3QP5A

Crystal structure of cvir bound to antagonist chlorolactone (cl)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
251
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
molecule keywords CviR transcriptional regulator
total genus 59
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qp5A02
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp5A01
4NQWA 4G9YA 4KA4A 2V79A 1UFMA 5CLSA 2P5LC 1FC3A 2X4HA 3L00A 3F21A 4O3MA 3QU6A 3IC7A 2W85A 3HRTA 5DCFA 5BPIA 3H3ZA 4MNUA 3IX3A 3VOEA 1I27A 3CUOA 5DUKA 3C7JA 3RKXA 1I1SA 3QAHA 4IRHA 4QWQA 1W5SA 1OYIA 4EMSA 3PQKA 3CJNA 2FNAA 4FHTA 1YW8A 3V7RA 1USSA 2QQBA 3GLXA 3K1MA 4PZJA 4G7OF 3QRFF 1XD7A 1H9GA 5K5RA 1YW7A 2K27A 3MWMA 1G3YA 1KU7A 4WXHA 2P6TA 2L54A 3IWZA 1YW9A 3P7NA 5E1WA 4Y13A 1HXDA 4LB6B 4UV8A 3HYIA 1SFUA 5HS8A 1IF1A 2PG4A 4KMUX 3BY6A 2P4WA 5L07A 2IA2A 3QOPA 4OINF 2UV0E 2XIGA 2KJCA 3S2WA 4CYDA 2QQAA 2WTEA 5EEGA 3ECOA 3KP3A 4R79A 3DPLC 5IT3A 1BC7C 3EUHA 2PI0A 3V8KA 1CGPA 5ICEA 2PN6A 2Z9OA 1IZ1A 5D4RA 3FMQA 1R1VA 1K79A 4L0YB 2HS5A 1T0FA 4RB2C 3E5UA 3I54A 4U0WA 3TO7A 2XAHA 4Q4ZF 1SFEA 4U7DA 1J9IA 3SXYA 3MZHA 3FM5A 2WV0A 1KU3A 1K78B 2IJLA 5ILSA 2Z99A 4BQAA 3K1NA 1YTYA 1R23A 3SQNA 2KIFA 3WTSC 4U0YA 1KU2A 3J7AO 3C18A 3F22A 2VC0A 4ON0A 1ZN2A 1W7PA 3WE3A 2M87A 2A61A 2IW5A 1TW3A 2XAJA 3RI4A 1MJBA 3M7GA 5FLXZ 5L3DA 3QPTA 3RIRA 5FLXK 4BAYA 5JR3A 4G8XA 1IXCA 2R7DA 1XDUA 1HW5A 2HTJA 1FOKA 2M5WA 1LEAA 1HKTA 4UV9A 5ILUA 1IXRC 4PGHA 1ZGJA 3HTUA 2Q8KA 4UVAA 5ICFA 3MCZA 2HQNA 2JPBA 2ZBKA 3M8EA 1O57A 2A69F 2ACJA 3P9IA 1QO0D 3ZMSA 3TQNA 3BP8A 4IPAA 4EJUA 1R7JA 5HLIA 5LRSA 3LA2A 1QBJA 2LF7A 4KUMA 4ENKA 4RGUA 1YQAA 3T1BA 3ZPLA 1QGPA 2W25A 4IJAA 4HLYA 2X0LA 4A6DA 5J8CA 2L4AA 4MEXF 5CYVA 2P8TA 4XSXF 5LHHA 2RVCA 3HRUA 4EM2A 1FT9A 3R61A 2PEXA 1QQIA 4DNCA 5KVRA 5DD4A 4ETSA 4L9TA 5TJJA 2HYFA 4WF2A 3WTVC 3WU0A 4IRGA 1S7OA 1Z6TA 2ZNZA 4YFXF 3HSRA 3ZMVA 4ENJA 2YSRA 2V1DA 3EETA 3WTZA 3TO9A 1FWZA 1KYZA 4M74A 3F23A 1ZGAA 2M45A 3HOTA 2VBWA 4I98B 1ZLJA 5D6EA 4LGWA 3F3XA 2O0YA 3IKTA 2E1NA 2A3SA 3K1PA 5LEKA 2FMLA 3GFIA 4EJOA 5JI6A 5D6FA 3FHZA 2PFBA 5CVRA 4MGRA 1IN6A 1PP8F 1G3WA 4HAMA 1QZZA 3HRSA 3WODF 1LQ1A 3M9AA 3H92A 3JSPA 4AIKA 4KICA 5LGUA 3ZN1A 4L9JA 3R0JA 1FYMA 3OOPA 1ZG1A 1D8JA 1TLHB 5JFRA 3E6MA 2FEZA 2B0LA 1TBXA 1B1BA 3N4MA 1ZRDA 1FBUA 5E20A 3E97A 4LG0B 3LQRA 3OV8A 3KEQA 4A0XA 1P4AA 2MA3A 2M30A 4KYWA 3F8BA 2EFOA 2MH2A 2RNJA 3REOA 3CLOA 1F1ZA 2QZ8A 1ON1A 2O8XA 1BI0A 2GQQA 2P7CB 4ZYGA 2D2WA 1R5HA 2DO7A 1GHCA 3U2RA 4UHTA 5HLHA 4PDKA 3KP4A 2O03A 4EGZA 3JSOA 3C1DA 4OMYA 3K2ZA 3B02A 1G4DA 2CSOA 2KIUA 1WSUA 6PAXA 1ULYA 3BROA 3LA7A 1LDJA 1KQ0A 5ICGA 5D8LB 1RI7A 2EFQA 2XVCA 2CO5A 3G3ZA 4JK1X 4WCGA 5F1RA 2Z5UA 5BMZA 5JVTA 1J0RA 5FFXA 2MLKA 2HOEA 1CF7B 4MEYF 4ZH4F 3T8TA 1KU9A 3DQVC 1JHHA 1S3JA 1SD4A 2A07F 4KDPA 3JAMZ 4I09A 4OIOF 4ZYHA 3GZ5A 2GXBA 4QLCU 5H20A 2CWEA 3F8MA 3RYRA 3V4GA 1TQPA 3K9TA 3GFJA 2ZXJA 1EH6A 5H6RA 2ESHA 5IT9Z 2G7UA 5DDGA 3V7CA 1G3SA 5BPDA 2RQPA 3WTUC 3GUDA 5HVQC 2DU9A 1Z05A 4S04A 3ABTA 2M8EA 1YO5C 2V1XA 4TV7A 2E1CA 3BJAA 2LF8A 4K2EA 2VOPA 1B6AA 4KIFA 3RKWA 2KJBA 4H0EA 4G6QA 1TQMA 2UXXA 2F2EA 4KNYA 2WC2A 1BIBA 2DK5A 5AIQA 3JTGA 4G7HF 1Z1DA 4EVIA 4S05A 3HOSA 2LSOA 3ZMTA 3GW2A 3KP6A 2Z33A 1WWXA 1MJAA 1IXSB 3GYHX 1W7PB 3ZMZA 5FO5A 2D1VA 3WTYC 1E2XA 1OKRA 1I1GA 1R58A 4FX0A 4HW0A 4HF1A 2QQ9A 1EH7A 3O3KA 3I53A 4L5IA 1HSTA 3EDPA 2OD5A 1AWCA 4HBLA 4RGSA 4OIPF 4L5JA 2VBZA 1KA8A 4EM1A 4RAYA 3RKYA 3DFGA 2W84A 1SD5A 3TDZC 1J59A 2TDXA 4N0BA 2ZFWA 3RDIA 2FBKA 1I6XA 1UHMA 4MTDA 2RN7A 3F8FA 3QP2A 3F72A 2KRFA 2ISZA 5LEJA 1MDMB 2YU3A 3W6KB 4I0BA 4XRFA 4KT5C 5DCMB 5LHGA 2EFPA 1PDNC 3VEPA 1HW1A 1OR7A 5CVUA 5L3GA 3IL2A 1C0WA 3ZP5A 1XGNA 3RJPA 5A2QK 5A2QZ 3J80K 2A68F 2IPQX 1REPC 3ML6A 3IRQA 1LEBA 1NHAA 3FF5A 4LD5A 3ELKA 2PJPA 5DYMA 3LWFA 5AONA 1ZARA 3TOBA 3ZMDA 4ZZDA 2PQ8A 1MJ9A 1DPUA 2FOKA 4KIBA 1WRJA 2XAGA 2EJRA 3HIFA 2NNYA 5DCMA 2EWNA 2W24A 2L02A 3ZN0A 5FD6A 3I58A 5F6FA 1I5ZA 3DF8A 3DP7A 1KQ9A 1D5VA 1IN7A 2EV5A 3QP4A 4L0ZB 3N97A 4CHUA 1DP7P 2OBPA 1U5TB 5K1YA 1U78A 1P92A 1SD6A 1Z7UA 4RAZA 3W6JB 4EJTA 4Y15A 4L9NA 1IAWA 2XKPA 4Y17A 1Q1HA 2GAUA 1T6SA 5DV5A 4ESFA 2GWRA 3RTRA 2MBFA 3L2CA 1BBYA 1FBSA 4EV0A 4HV5A 2P5KA 4M9XA 3HHHA 1R5GA 1GXQA 2IA0A 5CVJA 1IW7F 1TW2A 3IHUA 4HV6A 3R0AA 4U0VA 2LNBA 1LVAA 4Q47A 2LKPA 4XLPF 1MGTA 5H6QA 3U9GA 2ZJ2A 2EFNA 2DI3A 4P9FA 4UNOA 5LGNA 3QP6A 3GX4X 3WG9A 1R36A 4I7HA 3BWGA 4A0ZA 4BHCA 1HW2A 3NEUA 2YX4A 4HX7A 4G94A 1UB9A 3DV8A 2H27A 4OIQF 2DT5A 2QVOA 2XKOA 3GFMA 3SFZA 1Y0UA 3V7SA 4LG0A 1IRFA 3HSEA 1U2WA 1U3EM 2OA4A 3HUGA 3FXRA 2JT1A 1F5TA 1EH8A 3LAJA 2AXLA 4MQVA 2ZNYA 5E1XA 3I71A 4RS8A 2H6CA 2BBYA 2QUFA 1TTYA 4I02A 5HOOA 2IRFG 2FQ3A 4IRIA 2QYOA 2UZKA 2XRNA 4EGYA 1GXPA 2VE9A 2ISYA 2ESNA 1T39A 3EQLF 4YG2F 2FMYA 3F6OA 4KN4X 4N9IA 2FA5A 4PGGA 3M8FA 2PMUA 3BPVA 4ASNA 2P5VA 5L3EA 1ZYRF 5EEHA 2P7VB 2W57A 3FZVA 5J8FA 4U7BA 5IT9K 4RB3C 5HDGA 1TNTA 2IP2A 1LNWA 2IT0A 3E6DA 1FP1D 2R3SA 3J81K 1Z91A 2YR2A 1FBQA 4F7ZA 2O6GE 2FU4A 2V9VA 4M73A 1O7LA 1WQ2A 3VFZA 4GYGA 1XMAA 5K5QA 