3QP5A

Crystal structure of cvir bound to antagonist chlorolactone (cl)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
251
structure length
251
Chain Sequence
ARPLPAGLTASQQWTLLEWIHMAGHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENYAQHDPILRIHLGQGPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNIGSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHLAMPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CviR transcriptional regulator
publication title A strategy for antagonizing quorum sensing.
pubmed doi rcsb
source organism Chromobacterium violaceum
total genus 59
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qp5A02
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3qp5A01
2A3SA 1G3WA 4K2EA 2ZMEB 1HKSA 3CUQA 4QLCU 4XBFA 4PDKA 2YU3A 4KICA 2H6CA 1K78A 3K2ZA 3IX8A 1J75A 1L0OC 3IX4A 2K02A 1SMYF 3QU3A 2XKPA 1E2XA 3FMRA 5CYVA 3WGHA 4MNUA 1BM9A 3J81Z 2D1VA 2QUFA 3K0LA 5H6RA 3ZMZA 1WKMA 5FB2A 4KIGA 4YG2F 1AOYA 5FLXZ 3F3XA 1LVAA 1PP7U 3V7SA 2PN6A 2JZYA 3KCCA 1I6XA 3TGNA 1J59A 1HKTA 4A6DA 1TNSA 4ASNA 4U0YA 1X3UA 1V4RA 2P7CB 1G3TA 3U2RA 2IP2A 2HOEA 3QAHA 4LLLA 2KJCA 4HX7A 3CDHA 2VT3A 5K5QA 4I7HA 2X4HA 3ZQ7A 2D2WA 1R58A 5KVRA 2YX7A 2ZNZA 3F8FA 5HLGA 2DW4A 2FBIA 2NAZA 3RYPA 2PG4A 2GA2A 1PP8F 1YW7A 1MJAA 2W84A 4OMYA 1DUXC 4M9SA 4RB1A 2HWVA 1XDUA 3G73A 3C18A 1JHFA 2K4JA 1G3SA 3FMQA 1CF7B 1W5SA 5E8GA 5E1WA 4XRFA 4BXUA 2BE5F 5F6FA 1YS6A 2V1UA 4M9XA 3IL2A 2LSOA 3HSRA 4KIBA 5ICGA 2NRAC 4UHTA 4AVPA 3BZ6A 5J6XA 1ZH5A 4A0YA 5LGNA 3MEXA 2KRFA 3MWMA 2KKOA 4XLPF 3ELKA 5LLQA 1S3JA 2ZBKA 5CJ9A 2VBWA 1RIOH 1R36A 4QWQA 2V79A 1E17A 2CQKA 2A68F 5H20A 2E7WA 2VBYA 1BIBA 2DLLA 2V6CA 5DCFA 2BBYA 4LMYA 4GYGA 3T0YA 2QWWA 1CF7A 