BNCA 5E17F 1R7JA 3KP6A 1AOYA 1OYIA 5HS7A 2COMA 1QGPA 4EJTA 1S3JA 2EFWA 1R1UA 2MLKA 3GXOA 1OYYA 2PN6A 4RB1A 1YS6A 3I53A 4M9SA 4M71A 2P7VB 4OIPF 5EEHA 2G9WA 5DEQA 3P9IA 4GYGA 3D5LA 2CSOA 2Y75A 1B6AA 1LVAA 1LJ9A 2LDUA 3I0TA 2XAQA 4MEXF 1MGTA 1IN5A 3O3KA 3V7RA 1KGSA 3LA2A 3P7NA 1USSA 4KIGA 1Q1HA 4LG0A 5L10A 5L3CA 1T98A 2DAOA 3DEUA 1BOAA 5FD5A 5DCMB 2JTVA 4LB5A 3HYIA 3E97A 4MEYF 4EGZA 5TJJA 1H9TA 3R4KA 4CGZA 1FP2A 2PFBA 2QBYA 4UV9A 1V4RA 3WTSC 1HSTA 4RB2C 4RB0A 2PJPA 5BOXA 4ZH4F 3HTSB 2EK5A 1O57A 3LQQA 1FBQA 2HKXA 5BPDA 2NAZA 4A6EA 5D5XB 3Q5FA 4H0EA 5LGUA 1MDMB 5L07A 3F6OA 4M74A 4IVNA 1RI7A 1WWXA 4K2EA 1Z1DA 4KT5C 4WF2A 5D5WB 2XGXA 4P9UA 3BPVA 3I64A 1RZ4A 2K27A 3LQRA 2FBKA 1FYLA 4HDVA 1J7KA 5BS6A 1YFHA 3T8TA 4ON0A 1EH8A 4OOIA 1MJBA 5A2QK 2A69F 3K9TA 2DPDA 2CG4A 2OD5A 1DUXC 1LDDA 3SFZA 5LBQA 3R6SA 3GO5A 1XD7A 3W6KB 1PP8F 4U88A 1BI2A 3MFKA 2R7FA 1T38A 3CO7C 3VFZA 4GCVA 1XGNA 3GZ5A 3FZVA 4EVIA 3NRVA 3QPHA 3I5UA 4LK1F 4UHTA 2E1NA 5CVIA 2IT0A 3EETA 1YW7A 2WC2A 2UXXA 4RAZA 4A0YA 2F5CA 3ZMUA 1XGOA 2PMHA 3ELKA 4WK8F 1CGPA 1DPRA 5AONA 5LGNA 1ZG1A 1XN7A 2GZWA 2FNAA 2O03A 2Q2EA 1SD4A 3SZTA 2YR2A 2HQNA 2VC0A 5HLGA 2ZNYA 1MJAA 2EWNA 4LB6B 3M7GA 5E1WA 1O3TA 3FM3A 4HLYA 3BP8A 1ODDA 1TNSA 4N0BA 2HQRA 4G7ZF 3QU3A 1FZPB 1HW5A 2GAUA 1ZRFA 2XROA 2QZ8A 4M72A 1MD0A 3MWMA 2Q0OA 5JI6A 4Y15A 4U0YA 1YYVA 5D6FA 4EJUA 1XB4A 3CTAA 5FLXZ 2ZNZA 1R22A 1YIOA 3GFIA 2BEOA 1ZG5A 1FY7A 5CVVA 3PQJA 4IRGA 1I27A 5K5QA 1IAWA 1O3QA 4OIRF 3V8JA 4EQQA 1H0MA 2ZJ2A 2HTSA 1IN6A 1W5TA 4L9TA 4O5VA 1L0OC 3TO6A 2OQGA 2VBZA 5CJ9A 5F1RA 2K7LA 5L3DA 2FQ3A 4Q4ZF 2CYYA 4GXOA 4B09A 3JAMZ 3H92A 3DKWA 1B4AA 4I09A 3GX4X 3KP4A 4UV8A 2V9VA 1Z7UA 2EFPA 3ERED 1G4DA 2HDCA 1ZREA 3MZHA 2FBIA 2ADUA 3U1DA 1XMAA 4HAMA 4P96A 2VT3A 4M6YA 3FX3A 2DO7A 1Z9CA 2IA2A 3FXUA 2LF8A 2QVOA 1T6SA 4L18B 3FXQA 1WSUA 1K79A 1XMKA 2GA2A 2M8EA 3QP6A 5CYVA 1KU3A 1O3RA 2PEXA 1STZA 5E8GA 5J8CA 1G3WA 4OINF 2D45A 1SD6A 1DPUA 5DD8A 3RKYA 5LHGA 1OPCA 2P6TA 2F5DA 1FBUA 2E7WA 3CUOA 4YIIA 5D5VB 2HFHA 2VE9A 3O6BB 4IHSA 1K6OA 2RVCA 4HX7A 2LNBA 1QPMA 2BBYA 2W57A 2W24A 3J81K 1LDKB 1IXCA 3IRRA 2IRFG 4AIKA 5L3FA 3JSOA 5L3GA 3HHHA 2O61A 1YW8A 3ABUA 3K1NA 3TOBA 3EDPA 4R1HA 1CF7A 5J8FA 3DXJF 4U0VA 1P2FA 1FPQA 5ICCA 2ZKZA 4ZYDA 3LA3A 2PQ8A 4IRHA 5L09A 2P5KA 2MH2A 3GYHX 5H20A 1KQ8A 4Y17A 3NQOA 1TW2A 2JPCA 3FXRA 3S2WA 1S8NA 4A5MA 2MC3A 2HS5A 4I2OA 1ONVA 5D4RA 3CUQB 4MTDA 1IXSB 4MNUA 4WX9A 4U7BA 4CXFA 2Z99A 2G7UA 3CDHA 3PFIA 3IRQA 2EA4A 1E17A 1U3EM 3VB2A 2A3SA 3DF8A 4LD5A 2JPBA 2RC4A 1S7OA 3ULQB 1XDUA 1ZN2A 4OU0A 3HSFA 3T5XA 2M5WA 1J59A 5DUKA 4EJWA 4E70A 2VBWA 4KFCA 5HVQC 2HYFA 3J7AO 1P4AA 1F5TA 3CUQC 1TQMA 1IN7A 2OAZA 2CFXA 1R36A 1R23A 5F64A 5D8LB 3TKYA 5HS9A 3KP2A 5HDGA 4L5JA 3ZMTA 6PAXA 5E8IA 2EB7A 3MEXA 2ESHA 2D1HA 3IC7A 1HQCA 3KE2A 2Z9OA 1MKMA 3NEUA 1YLFA 1HXDA 2DPUA 3DP7A 1QBJA 4HOBA 1FC3A 3I4PA 1FLIA 2IPQX 2H94A 2ESNA 5DCFA 3GFLA 1R1VA 2CWEA 3ABTA 2H09A 3WTUC 3TO7A 3GWZA 2DLLA 1EH6A 4AD9A 1FYKA 2HGCA 1HSJA 3IKVA 1B1BA 4RB3C 3COAC 2D2WA 1WKMA 2STTA 2KIMA 2P5VA 4WWCA 2CW0F 2ZCWA 1TLHB 2WV0A 4OMYA 4Q5SF 4XRFA 5CVUA 2YU3A 2YX4A 4WXCA 2B0LA 4MGRA 3ZP5A 1F1ZA 4RAYA 5ILSA 1P6RA 3Q9SA 3L7WA 2ELHA 4IXAA 2UWMA 5DV5A 5A2QZ 2FSWA 2O8XA 3QP5A 4MQ9F 3RKXA 1S29A 2EV5A 2J5OA 1BI3A 4BYYA 3LWFA 3F8BA 5D4SA 3L00A 4ENMA 1HKSA 2HEOA 1FNNA 3I59A 2O6GE 1JE8A 3IL2A 3QOPA 2KRFA 4EM2A 3SQNA 3QRFF 3GVAA 3L09A 1KU2A 3FM5A 3F8FA 1SFXA 2V1XA 3TDZC 4A0ZA 2WWYA 1KYWA 1LEBA 4LG0B 5H6QA 3ZN0A 2V1UA 1OR7A 2A6HF 2JT1A 4CICA 1Z6TA 3M9AA 4ZZLA 2K02A 2QBYB 3RKWA 2AS5F 1B9MA 3E5QA 2QENA 4L0YB 4N9IA 3M8FA 3HRUA 2RN7A 5LGTA 1EV7A 4YFXF 2L02A 3KZZA 4HQMA 5IT9K 1GXPA 2Z33A 3VEPA 4EM1A 4R79A 1BIAA 1XSVA 4XSZF 2K4BA 3BZ6A 3JTGA 3BOQA 3KCCA 3FWEA 2XUBA 3QU6A 2XAJA 3L9FA 1YW9A 5AIQA 4EJVA 3J80K 5FB2A 3LA7A 1G6NA 1S6LA 3E5UA 4A0XA 4CDGA 1T2KA 3QPTA 1IUYA 2MH9A 2G7HA 3IX8A 3ECOA 1BI0A 1U6GA 1R00A 4ESFA 4KDPA 1XDSA 1PP7U 3F72A 1SD7A 4LLNA 3ML6A 3HRSA 3ZN1A 4KIFA 4AVPA 2P7CB 2M30A 4ZZDA 2RNJA 3MZYA 4DNCA 4RGUA 4TV7A 3SXYA 4S04A 1IXRC 2E1CA 2FF4A 2EFNA 2F2EA 2TDXA 1IW7F 3E6CC 4QWQA 3RTRA 4HZFA 1U78A 2PLYA 1RIOH 4HW0A 3CLOA 2YSRA 2L54A 2IVMA 5HDKA 2ZMEA 3RPUA 1BM9A 2HTJA 4ASNA 3KP7A 4L9NA 4LLGF 5LRSA 4JBAA 4RGRA 4G6DA 1IZ1A 2DI3A 2VT2A 4HF2A 3HTUA 1XSDA 4UXNA 5L3EA 3GF2A 3F8MA 3E6MA 4WXDA 4AIJA 1RUOA 3ROUA 3ZMSA 1QO0D 1G3SA 4HYEA 3GZ6A 4R8HA 5D8KB 3U2RA 2FXAA 4LK0F 4BHBA 1XGSA 2QQBA 3WE3A 2IJLA 2X0LA 2FNPA 4HF1A 2IA1A 1FX7A 4OIQF 2EJRA 4RGSA 5ILVA 1DP7P 5ICEA 5J6XA 1I5ZA 3K1MA 4G8XA 4KMFA 2MA3A 1BIBA 4RGXA 1T39A 3L2CA 3C3WA 5KK1A 2BGCA 4ENKA 1JGSA 1TNTA 3ECHA 2V1DA 2RDPA 2NNYA 3B02A 4EMSA 2FRHA 2BYVE 2VXZA 3WODF 3DQVC 2O0YA 4M9ZA 3WTXC 2W84A 2P4WA 1UCRA 4PGHA 3ISPA 5HS8A 3KZYA 3M8EA 5JFRA 