4G6DA 3DXJF 3QP1A 2NNNA 2DFIA 4M72A 5TRDA 4Z2YA 4CO8A 5ILVA 1R22A 2F5DA 5L3CA 5ED4A 3BPXA 2J5OA 4A6EA 2QBYB 1L0OC 2JPCA 2RDPA 3Q9VA 1W7PD 1R1TA 3BOQA 3KEOA 5D5VB 5HDNA 5CVIA 2K4BA 1BI2A 1OPCA 4P55A 2DK8A 2K7LA 1P2FA 4B09A 3GVAA 4LLGF 2VBXA 1MKMA 2MLGA 1XGOA 1K7AA 2ZO4A 4RGXA 3TKYA 4EJWA 1DDNA 1USTA 2V6CA 3BDDA 1BM9A 5HDKA 4M6XA 3I59B 1RUNA 2OU2A 2FRHA 3Q9SA 1B4AA 1FZPB 1J2XA 2O3FA 4RGRA 1XCBA 4XSZF 3EYYA 3O2PE 4MHGA 3F6VA 2ZMEA 2Y48A 4ZYDA 4BYYA 2Q0OA 5L10A 5L3FA 3P9CA 1B9MA 3AAFA 1SFXA 1SMYF 3MEXA 4HLXA 3GXOA 2H09A 4UXNA 4N9HA 1BOAA 1IN8A 2WWYA 4Q48A 3ROUA 3TOAA 3T0YA 4O6JA 4IHSA 3G73A 5E8IA 3ISPA 2HTSA 5HS7A 4BHBA 1O3QA 1ODDA 1ZG3A 1UCRA 2KKOA 5E1ZB 1IRGA 2FF4A 5BS6A 1ONVA 1T38A 3FM3A 1IN4A 2XUBA 2VOOA 1ZHFA 1F9NA 2DBBA 1HKQA 2MD5A 2XV4S 4U88A 5ERIA 3I59A 1S8NA 3IWFA 3FXQA 1UHWA 1STZA 1WKMA 5L09A 4AIJA 1U8RA 2DQRA 4GGGA 3KCCA 4L9VA 1BJAA 3WTTC 3KZZA 3B73A 2XAFA 4FX4A 1TQIA 2EK5A 4HDUA 4KN7X 4OU0A 3GWZA 2Q2EA 2BE5F 3CUQC 4R8HA 4UVCA 2F5CA 2K4JA 1R1UA 1XSXA 4BNCA 1J75A 3LAPA 4LMYA 1HKSA 3WE2A 4JBAA 4A5MA 2XHKA 2K86A 3QPHA 1A04A 3T5XA 1YS7A 4HF2A 2P6SA 1KQ8A 4WX9A 2BGCA 5HS9A 2ADUA 5D5WB 4CGZA 2OZ6A 3T8RA 3M1EA 1HQCA 2HDCA 4NG2A 4HYEA 1RZ4A 2HZTA 4CDGA 2OQGA 1XCVA 3I64A 3LFKA 1QPMA 2HYGD 3J81Z 3WGIA 3ECHA 3GF2A 1LB2A 1U5TA 3KP5A 3V8JA 4ESJA 1W5TA 2HWVA 2GIVA 2VC1A 3NQOA 4P5OA 1R00A 2ELHA 1XMKA 3ULQB 2L4MA 5CVVA 2NAZA 4LB5A 1KGSA 2RC4A 2PLYA 2XGXA 3FX3A 3Q5FA 1GVJA 3R6SA 3K69A 4JQFA 3WGHA 1HSJA 3CUQB 3E6BA 3MFKA 2NYXA 1LDKB 2MH9A 4XBFA 1HBXG 5FD5A 3EYIA 4KIGA 4ZYEA 1OMIA 2Z3YA 1B9NA 3HSFA 1YIOA 2V1UA 3HHGA 1XSVA 3GEZA 2DQLA 5E8GA 2HGCA 3CTAA 4CZZA 3KP7A 3PFIA 2OQRA 1OYWA 1Z6RA 3IKVA 4OMZA 2RKHA 3HRMA 5HLGA 4A12A 3NRVA 2STTA 2G7HA 3I5UA 3E5XA 1BN5A 5ICCA 1E17A 1FX7A 2YPRA 5DEQA 3RYPA 4RB1A 1FYKA 1CF7A 2CW0F 3JPUA 1MDMA 4YFKF 2VBYA 4LK1F 4HOBA 3KLOA 2UWMA 4G7ZF 5CJ9A 4UVBA 4WXDA 2EA4A 3JTHA 2VT3A 3CO6C 2L3DA 1XDSA 1MD0A 1K78A 4WWCA 5D5UB 3GO5A 3H3UA 1JXSA 4ESBA 1MZBA 2HR3A 2VE8A 3CUQA 1TNSA 1DUXC 3CO7C 4HQMA 3L09A 3J80Z 4CXFA 3JW4A 4MTEA 1EV7A 1F4KA 1YS6A 3U1DA 3FMRA 2A6EF 5LGTA 1FY7A 1ON2A 2DPUA 3L7WA 2UXNA 2JTVA 4GXOA 5K5OA 4HX8A 2HEOA 2A6HF 4KFCA 1V4RA 5E17F 5LHIA 2AVXA 3D5LA 3LA3A 3PQJA 1JHFA 1ZG5A 2L01A 2GA2A 1O3RA 3LSTA 3MZYA 4AD9A 4ENNA 1FYLA 4HDVA 3IRRA 3WTXC 2CYYA 2QBYA 2IA1A 3KE2A 5LLQA 4ENMA 4UUVA 2HFHA 3IX8A 1J5YA 1VTNC 2DAOA 3GZ6A 4KMFA 3ABUA 1O3TA 1P4XA 4HF0A 2JRTA 2DW4A 1B59A 3F8CA 2DPDA 4MQ9F 2K02A 4FT8A 2YX7A 4HX4A 5LRRA 2LDUA 4M9ZA 5FFZA 4L18B 3SHFA 1ZREA 4I0AA 2O61A 5D8KB 3IX4A 4A2UA 4A5NA 5BQTA 2ZKZA 2IVMA 2QWWA 1IUYA 3QP8A 4M71A 3ERED 4P96A 1P6RA 1V3FA 2QM3A 3BZ6A 3DKWA 5L3BA 1XGSA 2DLLA 2RGVA 3P9KA 4O5VA 5FB2A 2XASA 2QLZA 4WK8F 4XLNF 3F8NA 4LK0F 3E6CC 2VODA 3VB2A 1D3YA 3V8LA 1P4WA 1DPRA 1H9TA 1Z9CA 4IVNA 4HQEA 1SAXA 3HTSB 1AOYA 1BI3A 1ZRCA 3SZTA 2HKXA 2F5EA 2JZYA 1FPQA 3CDHA 4EM0B 4OIRF 1YYVA 2J5PA 1QNTA 1PP7U 4B8XA 4IHTA 4GCVA 2OAZA 5DD8A 3RPUA 4Q5SF 1XB4A 5D4SA 4BHPA 2FXAA 1ZLKA 1SMTA 5D5XB 4ZZLA 4LJZF 1SD7A 2NRAC 1LJ9A 1KYWA 4EQQA 4GYIA 1YFHA 2C6YA 1FLIA 3MQ0A 1G6NA 2CQKA 2QENA 2EFWA 3I4PA 3WU1B 3SZPA 4YFNF 3WTWC 1QZYA 1ZRFA 1T2KA 3TGNA 2FNPA 4R1HA 3KFWX 2GXGA 1LDDA 2VXZA 2D1HA 2F5FA 1ZH5A 1O3SA 4M6YA 3QP5A 4YIIA 5LBQA 2CG4A 4RB0A 5J6XA 1T98A 3R4KA 2ZMEB 1IN5A 4NHJA 1U5TC 4P9UA 2VONA 2PBIA 3BJOA 3WGGA 2AS5F 4BH9A 2E7WA 3D0SA 2XROA 1U6GA 4YIFA 2EA2A 2D45A 4I01A 1FNNA 4IXAA 3COAC 4E70A 1BC8C 3C3WA 4PCQA 4EJVA 1O7FA 1FP2A 1FSEA 2CFXA 1H0MA 2EV0A 2MC3A 1RUOA 1D8KA 2GA1A 3FXUA 2JSCA 5BOXA 1JGSA 1S6LA 4BXUA 1RIOH 1OYYA 2XAQA 3TDUC 3GFLA 2BYVE 1FSHA 1S7AA 2FE3A 1XN7A 2VN2A 2FBHA 3TO6A 2PMHA 3DEUA 2KIMA 1G3TA 2VT2A 3KLNA 2FBIA 2HKOA 3MAJA 3R60A 3BJ6A 3VODA 4AVPA 2BEOA 2M1BA 2H6BA 2ZCWA 3K0LA 4OOIA 5E18F 4AWXB 1PUEE 5DUIA 3E3VA 3KETA 4LLLA 3ZMUA 4M9SA 3RPQA 2G9WA 5JHUA 1JE8A 4WXCA 2DTRA 1S29A 3I0TA 4CICA 2ETHA 5AIPA 2OZUA 1XSDA 1X3UA 4DQ2A 2EV6A 2Y0MA 5KK1A 4HZFA 1WI9A 1L3LA 2R7FA 2NS0A 2COMA 4HA8A 1BI1A 3JAMK 1YG2A 1ZAOA 5F64A 4IF4A 4A0YA 1K6OA 3L9FA 4D0PA 4NB5A 1RNLA 3ZQ7A 2CGPA 1W4MA 1BIAA 2H94A 1J7KA 2GZWA 3FWEA 2Y75A 5FGMA 3FMSA 4LLNA 3DPTA 2FSWA 4AIHA 3O6BB 3KP2A 2A5YB 1YLFA 4GO1A 3LQQA 3E5QA 3KZYA 2E7XA 2RV8A 1XGMA 4I2OA 3QU3A 2BV6A 2STWA 2EB7A 4LFUA 2HQRA
chains in the Genus database with same CATH superfamily
