3QP5A

Crystal structure of cvir bound to antagonist chlorolactone (cl)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
251
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
molecule keywords CviR transcriptional regulator
total genus 59
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qp5A02
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp5A01
4IF4A 2CWEA 2RGVA 2P5VA 2CW0F 4L18B 2QWWA 2JPCA 1P6RA 2M87A 1XD7A 5E1ZB 2CSOA 3GEZA 3HOSA 1J9IA 3IHUA 5ILVA 3GW2A 1SD4A 1TQIA 4PCQA 2M8EA 4ESFA 5LEKA 5A2QZ 4XRFA 3BOQA 4MTDA 2D2WA 3ZMUA 2GXBA 2KJBA 4PDKA 4GXOA 2FMLA 5CYVA 4N0BA 1REPC 2FU4A 1HSJA 5ERIA 2MA3A 2CG4A 4QWQA 3I4PA 1K78B 2JPBA 1RIOH 1XMKA 2HYGD 1QBJA 2OZUA 2EV0A 3KP5A 3K69A 4LB6B 3IX3A 3JW4A 1IXSB 1QNTA 4R8HA 3F72A 4EQQA 1PDNC 1XN7A 5IT9K 4WXDA 4M73A 5ICGA 3ERED 2EFQA 3F22A 1S7AA 4LLGF 1KYWA 3I58A 3CUQA 3E6CC 1R22A 4LB5A 3AAFA 3NQOA 2V6CA 2QLZA 5HLIA 2JTVA 5ED4A 1U3EM 1TQMA 4MGRA 1FZPB 1SMYF 3PQKA 2QQBA 3SQNA 2DI3A 3J80Z 3ROUA 1ZHFA 3HRTA 1O57A 5LRSA 2XVCA 2HZTA 2O6GE 1ZRDA 1S8NA 5E17F 5CVVA 4A0XA 1OYWA 5K5QA 5FFZA 2ADUA 4MQVA 3BJOA 5HLGA 1OMIA 5DCFA 4N9IA 2H94A 3F3XA 1FNNA 4B09A 2DPDA 3FXUA 2AS5F 1XMAA 4LJZF 5D5WB 1IN7A 2A61A 4I09A 4EM0B 2CFXA 1QQIA 4I0AA 1LEAA 4KT5C 2HEOA 3WTUC 3E6BA 3O3KA 1BC8C 3IWZA 2F5DA 4KYWA 1ZG3A 3ZN0A 1XGMA 2OZ6A 4Y15A 2KIMA 3M1EA 2BE5F 1J59A 4IJAA 1HKTA 3TOBA 3IKTA 3JPUA 3WTZA 1ZLKA 2XV4S 3CLOA 3WG9A 1FBUA 5CVIA 2ESNA 3HOTA 4I0BA 2DT5A 4KMFA 4RS8A 1O7FA 2IA1A 2Z33A 2FRHA 3D5LA 4ENJA 4BXUA 6PAXA 5AIPA 3MEXA 2L4AA 3ML6A 3ULQB 2V9VA 3WTVC 5LHHA 2P5LC 3M9AA 2WC2A 1G3WA 3WTTC 5LBQA 3JTHA 4ZZDA 1BIBA 1UHWA 1T2KA 4KA4A 1HW2A 2OQRA 3F8NA 2X4HA 3TKYA 2QUFA 1R23A 4ENNA 3DP7A 3GLXA 2NNNA 4LGWA 3FX3A 3RYRA 4IRGA 1WRJA 4HOBA 1ODDA 3IX8A 4JBAA 2C6YA 3E5UA 5HLHA 2A07F 2OU2A 2OQGA 1XB4A 4P55A 4ETSA 1W5SA 2PMHA 4BHBA 1IN4A 1Q1HA 3KCCA 1IXCA 3DPLC 3I59B 3K9TA 2FBIA 3HSFA 3G3ZA 3MCZA 2B0LA 4ZZLA 2AVXA 2D1VA 1E2XA 3QP4A 1WQ2A 2NNYA 2PEXA 3ZN1A 1K6OA 3WTYC 2A68F 1J5YA 2VE8A 2FNAA 2XIGA 3QP1A 3BP8A 4HX8A 4NHJA 4ASNA 2EV6A 1CF7A 4WWCA 4R1HA 1Y0UA 2IW5A 5HOOA 3V8KA 4EGZA 1JE8A 3GO5A 1HBXG 2DK5A 3G73A 5CLSA 4RGXA 1GXPA 3H3ZA 2RN7A 4L5IA 3P9KA 1BN5A 4JQFA 1FY7A 4ESJA 4BHPA 2EA4A 1W7PA 4Q48A 4P96A 2PG4A 2HKXA 3GFMA 3FM5A 2H09A 4IHSA 3WGGA 4BQAA 4HF1A 4HV6A 3BJAA 2ZNYA 2NAZA 1YW8A 5D8KB 3F6OA 4EGYA 1TTYA 1R1TA 4FT8A 2H27A 4KNYA 1XCBA 2FF4A 1S3JA 2FA5A 4HV5A 3KZYA 4I01A 2IVMA 3QPTA 5E18F 4ZYDA 1LNWA 5EEHA 1MKMA 3CUQC 4KICA 4HX4A 3KP3A 2EB7A 3J81K 4YFXF 3V7CA 5AONA 3K2ZA 1U5TA 4HAMA 2GA2A 1TW2A 2TDXA 3DXJF 1U8RA 5L3BA 4O5VA 3F8FA 2LF7A 1OKRA 4HLYA 3T1BA 3FXRA 1IZ1A 3DFGA 1ULYA 3T5XA 4EV0A 4Z2YA 1ZG5A 3QU6A 3LA2A 3NEUA 1RUOA 2A6EF 5D4SA 3DEUA 3LA7A 1G3YA 1S7OA 2Z99A 3QP2A 1BI2A 2QZ8A 2STTA 2ISZA 2IT0A 1TW3A 4TV7A 4LLNA 1UFMA 3ZMVA 2BV6A 3MZYA 5JVTA 1T98A 4CZZA 4L9JA 1G3SA 4HZFA 3M8EA 2UZKA 4L9TA 1KA8A 4RB1A 2WWYA 4WF2A 1ZGJA 1HSTA 2XROA 2O3FA 2MH9A 5HDGA 1P4AA 1DPRA 3K1NA 2NRAC 1I1SA 4KMUX 3BDDA 2J5OA 2VOPA 4I98B 5ICFA 3WE2A 5DUIA 2K02A 1K78A 4LLLA 1JXSA 1UHMA 2HR3A 3ZMTA 5LHIA 3WU0A 2DO7A 5J8CA 2F5EA 4CYDA 5L09A 4ZYEA 2HWVA 3J7AO 2FSWA 2EFWA 1UB9A 4ZH4F 4RB2C 5F1RA 1BI1A 3FHZA 4ESBA 1ZG1A 1YW7A 4D0PA 1Z9CA 1GVJA 2QM3A 2L4MA 3R6SA 3RYPA 3O2PE 4IPAA 3ELKA 2RQPA 5ILSA 2K86A 1HW1A 3FF5A 5H6RA 3ZMDA 2EK5A 4AVPA 3JAMK 3PQJA 3TO9A 3IWFA 1R58A 3QP8A 3ZPLA 3DPTA 1B4AA 1BC7C 1B6AA 4RGRA 4ON0A 1D8JA 1D3YA 1DDNA 3IL2A 2VBYA 2MC3A 1FP1D 2O03A 1Z6TA 2P7CB 5IT3A 5D5VB 3MFKA 1J7KA 1TNTA 2E7WA 2DU9A 3WTWC 2VN2A 5L07A 2UXNA 1ON1A 1XSXA 2UWMA 1I27A 4R79A 2XAHA 5HDKA 2HDCA 2P4WA 4LK0F 1W7PB 4OINF 1XDSA 4RB3C 1LQ1A 4G6DA 1IN5A 1IAWA 5CVUA 2ZXJA 1CF7B 1UCRA 2ISYA 3K1PA 1PP8F 1T38A 1B1BA 3IX4A 5L3GA 1J75A 1PP7U 2QVOA 5CVRA 1YW9A 4KN4X 1HQCA 1G6NA 2HGCA 2AXLA 5FFXA 3C18A 2DPUA 5DDGA 4M9SA 3KP2A 3TDZC 1WWXA 2KKOA 1P2FA 2R3SA 2J5PA 3KE2A 5LGUA 3HHHA 4OU0A 3SZPA 3V8JA 3B02A 1MD0A 4HQEA 2F2EA 2HFHA 3KETA 2K7LA 3P9IA 5D5UB 4YIFA 2DK8A 4G6QA 1J0RA 1R1VA 2IPQX 3ZP5A 4L9VA 3WGHA 3FM3A 2XAQA 4KDPA 1V4RA 4XLPF 3ZQ7A 4I02A 4RB0A 3VOEA 2LF8A 1R7JA 3BWGA 3GZ5A 3SFZA 1ZAOA 3I59A 4BHCA 2YR2A 4EJVA 3LQRA 1U5TC 5AIQA 1ZGAA 4WK8F 2IA0A 1USSA 2MLKA 1PUEE 3LA3A 2VOOA 3R0JA 1TBXA 2H6BA 5LHGA 1FWZA 2V1XA 1OPCA 4MNUA 1HW5A 3S2WA 2W84A 1AOYA 1VTNC 1SFEA 1O3QA 3EYYA 4O6JA 3HTSB 1FYLA 4IHTA 3F6VA 3E97A 3ABTA 1DPUA 4A0YA 5TRDA 3COAC 4CHUA 1B59A 5ICCA 1LB2A 2BBYA 1KQ8A 1Z1DA 1KQ9A 1C0WA 2PMUA 4CICA 4Y13A 1Z91A 3K1MA 3HRMA 2PJPA 4HF0A 3C7JA 4G94A 3MWMA 3BY6A 2GXGA 3VB2A 2UV0E 4EJTA 3Q5FA 4OIRF 3RIRA 3R61A 4L0YB 3GWZA 3HIFA 5D6FA 4U0VA 3KP6A 2R7FA 2DQLA 3W6KB 1RI7A 3HRUA 5LGTA 4IVNA 4LG0A 1O7LA 3F8MA 2FEZA 5L10A 1LDKB 4LG0B 3E6MA 1ZH5A 1QZYA 3KLNA 1JGSA 3FXQA 1V3FA 4K2EA 4EM1A 3ECOA 1ZREA 5HS7A 2ZMEA 4AIJA 2Z3YA 2L54A 2MH2A 1HKSA 1O3RA 2G9WA 4CXFA 3H3UA 2Q2EA 5F64A 3F8BA 2XHKA 4Q4ZF 4FX0A 1CGPA 3ISPA 1YFHA 3EETA 1K7AA 2FNPA 1OYYA 3WODF 3DQVC 1STZA 3BPXA 2O8XA 2XAFA 2Y48A 3KEOA 2JZYA 3NRVA 3L2CA 4HQMA 1R5HA 2F5CA 3L00A 1T6SA 3LAPA 4EM2A 2XAGA 