3QP5A

Crystal structure of cvir bound to antagonist chlorolactone (cl)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
251
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transcription
total genus 59
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qp5A02
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp5A01
1KQ9A 1D5VA 2VOOA 2UXNA 1MDMA 1V4RA 4KIFA 3HRUA 1YYVA 2RDPA 3R4KA 2W25A 3LA3A 1U8RA 1E2XA 2Y75A 3RDIA 1QO0D 2Q0OA 5IT9K 3TOBA 1T0FA 2FBHA 2M30A 4LGWA 1XGMA 5LGUA 2ZCWA 3IKTA 2DPDA 4S05A 1I1SA 2IA0A 3SZPA 5DV5A 2FQ3A 4P9UA 2MLKA 1BIAA 4A0ZA 1Y0UA 3F22A 3MFKA 2E7XA 2AVXA 1QNTA 4L5IA 5AONA 2VT2A 2Y48A 5CVJA 4BYYA 4HLXA 1O7LA 4ETSA 3HSEA 4CYDA 4KMUX 2R7FA 1S7OA 2RVCA 1OYYA 2ZNZA 1TNTA 1P92A 3E5XA 2JSCA 2ZNYA 5DDGA 1WKMA 5BS6A 5EEGA 2H94A 1ZRDA 2ZXJA 1PP8F 2IPQX 3WTWC 1R58A 2FNPA 4HQMA 4OOIA 1S6LA 5ED4A 5L3GA 2DI3A 3IWFA 2QYOA 5L3FA 2YU3A 5DCMB 4XLPF 1A04A 3JTHA 4WXCA 2O03A 5FFZA 3RKWA 2CGPA 2XASA 2R7DA 1K78B 1QPMA 4TV7A 3O6BB 5ICGA 1IN8A 3KE2A 4MTDA 4NG2A 2XKOA 5LRSA 4ENNA 1BI1A 2OA4A 2GXGA 1JE8A 3ROUA 3DPLC 4XRFA 4UXNA 1IN5A 4HF2A 3WU0A 3R60A 1HXDA 4MGRA 4UVCA 3Q9VA 5LGTA 3K9TA 5FD5A 1T39A 2DBBA 3IRRA 1FBUA 1SFEA 3F8MA 1BI3A 1IF1A 2E1NA 1Z91A 3ABUA 5KK1A 1T6SA 2QQAA 4HBLA 3IRQA 4Q4ZF 3I59A 3GYHX 3IX8A 1SD6A 2O61A 2Q2EA 2QQBA 2H6CA 4L9TA 2EFPA 1ONVA 2ESNA 3TO7A 3ZMSA 2EWNA 5FLXK 2PMUA 4M6YA 3RPUA 2A69F 3L00A 4LK1F 3G73A 2STTA 3DPTA 3U9GA 3F8CA 1UCRA 3TDZC 3GFIA 1J7KA 4O5VA 3GFJA 3G3ZA 1TQPA 3FMQA 4ZYGA 1P6RA 1I1GA 1O57A 2HS5A 4ENJA 1IXSB 1IZ1A 1R00A 4HOBA 1OYWA 2HQNA 3I53A 4MQVA 3GX4X 1FPQA 2NAZA 2BYVE 3BZ6A 4IRHA 4IPAA 2CQKA 2W57A 2VBXA 2R3SA 3DFGA 4RGXA 2ZJ2A 3DXJF 1ZYRF 3SZTA 4CICA 2EFQA 1LDDA 3I64A 1S3JA 1FT9A 1GVJA 4HF1A 3BROA 2DAOA 4ZYEA 4LMYA 5AIPA 4RGRA 4P5OA 4ZZDA 2NRAC 2UWMA 2E7WA 3GF2A 3DQVC 3QU6A 1XB4A 2JPCA 2FEZA 1CF7A 5L10A 4AIHA 1YS7A 3KFWX 1YG2A 5DUKA 2GXBA 4GO1A 3QAHA 3M7GA 3M8FA 3WTVC 1FYLA 5CYVA 5D4RA 2EFOA 4XLNF 3B73A 1IRFA 1U2WA 2ISYA 4L9NA 1ZGJA 1U6GA 5D5XB 2O8XA 2HTJA 2ISZA 3PQKA 2HTSA 1ON1A 3HHHA 4IXAA 2ZFWA 2O6GE 3KP2A 1XN7A 5ICCA 2IVMA 3KP5A 3F6VA 1BI2A 5HDNA 4PGGA 1FY7A 3DF8A 2P6SA 4KICA 3MEXA 3VEPA 1DP7P 3KEQA 4P9FA 2PG4A 3QOPA 2W85A 5L3EA 5E17F 3BJOA 5E20A 4R79A 4OIOF 5LGNA 3JAMK 2RGVA 2B0LA 2COMA 2ZBKA 2CW0F 3RKYA 5F6FA 3OV8A 1T38A 4JBAA 3RKXA 3IX4A 2G7UA 2HZTA 1MJ9A 4EM1A 5ICEA 3COAC 4HW0A 2A6EF 3TO6A 3R6SA 3ECHA 4I0AA 3RYPA 1FSHA 3CLOA 4WK8F 4EM2A 3MWMA 2FBKA 4OU0A 4JQFA 3EYYA 3V8KA 1V3FA 5HS7A 1VTNC 2QUFA 4IHTA 3VODA 2M87A 2D2WA 1ZARA 2GA2A 2VXZA 4KN7X 5ILUA 5E1WA 1JGSA 1U5TA 2H09A 3FMRA 2ACJA 4LG0B 4M71A 2EV0A 5IT9Z 1B59A 4LK0F 2BV6A 3ECOA 2EJRA 2BEOA 2PI0A 4L9VA 3SHFA 3ZN0A 4AD9A 1H9TA 1P2FA 4KYWA 1HKTA 1U3EM 1K7AA 3WE2A 4HX8A 3R0AA 4RB0A 1KQ8A 3IWZA 1UHWA 1F5TA 1G3WA 3CUQC 3T0YA 1JHHA 3L09A 1YFHA 5TJJA 3TOAA 2IA1A 5DD4A 5DYMA 3I54A 3Q9SA 3FM5A 1MJAA 5ILVA 1HW5A 3ZMDA 3HYIA 3PFIA 2K02A 4I2OA 4LJZF 4M72A 2L54A 5ICFA 3FWEA 1LDKB 3ULQB 1YQAA 1FYMA 4KDPA 4WWCA 1SD7A 3F3XA 2CG4A 3C7JA 1K79A 5A2QK 1XSVA 3JTGA 2V1UA 1BIBA 1G3YA 1WRJA 1ULYA 5HS9A 5J6XA 3RI4A 4G7OF 3P7NA 3KLOA 3WG9A 4UVAA 3TKYA 3B02A 1SFUA 3ELKA 4L9JA 4HV5A 2VBYA 3Q5FA 1B1BA 4F7ZA 2FMYA 2QBYB 2DQRA 3F21A 4AWXB 1RZ4A 2WV0A 1ZLKA 4NQWA 1W7PA 1ZRFA 1RNLA 3J80K 2FU4A 1DUXC 1Q1HA 2OAZA 4ASNA 4A0XA 4LFUA 2Z3YA 1KGSA 3C1DA 3GWZA 3KP7A 3C3WA 1TW3A 2EA4A 4B8XA 3BOQA 2VODA 2MH9A 3WU1B 1DPRA 3QPHA 3E6MA 3MQ0A 2BBYA 2RN7A 1EH6A 2NS0A 1YW7A 4IVNA 4A5MA 1S8NA 4EJVA 1BC7C 2FNAA 4PGHA 5HLIA 5FLXZ 3ML6A 2MD5A 2NNYA 4G94A 3GFMA 4A0YA 1OPCA 1IXCA 5L3CA 1XSDA 4PDKA 3CDHA 4HF0A 1FWZA 5TRDA 5L07A 2LF7A 1YIOA 2P5KA 3W6JB 5D5WB 3GFLA 2QM3A 1KU7A 3C18A 4OINF 5HDGA 3E6CC 2HQRA 1F4KA 4KFCA 4CGZA 1O3RA 2Q8KA 1TLHB 1I27A 2DW4A 3GO5A 3N97A 4DQ2A 4AIJA 4O3MA 6PAXA 1MKMA 2OZ6A 4LLNA 4DNCA 3ZMZA 1XSXA 3I58A 2XAQA 2AS5F 3TGNA 2M8EA 2LKPA 4GCVA 4U0WA 4BH9A 1C0WA 3HSFA 3K1MA 5CVRA 2IW5A 2PQ8A 2XIGA 1G4DA 5D5VB 4ESBA 3SQNA 5CJ9A 2STWA 3HOTA 2P6TA 3QP5A 5H20A 2P7CB 4I02A 1CF7B 4GGGA 2ETHA 4OIRF 1ON2A 2UXXA 1UB9A 2QLZA 2EA2A 3P9KA 4IF4A 3DEUA 1ZREA 3V8JA 2CSOA 1MD0A 3LWFA 2FA5A 2A07F 3CO6C 3H92A 3LQRA 3KLNA 3V7SA 2HDCA 4BNCA 1ZRCA 4XBFA 3QP1A 1O7FA 5LHIA 3ZMVA 1LEBA 2VC0A 4HLYA 2D1VA 1H0MA 2M1BA 4KUMA 1ZG1A 2JRTA 3F8BA 5BQTA 2VBZA 1ZG5A 5FD6A 3WGIA 2V6CA 2GZWA 4A5NA 4YFXF 3JPUA 4KNYA 2YX7A 3GXOA 4EQQA 5F64A 4HX7A 5J8FA 3VB2A 1FSEA 4AVPA 1XGSA 4BHCA 4GYGA 2J5PA 3EETA 1ZLJA 5CVIA 1TQIA 2HFHA 3JAMZ 1AOYA 3GZ6A 4MEXF 2L4MA 2VE9A 3E3VA 2XAFA 2OQGA 4RB1A 4MHGA 2HR3A 3LAPA 2OQRA 2W24A 5D6FA 2F5DA 4I09A 2Z33A 4GYIA 1J0RA 3F8FA 3IHUA 2H27A 3FX3A 3J7AO 1T98A 2G9WA 2XRNA 4UHTA 1IW7F 4ZH4F 1FLIA 4CHUA 2OD5A 4M9SA 1YO5C 1B9MA 4YFNF 3SFZA 4IRIA 5DCMA 1USSA 4FX4A 3MZYA 3EQLF 3FM3A 2CO5A 2F5CA 4OMYA 1R1TA 1J5YA 1L3LA 1K78A 2WWYA 2DO7A 4HYEA 3V8LA 2ZMEB 3L9FA 3CUQB 4H0EA 3QPTA 3JW4A 2MLGA 4KMFA 4PCQA 3T5XA 4IHSA 2LDUA 3KETA 1R1UA 4N9IA 2IA2A 4B09A 2GAUA 1R36A 3ZP5A 4MEYF 1S29A 3RYRA 4ENKA 2H6BA 3HTSB 1W5TA 1B9NA 4EJOA 2BE5F 3KZYA 4Y17A 5JI6A 3J81K 