4XNFA 3F0CA 4NQWA 1XC5A 4MNRA 4G9YA 4K08A 4KA4A 2WKIA 5J40A 2V79A 1UFMA 2ZSHB 5CLSA 4XMYA 2P5LC 2WZXA 1FC3A 2R78A 3MF0A 1P9QC 4ZRRA 3LNQA 2X4HA 3L00A 4BXXJ 1DGRM 5FKMA 3KYQA 2Y2NA 4PJLA 5IT5A 5A93A 3F21A 4O3MA 4E3JA 5FKLA 3QU6A 2WYXA 3IC7A 2W85A 5EF6A 1ESUA 3N8LA 3HRTA 5DCFA 5BPIA 3G2YA 3S1YA 3H3ZA 2DCFA 2K9MA 3DKXA 4MNUA 3IX3A 3VOEA 3C38A 1I27A 2ZM8A 3CUOA 5DUKA 1MMGA 2JN7A 1BOBA 3C7JA 3RKXA 1I1SA 3CAXA 3LI8A 2P81A 1K6RA 3QAHA 3OL4A 4IRHA 4QWQA 4EW7A 3MXRA 4FOFA 1DU0A 1W5SA 3EWKA 2EINH 4LRYC 3K7AJ 1OYIA 4EMSA 5DM7F 2H8WA 3C7VA 2PJRA 2Y9YA 1N78A 3PQKA 3CJNA 2FNAA 4FHTA 1YW8A 3V7RA 2Y31A 4E6KG 1USSA 3K70D 2HPMA 5GLBA 2QQBA 1PI5A 3GLXA 4PKYA 1IC8A 3ZG8B 3K1MA 4PZJA 2DOEA 4G7OF 5FLVA 4BL3A 2ICWG 4Y3OA 2ME6A 2NVYJ 3QRFF 5CEBA 2B9SA 4GW9A 3P98A 5IP7J 3MBZA 2R7XA 1ZG4A 1XD7A 1PYYA 4ZDXA 2IEKA 1H9GA 5EYRA 1KVLA 5K5RA 2OAQ1 1ETWA 3K3CA 1YW7A 4GJ4A 3OY9A 3CP8A 4IUKA 3T4KA 4BQOA 4FETA 5M19A 3G34A 2K27A 3ISGA 3MWMA 2XGEA 4JLFA 3W2WA 4DF6A 4O8GA 1G3YA 1KU7A 4WXHA 3NECA 4E04A 2ZMFA 1WI3A 2P6TA 2ZXIA 3QPLA 1E4DA 4A3KJ 5FDSA 3OR1C 3RJUA 2L54A 4DZPA 5F69A 3OIPA 3L2UA 2P9VA 2KDZA 1T0FC 3IWZA 4BQQA 5M3MJ 1I5QA 5A91A 1YW9A 3GDIA 3OYDA 1B8IB 3P7NA 3O87A 5E1WA 4Y13A 2H1KA 1GSVA 4JXVA 1HXDA 3C2WA 1ORKA 2VLAA 4LB6B 4UV8A 2K85A 5EGOA 3HYIA 2XSJC 1SFUA 1W79A 5HS8A 3TJZC 1IF1A 2E5NA 2PG4A 2IGNA 2M7AA 5GPAA 3BYDA 4GD6A 4KMUX 1JJ6C 5M18A 5AJGA 1Y1WJ 2DODA 3I9V2 3BY6A 3KSFA 2P4WA 4XUXA 1LL5A 5L07A 2IA2A 3QOPA 4OINF 2UV0E 2XIGA 2BASA 2KJCA 4HG2A 2BXYA 4HNVA 2H0TA 3S2WA 4EATA 5FQJA 4CYDA 5DKLA 2NS7A 2QQAA 2WTEA 4MFEA 5EEGA 4S2JA 3ECOA 3KP3A 4R79A 1WFXA 3DTEA 4UUSA 3DPLC 5IT3A 1SANA 1O4XA 1BC7C 5HNFA 3EUHA 3PJRA 2KDKA 2PI0A 1AU7A 3V8KA 4M3GA 1NXYA 2Y59A 3UKGA 3IHBA 1CGPA 3H5AA 4KZ3A 1E3UD 5DF8A 4A3GJ 1JWZA 2HPBA 5ICEA 4B43A 2IAIA 2PN6A 3PTEA 2JQ7A 2Z9OA 1IZ1A 2VQLA 5D4RA 5EVIB 5L2FA 3FMQA 3J7AY 3H9QA 1BTLA 1WZ2A 2HP9A 3S1RJ 2E71A 3TE8A 3W2VA 4ZTKA 1R1VA 2VX8A 4OOLA 1K79A 3PUFA 3ZG7B 4BY7J 5EUAA 4B4XA 4HESA 1ZQ3P 4L0YB 2K31A 2HS5A 1TEMA 2R9XA 2FJ1A 1T0FA 2BHYA 1S4SA 1XP4A 2DNSA 3G4PA 4CLCA 4RB2C 3L2RA 3E5UA 3I54A 4MIMA 4U0WA 3TO7A 2ZJ9A 2FD5A 2XAHA 1NRJA 3OYNA 1V9YA 2WAFA 3LSPA 3Q0WA 4V2FA 4F3QA 4Q4ZF 1SFEA 4BDZA 4DJAA 1J3WA 2D01A 4G3KA 3M1CA 1UGUA 4F93B 1YLYA 3PO3J 4S2LA 4U7DA 3JVUA 4P87A 1J9IA 3VV4A 1YAXA 2W3DA 2HDSA 1K6YA 3SXYA 3MZHA 4AYBA 4HJ6A 1T56A 2LREA 3FM5A 5EGOB 2WV0A 2WBMA 2QF7A 1KU3A 2EQRA 3WRTA 4RAFA 4XKWA 2NOGA 1JJ8C 1K78B 2OF7A 2IJLA 1N9NA 1W7FA 3ABKH 1YJ9I 3GMEA 2M2EA 5ILSA 1EW0A 4UHUA 1BUEA 3IF6C 2Z99A 3V42A 4BQAA 3K1NA 1YTYA 1R23A 3CHWP 3UY6A 4I3JA 3SQNA 4DRTA 1TP4A 2KIFA 2YS9A 3WTSC 3FYZA 4HH3A 4IEDA 4FD8A 4OOMA 4HI4A 3A0BC 4U0YA 1KU2A 2R0QC 3C18A 3J7AO 5HPIA 4FE4A 3VP2A 4S2KA 3F22A 1VQ8I 2VC0A 4ON0A 2O99A 1ZN2A 1W7PA 2IS2A 2ZLYA 4Y0TA 3WE3A 1G6OA 4PSXA 5HDDA 2M87A 2A61A 3J7ZI 2IW5A 2XGDA 2DA1A 2HXOA 1TW3A 2XAJA 2I8DA 1DGWY 1MJBA 3RI4A 3M6HA 5GHYA 3ZCZA 3M7GA 5FLXZ 5HW3A 5L3DA 3QPTA 3RIRA 1A36A 5FLXK 2FFYA 3M6BA 4BAYA 5KSHA 3V50A 5JR3A 2VLGA 4G8XA 3CJRB 3HGGA 3OYBA 1IXCA 1PIOA 2R7DA 4IZZA 1N9LA 3CWFA 1XDUA 4LCMA 3ZRGA 1OLTA 1HW5A 2K9SA 4C30A 2IGKA 2HTJA 3I4MJ 3IH8A 4PAUA 1DU6A 1FOKA 1Y4OA 2DYRH 1R9TJ 3BFEA 3NJAA 1VQ9I 4FCFA 2M5WA 2L9NA 2X1EA 2QCOA 1LEAA 3ZGKA 1XPXA 1HKTA 4OLDA 2KLOA 4UV9A 3LFUA 5ILUA 1NY0A 1IXRC 2M8GX 1NZUA 4PGHA 1ZGJA 3HTUA 2Q8KA 4UVAA 4ZDPA 5ICFA 4XONA 3MCZA 2HQNA 2D02A 2JPBA 5E3MA 2ZBKA 3M8EA 1X4PA 1O57A 1LPQA 2MYSA 3LY4A 4OQ0A 3HKZA 2LG4A 1I50J 1FMVA 2A69F 3P9IA 4CUGA 2ACJA 2L9RA 2YKHA 1QO0D 2LLKA 2K2NA 4S2MA 3ZMSA 1XKZA 3TQNA 3BP8A 2EXBA 3PNTA 4IPAA 4EJUA 2DXIA 1Q2PA 3JYIA 1R7JA 5HLIA 2Z16A 5LRSA 4A3DJ 4JXWA 4N9KA 4E7IA 3LA2A 1QBJA 1TVFA 3AGDA 3MFXA 3ULFA 1JGGA 3FISA 2VA0A 3S3OA 2LF7A 5K7ZA 1LL9A 3KSGA 4DYRA 4KUMA 3TMOA 4ENKA 1B72B 4PPRA 1QZEA 3PFYA 4RGUA 4KZAA 5A92A 1O7EA 4C2MJ 3LYXA 4KUOA 4A3JJ 3TW7A 1YQAA 3T1BA 3ZPLA 1K57A 1XJ6A 2XGCA 4D1QA 2QSGX 3VP0A 2CQXA 1QGPA 2W25A 3DWLE 4IJAA 1T1BA 4Q0IA 4HLYA 3OC2A 2VGLM 2F6CA 2X0LA 4A6DA 3HL2A 5J8CA 1BR2A 2L4AA 2VGJA 2WAQN 1S4RA 5DTTA 1UG0A 5IOZA 1G68A 1NH3A 4MEXF 4IVKA 5CYVA 3FKJA 2P8TA 2E8IA 4XSXF 2FH5A 2WKPA 4L9GA 4DXCA 5LHHA 1UZCA 2RVCA 5EJCA 4D7MA 1AKHA 3HRUA 3E2LA 4EM2A 1FT9A 5F5YA 2R7WA 1V5EA 3R61A 2PEXA 2FX0A 1PJRA 2J80A 1ERDA 4GHIB 1QQIA 4DNCA 5KVRA 3RFBA 2A6TA 1KDSA 4ZJZA 5E3NA 3MS6A 2ZMEC 4U87A 3S16J 3FPWA 4QY6A 5DD4A 4NXBA 2X6YA 5HAIA 5A90A 3F1NA 4XLEA 4ETSA 2NVQJ 4L9TA 3R7WA 2HNHA 2ECBA 2WGWB 5TJJA 1TS8A 2HYFA 4WF2A 3NHQA 2X1CA 5FKKA 2VV6A 3WTVC 4XLCA 3EPZA 3WU0A 5CEDA 4IRGA 5FQMA 3NI9A 1S7OA 1Z6TA 4NKPA 4Q0HA 2ZNZA 3HOVJ 2CUZA 4YFXF 1WCMJ 4IBXA 5F68A 5JVGF 3MMHA 3HSRA 3ZMVA 1MW7A 1OCCH 4K0XA 1WGXA 3MZFA 5J8XA 4ENJA 5GLCA 2VIXA 3E4PA 2YSRA 1FR6A 2V1DA 5CGWA 4S2NC 4QTRA 1B72A 4A3IJ 3GTGJ 4H8RA 2DYSH 2VJWA 5DF7A 5F0CA 3EETA 1JVJA 5GADJ 3U4LP 1ZELA 3WTZA 4FQGA 3TO9A 2PMZN 1ETKA 1FWZA 2ZQ7A 3HCYA 3U2AA 3ZDJA 4HPQA 1KYZA 4M74A 2QKLB 3UPPA 3F23A 4RMNA 3I7JA 1ZGAA 1HLVA 3EUHC 1WJAA 2M45A 3HOTA 2VBWA 4I98B 1ZLJA 5F6AA 1YSQA 5D6EA 4LGWA 3F3XA 1I2WA 2XDVA 1PVEA 2O0YA 2VXDA 3IKTA 3W8KA 2E1NA 5FKNA 1N75A 2PHYA 2A3SA 3K1PA 5LEKA 1AKHB 1KOUA 3IBRA 2VJJA 2FMLA 4ABZA 2DFFA 3GFIA 1WJCA 2UWXA 4WMCD 4EJOA 2D5VA 4IQJA 3CPTA 5EE8A 5JI6A 4ZDOA 3SEQA 5D6FA 3WG7H 4MDZA 3FHZA 2DCEA 4OPYA 4E7ZA 4WZ5A 4BENA 5CTNA 2PFBA 5CVRA 2OTLI 2TRTA 5GTHC 3QNCA 1HOMA 4MGRA 1HLUP 4FSFA 1IN6A 2BY1A 1JTDA 4XT2B 1W8YA 2OV5A 1D7EA 2JKRI 4GCZA 4AUXA 3LUQA 4OPRA 3AGEA 1PP8F 1G3WA 2QYBA 1TL8A 4J01A 4HAMA 1QZZA 3HRSA 3WODF 2ZC7A 2JJ7A 3IS2A 3IXHA 3T4JA 1IDYA 1IG7A 1M6KA 2ELJA 5IPAA 1RGYA 1LQ1A 2JCHA 3MKEA 3SZGA 2LK2A 3M9AA 3H92A 2XA7S 4RVAA 2XF6A 3JSPA 4AIKA 4KICA 5LGUA 3QYEA 4M4XA 3ZN1A 1K61A 3VP1A 4L9JA 2J3WA 3I56I 3R0JA 1WJ5A 2LTPA 3S8PA 1MNEA 3LOCA 1ERMA 4EWFA 2ZBBA 