3QP5A

Crystal structure of cvir bound to antagonist chlorolactone (cl)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
251
Chain Sequence
b'ARPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 59
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qp5A02
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp5A01
3E5UA 2CWEA 3LAPA 2AXLA 4LK1F 3J81K 3CLOA 4KDPA 2X4HA 1Z7UA 3Q9SA 3QP8A 1YFHA 4G94A 1TLHB 2R3SA 3CUQB 2NRAC 5BMZA 1H0MA 2WWYA 3IX4A 2EV0A 4I09A 3RYRA 5TJJA 4BNCA 3EDPA 1I5ZA 2L4AA 2EFPA 2AS5F 4I0AA 3DP7A 2H94A 4NB5A 1R5GA 1XB4A 1ZHFA 3KLOA 3VB2A 5K5QA 4UVBA 3PQJA 3CDHA 3I0TA 2MLKA 4ESJA 1E17A 5D6EA 1LDDA 5HDKA 2DQLA 4CHUA 4AD9A 1KU2A 1R22A 4IRIA 2DU9A 3CUQC 1B4AA 2RQPA 3K1NA 3JAMK 4RB1A 2F5FA 3BDDA 3E6DA 4RB2C 2EFNA 1H9TA 5CVVA 4L9TA 1WRJA 3T8TA 3MQ0A 3K2ZA 3TOAA 1P2FA 5E1WA 3ECHA 2VOPA 4DQ2A 2PG4A 1FWZA 2A5YB 4LB6B 4ON0A 1NHAA 1W7PB 2JPCA 5CVUA 4RAYA 4GXOA 2ZMEB 2O0YA 4WWCA 4I2OA 1RUOA 2CQKA 1FC3A 3C18A 2P6TA 3U2RA 2BGCA 1V3FA 3F8FA 2STWA 3FMQA 2OQGA 4A0ZA 4EGZA 1CF7A 3KP2A 2W24A 1IXCA 2UWMA 1HXDA 1ZRFA 2BV6A 1KU7A 2EA4A 2GAUA 3OOPA 1FPQA 5DUIA 3ZMSA 1HKTA 2LSOA 5DD4A 1LNWA 2VODA 3LSTA 3C3WA 2VC1A 1V4RA 4WXDA 5ERIA 1ZG1A 3VEPA 1FBSA 1B59A 3WTTC 1EH6A 4CGZA 5HS7A 1OPCA 3KCCA 3JW4A 4UNOA 3F8BA 4ENJA 1Z05A 3WTUC 1ZG5A 3LA7A 3BJ6A 2DK8A 1ZN2A 2DPDA 4O6JA 4YIIA 4LMYA 1USSA 1JGSA 5BOXA 2NNYA 3GFJA 3NQOA 1REPC 2ESNA 5FFZA 2G7UA 2PMHA 1UB9A 3QPTA 1FNNA 3E6CC 4LGWA 4EJTA 3V8LA 1MD0A 1DDNA 4ENKA 1SD4A 2KRFA 4U0YA 2K86A 1FSHA 5F64A 2JSCA 2F5CA 2BE5F 4Y15A 1DPRA 2HZTA 2HQRA 2HGCA 5A2QZ 4A0XA 2RC4A 4GGGA 3O2PE 1YIOA 5ICCA 3RIRA 1TQIA 1Y0UA 3RTRA 3WTVC 4FX4A 1KA8A 2FRHA 1S6LA 1PDNC 3GFIA 1CGPA 4LG0B 2HKXA 4QWQA 2GA2A 4LFUA 3L2CA 2M1BA 1FYKA 2IPQX 2YPRA 2V1UA 3G3ZA 2Q0OA 4KT5C 4LK0F 4M71A 2EJRA 1B6AA 2JPBA 4WCGA 4FHTA 1O3QA 1IN5A 3ZN1A 5ICFA 3EYYA 3NRVA 4M72A 4KFCA 4G8XA 2WC2A 1J2XA 1U6GA 3ZPLA 5LHHA 2V9VA 5K5RA 5E8IA 5EEGA 4PDKA 3W6JB 3HIFA 1O3SA 5BPIA 2L54A 2E7XA 4MHGA 3FXUA 4ZYDA 4O5VA 2HDCA 4HX7A 3R0JA 2E1CA 1OKRA 1ODDA 3PFIA 2GXBA 1W7PD 4L9VA 4KNYA 4OIRF 5LEKA 4G6QA 2PLYA 3F6VA 1WWXA 1USTA 3F8NA 1IN4A 1RI7A 3BJAA 5DCFA 3KP7A 3SXYA 1ZGAA 5HDGA 1OMIA 4UV9A 5F6FA 2LKPA 1YS7A 2UXXA 3U9GA 3V7CA 3SZPA 2E7WA 2QQBA 1J75A 3GF2A 3M7GA 3IRQA 1BI1A 1T2KA 1FBQA 1TNSA 2VT2A 3QOPA 4HA8A 3HHGA 2KIUA 2QLZA 3QP5A 3W6KB 4EVIA 1UCRA 2HYGD 2XV4S 4YFXF 2ELHA 5CJ9A 2MBFA 2DBBA 4CO8A 3LQQA 1P4WA 2D1HA 2XKPA 1LVAA 1RIOH 3MCZA 3WODF 3WU0A 5HLHA 1ON2A 3FM3A 1FY7A 4YG2F 5FO5A 3F3XA 4G9YA 2ZXJA 1EH8A 2DFIA 4G7HF 1OYYA 2ZJ2A 4OU0A 2XKOA 3IWZA 3I4PA 3P9IA 4XBFA 2CGPA 5E17F 4IRHA 2IW5A 2V1DA 3BP8A 2FNPA 1DUXC 3KP4A 1MDMA 4HZFA 1YW9A 4BYYA 2Y75A 1T39A 4WX9A 3TO9A 1LEBA 2FU4A 1IUYA 3VODA 1IN8A 4AWXB 4RB0A 3FZVA 3TO6A 2BBYA 4JBAA 4ZZLA 2LF8A 4JK1X 2P7VB 5F1RA 2GXGA 1RUNA 4RS8A 5FD6A 2O3FA 2LF7A 2KJCA 3QP1A 4HV6A 4M9ZA 1O3TA 3K1PA 4I01A 2FBIA 1F1ZA 3KZYA 1IW7F 4L5JA 2W25A 2A6EF 3I53A 4BAYA 1BI0A 3FWEA 5K1YA 1ZREA 3LFKA 3QP4A 3H3UA 5FD5A 1WQ2A 3M8EA 3DEUA 5H6RA 2OA4A 2GA1A 3Q5FA 1J5YA 3FX3A 2DT5A 3ECOA 3WGGA 1TW3A 2NAZA 4P5OA 5JR3A 2Z33A 3CTAA 4O3MA 2W85A 5ED4A 1G3TA 3LA2A 3T1BA 1I6XA 1KGSA 4HYEA 4HAMA 3HUGA 4HV5A 2CO5A 3FMSA 4BXUA 1BI3A 5HS8A 3D0SA 1R36A 2O61A 2HFHA 1FOKA 4QLCU 3WE2A 2A68F 4RB3C 1KYWA 1G3SA 2W57A 3Q9VA 3TO7A 4NG2A 5IT3A 4EM2A 1YLFA 4P9FA 5CVRA 5D5VB 1BBYA 2FBKA 2KKOA 4XSXF 1Z9CA 5LGTA 5D8LB 3WGIA 2UXNA 2O6GE 1XCBA 1KQ0A 1R58A 2VN2A 3EQLF 2D45A 4U0WA 3QP2A 2PJPA 5D5UB 1QZYA 1YO5C 1F4KA 3FF5A 2F2EA 2K27A 2CSOA 1SD5A 1DP7P 2VBXA 3LWFA 3COAC 1BC7C 2L4MA 5LBQA 1T38A 3GFLA 4HDUA 3F8MA 2JZYA 3V8KA 3RPUA 3CJNA 5CVJA 1YQAA 1B1BA 3FMRA 4U0VA 4U7BA 3WTWC 2XAGA 1AOYA 4S04A 2A69F 1R1UA 1ZGJA 2OZUA 1XGNA 4PGGA 4IHSA 1FP2A 1HSTA 3EETA 4EJVA 3ABUA 3RKYA 1XMKA 4UVAA 2FMYA 2Y48A 4UVCA 3IC7A 2HTJA 1EV7A 2DQRA 3I59B 1S29A 2ZMEA 3IHUA 5H6QA 1XDSA 2HR3A 2RN7A 2PFBA 5L3CA 4HLYA 4R1HA 3H92A 1Z1DA 5L3EA 5DEQA 4XLPF 4Z2YA 3ZQ7A 4LLNA 4OMYA 1WSUA 4LLLA 2P8TA 4FT8A 4MNUA 1LDKB 2QYOA 2A61A 1IRFA 2FBHA 1XCVA 2IA2A 3HHHA 4UV8A 2FF4A 3SZTA 1ZAOA 1SFXA 1HW5A 1T6SA 2EFQA 3HRSA 2Q8KA 5HLIA 4G6DA 3F72A 3IX3A 3MAJA 2XVCA 3DPLC 1T0FA 1IXSB 4RGRA 4I98B 3KETA 3N4MA 5H20A 4HOBA 2IA1A 2H27A 4NQWA 3ISPA 2HQNA 3F6OA 1CF7B 3DKWA 5CVIA 2Z5UA 3TDZC 4F7ZA 4UUVA 2ZKZA 2RGVA 3GUDA 1HSJA 1LB2A 2DW4A 2XAQA 3BJOA 4HLXA 2OQRA 4WK8F 1P4XA 2ZNZA 2H6CA 3R0AA 1TTYA 2M5WA 2RDPA 5DCMA 3QPHA 2PN6A 1R1TA 1G3WA 2QBYB 3VFZA 2XGXA 2MLGA 5D5WB 1LQ1A 1HKQA 3E3VA 1XMAA 4L9JA 5DUKA 1Q1HA 1QO0D 3VOEA 3HSRA 4HBLA 1AWCA 3GYHX 2AVXA 4CYDA 3R60A 2HKOA 5LRSA 4I7HA 5TRDA 2K4JA 3K0LA 4WXCA 1QGPA 3JTHA 5D6FA 3GWZA 1MKMA 3V8JA 2VE8A 1YYVA 4GYGA 4HF0A 1BM9A 2XRNA 2HYFA 5AIPA 3ABTA 1PUEE 1HBXG 2MA3A 1FYMA 4L0YB 1IRGA 3REOA 3MFKA 2Y0MA 2M30A 1MJBA 3J81Z 2W84A 3DPTA 4M73A 2VT3A 1Z91A 2J5PA 4A5NA 5K5OA 5E18F 2P7CB 4ETSA 2DTRA 2OAZA 5E1XA 5FB2A 2E1NA 4M6YA 1J7KA 5L3BA 3GO5A 3RJPA 5JVTA 3MWMA 1L0OC 2DLLA 2FOKA 1U5TA 2K7LA 3SHFA 3K1MA 4ZYHA 1F9NA 1ON1A 4M6XA 3MEXA 5FLXK 1XSXA 1QNTA 5BQTA 4ASNA 