3B73A 1USTA 2RV8A 5LHHA 3IWFA 2L3DA 3SZPA 1F9NA 2VBYA 1D5VA 1UHMA 1HW2A 3BJ6A 4XLNF 3DPTA 4ENNA 1TQIA 3RI4A 4HX4A 1C0WA 1W7PD 4FX4A 1FP1D 3KP5A 2L01A 5ILUA 2IW5A 4Q47A 1LEAA 3FMSA 3Q9VA 2DK5A 5FGMA 2JRTA 4JQFA 2QQAA 1YTYA 1JHHA 3F8NA 3R61A 3JTHA 4BXUA 2ZXJA 1BC7C 2Z3YA 1R5HA 4WXHA 3I71A 3F21A 2LF7A 2VC1A 3WTVC 2XV4S 2E7XA 5L3BA 3ZMZA 5LRRA 4P9FA 5LHIA 2KIUA 1F4KA 5BQTA 3M1EA 3E6DA 4CO8A 1U5TA 1U5TB 1BN5A 1WRJA 3R0AA 3KETA 3LAJA 1CF7B 2R3SA 3TOAA 2NNNA 3IX3A 3DV8A 2VN2A 2W85A 4KUMA 1R58A 2VONA 1ON1A 2GWRA 4MQVA 2EA2A 3I58A 2DK8A 4D0PA 4L0ZB 3D0SA 1REPC 1XGMA 3T1BA 1KA8A 5FFXA 1XCVA 4KNYA 3TDUC 1UHWA 2OA4A 3BWGA 3WTYC 2C6YA 1U5TC 3DFGA 3BPXA 3QAHA 3CJNA 2AXLA 3GW2A 3WGHA 2KJBA 1PDNC 5K5OA 4OIOF 1J5YA 4N9HA 4ESJA 3HUGA 2GXGA 3RYRA 3BJAA 4XBFA 2ACJA 1PUEE 4NQWA 2VOOA 1X3UA 3ZMDA 5K1YA 3CO6C 1ZH5A 1ZARA 1SFEA 2OZ6A 1WQ2A 3EUHA 5DUIA 2XIGA 2GA1A 1ZYRF 1LNWA 3AAFA 1VTNC 1IRFA 1B59A 4LGWA 1SD5A 4HF0A 2A68F 2NS0A 4BQAA 3QP8A 3DPLC 2DFIA 4KIBA 5JVTA 4KN7X 4JK1X 3FF5A 4GO1A 3U9GA 1ZLKA 2HKOA 2P5LC 4I0AA 4Y13A 1BBYA 1B9NA 1GHCA 1HW1A 1Z6RA 2XASA 2M87A 2CQKA 1LB2A 2YPRA 2AVXA 1D3YA 1GXQA 1T0FA 2QLZA 4HDUA 3OV8A 5IT9Z 3HRMA 4LMYA 2F5FA 4UVBA 3EYYA 2VOPA 1MJ9A 2JZYA 3QP1A 3WG9A 4MHGA 1KU9A 1L3LA 3J80Z 1U8RA 2ZO4A 3P9KA 4WCGA 3HIFA 4BHCA 4EV0A 2YX7A 4G9YA 2OU2A 4L9VA 1SAXA 5DDGA 5ED4A 3IKTA 4UVAA 1W7PA 3H3ZA 2DT5A 4ZYEA 2EV6A 2PI0A 2OQRA 2FU4A 3BJOA 1YG2A 2XAFA 3E6BA 3IWZA 3FMRA 1KQ0A 2RKHA 2H27A 4RS8A 1JXSA 4PCQA 1JHFA 1ZRCA 4S05A 5BMZA 3K0LA 1TTYA 4M6XA 3I59B 2BE5F 3VODA 2QWWA 4ENJA 3KEOA 4YFNF 1YS7A 2QUFA 1A04A 1I1SA 1J2XA 1Z91A 1YO5C 5LEJA 1AWCA 1I1GA 1D8JA 2XRNA 2GXBA 2D1VA 4F7ZA 3FHZA 2Z5UA 3LAPA 4I0BA 1RUNA 1SMYF 3KLNA 5D6EA 2F5EA 4YFKF 1FYMA 5JR3A 2VE8A 3JSPA 2HZTA 4PGGA 3WTTC 1QQIA 3K2ZA 2Y0MA 2CGPA 2QYOA 1YQAA 2XVCA 1FBSA 4HV6A 3V8KA 4CZZA 3MQ0A 1J0RA 4I98B 3GLXA 2KIFA 3N97A 5DCMA 3N4MA 1NHAA 1K78A 1K78B 2J5PA 2IA0A 4P5OA 2R7DA 2BV6A 3R60A 2CO5A 1QZYA 1R1TA 1TQPA 4EJOA 5ICGA 3KLOA 4M9XA 5HOOA 2UZKA 2A61A 3HSRA 4FHTA 5ICFA 4KA4A 4CYDA 3RPQA 4EM0B 2VBXA 4BAYA 5FFZA 1ZG3A 1HKQA 4Q48A 3IX4A 5HDNA 2DU9A 4KN4X 1MDMA 2PG4A
chains in the Genus database with same CATH superfamily
3H35A 4HSTA 5DKLA 2H6BA 4JX5A 4FOFA 4ZYHA 1XJ4A 2KLOA 5JHUA 4RM3A 4PKYG 2E2IJ 1WVRA 2VJJA 1D0ZA 3QYEA 3BTIA 1KYZA 4NDLA 1KVLA 2EWWA 3K4LA 2HDQA 4DXBA 1FOKA 5KVRA 1XCBA 2DOAA 4IZZA 3ZHHA 2XGDA 2LP0A 4ZYGA 1K57A 5E1ZB 2QGUA 3G2ZA 2V1BA 3OOPA 5LLQA 3HHGA 1O7LA 1P4XA 2ECBA 2NYXA 3LFKA 5K7ZA 3S17J 2PMUA 5EOEA 3TP3A 5CGSA 2HR3A 2PYPA 3S7OA 1I5QA 3PBNA 4UA9A 1D5YA 5FRNA 1G3YA 1TWAJ 1VQMI 1TVFA 1B72B 4DGWB 4I38A 2VZWA 4WF0A 3DLLF 1A35A 2KJCA 2MD0A 3V42A 3L2VA 3DKYA 3BQ8A 1IN4A 4G94A 4YG2F 3IHUA 3X2QH 4DN0A 3EQVA 4BENA 1P0ZA 1HCRA 2XDMA 5F6FA 3IF6C 1R4MB 2K3FA 1D1BA 2JK3A 1K0KA 5F5YA 2QQ9A 3JYIA 3HLWA 2DW4A 1IRGA 3WHBA 2IAIA 3PQKA 3OYJA 2R4GA 4E7JA 1A6IA 3K69A 2O3FA 4EU0A 2V79A 2XDVA 2ZM8A 2QF7A 4XK4A 4O3MA 5HPIA 2ZFWA 3WE2A 3VMAA 4I3IA 4DYQA 4LJZF 1K7AA 3F3XA 2MBFA 2ZMEB 1JWPA 2WZZA 4XONA 2WKIA 1Y56A 2A5YB 3T50A 2ELJA 2RQPA 4HPQA 1BJAA 2VJWA 2VX8A 4GFBA 4IX7A 2J3TD 2QKPA 4U0WA 2P8TA 1XSXA 4J01A 3I7JA 1S67L 4FX0A 2AXTC 2BVLA 4W1UA 3W4OA 4IEJA 5DVAA 4MBKA 4CH7A 2K85A 4ABZA 3GTLJ 1R6RA 1HKTA 2A07F 4BHPA 4FE7A 4AC0A 3E5XA 4BXFA 3HOZJ 1Q1VA 2DBBA 5FRMA 5HWVA 2PBIA 1SHVA 3MFXA 1NK3P 2W1OA 2R5YB 4V2FA 3GFMA 1P92A 1P4WA 4ANJA 3BFGA 4BS9A 5J8XA 4IBXA 2LSOA 1UB9A 2ICWG 2R7WA 3IF5A 2FMYA 4C2MJ 1P9QC 3ZG5A 5TGFA 1ETOA 1BI1A 1YLWA 5HLIA 4MFEA 2XPUA 3NHQA 4IF4A 4C3HJ 5E3NA 1MNDA 4PZJA 5F83A 1GA0A 1ZGAA 1KVMA 2K5CA 3G3ZA 3GTPJ 1TW3A 4ZJ3A 4XLPF 5FDSA 3RJPA 3EYIA 2WKHA 4ESBA 5K5RA 4I3JA 3WGGA 3J81Z 3GV9A 3RIRA 3GFJA 2MLGA 1I50J 2DQLA 3HOVJ 4AM3A 1NLZA 2Y0SA 2XRLA 4GD8A 1TZLA 2Y79A 5FAPA 3SDBA 1FWZA 1Y0UA 2K86A 3BQZA 4PJJA 2Q9NA 3V50A 2DTZA 4X6AJ 3HPHA 4G3WA 2HDWA 4M3FA 2ME6A 3TGNA 3U21A 5GP9A 3OSGA 3BTCA 1N9LA 2GJ3A 4GDBA 4IJAA 3MKWB 3IAM2 5HL6A 1MBFA 5KSHA 3Q81A 3TEDA 3SH7A 2A6EF 5EFWA 1LVKA 2JKRI 3VP2A 1D8KA 3KFWX 4ZYAA 2WB1N 4G7OF 1BC8C 2HVSA 2XAHA 1S0WA 3MAJA 2ZXHA 2X71A 3LIFA 1OYWA 4G7HF 4R4SA 3WS5A 4HSRA 3T4JA 3HREA 3I54A 1EW0A 2IP2A 5EEAA 4GYIA 4PK4A 3SHFA 2LG4A 1IV6A 1FOXA 3IT9A 2UV0E 4KICA 3D9YA 4FUWA 1X1BA 4NG2A 3DBHB 1VM1A 2LKPA 4DJ2A 4XLCA 1ORKA 1BJZA 3BTJA 3JW4A 2XHKA 3N05A 1ZG6A 4JGPA 1GHPA 4NB5A 2NRAC 2K9NA 3H9JA 2XK1A 1XJ3A 2L4AA 5F0FA 1PYVA 3LY3A 3MMHA 4Y4RA 4CLCA 2EPFA 3K4CA 3QHYA 3UB8A 1Y1VJ 5K7FA 4U7DA 1OQYA 5H2FC 1IN8A 1DQUA 4A2UA 3REOA 3V39A 1BULA 1MZBA 1ON2A 2NS8A 4L9JA 1BSGA 1HTZA 3ISGA 4GKUA 2HXOA 2FA5A 4IHTA 1S7AA 3U2AA 4CHUA 2V6CA 3MN2A 1ENHA 1EH7A 4CZCA 1IF1A 3VFFA 1S5LC 2M4GA 2R7XA 2LB9A 2ZM2A 3S1NJ 4DJAA 4A3DJ 1PI5A 3F22A 5FQIA 1PWGA 1WJEA 4R1GA 1MMNA 3CCEI 