4WM9A 3G1LA 1FYMA 5AVFA 1ALQA 1SVMA 3K4CA 4X55A 2GOMA 3OOPA 1ZG1A 1D8JA 1TLHB 5JFRA 1X2NA 5IYBJ 4DW6A 1YE9A 2RREA 3OOUA 2V8FA 3E6MA 1OT6A 2FEZA 5GHXA 2B0LA 1TBXA 3BFCA 3F1NB 1B1BA 2BZTA 4WZ5C 1OCTC 3N4MA 1ZRDA 1X3ZB 2W7NA 2FFFB 1FBUA 3BR3A 2V0WA 2CV0A 1XPBA 4HP4A 2KX6A 5E20A 1ES5A 3K6GA 1PWDA 3E97A 2Y2PA 3LQRA 4LG0B 4I5SA 4MN7A 3WS5A 3KEQA 3OV8A 2ZL1A 1SFOJ 3OPHA 3D5RC 3OS2A 4RAGA 3CCMI 3P5JA 4A0XA 4A3FJ 2W1RA 1P4AA 4IO9F 4E7LA 1MSEC 3OPPA 5HL6A 1VQ4I 2KT0A 2K5CA 2BY0A 3DPUA 2CMNA 2MA3A 5KMWA 2HDUA 3OCLA 2M30A 4KYWA 2ZOIA 4CLCE 9ANTA 1YMXA 3LSJA 1WA9A 2DA5A 2ZMVA 4D2OA 3NC8A 2KOIA 4E7KA 2HVSA 3F8BA 1JT6A 3A03A 3OWTA 1R71A 2ZQ9A 3V3RA 5LBRA 2EFOA 2MH2A 2RNJA 3F1OA 2PMZA 3KYEA 3REOA 1CK3A 4JGQA 3CLOA 4XT2A 4B9OA 3UPOA 3TP0A 3ZQHA 1W5DA 2L1MA 4PHTA 1F1ZA 2QZ8A 1ON1A 5J1UA 4B93A 2O8XA 1BI0A 2L7FP 2LB9A 3CI6A 2GQQA 2P7CB 3W2AA 4ZYGA 2VQCA 4NQWB 1SVLA 2D2WA 1LKXA 3RQIA 4V19K 3CZDA 1R5HA 2DO7A 1CI9A 1LI0A 2MG4A 2Z2SB 3PNVA 2AO9A 1MBEA 4WMCA 3S7NA 4Y4RA 4LOCA 3V67A 1XTAA 4YIRX 1GHCA 4R23A 2AXTC 1OFCX 3BR5A 2I10A 3K4BA 4UHTA 3U2RA 5HLHA 1CI8A 3G35A 4PDKA 2RNGA 3HJEA 1ES2A 2ZD8A 3KP4A 3HUNA 5GLDA 1X1PA 3CCSI 3W6VA 3BFFA 1GUUA 2O03A 4MBKA 1UELB 4XK4A 3ITAA 3FKIJ 1Z7LA 4EGZA 4I38A 3JSOA 3C1DA 1RR7A 1Y0NA 1Z21A 4OMYA 4X69A 5J3WA 3OS1A 3K2ZA 2CUFA 3B02A 3Q3SA 4EV4A 3LIDA 1G4DA 4KG5A 2CSOA 1FIKA 2HVQA 4X53A 1SKOA 2NVTJ 1MC0A 1MBJA 1OTIA 2KIUA 1Y28A 2PJRB 4R3AA 1WSUA 1BW6A 6PAXA 3MQQA 1ZK8A 4OPZA 4HNBA 1ULYA 1HZOA 3BROA 4A69C 2V4JC 5KAFC 2R4GA 3LA7A 4UA6A 1LDJA 1KQ0A 4U3TA 2XR0A 3GZNB 5ICGA 5D8LB 4CLCC 5HWVA 1RI7A 2EFQA 4X6TA 2XVCA 1CQTA 2Y2HA 2CO5A 3Q81A 4YINA 1DP3A 3G3ZA 2HU9A 4JK1X 4B4CA 2VV7A 4CCNA 4WCGA 5F1RA 3LEZA 1FCOA 2Z5UA 3Q7ZA 5BMZA 4QIWN 5JVTA 1K57C 1J0RA 5FFXA 3HB9A 4EQIA 2R7QA 2MLKA 2HOEA 3BQZA 3BR6A 3F1OB 1CF7B 4MEYF 4ZH4F 1UHSA 1ERQA 1RRJA 3T8TA 1KU9A 2R7UA 3GRJA 3DQVC 2L9SA 4AU7A 5G4ZA 1JHHA 1NK2P 1V5FA 1S3JA 3RXWA 1SD4A 2A07F 4KDPA 1K56D 5KSCA 2CW8A 4ZYAA 3A01B 1XA1A 3JAMZ 2W48A 4I09A 4I76A 4BEHA 4OIOF 4G3WA 4ZYHA 3DBRB 3GZ5A 4BJ6C 3VYUB 2GXBA 2V26A 1SDNA 4WYYA 3SH8A 4YFMA 2Y2IA 4QLCU 1YM1A 5H20A 5L8MA 5J47A 2CWEA 4BU2A 3IP4B 3F8MA 3ITBA 4KZ8A 4Y2FA 3RYRA 3V4GA 1TQPA 1WJDA 2WY8Q 3K9TA 4E3LA 3EGDC 3G2ZA 4RLFA 3GFJA 2Y2GA 2ZXJA 4DDSA 5EVLA 1EH6A 1D0ZA 5H6RA 3A3EA 2ESHA 4N4OB 5IT9Z 3OYCA 1S1YA 4I99C 4BBTA 4EQ1A 2BG1A 2G7UA 5DDGA 3V7CA 5F1JA 2K9LA 2R7RA 5F1GA 1G3SA 2G0EA 2HP5A 5BPDA 2RQPA 1QPIA 3WTUC 5U47A 3ESWB 3GV9A 4IHQA 2DA6A 1OMEA 3GUDA 5J3LA 4YRVA 5CERA 4AIDA 3FKWA 2O8KA 3PUBA 3CDLA 1N25A 5HVQC 4XUZA 3HOUJ 4S2IA 3GTKJ 3FWLA 1K54C 4JGOA 2DU9A 1Z05A 2Q2EB 3FDYA 3TP3A 4C3JJ 4S04A 4GOGA 4YEJA 1GA0A 3IF6A 1UAAA 2IS1A 3ABTA 2KLIA 2XSDC 2DMQA 2XGNA 3S17J 2M8EA 1YO5C 4O7DA 2V1XA 3K4MA 4TV7A 2E1CA 3WS2A 2Q1ZB 2ZSIB 4R3JA 3BJAA 5DKKA 2LF8A 2H5SA 2WB1N 4K2EA 1GA9A 3RTYA 2VOPA 1B6AA 1T1AA 4KIFA 3RKWA 1KZHA 4DMZA 2KJBA 1WVRA 4QPOA 2LBFA 4H0EA 4G6QA 5CECA 2WKHA 4DYQA 1TQMA 2UXXA 2CU7A 3CDIA 3MZ8A 4I3AA 2M4GA 1K25A 3ICYA 1D0XA 4FH4A 4Y0OA 4K91A 2F2EA 3RPUD 4I6ZA 4KNYA 4XN3A 2WC2A 3P09A 1N4OA 3CCRI 2VKEA 4N9LA 2VGLS 3FBIB 2JA8J 1JTGA 3PNYA 2Z2MB 1BIBA 3FIWA 3FKVA 2DK5A 5AIQA 3JTGA 2OCCH 4G7HF 2N8GA 1Z1DA 2L7ZA 2F4IA 4M3BA 4EVIA 4S05A 3HOSA 2LSOA 1XFQA 4DOZA 4W97A 4FUWA 3IF5A 3ZMTA 3GW2A 3S1QJ 1Y6IA 4ARZB 4ETXA 3KP6A 1Z77A 2Z33A 4CQHA 2ZOHA 3LR0A 3C2HA 1WWXA 1MJAA 4N92A 1VNDA 1IXSB 2DOFA 3GYHX 1UJ8A 3H82A 1W7PB 3JREA 3HG9A 3ZMZA 2CC1A 5FO5A 1T8IA 1UWNX 3Q82A 1Z3YA 1WE4A 1MWSA 2D1VA 4DYCA 1GV2A 3WTYC 1E2XA 1Z09A 5CPRB 1OJLA 1OKRA 3MQOA 1JKQC 3EUAA 4BL2A 2KISA 4HOIA 1ZHHB 1I1GA 5IHVA 2PD8A 1R58A 3LSHA 2BVMA 3K70C 3HUOA 3S4XA 1YMSA 4FX0A 3N8RA 2ID3A 4HW0A 3CCYA 4HF1A 1VZ0A 2QQ9A 1KGEA 4EU0A 3LIFA 5F0HA 3BY8A 1EH7A 3O3KA 1VF9A 2ZJPF 5FL3A 3I53A 1DQUA 4GS9A 4XIDA 2UUZA 1HSTA 3CJTB 4L5IA 1APLC 4HJ4A 5CXWA 5HWTA 3EDPA 3RH8B 2OD5A 1AWCA 3CESA 4HBLA 4RGSA 1TC3C 2QKPA 4II7A 2CJJA 4OIPF 3CLQA 4L5JA 2VBZA 4PFPA 1N9BA 3NY4A 1KA8A 4EM1A 3IWOA 5AQBA 3WRZA 3PBQA 4BJ5C 4RAYA 3RKYA 4OQIA 3CP2A 2K3PA 1IYQA 2ZM0A 3DFGA 4LPZA 4D9JA 3S7QA 4OVDA 2W84A 4QB8A 1VFCA 3TRCA 2PU2A 4D60A 1VI0A 3LSGA 1SD5A 1X4OA 2AQEA 1OR7C 3Q0VA 3TDZC 1YIJI 1J59A 4PM8A 2TDXA 4OAYA 1D5YA 1VQLI 3G30A 3HBRA 3CJMA 2XFTA 1DRMA 4N0BA 4QWOA 2ZFWA 3RDIA 1PRQA 2G2WA 4CSWA 5EV0A 2FBKA 1I6XA 1UHMA 4CZCA 4MTDA 1ZG6A 2PBYA 2RN7A 2M1CA 2V1NA 3F8FA 2DDAA 3ZYTA 1OTEA 2ZJRF 1F2KA 4P85A 3SOIA 3QYBA 4XKCA 3QP2A 3F72A 2KRFA 2ISZA 3DAVA 4AYBN 5LEJA 3KYLA 2OPTA 2YU3A 4FTHA 1MDMB 3W6KB 4I0BA 4XRFA 3HL9A 2CMPA 5AQ7A 4ZJ1A 4KT5C 5M1AA 1X1CA 3UE1A 2KPMA 5DCMB 5LHGA 4DE1A 2EFPA 2LR8A 2UV1A 1PDNC 1YKDA 3OYAA 2B5RA 2XF7A 3VEPA 1BW5A 2XPVA 2JKTI 5GPCA 1HW1A 1HA8A 1OR7A 1MY8A 4HY8A 2DMTA 4XQFA 3GLLA 5HLTA 2JN6A 5CVUA 4IX7A 5L3GA 2KRHA 3IL2A 1TS6A 4KQOA 1SKFA 1C0WA 3ZP5A 1J9MA 4KQDA 5TISC 1XGNA 1R4NB 2FQ4A 4GRIA 4QPQA 4KJZA 2FZ0A 4OP8A 3ZVWA 3RJPA 3KEYA 4L9FA 1OJ5A 5A2QK 1I2SA 5A2QZ 3J80K 4PM9A 4DDYA 5LFAA 1JUSA 3TW8A 4R0QA 2A68F 2IPQX 2O5RA 3VE4A 3K2NA 1REPC 1VQ5I 1L0DA 4X1MA 3ML6A 3IRQA 1AXBA 1F9IA 