1KU3A 1XGMA 4N9HA 3RKXA 2IT0A 2XAJA 4K2EA 2JT1A 5AONA 4Y13A 5BS6A 2A6HF 4HX8A 5J8FA 3JAMZ 1YG2A 1OR7A 2EFWA 2XASA 1BC8C 2CYYA 3D5LA 2CFXA 2Z99A 4KMFA 1U2WA 1W5SA 1OYWA 3P9CA 4E70A 5FFXA 2LDUA 3SQNA 2QQ9A 1PP8F 2MC3A 2ZFWA 1QBJA 2K4BA 4BHBA 4ZYGA 5ICGA 4P96A 2X0LA 2J5OA 1JE8A 1K78B 5D4RA 1IZ1A 3PQKA 4YIFA 1IF1A 1QZZA 2GZWA 1SAXA 1KQ9A 1SFEA 4KMUX 3BROA 1S8NA 5HOOA 3KLNA 4CXFA 6PAXA 4IPAA 2XAFA 4U88A 4MTEA 4G7OF 2VONA 3TOBA 2HOEA 2EK5A 2YR2A 4MTDA 3G73A 5DDGA 3L09A 4HF2A 1ULYA 1P6RA 3JSPA 3FHZA 3ML6A 5LHIA 1BI2A 2V6CA 3KEOA 3DFGA 5CYVA 5LEJA 4G7ZF 1WKMA 1MJAA 3JSOA 1U78A 2ISYA 4AIJA 4XSZF 2VOOA 1O3RA 3MZYA 2VE9A 3WTYC 4IF4A 5HDNA 1UHWA 4EM1A 1R1VA 3I71A 3GFMA 3DF8A 5IT9K 4LLGF 3LQRA 4A2UA 5J6XA 2XIGA 2FA5A 3RDIA 3IRRA 3S2WA 3ZN0A 3CO7C 4OIQF 3WG9A 3LA3A 2VXZA 5ILVA 3U1DA 4HW0A 4EMSA 2OU2A 1KQ8A 4EM0B 2BEOA 1F5TA 3ZMUA 3NEUA 1R23A 1TBXA 2CG4A 5L3DA 3L9FA 1IN6A 2Z3YA 5ILUA 4Q47A 2XROA 2DPUA 2RVCA 3KE2A 2K02A 4A5MA 4Q4ZF 1FLIA 2IRFG 2P5LC 3B73A 4ESFA 2QUFA 3IX8A 1B9NA 4UXNA 2QM3A 3IKTA 4DNCA 2BYVE 5D4SA 2GWRA 4L9NA 5A2QK 3R6SA 2M87A 2PBIA 2RNJA 2CW0F 4WXHA 4JQFA 4ZH4F 5J8CA 4S05A 1W4MA 4ENNA 4AVPA 5FLXZ 3ROUA 5LRRA 3M9AA 4I02A 4OINF 2DAOA 5LLQA 5E8GA 3GXOA 3CUQA 1FZPB 2DK5A 1T98A 3TKYA 3H3ZA 3CO6C 2HEOA 2QWWA 4AIKA 2YX4A 4CDGA 1SMTA 3BY6A 4GO1A 3HOTA 3F21A 4BH9A 3M8FA 2NYXA 4EJWA 2HWVA 2ISZA 2FQ3A 3ZMDA 1ZRCA 5L09A 1JHHA 4GYIA 2FE3A 1U8RA 2C6YA 2P6SA 2D2WA 3T0YA 4A0YA 1LDJA 1XDUA 4EGYA 1HW2A 3E5QA 3GZ6A 3F23A 1O57A 2DI3A 4R8HA 3FXQA 1S7AA 4H0EA 2P5KA 2ETHA 4ZZDA 5JHUA 1QQIA 1J9IA 4CICA 1XSDA 1UHMA 1G3YA 2OD5A 1KU9A 1ZYRF 3I59A 5ICEA 4A12A 3I54A 1W7PA 3R61A 3BPVA 2KIFA 2A3SA 1ZARA 2F5EA 2L01A 2FXAA 3HTSB 4LJZF 4HDVA 1RZ4A 4YFNF 1SD6A 2JTVA 4NHJA 3ZP5A 2JRTA 3V7RA 3IL2A 4EJOA 3HSEA 1R7JA 4MEXF 4L18B 2VBYA 4L0ZB 3I64A 1R00A 2OBPA 4RGSA 1ZLKA 3HRMA 1XGSA 4RGXA 3E6MA 4EV0A 1X3UA 4B09A 1K7AA 4L5IA 3ZMZA 3KP5A 4I0BA 1BN5A 1XSVA 4RGUA 3WU1B 3P7NA 2STTA 3E5XA 3ZMVA 1WI9A 2ADUA 3CUOA 5LHGA 1J0RA 4KN4X 3BOQA 1R5HA 4GCVA 2QVOA 3RI4A 1FX7A 3KP3A 1O7LA 5IT9Z 5FGMA 1EH7A 2ZNYA 3C1DA 2IVMA 2PEXA 4Y17A 4IJAA 2F5DA 3IWFA 1IXRC 1LEAA 1D5VA 2P5VA 3GEZA 1L3LA 2QBYA 1QPMA 4IVNA 1I1SA 4HQMA 1I27A 3L00A 4M9XA 4IHTA 3HYIA 5LGNA 3L7WA 3BWGA 5L3GA 1TNTA 2YU3A 2LNBA 2HS5A 1HKSA 2IJLA 5LGUA 1MGTA 1K6OA 1W5TA 4LB5A 3HOSA 2PMUA 3FXRA 4LG0A 1YW8A 4BHCA 1I1GA 3WGHA 2EA2A 5EEHA 3C7JA 5DCMB 1PP7U 3J80K 4OIPF 4Q5SF 4HQEA 4KICA 2O03A 3RKWA 3I58A 1TQPA 2A07F 2MD5A 2V1XA 2L02A 3QU6A 4ESBA 5DD8A 2HTSA 1RNLA 4HF1A 1D8JA 4OIOF 1U3EM 1YS6A 1S7OA 2FNAA 3WE3A 4A6DA 4BHPA 2ZO4A 1GXPA 4MQVA 4RAZA 4P9UA 1Z6TA 4MEYF 2ACJA 4LD5A 1D8KA 4OOIA 5HS9A 5DYMA 4B8XA 3DV8A 2FSWA 1FBUA 4OMZA 1XN7A 3HRUA 3I5UA 2XAHA 3B02A 5HVQC 1SMYF 3GVAA 2WV0A 5L10A 5BPDA 4KIBA 2YX7A 2IA0A 2DO7A 3SFZA 2R7FA 2L3DA 1KYZA 3QRFF 3JTGA 2UZKA 1J59A 1BOAA 2VBWA 1SFUA 2M8EA 2NS0A 5DV5A 3GZ5A 3V7SA 3ZMTA 1HW1A 1BJAA 2G9WA 1ZLJA 3HTUA 2VC0A 2MH9A 1G6NA 1IAWA 2FEZA 1FYLA 1U5TB 4KIFA 2EWNA 1JHFA 3LAJA 4AIHA 1HQCA 3DXJF 2XUBA 3ULQB 2TDXA 5KK1A 3TGNA 2ESHA 4IXAA 5JI6A 4Q48A 1D3YA 1O7FA 2NNNA 1BIBA 1VTNC 1P92A 1DPUA 3M1EA 3N97A 2YSRA 2D1VA 3O6BB 3TDUC 1GVJA 3KP6A 2UV0E 5E20A 5L07A 2KJBA 4U7DA 4BQAA 1U5TC 2H6BA 1SD7A 4KUMA 1K78A 5ILSA 2V79A 1YW7A 2M45A 4XLNF 1BIAA 4N0BA 4P55A 1H9GA 3KZZA 1ZH5A 3BPXA 3HSFA 1G4DA 2EFOA 2H09A 1JXSA 3BZ6A 4UHTA 4FX0A 2R7DA 4PGHA 3K9TA 4R79A 3TQNA 1FSEA 4EJUA 3V4GA 5D8KB 3HRTA 1FT9A 3RPQA 3GW2A 1Z6RA 4YFKF 2EB7A 3T8RA 4M74A 4MGRA 1FP1D 1K79A 2P4WA 3QP6A 1STZA 5E1ZB 2IP2A 2KIMA 4TV7A 1IN7A 2XHKA 3E97A 1A04A 3GLXA 5L3FA 3K69A 4CZZA 4KA4A 3DQVC 3E6BA 3F8CA 3ERED 5JFRA 2MH2A 4MQ9F 4IRGA 4PZJA 4EQQA 5CLSA 3O3KA 3QU3A 4HX4A 4ENMA 2OZ6A 3WTXC 2ZBKA 1MDMB 4M9SA 1XGOA 1TW2A 2VBZA 3IKVA 2EV5A 4A6EA 1MZBA 2QENA 4KYWA 3EYIA 3KEQA 1E2XA 3R4KA 4WF2A 4D0PA 3MZHA 3J80Z 4N9IA 5KVRA 2COMA 2FMLA 3ELKA 2RV8A 2Q2EA 1UFMA 5D5XB 1LJ9A 3JPUA 3WTZA 2QQAA 1XD7A 4KIGA 3KFWX 1GXQA 1TQMA 1OYIA 2PQ8A 2ZCWA 3GX4X 1C0WA 2O8XA 1ZRDA 1B9MA 1YTYA 2GIVA 2RKHA 1ONVA 2QZ8A 2PI0A 5AIQA 4ZYEA 3J7AO 3P9KA 1GHCA 2GQQA 3OV8A 3F22A 2Z9OA 2G7HA 3RYPA 3EUHA 3T5XA 2B0LA 1ZG3A 4PCQA 2WTEA 2EV6A 3QAHA 3AAFA 1P4AA 1S3JA 3FM5A 5HLGA 1MJ9A 4XRFA 4KN7X 3WTSC
chains in the Genus database with same CATH superfamily
3S1NJ 2XDMA 3E5UA 2CWEA 3LAPA 1V9ZA 3HLEA 2ZJQF 4FCYA 3LR0A 4C2MJ 1U9NA 2AXLA 4UA7A 4EXOA 4LK1F 3J81K 2LTPA 2VI6A 1SC7A 1OTDA 1A31A 1P7IA 3HREA 1R6RA 3CLOA 1JI8A 4BBUA 4HJ3A 4KDPA 2WGWA 3ZFZA 4JXSA 3BR1A 2DOAA 1Z7UA 2X4HA 3Q9SA 5FL3A 3QP8A 1ZK8A 4FASD 2V2FF 2CFOA 5F1FA 4HQAA 1MPLA 1YFHA 4G94A 2VXDA 2LRDA 5HFOA 5I5LA 2M2EA 1H8YA 1J3WA 2VL8A 4IVIA 4N1XA 1TLHB 2R3SA 3CUQB 4CCNA 1B8IA 1YRNB 3VYTB 2VQHA 2EZKA 2NRAC 2V9AA 5BMZA 2VA0A 1A5JA 1H0MA 4NETA 5HDCA 4HOIA 1UJ8A 1ERQA 5G4YA 2WWYA 2DN0A 3IX4A 1TP4A 3WS2A 4K08A 2EV0A 3A4CA 4I09A 3RYRA 5TJJA 1LL8A 2LY9A 4BNCA 1DJBA 3EDPA 4R70A 1I5ZA 3QODA 2L4AA 2A24B 5J40A 4OLGA 1D06A 2EFPA 4PK4A 2AS5F 4WZ5C 1H8ZA 4I0AA 3CMEI 3DP7A 2H94A 4JYKA 4NB5A 3NJAA 1R5GA 1XB4A 1ZHFA 3GBGA 3KLOA 