3G1LA 1H8AC 3BDDA 3U1KA 2KDZA 4A6DA 2OJED 4F93B 3SEZA 1Z3YA 2FBHA 1B8IA 1TWFJ 4C2UA 4M73A 1F43A 4DYCA 3BR2A 1F98A 3S15J 1S1ZA 1AKHA 3E0JB 1E0EA 3NAUA 5E20A 3GDIA 3OC2A 3EQLF 1WI9A 2DFEA 3LIDA 4N9LA 4HEA2 3IHBA 4QPRA 2L4MA 3Q1FA 2KT0A 1Y0NA 4L5IA 4MLLA 4CLCC 4LLLA 3TE8A 4PJ0C 5EEGA 3QP2A 3UDXA 3GEZA 4HLXA 5B1BH 3HOTA 2CV2A 1ZGJA 2HOAA 3F8CA 3ZMVA 4EEFG 2QM3A 5B1AH 1SFUA 3WS1A 2WA0A 3P9CA 4D7MA 3K4JA 1FSWA 4B1RA 2HJEA 1W63M 3W6VA 3L2UA 2HDSA 2OTLI 2BTFP 4XT2B 2LKSA 4JLFA 1HVBA 2OZUA 2EILH 3S3NA 2KDOA 1JKPC 3D72A 3CP8A 4AWXB 4M6VA 2W25A 1K55A 1XS9A 4ETSA 3BEBA 5ERIA 4DDSA 3OYLA 2M8GX 3PO2J 2QWSA 2OOLA 3DTEA 1BLPA 3CAXA 2LBFA 1TEMA 2L4RA 5DKKA 3CWFA 5FQJA 2WAQA 1ES2A 2DQRA 4P55A 3JVUA 2Y91A 5HNFA 3DEEA 4A5NA 5TR7A 3KIOA 1GA9A 3FMQA 3HL2A 1OMEA 1UG0A 4KMUX 4XN3A 3S7QA 3HGYA 3ZFZA 2M9HA 4Z6YA 2MD5A 3CLQA 3KP3A 2E2JJ 4NHJA 3BCBA 1XX2A 2M45A 4IRIA 2PHYA 1S4RA 2Y31A 3C38A 3CJTB 3LSTA 2EZHA 4HV5A 1O7FA 3ESWB 5FJ8J 2FOKA 2COBA 2WGWA 3N7WA 4H6JA 3QPSA 1R5GA 3O2PE 5CVJA 2HOEA 2JJ7A 4HX8A 4DBQA 1HBXG 2KRHA 1T19A 5AIPA 2F4IA 1SMTA 1G28A 3G6OA 4GDNA 3C18A 5E18F 2H0TA 4MN6A 1S9HA 2KKOA 1P7IA 2LB5A 4PDKA 1YM1A 1QNTA 1ERMA 2OLVA 4PKYA 1VQOI 1ALQA 3H7WB 4LCMA 2PJRB 2JSCA 2D5VA 1A36A 1PFLA 3A01A 4JXSA 3HSEA 3NOPC 3NOTC 4I7HA 3BY9A 3ZXSA 5DD4A 3CUEC 4ZDXA 2O9BA 2QZ6A 4WMCD 4UNOA 3OPHA 3BY6A 5BPIA 2K3PA 4II3A 4A3BJ 2O8KA 3F9KA 4HA8A 1X2MA 1LUJB 1OMIA 4XSXF 1W0TA 4HNTA 1BR2A 3JPUA 3HOSA 2MW8A 3WTWC 1IGNA 2G2WA 3ZQ7A 3M4OJ 4EQIA 2X4HA 1QVTA 4ZRRA 4FT8A 3F1PA 3FG8A 5CGWA 2M1BA 1U2WA 2XKOA 1ZHFA 5CEBA 3ZGAB 2BXYA 2OF7A 2R7RA 2ISYA 2VLAA 4ZJ1A 5DTKA 2LY2A 2K4JA 3MD2A 1LT0A 3TQNA 4EETB 2PYRA 2VV7A 4X53A 5DF8A 1YIJI 1ZLJA 3T0YA 3V4GA 4QLCU 1YMSA 1UWNX 3G1MA 4E7LA 3G71I 1G59A 1CI9A 4JGQA 3KYCB 1XC5A 1EI5A 2ECCA 4HQEA 5CVRA 2DA6A 2ZBKA 2QJ5A 2VQGA 2X1DA 4JX6A 3KSFA 5F1FA 2KFDA 2E8JA 3W2ZA 3QODA 4GHIB 4A12A 3NECA 2HYGD 2VODA 5FASA 4BBRJ 3OS0A 1Y54A 3IV5A 1YLPA 4XKCA 2GXAA 2E1MB 1OFCX 3E3VA 3GZNB 3KSHA 2GX5A 2V8FA 2Q9MA 4FTHA 1FCOA 1ULYA 3M07A 4UQIS 3S22A 3RKQA 5HW3A 3CF2A 2BY2A 5IYCJ 3FXKA 2P6SA 1IYQA 5FLXK 3E98A 4Y7PA 3T8RA 4KYWA 1VHMA 2GOXB 2LREA 3R0JA 1YSPA 2V4JC 1W7FA 3W4PA 4HBLA 2EXAA 2EX2A 1MMGA 1V3FA 3BR1A 2WUQA 2EH3A 3C7UA 5D5UB 2RGVA 2M34A 4I02A 4X56A 3C7JA 3AG1H 3FISA 4YIFA 2ME0A 2YS9A 1IYSA 2ZQCA 2QSHX 2Y48A 4BEHB 2V9PA 4C9YA 3A03A 3VV4A 2DA4A 2DT6A 2Y2HA 5IT5A 2Y2JA 3DTIA 3HUGB 1VQ6I 4R3BA 1YOVB 1FOWA 3WU1B 3KYZA 3CUQA 2LYCA 3K70C 4EATA 4DE3A 3OYBA 1RNLA 1BZAA 1UELB 1ZAOA 4LFUA 4UVCA 4M3EA 2INWA 3K1PA 1GVJA 4B3AA 4NQWB 3V8LA 2GQQA 1NYMA 3LSKA 3CCVI 2E1MC 2R7TA 4GGGA 3C1DA 2Q8KA 1GSXA 3LCEA 5EUAA 1IV8A 1MWUA 2DXIA 2FH5A 3EGDC 4Z2YA 1F9IA 1TS8A 3CZDA 3TO9A 1N78A 3GTJJ 1JVJA 1NZOA 5FO5A 1U0JA 5H6RA 1JTDA 2DJIA 3K3DA 3VOYA 3WU0A 2FEZA 1XTAA 1V5GA 5F04A 3UDIA 5J47A 3KEQA 3JAMK 4BH9A 3K3CA 3RZDJ 1BL0A 3FXOA 2XA7S 4RAGA 1GSWA 2JKFA 2P81A 3H3UA 3NY4A 3D5RC 1H9GA 3S4XA 3TSGA 5M5YJ 3GTMJ 1FCMA 2ETHA 5AVEA 3S1YA 4OOMA 3JVVA 2DMNA 3KYEA 1BA5A 1PI4A 1ETVA 1M6KA 3EEAA 3C4OA 4KQQA 3ZRGA 3TW7A 1MSEC 3R7WB 4AIHA 1E3UA 1TBXA 3IXHA 2UXNA 4RBOA 3NOUC 1U8BA 2JA7J 1T1AA 2H5SA 4MFDA 4E4HA 5IT3A 3WTZA 3OZHA 4GN2A 5HDSA 4Y0OA 1PJRA 1SFKA 1E3PA 3GUDA 4G6QA 1IG7A 1FSHA 4F55A 2FE3A 3L9KA 4WELA 3GTQJ 4YIRX 1J75A 2O7OA 1LQ1A 5E1XA 3MCZA 4WN5A 1FSEA 1ZC2A 1R49A 2XAGA 1P9RA 4I01A 1WJDA 1QA6A 2Y2QA 4HJ6A 5HLHA 1YJ9I 1QVUA 3CI6A 3SH8A 2DDBA 3WGIA 2CUEA 3EUHC 3V7CA 5MC7A 1YLYA 1W4MA 2HU9A 2KMUA 1T18A 2XLNA 3JRAA 4K91A 3IWIA 2ZC4B 2IWCA 2W0NA 3KYQA 2F4OB 1LDJA 3C2HA 4A3KJ 2VKSA 4A3GJ 3QP4A 4M3KA 2HP6A 4WEKA 1QU3A 1QHHD 2L5QA 1J9MA 1FT9A 2JKRM 4BD1A 5HAPA 2EFOA 4K08A 1DGWY 1GHIA 4UUVA 3GBGA 1QZZA 1ZRDA 2L9SA 3RDIA 2VQHA 3VOEA 3BG6A 3OYGA 4AYBN 2FMLA 4BQNA 5FD6A 2GIVA 2WKRA 4YOFA 4Y52J 1X0OA 3BROA 4EUVA 2R7SA 3PO3J 2JKTI 1J09A 2EFQA 1YSQA 1E2XA 1J9IA 4B8XA 3B42A 4KENB 2LLKA 3BR0A 2DTRA 2V2FF 3E4PA 4Q8IA 3MFDA 4N4NB 3W6JB 1ESUA 3A3JA 2KRCA 4XMYA 4D9JA 4DQ2A 1ETWA 2VL8A 3DBRB 1PNEA 4NXEA 3CCRI 4MTEA 1D7EA 3FYZA 4PFOA 2STWA 5CLSA 1O3SA 5TRDA 2PX9A 1NJ4A 2JHEA 3F6VA 2O99A 2KDKA 2CUFA 5GHYA 3OOUA 5HPFA 5F0CA 4BE0A 2ISZA 1UFMA 2WTEA 4EGYA 1KU7A 3HLCA 1BR1A 2HWVA 2BLSA 1MMAA 5G18A 4A3FJ 2ZQ7A 5DYMA 4E04A 3ZPLA 1K6YA 2WGVA 2H1LA 2OBPA 2HI3A 3G6EI 5EGOA 1LFUP 2H6CA 1CEGA 4P6ZS 3PL8A 1APLC 3EEHA 3UE6A 1I6XA 4IPAA 3RYPA 4DW6A 3G73A 4O6JA 4JP0A 2IWBA 1Z05A 1F2KA 5LEKA 5GAEJ 4HJ4A 4XLHA 4OMZA 2GDNA 5FKLA 3GSGA 4BKXA 2O5RA 1OKRA 3D1NI 3FWLA 3MQOA 2XKPA 3KYLA 4DMZA 3V7SA 2WB1A 1WGXA 3IP4B 3I55I 4IVKA 3LSRA 1RGZA 1W5SA 3CPTB 1ES4A 3Q7VA 2EV0A 3F23A 4P87A 4CCMA 2M7UA 5JYPA 2LC2A 2GIZA 1MSFC 5DTSA 1T0FC 2DCEA 2X6WA 3ABKH 1W7PB 4F91B 4I6ZA 1DDNA 1R5ID 4OH0A 2FJ1A 4NUBA 1TT5B 1WJAA 1G3TA 5EG0A 1KQ9A 2E19A 