4A2UA 1ZYRF 3Q9VA 3B73A 4EJWA 5LGNA 2DAOA 3R4KA 4HDUA 4L9NA 1YIOA 2FQ3A 3CJNA 3KZZA 5DV5A 3EYIA 5D6EA 2W85A 3JSPA 2FXAA 1EV7A 4KFCA 5HS9A 3TGNA 1NHAA 4EMSA 5JFRA 2RKHA 4OIOF 1W7PD 5E20A 2ACJA 5BMZA 2YPRA 4HLXA 4MEXF 5FO5A 1F9NA 4HYEA 3VFZA 4GYIA 4A5NA 5BQTA 3OV8A 4G7HF 4KIFA 2K27A 3HSEA 2QYOA 3I0TA 4JK1X 2DW4A 5JR3A 2KRFA 4B8XA 3BZ6A 2OBPA 3QAHA 3R0AA 3I53A 2P7VB 2ZNZA 3M7GA 3DF8A 1MJBA 2W57A 1GXQA 1B9NA 1FYKA 3LQQA 4P5OA 1SD5A 4M6XA 1IF1A 4LFUA 2JRTA 3E5XA 3C3WA 2PFBA 1BI0A 1FSEA 2VC0A 2M5WA 4GCVA 3GX4X 1B9MA 4RGUA 3KP7A 4HX7A 4UV8A 3VODA 2EA2A 2NYXA 2W25A 3BPVA 2VBWA 1MGTA 4G9YA 4MHGA 1KU9A 2KIFA 4O3MA 3SXYA 2P8TA 5J8FA 5FB2A 1KU7A 2P6TA 3QP5A 5ILUA 2DBBA 3IRRA 5A2QK 5FLXZ 4XSZF 4HW0A 2V1DA 4I7HA 1JHFA 3HSRA 1I1GA 1W5TA 4M9XA 1YG2A 3GF2A 4UV9A 3P9CA 5CVJA 2KIUA 4XBFA 2O0YA 2L3DA 3CO7C 3U1DA 1F5TA 2ZMEB 4F7ZA 1D8KA 1X3UA 2QENA 1S6LA 1XDUA 3FMRA 2MD5A 3LFKA 1LEBA 5LLQA 1H0MA 2RVCA 1MDMB 2A5YB 2M30A 4LMYA 1QPMA 5LRRA 1P92A 4UVBA 2LNBA 1ZARA 2RC4A 3OOPA 1A04A 5HVQC 1ZRCA 1R5GA 3N4MA 2VODA 5IT9Z 2ZJ2A 1H9GA 3O6BB 2Y75A 1LJ9A 1Z6RA 3FWEA 1IRFA 5L3FA 1SFUA 1MZBA 4FX4A 4CGZA 5L3CA 2ZCWA 2EFOA 2VBZA 4OOIA 1R1UA 1MJ9A 3REOA 4G8XA 3RKXA 1I6XA 1D5VA 3GYHX 3BJ6A 4MTEA 2IP2A 1T39A 4HDVA 1ON2A 2A69F 2GA1A 1FYMA 2VT3A 3IRQA 3J80K 2A6HF 1I5ZA 1USTA 2HTJA 2PBIA 3RPUA 1EH8A 3CTAA 4G7ZF 4A12A 2Z9OA 3W6JB 1ZLJA 2VC1A 1BOAA 3BROA 2JSCA 3T8TA 3KP4A 1FC3A 2WV0A 2HKOA 2L02A 2H6CA 2HYFA 4AIKA 4A6DA 2EV5A 3Q9SA 3RPQA 3ABUA 2GZWA 5H6QA 1FP2A 2RDPA 1XSVA 4OIQF 2X0LA 3L09A 1QO0D 3V7RA 1YYVA 4P9FA 5EEGA 3CUQB 2Z5UA 1QGPA 4H0EA 2ZFWA 4S05A 1TQPA 3GVAA 1G3TA 4BAYA 3QP6A 2QBYA 2LDUA 3WTXC 3N97A 1TNSA 3R60A 1G4DA 1YTYA 5K1YA 4FHTA 3LWFA 2VXZA 4UHTA 4QLCU 3CDHA 4LK1F 5BOXA 1BIAA 1U6GA 1BBYA 2HTSA 1RUNA 2HS5A 3EDPA 2KJCA 2Y0MA 4UVAA 2VONA 1IN8A 3RJPA 4ENKA 1FOKA 3SHFA 4U0WA 4XSXF 1IN6A 2DTRA 4U7DA 1FBQA 5DEQA 2FMYA 2BYVE 2HQNA 2YSRA 3FMQA 4WCGA 4MEYF 2BGCA 2XKPA 3TOAA 2COMA 4E70A 5H20A 3T0YA 1WSUA 3SZTA 1XGSA 4UUVA 3E5QA 2EFNA 1FBSA 3TO6A 3KLOA 1IUYA 2NS0A 2YX7A 2XGXA 3M8FA 2XRNA 3DV8A 4BYYA 3QU3A 1EH7A 1SMTA 4EVIA 4IXAA 2CGPA 2JT1A 4GO1A 1QZZA 5DCMB 5BS6A 2EFPA 1U78A 5K5RA 1LDJA 2E7XA 2ELHA 1S29A 1FX7A 3MQ0A 1SFXA 3I5UA 4EJUA 4BNCA 1HXDA 5F6FA 2K4JA 2HOEA 3LAJA 4RAZA 2VE9A 5BPDA 2IA2A 2FE3A 3MZHA 2WTEA 5D8LB 2GIVA 1O3SA 4M72A 4YFKF 3RKWA 3T8RA 2EWNA 5DD4A 2V1UA 3L9FA 1T0FA 3P7NA 4AWXB 4OMZA 5JI6A 5DUKA 1YS7A 4M71A 3EUHA 1SAXA 4L5JA 2G7HA 2LKPA 5J6XA 3WGIA 4NQWA 4L0ZB 1H9TA 2FOKA 3HUGA 4MQ9F 2CQKA 3WTSC 4M9ZA 1KQ0A 3ZMSA 2O61A 1SD7A 2VBXA 1R36A 3IC7A 5L3DA 4Q5SF 1R00A 3FZVA 3RTRA 1DUXC 4Q47A 2D45A 4CDGA 5E1XA 5JHUA 1YLFA 1W4MA 2LSOA 4DQ2A 2XAJA 1U2WA 3HRSA 2BEOA 2ZBKA 4U88A 1IXRC 2G7UA 3C1DA 1MDMA 2Q0OA 3D0SA 3JTGA 3HTUA 2E1CA 2GAUA 2W24A 2GWRA 2UXXA 5FLXK 1XSDA 1RZ4A 3FMSA 2CO5A 1P4XA 4AIHA 3TO7A 2PLYA 1Z7UA 3HYIA 1EH6A 2ESHA 1KU2A 2V79A 3GZ6A 4ZYHA 5FGMA 3V7SA 3HHGA 3F21A 1TLHB 1F1ZA 4LD5A 3MAJA 3H92A 4KN7X 4BH9A 5FD6A 2A3SA 4A6EA 5E1WA 1FSHA 2XUBA 1O3TA 1GHCA 4UXNA 4YFNF 1L3LA 4WXHA 2STWA 3QPHA 2GQQA 5ICEA 3V8LA 1J2XA 2CYYA 3TQNA 2M45A 1YS6A 3PFIA 1XGNA 1FT9A 4ZYGA 2OA4A 1YQAA 2F5FA 4A0ZA 1K79A 1LVAA 4WX9A 4EJOA 1F4KA 3GFLA 2PQ8A 3IKVA 3E3VA 4RGSA 1L0OC 1KU3A 5TJJA 2YX4A 4U0YA 4KIGA 5D5XB 4Y17A 2D1HA 4NB5A 5BPIA 2QQ9A 3CUOA 4PGGA 2QQAA 3KFWX 2P6SA 3F8CA 4GGGA 4IRIA 4UNOA 3JSOA 1DP7P 3WE3A 4RAYA 2YU3A 1Z05A 1BM9A 4AD9A 2IJLA 5HS8A 2ZKZA 1IRGA 1XGOA 4S04A 2DLLA 1E17A 2IRFG 2RNJA 1OR7A 4P9UA 3RI4A 3GUDA 3E6DA 2PI0A 3J81Z 4M74A 3GFIA 1WI9A 3I54A 2HQRA 3JAMZ 2DFIA 2VT2A 3I71A 4HBLA 3TDUC 1YO5C 1FPQA 1FLIA 5DYMA 5LEJA 5E8GA 1HKQA 4KIBA 4G7OF 1RNLA 2M1BA 1WKMA 1ZN2A 4XLNF 3KEQA 3VEPA 4U7BA 3V4GA 4OIPF 4YIIA 4PGHA 2P5KA 1P4WA 3RKYA 5FD5A 1SD6A 4N9HA 2L01A 4HF2A 4OMYA 4M6YA 3DKWA 2EJRA 1LDDA 3QOPA 2OAZA 4KUMA 1IW7F 5KVRA 2K4BA 5E8IA 3EQLF 5HDNA 2XKOA 2ZO4A 2RV8A 4GYGA 4YG2F 4DNCA 4ENMA 3CO6C 1AWCA 4A5MA 1BJAA 2OD5A 2XASA 5K5OA 1BI3A 3ECHA 3U9GA 2Q8KA 1OYIA 3ZMZA 2MBFA 5L3EA 1KGSA 4UVCA 1KYZA 3K0LA 5KK1A 4HA8A 2FBKA 1ONVA 4PZJA 1MJAA 1U5TB 2R7DA 3F23A 4IRHA 2QBYB 2DQRA 1JHHA 5CJ9A 3RDIA 4I2OA 5DCMA 4NG2A 2ETHA 1XCVA 2PN6A 3GFJA 3QRFF 5DD8A 4CO8A 3LSTA 3U2RA 1ZRFA 3WU1B 2E1NA 2MLGA 3L7WA 2FBHA 3I64A 3GXOA 4WXCA 5D4RA
chains in the Genus database with same CATH superfamily