1KYWA 4A5MA 2HQNA 1STZA 3U9GA 2PI0A 1I27A 2CO5A 4R1HA 2Z5UA 3CJNA 1K79A 2PJPA 1ZN2A 4IJAA 3E5UA 1IF1A 3BJOA 1BC7C 3ZMDA 1Z9CA 4EMSA 1RZ4A 2MLGA 4IRHA 2AVXA 3F6OA 1BIAA 5DV5A 4CO8A 3KZZA 4I98B 4M73A 3BWGA 4DQ2A 1GVJA 4EGYA 1WWXA 4EM1A 2MLKA 2R3SA 4NHJA 5D5VB 4O3MA 4RGRA 1XGNA 1UCRA 5DD8A 2UXNA 5L09A 1B9MA 1R5HA 1HSTA 2NS0A 1HBXG 3ROUA 1BI2A 5D8LB 2EV0A 4HX8A 1IN4A 3JTGA 1RNLA 2OZ6A 3R0JA 2OAZA 2COMA 3JPUA 3I71A 4P5OA 3H3UA 3SQNA 1GXPA 4LLNA 4BHPA 1KQ8A 2K86A 3K1PA 5BMZA 2XAHA 5DCMB 1ZAOA 4ESBA 3MCZA 3BROA 3GYHX 5L3EA 1F5TA 2UV0E 3HHHA 3HRUA 2ADUA 2MH2A 4ENMA 5L10A 5L07A 2DPUA 4RS8A 3V8JA 3WU0A 1K6OA 3RI4A 2XIGA 1D8JA 3MAJA 2ZNYA 2EFWA 5AIQA 1CGPA 5LEJA 2F5FA 3IKTA 3KZYA 1DDNA 3IHUA 5JR3A 3H92A 2HFHA 1XMAA 5L3CA 5IT9K 4IVNA 5LGTA 4ZH4F 1F4KA 5ICFA 4L9NA 1LDDA 5FD6A 5AONA 4LG0A 4HF1A 2XRNA 3FHZA 1D8KA 2M30A 1K7AA 5K5RA 3ECOA 3P9KA 2EFNA 3J80K 1ZYRF 2RDPA 3CO6C 1W5TA 2CSOA 2RNJA 1ZRDA 1TBXA 3I4PA 3DPLC 2H09A 1EH8A 2QBYB 1LDKB 4DNCA 1YW8A 5ERIA 3I59B 2FOKA 5LBQA 2VE8A 4LFUA 1SFUA 5E18F 4YFNF 4HQMA 1SD6A 3V7CA 1IN6A 3F21A 4MEXF 3ECHA 3WTVC 4WCGA 3BP8A 3HRSA 4L5JA 1FBUA 3ZPLA 1UFMA 2M8EA 3IX3A 5CVIA 2UWMA 2EFQA 1FSHA 2GWRA 1R23A 2P7VB 4F7ZA 1EH6A 4XSXF 5LRSA 4AD9A 4M6YA 4AIHA 4L0YB 4O6JA 1Z6TA 3SZTA 2M87A 3Q9VA 5BQTA 2QBYA 1QQIA 2VOOA 1WI9A 2L01A 2JRTA 2IW5A 2QLZA 2FMLA 3GFMA 4S05A 1XSVA 3P9IA 2L02A 1USSA 2D1HA 4G8XA 3WE3A 3L00A 4HF0A 5L3FA 3KP4A 2M1BA 2HKOA 4Q5SF 3RJPA 2F2EA 2FQ3A 3BOQA 2R7DA 3E6CC 5CVVA 4PGGA 3KLOA 1XGMA 2W24A 5D4SA 5ILSA 5DEQA 2YR2A 1R1TA 4GCVA 1Z7UA 2FNPA 2CYYA 1EH7A 1HKQA 1LNWA 1FBSA 4R79A 4I01A 4ENNA 4EJUA 2G7UA 2AS5F 5F1RA 2UXXA 3R4KA 1XGOA 4RB0A 2ZXJA 4GGGA 1KYZA 1C0WA 1R22A 1O57A 1REPC 5DUIA 4B09A 4I0BA 2IA2A 