3MKZA 4UUTA 2CV0A 3K4BA 3HRTA 5J3LA 2X48A 2EZLA 1LE8B 4BNCA 1K25A 2Z1DA 4GZBA 1WZ2A 5E17F 3BG3A 4EUZA 4CCJA 3OIOA 2Y8HA 4QWOA 1ZQ3P 1R7JA 3KP6A 4IJGA 1AOYA 1OYIA 3W4QA 5HS7A 4X69A 2COMA 2VKDA 5A93A 4NXBA 2N8GA 4PSXA 2OC6A 5E79C 2Z6DA 4GS9A 1QGPA 3BLYA 4FSFA 4EJTA 1S3JA 4FETA 4XNFA 5IYBJ 5M3MJ 2EFWA 4BBSJ 1BW5A 1R1UA 4E7IA 2MLKA 3GXOA 4AIDA 4A3MJ 1ONGA 1DJBA 1OYYA 2PN6A 1FTTA 4F52A 3ZG8B 4RB1A 1G5UA 2K9QA 3E1SA 1YS6A 3I53A 1P9WA 1VNDA 4IQJA 3HC7A 4M9SA 5EVIA 4XLEA 4M71A 2P7VB 4OIPF 1G6OA 4UA6A 5EEHA 4S2MA 5DF9A 3BCAA 3L2RA 4KZ5A 5KSCA 2G9WA 2XPVA 1N75A 5DEQA 4ESPA 1ETQA 4JOMA 1KGFA 4WMCA 3P9IA 4A3EJ 4GYGA 3ABLH 3D5LA 1CJFA 1YLZA 5F68A 2CSOA 2Y75A 2V1NA 1B6AA 3S2DJ 1L0GA 4HH2A 4Q0JA 1LVAA 3I9V2 3HBLA 1LJ9A 2W3FA 3ZOBA 2LDUA 3JRGA 5AJGA 2XAUA 4O01A 1IRXA 4I76A 5A91A 5J1UA 1VQ5I 3I0TA 2Y55A 3E4QA 3EPZA 1K6SA 2XAQA 3BR3A 5EJCA 2FD5A 5A92A 4MEXF 4IUKA 1MGTA 1IN5A 2ZJPF 1KE3A 2C6WB 1JTYA 2QJ7A 5CHMA 5D3OA 3O3KA 3V7RA 1IUFA 1LSWA 3MJQA 1KGSA 3F1OA 3LA2A 3T4QA 3P7NA 5DFYA 1JUPA 1USSA 3HLGA 3SS3A 5TBMA 4KIGA 3OYKA 1Q1HA 4H8RA 5EVIC 4LG0A 2B63J 5L10A 4RX3A 3IXDA 5L3CA 3BZCA 5JYOA 4L9EA 4N1XA 1H5XA 1T98A 4O8GA 2DAOA 3CCYA 3DEUA 3G34A 5LFAA 3HPGA 4BJTA 2Y69H 4JPMA 3S3MA 3T1XA 1BOAA 5FD5A 3KX2A 4U87A 1XA7A 5DCMB 3J7ZI 4RM2A 3MKFA 2JTVA 3M8JA 4LB5A 4B93A 4YWZA 3HYIA 5J40A 2JWTA 1SVOA 2DYRH 3E97A 2FFYA 4MEYF 4EV4A 2JBFA 3K4NA 4EGZA 2CH0A 5TJJA 1L0FA 5FAOA 1NH3A 1AU7A 1H9TA 3R4KA 4CGZA 3CMAI 3C2GA 1WE4A 1FP2A 3CC2I 4N1HA 5EM1A 2PFBA 1DRMA 3T12B 1YQSA 2DYSH 2QBYA 4UV9A 4OLGA 1V4RA 4WLAA 3WTSC 4XORA 1HSTA 4RB2C 2DA1A 1DU0A 3C7VA 4RB0A 1PUFB 2PJPA 3G2BA 1D0XA 5BOXA 4ZH4F 1X1PA 3HTSB 2EK5A 1O57A 4L9FA 5CPRB 3LQQA 3O8GA 1FBQA 2HKXA 5GPCA 1MKIA 1T1CA 4KG6A 5BPDA 3MMYB 3VWBA 4BXXJ 2CQQA 3W3CA 2OAQ1 4E6XA 4O0PA 2NAZA 3O8HA 4A6EA 1MMSA 4R23A 4S2LA 1H3QA 3PFYA 5D5XB 3Q5FA 2HVQA 4H0EA 3VPRA 5LGUA 1GHMA 5CXWA 1GUUA 1MNEA 2KLIA 1ES3A 4PHTA 4PM9A 1MDMB 2R9WA 4E7ZA 3ZG7B 4BACA 5L07A 3F6OA 4M74A 1JKQC 4IVNA 4M3BA 4BDYA 2CMPA 4HI4A 4MMNA 1RI7A 1WWXA 4K2EA 1Z1DA 2BY1A 4KT5C 1UHSA 2XD1A 3ASOH 3UB7A 4WF2A 5GAHJ 5D5WB 2XGXA 1H8YA 1P7JA 3FV7A 4P9UA 2Y2IA 3BPVA 3I64A 1RZ4A 1OCCH 2K27A 3LQRA 2FBKA 3HDDA 1NY0A 3A3EA 1FYLA 2OWHA 5KMWA 4PJLA 4HDVA 5AQBA 2IXSA 2A2LA 1J7KA 2PMZN 5BS6A 1YFHA 3T8TA 1MNMC 2P04A 4ON0A 4G6TB 1UG2A 3NARA 1EH8A 4OOIA 1JJ6C 3T4KA 4A93J 3WS4A 1W5DA 1MJBA 4IHWA 4E3OA 1MH3A 5FA7A 5A2QK 3MXSA 2A69F 1E4DA 4Y33A 1QMFA 3K9TA 2DPDA 2CG4A 1GVDA 2OD5A 4O7DA 1DUXC 4R38A 2AQEA 4RX2A 1LDDA 1G8XA 1D1JA 3VP3A 2W82A 2CQXA 1HD8A 3PXPA 1XP4A 5E43A 3UY6A 1V5EA 1LI9A 3SFZA 2CMNA 5LBQA 3R6SA 2ZBBA 2DDAA 3GO5A 3BM6A 1XD7A 4HP9A 1D1AA 3W6KB 1DJAA 3SZGA 3A0HC 3LIAA 5C44J 1NLYA 3ITBA 1O7EA 1YRNA 2B7EA 1PP8F 4U88A 1BI2A 3MFKA 1K57C 4Z1WA 2EIKH 2R7FA 1T38A 3CO7C 3VP0A 4E3IA 5HSQA 3VFZA 5C4XJ 1JWZA 1SCWA 3E2LA 4GCVA 3QNCA 3PAGA 2XD5A 1VQ7I 1KDSA 1XGNA 4BU2A 3GZ5A 2JUGA 3FZVA 1XFNA 3I56I 4EVIA 1LKXA 2HXIA 2EFUA 3ZDJA 1XMXA 3NRVA 3QPHA 1HOMA 3HLBA 3I4MJ 3I5UA 2V20A 2BY0A 4LK1F 2JA8J 5CRFA 4UHTA 1E25A 2PAVP 4QY6A 2E1NA 3CCSI 2V1AA 3LUQA 5HL1A 5CVIA 2JKTM 2IT0A 2ZM0A 2AHQA 3EETA 1ETXA 1YW7A 3CZ6A 3HOUJ 3UE1A 3HKZN 1T56A 3VDXA 3CDLA 2WC2A 2UXXA 2W7NA 1G6AA 1Z3XA 4RAZA 4A0YA 1VQKI 5IOYA 3GRJA 5HZHA 4EBNA 2F5CA 3ZMUA 2V7FA 2WAEA 1XGOA 3PNTA 2PMHA 1T1BA 2H8WA 3ERMA 4X1EA 3JRBA 3QOEA 2VGKA 3ELKA 4WK8F 3M1CA 1CGPA 1LFBA 1DPRA 5AONA 5LGNA 2KHMA 5FQQA 1ZG1A 1FMVA 1OTEA 4ZTKA 3B6AA 3CCUI 3A2KA 1GLNA 4S2KA 3EOIA 1XN7A 2GZWA 1WYBA 2DRWA 2FNAA 2O03A 2Q2EA 4DE2A 4ZBEA 3K4MA 2CW8A 1PW8A 4KZAA 5CEDA 5IS1A 2HDUA 5CTNA 1SD4A 2L7KA 3SZTA 2J9PA 3V67A 4Y2FA 1WJBA 2YR2A 2HQNA 2UUZA 2VC0A 5HLGA 3BZKA 2ZNYA 3GTGJ 1K54A 1MJAA 2EWNA 4LB6B 5J4VA 1Y1WJ 4CSWA 3M7GA 2EFXA 1W5CC 5E1WA 1O3TA 1TD5A 2EA9A 2ZSHB 1MC0A 3FM3A 1TS0A 3MZDA 1YLTA 1RESA 4HLYA 1VQQA 3BP8A 1ODDA 5LBRA 4R6LA 1TNSA 4XL9A 4N0BA 1POGA 2BZTA 2HQRA 3VYUB 4KJZA 2QKMB 4G7ZF 3QU3A 1FZPB 1HW5A 1VQ4I 3VP4A 2GAUA 4CJNA 1ZRFA 2XROA 1CQTA 5DTDA 3GTKJ 2QZ8A 4M72A 3H82A 3DBLB 1BT5A 1H89C 1MD0A 2VA0A 3MWMA 2Q0OA 3LOCA 5JI6A 4Y15A 3IWQA 1IRZA 3LYXA 2LY9A 4MBHA 4U0YA 1BLSA 4WUJA 3BECA 4MDZA 1U9NA 3BWLA 1YYVA 3DWKA 5D6FA 4JBFA 4EJUA 1ZELA 1XB4A 4YFMA 4CLCB 5IYDJ 3CTAA 5FLXZ 2M7VA 3A4CA 2DODA 2ZNZA 3Q0UA 4MIMA 1R22A 1YIOA 4QSHA 3GFIA 1IJWC 2BEOA 1OJGA 1ZG5A 2PBYA 1FY7A 5CVVA 1D06A 1K54C 3PQJA 4IRGA 3GR2A 1MH4A 4D1QA 2V0UA 1I27A 5K5QA 1IAWA 1O3QA 4OIRF 3V8JA 4B44A 4QPQA 3OYIA 1WCMJ 4DZJA 4EQQA 4LRZE 1H0MA 4E3MA 2EZKA 2NOJB 2JA2A 4EWFA 2ZJ2A 4JGRA 2HTSA 2IGKA 1WA9A 1VQPI 2IWDA 3L2WA 4DZPA 4C6YA 1IN6A 1W5TA 5HLTA 4L9TA 4O5VA 1L0OC 4A3LJ 3DU6A 2MG4A 1MWSA 3H5RA 2WADA 3TO6A 1KE4A 2OQGA 5HDCA 1YJWI 2VBZA 3GTOJ 1YKDA 1B8IB 2J7VA 3IBRA 2Y9ZA 1ZGWA 4NEED 4NXGA 5CJ9A 