3VB2A 5K5QA 4OPRA 1MH4A 4UVBA 3PQJA 2JA5J 2C5WB 4BE2A 3SDBA 3CDHA 3I0TA 2MLKA 4ESJA 1VEUB 2WKRA 3WRTA 4BLMA 2NS7A 2F48A 4C30A 1X3WB 4MLLA 2B7EA 2O9LA 1E17A 1XMXA 3FBNB 3K4KA 3GTQJ 4HNBA 5D6EA 4E7LA 1LDDA 5HDKA 1W5DA 2DQLA 1NH3A 4CHUA 1TT5B 3CPTA 3S15J 4AD9A 4MEZA 4ANJA 1KU2A 3I4NJ 5TGTA 3TW8A 2IGOA 1NLZA 3MZEA 3WS5A 1R22A 3BG5A 2DU9A 4IRIA 2JA7J 4YNRA 3CUQC 2ZQ7A 1B4AA 3J7ZI 2RQPA 3KYQA 2BY3A 2XFSA 5HL1A 1LFUP 2XGCA 3A0BC 3K1NA 1L0GA 4MN7A 1M6KA 1OCCH 1N75A 3JAMK 3FV7A 4RB1A 2F5FA 3BDDA 4N4NB 3E6DA 2Y4AA 4RB2C 4PM5A 2EFNA 1H9TA 5CVVA 2R93J 1RGYA 4L9TA 3LIFA 3AGFA 1WRJA 3BFDA 3T8TA 4GN2A 3MQ0A 3K2ZA 2KOIA 3TOAA 3OIQA 4JGPA 1P2FA 5E1WA 3ECHA 2WK0A 5B66C 3IF6B 2VOPA 4DQ2A 2PG4A 2E35A 4UUSA 3OIPA 3ZR8X 2X71A 5FASA 1FWZA 4DW6A 3AKZA 5KNLA 2A5YB 4LB6B 3OYHA 4CLCE 4E3LA 2XB0X 1JKOC 3OBFA 3NECA 4ON0A 3OOUA 2K85A 1NHAA 1W7PB 2JPCA 4RAGA 5CVUA 4RAYA 1W79A 4GXOA 2XA7M 4DF6A 2ZMEB 2O0YA 4WWCA 2M1CA 4B47A 2GX5A 4I2OA 2ZC4B 4X68A 3RKQA 2F6CA 1BR2A 3TL4X 1RUOA 2NUTC 2CQKA 3QHYA 2RQQA 1S72I 1FC3A 1H8AC 5IS1A 1S1ZA 1X2MA 3V3SA 3WU2C 5M5XJ 4XKVA 1P7JA 3ZQFA 4MNRA 4JGOA 5E3MA 2R92J 4Y52J 1Z3YA 2WGIA 3C18A 5IPAA 4OPZA 2P6TA 3BZKA 3U2RA 2BGCA 1W0TA 4OQGA 4OLDA 3ZQLA 1V3FA 2CUFA 3F1PB 3IP4B 5J1YA 1K55C 1IC8A 3ZNTA 2ZC5B 4AYBN 2VGLM 2JSPA 3F8FA 2L7FP 5F1JA 3D5SC 2Y0SA 3PHYA 4NXFA 3UMDA 1XP4A 1XX5A 1DRMA 2QMIA 4DN0A 1OQYA 2KDOA 2JKFA 2STWA 3KX0X 3FMQA 2CW8A 2OQGA 3LSGA 4BDYA 4A0ZA 1LKXA 4EGZA 3LMMA 1CF7A 3GTCA 3KP2A 4B48A 2W24A 3IF6C 2DA1A 3HPHA 5AQ7A 1IXCA 2UWMA 2CV1A 2WV1A 1OFCX 1HXDA 1ZRFA 2BV6A 2LYCA 1KU7A 1AKHA 4C2UA 4JXVA 1V9YA 2EA4A 2GAUA 3OOPA 4Y33A 4E3OA 3A01A 1FPQA 1ZKJA 1D0ZA 1SEUA 1FSWA 2O99A 4HP4A 5DUIA 3ZMSA 1HKTA 2LSOA 5DD4A 4GS9B 3PTEA 1LNWA 2VODA 3LSTA 1WA9A 3C3WA 2XQZA 4KZ6A 2VC1A 3SJMA 3IH9A 3ZXSA 1V4RA 2FH5A 2ZMEC 4WXDA 5ERIA 1ZG1A 3VEPA 1IGNA 1FBSA 4EUZA 1B59A 2XSJC 5GAHJ 1EH6A 3WTTC 2CV0A 4BKXA 4CGZA 5HS7A 4O0PA 3K70C 3JREA 1OPCA 3KCCA 4UQIS 5CEDA 2DA5A 2W3DA 3JW4A 4UNOA 3F8BA 4ENJA 3HM5A 2M7BA 1VQNI 1Z05A 4XLCA 1CK3A 5HD5A 4WEKA 4BBVA 3QYBA 2Y31A 1SZVA 3WTUC 4Y0OA 2P04A 4JF4A 5KSCA 1VETA 4RA2A 1TVFA 3LR5A 1ZG5A 3LA7A 2LB9A 3BJ6A 4A5RA 2DK8A 1ZN2A 2B02A 1FOWA 3OSFA 2FJ1A 4LOCA 4O6JA 2DPDA 1YMSA 2H10A 4YIIA 4LMYA 4L5EA 1USSA 1JGSA 3G71I 5BOXA 2NNYA 3GFJA 4Y7NJ 2PR5A 2HXOA 4XRMA 3NQOA 2DOFA 2OF7A 1N9BA 1REPC 1JTGA 1BR1A 1TWCJ 3LSKA 3P01A 2ESNA 5FFZA 2E71A 2CUJA 2G7UA 5EG0B 2PMHA 2ZQDA 1Y6IA 1UB9A 4GHIA 2W27A 5CERA 3QPTA 4PM7A 1GCEA 1SVMA 4ZTFA 1FNNA 1SVOA 1GA0A 3TOIA 2JA8J 3E6CC 4LGWA 4AC0A 4EJTA 4S2IA 3V8LA 1ERDA 2OWJA 5CGWA 3GR2A 1L0EA 3E98A 1I50J 4BACA 1MD0A 1UMQA 5F0CA 1DDNA 4AM3A 4ENKA 1SD4A 1ZKGA 2K86A 2KRFA 4XQFA 5F64A 2JSCA 4OAYA 2F5CA 4U0YA 1FSHA 3UKGA 2BE5F 1C3BA 4X56A 5CPRB 4UB6C 4BBRJ 1MKIA 1T0FC 2I9VA 2DTZA 4IX7A 4Y15A 3BFFA 1DPRA 2HZTA 2HQRA 2HGCA 2OC6A 1G2HA 5A2QZ 3BFEA 1BYWA 4A0XA 2RC4A 4EQ1A 2VX8A 3ZG7B 4LPZA 3CJMA 4FE4A 5HLTA 4GGGA 3O2PE 1YIOA 5ICCA 2YU9J 2M0MA 3ZQHA 1DY6A 3RIRA 5HAIA 3QPLA 1FCMA 4Z1WA 4F3LA 1IYQA 4MBKA 1TQIA 1Y0UA 3RTRA 3WTVC 1LI9A 3U4LP 3EEHA 1IELA 1RKWA 4FX4A 1KA8A 2FRHA 1S6LA 3AFHA 1PDNC 2XPUA 1MBHA 1YLTA 2PYPA 4HIAA 1ZR4A 3HJKA 3OYLA 3Q7VB 3GFIA 4A3KJ 2CQNA 2NVQJ 1CGPA 1WYCA 1UELB 4LG0B 2HKXA 3CG5A 5TISC 1OJLA 4QWQA 3FKVA 2GM4A 2GA2A 4LFUA 2VKDA 3C5AA 3KYLA 3KSIA 4ETXA 3L2CA 4DJ3A 1V5EA 2QHKA 2M1BA 2JRMA 2PR6A 1K57C 1H3QA 1FYKA 5FQ9A 2IPQX 3KYZA 4CLCA 4O01A 2YPRA 2V1UA 2JK3A 4RVAA 3G3ZA 5FDHA 3VYRB 3IWOA 3JRDA 3ZG9B 2Q0OA 4KT5C 2XF7A 2N8GA 4LK0F 4M71A 3CCYA 3A3EA 2EJRA 1B6AA 1QZEA 2WAFA 2JPBA 3OYCA 3GVBA 3GTGJ 3FKIJ 3FKJA 4IHWA 4WCGA 4FHTA 1O3QA 1IN5A 2EXAA 5EPHA 2ACGA 3ZN1A 2G0EA 5ICFA 1YSPA 5EVIB 2F4MB 3EYYA 4DGWB 5GAGJ 3NRVA 3U2AA 4M72A 3RPUD 4KFCA 1VHMA 4G8XA 4EESA 2WC2A 2Y9ZA 5J47A 1J2XA 1U6GA 3L9KA 1S4RA 4ZDLA 4K0XA 2LY2A 3ZPLA 4IHXA 4EEPA 3C2GA 4ZDXA 1JTDA 5LHHA 4BE0A 3TP3A 2B18A 2E60A 1LSWA 2V9VA 5K5RA 2IWCA 2XK1A 3B42A 2JN7A 1DGRM 3GTKJ 3MSHA 5EEGA 5E8IA 2X6WA 4PDKA 1TS0A 4GD8A 2L0KA 4LRXC 4DE1A 5HWTA 1MMDA 3W6JB 2XSSA 3CWFA 3T1RA 2LOOA 4AYBA 3HIFA 4GLQA 2IWBA 1O3SA 5BPIA 1R4NB 2L54A 2HJ9C 2E7XA 4OOYA 2V8FA 1YJ9I 1KONA 2E2IJ 1HTZA 2VEAA 2F5VA 4MHGA 2BW3A 3K6GA 3FXUA 5F0FA 4ZYDA 1M1EB 2ZMVA 5EGOB 4O5VA 2L9VA 4I5SA 2HDCA 5HD3A 4JLFA 4HX7A 5FJ8J 3EUKL 3R0JA 2E1CA 2JE5A 2JN6A 1VQ9I 1OKRA 1ODDA 3PFIA 2GXBA 5DF9A 1SAUA 2HDRA 2Q9NA 2OV5A 4E3MA 4N9KA 2IGKA 3UPPA 3CJRB 3BLSA 3I7JA 4V2FA 5M19A 1W7PD 2GOXB 4L9VA 4KNYA 5EVIC 3UN7A 5FEGA 2JCHA 2DCEA 4PHTA 4PFPA 4OIRF 5LEKA 4G6QA 2DT7B 3ABLH 3BTJA 2PLYA 2H0TA 3F6VA 1EI5A 2F4OB 1F2KA 1WWXA 1USTA 3F8NA 3IQAA 2L7KA 2ECBA 1AXBA 1IN4A 5M5YJ 4L9GA 4LRYC 4HSTA 1PFLA 1RI7A 3BJAA 5DCFA 4CCOA 1DJCA 4P6BA 1E3OC 1VB6A 3IHAA 3KP7A 3SXYA 1ZGAA 5HDGA 1E4DA 1NJ4A 2DMWA 3H7WA 1J09A 5C3EJ 1OMIA 2R7VA 3R7WB 1S6RA 2GZAA 3UB9A 2IS4A 2HQ5A 1D1CA 4UV9A 1NZUA 1WJEA 5F6FA 2LKPA 3CHWP 1K6SA 1YS7A 2UXXA 3U9GA 3V7CA 3SZPA 4QJGA 1V55H 1I3AA 2E7WA 4PJJA 2QQBA 1DU6A 2JKRM 3GTPJ 3VSKA 1MWUA 2XH9A 3U1KA 2L4RA 5FI7A 1J75A 4BEHB 3K3DA 2Z1DA 4E7HA 1LPQA 