2MH9A 2RQPA 3WODF 2QQAA 2DK8A 1U5TC 4IRGA 4AIKA 4WXHA 3JTHA 1V3FA 3DXJF 5LHHA 3WTSC 3GZ5A 1HW5A 2FXAA 3I0TA 3F72A 3KP3A 4OIRF 2OA4A 2Y75A 3LQRA 4N9IA 3VEPA 5LEKA 4XSZF 2DFIA 3K1MA 3LA3A 2IPQX 1ZHFA 2XVCA 1H0MA 3DFGA 2GQQA 5IT9Z 1KU7A 1KGSA 3E6DA 5HLIA 4G9YA 2IRFG 3FZVA 1IUYA 1SD5A 3ZP5A 3DV8A 1MJBA 2M45A 1U78A 4ZYHA 2FNAA 4U0VA 1G4DA 1KQ0A 4EM2A 3J80Z 2A5YB 4NB5A 1LQ1A 4HLYA 5HOOA 4M74A 1T38A 5TRDA 2XGXA 1IN7A 4RB2C 1FLIA 1IW7F 1IXCA 4WWCA 1O7FA 3I64A 2VODA 3CUQC 2K27A 2VXZA 3GFLA 2XAGA 3ERED 3Q5FA 1B1BA 4BYYA 1R1VA 2P6TA 1I1GA 2HTJA 1Z05A 1ULYA 1O3TA 5DUKA 2O6GE 3HUGA 3RTRA 2FU4A 2WC2A 2ZCWA 2PMUA 2ZMEA 3ML6A 1XCBA 3KP2A 2L54A 4NG2A 4G6QA 4AIJA 1S7AA 4OIPF 3QP5A 5BOXA 3DKWA 1T6SA 4P55A 1LEBA 1XDSA 1FYKA 1P4WA 3GO5A 4KNYA 2A61A 4ENKA 2A07F 1W7PD 2KIFA 3K69A 1WSUA 3MZYA 3BPXA 1P4AA 1UHWA 2XAFA 5KK1A 1ONVA 3E5XA 1GHCA 3V7RA 5CVUA 3PQKA 1O3QA 1H9TA 4A0ZA 4M72A 2ZO4A 1YLFA 4FT8A 4G7OF 2H94A 3MFKA 2DAOA 3JW4A 1YQAA 2O61A 1SD7A 2NNYA 1BI1A 4CHUA 4NQWA 3WGIA 2KIMA 2HYFA 5HDKA 1LDJA 3BY6A 4UV8A 3TDZC 1TQIA 2EJRA 1TQMA 2Z3YA 2V9VA 1FOKA 2PMHA 2OU2A 2RN7A 4HAMA 3IWZA 3WTWC 2RVCA 4PZJA 4HDVA 5CVRA 2LNBA 1XN7A 3DF8A 4IPAA 1IZ1A 4EQQA 5HS8A 2EB7A 1FWZA 4GO1A 4N9HA 3SXYA 1OYWA 3LA7A 1O7LA 2XAQA 2QVOA 3GZ6A 3VFZA 2B0LA 2BGCA 4CDGA 5JHUA 2FMYA 1S8NA 2VONA 4H0EA 1ZRCA 1B9NA 1TW2A 4HBLA 1XMKA 2LF8A 4HV6A 3FXQA 1MDMB 2P8TA 5ICCA 4A5NA 3WTUC 2F5EA 3HYIA 1J2XA 1OKRA 1QGPA 3L9FA 2L3DA 3F8CA 2WWYA 3N97A 1SMTA 1IXSB 1BN5A 3L7WA 5L3BA 3WTTC 5E1XA 1EV7A 2DI3A 1R7JA 4CZZA 2IJLA 4U7BA 4LK1F 2QZ8A 2ISZA 3F8BA 1IRGA 1T98A 2LF7A 4PGHA 5J8FA 2NYXA 2H27A 3M9AA 2NNNA 2XAJA 3VODA 1HW2A 1ZG1A 2E1CA 4G6DA 3QP6A 1OR7A 1W7PB 4ETSA 1J7KA 5D5UB 3SHFA 3N4MA 2FA5A 1ZRFA 