1LEBA 2Y2MA 2AHQA 2KZVA 1H5XA 3IWIA 3LIEA 4P6BA 1RETA 3AG4H 1LFBA 3ERMA 1FIPA 1NHAA 2YU9J 1XJ2A 3LCEA 2WK0A 2CRGA 3R7WB 1DP8A 3FF5A 4BS9A 2VB6A 3ZQLA 4UA7A 2OV7A 4LD5A 1FOWA 2GX5A 5TGFA 4BBSJ 3A1YA 5AQAA 5HD3A 3ELKA 4JF6A 1IELA 4YOFA 2Y30A 2PJPA 2H1LA 1IRZA 5DYMA 3LWFA 5AONA 1PW1A 2QGUA 3I55I 2Z6DA 2L0WA 3WWXA 1ZARA 4PJJA 4IOAF 5IU1A 1WH5A 4BD1A 3TOBA 2B02A 3PIOF 3ZMDA 5LD2C 2JVHA 2V1ZA 5KZHA 4PM6A 4WEJA 2NOJB 4ZZDA 4P0MA 4MBFA 4Y33A 1TDGA 5FAPA 2CH0A 2TCTA 1LVKA 2CW7A 5CKTA 1ZR4A 2JKGA 3C4OA 2W1TB 4I3IA 2PQ8A 1MJ9A 4P1WA 2OAP1 4II2A 1DPUA 2FOKA 2L5QA 2ZC6B 5EM1A 4KIBA 1WRJA 2LOOA 2XAGA 4AM3A 2EJRA 5HFOA 2BW3A 4NUBA 2L2OA 1V54H 3DBLB 3ZCOA 4IUHA 2ZXWH 3DEWA 3HIFA 3QNBA 3UE6A 2NNYA 5DCMA 4X1LA 2EWNA 1R6RA 2L02A 2W24A 3ZN0A 5FD6A 4C3HJ 3I58A 5F6FA 3JRCA 2BHZA 2V9AA 4JPMA 4FCYA 3KYDB 5CGXA 1I5ZA 2V9PA 2DMNA 2X9DA 3DF8A 3DP7A 1MPLA 1KQ9A 1PI4A 1D5VA 3ZNYA 3LICA 1YT4A 1IN7A 2EV5A 3HBLA 3NDGA 4HNUA 4L0ZB 2HDQA 2V2FF 3QP4A 3N97A 3LSRA 1W5CC 4FASD 3ZR8X 4CHUA 1QHHD 1DP7P 1Q2QA 3A3DA 3BLMA 2OBPA 3CZ6A 2VKVA 3CCJI 3UE3A 4E6XA 5DM6F 2R7TA 1U5TB 3LIBA 4EXOA 4JYKA 2JA6J 5K1YA 4Y7PA 4XOTA 1U78A 3G4SI 1P92A 1LI9A 1SD6A 1Z7UA 1HD8A 1K6SA 2V1AA 2V7FA 3M8JA 4RAZA 1VQNI 1BA5A 3W6JB 1YLJA 1LFPA 4EJTA 1JUPA 5FLMJ 4Y15A 4II3A 3GECA 4MEZA 4G3VA 5H2FC 4JF4A 4L9NA 2JUCA 1IAWA 3CC4I 1F43A 2XKPA 2V20A 4Y17A 1Q1HA 3LFVA 5DTKA 2GAUA 2Y0SN 3HOWJ 5E79C 1T6SA 1A35A 5DV5A 2HDRA 4ESFA 1SFKA 2GWRA 3RTRA 2JWTA 3C2BA 2MBFA 2OOLA 3L2CA 1BBYA 1FBSA 4EV0A 1IGNA 4HV5A 1VETA 2ZQAA 1JKRC 5CHUA 4JF5A 1ETQA 3UE0A 2P5KA 3PSIA 5EVIA 4M9XA 3HHHA 4ZJ3A 1R5GA 1GXQA 1MBKA 2IA0A 3O86A 4UAAA 3FXOA 4LIUA 5CVJA 4EEUA 1IW7F 1P0ZA 4F3LB 1TW2A 3IHUA 4HV6A 2MABA 3R0AA 3HUGB 4U0VA 4KG2A 2W1TA 4M3DA 1SZVA 1UMQA 4Z1WA 4OONA 3TBIA 2LNBA 5EOOA 4UA9A 4C75A 3NULA 2DA4A 1L0EA 1YRNB 4KISA 1LVAA 4E7JA 3J7YJ 4HBUA 3MKWB 4QD4A 4RQ9A 3Q7VB 5HZHA 4Q47A 5EDNA 2LKPA 4XLPF 1MGTA 1BULA 5H6QA 3U9GA 1QU3A 2ZJ2A 5B66C 2EFNA 2DI3A 1GLNA 1FR1A 2PX9A 3HUMA 4P9FA 3F1PA 4Y3IA 3BG5A 2NVUB 4UNOA 3HEFA 4BXFA 3ZFZA 4HEA2 2ZL1B 5LGNA 5B1AH 1D1BA 4RA2A 3H5NA 3VP4A 3MSHA 4GS9B 3QP6A 4IOCF 3GX4X 2H0YA 3WG9A 3CQZJ 3G2BA 1R36A 4I7HA 3B3XA 3BWGA 2KQRA 2CS3A 4A0ZA 2ZC5B 1MZUA 4IBRA 3V3SA 2MC4A 4BHCA 1T33A 2R93J 4F3LA 1HC8A 2IS6A 4ITVA 1HW2A 3NEUA 2YX4A 1A31A 3OCNA 4HX7A 2GDNA 2OWJA 2DFHA 2DJNA 4G94A 2HXIA 1SVOA 1UB9A 4B48A 2JRMA 3DV8A 2H27A 3B6CA 3BT9A 3CF5F 3C5AA 4OIQF 4CCKA 1D06A 1Y8RB 2DT5A 4PMAA 1EI5A 4UUTA 2QVOA 2XKOA 3GFMA 3QWLA 1VQ6I 3SFZA 1Y0UA 3V7SA 2HZDA 4LG0A 1IRFA 3HSEA 2B63J 4Y0UA 5FA7A 1U2WA 1X1DA 2WY7Q 5HPFA 2E35A 3CMZA 2J9PA 3FC7A 3SYTA 1U3EM 4MFDA 2O7OA 3H7WB 2OA4A 3HDDA 4Q8IA 2R5YB 1POGA 3SDGA 1JUMA 4FTXA 4S2OA 4PM7A 3HUGA 3S7PA 3FXRA 5IYCJ 2JT1A 3PIPF 1ESIA 4ETZA 2VASA 1F5TA 3IAS2 1EH8A 3LAJA 1BZAA 2AXLA 3LSIA 3S1MJ 1LSXA 1IRXA 1EA3A 1ETOA 1LE8A 2IS4A 4B1RA 2XB5A 2ZNYA 4MQVA 3BM6A 5E1XA 3ZNTA 1V9ZA 3O88A 4HHDA 5CGSA 3I71A 4RS8A 2H6CA 2EFUA 2Y79A 3T1SA 1VQQA 3BLYA 5B5EC 3L2QA 1H8ZA 1NG6A 2BBYA 3DKYA 3F9KA 1W63M 2QUFA 1WYCA 1VM1A 3VFHA 4LV3A 1QA6A 1TTYA 4I02A 5HOOA 3OYJA 1NYMA 4PM5A 2PD7A 5B1BH 1VQMI 3H36A 2FQ3A 2IRFG 3F1PB 4IRIA 1PWGA 2P7JA 2L9VA 2QYOA 4BE2A 2J3TD 3M2KA 1DY6A 3IQAA 3IBJA 3PAEA 1OTDA 4NC7A 2Q9MA 2F4OB 2CUEA 3UMEA 4RA7A 1OCOH 2XRNA 2UZKA 3MKFA 4R1GA 4A5RA 2J8YA 5FJ8J 4EGYA 1GXPA 1IKGA 4RM2A 3WHCA 1P9RA 2VE9A 2ISYA 1JNUA 3OR2C 4GDNA 2ESNA 5B3SH 1T39A 1XXMA 2JMWA 3EQLF 2FOWA 1R4MB 4YG2F 4EBNA 5KCMA 2FMYA 4I39A 2JKTM 3T4QA 3G32A 3F6OA 4KN4X 3NOUC 4N9IA 1E0EA 3W4OA 2WGWA 5TBMA 2FA5A 3G1MA 1TDLA 3OPRA 4FE7A 3C4PA 2QZ6A 2HF6A 4PGGA 2FUG2 1ZKGA 3M8FA 1VQ7I 4D7NA 1NLYA 2XRLA 2DN0A 2PMUA 4DXBA 3BPVA 3K4JA 4ASNA 2LY2A 1PZOA 1NTCA 1FIAA 1RP5A 5C4JJ 4NXGA 2LFBA 1LSVA 2P5VA 2JUGA 3AG2H 5L3EA 1TWCJ 4NK3A 4RYEA 1ZYRF 5EEHA 2O9CA 2P7VB 2JKRM 2W57A 3FZVA 4UB8C 2CV2A 5J8FA 4JP0A 4PJ0C 5G4YA 4U0XA 3UN7A 4U7BA 3L2VA 5IT9K 4E7SA 3EGXC 1IYOA 4J00A 3N8SA 4RB3C 5HDGA 1TNTA 1A0KA 3AL0C 2WKEA 3MZDA 2M34A 1FMWA 3WHBA 1JT0A 2IP2A 1LNWA 2ZFUA 5M5XJ 2IT0A 2YUSA 3BTLA 3E6DA 1FP1D 2R3SA 1KE3A 3MFDA 4R3BA 4R4SA 3J81K 3T1RA 2MW8A 1Z91A 2YR2A 5JLXA 4DIQA 5FQQA 1FBQA 2VL8A 2VJ5A 3GTJJ 4F7ZA 2O6GE 4WEKA 3E4QA 3JVVA 3PBTA 3PHYA 4UQIM 2FU4A 1CEFA 2V9VA 4M73A 1O7LA 3KSIA 1WQ2A 4RX3A 2A5WA 3KYCB 5E3OA 1KGGA 3VFZA 4GYGA 3GBGA 2K9NA 5EVIC 1XMAA 5K5QA 4G6DA 2E2JJ 2KDOA 1Z3XA 3H7WA 3DXJF 4BGDA 3QP1A 3NOTC 4QPRA 4X56A 1K55A 2OLUA 3T4TA 3CPTB 2R5ZA 1WJBA 3L1PA 1H8MA 2HV1A 3SH7A 3VYRB 2NNNA 2DFIA 4M72A 2Y9ZA 4DJ3A 5TRDA 4Z2YA 4CO8A 3IUOA 1YOVB 5ILVA 4L9EA 1R22A 2F5DA 5GL9A 5L3CA 5ED4A 3HLBA 3W4PA 3BPXA 2J5OA 4A6EA 4RX2A 2QBYB 4ZAMA 1L0OC 2JPCA 4AVZA 2R7ZJ 2RDPA 2PR5A 3LGOA 4EBPA 4BJTA 5TGTA 3Q9VA 3CMYA 4HBTA 1W7PD 3HPGA 2XEPA 3MJQA 3FXKA 1R1TA 1KE4A 3BOQA 3KEOA 5D5VB 5HDNA 3TG9A 3DTIA 3VFFA 3MMYB 5CVIA 1L0GA 2K4BA 5M3FJ 5FQIA 1AA7A 1BI2A 1OPCA 4WUJA 3FZCA 4GDBA 1MBGA 2YKFA 4P55A 2DK8A 2Z1DA 4ZC3A 3OPLA 2K7LA 1YITI 3DU6A 1P2FA 1OJGA 5JLWA 5HDSA 4B09A 4CJNA 3GVAA 2DT7B 4LLGF 1GHMA 2VBXA 4WBGA 2IGOA 2F4MB 3C2GA 5CRFA 