2K4JA 2IJLA 3EYIA 4M74A 1LDJA 1TBXA 4HZFA 2F5EA 1RI7A 5JR3A 2JZYA 4FT8A 3L2CA 1RIOH 1J2XA 3MCZA 1HBXG 5CVVA 2MC3A 4IRGA 1ZN2A 4OIQF 2JT1A 4OMZA 4U0YA 1BN5A 5A2QZ 1YLFA 3ISPA 4UV9A 2QZ8A 1EH8A 4Q47A 5H6RA 3IC7A 1PP7U 3BDDA 3HTUA 2XHKA 3V4GA 3LSTA 1MDMB 3IL2A 1IN4A 2DFIA 5HVQC 4MQ9F 1LB2A 1FOKA 2IRFG 3HHGA 2YR2A 2Z9OA 4YFKF 3J80Z 5J8CA 4LB6B 3HOSA 2MBFA 2WC2A 1GXPA 4QWQA 5CLSA 2YX4A 1U5TC 2ELHA 2A61A 3HUGA 2UV0E 4WCGA 1HKQA 3E5UA 3RPQA 5D5UB 4WX9A 5BOXA 3T1BA 1DPUA 3KP4A 4M9XA 4I98B 1QZZA 1EH7A 1LNWA 1SMYF 4G9YA 2V1XA 3BP8A 2RQPA 4KN4X 4S04A 3KP6A 1E17A 3F72A 2DLLA 1I6XA 3CTAA 4A6EA 5F1RA 1TQMA 5ERIA 1SFXA 3N4MA 2FRHA 2C6YA 1IN7A 1K6OA 2F2EA 5E8IA 1XDUA 3H3ZA 2ZO4A 3GEZA 1G3TA 4L0YB 4EJUA 3WGGA 5DEQA 4MTEA 1UFMA 4L5JA 2A68F 1Z7UA 3BPVA 3E97A 1G6NA 2P5LC 2DQLA 3CUOA 3I4PA 1HW2A 2FE3A 1H9GA 4RAYA 2OBPA 3IX3A 1LEAA 4O6JA 5IT3A 1D8JA 2ESHA 3WE3A 4EV0A 1I5ZA 2FSWA 4EM0B 2DK8A 2K4BA 4UVBA 1QZYA 1G3SA 1TNSA 3MZHA 3K2ZA 1WI9A 1OMIA 4YIFA 1PDNC 1D8KA 5D6EA 3V7CA 2KKOA 2V9VA 5FFXA 4Z2YA 2V79A 4RAZA 1UHMA 2RKHA 3L7WA 5KVRA 3DKWA 1P4WA 2HYGD 2P4WA 4HAMA 5BPDA 3LAJA 3WTTC 4D0PA 2DTRA 5H6QA 3BJAA 3I0TA 1GXQA 2GQQA 2A5YB 1FNNA 2ADUA 4ENMA 1XCBA 2QVOA 4P55A 3I59B 1IRGA 5JVTA 2CYYA 3BWGA 4UNOA 1ODDA 2W84A 1L0OC 1R1VA 5D8LB 1FBQA 3R61A 1YTYA 4ESFA 5CVUA 2KRFA 2O3FA 4R8HA 4N9HA 2Z99A 1STZA 5L3DA 5LLQA 3CJNA 4U88A 3MAJA 2VOPA 4Y15A 1HSTA 4LG0A 2HEOA 3VOEA 2VT3A 2XUBA 2KJCA 1FBSA 2HKXA 2FMLA 1R5HA 5AIQA 2MH2A 4Q5SF 4NB5A 4HDVA 4BHPA 5LEJA 3EDPA 4M73A 4CDGA 5JHUA 2KIFA 4Y13A 2L02A 2EV5A 1Z6TA 5LHHA 5FB2A 2P7VB 3QP2A 4L0ZB 2G7HA 2L4AA 3T8TA 3NEUA 1BBYA 2A6HF 4RB2C 1WQ2A 3E6BA 1T2KA 1HSJA 2A3SA 2EV6A 1LQ1A 3W6KB 2PN6A 3P9CA 2HKOA 4U7BA 1DDNA 1GHCA 2RV8A 2L3DA 3WTYC 5E1ZB 1EV7A 1Z6RA 2D1HA 2EK5A 4G6DA 1KU2A 1W7PD 2UZKA 1JHFA 1ZAOA 3GUDA 2KIUA 2XAJA 3QP4A 2CFXA 4RB3C 5D4SA 1BJAA 3FMSA 1Z9CA 1YW9A 3P9IA 5HS8A 4CZZA 2M45A 5D8KB 1BM9A 3WTXC 5EEHA 1IUYA 5LRRA 2CWEA 3S2WA 2DK5A 1OR7A 1KA8A 3K1NA 3JSPA 1XDSA 5DCFA 3FXRA 1IXRC 2MA3A 5K5QA 5K1YA 1SAXA 5E8GA 3BPXA 4R1HA 4BHBA 2QBYA 1J75A 4I01A 2PBIA 1FC3A 1ZHFA 3KZZA 3KP3A 4EGYA 1XGOA 1HKSA 4MNUA 4U0VA 1KYZA 2X0LA 3H3UA 4YG2F 4HV6A 1D3YA 3D5LA 1TW2A 4BAYA 1SD5A 3HRTA 1R22A 2QQ9A 3CO7C 4LB5A 2QWWA 2TDXA 1IAWA 3O2PE 4M9ZA 3J81Z 2XGXA 2X4HA 2Y0MA 2DPUA 1QQIA 2NYXA 4EMSA 3LFKA 2XKPA 4NHJA 4RS8A 1KQ0A 1XCVA 2P5VA 1HQCA 2JPBA 2GWRA 4KT5C 1W4MA 2VC1A 1KU9A 3WTUC 4EJTA 3GW2A 3HRMA 2PJPA 2EFNA 3RTRA 1ZH5A 2PMHA 4A2UA 3ERED 5LBQA 3SXYA 4A12A 2K7LA 2XROA 1ZG3A 1F9NA 4ZYHA 5BPIA 3TQNA 4AIKA 1BC8C 2OU2A 2RC4A 1XGNA 3NQOA 2FBIA 3HSRA 3AAFA 4I0BA 1FX7A 1U5TB 4CXFA 1NHAA 1QGPA 5E18F 1R7JA 3GZ5A 1TTYA 3KEOA 4G7HF 3OOPA 2RNJA 3U1DA 1S7AA 2QENA 1R5GA 1REPC 1YW8A 2XV4S 4KIBA 1MJBA 3WODF 2HWVA 1MGTA 1SD4A 4G7ZF 5HOOA 3T8RA 4EVIA 2LNBA 5HLHA 4HQEA 3ZQ7A 1U78A 5E1XA 5K5OA 1QBJA 2J5OA 1MZBA 4L18B 2PEXA 1F1ZA 1HW1A 3QRFF 4JK1X 4P96A 1J9IA 3F23A 4EJWA 3GLXA 3I5UA 2M5WA 2PFBA 3KCCA 3ZN1A 3K0LA 3EUHA 3FZVA 3VFZA 1SMTA 4FHTA 1FP2A 1OYIA 4A6DA 2GIVA 4OIPF 3ZMTA 5JFRA 1RUOA 5HDKA 3E6DA 3I71A 3O3KA 4GXOA 4HX4A 2XAHA 5DD8A 4K2EA 4EGZA 1CGPA 4G8XA 1RUNA 1P4AA 3K1PA 5BMZA 3TDUC 1BI0A 1AWCA 4ESJA 3RJPA 2GA1A 1O3QA 3QP6A 1ZGAA 2IT0A 3FF5A 3WGHA 2F5FA 3TO9A 3LQQA 3M9AA 2VBWA 1W7PB 4CO8A 1XMAA 4UUVA 3WTSC 1P4XA 4RGSA 3FXUA 1USTA 2K27A 3BJ6A 4XSXF 2P8TA 1IN6A 1KU3A 2VE8A 2FXAA 4WXDA 4BQAA 1FP1D 3WTZA 1OKRA 3E5QA 2IP2A 1Z05A 2KJBA 4LD5A 3RIRA 3U2RA 2PLYA 3HRSA 5LHGA 2L01A 2V1DA 3GVAA 2O0YA 4I7HA 5LEKA 1Z1DA 3ZMUA 4XSZF 2DT5A 2VONA 4WF2A 5K5RA 3HIFA 1XD7A 3FXQA 3M8EA 4LLGF 3BY6A 2NNNA 2E1CA 3JSOA 4U7DA 2EFWA 1KYWA 1B6AA 2YPRA 2D45A 5L09A 4WXHA 4QLCU 2XAGA 2LSOA 2AXLA 4HA8A 2ZMEA 4Q48A 2XVCA 3R0JA 2K86A 4UV8A 2FOKA 4ON0A 1XMKA 3CUQA 2HGCA 3REOA 1X3UA 4E70A 2KIMA 3M1EA 2JTVA 3NRVA 1WSUA 1JXSA 2LF8A 5L3BA 3D0SA 3LA2A 3ABTA 4G6QA 2DU9A 4PZJA 2ZKZA 1LJ9A 5HLGA 4HDUA 4FX0A 5DUIA 2EB7A 3K69A 2FF4A 4KIGA 3ZPLA 1WWXA 3LA7A 3PQJA 4RGUA 3FHZA 1R23A 2HOEA 4BXUA 5FO5A 1FZPB 2VN2A 4ZYDA 1FYKA 5FGMA 3DV8A 1BOAA 4LLLA 1PUEE 2YSRA 4IJAA 3V7RA 1YS6A 4KA4A 1O3SA 2WTEA 2BGCA 2OZUA 3QP8A 1W5SA 1B4AA 2Z5UA 1J59A 3F6OA 4ZZLA 4N0BA 4M6XA 2HYFA 3IKVA 5ILSA 3DP7A 4YIIA 3F8NA 1O3TA 1LVAA 3QU3A
chains in the Genus database with same CATH superfamily
1KQ9A 2Y2NA 1D5VA 1MBJA 2VOOA 2UXNA 2VB6A 1MDMA 1W63M 2JUCA 3O87A 1JWVA 1V4RA 4NEED 4KIFA 2JSPA 4QIWN 3HRUA 1D5YA 2ZJRF 4RYEA 1YYVA 2RDPA 1WCMJ 2V26A 2Y31A 3CMAI 2DFFA 2V1AA 3E2KA 3G2ZA 4OPRA 2YKHA 3R4KA 2LTPA 4XLEA 2W25A 2P9VA 4R3JA 1X1BA 3OL3A 4YEJA 3VWBA 3IWOA 3T4TA 5HWVA 3PO3J 3LA3A 1U8RA 1E2XA 1ETYA 2Y75A 1ZTRA 3RDIA 4XONA 5GAGJ 1C3BA 1DJAA 1HVBA 1L2SA 1QO0D 2VA0A 1W0UA 4XICA 2Q0OA 4NBQA 4ESPA 2MGQA 5IT9K 3TOBA 1T0FA 4RLFA 3L2QA 2FBHA 1X2NA 3G4PA 3NARA 3M6HA 3LSPA 4KQRA 2J9PA 2M30A 4LGWA 1XGMA 5LGUA 4FOFA 2ZCWA 3IKTA 2DPDA 3AL0B 1T0FC 1ES2A 3PFYA 4S05A 1I1SA 4LIVA 1EA3A 3LGOA 4CQHA 4D7NA 4X56A 2LBFA 3PM1A 2DOAA 4XRSA 3KYQA 3QOEA 2Y2MA 5EV0A 3G30A 3W3CA 2IA0A 4HESA 3VP2A 5KZHA 3SZPA 3IAM2 4II2A 4FISA 3X2QH 