3GF2A 3M7GA 4U87A 3IRQA 4IOAF 1BI1A 1T2KA 3GLLA 3GTLJ 1FBQA 1TNSA 3BLMA 5F1GA 1FIAA 3NOTC 4O8GA 3T4TA 4JP0A 2NUPC 2JMWA 2OCCH 2VT2A 3BTIA 4R4RA 3T1XA 2KX6A 3IS2B 1IRXA 3OYBA 5J1RA 1YLJA 1IRZA 3QOPA 1YE9A 4HA8A 3HHGA 1FTZA 2OLUA 3L2VA 1IDYA 2KIUA 4QPOA 2XGEA 3FYZA 4G3WA 2OWHA 2QLZA 3QP5A 2VB6A 3CMMA 4ZYAA 3W6KB 4A3JJ 3S16J 1SKOA 5AQBA 4EVIA 1UCRA 2HYGD 2XV4S 4YFXF 1JKPC 1Y0NA 5C4JJ 2ELHA 5CJ9A 2MG4A 3ZQCA 2MBFA 2DBBA 4OKPA 4CO8A 4RAFA 3LQQA 2R7OA 3VV4A 1P4WA 2D1HA 2XKPA 3QQAA 1LVAA 4BBSJ 1K38A 5GAEJ 2L1MA 3GDIA 3LCEA 3WG7H 3NDEA 1WJAA 4F55A 1LLBA 3J7AY 1KOUA 2K9SA 1RIOH 4U0XA 3MCZA 5GADJ 2KP6A 3WODF 3BCAA 1MNDA 3WU0A 5HLHA 5GPAA 1ON2A 3HOXJ 1JT0A 3FM3A 1FY7A 3RQ4A 4BQQA 2R7UA 2ZM8A 1O7EA 4M3KA 3HGGA 2JA2A 4E7SA 4DXCA 4XONA 3IH4A 2Y2GA 3Q0VA 1B72B 5GLBA 4AFIA 4YG2F 5FRNA 1GV5A 3QP4A 4A3BJ 5FO5A 1ESUA 2CRGA 2QGUA 4UAAA 3ZG0A 1PWGA 1MIJA 3F3XA 1MMSA 2EWWA 2DDAA 3NOUC 4G9YA 2ZXJA 2KZGA 3S7OA 3S7QA 1EH8A 2DFIA 2NXNB 4G7HF 3A2KA 3PO3J 1OYYA 1S5LC 2ZJ2A 4OU0A 4OP8A 2XKOA 3HOVJ 3LNQA 1A6IA 3IWZA 2CS3A 3I4PA 1XPBA 3P9IA 4XBFA 1RRJA 3WS4A 2CGPA 5E17F 1BLPA 1Q2QA 4IRHA 4QWOA 2OAP1 3LSPA 2H8RA 1N4OA 5EVEA 2IW5A 2V1DA 2K5CA 3BP8A 2HZ5A 3L7HA 3HB9A 2FNPA 3F1OB 1DUXC 4XN3A 3OL3A 3KP4A 1D7EA 3C38A 3QWLA 1MDMA 4HZFA 1YW9A 3ESWB 3N8RA 3LI8A 4S2NA 1VFCA 2J3TC 4BYYA 2Y75A 5DS9A 1T39A 4PAUA 4EU0A 2VJWA 1AWIA 4HSRA 5EYRA 4WX9A 1ACFA 3FKWA 3L2QA 3SH9A 4IQ4A 3TO9A 1LEBA 1MBFA 3SS4A 2ZC2A 2FU4A 4DYCA 4CZCA 4HH2A 4LCLA 2JHEA 2PD8A 1IUYA 3BG9A 3CCMI 4X53A 3VODA 1U0JA 1IN8A 3V39A 5BOHA 3QNBA 1OJGA 2G2WA 4AWXB 4HBUA 3A0VA 4RB0A 1ZG4A 3FZVA 3TSGA 2ID3A 3PFYA 1LT0A 3TO6A 1PRQA 4DDYA 2BBYA 4JBAA 4ARZA 2M7AA 4FQGA 5CQGA 3S93A 1F36A 2LF8A 1Z21A 4DOZA 3CP2A 4ZZLA 1WI3A 3EGDC 4HEFA 4JK1X 2P7VB 1DP6A 3CZDA 2TCTA 2X1DA 3DTIA 5F1RA 2GXGA 3O5YA 2LR8A 1RUNA 5EVID 4RS8A 3W2AA 5FD6A 1MH3A 2O3FA 2PU4A 2X02A 2LF7A 2FX0A 5HDDA 2KJCA 1QHGA 2X6OA 2A3UA 5JVGF 3QP1A 3HLFA 4EW7A 5L8MA 4LLOB 4B88A 2WY8Q 4HV6A 4M9ZA 2V6EA 5J8XA 4C2TA 1O3TA 1FR1A 1W36C 1AU7A 1W63M 4E6XA 3K1PA 5HSQA 2ZQ9A 4I01A 3SZGA 2FBIA 3L1PA 1F1ZA 2L9NA 1TEMA 3MQOA 3TJZC 3KZYA 1IW7F 2O9CA 4L5JA 2W25A 4XLHA 2A6EF 3I53A 4BAYA 1BI0A 1V5GA 2R5ZB 2QSHX 3FWEA 2IS6A 5EOEA 5K1YA 4ME4A 1ZREA 3ZG8B 3LFKA 4BJ5C 1Q2PA 2OTLI 1FIKA 3DPUA 3H3UA 5FD5A 2NOGA 3OZHA 1I3QJ 2J8YA 3EOIA 2DMNA 3V3RA 3VP3A 3DTEA 1FMVA 3S3MA 1WQ2A 3M8EA 3DEUA 1K61A 1GA9A 3WWXA 2LLKA 2LC2A 5H6RA 1TWGJ 2OA4A 4XIDA 2GA1A 2VJ4A 4CCKA 1BL0A 2Y55A 3CCLI 3H82A 3Q5FA 3LY3A 4KG6A 1J5YA 5CEBA 1X19A 3FX3A 3TEDA 2DT5A 3ECOA 2W3GA 3WGGA 1TW3A 3C2WA 3A1YA 1VQKI 1JJ8C 2NAZA 2KT0A 3C2BA 2A2LA 4P5OA 5JR3A 2Z33A 3CTAA 4O3MA 4WMCA 2W85A 4I6ZA 1RETA 4I76A 1G3TA 4HEA2 4BQOA 5ED4A 4IZZA 2H1KA 3IAM2 3LA2A 2INWA 2Z2MB 5EOOA 5FEFA 2X1EA 1MW7A 1RCJA 4KQOA 4OQIA 3T1BA 2XPWA 3NIAA 4PJMA 4J00A 2PX9A 4KITB 1I6XA 1KGSA 4M3GA 4E7IA 3BFGA 5E2EA 2Y2KA 4II2A 3S1YA 3T12B 4HYEA 2RCXA 2TRTA 4E4HA 4HAMA 5F6AA 3HUGA 5C5KA 1BT5A 4OVDA 4HV5A 4OPYA 2JVHA 4EERA 2CO5A 4KT6A 4PKYA 3FMSA 2WAEA 4BXUA 1BI3A 3VFHA 1KZHA 5HS8A 3K4MA 1K54C 3C4PA 3D0SA 4KZ9A 1R36A 2C6WB 2O61A 3IXGA 2KISA 2FD5A 1E3PA 2Y0SN 1A35A 2VGKA 4C9YA 2HFHA 5B1BH 3RSNA 1FOKA 4UY8I 1WZ2A 5IP6A 4QLCU 2V7FA 2W1TA 4QY6A 3HPGA 1CEFA 1D1AA 2DXIA 3ITAA 4BBTA 1NG7A 3WE2A 2A68F 1TT0A 4EUVA 2MW8A 2K9NA 5FKNA 4RB3C 4RLQA 5FQKA 1KYWA 4DJ2A 4Y0TA 4EBNA 3H9GA 1G3SA 1T1BA 2MYSA 2W57A 3IT9A 4XT2A 3VOLA 2EX6A 1OISA 1IKIA 3Q9VA 1JUMA 4OAZA 4KZ5A 5M1AA 4Y7PA 3LSIA 3TO7A 3F1NA 3BC8A 4NG2A 2E36A 5IT3A 2H1LA 3GMEA 3MZ8A 4EM2A 4OH0A 1YLFA 3DKXA 3MVPA 4P9FA 5CVRA 5D5VB 3DU6A 3KPHA 1BBYA 2FBKA 4PJLA 2D01A 2VGLS 2BASA 5TBMB 3K2NA 3UNWA 4DBRA 2KKOA 2GJ3A 4XSXF 4EETB 1Z9CA 2PBDP 5LGTA 4C3IJ 1WPKA 5D8LB 2Y2LA 3WGIA 2UXNA 2O6GE 3GTMJ 1XCBA 2PJRB 1BLCA 2CQQA 1GHIA 4OQHA 1KQ0A 5CGXA 4YEJA 3SW1A 1R58A 2VN2A 2PYRA 4PM6A 2XDVA 2KDKA 3EQLF 2D45A 4BWIA 4U0WA 3FXJA 3QP2A 4S2LA 2PJPA 4LV0A 4HNVA 4X0GA 1WH5A 5E2HA 1NG6A 5D5UB 3H9WA 4FTXA 4HHDA 2JA6J 5U47A 4BL3A 1RPWA 2Q1ZB 1Y8RB 1YKDA 4HJ4A 3J7YJ 2Y91A 3UB8A 1QZYA 4AIDA 1YO5C 1F4KA 3HDDA 2J3TD 2IGMA 3M6HA 3FF5A 2F2EA 3L2RA 2K27A 5F83A 3HOUJ 2CSOA 2EIJH 4Y5FA 1SD5A 4IL6C 2VBXA 1DP7P 4WN5A 3UPOA 2WA0A 3LWFA 3PL8A 3COAC 5CKTA 1BC7C 3VP4A 3S32A 4HJ6A 2L4MA 5LBQA 1T38A 3GFLA 5JHFA 4HDUA 2DA6A 1BW6A 4A3DJ 3F8MA 2JZYA 3V8KA 3RPUA 4N9LA 3CDLA 3M2KA 3S2HJ 3CJNA 4MLOA 3VYUB 3IF5A 1NLYA 4B3XA 5CVJA 2HI3A 1OCOH 1YQAA 1SCWA 1B1BA 3FMRA 5JYPA 4XLEA 4W97A 1PI5A 1YQSA 5TFQA 4DE2A 5CQEA 5DKKA 2GIZA 2ME0A 1B8IB 3BQAA 2GXAA 2FZ0A 1YT4A 4U0VA 2JKTM 4U7BA 2K2NA 3N4IA 1GHPA 3WTWC 1YIJI 3HLWA 3ZGAB 2XAGA 1AOYA 4GOGA 4S04A 2W3FA 1VNDA 2A69F 1R1UA 3BTLA 3C30A 1ZGJA 2OZUA 1XGNA 4PGGA 1YHQI 4IHSA 2HDSA 3BFCA 2V1AA 3IWIA 2OJED 4H8RA 2EZLA 3O8HA 1FP2A 1HSTA 4XMYA 1Q1VA 3EETA 3N05A 1JJ6C 1ES2A 4XKWA 4CCMA 3ABUA 4EJVA 3RZDJ 3H1CA 3RKYA 4F52A 4JKTA 2E19A 4U3TA 3E2KA 1U8BA 1XMKA 3TP0A 4UVAA 1CI8A 3LIBA 3CP8A 4CCJA 2OCEA 2FMYA 1R5ID 4A3MJ 1T18A 2Y48A 4UVCA 3IC7A 4DYQA 5HARA 2PRFA 5HL6A 4M3BA 4X1EA 2Y2NA 2HTJA 1D5YA 1EV7A 1ONGA 3BLYA 