1X3WB 1MKMA 3CCLI 3IF6B 5GLAA 2CQ7A 2MLGA 1XGOA 1K7AA 2P74A 5E2GA 4KZ7A 3RXXA 1Y8QB 5J4EA 2E36A 3EOIA 2ZO4A 4RGXA 3TKYA 4EJWA 1ENHA 1DDNA 1PNEA 3JRAA 3BQYA 1USTA 2V6CA 4MN6A 3BDDA 3NWSA 3W3CA 1S6RA 1BM9A 1YQSA 5HDKA 4M6XA 1FTTA 3I59B 5J1RA 3IH4A 1RUNA 1A6IA 3L9KA 4F55A 2OU2A 4XKVA 2FRHA 3G6EI 1NLZA 3LI9A 3Q9SA 2V9KA 3UDFA 3D1NI 2EX9A 2HPIA 4ID4A 1B4AA 2I9VA 1TS0A 3OYFA 1FZPB 1XGJA 2Y2LA 4GD8A 2K9QA 3ZQ5A 5IP9J 2ZJQF 5J7EA 3KX0X 3K10A 1ACIA 2PYRA 2PAVP 3DW0A 1J2XA 2O3FA 4RGRA 2CV1A 1K4EA 4E3KA 1XCBA 3EQVA 2OCEA 4XSZF 3LEQA 3EYYA 2B7EA 3CCUI 2M3AA 1XJ4A 2RQQA 2BOLA 3O2PE 3F6VA 4MHGA 1BLPA 5DJTA 3X2QH 1WJEA 3OYHA 2ZMEA 1GHIA 2EXAA 2Y48A 4ZYDA 4B4ZA 2QMIA 2DA3A 2DTZA 3Q7VA 4BYYA 2Q0OA 5L10A 5L3FA 2KP6A 2W82A 3P9CA 5IP6A 1B9MA 3AAFA 4DE3A 4JGRA 3OYKA 1SFXA 2HI3A 5J4VA 4UEYA 1SMYF 5CHMA 3MEXA 4HLXA 2QPNA 3GXOA 5CHJA 1QHGA 1Z0XA 2M7BA 2H09A 2EZIA 3MXQA 4XRMA 5CTMA 4H6JB 4UXNA 1OCZH 4N9HA 2WADA 1EF4A 1RGZA 3H3VK 1BOAA 4D5FA 2W3HA 2R5ZB 2Y2JA 1IN8A 5I94A 1W63Q 3ZOBA 1BJZA 5FROA 4LCLA 2WWYA 4LIVA 1G8XA 4Q48A 3ROUA 3B6AA 3TOAA 3T0YA 4K0WA 4O6JA 5F08A 2RCXA 3NBLA 2BY3A 4IHSA 2RAEA 1OPXA 3G73A 5F0FA 5HD5A 2NXNB 1HVBA 5E8IA 4F94A 3S3NA 1JKOC 3ISPA 2JA5J 4PFOA 2HTSA 2VEAA 4Y5FA 5HS7A 1DJBA 1MMNA 4BHBA 1O3QA 1ODDA 1ZG3A 1UCRA 2KKOA 3VWBA 5E1ZB 2R92J 3W4QA 4AC0A 1IRGA 4OLGA 2FF4A 3V39A 2QSHX 4NDLA 1NK3P 3HM5A 2LYCA 4NETA 5BS6A 3AFHA 1ONVA 3MVPA 4OP5A 3DBHB 1T38A 5F82A 2JK3A 3RCOA 5IS1A 3OIQA 3FM3A 2QWSA 3A3FA 2F5VA 5F83A 4XLHA 1Y39A 1IN4A 2XUBA 1IV6A 2VOOA 3JRDA 2Y8HA 5FI2A 2OWHA 1ZHFA 3MR0A 1VEUB 3RZDJ 4KUKA 1F9NA 2DBBA 1HKQA 2MD5A 1K38A 2XV4S 3KZIC 1BLCA 3JCUC 4WL9A 1P97A 4U88A 4HEFA 2EX8A 2M9HA 3K2AA 2XH9A 2W1OA 3FXMA 5ERIA 2A24B 1K4SA 3DLAA 1K4TA 3I59A 3BR2A 3BECA 1S8NA 3CMAI 3IWFA 1IUFA 4JBFA 3AKZA 2PU4A 1Y56A 3FXQA 1N77A 3IHAA 1UHWA 1E25A 3BG7A 3CF2A 2VKSA 1STZA 1WKMA 2IXSA 4BEHB 3QPSA 4D5CA 1ONGA 1SKOB 4NXEA 3SS4A 1XX5A 1M1EB 2ZB9A 4A93J 1V5GA 4DGWB 1ES3A 2JKFA 2OLVA 5L09A 5A8BA 4AIJA 1IFQA 3VSKA 4B47A 2ECCA 1XJ3A 4FH2A 1U8RA 2EFXA 4HNTA 3H0DA 3HOZJ 3UMDA 2DQRA 1G5UA 4GGGA 3KCCA 2E2HJ 4L9VA 1BJAA 3WTTC 2I5UA 2MGQA 1Z6FA 3KZZA 3B73A 3O8GA 1MH3A 4HRIA 3CCVI 1EWZA 1NZOA 3BR1A 2LB5A 2XAFA 5FAOA 4BWIA 4DN0A 4FX4A 1TQIA 1CJFA 2EK5A 4IHVA 4IVIA 4HIAA 1ETVA 4P6ZS 4HDUA 2M0MA 5EFWA 2CQNA 4CCOA 1WPKA 3BTCA 2XF3A 2L7KA 3HLGA 3MZEA 3VDXA 3UB7A 5J4YA 4H6JA 4KN7X 1TS7A 2Y2OA 3K4LA 4OU0A 3GWZA 5HARA 3SJMA 2V6EA 2Q2EA 3OMYA 2BE5F 2XD1A 3CUQC 4R8HA 4UVCA 2XC7A 3S3MA 1SEUA 1KVMA 3PM1A 2F5CA 3DU5A 3DWKA 2QQ8A 2M4KA 3V5MA 2K4JA 1ZTRA 1NWZA 1R1UA 1XSXA 4BNCA 3CMMA 1J75A 1FJLA 3JRGA 3OSGA 1R49A 4OQHA 2HOTA 3LAPA 2O9AA 4LMYA 1IV8A 1HKSA 3WE2A 3D72A 3IV5A 4JBAA 4A5MA 5FKOA 4A3BJ 2XHKA 2A24A 2K86A 3QPHA 2XAUA 1A04A 3T5XA 1YS7A 4HF2A 5FI6A 2P6SA 3MD2A 3DWZA 1KQ8A 4WX9A 2DDBA 5GAHJ 2WKQA 4HQAA 2BGCA 2W27A 1XGIA 5HS9A 2ADUA 2XPWA 5D5WB 3NAUA 3AGFA 4CGZA 3CUEA 3H9WA 4BD0A 2OZ6A 1MWTA 5C5KA 3T8RA 3M1EA 1HQCA 2HDCA 3ZQFA 3D3OA 1S1ZA 4KG6A 4X25A 4NG2A 1MSFC 4YWZA 5K5BA 4HYEA 4BUPA 1RZ4A 2HZTA 4CDGA 2RL3A 1MXOA 2OQGA 1XCVA 1QVUA 3I64A 3RQ4A 4MO7A 3LFKA 1J09A 1QPMA 2HYGD 2ZXHA 1MKIA 3ONQA 2VJIA 3J81Z 3WGIA 1YPRA 1MBLA 3ECHA 3GF2A 2H10A 4ARZA 3C30A 3BZKA 1LB2A 4KZ4A 4EBLA 1U5TA 1PZPA 3KP5A 2Y91A 3V8JA 3UDXA 1W5TA 3ZQQA 4ESJA 3C8CA 2HWVA 4L5EA 4RDUA 2BXZA 4XL9A 2GIVA 1CQAA 2Y55A 4NC6A 2VC1A 2DMWA 3NQOA 3K4NA 4P5OA 1OT9A 1R00A 4JX6A 2GZAA 1GCEA 2PRFA 3KSHA 4E3NA 2ELHA 1XMKA 3ULQB 1W36D 2L4MA 5CVVA 1P9WA 2I72A 2EX6A 2NAZA 1MMSA 1W0TA 4LB5A 1KGSA 5JYPA 1MNDA 2RC4A 5EM0A 2PLYA 3UO9A 2XGXA 1VETB 3FX3A 2WGVA 4QSHA 1GVDA 5E3LA 1KE0A 1NJ4A 2NVXJ 2C5WB 4LITA 2DFEA 4BL0B 2M0CA 4KZ6A 3EQUA 3N4IA 3K3DA 4A3LJ 3Q5FA 1U9OA 5C4XJ 1GVJA 3R6SA 1OISA 2XK1A 5FDHA 2LRDA 4C2TA 4Y52J 5DJUA 5C3EJ 4QY5A 3BTIA 3K69A 4JQFA 3G31A 4OQGA 1X19A 3WGHA 1HSJA 4IL6C 1K0KA 5FATA 3CUQB 3BTJA 2XD5A 1YX5A 3S2DJ 3E6BA 1YRNA 3IAM2 1PFLA 1W8QA 4WELA 2XQZA 3FK6A 2NS8A 1T08B 3MFKA 1GT0C 3ZG5A 4BBVA 4BMWA 3HLEA 1TD5A 2M7VA 2NYXA 2R7SA 2MD0A 5CX7A 2WV1A 3ASNH 2EIJH 5M5WJ 2HQ5A 3RKQA 1U8BA 4PK4A 1LDKB 2L0KA 2MH9A 4XBFA 2G2UA 1HBXG 4KQRA 4BJPA 5FD5A 3EYIA 1LLBA 4KIGA 1E3PA 4ZYEA 1OMIA 2Z3YA 2INWA 1Q1VA 1B9NA 5FSRA 3HSFA 4B44A 5BNGA 5FQ9A 4BKXA 2E1MB 1MBFA 1YIOA 5DFYA 2V1UA 3HHGA 1XS9A 1XSVA 1H8AC 1PWCA 3GEZA 2DQLA 1N9OA 4L0LA 4XM3A 3BCAA 3CD6I 5E8GA 4MN5A 2HGCA 3CTAA 3H9GA 1G59A 2EWWA 4CZZA 3KP7A 3PFIA 3H35A 1CF0A 3SFIA 1D0YA 3O3VA 2OQRA 2EILH 3HOXJ 5KNLA 3L7HA 2P9VB 1OYWA 1Z6RA 4UUSB 3IKVA 1ONHA 4C6YA 4A3EJ 1D1AA 2HQAA 5JYOA 3W2ZA 3VSLA 4BQMA 4B3XA 4OMZA 2RKHA 2IBDA 2QJ7A 4OKPA 3HRMA 5HLGA 4IJGA 3A4CA 4LG3A 4A12A 3NRVA 2STTA 2G7HA 3GR2A 3I5UA 4DZJA 2P04A 2VV8A 3BFDA 3S32A 3E5XA 1BN5A 1IEMA 5ICCA 1E17A 2E1MC 3HJKA 2QHKA 4N4NB 4Q0JA 2W00A 1FX7A 3QODA 3RSNA 3UNGC 2YPRA 2KZGA 3MKZA 2HVRA 1MNMC 1GHPA 3UB9A 2DJIA 5CQEA 3A02A 3HGYA 5DEQA 2GXAA 2EBIA 4EEFG 3RYPA 5HODA 4RB1A 2A2LA 4M3FA 1SDEA 2HDDA 1W1WE 3CC2I 1FYKA 2KRCA 3PO2J 1LHYA 4C3QA 1TWFJ 1LE8B 1CF7A 3NOPC 5DFXA 2CW0F 3LMMA 3JPUA 1MDMA 3QOEA 3ZG0A 3KPHA 