5F1RA 2K7LA 2CUZA 1NTCA 3IHAA 5L3DA 1AKHB 2L1MA 2XH9A 4UAAA 2P0WA 5E3MA 5GLCA 4ZDPA 2H8RA 3Q7ZA 2FQ3A 1G68A 2QSFX 3BFEA 2JA6J 2M1CA 3CHWP 3MZFA 3DU5A 4MO7A 4Q4ZF 2CYYA 5EOOA 4GXOA 1XFQA 4B09A 3ASNH 3JAMZ 3H92A 3OYEA 3BC8A 5M5XJ 3DKWA 4HESA 4BMWA 1JNUA 1B4AA 4IHQA 4C3QA 4I09A 2PU4A 3GX4X 2W00A 2H1KA 3KP4A 4UV8A 1IC8A 2WK0A 1TS7A 4YINA 1F36A 2V9VA 1Z7UA 2EFPA 3S8PA 3ERED 1W8QA 3WS0A 4KUKA 5F08A 3T4SA 2HOTA 2EZIA 2CRGA 3SFIA 3NWTA 2QEXI 3TBIA 1G4DA 1NYYA 2EX6A 4XKVA 3NCKA 2LBFB 1MIJA 2HDCA 1ZREA 3MZHA 2H10A 2FBIA 4Y3IA 2ADUA 2YUSA 1WYCA 2IS1A 1WJ5A 3IH3A 1XMAA 3U1DA 1W36D 3RXXA 4HAMA 4KUOA 2VKVA 3ZG9B 4P96A 2VT3A 1XPBA 2B9SA 4M6YA 4HOIA 3T4TA 1RPWA 2DO7A 3FX3A 1Z9CA 1K4FA 2IA2A 3UPNA 3FXUA 1F5MA 2LF8A 3OBFA 1Q2QA 1EA3A 2QVOA 4CUGA 4ARZA 3B47A 3TRCA 1T6SA 1OCOH 4L18B 3FXQA 1WSUA 4KQOA 1K79A 1XMKA 2GA2A 2EX9A 3BG9A 4XXRA 4KISA 2M8EA 3A3DA 3QP6A 5CYVA 2F6CA 2WGWB 1KU3A 3HGGA 3MSHA 3C4PA 2LK2A 1FTZA 1O3RA 2EBIA 2PEXA 1YPRA 2JN7A 1WFXA 1STZA 5E8GA 3ZNTA 4DKIA 5HAIA 3ONQA 3M2JA 5F1GA 1K55C 5J8CA 4CYCA 2A5WA 2W3HA 2JA5J 1G3WA 2BY3A 2M4KA 3TP0A 3A01B 2VKEA 1PZPA 4OINF 2D45A 1SD6A 2XF5A 3NJAA 2BW3A 4DIQA 3V3RA 4B9OA 1ERQA 1ZK8A 1DPUA 5B5EC 5DD8A 4PM8A 3DPUA 4FE4A 3RKYA 1HC8A 2V9KA 1D0YA 1OPCA 2P6TA 5LHGA 1KOUA 3K6GA 4OKPA 4JXWA 1JWVA 3CD6I 5EE8A 2F5DA 1FBUA 1MY8A 2E7WA 3CUOA 4YIIA 4DOZA 5D5VB 2XF7A 3CMYA 1I3AA 2HFHA 4IKFA 1TT0A 4S2NA 3FKJA 5JLXA 2VE9A 3O6BB 1TDGA 3F1PB 3MZEA 4RVAA 3ZQFA 2HPMA 4IHSA 4QTRA 1K6OA 2RVCA 4HX7A 4IQ4A 2LNBA 1QPMA 2BBYA 2W57A 3L1PA 3G4SI 1AHDP 2VPLA 2W24A 1U60A 3J81K 3SEQA 1LDKB 1IXCA 4M3DA 3S1MJ 3IRRA 2IRFG 4YEJA 3MQQA 4LLOB 1MW7A 3DCFA 1T8IA 4N9KA 4AIKA 5L3FA 5FEFA 3JSOA 1QRYA 1PIOA 4NETA 2LOOA 2OWJA 5L3GA 1KONA 3HHHA 2KX6A 2O61A 2WKEA 1YW8A 3ABUA 2P7JA 3K1NA 2HP5A 3TOBA 2QCOA 3EDPA 1YHQI 3CESA 1I2WA 4P6BA 2LFBA 2XB0X 4R1HA 1CF7A 5J8FA 1SKOA 3DWLE 3DXJF 5K7HA 1SKOB 4U0VA 1P2FA 1TL8A 3N8RA 3OR2C 4GNUA 1FPQA 5ICCA 3AKZA 1OJ5A 4BL3A 3A02A 2ZKZA 4BY1J 3AGEA 1K83J 4ZYDA 4ZTJA 4KG2A 4NNJA 2HPIA 5M19A 3T1QB 2HQAA 3LA3A 2PQ8A 4IRHA 1IOUA 5L09A 4ITVA 4PM6A 2MH2A 2MYSA 2P5KA 3GYHX 3LFVA 4BJ6C 5H20A 2BG1A 2RL3A 2P9VA 1KQ8A 4Y17A 3NQOA 1TW2A 2JPCA 5F0HA 3FXRA 1WJCA 4B3XA 3S2WA 1XJ6A 3MXQA 4IBRA 1S8NA 4A5MA 4E3LA 2MC3A 2HS5A 3A3IA 3T4OA 5GADJ 3BLSA 4I2OA 2WV1A 4IVIA 1ONVA 5D4RA 3OMYA 3CUQB 4MTDA 4FCFA 5HODA 1IXSB 3CCJI 2R5ZA 4JX4A 1X3WB 4MNUA 2JKGA 4WX9A 3M3YJ 4U7BA 5E2EA 2WY8Q 4ZDLA 2Z99A 4CXFA 2G7UA 3CDHA 2EQRA 2VEAA 3PFIA 3C30A 3ZGKA 2OV5A 3UE3A 3G35A 2BOLA 4HNUA 3IRQA 2EA4A 3NDEA 1E17A 1V9YA 2KIQA 1U3EM 3NIAA 3VB2A 2J3WA 3TJZC 2A3SA 4LIVA 3DF8A 2J3TC 3LIEA 5FI2A 1XXMA 4C75A 4LD5A 3BYDA 2JPBA 2X85A 2RC4A 1S7OA 3C2WA 2PMZA 3HZJA 3ULQB 1XDUA 4PPRA 1ZN2A 1UAAA 5HAQA 3H5NA 2WKQA 4OU0A 3ZQLA 3HSFA 3UB6A 4CCNA 2WYXA 3T5XA 1RR7A 3JRFA 2M5WA 2I9VA 4OAZA 1J59A 1MWTA 5DUKA 4EJWA 3NDGA 4E70A 4EERA 4UB6C 3J7AY 2VBWA 4KFCA 5HVQC 3HM5A 2HYFA 3D4FA 5FKOA 1R9TJ 5C3EJ 1EJ9A 3GCMA 3J7AO 2L9RA 1P4AA 2Y2PA 3H9QA 2ZOIA 3HUOA 5FI6A 2K9MA 3CC7I 1F5TA 3IH8A 3CUQC 1TQMA 1RKTA 3IS2A 4BLMA 4QPOA 1LPQA 4QU3A 1IN7A 2WZXA 2DMTA 4B4XA 1YAXA 2OAZA 2CFXA 3ZQGA 1FR6A 1Z67A 4LV0A 1W1WE 1R36A 1R23A 2MC4A 2A6TA 5F64A 5D8LB 2ZQAA 3F1NA 1MBLA 1GSVA 3TKYA 5HS9A 3KP2A 5HDGA 2ZJ9A 3SH9A 4L5JA 2JQ7A 2HVRA 4OOLA 3NWSA 3ZMTA 3LSMA 2X6OA 3LSIA 1HDDC 2ZMFA 6PAXA 4KG5A 2L7FP 5E8IA 4S2JA 4WEJA 2Y2LA 4DDYA 1JI8A 2XC7A 2OCCH 2EB7A 3LSPA 2YU9J 3KSIA 3MEXA 1TWHJ 4P85A 3S3OA 1QMEA 2ESHA 3SOIA 2D1HA 4BY7J 3VYSB 3IC7A 1HQCA 2ELKA 3KE2A 1BOBA 1QPIA 4C3JJ 2Z9OA 1MKMA 4F92B 3BJNA 3NEUA 1YLFA 4NC7A 3FXMA 5HFOA 4OQIA 3I4NJ 1HXDA 2GZAA 2DPUA 3DP7A 2Y0SN 3FK6A 2E8IA 1QBJA 4HOBA 4BDZA 3KPHA 3HOWJ 1FC3A 3I4PA 4XRSG 1FLIA 1ODVA 3LR4A 5AVFA 2X9DA 2IPQX 3MKLA 2H94A 5AQ9A 2ESNA 3GMEA 5GPAA 5DCFA 3GFLA 2JSPA 1R1VA 2CWEA 3Q0VA 1HLVA 1JKOC 3ABTA 3OPRA 4GD6A 2H09A 2L0WA 3WTUC 3BFDA 4LOCA 1IDZA 3TO7A 3GWZA 2DLLA 1EH6A 2VV8A 4AD9A 3UDFA 4NC8A 1FYKA 3G32A 3OPLA 1OISA 3CJQB 2HGCA 2W3EA 1HSJA 1JT6A 5EGOB 4DE0A 1O4XA 3RQ4A 4M3GA 5JHFA 2M2EA 1BUEA 4U0TA 3KZIC 2O9CA 3IKVA 3O87A 3ZQHA 1B1BA 4RB3C 5IP7J 3PJRA 3RPUD 5AQ7A 5EV0A 3COAC 5CKTA 3OYAA 3HOXJ 2I8DA 2D2WA 3OL3A 1WKMA 4HJ3A 1LLBA 4MNRA 2DFHA 5E3LA 4S2OA 4KZ8A 2RREA 3DLAA 2STTA 2QYBA 2KIMA 2P5VA 1HDPA 5IP9J 2CW0F 2ZCWA 4WWCA 3K4KA 3M6HA 4D60A 1TLHB 1E3OC 3Q7VB 2WV0A 4OMYA 4OPYA 4Q5SF 4XRFA 2WAFA 2JN6A 5CVUA 2YU3A 2L7ZA 3KEYA 3ZR8X 5EG0B 3CJMA 2X1CA 2YX4A 4WXCA 2GM4A 3PBTA 1GV5A 2Y59A 2B0LA 4MGRA 3FZCA 3U4LP 3LR0A 5KIZA 3ZP5A 1F1ZA 1ZTUA 1JT0A 3TOIA 4ETXA 4RAYA 3B6CA 5FL3A 5ILSA 1P6RA 3Q9SA 2X6YA 5JLWA 3BT9A 1ZKGA 1KDWA 3N8LA 4S2PA 1Y6IA 1TS6A 2UWXA 3L7WA 2V1ZA 2ELHA 1N77A 4IOAF 1N4OA 1SC7A 3LI8A 1X4PA 1IKIA 2GNXA 3DKXA 4IXAA 2UWMA 1R71A 5BNGA 