2IWDA 4OONA 1O4XA 1OTBA 1H5XA 1LL9A 1PUFA 2DQRA 3H5NA 3I59B 4CYCA 3OL4A 1S29A 2ZMEA 3HOYJ 3IHUA 2DJNA 2V26A 3VE4A 2W7NA 1EKEA 3GSGA 1ESIA 5H6QA 2XC7A 2R7RA 3B6AA 1VQ5I 5LFAA 1LSVA 1XDSA 2HR3A 2R0QC 2RN7A 4NC7A 3IXBA 2PFBA 1KVLA 5C4XJ 5FQIA 5L3CA 2WKQA 4HLYA 2MJ6A 3CUEC 3DW0A 4R1HA 1FOYA 2HOAA 3O88A 3CF2A 5F68A 3H92A 1Z1DA 3PNYA 3W2ZA 3F1PA 3PUFA 3EQVA 4AUXA 5L3EA 4BE1A 5DEQA 4WELA 1T1CA 2WB1N 4QD4A 1X1PA 3C4OA 4XLPF 4Z2YA 3ZQ7A 3B47A 2BXZA 2W48A 1E3UD 2GNXA 3VOZA 1P9WA 1VI0A 2FUG2 4LLNA 4OMYA 4ZJ3A 3LFUA 1MWRA 3S17J 1D1BA 2WYXA 1NXYA 1WSUA 4LLLA 3WS1A 2P8TA 4FT8A 4EATA 2ZJRF 2W4SA 3W8KA 2BLSA 5M18A 4XLAA 2ZL1A 2DMTA 5GTIC 3BTCA 3JRAA 1H88C 1CF0A 4MNUA 1A6QA 1LDKB 1ETKA 2QYOA 2V8CA 2A61A 1IRFA 2FBHA 4G12A 4FSFA 1QRYA 5HPFA 1XCVA 1Z67A 2IA2A 3HHHA 4UV8A 1ZC2A 2FF4A 2AHQA 3BR0A 3SZTA 1VQ6I 2HV1A 3KO6A 5DM7F 2AQEA 3CCQI 1ZAOA 3BCBA 1BTLA 1SFXA 1HW5A 3S3NA 1T6SA 3H5RA 2EFQA 3HRSA 3BG3A 3MS6A 5DF7A 5GL9A 3DBLB 4HPQA 2Q8KA 5HLIA 3UDXA 5CECA 4G6DA 3F72A 1FQGA 3IX3A 3MAJA 2QA4I 3G4PA 2XVCA 3UY6A 3DPLC 3RCOA 4B4CA 1T0FA 1IXSB 2LBFA 4RGRA 3S7PA 5HWWA 4I98B 4JBFA 4Q0HA 3KETA 3QPSA 3N4MA 5H20A 3OYEA 4HOBA 2IA1A 4F93B 2H27A 2OOLA 3GCMA 4NQWA 4FCFA 1S4SA 3OOVA 3FZCA 3ISPA 3FIWA 4BJ6C 3OSGA 2HQNA 3LUQA 4HP9A 3OR2C 1K56D 4XNFA 4PM8A 4HNUA 3OPLA 4QIWN 3F6OA 2QEXI 1CF7B 3DKWA 1ETXA 5CVIA 1DP9A 2Z5UA 3FWLA 1MMNA 3TDZC 4XRSG 1LFPA 2WY7Q 5D3OA 4F7ZA 1AKHB 2E2JJ 4UUVA 1IYSA 1FOFA 2VV6A 2ZKZA 3DU5A 4X69A 2HU9A 2RGVA 3GUDA 2E8JA 3A01B 2OV7A 3ITBA 3A0HC 1HSJA 2VJJA 2RNGA 1LB2A 4NEED 5F27A 2DW4A 2R4GA 2XAQA 3BJOA 5B5EC 4HLXA 3CJQB 3B3XA 2P0WA 3A3JA 2OQRA 2L5QA 5EG0A 2BXYA 4RM2A 2UWXA 4WK8F 5GLDA 2E5ZA 3G2ZA 1P4XA 3HBLA 3KYCB 2PAVP 1KVMA 4MMNA 4B4ZA 2ZNZA 2QCOA 2H6CA 3VP0A 5G4ZA 5F0HA 4D9JA 1PI4A 2EX8A 3R0AA 1TTYA 2M5WA 2RDPA 5DCMA 2K40A 2Y2HA 5JYOA 1PW8A 2LG4A 2PBYA 3QNCA 2ZC3B 3QPHA 4PSXA 2PN6A 1R1TA 2B63J 5FLMJ 3IBJA 2Y2MA 1G3WA 1V5FA 3UB6A 3B6CA 2ID6A 2EXBA 1F98A 2QBYB 2Z6CA 5EZGA 2XGXA 2MLGA 3VFZA 5D5WB 1HKQA 1LQ1A 1Y28A 3E3VA 1Z0XA 4Z6YA 1YI2I 1XMAA 4L9JA 4PKYG 2LREA 2EWVA 1JWZA 5DUKA 1Q1HA 1QO0D 1T8IA 5E3LA 5HW3A 3TW6A 4RX2A 3OLOA 4XN0A 4ZTJA 2R7ZJ 3VOEA 3HSRA 1TS8A 1IUFA 1X3ZB 4HBLA 1AWCA 3U21A 3BG7A 5FKLA 5KHDA 3GYHX 1XTAA 2AVXA 4CYDA 3R60A 3D72A 2BHYA 4YELA 5F08A 1SDEA 2HKOA 4Y4RA 2KPMA 1PIOA 4KENB 2M7VA 5LRSA 4JXGA 4GHIB 1Z7LA 1NRFA 4I7HA 2KZVA 3K4JA 5TRDA 1EWZA 3OS2A 2K4JA 4N92A 3K0LA 4WXCA 2DA4A 3JVUA 2DYRH 1QGPA 3JTHA 2VKHA 5D6FA 3Q1FA 4S2PA 3GWZA 1DP3A 4WZ4A 4NXGA 3T1QB 1MKMA 2ZMAA 3SDGA 4RM3A 3V8JA 1G28A 2VE8A 1APLC 3CCEI 1XGIA 3G31A 1YYVA 1ZG6A 1TC3C 1WVRA 4AVZA 2HPMA 2VUMJ 5M5WJ 3G30A 4GYGA 4HF0A 1BM9A 2XRNA 3OPHA 2J7VA 4FOFA 2HYFA 5AIPA 3ABTA 3H0GJ 1PUEE 4X1LA 5FDSA 3MF0A 1YITI 2ZQCA 3S7NA 3LIAA 2M4KA 1HBXG 2MA3A 1FYMA 4L0YB 1IRGA 3REOA 4UB8C 3HLCA 3MFKA 1G6AA 3I4MJ 3M1CA 1I39A 2Y0MA 1XXMA 2V1ZA 4F3LB 4JPMA 3DWLE 2M30A 3AG1H 1MJBA 3QYEA 3HLDA 3RXWA 3CF5F 3J81Z 2W84A 3DPTA 2X6XA 4M73A 3BEBA 2VT3A 1Z91A 3DTKA 1WJFA 2J5PA 3CC2I 4A5NA 1GHMA 5K5OA 5E18F 2P7CB 4ETSA 4E7KA 4FH2A 2EFUA 4E04A 3PSFA 4MIMA 3OYNA 3OPPA 5GHYA 4P87A 2DTRA 2CV2A 2OAZA 2WB1A 5E1XA 4AU7A 2BZTA 5FB2A 1G5UA 1O07A 2E1NA 4CLCB 1K4TA 4M6YA 1VQMI 3M07A 3FK7A 1J7KA 5J3LA 2ZSHB 3GO5A 2DMQA 5L3BA 5EGOA 2R7XA 1LL5A 3S1MJ 1U60A 4B9OA 2KFDA 3EEAA 1OTAA 3RJPA 5JVTA 1HLUP 3MWMA 3K10A 1YM1A 1L0OC 2DLLA 1ZELA 4S2OA 2XPVA 2BY2A 2FOKA 1U5TA 1S0WA 3BM6A 4KZ7A 1I2SA 2E8IA 3JRBA 1N9NA 3FG8A 5EV0A 2K7LA 3K4NA 2X1CA 3SHFA 3K1MA 2NVXJ 4EBPA 3GQZA 4ZYHA 1F9NA 2A05A 4MFDA 4Z9QA 1ON1A 4CCLA 3PBRA 3RJUA 4PJ0C 4M6XA 3MEXA 1EW0A 1I2WA 3CLQA 3WRZA 4WUJA 2I10A 1WJBA 1XSXA 2CQXA 3VDXA 5FLXK 1QNTA 5BQTA 5EEAA 1F5MA 1QVUA 4C75A 4ASNA 1MXOA 2LD5A 1KU3A 3CC4I 1X4PA 1XGMA 1TD5A 4XKBA 2A49A 2PD7A 3R7WA 3HOWJ 2XSDC 2HDQA 2JUCA 4N9HA 3RKXA 2IT0A 5CHJA 2LY1A 2XAJA 3W4QA 5IU1A 1KGEA 3K70D 4KUKA 1XKZA 2VLAA 4K2EA 2XLNA 2JT1A 2BW3B 5JLWA 1YJNI 5IOYA 3JRFA 1LI0A 5EFWA 5A8BA 5AONA 2HPIA 2WBMA 4Y13A 1OCTC 1K6RA 3MN2A 4GNUA 4CLCC 1K6YA 1FJLA 5BS6A 1NK3P 2DFEA 2ZJ9A 2R7QA 3W2VA 2A6HF 4A3IJ 4R6LA 4RBOA 4HX8A 1VM1A 3HL9A 5J8FA 3JAMZ 4QTRA 1LE8A 5CTMA 2W1OA 1IV6A 1YG2A 4ZTKA 1VQ8I 1GSWA 4QU3A 4X25A 1OR7A 2M4GA 1YLWA 4P85A 1JKQC 3NI9A 2VLGA 2EFWA 1M40A 3CC7I 1QVTA 1WGXA 4XXRA 3FC7A 3OCLA 2EA9A 2XASA 4GKUA 1BC8C 2LP0A 3SYTA 4MN5A 2ECCA 3X2QH 2CYYA 3D5LA 2DNSA 2QSGX 3LGOA 3MXRA 2CFXA 1E0EA 2Z99A 2YKFA 1N78A 4IQJA 2ZOHA 5HDSA 3FHNA 2HP6A 4KMFA 3IWQA 4N4OB 1U2WA 1W5SA 1OYWA 3P9CA 4E70A 3OYIA 1BLHA 2ZD8A 5HZHA 3BR2A 5FFXA 1K4FA 3N8SA 5HX9A 2OPTA 3CMAI 2WKHA 2LDUA 4YWZA 1PYVA 1K4SA 3SQNA 1T95A 3WHBA 4ZAMA 2QQ9A 3HEFA 2LK2A 1PP8F 4NXBA 5A92A 2MC3A 3UPNA 2ZFWA 3VPRA 1QBJA 2VK3A 4KQRA 3AG2H 5FRMA 2K4BA 4BHBA 1ETOA 4ZYGA 5AVFA 3IUOA 3HKZN 3OPRA 1Y56A 2IBDA 3IAS2 3OCNA 4FE7A 3K2AA 4B3AA 5ICGA 4A3CJ 1SFOJ 3CCUI 2ZFUA 3K4BA 1ZGWA 1RR7A 4CQHA 4P96A 3T4LA 2Q9MA 4CJNA 1Y39A 1B72A 2HP9A 1YSQA 5CGSA 2X0LA 2J5OA 5LD2C 1JE8A 5D4RA 4V2GA 1K78B 3V67A 2ZXIA 1IZ1A 3DEWA 2LKXA 3W3CA 2CC1A 3PAGA 3C8CA 3PQKA 1W8YA 4DYRA 