4XLFA 4YFKF 2VBYA 4LK1F 2DOAA 2XF5A 2Q9NA 4HOBA 4UQIS 1QRYA 3KLOA 3P01A 4JXSA 2J9OA 4W1UA 2UWMA 3NDEA 4G7ZF 5CJ9A 2E5ZA 4UVBA 4WXDA 1HTZA 2HP6A 2EA4A 3JTHA 2VT3A 3CO6C 2Y4AA 1RKWA 2EA9A 2L3DA 3LL7A 4GKUA 4LV2A 4ZDLA 2DRWA 1XDSA 1FQGA 4WZ4A 5HWWA 3HZJA 5EZGA 1MD0A 2E2IJ 1BSGA 4EESA 4KZ5A 3NCKA 1K78A 3PBSA 1C3BA 4WWCA 3OSFA 5D5UB 3GO5A 3E4OA 3H3UA 1JXSA 2W0NA 4ESBA 3M2JA 1T1CA 5HX9A 2ID6A 4CPKA 1MZBA 2HR3A 2VE8A 3CUQA 2V0UA 2EWVA 1TNSA 2PR6A 3T1XA 1MH4A 3OYIA 1DUXC 2X01A 1GDTA 2BW3B 1XA7A 3CO7C 5G18A 1OTAA 4WLAA 3E1SA 4IKFA 3HJIA 4HQMA 3L09A 3TEDA 1HDDC 1T18A 2E34A 1RKTA 4X68A 4B3AA 3MXSA 3E2KA 4CXFA 3J80Z 3GTCA 1OCRH 2KHMA 3JW4A 2X6OA 4XORA 4MTEA 2LH9A 1EV7A 2VQGA 1F4KA 1FOYA 1YS6A 2P08A 3U1DA 3FMRA 2A6EF 5LGTA 4C3IJ 3JRHA 1JWPA 1FY7A 3JRIA 3MKYB 2HJ9C 3SS5A 1DP6A 1ON2A 2DPUA 3B47A 3L7WA 4XLAA 1IOUA 3FHNA 2BVLA 3N7WA 4LV0A 2KL4A 3ZXSA 2UXNA 4MMNA 4PSWA 2JTVA 2A05A 4GXOA 1VHMA 4NXFA 1RESA 5K5OA 2QKMB 4HX8A 1K56A 1F5MA 4WN5A 2X1DA 3PBNA 3WS4A 4ZJ2A 1YX3A 2DMUA 4XRSG 2HEOA 2C6WB 4IHWA 2R7OA 4X1EA 1F36A 2A6HF 4KFCA 1V4RA 4XR6A 1LL8A 5E17F 5LHIA 2EX2A 3NWTA 4NBQA 1U0JA 3GTPJ 3BEBA 2AVXA 2QA4I 1H89C 3D5LA 3LA3A 2ZQ8A 1TWAJ 1S7EA 3PQJA 4CCLA 1IYPA 1JHFA 5E2HA 1ETYA 5E2EA 1ZG5A 2L01A 3E98A 1R5ID 3IT9A 1I6HJ 1SHVA 4ZTFA 2W3EA 3GSGA 3Q0UA 2GA2A 3OIOA 2JA2A 5HNHA 2JC7A 4MLLA 3TSGA 1X1AA 4EUZA 1O3RA 5IYDJ 4DE0A 5HAQA 3BC8A 3LSTA 5GAEJ 1T19A 3MZYA 4AD9A 4ENNA 3S2HJ 1FOXA 1OCPA 1Y54A 4JXGA 1FSYA 4B88A 2B18A 1FYLA 3S7OA 5FI7A 4HDVA 4BE0A 1QVTA 3GQZA 4BY1J 3M07A 3H1CA 1XG1A 1X0OA 5F1FA 3FK7A 3IRRA 1FTZA 1IDZA 3ABMH 3WTXC 2CYYA 2QBYA 2OSUA 3OBFA 4LENA 3HLDA 3CCEI 1RC9A 2IA1A 1U9NA 2MFZA 2OC6A 3KE2A 4FISA 2HFHA 5LLQA 4ENMA 1J5YA 4UUVA 3H82B 3IX8A 3GVBA 1G2HA 1BT5A 4E3MA 1VTNC 4JGPA 2DAOA 3GZ6A 2H8RA 4KMFA 3ABUA 1O3TA 4UB6C 4C2UA 1P4XA 4HF0A 2JRTA 3SDBA 2HGVA 2DW4A 4KENB 5F04A 1B59A 5BOHA 1HF0A 1KONA 1JI8A 1JTYA 5EOEA 3F8CA 5KAIC 1H88C 2DPDA 1BL0A 3CITA 1YJWI 4MQ9F 2OUMA 5IOYA 2K02A 4FT8A 3UDIA 3SW1A 1TT0A 4XKBA 3D4FA 2VUMJ 3ZQIA 2YX7A 4HX4A 2GIZA 2WAEA 1NG7A 5LRRA 2J3TC 4QHCA 3SH9A 4X0GA 3FPVA 2LDUA 3IXGA 2QSFX 2W4SA 2L7MP 2WA0A 3IH2A 4LV1A 3DEEA 1ZTUA 1I3QJ 3FXJA 4M9ZA 5FFZA 3HLCA 5I5LA 4L18B 2W3FA 3SHFA 1ZR2A 1B8IA 2HOSA 2L4RA 1EROA 3BG6A 4I0AA 1ZREA 2O61A 1X2MA 5D8KB 2Y2QA 5MC7A 3LSMA 1S0WA 1ZC2A 2IWCA 2VGKA 3IX4A 4A2UA 3KO6A 3QQAA 1X58A 1S66L 3B33A 1OQYA 2IWBA 1S5LC 3A01A 3MN2A 1D1JA 3BRMA 1MIJA 4A5NA 5BQTA 1K54A 5J1YA 1O07A 1YLZA 4V2GA 3ABLH 4P6ZM 1YI2I 5FRNA 3M4OJ 2GLOA 2GNXA 2ZKZA 2XFSA 4KZ9A 3BLSA 3GTMJ 2IVMA 3ASOH 1WH7A 5GTIC 3TOIA 2ZQCA 2F48A 3PAGA 3KIOA 2QWWA 2EPFA 1BR1A 1IUYA 4XRSA 1VB6A 3BZCA 4YELA 2Y2ZA 4M71A 4GDFA 1ODVA 3QP8A 3G71I 3ERED 4KZBA 4P96A 4CLCB 1P6RA 4F91B 2LY9A 2VKDA 3H9JA 2COBA 3I3LA 3BG3A 2A3UA 1V3FA 3NARA 3LR3A 3HKZN 4ME4A 1ACFA 2QM3A 3JR9A 3LSKA 3AL0B 3BZ6A 2XA7M 3DKWA 1K83J 5L3BA 1XGSA 2DLLA 2RGVA 2QEXI 1BLHA 4HH2A 5EVEA 4DKIA 4HJ3A 3P9KA 3T50A 3T4LA 3UNWA 3EEHA 3JRFA 1RCJA 4O5VA 2LD5A 4A3MJ 5FB2A 2XASA 2QLZA 4WK8F 4BBUA 4XLNF 3F8NA 2VPRA 4QJGA 4LK0F 3CMEI 3E6CC 3VP3A 2GOXB 2B95A 1IO2A 3DTKA 3HPHA 4G6TB 4HSTA 2NUPC 2VODA 5EVID 3VB2A 1D3YA 2JVGA 3V8LA 3D5SC 1P4WA 1H3QA 3A0SA 2M7UA 1DPRA 1H9TA 1RPWA 2VI6A 1Z9CA 3UR3C 3E7LA 4PUSA 1ES4A 3S22A 4IVNA 4MBHA 1YLTA 4N1XA 5FRMA 4HQEA 1SAXA 3DTMA 2HJEA 3HTSB 1AOYA 1BI3A 1ZRCA 5EPHA 3SZTA 3GTQJ 3DBAA 1FOFA 3IWQA 5DS9A 2HKXA 3B42A 3LR4A 4BLMA 4U0TA 3PSFA 1L0FA 3ZVTA 5FEFA 2ZQDA 2F5EA 2JE5A 4JX5A 2VKHA 2HZ5A 2JZYA 1FPQA 1MMAA 2OJED 4OWRB 1S72I 3S1NJ 3CDHA 4EM0B 4RBOA 1BYWA 3A0HC 2BLSA 3BY9A 5GP9A 4OIRF 3ZGAB 2PT7A 1YYVA 2J5PA 3A0RA 1QNTA 1YJNI 1PP7U 2GM4A 2VQHA 1CEGA 4NEED 3GMWA 4GN2A 4B8XA 4ZTJA 4IHTA 3CJQB 4GCVA 3BFGA 3GTLJ 2OAZA 1E3UA 1IYSA 3OOVA 4NC8A 5DD8A 2DMPA 3RPUA 4Q5SF 4E3OA 1XB4A 2ME0A 3FXLA 5D4SA 4BHPA 4J19A 4A3CJ 3EEAA 2FXAA 1ZLKA 2EZLA 5TR7A 3FBNB 1K4FA 1SMTA 1A6QA 5D5XB 2E60A 4ZZLA 3O8HA 1Z67A 5HDCA 4LJZF 1TWGJ 1X1BA 4F92B 3HLWA 1SD7A 1LT0A 4EEPA 3AG1H 1EJ9A 4MLOA 1LJ9A 1KYWA 2NRAC 1U60A 3KYZA 4EQQA 1TWHJ 4BDYA 2Y69H 4GYIA 3A2KA 3ZHHA 4Y7NJ 1YFHA 1K55C 2QJ5A 5EECA 4CH7A 1RR8C 2VPLA 1DJCA 1FCNA 4IEJA 1TT5B 1PUFA 4O0PA 3VMAA 2DA2A 3BW6A 5DF9A 2MSYA 4E7HA 2C6YA 5E2FA 1FLIA 3MQ0A 3UB6A 3ZG9B 1FCMA 4XICA 3C7UA 1G6NA 1UG2A 3QHYA 2CQKA 1P7JA 3CCQI 4JKTA 3Q07A 3S14J 2QENA 3OYEA 1NRFA 4EERA 2EH3A 1VQKI 4GLQA 2EFWA 4E4HA 2ZC2A 5M5YJ 3I4PA 2HYJA 3WU1B 2ZC4B 5D3OA 3VOYA 4XN0A 3SZPA 4YFNF 3WTWC 2HDWA 4R6LA 2EZHA 1QZYA 4OAZA 3TL4X 3HLFA 3IXBA 4JOMA 1ZRFA 2KMUA 1MBHA 5KHDA 1JKPC 1T2KA 2Z6CA 2X51A 2P0WA 3BG9A 3E0JB 3OYLA 1YLPA 3HREA 2O9LA 3TGNA 2FNPA 4GNUA 4R1HA 3KFWX 3L2WA 1I3AA 2GXGA 2LC2A 3IXDA 5EG0A 4DBRA 3VYSB 3BQ8A 1LDDA 2X02A 2VXZA 2D1HA 2F5FA 1ZH5A 1O3SA 3HOYJ 1MWRA 1MWUA 1WYBA 2V1BA 3OZHA 3UB8A 1XMXA 4CCJA 4DE2A 1SCWA 4HSRA 3K4KA 5EZHA 4OH0A 3JRBA 3ZQGA 4M6YA 3QP5A 4YIIA 5LBQA 3HXLA 2W3GA 2CG4A 3T12B 4RB0A 2GJ3A 5DTSA 3R4KA 1T98A 5J6XA 2ZMEB 3CG5A 1IN5A 5AQ9A 4C9YA 4NHJA 1S9HA 4CYCB 4RLQA 1U5TC 4P9UA 2VONA 2JHEA 2LP0A 1LUJB 4GHIA 3MKLA 3I4NJ 2PBIA 