2ZMAA 3QYFA 2M0CA 1IYPA 4XN0A 3PAEA 4NC6A 2CUJA 4GS9B 4UHUA 2E34A 5DV5A 1S4SA 1AA7A 2V9AA 3FKIJ 2FSWA 5A2QZ 1VQ8I 1PYYA 5C5KA 3W2VA 2GLOA 4PAUA 1ETYA 1Y8RB 3K2NA 4HH3A 2O8XA 1OCPA 2HZDA 1ES5A 3QP5A 2OLUA 1IDYA 1XX5A 4A3JJ 1K6RA 5K5BA 3TMOA 3OYFA 5EVIB 3FBIB 4MQ9F 1K38A 2B95A 4FH4A 2E1OA 2W48A 3RKXA 1YMXA 4R3AA 3CF5F 1TDLA 1S29A 2EV5A 2J5OA 5GTHC 1JUMA 5FLVA 4J19A 2ZXIA 1BI3A 3AG3H 1SZVA 4BYYA 3LWFA 3F8BA 5D4SA 3GQZA 4ZAMA 2HYJA 3LO7A 1KGEA 3L00A 4ENMA 1VETA 2HF6A 1HKSA 2HEOA 2M0MA 1FNNA 1Y8QB 1I39A 3I59A 3MVPA 2O6GE 3G30A 1JE8A 2V6EA 3IXBA 3IL2A 2ZJRF 2RAEA 4CQHA 2XFTA 3QOPA 2KRFA 4EM2A 1I3QJ 1A5JA 1N9NA 3SQNA 3QRFF 2NOGA 4QHCA 4HQAA 3GVAA 3L09A 2EINH 1RCJA 5IU1A 4EXOA 1KU2A 3FM5A 3F8FA 1SFXA 2V1XA 2NUPC 3TDZC 4A0ZA 3F1OB 4LITA 2WWYA 1PVEA 4L9GA 4OQGA 2VJ4A 5KHDA 1KYWA 1LEBA 5HARA 5TBMB 4LG0B 3PBOA 4F3LA 1R4NB 3S2HJ 3SS5A 4B43A 5CTMA 2DMUA 2B5RA 2NS7A 1YE9A 3LSGA 5H6QA 4BUPA 3ZN0A 2ZSIB 4HY8A 2V1UA 1WI3A 3V5MA 3PUBA 1J3WA 2V8CA 1OR7A 3OS2A 2VJ5A 2A6HF 4J00A 3BFCA 5J4YA 3H9WA 1TWCJ 2JT1A 3LR3A 3WS2A 3LSHA 4UUSA 3HVFA 1PZOA 4RDUA 5M5WJ 2FZ0A 5DS9A 4X68A 5DTTA 1Q2PA 4CICA 3OSFA 1Z6TA 3FIWA 3M9AA 2LD5A 5HD3A 2MABA 2XB5A 2ID6A 4MLOA 3FKVA 4ZZLA 3FPWA 3JRDA 2R7OA 5HX9A 2K02A 3SS4A 2NVUB 3P5JA 2J9OA 2D01A 4D5CA 2HGVA 2QBYB 2IGOA 2VGLM 1X1CA 2XGCA 2ZC2A 3RKWA 3HLEA 1VQNI 2TCTA 1H88C 2EIJH 4PJMA 3RZOJ 1PW1A 2AS5F 1B9MA 1FSYA 2JUCA 3E5QA 4Q0HA 2HDDA 2QENA 3AFHA 4L0YB 4ZJ2A 4IO9F 3GTCA 3V3SA 3WRZA 3TW8A 1SFOJ 4N9IA 2VK3A 2XGNA 2QHKA 1SAUA 1HA8A 3M8FA 1NG6A 3HRUA 4OPQA 1JGGA 3BG5A 2RN7A 3OWTA 5LGTA 3T1RA 2A49A 1EV7A 3WU2C 4YFXF 2VV6A 4K0WA 1WPKA 5J3WA 2CQ7A 4OPRA 5DJUA 2L02A 5DFXA 3KZZA 4HQMA 5IT9K 4DJ3A 3SJMA 2Z33A 3VEPA 1GXPA 4EM1A 1T33A 4R79A 1BIAA 1XSVA 4XSZF 4E3KA 2K4BA 2CJJA 3BZ6A 2OCEA 5GAGJ 3JTGA 4GDFA 2ZD8A 3BOQA 3KCCA 3FWEA 4AFIA 2XUBA 3QU6A 1NRFA 2XAJA 3JR9A 2DJNA 2YKHA 2QKLB 3LNQA 3L9FA 2Z2LB 2OTJI 1YW9A 2FUG2 3CQZJ 5AIQA 4EJVA 1LL9A 3J80K 5FB2A 4CCLA 4FD8A 5EDNA 1K4TA 4X25A 3K2AA 1BYWA 3LA7A 1G6NA 3CCMI 1S6LA 3S1RJ 1P97A 1ZKJA 2JMWA 4FH2A 1UWPX 2A24A 3E5UA 2OUMA 4Y3OA 4BBTA 4A0XA 3IF6A 4CDGA 1T2KA 1RKWA 3BRMA 2BHYA 3PHYA 3QPTA 2F4MB 4PUSA 1IUYA 2CFOA 2G7HA 2MH9A 3HOYJ 3AG2H 3PBSA 3IX8A 1W79A 3ECOA 2NVYJ 4EESA 2VXDA 4XQFA 2M7BA 4JXVA 2AO9A 2VJIA 1BI0A 1S6RA 3C8CA 1HLUP 3G4PA 5DF7A 1DGRM 1RR8C 1U6GA 1R00A 4ESFA 4A3CJ 1W63Q 4X55A 1G2HA 4KDPA 1XDSA 2VB6A 2ZC6B 3BQYA 1PP7U 1ZR2A 4IHVA 3S7NA 3F72A 5CGXA 4RLFA 1SD7A 2QPNA 4LLNA 2BHZA 3ML6A 4X1MA 4LG3A 4ME4A 2JVGA 3HRSA 4GCZA 2Y9YA 3ZN1A 4KIFA 4AVPA 3JRHA 1QZEA 4E7SA 4K0XA 1FMWA 3Q0WA 1SANA 1MPLA 2P7CB 4G3KA 2ZC7A 2M30A 1RETA 4ZZDA 4XRSA 1B72A 2RNJA 1HZOA 4UEYA 4RAFA 3CMMA 3MZYA 4DNCA 1YRNB 2R7VA 4BWIA 2IGNA 1TC3C 2DA2A 4RGUA 2EX8A 2L9VA 3DWZA 3WWXA 2ZMVA 4TV7A 3SXYA 4BE1A 3ZYTA 2L7MP 3FKWA 4WZ4A 2L9NA 4S04A 1IXRC 2E1CA 3OCNA 2FF4A 2EFNA 2F2EA 2TDXA 1IW7F 3E6CC 2H0YA 4QWQA 2W1TB 3IWOA 3RTRA 4HZFA 4XKBA 3A1YA 1U78A 3K70D 3H1CA 2PLYA 3L7HA 4OQ0A 4D2OA 4QJGA 1L0EA 1RIOH 5CHJA 3IAS2 2VQCA 3H9GA 4HW0A 3PBRA 5G4YA 3CLOA 2I72A 1XGIA 4QY5A 3MZ8A 2YSRA 4QIWN 2L54A 2IVMA 5HDKA 2ZMEA 2Z6CA 3RPUA 1BM9A 2DOFA 2HTJA 4XOTA 3SYTA 3OY9A 3S14J 1FIAA 2Y2NA 4ID4A 1T08B 4UB8C 2PD7A 2PR5A 5HWWA 1EF4A 2QQ8A 2PDRA 4Q0IA 4ASNA 2L0KA 3KP7A 4I99C 5F82A 3T4LA 4KT6A 4WZ5A 3FPVA 1S66L 3H5AA 1DP8A 3E7LA 1N25A 3VOZA 3VP1A 4L9NA 4OPZA 4LLGF 1GT0C 4R0QA 2WKPA 2JRMA 2W1TA 4KZ3A 2ZC3B 5LRSA 4JBAA 1SDEA 4RGRA 3UN7A 1TWGJ 1NXYA 1Y4OA 2OAP1 3BQAA 2IS2A 4G6DA 2ZB9A 1Y28A 4IHXA 1IZ1A 2DI3A 4RMNA 2R5YA 2VT2A 3VYRB 2Q2EB 1K61A 1D1CA 1CI8A 1ACFA 5KAFC 1L2SA 2UV1A 1XPXA 3HTUA 1XSDA 4UXNA 5L3EA 4HF2A 1W8YA 3GF2A 4X6TA 3F8MA 3E6MA 4WXDA 4D5FA 4AIJA 3A0RA 5J1YA 4B47A 1RUOA 3ROUA 3KO6A 3ZMSA 1QO0D 1OT9A 5E2HA 1G3SA 4OAYA 1FCNA 5EYRA 1M1EB 4HYEA 3GZ6A 1LHYA 3ICYA 4R8HA 4G3VA 2OSUA 2ZMEC 4I5SA 5CQEA 2YKFA 1JKRC 1X19A 5D8KB 1SVLA 4AYBA 5KCMA 3U2RA 3L2QA 1H8MA 2HV1A 3HLDA 3MR0A 2FXAA 4LK0F 4UY8I 5E2GA 3UPPA 4EBLA 2DMPA 4BHBA 3J7YJ 1XGSA 2QQBA 3WE3A 4WZ5C 3RFBA 3UKGA 2ZFUA 4ZC3A 1RRJA 2IJLA 3KYDB 1VF9A 4XLAA 1FJLA 2IS6A 4HBTA 2X0LA 2FNPA 4MN5A 4HF1A 2IA1A 1FX7A 2VQLA 3H82B 3UMDA 4OIQF 2EJRA 1YI2I 2ID3A 2R7QA 4RGSA 3FXLA 3DW0A 3CC4I 5ILVA 3LL7A 3OYCA 1E3UD 5E3OA 3SW1A 1DP7P 4KITB 5ICEA 2ZXWH 4BD0A 2Y2MA 2NVQJ 4QD4A 4DF6A 5J6XA 3PBQA 1I5ZA 5B3SH 4CLCE 4IOCF 3K1MA 4OP5A 3S7PA 2XSSA 3P98A 4G8XA 1SDNA 4KMFA 4L0LA 1Z21A 5IHVA 1JJ8C 2X1EA 1GV2A 2ZQ9A 2MA3A 3OPPA 4BQOA 1BIBA 4RGXA 1I2SA 1T39A 4P1WA 4CCKA 3L2CA 1LI0A 2CC1A 3C3WA 2MSYA 4RQ9A 2RNGA 3ZQ5A 9ANTA 3OS1A 1H8ZA 5KK1A 4HIAA 3S16J 3GVBA 3O88A 5F6AA 3HCYA 1PRQA 4ZJZA 2BGCA 1CK3A 4FCYA 1MBEA 4MCWA 4ENKA 3Q82A 5GLBA 1JGSA 3IBJA 2LKXA 2DMQA 1TNTA 1WH7A 4FTXA 3ECHA 2V1DA 2L2OA 3KX0X 1YT4A 2LR8A 