3O86A 3K4LA 4YIFA 1IF1A 4ID4A 4ZRRA 2HJEA 1GLNA 3AGDA 3MZFA 1QZZA 3T1SA 2LKSA 3OYJA 2GZWA 1FEXA 1SKOB 1SAXA 2V4JC 4EBLA 4CA0A 4I99C 3BYDA 3HVFA 1LUJB 1ALQA 1KQ9A 1MNEA 3O87A 5F5YA 4CPKA 4DKIA 3JRGA 2CMNA 1SFEA 4KMUX 5MC7A 3BROA 4XM3A 1N9LA 1S8NA 5HOOA 3E0YA 2IAIA 4Y3OA 3KLNA 3F9KA 2QQ8A 4CXFA 6PAXA 4IPAA 1HD8A 2R78A 4LIVA 3HLBA 2XAFA 3Q7ZA 2PU2A 4U88A 3S1QJ 2ZM2A 4MTEA 3TE8A 4G7OF 1DQUA 4BD0A 3IXHA 4IEJA 3TOBA 2VONA 4A3FJ 3RXXA 2HOEA 1PNEA 2Y2PA 2J9OA 2EK5A 3M3YJ 4WEJA 4ABZA 3MXQA 3V50A 3ZVTA 1QMEA 4L9FA 1W0UA 3DEEA 2QYBA 2NVTJ 2DT6A 1WFXA 4E6KG 1BSGA 1G68A 3OWTA 4F91B 2Y2QA 3SEZA 4H6JB 1SVLA 2YR2A 4Q8IA 2UUZA 4MTDA 3G73A 4W1UA 1PWDA 2MGQA 2HOSA 5DDGA 5IP7J 3H5AA 4BENA 3RTYA 3L09A 4NC6A 4HF2A 1ULYA 1P6RA 3JSPA 3FHZA 2BY1A 1AA7A 2XAUA 1XS9A 2GBYA 5HPIA 3ML6A 3RH8B 3FXMA 5LHIA 1KE3A 1X1AA 1BI2A 2V6CA 3G2BA 3Q0UA 3BWLA 4IHVA 3KEOA 3DFGA 4BJTA 1IYPA 3LR4A 4IEDA 5CYVA 5GTHC 2ZQAA 2IS1A 3BY8A 3BG6A 5LEJA 4G7ZF 3CAXA 1WKMA 4I38A 3D5RC 3NWTA 3ULFA 1ZR2A 2FFFB 4BD1A 1MJAA 4NDLA 2EILH 3OYKA 3N8LA 1IV8A 2Z2SB 3JSOA 3OS1A 4C3QA 4OOLA 4P6ZM 3HXLA 1U78A 1SANA 2ISYA 1L2SA 4AIJA 1SKFA 4XSZF 2VOOA 1E3UA 4QY5A 2QKMB 1O3RA 5EM1A 4XK4A 4IHYA 4P0MA 5FROA 2QKLB 2VKVA 4R3AA 2DA3A 1S7EA 1N9OA 3MZYA 2Z2LB 2WAQN 3IH3A 3M4OJ 2VE9A 3WTYC 1QU3A 1XG1A 4IF4A 1K25A 5F69A 4PFOA 5HDNA 1UHWA 2R5ZA 4DJAA 2K3PA 1Y1WJ 5FAPA 1QMFA 4Y2FA 3HJIA 1WH7A 1UAAA 1YLZA 5K5BA 1TS7A 4EM1A 3PAEA 2JKGA 1R1VA 3I71A 3GFMA 3DF8A 5DTKA 1SHVA 5IYDJ 1YOVB 5GLAA 3W2WA 4IVKA 5IT9K 4LLGF 3LQRA 1GVDA 1X2NA 4A2UA 5J6XA 3PIOF 5FLVA 2XIGA 1BW5A 2HDUA 3N6IA 2HVRA 3MKEA 3S22A 5EE8A 3LR3A 2FA5A 3RDIA 3ZCOA 3IRRA 3S2WA 1IDZA 1ORKA 3ZN0A 4D1QA 3VYSB 3CO7C 2I5UA 4OIQF 2EINH 3LA3A 2VXZA 4PUSA 4XORA 3WG9A 5ILVA 3LYXA 2BG1A 4QB8A 1KDSA 1U9OA 4KZ8A 4II7A 3U1DA 1E25A 4MBFA 4HW0A 4EMSA 5GHZA 2M8GX 2OU2A 1KQ8A 4EM0B 2O5RA 1WHUA 2QKPA 3IHBA 3MBZA 2Q2EB 2K9MA 2JKRI 4R38A 3HBRA 3GV9A 2BEOA 3KYEA 4A3LJ 2R9XA 4PPRA 2WADA 1K56A 3TRCA 2W1RA 1F5TA 3ZMUA 2Y8HA 5E3NA 3NEUA 3LO7A 2V0UA 4S2NC 2K31A 2P9VA 2WGVA 4XOTA 1T56A 1RP5A 2X51A 1ENHA 4A93J 4R3JA 1R23A 2VPRA 1TBXA 1HDPA 2CG4A 5L3DA 4BQNA 3I56I 3SS5A 3KEYA 3L9FA 2VJIA 1IN6A 2Z3YA 3BW6A 5FQJA 5J4YA 5ILUA 4Q47A 2XROA 2FQ4A 1VQ4I 2BOLA 2DPUA 2RVCA 1E3HA 1CQAA 2V20A 4EEUA 3KE2A 2COBA 2K02A 2RREA 1HCRA 3L2WA 4A5MA 1JT6A 4KISA 4Q4ZF 1FLIA 4LV3A 2MABA 2IRFG 3HKZA 2P5LC 3B73A 4ESFA 3L2UA 2OTJI 5B1AH 2QUFA 3IX8A 2OSUA 1B9NA 1QPIA 3H82B 4PSWA 4UXNA 2QM3A 3IKTA 4DNCA 3AL0C 2KLIA 2BYVE 5D4SA 4B93A 3NULA 3Q3SA 2GWRA 4L9NA 1P97A 3A0RA 3VP2A 4YFMA 4RMNA 2XF5A 1WJCA 2K7SA 3R6SA 5A2QK 2M87A 3DWZA 1WJ5A 2PBIA 4JGRA 4WZ5A 2RNJA 3MMYB 3PSIA 3OYFA 4JF5A 5K7ZA 2CW0F 1W63Q 1MSEC 2R7SA 5HODA 1D0XA 4WXHA 1EROA 5KZHA 2Y30A 3ERMA 4JQFA 4ZH4F 3T4JA 5J8CA 2GLOA 5J7EA 3Q81A 2GDNA 3HUGB 1QHHD 2WZZA 4S05A 5EJCA 3MJQA 3NHQA 1GUUA 1W4MA 2PJRA 1XGJA 4ENNA 3LL7A 3SFIA 1SDNA 4F94A 4AVPA 2IEKA 3DLAA 4DRTA 5FLXZ 2HF6A 3ROUA 3MKWB 5CRFA 5LRRA 1DGWY 3M9AA 3UDIA 2XEPA 4I02A 1ETQA 4OINF 2DAOA 4QHCA 2W1TB 5LLQA 4R4SA 5E8GA 3GXOA 4B43A 1HDDC 2QZ6A 2EH3A 3FDYA 3CUQA 1FZPB 1YRNA 2DK5A 1MNMC 2CMPA 3PR6A 1T98A 5FKOA 2L0WA 4HNTA 3GZNB 5H2FC 4QPQA 4PJNA 3H3ZA 3TKYA 4D7NA 3CO6C 2HEOA 2WZXA 2B9SA 2XGNA 4WYYA 2QWWA 4AIKA 5HNFA 3MKZA 2QWSA 2HYJA 5EUAA 2YX4A 5DJUA 2R5YB 3ZDJA 4XT2B 4CDGA 4OP5A 1SMTA 3BY6A 4GO1A 1AHDP 3PIPF 1OPXA 2I8DA 3F1NB 4BXFA 3CCVI 3HOTA 2NS8A 2A24A 5FQMA 4UHUA 3F21A 3LSMA 3LIEA 4BH9A 3M8FA 2NYXA 2QJ7A 4EJWA 1GSXA 1S66L 1XA1A 3DAVA 3DCFA 2HWVA 3ZQGA 5E3OA 4KZ3A 2ISZA 5I94A 2FQ3A 3ZMDA 1ZRCA 5FI6A 5L09A 1PJRA 1UHSA 2L7ZA 2YKHA 4EQIA 4HG2A 1JHHA 4GYIA 1VEUA 4UA9A 2FE3A 5KMWA 1S9HA 1U8RA 2WGWB 4KG2A 3OR1C 2C6YA 2HZDA 3D1NI 1SFKA 3CUEA 2P6SA 2D2WA 3T0YA 5BNGA 3EUHC 3OYMA 3CITA 4IHQA 2CW7A 1X58A 3BR3A 4OPQA 3T4SA 5E79C 3AGEA 3CESA 1IG7A 4BY1J 2M3AA 5DFXA 4A0YA 1LDJA 4Y0UA 5FAQA 1XDUA 4EGYA 1JWVA 1MWTA 5J3WA 1HW2A 2L9RA 3E5QA 1K55A 1JTXA 2KIQA 2WAQA 2Y2ZA 3GZ6A 1O57A 3G6EI 3F23A 3LEZA 2K3FA 2X01A 5TGFA 1KE0A 4B4XA 2DI3A 4R8HA 4E3IA 3FXQA 1A36A 1W36D 1S7AA 4H0EA 2P5KA 4FUWA 2ETHA 3BJNA 4MFEA 4ZZDA 5JHUA 1QQIA 1J9IA 3PNVA 4CICA 2E2HJ 1XSDA 1VQ7I 1HC8A 3IF6A 3UE6A 4YOFA 1N25A 1UHMA 1G3YA 2OD5A 2RL3A 1KU9A 1T1AA 1ZYRF 1UGUA 4S2JA 3I59A 2VGJA 4D2OA 1FCNA 3Q07A 5ICEA 2L2OA 3I54A 4A12A 3SH8A 1POGA 1RKTA 1W7PA 3R61A 4GJ4A 2L7MP 1KGGA 3ZQQA 2DA7A 5FKMA 4C3JJ 3BPVA 3PBQA 1BR4A 3EGXC 2KIFA 3BECA 1PYYA 1BLSA 2XD5A 1NZOA 2A3SA 4K91A 4NKPA 1ZARA 2FFYA 3CPTB 4KJZA 2Y2OA 3HUNA 2F5EA 3HGYA 1MBKA 1PWCA 4HESA 2DOEA 5HNHA 2R7WA 2H28A 4II3A 2L01A 3DBAA 3ZG5A 2HQAA 2FXAA 3HTSB 2WKPA 3PBTA 4LJZF 4HDVA 3OYGA 2XF3A 4KQDA 3KZIC 2QPNA 1RZ4A 3KSFA 5DTDA 2H0YA 5IT5A 4YFNF 1Z3XA 1SD6A 2PMZN 3DBHB 2JQ7A 5K7FA 2JTVA 2MSYA 1YAXA 4RDUA 4NHJA 2IS2A 1WE4A 1GV2A 3BT9A 2JJ7A 3I9V2 3ZP5A 3UE1A 1T08B 2HVSA 2DDBA 5AVEA 2JUGA 3CQZJ 2NOJB 2JRTA 3PBNA 3V7RA 3WS0A 3IL2A 4HY8A 4EJOA 3HSEA 4ZC3A 1R7JA 4UUSB 4MEXF 4L18B 2VBYA 1BZAA 1JVJA 3A3DA 1PUFB 3I64A 2VQLA 1YX5A 4L0ZB 5A90A 4CYCB 3K4CA 1R00A 1MC0A 2R7TA 1IYOA 4I39A 2ZMFA 