4Y17A 2Z33A 3KEOA 4ESJA 2V1XA 4KA4A 4B8XA 2GXBA 4Y15A 1ODDA 4WK8F 3ULQB 3PFIA 1FT9A 2OQRA 3O6BB 1ZARA 1QZYA 3QOPA 3RIRA 2YX4A 1UB9A 4MQVA 1XCVA 2JPBA 5IT3A 4CICA 5DCMA 4HYEA 2P5LC 1KQ9A 3BPVA 4M71A 1U8RA 4YIIA 1G3YA 2Q8KA 4RGUA 2K7LA 2ZKZA 1R5GA 2HR3A 3WGGA 2D45A 4KMUX 1USTA 4HA8A 1DP7P 3HSEA 3M8EA 3R60A 5F64A 4OINF 3ZMUA 2OQGA 4O5VA 1F1ZA 2CGPA 1XB4A 2ZJ2A 2FEZA 5ILUA 1FNNA 1YYVA 4MTDA 1J0RA 1JHHA 3TOBA 3P7NA 4A2UA 4U88A 4ESFA 3RPUA 4HOBA 4FX4A 1I1SA 3BJAA 1BI3A 1S7OA 2XKOA 3RKXA 4CYDA 4HX4A 4OMZA 2PEXA 2Y0MA 2Q2EA 2VBXA 2CWEA 2QQBA 2HDCA 4D0PA 1U5TB 2A6HF 2MC3A 4A0XA 4LB5A 4P9UA 3I59A 3T5XA 3D0SA 2YSRA 4HW0A 3F22A 4UV9A 3E5QA 2DQRA 3S2WA 5K1YA 4KFCA 4I2OA 5K5OA 5LGUA 2L4MA 5TJJA 5E1ZB 3HIFA 4L9VA 3REOA 5FD5A 4OOIA 3V8KA 3EQLF 2OBPA 4MTEA 3OV8A 5HDGA 3E97A 3HRMA 4I02A 2XROA 5ILVA 4Q4ZF 5D6FA 3QP4A 1T0FA 3WTYC 4ENJA 1FC3A 4YIFA 1BC8C 5LRRA 1ZGAA 3TO7A 1P4XA 5CVJA 5FFZA 5BPDA 1ZREA 2QENA 2OZUA 5D5WB 2DBBA 3D5LA 1XSXA 5BPIA 5E8IA 2W25A 5H6QA 3V4GA 2A6EF 2E1NA 5HS7A 1TLHB 4Q48A 3CUQB 2CFXA 1KU9A 3F8MA 1P92A 3QU6A 1T39A 3LQQA 2BYVE 2GAUA 1NHAA 4LJZF 1K78B 2VOPA 3EYIA 2JT1A 2EWNA 5HLHA 2L4AA 4BHBA 1L3LA 1QPMA 2EA2A 2DK5A 3FWEA 3ZN0A 2G9WA 4IF4A 2VE9A 1YW9A 3HHGA 1JGSA 3ZMVA 4KIFA 3L09A 3O2PE 3LAJA 1QZZA 3E6MA 2Z9OA 5JVTA 5D5XB 3ZMTA 5J8CA 3K1NA 1B6AA 4IXAA 2GZWA 2JPCA 4P96A 2F5DA 4GYIA 3M7GA 1QO0D 1FP1D 1ON1A 5HS9A 3GUDA 2JSCA 4OIOF 4MGRA 3T1BA 1T2KA 3GF2A 3IC7A 4EJVA 1FSEA 3GEZA 4KMFA 2STWA 1I5ZA 2G7HA 3WG9A 1MKMA 3ABUA 2A69F 4WX9A 1O3RA 1MD0A 3JSPA 2Q0OA 4HV5A 4L9TA 1FPQA 1R1UA 2RC4A 3AAFA 4ON0A 3H3ZA 4LD5A 3EETA 1MZBA 1SFXA 1FBQA 4GXOA 4MHGA 5FFXA 1XD7A 3V8LA 1YG2A 3P9CA 4G94A 1H9GA 1QNTA 3LSTA 3TO6A 1AWCA 2J5OA 2V1DA 3GLXA 