3LYXA 2EZKA 4R23A 5DV5A 1LPQA 3HVFA 2FQ3A 4P9UA 2QGUA 3IV5A 4DBQA 2XA7S 3G4SI 2JCHA 2MLKA 1BIAA 2XF5A 4A0ZA 1Y0UA 2BXYA 3MFKA 3F22A 2EFUA 2WKQA 4GB7A 2E7XA 3OMYA 2OUMA 4R4SA 2AVXA 3A3JA 2L9VA 2QJ7A 1QNTA 2PU4A 2A49A 4L5IA 2JRMA 1XA7A 5AONA 2Y69H 2VT2A 2Y48A 5CVJA 2XSSA 5A91A 2B5RA 2WAEA 2ECCA 5FDSA 3RZOJ 3V67A 1IV6A 4BYYA 2D02A 4HLXA 4WMCA 1O7LA 4ETSA 3HSEA 4CYDA 3H5AA 3OS2A 2GM4A 2XEPA 2VQHA 4KMUX 4OPZA 5FA7A 2R7FA 1AHDP 1N9LA 1S7OA 2RVCA 1OYYA 3V3RA 4CCLA 3BEBA 3SH7A 2ZNZA 1TNTA 1P92A 3E5XA 1FR6A 2OPTA 3K4MA 2JSCA 2ZNYA 5DDGA 4N9LA 1YSPA 3ABKH 3CUEC 3GDIA 1WKMA 1JJ6C 5BS6A 3CMYA 2J80A 4RA2A 5EEGA 2H94A 1ZRDA 4HRIA 2JC7A 3U2AA 2ZXJA 2DYSH 1PP8F 2IPQX 3WTWC 1NK2P 4E7SA 2JK3A 5GPCA 2R5YB 3TJZC 1R58A 2EZLA 4S2OA 2M34A 2Q9NA 2FNPA 4HQMA 4OOIA 1S6LA 5ED4A 2PAVP 5L3GA 2WUQA 2WKIA 3LNQA 4Q8IA 3F1PA 4Y7NJ 3LIFA 1EWZA 1T95A 2DI3A 4RM3A 2WKRA 4A3MJ 3ZQQA 3IWFA 3Q3SA 3OPHA 2QYOA 3UN7A 5L3FA 1DY6A 2JKTI 4WYYA 2ZQAA 4CYCB 3LIBA 2YU3A 1YLTA 2IS1A 2Y9YA 1Z09A 5DCMB 2OAQ1 3HUMA 4XLPF 1A04A 2EILH 2X6WA 3JTHA 4WXCA 3J7ZI 1ES3A 1L0GA 1WH5A 2Y59A 4BY1J 1DRMA 2O03A 5FFZA 3CC4I 3BC8A 1BSGA 1K4TA 3L2WA 4AVZA 1BLPA 1KGFA 3RKWA 2CGPA 2EPFA 2NXNB 2KRHA 3MXRA 1DGRM 2X02A 2XASA 3MD2A 4B3XA 4XT2A 2R7DA 1K78B 1QPMA 2PYRA 4TV7A 1I39A 2ZB9A 3O6BB 4N9KA 5ICGA 4A3EJ 3IXDA 4U0XA 3LIAA 2QKPA 1JJ8C 2CUJA 1IN8A 3KE2A 4MTDA 3S15J 4NG2A 3BFFA 2LC2A 2XKOA 2XSJC 5IP9J 5LRSA 3PBOA 1OR7C 4ENNA 1BI1A 2OA4A 4RMNA 4ARZA 1MNMC 2EIKH 3DTMA 3EQUA 4D5CA 4QU3A 1EW0A 4JX5A 4DBRA 1Z21A 3KYCB 2YS9A 1MMNA 1MNDA 2W3DA 3HOYJ 2GXGA 4BACA 1JE8A 3W2AA 2VGLS 3ROUA 3UMDA 3DPLC 2V6EA 3V5MA 2K40A 4XRFA 4RQ9A 3S17J 3KEYA 4UXNA 3PSIA 3OCLA 5FRNA 1HA8A 3D4FA 3ZNTA 2BY2A 3E1SA 2J3TD 1IN5A 5HZHA 1MMDA 1WGXA 2K9MA 3G2YA 4HF2A 5KIZA 3VYUB 3WU0A 5J1YA 3BFEA 3R60A 1HXDA 4MGRA 4GDNA 5CEDA 4UVCA 3Q9VA 5LGTA 1D0ZA 3K9TA 3MZDA 4K91A 3FIWA 5FD5A 2CC1A 4E7KA 5IYCJ 1T39A 1K56A 2DBBA 1FBUA 1SFEA 3F8MA 1BI3A 3IRRA 3ZVTA 1IF1A 4BBVA 2E1NA 1FOFA 1Z91A 3P09A 2WGIA 1OFCX 3ABUA 1JUSA 3CF2A 2MG4A 2F4IA 3MKEA 2DOFA 4K08A 3LSIA 4H6JB 4R38A 5KK1A 1K57C 2VKDA 1T6SA 3S3OA 4L9FA 5GP9A 4DJ3A 3CJQB 1OCRH 2QQAA 5EGOA 1PYVA 1YI2I 4RX3A 4KQOA 3ITBA 2JMWA 4X68A 1NLZA 3OY9A 2OSUA 1OTIA 5DFXA 4HBLA 3IRQA 4Q4ZF 1TDLA 4ZAMA 4G3VA 3I59A 2EH3A 1Y1WJ 4C2TA 2HP5A 3RXWA 1T1BA 3VE4A 4ZDPA 3GYHX 4BDYA 4M3EA 3OYNA 3IX8A 1MXOA 1SD6A 1LLBA 4G3KA 3G6EI 2O61A 2Q2EA 2XRLA 1WI3A 2Q1ZB 3V3SA 2R5ZB 4X1LA 2QQBA 1TP4A 2H6CA 2WAQN 2JKTM 5JYOA 1YLZA 1A0KA 4BXXJ 4L9TA 1PUFB 2OWHA 2EFPA 1ONVA 2NOGA 3S3MA 3BWLA 4JXGA 3C7VA 2ESNA 3PUBA 3TO7A 2EWNA 3ZMSA 5FLXK 3A3DA 4UAAA 2PMUA 1T56A 1S1YA 4M6YA 1GLNA 3RPUA 5DS9A 4XOPA 1KE0A 2XR0A 4DKIA 4M3BA 1F9IA 5DTDA 1OCZH 2A69F 2P08A 3L00A 4LK1F 4P1WA 4V2GA 4AC0A 1X0OA 2KOIA 3G73A 1XJ6A 4OONA 2STTA 3DPTA 3U9GA 4BEHA 2Y2LA 2XGEA 3BR3A 1FOYA 3KYDB 4L5EA 1MWUA 3F8CA 3CCLI 1UCRA 2IS6A 1NXYA 2H0YA 3TG9A 3TDZC 3GFIA 1O7EA 1ESIA 3BTIA 3IAS2 4GHIA 1J7KA 4O5VA 3L7HA 3GFJA 3WS2A 2ZMFA 3H5NA 3G3ZA 1TQPA 3GTPJ 3FMQA 5IOYA 3WG7H 2M7AA 2BHYA 1R71A 4ZYGA 1P6RA 1I1GA 3LIDA 1IGNA 4WN5A 1O57A 3BECA 3SEQA 2K3FA 2HS5A 3UNWA 4ENJA 5F69A 5HNHA 1IXSB 4CZCA 1IZ1A 5HD5A 1R00A 3UE6A 3DWZA 4HOBA 4PM9A 2UWXA 5L8MA 5KCMA 1OYWA 2HQNA 2X6YA 1AU7A 1ACFA 1LL8A 2VX8A 3IH2A 3K4CA 3GLLA 3I53A 4YRVA 3NDEA 3UDIA 4FCYA 4BLMA 4MQVA 1LSVA 3JRAA 2W0NA 4OQHA 5CGXA 1MMGA 2CFOA 4CCJA 3GX4X 3M4OJ 3O88A 1FPQA 4HY8A 3S8PA 2NVQJ 2NAZA 1SAUA 2BYVE 3BZ6A 4QWOA 5CECA 4IRHA 5B3SH 3LL7A 3S93A 4CSWA 3W4QA 1OJLA 5JVGF 1U0JA 1RRJA 2HDRA 5DTKA 4IPAA 2QEXI 1VF9A 2CQKA 3GR2A 5B1BH 2H0TA 2W57A 2XFSA 2VBXA 2R3SA 3HUGB 3IBRA 1NRJA 2Y91A 3Q0WA 1V54H 3DFGA 4RGXA 4KUOA 3KYLA 1JTXA 4JP0A 2ZJ2A 3DXJF 1KVLA 4OWRB 2HPBA 2KX6A 1M6KA 3IS2A 5TR7A 1XC5A 3U4LP 1PZOA 5FAPA 1ZYRF 3SZTA 3BG3A 5FQQA 1X4OA 2K85A 1PZPA 4CICA 2LMDA 4GOGA 1IFQA 3T4KA 2EFQA 5KNLA 3GTLJ 2ZOHA 4D7MA 2ZC2A 4QTRA 2R7XA 2GX5A 9ANTA 3OS1A 1LDDA 3BG6A 3I64A 3S1QJ 3G6OA 4Q0IA 1S3JA 1FT9A 5FI6A 3PBSA 4JF6A 1GVJA 3OYJA 2HQAA 4N4OB 2TRTA 3BROA 4HF1A 2DAOA 5IYDJ 1VEUA 4ZYEA 2GOXB 3PIOF 2BY0A 1FILA 1PVEA 1I50J 1ALQA 2XDVA 5LBRA 2KMUA 1XMXA 4LMYA 3UB8A 5J4YA 3F1NB 5AIPA 3O8HA 1T8IA 1N9BA 4IZZA 2V9AA 3HJKA 5EPHA 3AFHA 1KVMA 2HI3A 2CJJA 4P5OA 4RGRA 2QSGX 4GLQA 4ZZDA 2NRAC 2R7ZJ 5E2EA 4KENB 2UWMA 2E7WA 3GF2A 4A3GJ 3DQVC 4BS9A 3RJUA 3QU6A 2R9WA 1XB4A 2JPCA 1VQNI 2VV7A 2FEZA 1CF7A 5L10A 3HLGA 3D1NI 1ZR4A 1OLTA 4PSXA 2VZWA 1JWZA 1CI8A 4E3NA 3T4QA 4AIHA 1ERQA 2R7OA 2ZBBA 2CMPA 1GV2A 1YS7A 1BA5A 2XB5A 2KLIA 4NXEA 1X4PA 4AYBA 4J00A 3KFWX 3QYBA 1YG2A 2EXAA 1Y6IA 5DUKA 2W3HA 4IHYA 1F36A 4XM3A 2GXBA 1JWPA 4ZJ2A 4GO1A 4FUWA 2GBYA 5IT5A 3BFDA 3QAHA 3ZRGA 1QMEA 4F52A 3M7GA 2EWVA 3M8FA 4ZDLA 3GBGA 3WTVC 5TBMA 4D5FA 1FYLA 3BY9A 5CYVA 3BG9A 5D4RA 3Q82A 2ZL1B 4IOCF 2W4SA 4E6XA 3C38A 2QKMB 5J3LA 3SH8A 2AQFA 3CMMA 3OOUA 1HF0A 3EUHC 2EFOA 5J1RA 3NBLA 4XLNF 2A24B 3HKZN 3B73A 1IRFA 1PI5A 3BG5A 4M6VA 1U2WA 2AQEA 2ISYA 2JN7A 4L9NA 1BULA 4F3QA 1ZGJA 4MBHA 1U6GA 5D5XB 2O8XA 4C3HJ 2HTJA 2ISZA 1UGUA 1G6OA 3PQKA 3NDGA 2HTSA 4X53A 2KZVA 