4IF4A 2CWEA 4IUKA 2HP6A 3DKYA 4F55A 2BY2A 2RGVA 1GDTA 4AFIA 2P5VA 4BE0A 2M4KA 2NS8A 2CW0F 2NXNB 4L18B 3CD6I 2QWWA 1VETB 4OAZA 2JPCA 1KONA 4YIRX 1P6RA 5GAGJ 2M87A 1LSXA 3FG8A 3S2HJ 1XD7A 1IG7A 2EBIA 2P9VA 5E1ZB 2X6WA 4IHWA 3CAXA 2CSOA 3GEZA 4F93B 2H5SA 2L4RA 3F1NA 4JXWA 1XPXA 3HOSA 2FH5A 1J9IA 3IHUA 5ILVA 4E6XA 2CQNA 3HREA 5HZHA 3GW2A 1BW6A 2FD5A 1T0FC 1SD4A 2KT0A 2VPLA 2M7AA 1TQIA 5DJUA 1FQGA 1EWZA 4LV0A 1IYQA 4EUZA 4X53A 4D9JA 1LT0A 4PCQA 3LSJA 4XKCA 4ETZA 5TISC 2M8EA 3HZJA 4JOMA 3LIBA 2O9BA 1ITYA 3AGEA 4LG3A 4ESFA 3HOVJ 1U8BA 2PBDP 2WB1N 1VM1A 5LEKA 1NTCA 5A2QZ 2P81A 4E3LA 4XRFA 3QYEA 2MC4A 3BOQA 2WZZA 5EGOA 4WL9A 4MTDA 2D2WA 3HL2A 2Y2NA 2XRLA 3ZMUA 2A6TA 2GXBA 3CPTA 2P74A 2VI6A 2KJBA 4RDUA 2VA0A 2I72A 3PBSA 5TGTA 4PDKA 4KG6A 3FISA 2M0CA 3LR4A 4GXOA 2FMLA 5CYVA 1Y39A 4L9EA 1BW5A 1QHGA 3E1SA 2PYRA 4N0BA 3KO6A 3L7HA 3MQQA 1FIPA 1REPC 2FU4A 1XJ6A 3JCUC 2ZQAA 1HSJA 3HLWA 4LV3A 5ERIA 2MA3A 4E3NA 3MZ8A 5C3EJ 1DJBA 4Z6YA 2CG4A 3H5RA 3TBIA 2LKXA 4N92A 1ESIA 4QWQA 5J4YA 1KDWA 3M3YJ 3SOIA 3I4PA 3QOEA 2LBFB 1K78B 1ETVA 2JPBA 1E3UD 2JK3A 2ELKA 2KRCA 2LKSA 4PKYG 3LNQA 2MG4A 3GBGA 2FZ0A 3ZG5A 1I3AA 1RIOH 1XMKA 2HYGD 1QBJA 2QGUA 4BY7J 1FIAA 1A36A 4HNBA 1IV6A 1CF0A 3WS2A 5E3OA 5A90A 4C30A 4BGDA 2OZUA 1OJGA 2EV0A 2Y9ZA 3GTOJ 3KP5A 3K69A 3D5RC 2G2UA 3UE6A 4B43A 4MFDA 2WKPA 4ZC3A 4LB6B 3IX3A 1K6YA 2RQQA 1MC0A 1WYBA 3JW4A 1MKIA 2P7JA 1IRZA 1IXSB 1DGWY 1QNTA 4HG2A 2PU2A 4R8HA 3F72A 3MFDA 4HI4A 1BT5A 3M6BA 4EQQA 4LCMA 2EPFA 1OCTC 4ZJ3A 1X0OA 3LSMA 2B18A 1PDNC 1XA1A 2W1OA 1K55C 4P6BA 1XN7A 5IT9K 3W2VA 3V67A 1X1CA 2EX9A 1LE8A 1E4DA 4WXDA 4M73A 3W2WA 5ICGA 3ERED 2EFQA 1MWRA 2PAVP 2W0NA 4R0QA 2XEPA 3EQUA 3G4PA 3F22A 1S7AA 4LLGF 1KYWA 3I58A 4OPYA 1BOBA 1QPIA 4B4XA 3V50A 1JT6A 1FEXA 4C2TA 3CLQA 3CUQA 1FOXA 1NYYA 2Y2MA 4LRXC 3ZQGA 4R3JA 3E6CC 1V5FA 1R22A 2VKHA 3FK7A 3AAFA 4LB5A 3NQOA 2HZDA 3OR2C 5KCMA 2R7TA 2V6CA 1G5UA 2QLZA 5KIZA 5B3SH 3I4MJ 4HP4A 1LFBA 2XD5A 2WGIA 4A3LJ 5HLIA 2JTVA 5ED4A 3Q0VA 4XRSA 2WA0A 3GTGJ 1DGRM 1U3EM 5B1AH 4MNRA 1Y4OA 3S22A 1TQMA 4MGRA 1S67L 1OCPA 1FZPB 4BXFA 1H8MA 1UELB 5TR7A 2ZXHA 1SMYF 2F4OB 2LB9A 3LEQA 3PQKA 2QQBA 1BJZA 1MY8A 2ELJA 1JTXA 4EXOA 4E7IA 4Y3OA 3SQNA 1CJFA 2DI3A 2K3FA 1RCJA 1T19A 4GB7A 4LPZA 2HDRA 5FQ9A 2Z6CA 3VFFA 3J80Z 3ROUA 2CV2A 3LL7A 5F1JA 1ZHFA 1B8IA 2OPTA 1YPRA 3HRTA 2OSUA 1LL9A 2PT7A 4FUWA 1O57A 2V8CA 5LRSA 3BZCA 2XVCA 2HZTA 3FXKA 1WZ2A 1JJ8C 2O6GE 1BLHA 2LD5A 2KDZA 1IGNA 1ZRDA 2JMWA 1IUFA 1S8NA 2KIQA 5M5WJ 5CGWA 1JUMA 5E17F 2JA7J 2XLNA 1UZCA 3PUBA 3C2BA 5CVVA 4A0XA 1OYWA 3HOWJ 4A3DJ 1P0ZA 5EPHA 3MSHA 5K5QA 2B02A 1EROA 1FOWA 1R4MB 3LSRA 5FFZA 4JYKA 3J7YJ 2ADUA 4MQVA 2XFSA 1X4OA 2XF5A 3H0DA 1XMXA 3EOIA 3BJOA 5J1RA 5HLGA 4UB8C 4KQRA 1E3OC 3EGDC 1OMIA 5DCFA 4BACA 2BTFP 3UR3C 2I8DA 1X19A 3CMYA 4BDYA 1DU0A 2DDAA 4N9IA 4BJPA 3ZVWA 3ZRGA 3RZOJ 2H94A 3F3XA 3QNBA 2A49A 1FNNA 1T8IA 3GZNB 4B09A 1NRJA 1NG6A 1UWNX 2V2FF 1V54H 4KISA 2DPDA 3HBRA 2EIMH 3FXUA 2AS5F 1DP3A 4EBLA 2ZL1B 1G28A 1XMAA 4LJZF 2HDQA 1JUPA 5D5WB 1D1CA 1IN7A 2A61A 4I09A 2IWDA 4NXFA 3CDIA 5DS9A 2DOEA 4UUTA 2O9LA 4EM0B 2CFXA 1PW8A 1QQIA 3E7LA 2QKPA 3O3VA 2C5WB 2OLVA 5DFXA 2IXSA 4I0AA 2XA7M 5HL1A 1YLJA 1LEAA 5F83A 3E2LA 2IGMA 3OYIA 2OV5A 2CJJA 3S1QJ 4KT5C 3K4KA 4WYYA 2HEOA 3ZQFA 1MSFC 3WTUC 3S32A 5HDCA 2DMWA 2J7VA 3E6BA 3U4LP 3CPTB 4EBPA 2XB0X 3O3KA 4F52A 1BC8C 3V3SA 2HP5A 4IUHA 3NBLA 2DCEA 3IWZA 2XF3A 2F5DA 2PD8A 1MBGA 2AHQA 2EIJH 5I5LA 4KYWA 2MGQA 1ZG3A 3ZN0A 1XGMA 4HP9A 5E2HA 2OZ6A 3UY6A 4Y15A 3J7AY 2KIMA 1K38A 2DA2A 1DQUA 4ZTFA 4C9YA 1FTZA 4KUOA 4I3JA 2E35A 5HLTA 4V2FA 3M1EA 2BE5F 3DWLE 3ONQA 4MFEA 1J59A 2L9NA 4G3WA 3RXWA 2FJ1A 3BTCA 4IJAA 1HKTA 5DF8A 3BG3A 3UDFA 3TOBA 3IKTA 4P1WA 2OTLI 3JPUA 4R4RA 3WTZA 1ZLKA 2XV4S 3NWSA 1M40A 4QPRA 3CLOA 3W4OA 4GKUA 3WG9A 3LI8A 1FBUA 3BR5A 4ZRRA 5L8MA 1A6QA 3S3MA 3TL4X 3L2VA 5CVIA 2P9VB 2ESNA 3PAEA 1WFXA 3ZQHA 4I76A 4G6TB 1PWCA 4XLAA 3HOTA 3JRFA 2GLOA 4WM9A 4I0BA 5A92A 2DT5A 3BR2A 4RS8A 4KMFA 1O7FA 3BCAA 5D3OA 1VQ9I 2E71A 3I56I 2IA1A 2Z33A 1P9WA 2YS9A 5FLMJ 1K56A 1MSEC 4ZDOA 2HPBA 1P97A 2LC2A 2XGNA 5CTMA 4XUZA 2FRHA 3D5LA 5K7FA 4ENJA 3F9KA 4BXUA 6PAXA 4FETA 1YLYA 1LE8B 1LFPA 5AIPA 1YSQA 3LIEA 3MEXA 1CQAA 3MS6A 1V5GA 2L4AA 3ML6A 3ULQB 2V9VA 3BG5A 4BEHB 1F5MA 5DKLA 3WTVC 1DY6A 1ESUA 2Z16A 5LHHA 2P5LC 2WGWA 3M9AA 2WC2A 1G3WA 5F27A 2XB5A 3WTTC 1XX2A 3GQZA 4BQNA 5LBQA 3JTHA 2M7BA 4OPZA 3DBRB 4JX5A 3MQOA 4ZZDA 2WAFA 1BIBA 3OPRA 4ZJ2A 3ZQ5A 1UHWA 1T2KA 1K6RA 4KA4A 1HW2A 3ITAA 2OQRA 2ZC4B 3F8NA 2X4HA 3TKYA 3EEAA 3KYQA 4QJGA 4LIVA 3UMEA 2EZHA 2QUFA 1R23A 2Y2ZA 4XRSG 4ENNA 1VQ6I 4OPQA 3HOXJ 1PUFA 3DP7A 3UO9A 3GLXA 1PI5A 2NNNA 3IAM2 1UAAA 4LGWA 3FX3A 5A8BA 3ZG0A 3RYRA 2JUCA 5J3WA 4IRGA 1WRJA 2DMPA 3G1LA 1M6KA 2EWWA 4HOBA 1ODDA 3IX8A 1QZEA 4JBAA 2C6YA 1X2MA 3E5UA 3IUOA 1L0FA 4EBNA 5HLHA 2A07F 2OU2A 1YKDA 3I3LA 2DA5A 2BLSA 3ZQIA 1HD8A 1ZR2A 4MBFA 2OQGA 1XB4A 1VEUB 4P55A 1AXBA 3N8LA 4Y5FA 2X1CA 4ETSA 2KP6A 3RPUD 1W5SA 2PMHA 4BHBA 5F1GA 3PTEA 1IN4A 4C6YA 1MBHA 2P0WA 1Q1HA 3KCCA 1YJWI 3C2HA 3LFUA 1IXCA 3DPLC 3I59B 3K9TA 4XOPA 4F3QA 2FBIA 5FKNA 1SVOA 2JQ7A 1UHSA 2V1BA 3BJNA 3HSFA 3I7JA 1GCEA 2HI3A 3PIPF 4OKPA 1QRYA 1T18A 5CQGA 3G3ZA 2PJRB 3OL4A 3MCZA 2B0LA 3SZGA 4ZZLA 2D1VA 2AVXA 1E2XA 2R9WA 3QP4A 4NEED 1WQ2A 1JT0A 1TVFA 2NNYA 2PEXA 3ZN1A 4RQ9A 5EEAA 1P7JA 5C4JJ 1A0KA 1VQQA 2VV8A 2CH0A 5HWWA 1K6OA 1Q1VA 2V8FA 3WTYC 5C5KA 3IAS2 1KE3A 2H10A 2A68F 4BQOA 4BBRJ 3PAGA 5FDSA 1J5YA 2VE8A 1UG2A 3UDIA 3WHCA 2FNAA 4BL2A 5F68A 2XIGA 4DYQA 3AG1H 3U21A 4PSXA 3CC2I 4Y33A 4C3QA 3QP1A 3LSGA 3CCYA 2RCXA 2ZM0A 4ID4A 4Y3IA 3BP8A 4HX8A 4NHJA 2F4MB 4ASNA 2EV6A 4CSWA 1IYPA 4IHVA 2VGLM 5JLWA 1CF7A 3BWLA 3LUQA 2E8IA 4WWCA 4R1HA 4O8GA 1Y0UA 2IW5A 5HOOA 3V8KA 4EGZA 3HUOA 3HVFA 1JE8A 3JYIA 3LIAA 5E3MA 4PMAA 1TP4A 4XK4A 