5FQKA 3BJOA 1SC7A 2X85A 3WGGA 2AS5F 4BH9A 2JA7J 2PYPA 1M40A 2E7WA 3D0SA 1E3HA 1U6GA 2XROA 2NUTC 4IHYA 1I39A 4M6VA 4DBQA 1FILA 4R38A 4YIFA 3G1OA 1SAUA 2X6XA 3BWLA 2X6WA 3PBRA 3O5YA 4E3IA 3E0YA 2EA2A 1XFNA 2D45A 4I01A 4O01A 3BR0A 2X71A 1FNNA 3CUEC 2BTFP 1F98A 4IXAA 3COAC 2DA7A 4PJMA 1HCRA 5E43A 4E70A 1BC8C 5DTDA 3C3WA 4PCQA 4RM3A 4EJVA 4KITB 1O7FA 1LSWA 3WS1A 3AG3H 1JWVA 3GCMA 3PR6A 3LY3A 1FP2A 1FSEA 2CFXA 1H0MA 1JTXA 2EV0A 2VZWA 1D1CA 2MC3A 1RUOA 4EUVA 4IQ4A 2ZC3B 1D8KA 2E19A 2GA1A 2JSCA 3FXUA 1JGSA 1S6LA 3KX2A 4BXUA 5C44J 5BOXA 1RIOH 5F27A 3BCBA 1OYYA 1E3OC 4G12A 2XAQA 3QYFA 3TDUC 4R4RA 2K3FA 3HC7A 5FEGA 3N05A 2DT6A 1GV5A 3A3JA 3GFLA 2BYVE 2H28A 1UWPX 3BJNA 4Z9QA 5KIZA 3OL3A 3S15J 1FSHA 4GFBA 3OYGA 2V8CA 1PUFB 1S7AA 5EG0B 2LY1A 5FASA 1V55H 1ZGWA 2FE3A 1ITYA 2J7VA 4S2NA 1XN7A 4M3KA 1HDPA 3U1KA 3U21A 3WU2C 4XOPA 2VN2A 2WZZA 2FBHA 2R5YA 1QMFA 1KDWA 1TZLA 1W0UA 3TO6A 1A5JA 5GAGJ 2CFOA 1S67L 4IHXA 3UPNA 2IWDA 1YHQI 2E8JA 3VYTB 2X48A 2PMHA 3DEUA 3FV7A 2XB0X 1WJFA 2KIMA 5JHFA 1G3TA 3BQAA 2VT2A 2EIMH 2Y0SA 3KLNA 1EKEA 2FBIA 2HKOA 2K7SA 4GB7A 1KGFA 3MAJA 3R60A 2R7VA 4X6AJ 3BJ6A 1OTBA 3VODA 2PDRA 5DVAA 4AVPA 2BEOA 2M1BA 3GTOJ 2H6BA 2JBFA 2CUJA 2ZCWA 3OYMA 2LKXA 4KQQA 4M3EA 4HP9A 4ESPA 3K0LA 2GBYA 4OOIA 4LRXC 2WB1A 4ANJA 5E18F 1AWIA 4AWXB 1PUEE 3LR5A 4R70A 3VOLA 2IGMA 3WS0A 3M3YJ 4CLCD 2WKRA 5CQGA 5GHZA 5DUIA 3E3VA 1XX2A 1YLWA 2WGIA 4LLOB 3KETA 4PJNA 4LLLA 3ZMUA 5K7HA 2XDMA 4N1HA 3PYPA 4M9SA 1VEUA 3RPQA 1BR4A 2G9WA 5JHUA 3PBOA 1DJAA 5K7FA 1G28A 1IKIA 2K40A 1QMEA 3A3IA 4DJ2A 4Z6YA 1JE8A 1IJWC 2XSSA 1H8YA 2WAQA 3OLOA 4EETB 3TW6A 4WXCA 2XLNA 4CYCA 3DLLF 1Y1VJ 2BY2A 2DTRA 4H4KC 1T95A 3VOZA 1S29A 3I0TA 5HL1A 4CICA 2ETHA 4NNJA 1P7IA 2OZUA 5AIPA 5TBMB 1XSDA 1X3UA 4AFIA 3OS0A 3PXPA 4DQ2A 1NYYA 2HOAA 2ACGA 3IS2B 2LBFB 2EV6A 2A49A 2Y0MA 5KK1A 3CC7I 1BLSA 4BE1A 3RZOJ 1ZKJA 4HZFA 4LRZE 1WI9A 3T4OA 2R7FA 1L3LA 1G6AA 4E6WA 2NS0A 2COMA 4HA8A 1BI1A 1YG2A 1ZAOA 3JAMK 5F64A 4IF4A 4A0YA 1K6OA 3Q1FA 3T1QB 3UB5P 1VQOI 4BBRJ 1AHDP 2Z2LB 3L9FA 4D0PA 2AQFA 2EZKA 2KFDA 4KT6A 4NB5A 3S93A 1RNLA 2CQQA 2OTJI 3ZQCA 3N6IA 3ZQ7A 1DP9A 3IH3A 2CGPA 1ETXA 3PL8A 1W4MA 3G6OA 4CA0A 5TFQA 1L2SA 1BIAA 4CCMA 2O9BA 3DCFA 4S2PA 5HSQA 1YSPA 2H94A 3H0GJ 1J7KA 1FEXA 5EEAA 2GZWA 4GZBA 2VK3A 1WHUA 4BACA 3IH9A 3LIAA 3FWEA 2Y75A 5FGMA 4YNRA 3FMSA 2VJ4A 1MMDA 3DPTA 2FSWA 4LLNA 4AIHA 1FSWA 3T4SA 3VE3A 3O6BB 2LKSA 4S0HB 1PW8A 2ZMAA 1GSWA 3HVFA 3LO7A 2ZM2A 2ELKA 4OOYA 2Y2KA 4F52A 2LVSA 3KP2A 2A5YB 1YLFA 1W36C 4GO1A 3SEZA 4ZBEA 3LQQA 3E5QA 3KZYA 3H5RA 3A0VA 2EIKH 2E7XA 1VQPI 1PYVA 2LMDA 2RV8A 2R9WA 2KIQA 1XGMA 1TF1A 5FAQA 1LFUP 3EUKL 4JX4A 4I2OA 2MJ6A 4OPQA 4WF0A 3D9YA 4QU3A 2E1OA 5AVEA 3SS3A 3VPRA 3QU3A 4MCWA 2JSPA 2WUQA 5HAPA 4BQNA 4UY8I 2BV6A 2STWA 2PBDP 2EB7A 4LFUA 4PKYG 5IY5H 3FG8A 2HQRA 4XXRA 2XPUA 3NIAA 1GSXA
chains in the Genus database with same CATH topology
4NQWA 4G9YA 4KA4A 2V79A 1UFMA 5CLSA 2P5LC 1FC3A 2X4HA 3L00A 3F21A 4O3MA 3QU6A 3IC7A 2W85A 3HRTA 5DCFA 5BPIA 3H3ZA 4MNUA 3IX3A 3VOEA 1I27A 3CUOA 5DUKA 3C7JA 3RKXA 1I1SA 3QAHA 4IRHA 4QWQA 1W5SA 1OYIA 4EMSA 3PQKA 3CJNA 2FNAA 4FHTA 1YW8A 3V7RA 1USSA 2QQBA 3GLXA 3K1MA 4PZJA 4G7OF 3QRFF 1XD7A 1H9GA 5K5RA 1YW7A 2K27A 3MWMA 1G3YA 1KU7A 4WXHA 2P6TA 2L54A 3IWZA 1YW9A 3P7NA 5E1WA 4Y13A 1HXDA 4LB6B 4UV8A 3HYIA 1SFUA 5HS8A 1IF1A 2PG4A 4KMUX 3BY6A 2P4WA 5L07A 2IA2A 3QOPA 4OINF 2UV0E 2XIGA 2KJCA 3S2WA 4CYDA 2QQAA 2WTEA 5EEGA 3ECOA 3KP3A 4R79A 3DPLC 5IT3A 1BC7C 3EUHA 2PI0A 3V8KA 1CGPA 5ICEA 2PN6A 2Z9OA 1IZ1A 5D4RA 3FMQA 1R1VA 1K79A 4L0YB 2HS5A 1T0FA 4RB2C 3E5UA 3I54A 4U0WA 3TO7A 2XAHA 4Q4ZF 1SFEA 4U7DA 1J9IA 3SXYA 3MZHA 3FM5A 2WV0A 1KU3A 1K78B 2IJLA 5ILSA 2Z99A 4BQAA 3K1NA 1YTYA 1R23A 3SQNA 2KIFA 3WTSC 4U0YA 1KU2A 3J7AO 3C18A 3F22A 2VC0A 4ON0A 1ZN2A 1W7PA 3WE3A 2M87A 2A61A 2IW5A 1TW3A 2XAJA 3RI4A 1MJBA 3M7GA 5FLXZ 5L3DA 3QPTA 3RIRA 5FLXK 4BAYA 5JR3A 4G8XA 1IXCA 2R7DA 1XDUA 1HW5A 2HTJA 1FOKA 2M5WA 1LEAA 1HKTA 4UV9A 5ILUA 1IXRC 4PGHA 1ZGJA 3HTUA 2Q8KA 4UVAA 5ICFA 3MCZA 2HQNA 2JPBA 2ZBKA 3M8EA 1O57A 2A69F 2ACJA 3P9IA 1QO0D 3ZMSA 3TQNA 3BP8A 4IPAA 4EJUA 1R7JA 5HLIA 5LRSA 3LA2A 1QBJA 2LF7A 4KUMA 4ENKA 4RGUA 1YQAA 3T1BA 3ZPLA 1QGPA 2W25A 4IJAA 4HLYA 2X0LA 4A6DA 5J8CA 2L4AA 4MEXF 5CYVA 2P8TA 4XSXF 5LHHA 2RVCA 3HRUA 4EM2A 1FT9A 3R61A 2PEXA 1QQIA 4DNCA 5KVRA 5DD4A 4ETSA 4L9TA 5TJJA 2HYFA 4WF2A 3WTVC 3WU0A 4IRGA 1S7OA 1Z6TA 2ZNZA 4YFXF 3HSRA 3ZMVA 4ENJA 2YSRA 2V1DA 3EETA 3WTZA 3TO9A 1FWZA 1KYZA 4M74A 3F23A 1ZGAA 2M45A 3HOTA 2VBWA 4I98B 1ZLJA 5D6EA 4LGWA 3F3XA 2O0YA 3IKTA 2E1NA 2A3SA 3K1PA 5LEKA 2FMLA 3GFIA 4EJOA 5JI6A 5D6FA 3FHZA 2PFBA 5CVRA 4MGRA 1IN6A 1PP8F 1G3WA 4HAMA 1QZZA 3HRSA 3WODF 1LQ1A 3M9AA 3H92A 3JSPA 4AIKA 4KICA 5LGUA 3ZN1A 4L9JA 3R0JA 1FYMA 3OOPA 1ZG1A 1D8JA 1TLHB 5JFRA 3E6MA 2FEZA 2B0LA 1TBXA 1B1BA 3N4MA 1ZRDA 1FBUA 5E20A 3E97A 4LG0B 3LQRA 3OV8A 3KEQA 4A0XA 1P4AA 2MA3A 2M30A 4KYWA 3F8BA 2EFOA 2MH2A 2RNJA 3REOA 3CLOA 1F1ZA 2QZ8A 1ON1A 2O8XA 1BI0A 2GQQA 2P7CB 4ZYGA 2D2WA 1R5HA 2DO7A 1GHCA 3U2RA 4UHTA 5HLHA 4PDKA 3KP4A 2O03A