3OYFA 1ON1A 3DBLB 1MSEC 2ZLYA 3HHHA 4HSRA 4PJ0C 3A3FA 1J9MA 4IXAA 2ZFWA 2RREA 4PJLA 3FISA 4LRZE 2O6GE 3SS3A 3KP2A 1XN7A 5ICCA 3NECA 1A36A 2IVMA 3KP5A 4JGRA 3F6VA 1BI2A 3FBNB 4PGGA 5HDNA 1FY7A 1SC7A 3DF8A 4C2UA 2P6SA 5CKTA 3MEXA 4KICA 4NC8A 4GS9A 3H82A 3RXXA 3VEPA 3VYSB 3KEQA 4P9FA 3OSFA 2PG4A 3OYAA 1DP7P 1LL5A 1K4FA 2VQGA 3GCMA 3QOPA 3UPPA 2W85A 3VE3A 5I94A 5L3EA 3HGYA 5E17F 1RKWA 1VQLI 1F43A 2JHEA 3BJOA 5E20A 4ZDOA 1TT0A 2INWA 3E4OA 3JRGA 4R79A 2ID3A 3JRFA 4WEKA 4OIOF 1I5QA 4UA7A 5DTSA 2OOLA 1QZEA 2W48A 5LGNA 3JAMK 3ZVWA 2PR6A 2RGVA 2B0LA 3VYRB 2X6XA 4ZJ3A 2COMA 1W8QA 4X55A 3W4PA 2LVSA 3HLCA 2ZBKA 2CW0F 1H5XA 5CPRB 3RKYA 2Z2SB 1NLYA 5CXWA 5F6FA 3OV8A 2O9LA 5J8XA 4MFEA 2RQQA 4XRSG 4JBAA 1T38A 3BTCA 3RKXA 1G28A 3IX4A 3K70D 1R5ID 2E2JJ 2G7UA 2ZC3B 4OPQA 2MW8A 1HD8A 4B93A 3CPTB 4BL2A 3C2GA 2HU9A 2HZTA 2ZMAA 1MJ9A 1S5LC 3HZJA 4EM1A 5ICEA 3COAC 4CCNA 2KPMA 5G18A 2M2EA 2A6EF 4HW0A 4II3A 3TO6A 2BY3A 4UUSB 3HREA 4CCMA 4RX2A 4D2OA 1XFNA 2Q9MA 2XPVA 4WBGA 3LR0A 2OAP1 3K6GA 3R6SA 2W27A 1LUJB 2Y4AA 4DDSA 3O3VA 3ECHA 2Z2MB 2R7RA 2Y2GA 3IBJA 3VOYA 3N05A 4B1RA 4I0AA 3RYPA 2JA6J 3S16J 1FSHA 2HYJA 1P97A 1VETA 5GAEJ 2E34A 3MS6A 3CLOA 3FKVA 4WK8F 3K3CA 2Z6DA 4EM2A 3MWMA 2FBKA 3WHBA 1UG0A 5M5XJ 4I38A 2OTLI 1JI8A 1Y4OA 5F0HA 5FRMA 2Y2KA 1IYOA 4OU0A 2IS4A 4JQFA 3DPUA 3EYYA 4AIDA 1W7FA 2VV8A 4UQIM 3MN2A 3V8KA 1V3FA 3CCEI 2OJED 2G0EA 3H9GA 4PM7A 5HS7A 2L7ZA 1VTNC 2QUFA 4IHTA 5FKOA 3VODA 1WJBA 2CUZA 2D2WA 2M87A 3KIOA 1ZARA 2A6TA 2GA2A 1V9YA 2VXZA 4KN7X 1MC0A 3PNTA 5ILUA 5E1WA 3PIPF 1JGSA 3FPWA 3S1YA 2VGKA 4GJ4A 1OQYA 2JKFA 4LPZA 3TSGA 1N77A 1U5TA 2H09A 3FMRA 2LBFB 3ZCOA 2ACJA 1NRFA 1YMXA 3OYMA 2NUPC 3CCQI 4LG0B 4M71A 4A3FJ 3OYGA 2L1MA 3IP4B 2WGVA 3E4QA 2EV0A 2VJ4A 1B59A 5IT9Z 4LK0F 3WU2C 3A0BC 1LFPA 2BV6A 4MBKA 3ECOA 2ZSIB 2IS2A 2VI6A 3TP3A 1XPXA 4HEFA 4O0PA 2R7WA 2EJRA 1YJWI 2BEOA 2PI0A 1FSYA 5B66C 4GKUA 4B44A 4B43A 4L9VA 2LLKA 4ZYAA 1NZUA 4MBFA 2HJEA 2EINH 3SHFA 3ZN0A 4M3KA 2HOSA 2DA1A 4AD9A 2HOTA 3CLQA 1H9TA 1WJDA 1P2FA 4KYWA 1HKTA 1U3EM 3FC7A 1K7AA 4XLCA 1YLPA 3WE2A 4HX8A 4JPMA 3WRTA 2ZMEC 3R0AA 3QHYA 3T4LA 1QHHD 4RB0A 3UDFA 2JQ7A 1KQ8A 3IWZA 2KHMA 1UHWA 1F5TA 2HDQA 3N8SA 1G3WA 3KSFA 3OYIA 3LSJA 1MBLA 3W4OA 1LHYA 1RESA 3CZDA 2LD5A 3CUQC 1RETA 2EIJH 3T0YA 1JHHA 3J7YJ 2ZOIA 1CQTA 3B6CA 5EM0A 4BUPA 3L09A 3GTQJ 3O5YA 4N1HA 4JGPA 1YFHA 5TJJA 1E3PA 3UE1A 5HODA 3TOAA 2IA1A 5DD4A 5DYMA 4X6TA 1JUPA 3IQAA 5FSRA 2W1TA 1KE3A 2B63J 3I54A 4OVDA 3G71I 3FZCA 3RQ4A 3Q9SA 5GAHJ 1V5FA 3ZGKA 3A2KA 3C8CA 5A90A 2Y9ZA 1G2HA 2L7KA 2XD1A 4IJGA 3FM5A 4E6KG 1BR2A 1O4XA 4S2KA 4IHWA 1MJAA 5ILVA 1HW5A 3E2LA 2VKSA 3T4JA 3ZMDA 4LV1A 2JUGA 3HYIA 3PBQA 3PFIA 2K5CA 2K02A 4QPQA 4I2OA 2ZXHA 3EPZA 4LJZF 4M72A 2H8WA 2L54A 5ICFA 3FWEA 1LDKB 3ULQB 1SHVA 1MSFC 1YQAA 1DJBA 2VJWA 1FYMA 2DA3A 4KDPA 1UZCA 4FH2A 4WWCA 1SKOB 4L9EA 5HARA 5HPFA 3FWLA 3OWTA 1WE4A 1SD7A 2FX0A 3F3XA 2MYSA 3GTJJ 5FL3A 4HNUA 3MKYB 2CG4A 3C7JA 3BFGA 1K79A 4B9OA 4A3CJ 4CLCC 1FTZA 4B88A 4DRTA 1HOMA 3K3DA 4E7ZA 1VQKI 3BTJA 2L7MP 5A2QK 5F82A 3FXJA 2GNXA 3BM6A 1XSVA 3JTGA 2L2OA 4E7HA 2P74A 2V1UA 1ZKJA 1BIBA 3BCBA 1NG6A 3RCOA 4XT2B 1G3YA 3L2VA 1WRJA 1W36C 1ULYA 4V19K 4GDBA 4EUVA 5DF8A 2KDOA 3R7WB 2LY1A 1UMQA 5HS9A 5J6XA 3GTMJ 2LOOA 4OPYA 1CJFA 1XX5A 3RI4A 1NTCA 3S1NJ 4E3JA 3FKIJ 4G7OF 3MZFA 3HPHA 3P7NA 3ZR8X 3KLOA 1FIKA 3WG9A 1YAXA 4DE1A 2XF6A 4UVAA 2DN0A 2ECBA 3NWSA 2TCTA 3TKYA 3LI9A 1PW8A 3B02A 2C5WB 1I2SA 1SFUA 4KG5A 1IOUA 3ELKA 4L9JA 3S2DJ 3SW1A 2PBYA 3RQIA 2ZJQF 5FROA 5GADJ 4LOCA 4P85A 4HV5A 5HFOA 2E5NA 2VBYA 3Q5FA 1B1BA 2DJIA 2FMYA 4F7ZA 2QBYB 2DQRA 2NVTJ 1BW5A 5K7FA 1SDNA 5KSHA 1K6RA 2H28A 3F21A 2M3AA 2PDRA 2FZ0A 4AWXB 5EVIA 4S2JA 1IKIA 4S0HB 3ZG5A 2Y8HA 1RZ4A 2I5UA 2WV0A 2XPUA 2X85A 4NQWA 1ZLKA 1SEUA 1W7PA 1ZRFA 3D72A 1RNLA 2VKEA 3DEEA 2FU4A 3J80K 1DUXC 4XQFA 3E98A 3NOUC 1Q1HA 4FD8A 2OAZA 4AM3A 3HBLA 1PW1A 1NH3A 2WKHA 4ASNA 4A0XA 4KZ5A 1XS9A 2BW3B 4E7IA 2LREA 4CCOA 1NWZA 4C9YA 4LFUA 2WKPA 3T50A 3ZG9B 2DFEA 1ONGA 2OLVA 1YKDA 3G35A 3OPLA 4IHXA 3K2AA 4F3LB 2Z3YA 3EUKL 2G2UA 4C75A 3ISGA 2FQ4A 2HGVA 4X25A 1KGSA 3EQVA 3C1DA 3SS4A 5IOZA 3GWZA 5F1FA 3KP7A 3NJAA 2PJRB 4C30A 5F08A 1OTEA 3E0JB 3TL4X 3C3WA 1TW3A 4B3AA 2EA4A 4M3GA 2NVUB 1VQQA 5GHZA 4DE3A 3IH4A 1E3UD 4B8XA 5CEBA 1K83J 1JKQC 3BOQA 2VODA 3HJEA 3H9WA 3UB7A 4BE2A 2KDKA 5CGWA 2M7VA 1MMAA 2VQLA 5AQ9A 2MH9A 2YUSA 3WU1B 4EWFA 1DPRA 4FTHA 3QPHA 4EEFG 2IBDA 3E6MA 3MQ0A 1ES5A 1IEMA 5EZHA 2BBYA 5FKMA 2RCXA 2RN7A 1EH6A 3MKZA 2QWSA 2NS0A 1YW7A 4JGQA 4IVNA 4IHVA 2ZMVA 2DTZA 2JBFA 4A5MA 1S8NA 4EJVA 2I10A 5DF9A 1BC7C 3M3YJ 3M07A 3CCJI 1FQGA 1WJ5A 5CQGA 1TWGJ 4R0QA 2FNAA 2V2FF 4PGHA 3JRDA 5HLTA 1MWSA 4BDZA 4CLCD 5DM7F 2DT7B 5HAPA 1TEMA 5HLIA 1Y54A 1Z0XA 5FLXZ 4N92A 2Y0SA 3ML6A 1TS6A 3P98A 4R1GA 1X1AA 3HEFA 1G5UA 2MD5A 4GHIB 4P6BA 2NNYA 4G94A 3GFMA 4A0YA 1OPCA 1W36D 2COBA 1WJAA 4EU0A 1IXCA 5L3CA 4R6LA 5GLBA 4W1UA 2OF7A 1XSDA 1CEGA 3NCKA 4PDKA 3CDHA 4N1XA 4HF0A 3HGGA 1H8ZA 2MD0A 2W82A 1FWZA 2QQ8A 5TRDA 4IOAF 5CTMA 2R7TA 5TFQA 5L07A 2LF7A 3H36A 4Y3OA 1YIOA 