4A12A 2RKHA 3C1DA 1J5YA 2GXGA 1FY7A 4L0ZB 4HLXA 3TOAA 1OYIA 4UUVA 3C7JA 1ZGJA 3SZPA 3IKVA 1WQ2A 1TW3A 2ISYA 3EDPA 2IA1A 4KYWA 3HRTA 4LLGF 2FBHA 4M6XA 1IAWA 3TDUC 1U6GA 1FP2A 4EJTA 1HW1A 2EA4A 2FF4A 3GW2A 4EGZA 1ZLJA 4L9JA 2P5VA 3MQ0A 1Q1HA 1R00A 1RUNA 3QPHA 5A2QK 4LB6B 4I0AA 3W6KB 3EUHA 2FSWA 3TO9A 2ESHA 3R6SA 3EYYA 3LAPA 2YPRA 2BEOA 3I53A 2HS5A 1A04A 3O3KA 1HQCA 4OU0A 1BBYA 1UHMA 1RI7A 3Q9SA 2Z99A 3CTAA 2J5PA 4TV7A 3HOSA 5JFRA 1RUOA 1IN8A 2RV8A 2LKPA 3L2CA 4U0WA 2CG4A 4RAZA 5LHIA 4JBAA 4BNCA 1YFHA 3U1DA 5DYMA 3BDDA 4KN7X 3WTXC 3FXUA 2O03A 3B73A 5D8KB 1Y0UA 5JI6A 1XGSA 4PCQA 4L18B 1LEAA 2DTRA 5E20A 3RKWA 1S29A 4ZZDA 5D6EA 1LJ9A 2HKXA 3LWFA 4EVIA 3COAC 3ZMSA 3QPTA 1LB2A 6PAXA 4FHTA 4WXCA 3F8NA 5L3DA 1G6NA 3ABTA 2F5CA 1DPUA 2STTA 3M8FA 2R7FA 3M1EA 4FX0A 2JTVA 1Z1DA 3DQVC 3HOTA 2PLYA 3F6VA 2KJBA 4RGXA 4UVCA 3CO7C 3JSOA 3GFJA 3NRVA 2XUBA 3W6JB 1U2WA 4BHCA 2WV0A 3HSFA 3FM5A 3R61A 4BH9A 4LGWA 4BAYA 2GA1A 4R8HA 1O3SA 1B59A 3KP5A 3JAMK 2ESNA 3MZHA 3E3VA 4LG0B 1VTNC 1Z6RA 2O3FA 1FX7A 3CLOA 4ZYDA 4E70A 1IN5A 2FBKA 2O8XA 4N0BA 1IXRC 4CXFA 1P6RA 3ISPA 3FMSA 2BV6A 3QP8A 5FO5A 1J9IA 4AWXB 3VOEA 2DO7A 1TQPA 3RDIA 4MQ9F 3LA2A 2VC1A 2VBZA 1SD4A 3KP6A 1MDMA 1YIOA 2HZTA 2PBIA 2EFPA 3RKYA 4LK0F 2ACJA 3BJ6A 2PFBA 2O0YA 2HYGD 3FX3A 4CGZA 3I5UA 3T8RA 3GWZA 4YFKF 5DDGA 2XV4S 2MA3A 4I09A 2QM3A 2DQLA 3KP7A 3FF5A 1MGTA 2VC0A 3IRQA 4UNOA 1ON2A 4EJOA 3GFIA 4HQEA 3HTSB 2MD5A 1KU2A 1YS7A 1TTYA 3DP7A 5A2QZ 3C3WA 3KE2A 4G7HF 2ELHA 2K4BA 3KETA 2FE3A 4WXDA 3TKYA 3GX4X 4Y13A 3J81K 1BOAA 3NEUA 1W7PA 1KU3A 2HGCA 3FM3A 1D3YA 3OOPA 1ZG3A 5FLXK 2FRHA 5BS6A 4UVBA 3F23A 4Z2YA 4JK1X 3RYRA 1ZLKA 2M5WA 4HF2A 5L3GA 3QRFF 4YFXF 4HZFA 5HVQC 5D4RA 3IRRA 2XASA 1JE8A 3WE2A 3WU1B 