2ME6A 2OBPA 4RGSA 1RR8C 3HRMA 1ZLKA 1BA5A 2VIXA 4GDBA 3LSJA 1XGSA 4RGXA 1PVEA 3E6MA 4EV0A 4E3KA 4GS9A 5J1UA 1YJWI 4ITVA 2O8KA 1X3UA 3CCRI 4B09A 1K7AA 2KQRA 3LIDA 4FH4A 4GDNA 3VMAA 4L5IA 2EX2A 2K9QA 3ZMZA 1TWHJ 4DMZA 2V9KA 1TWFJ 3KP5A 4I0BA 2PT7A 5DTSA 2VV8A 2CU7A 2KRCA 1BN5A 1XSVA 3HC7A 2LH9A 4M3DA 4RGUA 3WU1B 5CHUA 3TG9A 3UMEA 1YPRA 5KSHA 5KCMA 5J4VA 4QSHA 1OCZH 2HP5A 3P7NA 5B3SH 4MO7A 1FR6A 4BY7J 3CD6I 4BUPA 5A93A 2WKIA 2KHMA 2STTA 3E5XA 3ZMVA 4XICA 3S8PA 3IH2A 1VQPI 1EJ9A 1IEMA 3OY9A 3JRIA 3FISA 1WI9A 1IOUA 2ADUA 2EX9A 1OJ5A 1EF4A 1VQLI 2ZL1B 4RQ9A 5LBRA 5EVLA 3MXSA 3CUOA 5F04A 5LHGA 4KG5A 3ZOBA 2AO9A 2K9LA 1CEGA 1J0RA 4XOPA 1CI9A 4KN4X 1T19A 3MD2A 3BOQA 3V42A 2D02A 4LIUA 1BUEA 5AQ9A 1R5HA 3CJTB 4GCVA 2QVOA 2KDZA 3LICA 2ZXWH 3RI4A 1FX7A 3HZJA 4GFBA 2XD1A 3KP3A 1O7LA 5IYCJ 3ONQA 2WKEA 4KZBA 3UE0A 3ZNYA 4BL2A 5KIZA 5IT9Z 5FGMA 4UEYA 3NAUA 2VPLA 1ES3A 4Q0IA 1ETYA 3OYDA 2W82A 3N7WA 2YUSA 1K57A 4LG3A 5GPCA 1EH7A 2LBFB 2ZNYA 3C1DA 2IGNA 4QPRA 4WMCD 3FXKA 3VSLA 2IVMA 2PEXA 4Y17A 3D3OA 4IJAA 2F5DA 4NQWB 1MBGA 2X6YA 1IXRC 3IWFA 1LEAA 3BQYA 1D5VA 1ODVA 1OMEA 3JYIA 2P5VA 3GEZA 1L3LA 3BRMA 1ZHHB 2J9PA 2QBYA 1DJAA 4LV2A 1QPMA 1UG0A 3AG4H 3UNGC 4UA6A 3NC8A 2JWTA 2RAEA 3DWKA 1JUPA 3FPVA 4IVNA 1I1SA 2Y59A 3G2YA 4HQMA 1I27A 5FA7A 3L00A 3K7AJ 4M9XA 4IHTA 4F3QA 4XLFA 3GECA 1H8MA 3HYIA 5LGNA 1ONHA 1VETB 2B5RA 3L7WA 4LENA 4ZJ2A 3BWGA 5L3GA 4HRIA 1TNTA 2YU3A 3MKLA 1LFBA 4D5CA 4X6AJ 1GSVA 4KQQA 1FSYA 1Y1VJ 5IHVA 3PYPA 4EEFG 2LB5A 3C7VA 2LNBA 5IOZA 2HS5A 1FCOA 4L0LA 5F82A 1HKSA 2CJJA 2IJLA 3I55I 1JNUA 1P0ZA 5LGUA 1MGTA 3JCUC 4E7JA 2EFXA 1K6OA 3ZQIA 1W1WE 1BOBA 1W5TA 1IKGA 3DBRB 2EZIA 3EWKA 4GDFA 4X55A 4LB5A 3Q7VA 1OCPA 4GW9A 2ZB9A 2YS9A 3HJEA 3HOSA 2PMUA 2G2UA 4IUHA 3FXRA 4LG0A 1UWPX 1YW8A 4BHCA 5KAFC 1G8XA 1HA8A 1I1GA 2BTFP 2OLVA 3P5JA 4PMAA 2X9DA 3CMYA 2JKTI 3T4QA 3VWBA 3WGHA 2EA2A 2H8WA 5EEHA 3C7JA 1S1YA 1R49A 5DCMB 4FD8A 1PP7U 3UO9A 2X48A 3J80K 4OIPF 4Q5SF 2BVMA 4HQEA 4KICA 3FPWA 1YX3A 3FXOA 2O03A 3RKWA 1G59A 3I58A 2PHYA 3JVVA 3MMHA 2ZJPF 4E3JA 1TQPA 2V1NA 2E1MB 2A07F 2MD5A 2V1XA 3CCSI 5DKLA 2L02A 2VQGA 3QU6A 4ESBA 5DD8A 2HTSA 5GP9A 3OC2A 1R9TJ 5DTTA 1RNLA 5EVIA 3HLGA 3SS3A 4HF1A 1MMAA 1D8JA 4I3IA 4OIOF 3HCYA 1U3EM 3KIOA 4DBQA 1YS6A 4S2MA 4U0TA 1S7OA 1CQTA 2FNAA 3H3VK 2M34A 3PO2J 3G6OA 5CHMA 1WCMJ 3WE3A 4A6DA 1CJFA 1PZOA 4BHPA 2ZO4A 3SEQA 2B95A 1GXPA 4MQVA 5DFYA 2VV7A 3PM1A 3HUMA 1XFNA 4RAZA 3MR0A 4P9UA 1Z6TA 4MEYF 4DXBA 1R4MB 2ACJA 2PMZA 4LD5A 1D8KA 5IYBJ 2ZOIA 4OOIA 5HS9A 5E2FA 1R71A 4G3KA 4KZAA 2DCFA 4XL9A 1HF0A 5DYMA 4B8XA 2M0CA 4JX5A 3DV8A 4O7DA 5DJTA 1ES5A 4LV1A 4E7ZA 4IO9F 5EECA 2FSWA 3GRJA 3RZOJ 3RFBA 1FBUA 4FISA 4OMZA 3VE3A 1XN7A 4J19A 3HRUA 3ZYTA 3I5UA 3G34A 1TWAJ 1V54H 2XAHA 3B02A 4IBRA 5HVQC 1OT9A 3E4PA 2EIMH 1WYBA 1SMYF 1N77A 1XFQA 3MFXA 3GVAA 3FK6A 2WV0A 5L10A 2V1BA 4BGDA 4EV4A 3ZVWA 1RC9A 3O8GA 1FMWA 3ASOH 3MFDA 4N1HA 2VASA 2VQCA 3Q0WA 5BPDA 4JF6A 3EUAA 4KIBA 2YX7A 3S3OA 2E1MC 2IA0A 2DO7A 3SFZA 5J4EA 2R7FA 5FQQA 2QSFX 3AG3H 4YRVA 3G1OA 4RX3A 3ZQ5A 1W7FA 3KYDB 3JRHA 5TR7A 2L3DA 4IBXA 3SOIA 1KYZA 3QRFF 2VZWA 3MKYB 3JTGA 1OTEA 2UZKA 1MWSA 2XGDA 2Y79A 4M6VA 1K4EA 1JWPA 1J59A 1RGZA 4ZBEA 1UWNX 4A3EJ 2W00A 1BOAA 2VBWA 1OT6A 1SFUA 3WHCA 3S4XA 5K7HA 3MQQA 2ZQ8A 2M8EA 1P9QC 2NS0A 1X1DA 2ICWG 2P08A 5DV5A 1FTTA 2V9PA 3GZ5A 3V7SA 4UQIM 3ZMTA 3H35A 2ZBBA 3W4PA 1KE4A 4BL0B 4B1RA 1HW1A 1BJAA 3E4QA 4LITA 3JR9A 2O9BA 3NARA 2CUZA 2ZLYA 2G9WA 1ZLJA 3HTUA 5M3FJ 2VC0A 3BZCA 2QJ5A 2W3EA 3A03A 2MH9A 1G6NA 1XA7A 3LI9A 3P98A 1IAWA 4FTHA 2FEZA 4D5FA 1FYLA 5C44J 1U5TB 3UDFA 2Z6DA 3VP1A 1Z77A 4KIFA 4HI4A 2DRWA 5FI2A 3KX2A 4ZDPA 2O7OA 2EWNA 2XF6A 4CSWA 4C3HJ 5M3MJ 4H4KC 1JHFA 3K3CA 4R23A 4BEHA 1DP8A 4P1WA 4ETZA 3LAJA 1A0KA 3A0SA 4BJPA 3UB5P 5A91A 4P6ZS 4AIHA 2VKEA 1K0KA 2BVLA 1HQCA 3DXJF 2XUBA 1GDTA 3NOPC 3ULQB 3OIOA 3VFFA 4LRZE 3T4KA 2TDXA 5KK1A 3TGNA 1H89C 2CH0A 2E5NA 2HVQA 2ESHA 3OYAA 3T50A 4IXAA 2MD0A 5JI6A 3IS2A 4LCMA 1LSXA 4HH3A 4Q48A 1ZQ3P 3W4OA 1D3YA 3PJRA 1BJZA 2I72A 1O7FA 1T33A 2NNNA 1BIBA 2M9HA 1F9IA 4S2KA 4BDZA 2QF7A 2M7UA 2AQFA 2EIKH 4A69C 2GOMA 3H36A 1VTNC 1P92A 3H7WB 3G1LA 3S1RJ 3M1EA 1DPUA 2DYSH 2W0NA 3N97A 2YSRA 2E34A 4V19K 2D1VA 2VJ5A 3O6BB 1S67L 1EA3A 3ICYA 3M2JA 3PXPA 3TDUC 4GB7A 2HOTA 4XKCA 1GVJA 1MMGA 3KP6A 3NWSA 2UV0E 1LE8B 4RYEA 1MBJA 5E20A 2PDRA 2EZHA 2P7JA 3IV5A 2CQ7A 5L07A 2KJBA 1Z09A 3NBLA 2HGVA 4U7DA 5FATA 1XPXA 1U5TC 4BQAA 2H6BA 3LOCA 1SD7A 3TMOA 2P74A 4WM9A 1X4OA 3C2HA 4KUMA 1K78A 2Y9YA 4IKFA 3M6BA 3HUOA 3NCKA 4X6TA 5ILSA 4BXXJ 1Y4OA 2V79A 3GMWA 2MC4A 3IXDA 1FOXA 5L2FA 1YW7A 1F43A 2M45A 3PUBA 2HPBA 4BMWA 3TBIA 4HBTA 4XLNF 1BIAA 1ERMA 4MN6A 4N0BA 1TDGA 2NVYJ 4J01A 4GRIA 2BY0A 4P55A 1H9GA 3BR6A 3I3LA 3KZZA 4IOCF 1RESA 4M3EA 1ZH5A 3BPXA 3ASNH 3HSFA 1G4DA 3PBOA 4MCWA 1XX2A 2EFOA 2XB5A 2H09A 1JXSA 1XJ6A 4DZJA 3BZ6A 4UHTA 4BS9A 4FX0A 4F92B 2DFFA 1K83J 2R7DA 4PGHA 3K9TA 3QOEA 4R79A 3CCJI 1IJWC 1MY8A 4GD6A 4KZ4A 2OAQ1 3TQNA 1FSEA 4DE0A 4EJUA 4RA7A 1ACIA 3V4GA 5D8KB 1JTYA 3HRTA 1HZOA 5GLCA 3KSGA 4GCZA 5E2GA 