2P5KA 3W6JB 1B72B 5D5WB 3GFLA 4NXBA 4ETZA 2QM3A 1KU7A 5IU1A 3C18A 3CCYA 5HDGA 3ABLH 4OINF 3ZQFA 3E6CC 1RR7A 4IEJA 2DMWA 2HQRA 1F4KA 4KFCA 3H7WA 2EFXA 5F83A 3FXOA 3CCUI 1YQSA 4AFIA 3BCAA 1IYPA 3DCFA 3S4XA 4CGZA 1O3RA 2PRFA 3S7PA 2UV1A 1QVUA 2Q8KA 3LSKA 1TLHB 1X3ZB 2PX9A 4MIMA 4Q0HA 3A1YA 1I27A 2DW4A 1XG1A 4EATA 2KP6A 2VJ5A 5FEGA 1P9QC 3GO5A 3TRCA 1WJCA 3N97A 4HJ6A 4DQ2A 2X6OA 4AIJA 3V50A 4O3MA 4IVIA 6PAXA 3K4NA 1K4EA 1MKMA 2OZ6A 4LLNA 1A5JA 4DNCA 3N7WA 3I9V2 3BYDA 1LKXA 3ZMZA 1XSXA 4EW7A 3I3LA 3I58A 5EG0A 1F5MA 1KONA 2Z1DA 3C30A 2XAQA 1RP5A 2Z6CA 3NIAA 2AS5F 3TGNA 2M8EA 4OOLA 1FSWA 4JBFA 4QPRA 5HD3A 5IS1A 2LKPA 1AKHA 5FKNA 3HDDA 1UWPX 5EVEA 5GLCA 4GCVA 4U0WA 4BH9A 2K7SA 4XORA 1C0WA 3HSFA 3K1MA 2V20A 5CVRA 2IW5A 2PQ8A 3CMEI 4PKYG 4BQNA 2WGWA 2XIGA 1G4DA 2K2NA 4KZ7A 4BGDA 5D5VB 2ZC4B 4ESBA 1IUFA 4XN3A 5EJCA 3SQNA 1LE8B 3BY8A 5CJ9A 3AGFA 2ZC7A 2STWA 3DKXA 3HOTA 1KE4A 5FKKA 2P6TA 4O01A 1H88C 3QP5A 5H20A 3OYCA 1K55A 5B5EC 1JNUA 1ZELA 2HVQA 1B8IB 3GTKJ 1GSXA 1RGYA 4IBRA 2P7CB 4BD0A 5M3FJ 4I02A 1WYBA 1CF7B 1XKZA 1IYSA 1W5CC 4GGGA 2ZC6B 5HL1A 2DA6A 2ETHA 5HNFA 1DP3A 1XP4A 3EWKA 1YLJA 4OIRF 1ON2A 5LD2C 2ZXIA 1UAAA 2UXXA 2BTFP 2KISA 1UB9A 2QLZA 2EA2A 3P9KA 4IF4A 4NETA 3DEUA 1ZREA 4ID4A 3V8JA 4BBRJ 2XD5A 3DW0A 3JVUA 2IAIA 2KFDA 2VJIA 4E4HA 1UWNX 2R78A 2CSOA 4OOMA 4P6ZM 1MD0A 4F92B 4LENA 3LWFA 2LG4A 1U60A 2H1LA 1ETWA 2FA5A 2DJNA 2A07F 3SJMA 1JVJA 3CO6C 3MXSA 4HBUA 4IHQA 3H92A 2W3FA 5TBMB 4UA6A 1ORKA 1ESUA 2NVXJ 2ELJA 3LQRA 3KLNA 4GDFA 1YSQA 3GMEA 3Q7VB 4JXVA 1Z77A 4QD4A 2Y2QA 1GSWA 3V7SA 4WMCD 1YRNA 2GOMA 2HDCA 4XNFA 5EYRA 4PFOA 4BNCA 5J1UA 1ZRCA 5G4ZA 1BTLA 3QQAA 4XBFA 1H89C 1S72I 4G12A 2EX9A 3IWIA 3OC2A 3LSMA 3QP1A 1O7FA 2ELKA 4XUZA 2GIZA 3FXKA 5LHIA 3ZMVA 3SOIA 3KSIA 1LEBA 2VC0A 3SZGA 3JVVA 1PI4A 2JA7J 5C44J 2PHYA 5CTNA 4HLYA 3EEAA 3B42A 2D1VA 1H0MA 2PMZA 3UR3C 3NY4A 4I39A 2M1BA 3FV7A 4KUMA 1ZG1A 1ODVA 3U21A 3H5RA 1TT5B 2XPWA 2DMPA 2JRTA 3F8BA 5FJ8J 5TISC 4HEA2 2K9LA 2VBZA 5BQTA 3ASOH 1ZG5A 4BY7J 1VQ7I 2XK1A 5FD6A 4MMNA 4HPQA 3JREA 1OT6A 3H82B 3WGIA 1XFQA 3TW8A 5FI7A 4B4CA 1GT0C 1IRZA 1OJGA 2V6CA 2R4GA 2GZAA 3M2JA 3ZYTA 3GZNB 2GZWA 2L7FP 4A5NA 2G2WA 1HDDC 4YFXF 2JA8J 3JPUA 4MCWA 3LFVA 3M6BA 3HOVJ 4KNYA 1S0WA 3IWQA 2YX7A 4NDLA 1JT6A 3GXOA 4EQQA 5F64A 4XRMA 4HX7A 2CS3A 3NULA 4PK4A 3ERMA 5J8FA 3OYHA 3VB2A 1FSEA 3BLSA 3OZHA 1R4MB 5HW3A 4AVPA 1CF0A 1XGSA 3ONQA 3S7OA 4BHCA 4GYGA 2J5PA 3CP2A 2EX2A 3EETA 5AQBA 2HNHA 4WL9A 4DDYA 1ZLJA 5CVIA 1UHSA 1TQIA 2HFHA 4GRIA 3JAMZ 1AOYA 3WS4A 1OJ5A 1XX2A 2V1ZA 2CUFA 5FLVA 3GZ6A 4MEXF 2L4MA 3BRMA 3HLWA 5FEFA 3K4BA 2E71A 2VE9A 1QMFA 4IEDA 3E3VA 2WYXA 1T1CA 2L9NA 3F0CA 5E2HA 2XAFA 2OQGA 4RB1A 1R9TJ 1K6SA 5CX7A 4MHGA 1ES4A 5U47A 1GCEA 4C3QA 2HR3A 2OQRA 2W24A 3LAPA 3PNVA 5D6FA 2A3UA 3DTEA 2Z16A 1S9HA 1QRYA 1V9ZA 2F5DA 3W6VA 3MZ8A 4A69C 2KRCA 2E60A 4I09A 2Z33A 2J9OA 4GYIA 1J0RA 1P7IA 2M9HA 3F8FA 2W1RA 2IXSA 3A0HC 3VSKA 3UMEA 3IHUA 3S22A 4O8GA 4IQJA 3QPLA 2ID6A 1YMSA 2H27A 1SCWA 3FX3A 3SYTA 3ZQGA 2WB1A 3J7AO 1T98A 4U3TA 5EUAA 2G9WA 2KT0A 2XRNA 3U1KA 4BE1A 3HOXJ 2CQXA 1G59A 1XJ3A 1POGA 2VJJA 4ZTJA 2JE5A 4KZ9A 4XL9A 1LI9A 1TVFA 2R5YA 4UHTA 1IW7F 4ZH4F 1IG7A 4F91B 1FLIA 2E8JA 4CHUA 1OTBA 2OD5A 3PYPA 3MFXA 1Y0NA 1ETQA 4L0LA 5FQIA 4ETXA 4KQQA 3GMWA 2AO9A 3OBFA 4M9SA 3OPRA 1K56D 3TEDA 1YO5C 1B9MA 2LB9A 3VDXA 5CGSA 4CYCA 2K9NA 1X19A 4YFNF 3SFZA 2CV2A 2X48A 4IRIA 5DCMA 1USSA 2VPLA 3BQ8A 1NZOA 2Y30A 4Z9QA 2X1DA 4FX4A 3CHWP 2KLOA 5JYPA 4M3FA 1I3QJ 1CI9A 3DTIA 2LRDA 3MZYA 4LITA 2W3EA 4IKFA 3EQLF 1GV5A 1Z3XA 3VPRA 4KZ8A 1P0ZA 2BVLA 3FM3A 4L9GA 4S2LA 2CO5A 5DKKA 2F5CA 4OMYA 3UE3A 1BZAA 4GNUA 1R1TA 1J5YA 3VP3A 1L3LA 2X1CA 1K78A 3BJNA 2WWYA 2DO7A 4HYEA 5HL6A 4HHDA 3V8LA 2ZMEB 3ZCZA 3PSFA 4DJ2A 5JHFA 2MJ6A 5EVLA 2ZJ9A 3L9FA 3JRBA 5K7HA 4KITB 3UO9A 1YT4A 2CUEA 5E43A 4BJPA 3TW7A 4X0GA 2DNSA 1DJCA 4OQ0A 3CUQB 1TWAJ 4H0EA 3QPTA 2ZM0A 1YJ9I 2M4KA 4KISA 1E3OC 3MQQA 3JW4A 1P7JA 2MLGA 4KMFA 4I3AA 2H10A 4PCQA 3T5XA 5IP6A 3B47A 4F55A 4D1QA 4IHSA 3MKWB 2LDUA 1TL8A 3T1SA 3KETA 2QJ5A 1R1UA 4N9IA 2IA2A 4B09A 3RPUD 2GAUA 2IGOA 4B4ZA 4OP8A 3CJRB 1R36A 3ZP5A 4R3BA 4MEYF 2VKHA 4XKBA 3A01A 1BT5A 1D1AA 3A0VA 1S29A 5M18A 5CHJA 3RYRA 4C3IJ 5FDHA 1MBHA 2H6BA 4ENKA 3ULFA 1BLHA 4J01A 1K54A 3HTSB 1K25A 3EOIA 1W5TA 1B9NA 4EJOA 2BE5F 4XLAA 4XKWA 3AG1H 3KZYA 3VOZA 3N8LA 1A35A 4HH3A 4Y17A 5JI6A 1PWDA 1EROA 3SDGA 2QPNA 4BKXA 1ITYA 3J81K 2QZ6A 2VPRA 1CQAA 2E1OA 2K4JA 2IJLA 3EYIA 1MBGA 3ZQIA 4IX7A 2YU9J 4M74A 1CK3A 1SDEA 4H6JA 1LDJA 1TBXA 4HZFA 2F5EA 5GTIC 2DOEA 1RI7A 1HCRA 1Q2PA 2MFZA 4CLCB 2RL3A 5JR3A 2JZYA 4MO7A 2FFFB 4FT8A 4A3KJ 3FYZA 3L2CA 1YLWA 2M7UA 4RLQA 1VM1A 3DAVA 2LP0A 5M3MJ 2ZJPF 2JWTA 1GDTA 3C7UA 1RIOH 1LFUP 3HBRA 4GD8A 3OYLA 2J8YA 1NYYA 4S2NA 2D01A 4R4RA 2QKLB 5EM1A 1J2XA 2VV6A 4PJJA 2N8GA 3MCZA 5IYBJ 2X9DA 2ZXWH 4Z6YA 1HBXG 5CVVA 3LY3A 3Q81A 2MC3A 4IRGA 1ZN2A 4D9JA 1XJ4A 2HP6A 2HOAA 3WRZA 4OIQF 2W3GA 2JT1A 4QY6A 4OMZA 4U0YA 1BN5A 5A2QZ 1KOUA 1XXMA 2HVSA 3RZDJ 4DZPA 2NUTC 3RH8B 3C2BA 4XUXA 4DF6A 4BU2A 2XQZA 1LI0A 5E2GA 1YLFA 