3CUOA 1FZPB 3I54A 4ZYEA 2Y48A 4UVAA 1OMIA 1BI0A 5HDNA 4EV0A 1Z91A 2C6YA 2ZFWA 3PQJA 3QP2A 3SFZA 3WTZA 3TQNA 1GXQA 2DT5A 2HTSA 4UXNA 4EJWA 1P2FA 1FYMA 2IA0A 4U7DA 4HDUA 1JXSA 1MJ9A 2GIVA 1D5VA 4RB3C 1HSJA 3FXRA 4A6EA 3B02A 3RPQA 5ICEA 4EM0B 4XLNF 3KEQA 1PDNC 2DU9A 1W4MA 3T8TA 1FYLA 4IRIA 2X0LA 3GXOA 4Q47A 2W57A 2UZKA 2EV5A 4RGSA 3DPTA 2XHKA 1YO5C 4ZZLA 4BQAA 1B4AA 2MBFA 4OIQF 2QYOA 4S04A 3K9TA 1WRJA 5AIPA 4IHTA 2IVMA 2VN2A 5E17F 2W85A 3E6BA 3NQOA 3QP1A 2PQ8A 1TNTA 5EEHA 2HEOA 1U5TA 3LFKA 5CLSA 3HTUA 3KLNA 2OD5A 3JAMZ 3VB2A 1HXDA 1F9NA 4ZYGA 3J7AO 2RGVA 2EFOA 1ZG5A 1S6LA 1U3EM 2EK5A 4KDPA 4WF2A 2AXLA 3IWFA 1SFEA 4KT5C 5LHGA 2EV6A 2WTEA 4MEYF 4JQFA 2DPDA 2KIUA 2P5KA 4L5IA 3DEUA 2P6SA 3G3ZA 1XSDA 4IHSA 4RAYA 3ZN1A 2CW0F 4KN4X 2VT2A 2ETHA 2HQRA 1OYYA 1DPRA 2QQ9A 3KFWX 4M9ZA 4P9FA 3R0AA 5ED4A 1OPCA 1SAXA 1IRFA 2E7XA 5FGMA 4G7ZF 1QBJA 1KA8A 2TDXA 1YTYA 5DD4A 5EEGA 3I58A 4KUMA 2LDUA 1BJAA 2H6BA 2P4WA 1PUEE 2IT0A 3GVAA
chains in the Genus database with same CATH superfamily
4YFMA 2A3SA 1G3WA 2QSFX 4XK4A 4K2EA 3MQQA 4DMZA 4EEUA 2KIQA 2ZMEB 5L8MA 1V55H 3PNTA 1WH7A 2E1MC 3K2NA 1HKSA 3CUQA 3F0CA 4GB7A 4Z9QA 4QLCU 4BY1J 4KQOA 4XBFA 4PDKA 2HI3A 1BZAA 4BBVA 5FSRA 3FBIB 2YU3A 1W5DA 4KICA 2VXDA 4ZDLA 2H6CA 2HGVA 1SKOA 5EGOB 1K78A 3K2ZA 3IX8A 5TGTA 1BT5A 1EROA 1XA7A 1J75A 1F2KA 4LV0A 1JT6A 1L0OC 2ECCA 3LSMA 4CLCB 3IX4A 2K02A 1FCMA 2ZSHB 3WS4A 2DCEA 1APLC 3T4QA 5GLCA 1SMYF 3QU3A 1DP3A 2XKPA 1X1CA 1E2XA 3FMRA 1ESUA 1VHMA 3VP4A 2OSUA 5CYVA 3WGHA 4YIRX 4MNUA 2CW7A 2QSHX 2CUZA 5M5XJ 1BM9A 3J81Z 5BOHA 1H8YA 5FL3A 2D1VA 2HOTA 2QUFA 1ZHHB 3K0LA 1HF0A 2IGKA 5M5WJ 4GS9A 2BHZA 5H6RA 4HSRA 1WKMA 3ZMZA 5FB2A 4A93J 2B95A 4KIGA 3SH7A 3SYTA 4ITVA 2KRCA 4YG2F 