2HNHA 3T4OA 4ESPA 4R3BA 1FT9A 1ETWA 3RPQA 4WL9A 4NNJA 2ZSIB 3A02A 3GW2A 1G6OA 1Z6RA 3F1OA 4MDZA 2Y2IA 4H6JA 4XUZA 5GHXA 1PZPA 4YIRX 4YFKF 3G4SI 3UE3A 1OR7C 2EB7A 3G35A 3T8RA 4OWRB 4M74A 5CTNA 4MGRA 1FP1D 1ES4A 1K79A 2P4WA 1D1JA 2A5WA 4A3GJ 5EDNA 2DMUA 3QP6A 1STZA 3D9YA 5KAIC 4CH7A 3S14J 1JGGA 2ELKA 5E1ZB 4I3AA 4XUXA 3ZCZA 3GTJJ 3Q82A 1ETVA 2IP2A 2KIMA 4TV7A 2HDDA 4ZDOA 5FKKA 1IN7A 9ANTA 2JBFA 2F4IA 2XHKA 3E97A 4Y3IA 2DMPA 1NK2P 1A04A 1TS6A 1VZ0A 1Y8QB 3S2DJ 2DJIA 3GLXA 2XFTA 5L3FA 3PBSA 3K69A 4CUGA 4CZZA 4DZPA 4KA4A 2ZXHA 4X1MA 3DQVC 3E6BA 3F8CA 3ERED 2MFZA 2DFHA 1HOMA 4E3NA 5JFRA 2MH2A 2KL4A 4MQ9F 4IJGA 4IRGA 3CZ6A 1JKRC 3D4FA 4ZJ1A 3GTOJ 4PZJA 5HAPA 1ZTRA 2UV1A 1X1BA 4EQQA 1Z6FA 5CLSA 3ZRGA 4PM9A 3O3KA 3QU3A 1MZUA 4HX4A 4ENMA 2J80A 2OZ6A 2ZC7A 2EPFA 1I5QA 1OTIA 3UR3C 3WTXC 2ZBKA 1MDMB 3HL2A 2HXIA 1YMXA 3KSHA 2KLOA 4R0QA 2XR0A 2VKSA 1YLYA 4RLFA 4M9SA 5EZHA 3UB7A 3M8JA 1XGOA 1FILA 4DDSA 1TL8A 2KMUA 1I6HJ 3MKFA 1PW1A 3CMZA 1K54A 4ZJZA 3F0CA 2Y2JA 1TW2A 1UG2A 5EF6A 4FETA 4WF0A 2VBZA 1W8QA 3IKVA 1GT0C 2EV5A 4A6EA 1NWZA 3SH7A 5DVAA 2ZC6B 5HAQA 1MZBA 4GZBA 2QENA 3LSHA 4IUKA 1W5CC 2HDWA 5DM6F 4JOMA 4KYWA 1OCRH 5HWVA 3EYIA 3KEQA 1JUSA 1E2XA 4CLCD 2AXTC 3R4KA 4WF2A 4NUBA 4D0PA 2XRLA 3ABMH 3MZHA 1NY0A 3J80Z 5EM0A 4N9IA 5KVRA 5DF8A 2BHZA 2COMA 2FMLA 3ELKA 3AL0B 2RV8A 2W3HA 5AJGA 2D5VA 3VOYA 4ARZB 2ELJA 3ABKH 4KUOA 3G1MA 4BQMA 5IY5H 2Q2EA 1HLVA 1UFMA 2EBIA 3BY9A 5D5XB 1LJ9A 3JPUA 1OLTA 2EQRA 3WTZA 3LFVA 4L9EA 1NYMA 4R1GA 4G6TB 3E2LA 2QQAA 5IP9J 3BQ8A 4NBQA 3TW7A 4S0HB 5G18A 3BR5A 4JX4A 1MBEA 1XD7A 2JVGA 4KIGA 3KFWX 3G32A 1GXQA 1LHYA 4EWFA 1VF9A 5CXWA 3PNTA 3EPZA 1TDLA 4NXEA 4B44A 4D60A 1HVBA 2CUEA 1TQMA 3FXLA 1OYIA 3NY4A 4MBHA 2PQ8A 4DE3A 3C7UA 2ZCWA 1KGFA 3GX4X 1Y54A 4K0WA 3BQZA 2O8XA 3H9JA 1C0WA 3A3FA 3FBIB 1L0FA 2ZM0A 1ZRDA 2IXSA 3DTMA 5FAOA 3HG9A 3E4OA 1BULA 1IFQA 4WBGA 1B9MA 2P81A 2Z16A 2LFBA 1J9MA 5JLXA 1DU0A 1TF1A 3V5MA 3H9QA 1NYYA 1YTYA 2GIVA 2RKHA 2R9WA 3P09A 1ONVA 2LMDA 2QZ8A 3E7LA 4M3FA 3EQUA 2PI0A 4M4XA 3RQIA 4D7MA 4JGQA 1NRJA 3LY4A 1X1CA 2JC7A 1KDWA 4OQ0A 5AIQA 3JRCA 2J3WA 4ZYEA 2O9AA 2V0WA 4DIQA 5AQAA 3J7AO 4E6WA 5E43A 2FOWA 4XRSA 1FIPA 3MZDA 3LEQA 4I3JA 4Q0JA 1P9RA 3CDIA 1XJ3A 3P9KA 4NC8A 1UZCA 2GQQA 1GHCA 5CX7A 2P9VB 4NK3A 4C6YA 4BU2A 3OV8A 3F22A 2Z9OA 2G7HA 5TBMA 3A3IA 3RYPA 2DODA 3EUHA 3E0JB 3T5XA 3HOZJ 1ITYA 1XC5A 3OMYA 1MBLA 2B0LA 1VQOI 3IH8A 1ZG3A 1L0DA 4YINA 3OS0A 4PCQA 2Y69H 1TZLA 3ZGKA 2WTEA 4JX6A 3H0DA 1ZTUA 5FSRA 1LVKA 2EV6A 2E1OA 1QA6A 3QAHA 2XA7S 4G3VA 1X0OA 3LSRA 2A6TA 3E1SA 1YLPA 1VQQA 2WUQA 3AAFA 1MSFC 4JXWA 3ZHHA 2NVUB 1D0YA 4XR6A 3W6VA 1P4AA 1XJ4A 1S3JA 3FM5A 3B33A 3ISGA 1NTCA 3O3VA 2LVSA 2L9SA 1WJDA 1IO2A 1MJ9A 2KRHA 3QYFA 5HLGA 2R5YA 2H5SA 3CI6A 4XRFA 2X85A 4KN7X 4UUTA 1XJ2A 4WLAA 3IBRA 3DLLF 3DKYA 4OOMA 3WTSC 2DA2A 2OUMA 3NDGA
chains in the Genus database with same CATH topology
3E5UA 2CWEA 3LAPA 2AXLA 4LK1F 3J81K 3CLOA 4KDPA 2X4HA 1Z7UA 3Q9SA 3QP8A 1YFHA 4G94A 1TLHB 2R3SA 3CUQB 2NRAC 5BMZA 1H0MA 2WWYA 3IX4A 2EV0A 4I09A 3RYRA 5TJJA 4BNCA 3EDPA 1I5ZA 2L4AA 2EFPA 2AS5F 4I0AA 3DP7A 2H94A 4NB5A 1R5GA 1XB4A 1ZHFA 3KLOA 3VB2A 5K5QA 4UVBA 3PQJA 3CDHA 3I0TA 2MLKA 4ESJA 1E17A 5D6EA 1LDDA 5HDKA 2DQLA 4CHUA 4AD9A 1KU2A 1R22A 4IRIA 2DU9A 3CUQC 1B4AA 2RQPA 3K1NA 3JAMK 4RB1A 2F5FA 3BDDA 3E6DA 4RB2C 2EFNA 1H9TA 5CVVA 4L9TA 1WRJA 3T8TA 3MQ0A 3K2ZA 3TOAA 1P2FA 5E1WA 3ECHA 2VOPA 4DQ2A 2PG4A 1FWZA 2A5YB 4LB6B 4ON0A 1NHAA 1W7PB 2JPCA 5CVUA 4RAYA 4GXOA 2ZMEB 2O0YA 4WWCA 4I2OA 1RUOA 2CQKA 1FC3A 3C18A 2P6TA 3U2RA 2BGCA 1V3FA 3F8FA 2STWA 3FMQA 2OQGA 4A0ZA 4EGZA 1CF7A 3KP2A 2W24A 1IXCA 2UWMA 1HXDA 1ZRFA 2BV6A 1KU7A 2EA4A 2GAUA 3OOPA 1FPQA 5DUIA 3ZMSA 1HKTA 2LSOA 5DD4A 1LNWA 2VODA 3LSTA 3C3WA 2VC1A 1V4RA 4WXDA 5ERIA 1ZG1A 3VEPA 1FBSA 1B59A 3WTTC 1EH6A 4CGZA 5HS7A 1OPCA 3KCCA 3JW4A 4UNOA 3F8BA 4ENJA 1Z05A 3WTUC 1ZG5A 3LA7A 3BJ6A 2DK8A 1ZN2A 2DPDA 4O6JA 4YIIA 4LMYA 1USSA 1JGSA 5BOXA 2NNYA 3GFJA 3NQOA 1REPC 2ESNA 5FFZA 2G7UA 2PMHA 1UB9A 3QPTA 1FNNA 3E6CC 4LGWA 4EJTA 3V8LA 1MD0A 1DDNA 4ENKA 1SD4A 2KRFA 4U0YA 2K86A 1FSHA 5F64A 2JSCA 2F5CA 2BE5F 4Y15A 1DPRA 2HZTA 2HQRA 2HGCA 5A2QZ 4A0XA 2RC4A 4GGGA 3O2PE 1YIOA 5ICCA 3RIRA 1TQIA 1Y0UA 3RTRA 3WTVC 4FX4A 1KA8A 2FRHA 1S6LA 1PDNC 3GFIA 1CGPA 4LG0B 2HKXA 4QWQA 2GA2A 4LFUA 3L2CA 2M1BA 1FYKA 2IPQX 2YPRA 2V1UA 3G3ZA 2Q0OA 4KT5C 4LK0F 4M71A 2EJRA 1B6AA 2JPBA 4WCGA 4FHTA 1O3QA 1IN5A 3ZN1A 5ICFA 3EYYA 3NRVA 4M72A 4KFCA 4G8XA 2WC2A 1J2XA 1U6GA 3ZPLA 5LHHA 2V9VA 5K5RA 5E8IA 5EEGA 4PDKA 3W6JB 3HIFA 1O3SA 5BPIA 2L54A 2E7XA 4MHGA 3FXUA 4ZYDA 4O5VA 2HDCA 4HX7A 3R0JA 2E1CA 1OKRA 1ODDA 3PFIA 2GXBA 1W7PD 4L9VA 4KNYA 4OIRF 5LEKA 4G6QA 2PLYA 3F6VA 1WWXA 1USTA 3F8NA 1IN4A 1RI7A 3BJAA 5DCFA 3KP7A 3SXYA 1ZGAA 5HDGA 1OMIA 4UV9A 5F6FA 2LKPA 1YS7A 2UXXA 3U9GA 3V7CA 3SZPA 2E7WA 2QQBA 1J75A 3GF2A 3M7GA 3IRQA 1BI1A 1T2KA 1FBQA 1TNSA 2VT2A 3QOPA 4HA8A 3HHGA 2KIUA 2QLZA 3QP5A 3W6KB 4EVIA 1UCRA 2HYGD 2XV4S 4YFXF 2ELHA 5CJ9A 2MBFA 2DBBA 4CO8A 3LQQA 1P4WA 2D1HA 2XKPA 1LVAA 1RIOH 3MCZA 3WODF 3WU0A