3ISPA 3P5JA 1IRXA 1Z7LA 3CITA 4UV9A 3CI6A 2E5ZA 2QZ8A 2V4JC 4WEJA 1EH8A 4Q47A 5H6RA 2HPMA 3O86A 3IC7A 4O7DA 1OISA 4XLHA 5A92A 1PP7U 5CHUA 3BDDA 2O7OA 2DRWA 3HTUA 3H9QA 1VQPI 1BLSA 2QA4I 2HDSA 4U87A 5IY5H 3V39A 3T1XA 2XHKA 3V4GA 1TDGA 3LSTA 4Z1WA 1MDMB 4V2FA 1ERDA 1L0DA 2Y2OA 3IL2A 3IF6A 5EF6A 1QA6A 3VP0A 2M0CA 1IN4A 2CRGA 2DFIA 5HVQC 4MQ9F 1E4DA 2CQNA 3I56I 2V0WA 2WV1A 1OPXA 1F98A 5GHYA 4DMZA 3K4KA 2P9VB 1WHUA 1W1WE 1LB2A 2R92J 2X1EA 1BLCA 4JLFA 4KZ3A 1FOKA 2IRFG 1WA9A 3OSGA 2I72A 2E8IA 3SH9A 3HHGA 2ZQ7A 5F68A 2YR2A 3FK6A 2HQ5A 4ZTFA 2Z9OA 4YFKF 5BNGA 2VLGA 4Y2FA 4YWZA 3J80Z 5J8CA 2LY9A 5D3OA 3HLBA 4LB6B 1Y8QB 4PPRA 2Y2HA 5F1GA 3HOSA 1N78A 2MBFA 1D1BA 4OKPA 5J3WA 3QODA 2B02A 1S67L 5EEAA 2ICWG 4E04A 2CV1A 4JF5A 3DWKA 2WC2A 5F5YA 1GXPA 4QWQA 5CLSA 2YX4A 4IUHA 5IP7J 2VUMJ 1HC8A 1U5TC 1XA1A 2ELHA 3G1OA 3EGXC 2A61A 5E2FA 3HUGA 2UV0E 3D5RC 4A3IJ 2B9SA 4XR6A 1DP9A 4WCGA 1VQ6I 1HKQA 3W8KA 3E5UA 3RPQA 1HLVA 4KQDA 5D5UB 4LCLA 4WX9A 1V5EA 5K7ZA 5BOXA 2F5VA 5FATA 4EESA 2A2LA 2CMNA 2M1CA 4JXWA 3T1BA 1VZ0A 1DPUA 1QPIA 4I3IA 2Y2JA 3KP4A 4M9XA 4I98B 5HAQA 1K61A 3OIQA 4PSWA 2A5WA 2CQ7A 3Q0VA 3HOZJ 1QZZA 1SMYF 1EH7A 1LNWA 3BP8A 2V1XA 4G9YA 2RQPA 4A3JJ 1G8XA 1WJFA 4KN4X 2R93J 5KMWA 4S04A 2BHZA 2H8RA 3KP6A 4OOYA 3S1RJ 3MF0A 1SANA 1BYWA 1P9RA 1E17A 3F72A 2QF7A 1H8MA 2MABA 3CCMI 3M1CA 2HVRA 2DLLA 2O8KA 1I6XA 4A3LJ 4JKTA 3CTAA 5FQJA 4EUZA 4A6EA 5F1RA 1TQMA 5ERIA 2B18A 4QSHA 4NXFA 4IQ4A 3C4PA 1SFXA 4CA0A 2E35A 3MQOA 5E3NA 3N4MA 1ACIA 3HLFA 3BFCA 2V8FA 4YFMA 2FRHA 2C6YA 1IN7A 1K6OA 4E7JA 2F4MB 4GW9A 2F2EA 5E8IA 3JYIA 4NXGA 1XDUA 2Y2IA 2X01A 5TGTA 3H3ZA 1N9OA 4OQIA 2P81A 1TD5A 2GDNA 3S2HJ 2Y55A 4FSFA 3IH3A 3K4LA 3BLMA 2ZO4A 4MN5A 3LY4A 3GEZA 4S2MA 1G3TA 4PUSA 5E3OA 4A93J 2HP9A 4HJ4A 1N9NA 4WZ5A 2VEAA 4JF4A 4L0YB 4UB8C 3CJMA 1WVRA 4XK4A 3H7WB 4EJUA 1Y28A 3IT9A 3WGGA 5C3EJ 3AKZA 1IC8A 3F1PB 5DEQA 2FOWA 3L2UA 1LSWA 3BTLA 1MH3A 1BJZA 4PJNA 2RNGA 1A6QA 3DBHB 4MTEA 3S7NA 4LRYC 4ME4A 2HDUA 4B48A 3IHAA 5KAIC 2V7FA 3Q0UA 5M5WJ 1H8AC 3HL9A 4HIAA 1I2WA 4FQGA 1YIJI 1UFMA 4HG2A 1ZHHB 5CRFA 1SKFA 3N6IA 4Y0UA 4L5JA 3ZG0A 2VASA 1MY8A 2A68F 3F9KA 1Z7UA 1S4SA 2A24A 3PBRA 3LEQA 3PXPA 3BPVA 2EZIA 3E97A 1G6NA 3BZKA 3GVBA 3DU5A 2P5LC 4UB6C 2JVHA 4BMWA 3AGEA 4LV2A 2DQLA 3CUOA 3I4PA 1MH4A 3G1LA 2FE3A 2LK2A 1HW2A 1H9GA 3BR1A 3ZQHA 4RAYA 2OBPA 3IX3A 4WELA 1LEAA 1JTYA 2WADA 3DLAA 4O6JA 5IT3A 5C4JJ 1D8JA 1SVMA 1TF1A 2AHQA 5HDCA 1A31A 3BQYA 2ESHA 3WE3A 4EV0A 1PWGA 5I5LA 1I5ZA 2FSWA 4XMYA 1MBEA 4EM0B 3HXLA 2DYRH 4BL3A 1QHGA 2DK8A 2K4BA 4ARZB 4UVBA 2WGWB 1QZYA 3CC7I 1TWCJ 3PBTA 2K9QA 1OCOH 3GTCA 1G3SA 5GLAA 3D9YA 1TNSA 1YLYA 3MZHA 3K2ZA 1WI9A 2LKXA 4HH2A 3NAUA 5FQ9A 5F0CA 1OMIA 4YIFA 3DU6A 1PDNC 1D8KA 4EXOA 3L9KA 4E3IA 5D6EA 3V7CA 5M1AA 3PR6A 3UY6A 2KKOA 3RTYA 2V9VA 2W00A 5FFXA 2W1OA 3HG9A 4Z2YA 4C3JJ 4BQQA 2PR5A 2V79A 1QU3A 1ERMA 4RAZA 1UHMA 2RKHA 4PFPA 4IO9F 3ZDJA 1FOXA 4YIRX 3UKGA 2QHKA 4HSTA 3L7WA 2VGJA 2JJ7A 1DQUA 1NG7A 2DCEA 4UUTA 1K38A 3KX2A 1EKEA 1LT0A 3A3IA 3CPTA 3F1OA 5KVRA 3Q1FA 5EVIC 3T4OA 1TZLA 3DKWA 1MBKA 4FASD 2VQCA 1P4WA 3GTGJ 2HYGD 2P4WA 2V9KA 4HAMA 3FXMA 4JX4A 4OAZA 4UUSA 3I55I 3ABMH 5BPDA 3WHCA 3EEHA 1Q2QA 2QSFX 2EWWA 3UDXA 2JVGA 3LAJA 3MSHA 3N8RA 3WTTC 4HJ3A 2HJ9C 4D0PA 2DTRA 5H6QA 3BJAA 3PL8A 3PUFA 3I0TA 4UA9A 4ABZA 3OYKA 1GXQA 1ETKA 2GQQA 2A5YB 2OLUA 3GECA 1FNNA 5EGOB 1AWIA 3ASNH 1IELA 2CQQA 1YRNB 1ZG6A 4R70A 2VKVA 2ADUA 3CF5F 1XCBA 4ENMA 3TW6A 3S7QA 4MFDA 2NVYJ 2BXZA 4BJTA 4PM6A 2P0WA 2QVOA 1ZGWA 3LR4A 4P55A 3I59B 4Y4RA 1IRGA 5EZGA 1FJLA 5JVTA 2CYYA 3SDBA 3BWGA 4YINA 1Y8RB 5H2FC 1VQ9I 2Q2EB 4ANJA 4UNOA 1ODDA 2W84A 3DBRB 4NUBA 2DDAA 1L0OC 4EERA 2OV7A 1R1VA 3V42A 5D8LB 3GV9A 3ZGAB 4UEYA 1FBQA 1Y39A 2DA4A 3A02A 3R61A 1VHMA 2J3WA 1YTYA 1HTZA 4ESFA 2P7JA 2QCOA 3DLLF 5CVUA 2KRFA 3WS1A 2O3FA 4Q0JA 4R8HA 4N9HA 2Z99A 3HOWJ 1V55H 1STZA 5L3DA 5LLQA 3CJNA 4U88A 3MAJA 3LCEA 3SEZA 2VOPA 1FIPA 4Y15A 1HSTA 1RGZA 4WUJA 4LG0A 4E3MA 5DTTA 3LI8A 5K5BA 4J19A 2HEOA 1HDPA 4KZBA 3LICA 3NHQA 3GTOJ 3EGDC 3VOEA 2VT3A 1DU0A 2XUBA 5J47A 1PJRA 2HXOA 5EDNA 2E2HJ 3FG8A 4IUKA 2F48A 2KJCA 5G4YA 2J3TC 4BEHB 1AXBA 3NOPC 4HOIA 1FBSA 2VIXA 2HKXA 3GSGA 2FMLA 1R5HA 1W0TA 1O07A 5AIQA 2MH2A 4RVAA 3HJIA 2E1MC 3OYBA 4Q5SF 4NB5A 4HDVA 1D7EA 1IO2A 3PAGA 4KZ6A 4BHPA 1OMEA 2C6WB 3MJQA 1ZTUA 5LEJA 3EDPA 4M73A 1P9WA 4CDGA 2R9XA 1TC3C 5FAQA 2DA5A 1X1PA 5JHUA 2KIFA 4CCKA 1WYCA 4S2IA 4Y13A 1XGJA 2L02A 3LR3A 3T1RA 3IH8A 2EV5A 5HPIA 2VLAA 1Z6TA 1J3WA 5LHHA 5FB2A 1Z67A 2P7VB 3QP2A 1IJWC 4L0ZB 3UNGC 3G1MA 1IV8A 2FD5A 2G7HA 2W7NA 2PU2A 3GQZA 2L4AA 3QYEA 2WA0A 3T8TA 3CESA 1KZHA 2AXTC 3CG5A 4BL0B 4MEZA 2XH9A 5HSQA 3NEUA 1BBYA 2A6HF 3E6BA 1WQ2A 4RB2C 1T2KA 2HV1A 2DDBA 1BOBA 1HSJA 2A3SA 2EV6A 5J40A 4ZDXA 1LQ1A 1VNDA 2BVMA 3HM5A 3W6KB 1CEFA 5JLWA 3CUEA 3CC2I 1JKRC 2JKRI 2FJ1A 3W2VA 3M2KA 2PN6A 2M8GX 1FMVA 2XGNA 1JUMA 2JN6A 1YX3A 3P9CA 2HKOA 2ZFUA 4U7BA 1DDNA 3PAEA 1GHCA 3Q7ZA 2RV8A 2KZGA 1GHIA 4OH0A 4P6ZS 2L3DA 1VQMI 4OP5A 2XB0X 3CDIA 5E1ZB 3WTYC 4IBXA 5EVID 5EFWA 3IS2B 1EV7A 1Z6RA 2D1HA 2EK5A 