1T56A 1X1BA 4BJ6C 4MEZA 3GO5A 1JTDA 2V6EA 2OWJA 2VV7A 1W0UA 1HBXG 3A2KA 2DK5A 4BD0A 4QPOA 3G73A 3TE8A 2OOLA 5CLSA 4RGXA 2XGCA 1XA7A 3ZNYA 1T95A 4N1HA 4FASD 4M3DA 2W7NA 3H3ZA 1YITI 2RN7A 4L5IA 3P9KA 3L2QA 1GXPA 2R7UA 4L5EA 2HZ5A 3DWKA 1BN5A 3H1CA 4JQFA 1FY7A 4ESJA 4BHPA 2EA4A 4A3EJ 2CW7A 2ZMVA 1SFOJ 1W7PA 4Q48A 3UE1A 4RA7A 4P96A 1K4SA 1EA3A 1DJCA 1QMFA 5GLCA 3FXJA 3H9JA 1RGZA 3CITA 2K5CA 2PG4A 2HKXA 3GFMA 2Q9NA 5FI6A 5AJGA 3FM5A 2WUQA 3TOIA 2H09A 4IHSA 3WGGA 3BQAA 4BQAA 4HF1A 4HV6A 2IS2A 2VQLA 3BJAA 2ZNYA 2NAZA 1HCRA 1A6IA 1YW8A 5D8KB 1LI9A 3AGFA 4UA7A 3IS2B 4WMCA 2OJED 3F6OA 4BEHA 1TZLA 4EGYA 1TTYA 2EX2A 2J3WA 5E43A 5DTKA 1B72A 3JR9A 5HNFA 1R1TA 5GLDA 4FT8A 2H27A 3OIPA 2M34A 3TP0A 4KNYA 2H8RA 2OLUA 1XCBA 4A5RA 2V0UA 3RXXA 3BTLA 2A24A 4DRTA 3H9GA 4YOFA 2VJIA 1YJNI 3E98A 4DJ3A 2FF4A 2VGKA 3E2KA 1IELA 1N9BA 3MMHA 1S3JA 4KQQA 3MKLA 2FA5A 1LFUP 1MWSA 3S17J 2PR5A 4HV5A 3MF0A 3KZYA 4I3AA 4OOYA 4UA6A 4I01A 2IVMA 3QPTA 5DM6F 1EJ9A 4LLOB 3OCLA 3FKIJ 2JWTA 3OIOA 5E18F 4ZYDA 1LNWA 5EEHA 5K7ZA 4Y2FA 3T4KA 2IAIA 3CUQC 1MKMA 2FX0A 1QVTA 4KICA 3CCVI 3IH2A 4B3AA 1NK3P 3W6VA 5KAFC 1SFKA 4HX4A 1WYCA 3KP3A 4ME4A 2EB7A 4F92B 3J81K 4YFXF 4BUPA 2O7OA 5AONA 3V7CA 1Q2PA 1IRXA 4IHXA 2EFUA 4RLFA 2A05A 3TP3A 1YMSA 4K0WA 4IX7A 1VNDA 2XDVA 3K2ZA 1U5TA 4HAMA 4JKTA 3UNWA 5GP9A 2NVTJ 2GA2A 2K7SA 4K91A 4JPMA 1GSXA 1TW2A 2TDXA 3DXJF 1U8RA 3FIWA 5L3BA 3AKZA 1CQTA 3PO2J 1S4RA 3GR2A 1ETKA 4X68A 5FDHA 4O5VA 5HAPA 2K3PA 1TWAJ 3PUFA 3DPUA 4WF0A 5AQBA 2L7FP 3F8FA 4ITVA 2LF7A 5FAOA 2KFDA 1OKRA 2FFYA 4RVAA 4HLYA 3T1BA 1XJ3A 1WH5A 3FXRA 4R38A 1IZ1A 1D5YA 2EZLA 3DFGA 1ULYA 4HRIA 4LV1A 3T5XA 4EV0A 4Z2YA 3NARA 2R7OA 3QU6A 1RR7A 5CQEA 1ZG5A 1IEMA 1SCWA 3HUGB 3LA2A 1PYYA 1RGYA 3NEUA 2RL3A 2A6EF 1RUOA 5AVEA 5D4SA 4KUKA 2Y31A 4LIUA 3DEUA 3LA7A 1G3YA 1ZHHB 1GHIA 4JP0A 1H88C 1S7OA 4GLQA 2Z99A 4YINA 4GDFA 3WRTA 3QP2A 1BI2A 2QZ8A 2X51A 3OS0A 4XN3A 1A5JA 2TRTA 2XDMA 5IOZA 2QCOA 1HA8A 1VEUA 4QD4A 2JKGA 2STTA 4X69A 5I94A 1ZTRA 2ISZA 2IT0A 5CTNA 5JYPA 3K4CA 3MR0A 5IS1A 1TW3A 4QB8A 4TV7A 1WCMJ 1KOUA 4LLNA 1PZOA 1UFMA 3AGDA 3RKQA 3ZMVA 2H1LA 3Q7VB 3SDGA 4PAUA 2BV6A 5EZGA 1APLC 4NDLA 3MZYA 4ZDPA 5JVTA 2VPRA 1KE0A 1NRFA 3H9QA 3TW7A 3D72A 4P6ZS 2IGNA 2CQ7A 4RAGA 1T98A 3DBHB 5EJCA 4L9JA 4CZZA 1RP5A 1G3SA 4HZFA 1SANA 1Z67A 2K2NA 3CZDA 3G2YA 4M3KA 1X2NA 4FTXA 3DKXA 2JBFA 3V39A 4RYEA 1ZKJA 1LSVA 3M8EA 1RC9A 1JVJA 1HF0A 2J3TC 4JXVA 3GTQJ 1HC8A 1JTYA 1MZUA 3OYKA 2UZKA 1W8QA 1G6AA 1C3BA 4L9TA 1KA8A 2XF7A 4RB1A 3JRIA 2HOSA 1JNUA 1XFQA 3EUAA 2ZB9A 2JRMA 4W1UA 4CCOA 2WWYA 2ZL1A 4WF2A 2J80A 1ZGJA 2Z2MB 1HSTA 4BXXJ 2WAQN 2O3FA 2XROA 2MH9A 3MKWB 4G3VA 1YJ9I 3BRMA 4WEJA 3CF2A 3BY8A 3HOUJ 1GSVA 4BBTA 3IH9A 1T33A 5HDGA 2R9XA 4PM5A 1DJAA 1P4AA 4R70A 3VSKA 1DPRA 4NXGA 5HSQA 2FFFB 3K1NA 2NRAC 1ES2A 1I1SA 4KMUX 2JN6A 4ARZB 3BDDA 2J5OA 2VOPA 3B47A 3T4QA 5EDNA 1Z3XA 1YT4A 1W5DA 4IO9F 4I98B 5ICFA 4MO7A 4CCJA 3C7VA 1R5ID 4EU0A 3A0RA 5KSCA 5F04A 3OIQA 3ZQCA 3WE2A 5DUIA 3L2WA 3ZCZA 2LR8A 2K02A 2QF7A 2HQ5A 1ZK8A 3AG4H 1K78A 3Q1FA 4LLLA 1JXSA 5CHJA 2BY0A 1AHDP 2LB5A 2EA9A 3S3NA 1KDSA 3L1PA 1UHMA 2HR3A 1UG0A 5CGSA 1KVMA 1SKFA 1YAXA 4CLCE 3F1OA 1D0YA 3ZMTA 5LHIA 3HOZJ 3WU0A 2DO7A 4DBRA 2BASA 4R4SA 5J8CA 2F5EA 4CYDA 3H0GJ 4A3MJ 5E79C 1FILA 5L09A 2X9DA 1CEFA 3ABLH 4ZYEA 2HWVA 4DKIA 5A93A 5E3LA 3FKJA 4JXGA 1E0EA 2XFTA 4O0PA 3J7AO 2FSWA 1HDPA 2W3HA 2EFWA 2DFFA 1U9NA 1UB9A 3FXLA 2V9PA 3BZKA 4ZH4F 4RB2C 5F1RA 3NOUC 1BI1A 3FHZA 2E1MC 4HSRA 3VP4A 3RQIA 4DN0A 4ESBA 4BE1A 1ZG1A 2BY3A 4CCLA 1GA9A 5FQKA 3H3VK 5JYOA 2W3EA 3A3JA 3K2NA 1YW7A 4D0PA 3DTMA 5FASA 4XT2A 5IY5H 1Z9CA 2ID3A 5FJ8J 1GVJA 2QM3A 4IVIA 2L4MA 2KHMA 4DIQA 3T1SA 3R6SA 4E3OA 3HBLA 3RH8B 3UB5P 3RYPA 3OYFA 3NJAA 4NNJA 5HD3A 5J1YA 5IPAA 2JVGA 3O2PE 3OY9A 2Z2LB 4IPAA 3A3EA 3PNTA 2VKDA 3Q0WA 3BFGA 3ELKA 2RQPA 5ILSA 1XGIA 2K86A 4A93J 1YLTA 1YLWA 1HW1A 2E8JA 2Y8HA 3FF5A 5H6RA 3ZMDA 1YSPA 5EG0B 5HDSA 4GDNA 4Y0TA 3CG5A 3E0YA 4QU3A 3DTKA 3H5AA 2EK5A 5F08A 4WEKA 3OR1C 2X1DA 5IP9J 1HOMA 4HNTA 4AVPA 3CF5F 3OMYA 3FZCA 4X1LA 3JAMK 4V2GA 2YKHA 1A35A 4RBOA 2X6OA 3PQJA 2D5VA 1TWGJ 5CEDA 4DE0A 2MW8A 4XN0A 3SYTA 3BG6A 3HGYA 3TO9A 3LCEA 1PVEA 3IWFA 1R58A 3QP8A 4QTRA 3ZPLA 4UHUA 3DPTA 1B4AA 1IYSA 5EVIC 1ETYA 1BC7C 4ZTJA 3BTJA 1B6AA 4RGRA 4ON0A 2W3FA 1D8JA 2QJ5A 2PD7A 1D3YA 2EZIA 2RREA 1S72I 1DDNA 2KZGA 3SS4A 4E3JA 3K70D 3IL2A 4DMZA 3KYCB 2VBYA 2B9SA 2MC3A 3HLFA 3VYRB 3IXBA 4PKYA 1FP1D 2O03A 1LSWA 1Z6TA 3CCJI 4UUSA 2P7CB 2R7WA 1KGGA 4WELA 5HW3A 5TFQA 4FE4A 2VJ5A 4FD8A 3OOUA 1Y6IA 2OUMA 5IT3A 5D5VB 1DU6A 3KSFA 4XOTA 3MFKA 4ZDXA 3DBAA 1OTEA 5FATA 2WYXA 4BBUA 1Q2QA 1IDZA 1N9OA 5E3NA 4R3AA 1J7KA 1TNTA 2E7WA 1OISA 3HKZN 4CZCA 2V1AA 2DU9A 2X02A 4GD6A 4OQ0A 2FUG2 2VN2A 3WTWC 3C38A 3NHQA 5L07A 3NWTA 3RJUA 2UXNA 4E6KG 1ON1A 3A0SA 5J1UA 4S2NC 1XSXA 2BW3A 4D5CA 4PFOA 2Y79A 4KZ9A 2UWMA 1I27A 3C30A 5EM1A 2K9NA 2ZJQF 2OCCH 1BR2A 4GRIA 1OTDA 3DCFA 1LL8A 1VQMI 4R79A 1K55A 2XAHA 5HDKA 2HDCA 2P4WA 4GFBA 4LK0F 5G4YA 3K4LA 3IXGA 1W7PB 3BYDA 3UNGC 3O8GA 1XDSA 2VL8A 4OINF 4RB3C 3WG7H 4O7DA 2LOOA 