2RDPA 5KNLA 1OCZH 1YLJA 2NNYA 3HLFA 3B02A 4EMSA 4DXCA 4E6KG 2FRHA 2KZVA 2BYVE 2VXZA 3BR5A 4IL6C 3WODF 3PIOF 1YITI 1FIKA 2P08A 4H6JB 4HEFA 1OTAA 1V54H 3DQVC 1WJFA 4RLQA 3HUMA 2O0YA 4M9ZA 3VSLA 3HJEA 1A31A 3WTXC 2W84A 1N9OA 2P4WA 1UCRA 1Z0XA 1AWIA 3BTLA 4PGHA 2DA7A 3H36A 3ISPA 4P0MA 5FEGA 4AUXA 5HS8A 3PR6A 3KZYA 5I94A 3FHNA 3M8EA 5FQ9A 3WHCA 2DFFA 3LFUA 3N4IA 3O3VA 4IUHA 3H0DA 5JFRA 3RTYA 1ACIA 2HNHA 3H0GJ 1TF1A 3UNWA 3MKYB 3B73A 1USTA 2LVSA 2NVTJ 2RV8A 3GECA 5LHHA 3GMWA 3IWFA 1BLCA 5CERA 1E3HA 2CS3A 2L3DA 2WBMA 5FKNA 3SZPA 1KE0A 1F9NA 2Y30A 1FQGA 4B48A 2VBYA 1D5VA 1UGUA 3MS6A 3IH4A 3OYNA 3HBRA 5EM0A 3D3OA 3HL9A 3T1SA 3K10A 1BR4A 1UHMA 2W4SA 3JREA 3LGOA 1RGYA 2KL4A 2Q1ZB 4XT2A 1VZ0A 4C30A 4KQDA 4GB7A 1HW2A 3BJ6A 2BASA 2VLGA 3NC8A 4ETZA 4XLNF 3DPTA 4ENNA 3IXGA 1TQIA 4BQQA 3UMEA 4ARZB 4FASD 3RI4A 2KPMA 2O9AA 4HX4A 1C0WA 1W7PD 4FX4A 4GOGA 2QA4I 1FP1D 3KP5A 2L01A 5ILUA 1SKFA 4JF5A 2GBYA 2IW5A 2Y2KA 3CUEA 3HJKA 4LV1A 4Q47A 1LEAA 2OPTA 3FMSA 3Q9VA 1N9BA 1OCTC 5C4JJ 4BL0B 1FIPA 2EWVA 3EWKA 3HJIA 5U47A 5F1JA 2DK5A 5FGMA 4CYCB 2Z16A 2JRTA 2X6XA 2W3GA 4JF4A 4JQFA 1X58A 4JKTA 1EROA 3BY8A 2QQAA 1YTYA 1JHHA 4OONA 2BW3B 2Y4AA 2OV7A 1IELA 5HDDA 4OQHA 4HP4A 3F8NA 3R61A 1XG1A 3JTHA 4BXUA 4I3AA 2RQQA 2VUMJ 2XR0A 2ZXJA 4JYKA 4XICA 4UA7A 3G2YA 5IP6A 1FOYA 1BC7C 2Z3YA 3ZCZA 1UMQA 4U0XA 1R5HA 2XQZA 3MXRA 4RA7A 2E5ZA 3H7WA 4WXHA 2DN0A 2LTPA 3D5SC 3I71A 3F21A 4BE2A 2PJRA 5EVID 2LF7A 2VC1A 3WTVC 2XV4S 2EIMH 2E7XA 5EPHA 3ZG0A 5M18A 5L3BA 1WH5A 1SEUA 5CQGA 2MJ6A 3EQUA 3ZMZA 5DM6F 2JCHA 5LRRA 4P9FA 1L0DA 2M7AA 5LHIA 2KIUA 1F4KA 5BQTA 2I10A 3OL4A 2DCFA 3FXJA 3M1EA 3TW6A 2K7SA 5GTIC 2QSGX 5A8BA 3BFFA 3CDIA 1VI0A 4QB8A 3E6DA 4CO8A 1U5TA 5IY5H 4U3TA 1U5TB 2Z2MB 2LMDA 4DYRA 2W1RA 2FOWA 1S1YA 4N92A 2PT7A 1BN5A 3OYDA 1U9OA 1ITYA 2LRDA 1WRJA 3R0AA 2F5VA 3KETA 3CJRB 2AQFA 4C3IJ 5EZHA 4XRMA 3JRIA 3LAJA 2R3SA 4II2A 1CF7B 1DP6A 1NWZA 3TOAA 1NZUA 4PJNA 4RYEA 5BOHA 2NNNA 3IX3A 3DV8A 5JVGF 2VN2A 5CECA 1GCEA 3H3VK 2W85A 4KUMA 5M3FJ 2R92J 1ZHHB 4BQMA 4XUZA 1R58A 3RSNA 2VONA 1OTIA 5EVLA 1ON1A 2I5UA 4A69C 3FDYA 4S2NC 1LSXA 5A90A 4GHIA 1Y39A 1VQLI 4HBUA 2ZJQF 4MBFA 1TP4A 4XR6A 1EKEA 2GWRA 3OIPA 2K31A 2P9VB 3N6IA 4OVDA 4MQVA 3PM1A 2X01A 4ZTFA 1AXBA 3PYPA 1MBHA 2EA2A 3I58A 2DK8A 2NVXJ 4LPZA 1C3BA 4E3JA 4D0PA 5CHUA 4L0ZB 1I6HJ 5EF6A 2KOIA 3D0SA 2DT7B 2E71A 1REPC 1XGMA 2F48A 1KA8A 3T1BA 5FFXA 3OYHA 1XCVA 4A3IJ 3TDUC 1UHWA 1YX5A 4KNYA 2ACGA 4WYYA 4EQ1A 2OA4A 5FKKA 3BWGA 3ZQIA 2VKHA 3WTYC 3LSJA 3ZCOA 2R5ZB 2C6YA 3S1QJ 2E35A 3C2BA 3G1OA 1U5TC 3GLLA 3IH9A 3M2KA 3DFGA 3BPXA 2WGIA 1YJNI 4I39A 5FATA 3QAHA 3CJNA 2AXLA 3GW2A 2VI6A 3WGHA 2KJBA 3SDGA 2HZ5A 1K56D 3ITAA 3QNBA 1PDNC 1QHGA 2R93J 2E5NA 2TRTA 5K5OA 4OIOF 4BEHA 3FC7A 4CA0A 3EUAA 1NG7A 3HG9A 3LMMA 3PSIA 5FROA 3AGFA 1J5YA 5GHZA 1OLTA 4N9HA 4ESJA 3FK7A 1LFPA 3HUGA 4HNVA 3PNVA 4FQGA 4G12A 1ZR4A 3KSGA 3NBLA 2GXGA 4JXGA 2HDRA 3G31A 3RYRA 3BJAA 1NRJA 3DAVA 1T95A 4R70A 4KZBA 2MFZA 1X1DA 4XBFA 2HPBA 2Y2OA 3VFHA 2ACJA 1PUEE 2X02A 4BJPA 4NQWA 2A05A 1JTGA 1CEFA 2VOOA 5FLMJ 1X3UA 3ZMDA 5FAQA 3CCQI 3RQIA 2A3UA 5K1YA 1Z77A 1JUSA 3BG7A 3HXLA 2M3AA 1DU6A 5KAIC 2IGMA 4Y7NJ 3CO6C 2E2HJ 1ZARA 1ZH5A 1SFEA 2OZ6A 2G0EA 1V55H 3IH2A 4BBUA 2DA3A 1WQ2A 3EUHA 3P09A 4EEPA 1S7EA 4MEZA 3UO9A 4B4CA 2XF6A 5DUIA 3IS2B 3LIBA 3QQAA 2Y2GA 2DMWA 4OWRB 2XIGA 3A0BC 2GA1A 2R7ZJ 1ZTRA 2PD8A 3CCLI 2Z2SB 3A3FA 5GLAA 4PFPA 1ZYRF 5M1AA 1LNWA 5B66C 3AAFA 2RCXA 1OTBA 3DBAA 1VTNC 4XKWA 3F1NB 1MBKA 2BVMA 2K2NA 1IRFA 3VE3A 1B59A 3OCLA 5J1RA 3R7WA 4LGWA 2JVHA 2HP9A 2C5WB 1VQ9I 5IOZA 4ZDOA 1X1AA 1SD5A 4E3NA 1GDTA 2JE5A 5FDHA 4E7HA 2VASA 3HEFA 3DEWA 4HF0A 2A68F 2NS0A 3B3XA 4BQAA 1DP3A 5FSRA 4N4OB 4E7KA 4DRTA 2DA5A 3QP8A 2R78A 3DPLC 2DFIA 1DP9A 4KIBA 1DY6A 5JVTA 4KN7X 4DBRA 1MWRA 3M6BA 5EECA 3ZNYA 1VEUA 4BJ5C 4OOYA 1OPXA 1VEUB 3JRCA 3P01A 3IUOA 4V2GA 5FQMA 4PMAA 1V9ZA 4JK1X 1BLHA 3FF5A 3HKZA 2IEKA 4GO1A 1KGGA 4XUXA 2CQNA 3U9GA 1W0UA 1VB6A 1ZLKA 4OLDA 2HKOA 1IEMA 2ZOHA 2P5LC 3PSFA 1LSVA 3HB9A 1V5FA 1X2NA 3UNGC 3UPOA 1FOFA 4I0AA 5EZGA 4Y13A 1LL5A 4UQIM 3W8KA 2QMIA 3NULA 3C5AA 4WBGA 2K9SA 4Z9QA 3E2KA 1BBYA 5IPAA 4JF6A 3LR5A 3WRTA 1B9NA 2R9XA 3W2WA 5GLDA 3QWLA 1HW1A 4YELA 1GHCA 4GW9A 1Z6RA 2XASA 3BR6A 4HHDA 2M87A 3LEZA 2CQKA 3TL4X 1LB2A 4KQRA 5E2FA 5TFQA 4R3JA 2YPRA 2JC7A 2AVXA 5FI7A 1D3YA 1GXQA 1T0FA 2QLZA 4HDUA 3OV8A 2LY1A 4GJ4A 3VYTB 5IT9Z 3S32A 3HRMA 3AGDA 1JTXA 4LMYA 4R4RA 2F5FA 1UJ8A 2X51A 4UVBA 2P74A 3MKEA 5KZHA 3EYYA 1X3ZB 2XF3A 2VOPA 1MJ9A 3E4OA 4XIDA 4GLQA 4YNRA 4JGOA 1IO2A 4BL2A 2JZYA 3QP1A 1Z7LA 3EUKL 3WG9A 4MHGA 1KU9A 4PM7A 1L3LA 3J80Z 2ZQ8A 1U8RA 1VFCA 2ZO4A 3P9KA 4WCGA 4Y0TA 3HIFA 3ZQQA 3NI9A 4B88A 4LRXC 4BHCA 4M4XA 4EV0A 2XA7M 2VPRA 2MGQA 2KQRA 3EGXC 2WY7Q 3MBZA 2YX7A 3UE0A 