4G6DA 5E3MA 1KU2A 2BY1A 2JA5J 2O5RA 2PMZN 4BENA 4QJGA 1W7PD 2UZKA 2XA7M 1W5DA 2HXIA 1FMWA 1SFKA 1JHFA 3PTEA 1ZAOA 3GUDA 1SKOA 2KIUA 3KYZA 2L0KA 2XAJA 2DA7A 3QP4A 1K0KA 2PD8A 4FH4A 3OCNA 2CFXA 4RB3C 5AJGA 5D4SA 3IH9A 3QWLA 2ZM2A 1VEUB 1BJAA 3FMSA 5C4XJ 1MKIA 3VSLA 1Z9CA 2DMNA 1YW9A 3P9IA 2WKEA 1R4NB 2DT6A 2E19A 5HS8A 4KG2A 3VV4A 4CZZA 2M45A 3WWXA 5D8KB 1BM9A 3NWTA 3WTXC 1ZC2A 5EEHA 3NC8A 4I6ZA 2IGNA 3ITAA 1U9NA 5LRRA 1IUYA 3O8GA 2CWEA 3G31A 5DFYA 1ETOA 2PT7A 3HB9A 3OYDA 3S2WA 1Q1VA 3CWFA 2DK5A 1OR7A 4PJMA 4HNVA 1K55C 3MFDA 3R7WA 1KA8A 2M4GA 3K1NA 1LSXA 4C2MJ 2V1BA 3JSPA 2O99A 1XDSA 3IHBA 1RC9A 5DCFA 1ZKGA 3JRCA 3CD6I 3FXRA 5HAIA 3MR0A 4BBUA 5E79C 4IVKA 4BJ6C 1X58A 1IXRC 2M7BA 2GXAA 3IF5A 3HL2A 3Q07A 3OR2C 2MA3A 1I3AA 4XIDA 5K5QA 3FKJA 5K1YA 1TS0A 3K4JA 2ZM8A 4BE0A 1SAXA 2HPIA 1RCJA 3C5AA 5E8GA 3BPXA 4R1HA 4BHBA 3I4NJ 3H1CA 2QBYA 1W8YA 2L0WA 1J75A 1PFLA 2P04A 5DVAA 3L2RA 4I01A 2PBIA 1FC3A 2BOLA 4JXSA 2NS7A 1ZHFA 3KZZA 1TS7A 3KP3A 3A01B 4CPKA 4EGYA 4K0WA 4A3DJ 1WJEA 1XGOA 4FE7A 5AVFA 1HKSA 4MNUA 4G6TB 4U0VA 4WLAA 5HDDA 4BXFA 4DYRA 2EZHA 3DTKA 1KYZA 1SFOJ 3HOUJ 3E0YA 3MKLA 2X0LA 4BQMA 2DFHA 2WB1N 3SFIA 2Y2PA 3FPVA 4HQAA 3H3UA 4YG2F 3CDLA 4HV6A 3ZG7B 4DXCA 4UY8I 1WFXA 1K57A 4I3JA 4CH7A 2BW3A 1L0EA 4IL6C 1D3YA 3H0GJ 2EXBA 3D5LA 1TW2A 2IWBA 2JKRM 2BZTA 4B4XA 3CP8A 2XF7A 4BAYA 2ZD8A 3IXHA 1SD5A 3HRTA 1R22A 2QQ9A 2R7SA 3CO7C 4UHUA 4LB5A 4OLDA 4F3LA 2ZQCA 1Y1VJ 2QWWA 2TDXA 1BR4A 4E3LA 3TMOA 1IAWA 1MWTA 3O2PE 4M9ZA 4RAGA 3MBZA 2OCEA 3W2WA 3J81Z 2XGXA 2F4OB 1BL0A 3KSHA 2OC6A 3MMYB 4GS9B 4E6WA 2PJRA 1GHMA 3FBIB 3AL0C 5FI2A 3CJTB 1OT9A 2WK0A 1U9OA 3H3VK 2X4HA 4AUXA 4G3WA 1MPLA 2Y0MA 4EETB 3NOTC 1VQ5I 2DPUA 1QQIA 1K6YA 4RM2A 3KSGA 2NYXA 4EMSA 3LFKA 4PHTA 2XKPA 4NHJA 4RS8A 1IKGA 2VGLM 1M1EB 2E2IJ 2WBMA 3JCUC 4MLLA 3UE0A 1KQ0A 3C2HA 3AG2H 5CQEA 4Y33A 1JTDA 3IXGA 1XCVA 4EBLA 3AGDA 2DODA 3WS0A 5DJUA 2P5VA 1HQCA 3RKQA 2JPBA 2GWRA 4KT5C 4JYKA 3VOLA 1FCMA 4X6AJ 3BZCA 4JGOA 3LIEA 2PBDP 4AU7A 4XKVA 1W4MA 2ZQ9A 2VC1A 1JKOC 1KU9A 4RBOA 4KZ4A 4AYBN 2FFYA 2XAUA 3OR1C 2BASA 3C4OA 2H1KA 1MIJA 4QHCA 1NYMA 4DXBA 2A05A 3WTUC 5E3LA 1BR1A 1QVTA 4EJTA 4HP4A 2LY2A 1SVLA 3BR5A 3GW2A 4XLFA 2IWDA 3MZEA 3HRMA 3BLYA 2E36A 3OIOA 1VETB 3WS5A 2K9SA 2PJPA 5CERA 2EFNA 3RTRA 1ZH5A 3A03A 2PMHA 3IF6B 3LSGA 2OCCH 2EA9A 1FEXA 2DXIA 4A2UA 5A8BA 3VFHA 3ERED 1ETVA 2QSHX 2OV5A 5LBQA 4II7A 3SXYA 5DM6F 4A12A 1ZR2A 4MN6A 5HDSA 4E3OA 4EQIA 1DGWY 1U8BA 2K7LA 3HC7A 2XROA 4I76A 1MZUA 1DP8A 3HUOA 3AG4H 3LFUA 2B95A 1ZG3A 3OIPA 1NK3P 4A3BJ 1F9NA 4ZYHA 5BPIA 3OYEA 3TQNA 2VK3A 4H8RA 1IDYA 1B72A 3D3OA 2DMQA 4M4XA 4LG3A 4AIKA 4Y0TA 4GCZA 1BC8C 2OU2A 2K31A 2RC4A 1XGNA 1EF4A 2I9VA 3NQOA 1J09A 2FBIA 5GLDA 3HSRA 3AAFA 2CV0A 3RFBA 2Y79A 4I0BA 1FX7A 1LL9A 1U5TB 4XKCA 2WAFA 1NHAA 4RAFA 1QGPA 4CXFA 1ZQ3P 2M0MA 1SZVA 3ZG8B 1L0FA 4NNJA 4A5RA 5E18F 1TWHJ 4Y52J 3FHNA 3JRIA 4BBSJ 5AQAA 3SS5A 1LFBA 1R7JA 2IWCA 4Y3IA 4F94A 3H9JA 2QYBA 2X71A 1W63Q 1FOWA 4FCFA 3BQAA 2XF3A 3GZ5A 4BQOA 4S2PA 4X1EA 1G68A 2BLSA 1TTYA 3KEOA 3S32A 4G7HF 2YKFA 3OLOA 3CQZJ 1XGIA 2L4RA 3OOPA 3K70C 2WAQA 1DP6A 5DF7A 2RNJA 3U1DA 1APLC 1S7AA 2QENA 1R5GA 1RR8C 1REPC 3ZQLA 3A3EA 4WM9A 1PYYA 1YW8A 4QB8A 1TWFJ 1BUEA 2XV4S 4KIBA 1X1DA 4LV0A 1MJBA 3E4PA 4DYCA 4YNRA 4BWIA 3WODF 3EUAA 3UB6A 1F2KA 3CMZA 2HWVA 1MGTA 1SD4A 3KYEA 3IUOA 4G7ZF 1KGEA 5HOOA 3T8RA 4KJZA 4EVIA 2KQRA 1D0XA 2LNBA 5HLHA 4PM5A 4HQEA 4F93B 1LE8A 3CCSI 3BG7A 4BD1A 2Z2LB 2DMTA 3G32A 4MNRA 3H0DA 4U0TA 5F27A 3TP0A 3ZQ7A 1FIAA 1U78A 3A4CA 5E1XA 4DOZA 5K5OA 1QBJA 1XJ2A 1B8IA 3FKWA 2CW8A 5FAOA 4ZBEA 1E3HA 2J5OA 3K10A 1MBFA 1MZBA 2DMUA 2KL4A 1R49A 4L18B 4WZ4A 2PEXA 1F1ZA 1HZOA 2V8CA 4NK3A 4LV3A 3FXLA 1W79A 4CLCE 2W1TB 1HW1A 5J4VA 3QRFF 1PRQA 3A0RA 1T08B 4JK1X 3UB5P 4P96A 3QYFA 1J9IA 3F23A 3QNCA 3PO2J 4OLGA 4EJWA 3GLXA 3I5UA 5KAFC 2M5WA 3JR9A 1OCCH 1K54C 3PHYA 4RA7A 2Y2ZA 4E7LA 2HDDA 4QY5A 2V1NA 1E25A 2L9SA 1N4OA 2PFBA 5F1JA 4DN0A 3OPPA 3AG3H 2IEKA 3KCCA 2IGKA 1S7EA 3ZN1A 1EI5A 3K0LA 4CUGA 5CHMA 3LSRA 2XDMA 4HP9A 1D06A 1PNEA 3BW6A 5J4EA 3EUHA 3FZVA 2ZSHB 3VFZA 3Q7VA 2IGMA 3JRHA 1SMTA 4MLOA 2EX6A 4ZJ1A 2R7VA 1KDSA 1T1AA 2H5SA 1H3QA 2ZQDA 2R7UA 5IPAA 4FHTA 4UQIS 1FP2A 1OYIA 1S6RA 2EBIA 1JT0A 3C2WA 5GHXA 4A6DA 2XC7A 2V9PA 5J7EA 1BW6A 5EECA 2GIVA 4OIPF 4ITVA 3ZMTA 4PKYA 5JFRA 1UG2A 1SVOA 1RUOA 5JLXA 3UB9A 1HLUP 4LLOB 4P0MA 2KDZA 1M40A 2O9AA 3VP4A 5HDKA 2R5ZA 4S2NC 4ZC3A 3ESWB 3S3NA 3E6DA 3I71A 3O3KA 4GXOA 4HX4A 4RDUA 1PIOA 2XAHA 5DD8A 4BJ5C 2FH5A 4GD6A 2WZZA 5F6AA 3T4SA 3BQZA 4K2EA 2LYCA 1PUFA 4EGZA 1CGPA 2WY8Q 4LCMA 3HPGA 4G8XA 1RUNA 3GRJA 4NKPA 4H4KC 3HUNA 1P4AA 3K1PA 5BMZA 3MVPA 4KT6A 3TDUC 1BI0A 1V5GA 1JKPC 1AWCA 4ESJA 3RJPA 3G34A 2F6CA 2GA1A 2VXDA 4DW6A 1O3QA 3QP6A 2CU7A 3VFFA 2HZ5A 1ZGAA 3E7LA 5EOOA 1ETXA 2DA2A 2IT0A 3MXQA 3FK7A 4HNBA 4NC6A 4LRXC 3FF5A 3WGHA 4FETA 5KHDA 3TE8A 4B47A 5EVIB 1IDZA 2F5FA 2X51A 4DZJA 3TO9A 5EE8A 2LFBA 3ICYA 3LQQA 3W2ZA 3M9AA 2VBWA 4JX6A 4KG6A 4NQWB 3F1OB 4X69A 2XSDC 1GSVA 1ZK8A 2WY7Q 1W7PB 5TGFA 4CO8A 3LMMA 3IF6C 1XMAA 1E0EA 2MC4A 4QPOA 