1MBEA 2HQAA 1LQ1A 2NVQJ 1IKGA 4B9OA 4G6DA 1IN5A 1HDDC 1BR4A 3K4BA 3GVBA 1IAWA 5CVUA 3F1PB 2E2JJ 3HLBA 3K10A 1PIOA 3MKEA 1FIKA 2ZXJA 3IWOA 3DTEA 4ZAMA 1YX3A 2NVUB 3BLMA 5FAPA 1JWZA 4IEDA 4EQIA 1CF7B 1L0DA 1UCRA 1YX5A 2ISYA 5DKKA 2COBA 5CRFA 1L0EA 3LSPA 1X1AA 2ZSIB 5L2FA 3BQ8A 3K1PA 1PP8F 1TS0A 4UB6C 1T38A 4PUSA 1Z6FA 1B1BA 2L2OA 3OYLA 3IX4A 4IBRA 5L3GA 1J75A 1PP7U 1S4SA 4L9GA 2E5NA 2QVOA 2HDUA 4DXCA 3K6GA 3UE0A 1QHHD 4YNRA 3RZDJ 5GL9A 1TS7A 5CVRA 5CGXA 3ZG7B 1YW9A 5F6AA 2VKSA 3NULA 4KN4X 1HQCA 3SFIA 3CJQB 1G68A 1G6NA 2HGCA 2AXLA 4EERA 3ZCOA 3MKZA 2HGVA 3OYJA 5FFXA 1YQSA 2Y2HA 1H3QA 1SHVA 3T12B 2VLAA 3SW1A 3C18A 3UB8A 2DPUA 5DDGA 3R7WA 4M9SA 3KP2A 3TDZC 1G59A 2O99A 2HXIA 1WWXA 2W82A 3A01B 2KKOA 4BDZA 1P2FA 1O07A 4S2PA 4EETB 2R3SA 4A3FJ 2V4JC 1EW0A 2QWSA 2VEAA 3ZDJA 2J5PA 4G3KA 3KE2A 5LGUA 3SDBA 2NVXJ 3LI9A 4N9KA 3HHHA 4OU0A 3SZPA 3V8JA 1OT6A 3B02A 3GMWA 1MD0A 4HQEA 2F2EA 2HFHA 2ACGA 4CCNA 4QIWN 3KETA 1S66L 2E1OA 2K7LA 3G2ZA 3P9IA 2Q1ZB 1XFNA 5EECA 5D5UB 3G6OA 4GZBA 2MFZA 4YIFA 2DK8A 4G6QA 5GHXA 1NY0A 3FXOA 1J0RA 3PJRA 3ICYA 4C3HJ 2PHYA 1R1VA 2IPQX 2LREA 3ZP5A 1D0ZA 4L9VA 3WGHA 2L7KA 3FM3A 4L0LA 2XAQA 4CCMA 4F3LA 3LOCA 1YLPA 4KDPA 2GJ3A 1V4RA 3MBZA 1WJDA 4XLPF 3ZQ7A 4I02A 1Y8QB 2HXOA 3HPHA 1XTAA 2OTJI 3KSHA 3CHWP 2E19A 1PI4A 3TSGA 2ZXWH 3BQZA 3VP2A 4CUGA 4RB0A 2PJRA 3WU2C 3VOEA 5JHFA 2LF8A 2LK2A 3BCBA 3SJMA 2A5WA 3P98A 1R7JA 3BWGA 3GZ5A 4I99C 4ZYAA 3SFZA 1E3UA 4PJMA 4I39A 3ZFZA 1JI8A 4XT2B 1ZAOA 3I59A 2LFBA 4BHCA 1DP8A 2YR2A 3ZQQA 2DA4A 4EJVA 3ABKH 3W3CA 5FKKA 3OZHA 2W1RA 3FV7A 2WY8Q 2AQFA 2UUZA 5HARA 2A24B 2JJ7A 2J8YA 4HH3A 4NBQA 4X1EA 5EVIB 1SEUA 3LQRA 1U5TC 2JKFA 2CMPA 5AIQA 5J3LA 4ANJA 1ZGAA 1VQ4I 3BW6A 1VZ0A 4UA9A 2UWXA 4WK8F 2IA0A 5HAIA 5DM7F 1USSA 3BG7A 2MLKA 2WZXA 1P9RA 3OYDA 4Z1WA 3VYSB 1PUEE 2WB1A 4E7ZA 3VWBA 4M3BA 1NLYA 1T1CA 2QJ7A 3BQYA 1W79A 3LA3A 4GS9A 2M2EA 2DMNA 5AQ9A 2KL4A 2VOOA 2M3AA 3R0JA 1TBXA 5LD2C 2H6BA 1GHMA 3IXDA 2NOJB 3RFBA 1IJWC 3CP2A 5LHGA 1K57C 3HUNA 1MNEA 2F5VA 1FWZA 2V1XA 2WKQA 2ZJ9A 4LV2A 2GBYA 1OPCA 2E34A 2IBDA 4MNUA 4OQIA 4G12A 3OLOA 1HW5A 3HB9A 5F82A 3S2WA 1MBKA 2W84A 1AOYA 3KYZA 2HDWA 1MPLA 4ZJ1A 2KISA 2BHZA 1VTNC 1F43A 4B1RA 1DP6A 5EM0A 2AO9A 4LOCA 2YUSA 1SFEA 1L2SA 2HU9A 1LL5A 3GRJA 4JBFA 3UPNA 1XJ2A 3S1NJ 1O3QA 4M4XA 2CUFA 3FBNB 1YLZA 4ZBEA 4IEJA 2V1NA 3EYYA 2E60A 5F0HA 4O6JA 1I6HJ 3HTSB 4DBQA 1FYLA 1MWTA 3V5MA 4IHTA 1H8ZA 3F6VA 4XLHA 3EPZA 3FBIB 1MMGA 5IOYA 1W36C 2M1CA 2CW8A 2Y2KA 4MIMA 3E97A 3ABTA 1TL8A 1DPUA 4A0YA 5TRDA 3COAC 5FKOA 4CHUA 1B59A 5ICCA 4IL6C 2BBYA 1LB2A 1KQ8A 5DTTA 1Z1DA 4NKPA 1KQ9A 2GDNA 2Z6DA 4BQMA 1C0WA 4MLLA 2PMUA 3S4XA 4CICA 2V1ZA 4DDSA 4Y13A 1X1PA 1Z91A 1JTGA 2D01A 1FMWA 3K1MA 4PM9A 3HRMA 4DJAA 3QPLA 2WK0A 3KYEA 5FRMA 3UN7A 1XX5A 4AUXA 2PJPA 1WJCA 4J01A 2R5ZB 3A3FA 3HJIA 4HF0A 2X1EA 3C7JA 3MWMA 4G94A 3BY6A 2GXGA 3VB2A 1UWPX 3CI6A 4KZBA 4C2MJ 2LH9A 1R9TJ 2UV0E 4EJTA 2WAQA 4IKFA 3JRGA 4JF5A 3Q5FA 1D06A 2ZJPF 4HY8A 4OIRF 2R5YB 3RIRA 1TDLA 3WS4A 3AFHA 3R61A 2E1MB 3GWZA 3HIFA 5D6FA 4L0YB 1X58A 1BLCA 3LMMA 4U0VA 5FEGA 2JC7A 3QQAA 3KP6A 3DW0A 2R7FA 5M18A 3FXMA 2DQLA 3CMAI 3GLLA 3W6KB 5GTIC 5GPCA 3HRUA 1RI7A 1UMQA 1WVRA 4FISA 1MBFA 5LGTA 3A01A 3VE3A 1Y1WJ 3E0JB 4IVNA 1OT9A 4LG0A 1O7LA 2AXTC 3OL3A 2X01A 2CUZA 3F8MA 2FEZA 5L10A 4X6TA 3VP1A 2XGDA 1LDKB 2X48A 3MZDA 4KG5A 2C6WB 4LG0B 3E6MA 1ZH5A 1OCOH 2BY1A 1QZYA 3KLNA 1WJBA 1JGSA 3FXQA 4OPRA 5IU1A 1RKTA 3MKYB 3DBLB 5HL6A 1V3FA 3IV5A 3SEZA 3NI9A 4K2EA 2VV6A 4EM1A 1TS8A 3ECOA 2JN7A 4QWOA 1ZREA 3VFHA 5HS7A 1ZQ3P 2ZMEA 3SS3A 4AIJA 2RAEA 2QKLB 3CCLI 5F5YA 2IS1A 1XP4A 4NETA 1BYWA 2Z3YA 2L54A 2F6CA 4D1QA 2DODA 5GAHJ 1D1BA 2MH2A 1HKSA 3CC4I 3H7WA 2ZQDA 4XRMA 1O3RA 4KZ4A 2G9WA 5FI2A 1L0GA 4CXFA 3IWIA 2M9HA 3H3UA 4E7LA 2K85A 2EH3A 2Q2EA 2VASA 5F64A 4XIDA 3IH8A 5AQAA 3F8BA 2XHKA 2VLGA 3GMEA 4Q4ZF 2L7MP 2Y2PA 3I55I 3A4CA 1Y56A 2OAQ1 5JVGF 4S2KA 4FX0A 1CGPA 2DRWA 3C2WA 3ISPA 3VYUB 1YFHA 2L0WA 2JVHA 3H5NA 3DLAA 4JLFA 3EETA 2M4GA 1NLZA 5J4VA 1TWCJ 1LKXA 3OYEA 1K7AA 3GTCA 4J19A 2FNPA 4UEYA 1OYYA 3WODF 4MCWA 3CCEI 3DQVC 2ZM2A 2WKRA 1STZA 2DFEA 4AYBN 3PR6A 1B72B 1R6RA 2DDBA 3BPXA 2O8XA 1K61A 2GM4A 2OWHA 2XAFA 3NDGA 2M0MA 2Y48A 3KEOA 4XQFA 2JZYA 3E4PA 3NRVA 3T4LA 3L2CA 4GS9B 4HQMA 1R5HA 2F5CA 2W00A 3L00A 5C44J 1T6SA 3LAPA 3NY4A 4EM2A 2XAGA 3H7WB 2BXZA 2NUPC 1J09A 1GVDA 3C2GA 4NC6A 1W0TA 4A2UA 4M3EA 1ZYRF 3Q9VA 3B73A 4EJWA 5LGNA 2CV1A 2Y2IA 3KZIC 3GSGA 4BWIA 2DAOA 3R4KA 1VQPI 2L1MA 4C2UA 4HDUA 1V9ZA 4L9NA 4QY6A 3MZEA 3CMMA 3W4QA 1YIOA 2FQ3A 3CJNA 3KZZA 1T1AA 1I5QA 3OYHA 2W4SA 5DV5A 3OOVA 4D7MA 1AWIA 3EYIA 2XQZA 5D6EA 1RESA 2W85A 4DGWB 1MXOA 1N4OA 2X6YA 3A0BC 1I50J 4E7SA 3JSPA 2FXAA 1K54A 1EV7A 1N78A 1LHYA 4KFCA 2CRGA 5EYRA 3H9WA 1K6SA 3MXSA 1G6OA 5HS9A 1QMEA 3TGNA 1HTZA 1NHAA 4EMSA 2VJ4A 5JFRA 2RKHA 3RTYA 1W63M 3OS1A 4OIOF 4PSWA 2M7VA 1W7PD 1VQ7I 3M4OJ 1ZG4A 3S7NA 1S5LC 2E5ZA 5E20A 3K4NA 2ACJA 1PYVA 5BMZA 2ZQCA 4BBVA 2YPRA 4GDBA 4LRZE 2XPUA 2JUGA 4HLXA 5F0FA 3AG3H 1ACIA 3C7UA 1F36A 3O88A 4MEXF 5FO5A 1TS6A 3PBQA 3HKZA 4EQ1A 1OR7C 