4LV3A 4G9YA 3PUFA 3VSKA 4E6WA 2OU2A 4L9VA 3B33A 4XOPA 1SAXA 4BGDA 5DDGA 2XPWA 1MXOA 4FISA 2PRFA 3CPTA 1BW6A 5TGTA 3AL0B 1ESIA 4B4ZA 1A6QA 5ED4A 3IKTA 1OJLA 1FR1A 3MF0A 4UVAA 1W7PA 1O07A 1A0KA 3H3ZA 5HD5A 2DT5A 3OR1C 2VGLS 2BXZA 4ZYEA 2ZC5B 3ULFA 2EV6A 2VGJA 2LH9A 2PI0A 1IKGA 5F69A 2VIXA 2OQRA 1LE8A 3O86A 2XFSA 4OP8A 2FU4A 4CPKA 2ZLYA 3RH8B 3BJOA 1CQAA 4F3QA 4XLFA 1YG2A 2XAFA 2Y2ZA 3E6BA 3FMRA 3IWZA 1PWCA 3FBNB 1KQ0A 2RKHA 3CMEI 3OOVA 2H27A 4RS8A 1JXSA 1YX3A 4IHYA 1W36C 2CV1A 1EWZA 4PCQA 1JHFA 4II7A 1S72I 3PTEA 4H4KC 3LY4A 1ZRCA 1BTLA 4S05A 5BMZA 1OTDA 4HNBA 3K0LA 1TTYA 4M6XA 2XSDC 1VETB 5GL9A 4NK3A 4F94A 5LD2C 3AL0C 1NK2P 3I59B 4IEDA 1IFQA 2BE5F 2D02A 2PR6A 3ZQCA 3VODA 4C2TA 2J8YA 2QWWA 4ENJA 2H28A 3KEOA 4YFNF 2WAQN 3RCOA 3RJUA 3I3LA 1YS7A 2QUFA 2DOEA 1A04A 1I1SA 4WL9A 1J2XA 1Z91A 3WG7H 3S93A 5LEJA 1YO5C 1AWCA 3E0YA 4DE1A 1I1GA 3CMZA 1MBJA 3JCUC 1LL8A 2W27A 3VOLA 1D8JA 3A0SA 5J7EA 4RA2A 4CLCD 4XM3A 2XRNA 2PBDP 2GXBA 5FKMA 5DJTA 2D1VA 3QPLA 2R7UA 3CG5A 1X4OA 4F7ZA 2FQ4A 4LIUA 1XGJA 3A0VA 4F3LB 3IQAA 4V19K 4Y5FA 4LV2A 4WM9A 3FHZA 3UB5P 2Z5UA 3LAPA 2XGEA 4I0BA 1XJ2A 3AG4H 2E60A 3CITA 4W97A 1Z09A 2XSJC 1RUNA 2W3DA 4P6ZM 1SMYF 5F27A 3KLNA 5D6EA 2F5EA 4YFKF 4LCLA 3LICA 3ABMH 1FYMA 2FFFB 5JR3A 2VE8A 4Y0UA 2V26A 4X1LA 3CP2A 4D7NA 3JSPA 2ZL1A 2ZL1B 3BLMA 3BW6A 3F0CA 4PSWA 2HZTA 4PGGA 3WTTC 1QQIA 1UZCA 2IS4A 3QYBA 3K2ZA 1DJCA 2CU7A 2Y0MA 4UUSB 2CGPA 3N8SA 3Q3SA 2QYOA 1FILA 2XEPA 4BBVA 5FQKA 1YQAA 2FX0A 2XVCA 4NBQA 1FBSA 1ZG4A 4HV6A 2J80A 3DTMA 1HF0A 3V8KA 1KZHA 3LI9A 4CZZA 3VE4A 4EW7A 3MQ0A 4CCOA 1J0RA 4I98B 5DM7F 3GLXA 3K7AJ 5J4EA 3UR3C 4LRYC 1CF0A 5HWTA 2KIFA 2PU2A 5G4ZA 3N97A 5GHXA 4EBPA 2NXNB 3W2AA 5DCMA 5I5LA 2DNSA 3ZVTA 1ONHA 3N4MA 5CX7A 4EEUA 1NHAA 2IBDA 1K78A 1K78B 4L5EA 1ERDA 3Q07A 4S2IA 2J5PA 2EXBA 2IA0A 1MBGA 1FEXA 5L8MA 3LEQA 1K56A 1K4EA 4P5OA 5TISC 4KZ9A 2R7DA 2KZGA 5HNHA 1M40A 4PM5A 3OLOA 3OYMA 3HUNA 2B02A 2BV6A 1MMDA 4MN7A 3R60A 4KZ6A 3UB9A 1OR7C 2CO5A 1QZYA 1R1TA 4HG2A 1TQPA 2KP6A 4EJOA 3DTKA 3OIQA 2V0WA 4NXFA 3ZVWA 5ICGA 3KLOA 4M9XA 4AU7A 5HOOA 2UZKA 2A61A 1RP5A 4KZ7A 1SVMA 4LENA 2G2UA 1PUFA 1IYOA 4KZ4A 3HSRA 2HOSA 4X0GA 2GOMA 1K4SA 2K9LA 4FHTA 3PIPF 5ICFA 4KA4A 3PNYA 4CYDA 3RPQA 1OCRH 1MZUA 4YRVA 2NUTC 1Z6FA 1XKZA 3TG9A 4EM0B 5L2FA 1XA1A 1PWDA 4S0HB 2K40A 2E36A 2R0QC 1OT6A 4AVZA 2VBXA 2ZQDA 2KISA 3O5YA 4NKPA 2B18A 4BAYA 5EVEA 1RC9A 2CW7A 1ETKA 5FFZA 4GRIA 1ZG3A 2A24B 3RXWA 2HQ5A 1HKQA 4Q48A 2HJ9C 1WHUA 5HDNA 3IF6B 3IX4A 2DU9A 4KN4X 2O9LA 4A5RA 4HRIA 5AQAA 1MDMA 2PG4A
chains in the Genus database with same CATH topology
2H6BA 4ZYHA 5JHUA 1KYZA 1FOKA 5KVRA 1XCBA 4ZYGA 5E1ZB 3OOPA 5LLQA 3HHGA 1O7LA 1P4XA 2NYXA 3LFKA 2PMUA 2HR3A 1G3YA 2KJCA 1IN4A 4G94A 4YG2F 3IHUA 5F6FA 2QQ9A 2DW4A 1IRGA 3PQKA 3K69A 2O3FA 2V79A 4O3MA 2ZFWA 3WE2A 4LJZF 1K7AA 3F3XA 2MBFA 2ZMEB 2A5YB 2RQPA 1BJAA 4U0WA 2P8TA 1XSXA 4FX0A 1HKTA 2A07F 4BHPA 3E5XA 2DBBA 2PBIA 3GFMA 1P92A 1P4WA 2LSOA 1UB9A 2FMYA 1BI1A 5HLIA 4IF4A 4PZJA 1ZGAA 3G3ZA 1TW3A 4XLPF 3RJPA 3EYIA 4ESBA 5K5RA 3WGGA 3J81Z 3RIRA 3GFJA 2MLGA 2DQLA 1FWZA 1Y0UA 2K86A 3TGNA 4IJAA 2A6EF 1D8KA 3KFWX 4G7OF 1BC8C 2XAHA 3MAJA 1OYWA 4G7HF 3I54A 2IP2A 4GYIA 3SHFA 2UV0E 4KICA 4NG2A 2LKPA 3JW4A 2XHKA 4NB5A 2NRAC 2L4AA 4U7DA 1IN8A 4A2UA 3REOA 1MZBA 1ON2A 4L9JA 2FA5A 4IHTA 1S7AA 4CHUA 2V6CA 1EH7A 1IF1A 3F22A 3BDDA 4A6DA 2FBHA 4M73A 5E20A 3EQLF 1WI9A 2L4MA 4L5IA 4LLLA 3QP2A 5EEGA 3GEZA 4HLXA 3HOTA 1ZGJA 3F8CA 3ZMVA 1SFUA 2QM3A 3P9CA 2OZUA 4AWXB 2W25A 4ETSA 5ERIA 2DQRA 4P55A 4A5NA 3FMQA 4KMUX 2MD5A 3KP3A 4NHJA 2M45A 4IRIA 4HV5A 3LSTA 1O7FA 2FOKA 5CVJA 1R5GA 3O2PE 1HBXG 2HOEA 4HX8A 5AIPA 1SMTA 3C18A 5E18F 2KKOA 4PDKA 1QNTA 2JSCA 3HSEA 4I7HA 5DD4A 4UNOA 3BY6A 5BPIA 4XSXF 4HA8A 1OMIA 3JPUA 3HOSA 3WTWC 3ZQ7A 2X4HA 4FT8A 2M1BA 1U2WA 2XKOA 1ZHFA 2ISYA 2K4JA 3TQNA 1ZLJA 3T0YA 3V4GA 4QLCU 4HQEA 5CVRA 2ZBKA 4A12A 2HYGD 2VODA 3E3VA 1ULYA 2P6SA 5FLXK 3T8RA 4KYWA 3R0JA 4HBLA 1V3FA 5D5UB 2RGVA 4I02A 3C7JA 4YIFA 2Y48A 3WU1B 3CUQA 1RNLA 1ZAOA 4LFUA 4UVCA 3K1PA 1GVJA 3V8LA 2GQQA 4GGGA 3C1DA 2Q8KA 4Z2YA 3TO9A 5FO5A 5H6RA 3WU0A 2FEZA 3KEQA 3JAMK 4BH9A 3H3UA 1H9GA 2ETHA 4AIHA 1TBXA 2UXNA 5IT3A 3WTZA 4G6QA 3GUDA 1FSHA 2FE3A 1J75A 1LQ1A 5E1XA 3MCZA 1FSEA 2XAGA 4I01A 5HLHA 3WGIA 3V7CA 1W4MA 3QP4A 1LDJA 1FT9A 2EFOA 4UUVA 1QZZA 1ZRDA 3RDIA 3VOEA 5FD6A 2FMLA 2GIVA 3BROA 2EFQA 1E2XA 1J9IA 4B8XA 2DTRA 3W6JB 4DQ2A 4MTEA 2STWA 5CLSA 1O3SA 5TRDA 3F6VA 2ISZA 1UFMA 2WTEA 4EGYA 1KU7A 2HWVA 5DYMA 3ZPLA 2OBPA 2H6CA 1I6XA 4IPAA 3RYPA 3G73A 4O6JA 1Z05A 5LEKA 4OMZA 1OKRA 2XKPA 3V7SA 1W5SA 2EV0A 3F23A 1W7PB 1DDNA 1G3TA 1KQ9A 3HRTA 4BNCA 5E17F 1R7JA 3KP6A 1AOYA 1OYIA 5HS7A 2COMA 1QGPA 4EJTA 1S3JA 2EFWA 1R1UA 2MLKA 3GXOA 1OYYA 2PN6A 4RB1A 1YS6A 3I53A