1OTDA 1OTAA 3K2NA 3BR2A 4UUVA 5B1AH 3WTSC 3KX0X 1P4XA 3OL4A 3BR0A 4RGSA 2ME0A 3FXUA 3K7AJ 3I7JA 1USTA 2LH9A 1YITI 1YJNI 2K27A 3BJ6A 4XSXF 2P8TA 4ZJZA 1K4SA 4I99C 2XFTA 1IN6A 1YE9A 3G2BA 1KU3A 2ME6A 1FCOA 3UPOA 1WH7A 3TBIA 1A6IA 1FCNA 4E3KA 2VE8A 2FXAA 4WXDA 4BQAA 3S14J 1FP1D 1VI0A 3T12B 4JOMA 3HLEA 2CH0A 1JTGA 3WTZA 4EEUA 1OKRA 2CW7A 3FDYA 3PBNA 3E5QA 2IP2A 1RKTA 1Z05A 1Z6FA 1VQ8I 3LSHA 1YM1A 5BOHA 2KJBA 3HKZA 5FLMJ 4LD5A 2O9CA 1DU6A 1X1CA 3KZIC 3RIRA 5HX9A 3U2RA 3HLDA 2UUZA 2PLYA 3HRSA 3CAXA 5LHGA 2EX8A 1D1JA 2L01A 2V1DA 3GVAA 4MDZA 4OQGA 1T33A 4NC7A 4DIQA 1Y56A 2O0YA 4PAUA 4I7HA 5LEKA 4P87A 1FR1A 2L5QA 4Y7PA 2B7EA 4LIUA 1MW7A 4KUKA 5FQKA 4DE0A 1Z1DA 1GHPA 3MKFA 3ZMUA 4XXRA 4XSZF 4Y0OA 3RSNA 1MWRA 2ZQ8A 1UELB 3ZQCA 1R6RA 3N4IA 5AVEA 2DT5A 4PMAA 1T18A 1AA7A 4EBNA 2O9BA 1NY0A 3ZOBA 2VONA 1YOVB 4WF2A 4Y5FA 5KSCA 4HNTA 5K5RA 5GL9A 3HIFA 1XTAA 2FUG2 5MC7A 4WF0A 5F0FA 2E1MB 1XD7A 3FXQA 3M8EA 4LLGF 3BY6A 3LOCA 1S66L 5AQ7A 2NNNA 3CCVI 3F1NA 2E1CA 3JSOA 4U7DA 1YPRA 2EFWA 1KYWA 3D5SC 3VYTB 1B6AA 3QNBA 1VFCA 2WZXA 4ZRRA 2BG1A 3NI9A 3LO7A 2RAEA 2YPRA 2D45A 5A93A 5L09A 4WXHA 4QLCU 1MNEA 4HBTA 2XAGA 4CJNA 2LSOA 2AXLA 1S4RA 4DE2A 4ZTKA 4KZAA 4EBPA 4HA8A 2XLNA 2ZMEA 2GLOA 2OWJA 3HCYA 1VQ4I 3A0SA 4Q48A 2JKGA 3P01A 3ZHHA 2XVCA 2JA2A 4XOTA 2VL8A 3R0JA 1VB6A 2R7QA 1D1CA 5LFAA 3IXBA 3BT9A 2K86A 4UV8A 3MMHA 2FOKA 4ON0A 1XMKA 3CUQA 2HGCA 5FKLA 2PD7A 5IHVA 3REOA 1N25A 4N4NB 4GFBA 1X3UA 2K3PA 4E70A 3L1PA 4FE4A 2DCFA 1Z3YA 2QMIA 4WZ5C 5DKLA 2KIMA 1GUUA 2JTVA 3M1EA 3NRVA 1WSUA 1I6HJ 1JXSA 3CZ6A 4W97A 1PWCA 1T19A 2LF8A 5EOEA 5L3BA 4PM8A 1E3UA 3I4MJ 1ZG4A 4YOFA 1WPKA 4EV4A 2EQRA 1N75A 2ZL1A 3D0SA 2GJ3A 3LA2A 2PYPA 2R0QC 3ABTA 3DEWA 4G6QA 3B33A 3DBAA 3VMAA 2XGDA 2LKSA 4GN2A 1D0YA 5C5KA 1GVDA 4DYQA 2HDWA 3LUQA 2DU9A 2OTJI 3BR6A 4PZJA 5FASA 2ZKZA 3OOVA 4R3AA 1LJ9A 1ONHA 2I8DA 5HLGA 4X1MA 3ZFZA 3M8JA 4HDUA 4EQ1A 4FX0A 2ACGA 5EG0B 5M19A 2NS8A 3KPHA 1KDWA 3H35A 2LR8A 1FTTA 3PNYA 5DUIA 3TOIA 1X3WB 2EB7A 3K69A 1JGGA 2FF4A 4KIGA 1AKHB 1WWXA 3ZPLA 4HI4A 3LA7A 3UPNA 3PQJA 4M3DA 3DKYA 4C6YA 4CLCA 4GZBA 4RGUA 3ZNYA 3FHZA 1IYQA 1R23A 4DGWB 1VQOI 2LB5A 2HOEA 1X2MA 2J7VA 5DJTA 4BXUA 1ENHA 1GA9A 5FO5A 5M5YJ 1FZPB 2HF6A 3LEZA 2VN2A 3ZQ5A 5HWTA 2MSYA 4ZYDA 1FYKA 2XGCA 5HWWA 4OAYA 5FGMA 3CCRI 1S1ZA 5FQMA 4XN0A 3DV8A 1BOAA 3KO6A 3OS0A 4LLLA 4K0XA 1PUEE 1OCTC 2Y0SN 2YSRA 4IJAA 1RPWA 3V7RA 1YHQI 2L9RA 3DWLE 1YS6A 4KA4A 4EEPA 2NOJB 1O3SA 2WTEA 3LR5A 4DJAA 3S1MJ 2BGCA 1MMSA 2OZUA 3QP8A 2D5VA 1UJ8A 3J7AY 1W5SA 1XPBA 4FTXA 1WZ2A 4MN7A 5GTHC 1G6AA 1B4AA 2Z5UA 1J59A 1KGGA 1NJ4A 3F6OA 1LVKA 3ZXSA 4ZZLA 1EJ9A 5L2FA 3B6AA 2HZDA 2KIQA 3PJRA 2EIMH 4M6XA 2HYFA 4N0BA 1GA0A 3IKVA 3T1QB 1H8YA 5ILSA 4D60A 4YELA 3DP7A 4YIIA 1TS8A 2V0UA 3QPSA 3F8NA 3VP1A 5GPAA 1O3TA 2ZC5B 3B3XA 4BBTA 1YX5A 5F04A 1OCPA 1LVAA 4I5SA 3QU3A
chains in the Genus database with same CATH topology
1KQ9A 1D5VA 2VOOA 2UXNA 1MDMA 1V4RA 4KIFA 3HRUA 1YYVA 2RDPA 3R4KA 2W25A 3LA3A 1U8RA 1E2XA 2Y75A 3RDIA 1QO0D 2Q0OA 5IT9K 3TOBA 1T0FA 2FBHA 2M30A 4LGWA 1XGMA 5LGUA 2ZCWA 3IKTA 2DPDA 4S05A 1I1SA 2IA0A 3SZPA 5DV5A 2FQ3A 4P9UA 2MLKA 1BIAA 4A0ZA 1Y0UA 3F22A 3MFKA 2E7XA 2AVXA 1QNTA 4L5IA 5AONA 2VT2A 2Y48A 5CVJA 4BYYA 4HLXA 1O7LA 4ETSA 3HSEA 4CYDA 4KMUX 2R7FA 1S7OA 2RVCA 1OYYA 2ZNZA 1TNTA 1P92A 3E5XA 2JSCA 2ZNYA 5DDGA 1WKMA 5BS6A 5EEGA 2H94A 1ZRDA 2ZXJA 1PP8F 2IPQX 3WTWC 1R58A 2FNPA 4HQMA 4OOIA 1S6LA 5ED4A 5L3GA 2DI3A 3IWFA 2QYOA 5L3FA 2YU3A 5DCMB 4XLPF 1A04A 3JTHA 4WXCA 2O03A 5FFZA 3RKWA 2CGPA 2XASA 2R7DA 1K78B 1QPMA 4TV7A 3O6BB 5ICGA 1IN8A 3KE2A 4MTDA 4NG2A 2XKOA 5LRSA 4ENNA 1BI1A 2OA4A 2GXGA 1JE8A 3ROUA 3DPLC 4XRFA 4UXNA 1IN5A 4HF2A 3WU0A 3R60A 1HXDA 4MGRA 4UVCA 3Q9VA 5LGTA 3K9TA 5FD5A 1T39A 2DBBA 3IRRA 1FBUA 1SFEA 3F8MA 1BI3A 1IF1A 2E1NA 1Z91A 3ABUA 5KK1A 1T6SA 2QQAA 4HBLA 3IRQA 4Q4ZF 3I59A 3GYHX 3IX8A 1SD6A 2O61A 2Q2EA 2QQBA 2H6CA 4L9TA 2EFPA 1ONVA 2ESNA 3TO7A 3ZMSA 2EWNA 5FLXK 2PMUA 4M6YA 3RPUA 2A69F 3L00A 4LK1F 3G73A 2STTA 3DPTA 3U9GA 3F8CA 1UCRA 3TDZC 3GFIA 1J7KA 4O5VA 3GFJA 3G3ZA 1TQPA 3FMQA 4ZYGA 1P6RA 1I1GA 1O57A 2HS5A 4ENJA 1IXSB 1IZ1A 1R00A 4HOBA 1OYWA 2HQNA 3I53A 4MQVA 3GX4X 1FPQA 2NAZA 2BYVE 3BZ6A 4IRHA 4IPAA 2CQKA 2W57A 2VBXA 2R3SA 3DFGA 4RGXA 2ZJ2A 3DXJF 1ZYRF 3SZTA 4CICA 2EFQA 1LDDA 3I64A 1S3JA 1FT9A 1GVJA 4HF1A 3BROA 2DAOA 4ZYEA 4LMYA 5AIPA 4RGRA 4P5OA 4ZZDA 2NRAC 2UWMA 2E7WA 3GF2A 3DQVC 3QU6A 1XB4A 2JPCA 2FEZA 1CF7A 5L10A 4AIHA 1YS7A 3KFWX 1YG2A 5DUKA 2GXBA 4GO1A 3QAHA 3M7GA 3M8FA 3WTVC 1FYLA 5CYVA 5D4RA 2EFOA 4XLNF 3B73A 1IRFA 1U2WA 2ISYA 4L9NA 1ZGJA 1U6GA 5D5XB 2O8XA 2HTJA 2ISZA 3PQKA 2HTSA 1ON1A 3HHHA 4IXAA 2ZFWA 2O6GE 3KP2A 1XN7A 5ICCA 2IVMA 3KP5A 3F6VA 1BI2A 5HDNA 4PGGA 1FY7A 3DF8A 2P6SA 4KICA 3MEXA 3VEPA 1DP7P 3KEQA 4P9FA 2PG4A 3QOPA 2W85A 5L3EA 5E17F 3BJOA 5E20A 4R79A 4OIOF 5LGNA 3JAMK 2RGVA 2B0LA 2COMA 2ZBKA 2CW0F 3RKYA 5F6FA 3OV8A 1T38A 4JBAA 3RKXA 3IX4A 2G7UA 2HZTA 1MJ9A 4EM1A 5ICEA 3COAC 4HW0A 2A6EF 3TO6A 3R6SA 3ECHA 4I0AA 3RYPA 1FSHA 3CLOA 4WK8F 4EM2A 3MWMA 2FBKA 4OU0A 4JQFA 3EYYA