3B3XA 2YKFA 1F9NA 4HYEA 3VFZA 1ONHA 3NIAA 4GYIA 4R1GA 2VUMJ 4A5NA 4S2MA 3TW8A 2VKVA 4OWRB 5BQTA 3OV8A 2DOAA 4CA0A 3I4NJ 3PHYA 2G0EA 1WGXA 4G7HF 3OYGA 4CH7A 2XC7A 1BUEA 4WBGA 1TT0A 3KIOA 4OQHA 4KIFA 3VYTB 5KNLA 1F98A 2R7QA 2WGVA 2K27A 1IOUA 3HSEA 5HDDA 3F1NB 3DEWA 1V55H 3GECA 2QYOA 5IP7J 2QYBA 3I0TA 3NECA 3V3RA 2VQGA 2LVSA 1VI0A 2DA3A 4JK1X 5DTDA 3GTJJ 3OYCA 1OJ5A 5DFYA 3J7ZI 5FRNA 2DW4A 5E2FA 5JR3A 1E3PA 2KRFA 2BZTA 4HOIA 3CCRI 4B8XA 1YRNA 3G1MA 2F4IA 3BZ6A 1POGA 3OYNA 1O4XA 3GDIA 2JA2A 3LEZA 2NS7A 2OBPA 3QAHA 3R0AA 1TEMA 2R92J 3I53A 2P7VB 2ZNZA 2J3TD 3M7GA 3G4SI 3FC7A 3VV4A 4HESA 3HC7A 3DF8A 3V42A 4ABZA 1N9NA 1MJBA 2W57A 4L9FA 4LENA 2L9VA 1GXQA 1DP9A 1B9NA 3UPOA 4EEFG 2LY1A 1FYKA 3LQQA 4P5OA 3MKFA 4WN5A 1RR8C 3A02A 2DMTA 4BE2A 1XKZA 2HVQA 3PM1A 2VKEA 3PIOF 3C4PA 3P01A 1PFLA 4A3BJ 1SD5A 2ME0A 4M6XA 1IF1A 4LFUA 4K08A 2JRTA 4QSHA 2GNXA 3E5XA 4KG2A 4YEJA 3SS5A 3UB6A 3C3WA 2R5ZA 2PFBA 2HJEA 3MN2A 2O9AA 5FQQA 5TBMA 2HYJA 5HODA 1BI0A 3B33A 1FSEA 1LVKA 2VC0A 2VIXA 1ERMA 2M5WA 4GCVA 5CKTA 3GX4X 1E25A 1S1YA 3AL0C 3VOYA 4RMNA 5HWTA 1B9MA 1HVBA 1X3ZB 2H8WA 3EUKL 2DNSA 4RGUA 1PWDA 4BKXA 4DYCA 1K0KA 3KP7A 4NQWB 3G32A 5DF7A 1FCOA 4HX7A 1ZC2A 3KX0X 1SC7A 4UV8A 3VODA 1XC5A 3L2UA 2V26A 3OYAA 2Y55A 2EA2A 4XLCA 2QHKA 2NYXA 2WADA 3PO3J 3NOTC 3SH8A 1MIJA 4S2JA 2QPNA 2W25A 3BPVA 4YFMA 2VBWA 1GT0C 4A3KJ 4B48A 3ZQLA 1MWUA 1MGTA 2K9LA 1KE4A 5FLVA 1W63Q 3BFFA 3M2JA 1ETXA 3WS1A 3F1PA 4G9YA 3N8SA 4KT6A 4R23A 4MHGA 1KU9A 2KIFA 4AU7A 4O3MA 5HAQA 3SXYA 2P8TA 5J8FA 5FB2A 4I5SA 1NH3A 5J4EA 3BFCA 1KU7A 2DA6A 3A1YA 2P6TA 1WJEA 3TW6A 1NYMA 1H89C 4BD1A 4PJJA 2ECBA 4DW6A 5J47A 3QP5A 1TWHJ 5FKMA 5ILUA 1H5XA 1ODVA 3ZXSA 2V20A 4JXSA 2CMNA 2DBBA 3IRRA 5A2QK 3K2AA 2EWVA 5FLXZ 3Q07A 4YELA 4XSZF 3GTLJ 4KZ8A 2XGEA 4HPQA 4HH2A 4HEA2 1X4PA 1HLVA 4HW0A 3UB9A 4XKVA 2KDKA 1MMAA 2V1DA 1V5EA 3PL8A 4XXRA 3LY4A 4I7HA 1JHFA 2EX8A 2ZMFA 4IBXA 5EE8A 3HSRA 1I1GA 1W5TA 5CPRB 1SKOA 4M9XA 2PR6A 1YG2A 1M1EB 3GF2A 4C3IJ 4UV9A 3OYMA 4FOFA 2DA1A 2LLKA 3P9CA 5CVJA 1K4FA 2B95A 2KIUA 5CEBA 3JVUA 3QPSA 3QYFA 4XBFA 2O0YA 4X6AJ 2L3DA 3U1DA 3CO7C 3FWLA 3VP0A 1OQYA 2ZMEB 1F5TA 4F7ZA 1VB6A 1D8KA 4UQIM 3UDXA 4ETXA 5FA7A 1X3UA 3DEEA 4II3A 2V7FA 2QENA 2CUEA 2LYCA 5FROA 2ZC2A 1FMVA 5B1BH 4XNFA 3KEYA 1S6LA 4OVDA 1XDUA 3PNYA 1UGUA 3FMRA 4BY1J 3EUHC 3OPPA 4E6WA 1VF9A 2Y2GA 5FI7A 5FL3A 3R7WB 2WKHA 1DRMA 2N8GA 2MD5A 1GV2A 3LFKA 1LEBA 3S14J 5LLQA 1H0MA 3K3CA 2EIKH 2RVCA 2I5UA 1MDMB 2A5YB 2M30A 2R4GA 4LMYA 1QPMA 5LFAA 4IZZA 1ACFA 2ZC3B 2ID6A 2K9SA 1P92A 2CQQA 5LRRA 4UVBA 3BM6A 5M1AA 2LNBA 1ZARA 2RC4A 3OOPA 1A04A 3PBTA 4RX3A 3TRCA 2WKIA 4WZ5A 4N4NB 5HVQC 1BA5A 1ZRCA 1R5GA 3N4MA 3LICA 2VODA 4A3JJ 2UV1A 5IT9Z 2IGOA 1ES5A 3Q82A 1RRJA 2ZJ2A 3MJQA 2JKTM 2R0QC 2DA7A 1MMNA 5FKLA 1OMEA 1XGJA 4MN7A 1H9GA 3GV9A 3S7QA 3I9V2 3ZVTA 1LUJB 3O6BB 4S0HB 2OF7A 2Y75A 1LJ9A 1FSYA 3RSNA 4D7NA 1Z6RA 4DOZA 5EVLA 2VJWA 4CLCD 3FWEA 1IRFA 5L3FA 3JREA 1SFUA 1K57A 1IFQA 2D02A 3LR0A 3Q81A 4S2OA 1MZBA 1N75A 4FX4A 9ANTA 1HZOA 1MH3A 3HLEA 4CGZA 5L3CA 2KZVA 2P08A 1FCNA 2ZCWA 2EFOA 4DJ2A 2VBZA 4OOIA 3N7WA 1R1UA 2FOWA 4RAFA 1MJ9A 3REOA 4B44A 4G8XA 3RKXA 2QSHX 3L2RA 4Y7NJ 1N9LA 3CJTB 2JKTI 3ZNTA 1I6XA 2G2WA 1D5VA 2JKRI 4GN2A 4U0XA 3GYHX 1JWPA 4MN6A 1Y0NA 3BJ6A 4MTEA 3K7AJ 3IHAA 4FQGA 3PXPA 1ZR4A 5EGOB 2IP2A 2WY7Q 1T39A 4HDVA 4AYBA 1ON2A 2A69F 2BOLA 2GA1A 3C4OA 1FYMA 1YM1A 3OC2A 1OJLA 2VT3A 3H35A 2B5RA 3IRQA 2ICWG 3G1OA 3J80K 3G30A 3JRAA 3VE4A 4E7JA 2A6HF 2INWA 3QHYA 5U47A 3CZ6A 1I5ZA 1USTA 3HGGA 2W3GA 2HTJA 3BY9A 2PBIA 3NC8A 2DOFA 2ECCA 3WHBA 2I9VA 3D9YA 3RPUA 1EH8A 3CTAA 4G7ZF 4A12A 2X71A 2VB6A 3DTIA 2Z9OA 3N6IA 4BLMA 3W6JB 2GXAA 4ZTKA 4BQQA 2W48A 2HVRA 2Y2LA 5FEFA 1ZLJA 2VC1A 3KPHA 4M3GA 4FTHA 2HOTA 1D7EA 3ZGAB 4CYCA 1BOAA 3BROA 2LTPA 1IV8A 2JSCA 1YMXA 4KZ5A 3S2DJ 3T8TA 3KP4A 1FC3A 2WV0A 4A69C 4CLCB 2HKOA 3P5JA 1NWZA 4PJLA 2L02A 2H6CA 2BVLA 4CYCB 2HYFA 1ZKGA 3TG9A 2L0KA 4AIKA 3EEHA 3KYDB 4A6DA 1ERDA 3ISGA 3VSLA 2EV5A 3Q9SA 1H8AC 3HUMA 3IBJA 4KZ3A 2Z2SB 2ZD8A 4EESA 1A31A 3RPQA 4FH2A 4YRVA 3ABUA 2OAP1 2GZWA 4ZJZA 2R7RA 2Q2EB 1U60A 5H6QA 2HDDA 1I3QJ 2GOMA 2R78A 2JA5J 1FP2A 2Y69H 1O7EA 2RDPA 1XSVA 3T4OA 2H0YA 4OIQF 4EW7A 2X0LA 4EATA 2MJ6A 3SEQA 4I38A 1OTIA 5J7EA 3L09A 1QO0D 2HJ9C 3T1QB 3V7RA 4DE1A 1YYVA 3PFYA 4P9FA 5KSHA 5EEGA 3E4OA 3CUQB 4PHTA 2PMZA 1EKEA 1QGPA 2Z5UA 2ZFWA 4H0EA 1BLPA 4S05A 1GUUA 1WHUA 1TQPA 3GVAA 4GHIB 2XSSA 1G3TA 4BAYA 3QP6A 2QBYA 2LDUA 2LY9A 3PNVA 3WTXC 4J00A 4XLFA 3A0VA 3IF6C 2DJIA 1TNSA 5KHDA 3N97A 3LYXA 5MC7A 3DLLF 2LG4A 3IQAA 2X6XA 5G4ZA 4DXBA 3R60A 1G4DA 4PK4A 1YTYA 2K9MA 3W2AA 5K1YA 4FHTA 3IH4A 3LWFA 2VXZA 1UJ8A 1W36D 4UHTA 3UB7A 3CWFA 4PPRA 4QLCU 3CDHA 4LK1F 5BOXA 1BIAA 1U6GA 5GADJ 1BBYA 4Y0UA 1ZELA 4NXEA 2HTSA 3PSFA 1GLNA 1BZAA 2X85A 1RUNA 2PBYA 2ZMAA 1CEGA 3G34A 3LGOA 4WMCD 2HS5A 3RCOA 3W4PA 3FYZA 3EDPA 2ME6A 2ZC6B 3ASOH 4XICA 4JX6A 2KJCA 1Z21A 3QODA 1WJAA 2L9RA 3HEFA 1PUFB 3VDXA 4FCFA 2Y0MA 4UVAA 2VONA 4MDZA 5J8XA 2R7XA 2L5QA 2Y9YA 2KRHA 2K9QA 4BJTA 1I39A 3QYBA 4N9LA 1IN8A 3RJPA 4ENKA 1YRNB 3HLCA 3S7OA 4F3LB 1K83J 4BJ5C 1FOKA 3CESA 4CQHA 1P9QC 5CERA 3WS0A 4GW9A 3M2KA 3SHFA 4U0WA 2HV1A 4XSXF 1IN6A 4KQDA 2MABA 2OC6A 2DTRA 4U7DA 3BR1A 3ULFA 1FBQA 5DEQA 2FMYA 1VQNI 1SVLA 1F2KA 2BYVE 4OP5A 2HQNA 4A3GJ 2YSRA 3FPVA 1WE4A 2DN0A 2Y91A 5M5YJ 4N1XA 3FMQA 1TT5B 4WCGA 4MEYF 2HDSA 2BGCA 2JKRM 1GSWA 2KX6A 2XKPA 2IEKA 3TOAA 2ZC7A 3U2AA 2F48A 2COMA 4ZDLA 4E70A 2QSGX 3IS2A 5H20A 1VETA 3T0YA 2VGJA 4C3JJ 1WSUA 2KLOA 3HXLA 5CXWA 3SZTA 5F69A 2CFOA 1MW7A 1XGSA 4UUVA 3E5QA 2XK1A 2CUJA 2EFNA 2Y59A 2WAEA 5E2GA 1FBSA 3TO6A 3KLOA 1IUYA 4HNUA 2NS0A 1BTLA 3ITBA 2YX7A 3OS2A 1OTAA 4EEUA 1G2HA 2XGXA 3M8FA 1OTBA 5EVEA 4XUXA 2L9SA 5HPFA 2XRNA 4HBUA 3DV8A 4B47A 5EV0A 4E3MA 3QU3A 4BYYA 3UKGA 4RX2A 1FOYA 1EH7A 1SMTA 5M3FJ 5FQIA 4D2OA 2XSJC 4EVIA 5K7HA 4IXAA 2CGPA 3HPGA 2E2HJ 3A3IA 2R93J 4CJNA 3LSIA 2JT1A 3DU6A 3K4JA 4GO1A 1BR1A 1QZZA 2QQ8A 4B3XA 5DCMB 1K54C 5BS6A 2O8KA 2EFPA 1U78A 2WKEA 4B4CA 1GV5A 3X2QH 4X25A 1IYOA 3BFEA 3MVPA 1LDJA 5K5RA 3DAVA 2E7XA 2ELHA 1S29A 3TMOA 2EXBA 1FX7A 4GCZA 3MQ0A 2MSYA 3H82B 4II7A 3N4IA 1SFXA 3I5UA 1ES4A 3ZG9B 4EJUA 4BNCA 5F1FA 1HXDA 3FHNA 1Y54A 5F6FA 1N77A 2K4JA 4W97A 4IQJA 3M07A 1FTTA 2KOIA 3BTIA 2HOEA 3LAJA 3GTMJ 4JGOA 1VQ5I 4X1MA 1D0XA 3T1XA 3BT9A 3D1NI 3T50A 1RKWA 1R71A 1JKPC 1BL0A 3IT9A 2K40A 4RAZA 3KYLA 2VE9A 3CCSI 1VQKI 5BPDA 4V19K 1BLSA 4Q0JA 2IA2A 1AKHB 2W1TB 2FE3A 3MZHA 3S8PA 1D1JA 2WTEA 5HFOA 3D4FA 2EFXA 5D8LB 2VJJA 5GTHC 3D5SC 4PJNA 1TD5A 3VOZA 2B63J 3NCKA 2AQEA 5HWVA 2GIVA 4IQ4A 2K31A 3N05A 1O3SA 2LY2A 2BVMA 4PM6A 2QKMB 3S7PA 1TDGA 4M72A 3JRBA 3GTKJ 4YFKF 1GA0A 2HP9A 5KAIC 3RKWA 1SZVA 3T8RA 3FK6A 2EWNA 5DD4A 2IS4A 2PRFA 4FCYA 2V1UA 3GCMA 1IO2A 3L9FA 4JF6A 1T0FA 3P7NA 4AWXB 4OMZA 2M8GX 5JI6A 4EUVA 5DUKA 1YS7A 4M71A 3HJKA 1K4EA 3HLGA 4H8RA 4FE7A 3EUHA 4E04A 1SAXA 4I3IA 2H1KA 4MBKA 4L5JA 3BFDA 2O5RA 4HJ4A 5IT5A 3Q7VA 2DYRH 3HL9A 2EINH 2G7HA 2LKPA 5J6XA 3WGIA 3P09A 4NQWA 3FPWA 3IWQA 5GHYA 4NUBA 4L0ZB 5FSRA 2DMQA 1Z0XA 4GJ4A 3Q7ZA 2OV7A 3ZOBA 1WA9A 3KX2A 2XPWA 5KMWA 3MZFA 1H9TA 2FOKA 3BR0A 2PYPA 3S15J 3ZGKA 5GAEJ 3HUGA 5EOEA 2DMUA 4XMYA 4E4HA 4MQ9F 3OCNA 2QMIA 2CQKA 4KENB 4U87A 3WTSC 1PZPA 4JX4A 4M9ZA 1AU7A 2R7SA 2HPIA 3LY3A 3MFXA 1KQ0A 2GIZA 3ZMSA 3G2BA 3W8KA 4DZPA 1NG7A 1BSGA 1AA7A 1PW1A 3PBRA 2O61A 2XSDC 4ESPA 1JUSA 5CHUA 3M1CA 1MMSA 4B4ZA 3Q3SA 5A91A 3O87A 1SD7A 3SH9A 4B93A 4PFPA 2VBXA 4AM3A 2XD1A 1ERQA 3C5AA 5EG0A 1W8YA 4KZAA 1R36A 1ENHA 3IC7A 3CC7I 5L3DA 4Q5SF 1R00A 1U0JA 2NVYJ 3FZVA 2ZXIA 1G8XA 3RTRA 2KLIA 5BNGA 2WGWB 1DUXC 4Q47A 4OLDA 2D45A 4PM7A 5HX9A 1QVUA 2VX8A 3S93A 4CDGA 3GTPJ 5E1XA 5JHUA 3IF6B 2ZBBA 3ERMA 1YLFA 5K5BA 1W4MA 2LRDA 2DFHA 2LSOA 3ASNH 4RA2A 4DQ2A 4KITB 4IOCF 3CDLA 2XAJA 4XR6A 4XORA 2GZAA 2ZQ7A 2VXDA 1U2WA 3Q0UA 4HBTA 4BL3A 3HRSA 4IHYA 1MBJA 2BEOA 3LIDA 2ZBKA 4U88A 3BLYA 3CUEA 1X3WB 4EV4A 1IXRC 3C1DA 1Z7LA 2G7UA 1MDMA 4DE2A 2Q0OA 5IHVA 3D0SA 3JTGA 4CLCA 1OCCH 3LIFA 1LLBA 4OLGA 5DJTA 4MN5A 3BR3A 2HF6A 3HTUA 1FCMA 5J40A 2R7VA 3O86A 2DJNA 2E1CA 4DE3A 2GAUA 2JHEA 3G71I 2V9KA 2M7UA 3DU5A 3K3DA 3LR5A 1OCZH 2W24A 2GWRA 4A3IJ 4HEFA 2UXXA 1YI2I 4CPKA 3CCMI 5FLXK 1XSDA 1I2SA 4Y0OA 2CQXA 5BOHA 1RZ4A 2IWCA 1K25A 2QA4I 4X0GA 1WJ5A 1ZTUA 3PBNA 3FMSA 2BXYA 2CO5A 3IF6A 1F9IA 1P4XA 2R7ZJ 2W27A 3S1MJ 1NJ4A 3T4JA 4AIHA 1N25A 3TO7A 2NUTC 5EUAA 2PLYA 2PU4A 2DT6A 3FKWA 3N8RA 1IDYA 1Z7UA 3HYIA 4JGQA 1JGGA 2GOXB 3ZYTA 1EH6A 2ESHA 2VZWA 4PM8A 1PNEA 3M8JA 1KU2A 2P04A 2V79A 5TBMB 4CLCC 1S1ZA 1VQ8I 4BU2A 2ZQ8A 3GZ6A 1OCRH 4ZYHA 2LP0A 3KSGA 4H6JB 2MD0A 5FGMA 1WPKA 4QHCA 3TEDA 4C75A 4KZ7A 1XPBA 3V7SA 4WLAA 1FJLA 4E7HA 2NOGA 3HHGA 1EF4A 2HVSA 3CCQI 2BHYA 4P87A 2XR0A 3F21A 2ZOIA 1TLHB 3BG9A 3VOLA 1F1ZA 4LD5A 4D5FA 3MAJA 3G6EI 3H92A 3D3OA 4KN7X 4BH9A 4BS9A 5G18A 4HJ3A 5IYBJ 3T4TA 4H4KC 2JCHA 4XKWA 5FD6A 2A3SA 4A6EA 3IH3A 5E1WA 2XUBA 3OSFA 1FSHA 3MD2A 1HLUP 1O3TA 1TF1A 2EXAA 3MXRA 4WUJA 2DCFA 1GHCA 4UXNA 2Y30A 3JVVA 5CECA 4GD8A 4YFNF 1W1WE 3CCUI 4WXHA 4E7KA 1L3LA 2STWA 2H28A 4P85A 1S7EA 4NC8A 2FQ4A 3WWXA 3QPHA 3HOYJ 4B88A 2DYSH 4U0TA 2GQQA 3K4MA 1YIJI 1W7FA 1FOFA 5ICEA 5HD5A 1KGFA 1SDNA 3V8LA 4XL9A 1J2XA 3FKVA 3IF5A 4HIAA 4IHQA 2CYYA 3CQZJ 3TQNA 1VQOI 2M45A 1YS6A 3PFIA 3BECA 1XGNA 1FT9A 2LBFA 4ZYGA 2KDOA 3CJMA 2OA4A 1YQAA 2HOAA 1FSWA 1S0WA 5M19A 2F5FA 4A0ZA 1K79A 1LVAA 4WX9A 4EJOA 1F4KA 3GFLA 1B8IB 3HCYA 3IBRA 5FQJA 2PQ8A 3IKVA 5HNHA 1NXYA 4WZ4A 2J9OA 3E3VA 4RGSA 3NDEA 1L0OC 3HLDA 1JWVA 1KU3A 4OONA 1J3WA 5TJJA 2YX4A 4U0YA 2XH9A 4KIGA 1VHMA 5D5XB 4UY8I 3O5YA 4HJ6A 1JKOC 4Y17A 2D1HA 2VQCA 2A3UA 2V0WA 3PYPA 3CP8A 3HJEA 3OBFA 4XONA 1Y28A 2Y2QA 4NB5A 4RLQA 1MBLA 3BEBA 3VMAA 5BPIA 2QQ9A 2JA6J 1SKOB 2GX5A 4OH0A 5C4XJ 2MYSA 4M3FA 1YHQI 1K4TA 1RETA 3CUOA 3LSKA 4PGGA 3ZG8B 2DTZA 5DF9A 2E36A 1WH7A 5M5XJ 5IYCJ 1SDEA 4K0XA 3CMZA 2QQAA 4NK3A 5GLAA 3KFWX 4P6ZM 4AVZA 1QA6A 1LI0A 4S2LA 5EFWA 2P6SA 3VPRA 1S6RA 5AQ7A 4M6VA 4I6ZA 4HQAA 3MXQA 3FDYA 3LSHA 5EOOA 2DT7B 4H6JA 5F0CA 3ABMH 1IC8A 3F8CA 4R6LA 4OOMA 4GGGA 3QWLA 4IRIA 4UNOA 2PDRA 3JSOA 3JRHA 2OCEA 1DP7P 3WE3A 1ETOA 1JKQC 4RAYA 4HHDA 2WBMA 2Q9MA 2ZOHA 3BC8A 2Y4AA 3IHBA 4Q0IA 3LR3A 4KQOA 4XM3A 1ETQA 4DYRA 3G35A 5EVID 2YU3A 1Z05A 2L7ZA 4WZ5C 1BM9A 5EVIA 2B7EA 4AD9A 2RNGA 1FR1A 2QZ6A 3A03A 1ZG6A 1VQLI 2A2LA 2IJLA 4A3CJ 4RM2A 5HS8A 5GPAA 3UE3A 2ZKZA 1ES3A 5B66C 1IRGA 1OFCX 1XGOA 1X1DA 4S04A 1W5CC 1PJRA 5FAQA 2DLLA 2TCTA 4DZJA 1Z3YA 1ALQA 4JF4A 1E17A 4ARZA 4LCLA 3S1RJ 3NOPC 2IRFG 4Y7PA 3JRCA 3CMEI 2ZM8A 3OPLA 2RNJA 3TJZC 2Y0SA 1OR7A 1U9OA 2XAUA 4P9UA 3RI4A 1PRQA 3GUDA 3L9KA 4II2A 3OYBA 3E6DA 2VGLS 2PI0A 4NC7A 3J81Z 4FSFA 4P0MA 4M74A 3GFIA 1I2WA 1WI9A 2XPVA 3I54A 4Z9QA 2H0TA 2ZSHB 4HNVA 3RQ4A 2HQRA 2Y0SN 4BENA 1IKIA 5GHZA 1OLTA 4S2IA 3OPHA 3U1KA 5M3MJ 3JAMZ 1CI9A 3H36A 2DFIA 1KZHA 3IXHA 2VT2A 3I71A 4HBLA 2ZJRF 1TWFJ 1VFCA 3H82A 1YE9A 3TDUC 2O9CA 2BW3B 1YO5C 3WS5A 1FPQA 2IGKA 1FLIA 3VP3A 4E3IA 5DYMA 4PJ0C 2Y2OA 4BMWA 4KZ6A 5LEJA 2XF6A 5E8GA 3W2ZA 2KQRA 3HM5A 1HKQA 1Y1VJ 4KIBA 1RNLA 2M1BA 3JRDA 4G7OF 2Z1DA 1CI8A 5EF6A 2XA7S 4F94A 1ORKA 1ETWA 1WKMA 1ZN2A 4HSTA 2PMZN 3KEQA 4XLNF 3S3OA 3DWZA 5B5EC 2DXIA 4DDYA 1OPXA 3VEPA 4F91B 4U7BA 3OSGA 1BULA 3V4GA 4OIPF 1T1BA 4YIIA 4S2NA 3O8HA 1ONGA 4UUSB 5CX7A 5FQMA 4PGHA 1ZGWA 3S1YA 3K70C 1H8YA 1XXMA 2P5KA 1TC3C 1P4WA 3QNCA 4OP8A 1XS9A 4O01A 4OAYA 1NK2P 5EZHA 3RKYA 4OOLA 5FD5A 4X56A 1Z09A 1KGEA 1SD6A 3C8CA 4MMNA 2JE5A 3B6CA 5CHMA 1T08B 3AL0B 3A3DA 3T1RA 3A0HC 3ESWB 3NAUA 5H2FC 1WI3A 2EILH 2L01A 4N9HA 2IS6A 1EI5A 3MMYB 4HF2A 4OMYA 1QU3A 3PSIA 3DKWA 2EJRA 1LDDA 2EZKA 4M6YA 2VK3A 2ZLYA 2CV0A 5DVAA 3QOPA 1E3HA 4KJZA 2JA8J 3T4SA 2R5YA 2OAZA 4KUMA 1IW7F 5KVRA 2HPMA 2K4BA 3BLSA 5E2EA 2J9PA 4QY5A 4GNUA 5IYDJ 5GLBA 5E8IA 3EQLF 3PBOA 4E3KA 4FH4A 4D60A 5HDNA 1XJ4A 2XKOA 3IP4B 2EX6A 3OWTA 3ZHHA 1NZOA 2EQRA 2I10A 3AG2H 3F0CA 2WV1A 3UMDA 1MH4A 2ZO4A 2RV8A 3ZR8X 4Q0HA 4GYGA 4YG2F 4MBHA 4DNCA 4ENMA 2CC1A 2YU9J 3CO6C 3HDDA 1J9MA 3LO7A 1YOVB 1AWCA 1RPWA 4A5MA 1BJAA 2OD5A 3G31A 2XASA 4BBSJ 2W3DA 1D1AA 2KPMA 5K5OA 5IP6A 5AVFA 4AIDA 1BI3A 3ECHA 3U9GA 2Q8KA 5JLXA 1WJFA 1R49A 1OYIA 4JGRA 3ZMZA 2ZQ9A 2PX9A 4U3TA 2QSFX 4UQIS 3E4QA 2MBFA 1FR6A 1SAUA 1XG1A 4YWZA 5L3EA 3S16J 1MNDA 1KGSA 1P7IA 1SVMA 2CU7A 2VQHA 3HG9A 4MLOA 4BL0B 5LBRA 4UVCA 3CUEC 1KYZA 3BR6A 3EQVA 3K0LA 5KK1A 2ZC5B 4HA8A 1JKRC 2FBKA 4NXBA 4XLEA 1ONVA 1R4NB 4PZJA 4LITA 1MJAA 1K56D 1PWGA 2E2IJ 3B6AA 5KZHA 1MNMC 1U5TB 3KSIA 2R7DA 3F23A 4IRHA 4QPQA 2DQRA 2QBYB 1JHHA 1MMDA 1CK3A 5CJ9A 3RDIA 4GHIA 4I2OA 3EGXC 4UAAA 4N4OB 1GHPA 3EWKA 5DCMA 4NG2A 4RM3A 4IOAF 3WRZA 2HNHA 1JJ6C 2ETHA 1LPQA 1XCVA 3SH7A 2PN6A 2QEXI 3GFJA 4Y4RA 4GOGA 4IJGA 4IVKA 3QRFF 5DD8A 2IWBA 3F1OB 4X55A 3LSTA 4CO8A 1NZUA 4OQGA 3U2RA 4JGPA 3B42A 1ZRFA 5TGFA 3M6HA 3WU1B 2E1NA 3UPPA 4AC0A 2MLGA 2LMDA 2Y2JA 2CS3A 5HPIA 3LFVA 2ZFUA 4XKBA 3L7WA 2FBHA 4R3BA 3CJRB 1AKHA 2W1TA 4EEPA 4DF6A 1Z77A 3I64A 2KMUA 4CCKA 4Y52J 3GXOA 5DTSA 4LRYC 1KVLA 4WXCA 1S9HA 1V9YA 1Y8RB 2V9AA 4EWFA 2JSPA 4Q8IA 2ZMEC 5D4RA 2BG1A
chains in the Genus database with same CATH topology
4IF4A 2CWEA 2RGVA 2P5VA 2CW0F 4L18B 2QWWA 2JPCA 1P6RA 2M87A 1XD7A 5E1ZB 2CSOA 3GEZA 3HOSA 1J9IA 3IHUA 5ILVA 3GW2A 1SD4A 1TQIA 4PCQA 2M8EA 4ESFA 5LEKA 5A2QZ 4XRFA 3BOQA 4MTDA 2D2WA 3ZMUA 2GXBA 2KJBA 4PDKA 4GXOA 2FMLA 5CYVA 4N0BA 1REPC 2FU4A 1HSJA 5ERIA 2MA3A 2CG4A 4QWQA 3I4PA 1K78B 2JPBA 1RIOH 1XMKA 2HYGD 1QBJA 2OZUA 2EV0A 3KP5A 3K69A 4LB6B 3IX3A 3JW4A 1IXSB 1QNTA 4R8HA 3F72A 4EQQA 1PDNC 1XN7A 5IT9K 4WXDA 4M73A 5ICGA 3ERED 2EFQA 3F22A 1S7AA 4LLGF 1KYWA 3I58A 3CUQA 3E6CC 1R22A 4LB5A 3AAFA 3NQOA 2V6CA 2QLZA 5HLIA 2JTVA 5ED4A 1U3EM 1TQMA 4MGRA 1FZPB 1SMYF 3PQKA 2QQBA 3SQNA 2DI3A 3J80Z 3ROUA 1ZHFA 3HRTA 1O57A 5LRSA 2XVCA 2HZTA 2O6GE 1ZRDA 1S8NA 5E17F 5CVVA 4A0XA 1OYWA 5K5QA 5FFZA 2ADUA 4MQVA 3BJOA 5HLGA 1OMIA 5DCFA 4N9IA 2H94A 3F3XA 1FNNA 4B09A 2DPDA 3FXUA 2AS5F 1XMAA 4LJZF 5D5WB 1IN7A 2A61A 4I09A 4EM0B 2CFXA 1QQIA 4I0AA 1LEAA 4KT5C 2HEOA 3WTUC 3E6BA 3O3KA 1BC8C 3IWZA 2F5DA 4KYWA 1ZG3A 3ZN0A 1XGMA 2OZ6A 4Y15A 2KIMA 3M1EA 2BE5F 1J59A 4IJAA 1HKTA 3TOBA 3IKTA 3JPUA 3WTZA 1ZLKA 2XV4S 3CLOA 3WG9A 1FBUA 5CVIA 2ESNA 3HOTA 4I0BA 2DT5A 4KMFA 4RS8A 1O7FA 2IA1A 2Z33A 2FRHA 3D5LA 4ENJA 4BXUA 6PAXA 5AIPA 3MEXA 2L4AA 3ML6A 3ULQB 2V9VA 3WTVC 5LHHA 2P5LC 3M9AA 2WC2A 1G3WA 3WTTC 5LBQA 3JTHA 4ZZDA 1BIBA 1UHWA 1T2KA 4KA4A 1HW2A 2OQRA 3F8NA 2X4HA 3TKYA 2QUFA 1R23A 4ENNA 3DP7A 3GLXA 2NNNA 4LGWA 3FX3A 3RYRA 4IRGA 1WRJA 4HOBA 1ODDA 3IX8A 4JBAA 2C6YA 3E5UA 5HLHA 2A07F 2OU2A 2OQGA 1XB4A 4P55A 4ETSA 1W5SA 2PMHA 4BHBA 1IN4A 1Q1HA 3KCCA 1IXCA 3DPLC 3I59B 3K9TA 2FBIA 3HSFA 3G3ZA 3MCZA 2B0LA 4ZZLA 2AVXA 2D1VA 1E2XA 3QP4A 1WQ2A 2NNYA 2PEXA 3ZN1A 1K6OA 3WTYC 2A68F 1J5YA 2VE8A 2FNAA 2XIGA 3QP1A 3BP8A 4HX8A 4NHJA 4ASNA 2EV6A 1CF7A 4WWCA 4R1HA 1Y0UA 2IW5A 5HOOA 3V8KA 4EGZA 1JE8A 3GO5A 1HBXG 2DK5A 3G73A 5CLSA 4RGXA 1GXPA 3H3ZA 2RN7A 4L5IA 3P9KA 1BN5A 4JQFA 1FY7A 4ESJA 4BHPA 2EA4A 1W7PA 4Q48A 4P96A 2PG4A 2HKXA 3GFMA 3FM5A 2H09A 4IHSA 3WGGA 4BQAA 4HF1A 4HV6A 3BJAA 2ZNYA 2NAZA 1YW8A 5D8KB 3F6OA 4EGYA 1TTYA 1R1TA 4FT8A 2H27A 4KNYA 1XCBA 2FF4A 1S3JA 2FA5A 4HV5A 3KZYA 4I01A 2IVMA 3QPTA 5E18F 4ZYDA 1LNWA 5EEHA 1MKMA 3CUQC 4KICA 4HX4A 3KP3A 2EB7A 3J81K 4YFXF