2E2IJ 5DTDA 1AOYA 5FLXZ 1TVFA 3OPRA 4EUVA 3F3XA 2X85A 1SEUA 2X02A 4K91A 1LVAA 3GMWA 4GCZA 3A03A 1M1EB 3DEEA 1PP7U 3CI6A 2COBA 3V7SA 3KPHA 2PN6A 3BG6A 2H0TA 1Z0XA 2JZYA 3HLGA 3KCCA 3VFHA 1I6XA 4W97A 3KYDB 1YSPA 1K6SA 3TGNA 1J59A 4A3KJ 2R92J 1HKTA 4A6DA 1TNSA 3JRIA 3ZQCA 1BSGA 1O7EA 3F1PB 1U8BA 4F3LA 1E3HA 3K2AA 1D5YA 4ASNA 4X55A 4U0YA 1X3UA 1V4RA 2P7CB 1T8IA 1G3TA 1KOUA 4V2FA 1YMXA 2LB5A 3LFUA 5I5LA 4BJ6C 5IP6A 3U2RA 2IP2A 2HOEA 4WLAA 2IS2A 3L2RA 1KE4A 3G1MA 3QAHA 4LLLA 2KJCA 4HX7A 5TBMA 3CDHA 3W8KA 5HX9A 2VT3A 3JRGA 4MMNA 5K5QA 4I7HA 3BQYA 3S17J 4UQIM 2X4HA 3ZQ7A 4BENA 2D2WA 1R58A 2BVLA 4PSXA 5KVRA 1DU6A 2QJ5A 4NQWB 3HREA 3U1KA 3NARA 1NTCA 2YX7A 2HOSA 3LI9A 2ZNZA 1XC5A 1JJ8C 1VQKI 3F8FA 5HLGA 2DW4A 5K7ZA 3C8CA 3IXHA 3LIAA 5CGWA 4J00A 2FBIA 2NAZA 2XPUA 3VYSB 1YRNB 3RYPA 4O0PA 4IHQA 4E7IA 2PG4A 2V1BA 2Y91A 2GA2A 1PP8F 2D02A 3IXBA 5KCMA 1YW7A 1BTLA 1MJAA 3HLEA 4MN5A 2W84A 1OCZH 2DA5A 4RA2A 1DUXC 4X0GA 4OMYA 1CJFA 2HDQA 4V19K 4M9SA 4DXBA 2HZ5A 2R9XA 4RB1A 2HWVA 1XDUA 3G73A 3A2KA 4LRZE 1A6IA 5CX7A 5FROA 3C18A 1PUEE 1NH3A 1JHFA 3HGGA 1YJWI 1NZUA 3S2HJ 4S2IA 2K9MA 3HKZN 2KDOA 2K4JA 4ZTKA 3EGDC 1G3SA 3FMQA 1CF7B 4WF0A 2PDRA 1W5SA 2MYSA 3MN2A 2LFBA 3CP8A 5E1WA 4XRFA 5E8GA 1V5GA 4BXUA 4A3IJ 3L9KA 4PM9A 5CECA 4HEFA 2BE5F 5F6FA 1YS6A 2V1UA 4M9XA 3IL2A 4P1WA 1X2NA 1TDGA 1F5MA 2LSOA 3HLFA 4IEDA 2JMWA 3HSRA 4KIBA 3OYBA 3ZG8B 5ICGA 1NLYA 2NRAC 4UHTA 5C3EJ 4AVPA 4HRIA 3BZ6A 3GTOJ 3C2WA 4WEKA 5J6XA 2A5WA 2X9DA 3FYZA 1ZH5A 2MW8A 4A0YA 3HOZJ 4JPMA 5JYPA 5LGNA 3IHBA 3MEXA 2K40A 2KRFA 1YPRA 4BJTA 2E34A 3MWMA 1KZHA 2KKOA 4KZ5A 3EUHC 4XLPF 1DJAA 3Q0UA 4ZYAA 1YITI 2R7WA 1XFQA 1CF0A 2N8GA 1UGUA 4OAYA 3OY9A 5HWWA 4E4HA 1I2SA 3E2LA 4UUTA 3ELKA 5LLQA 3FK7A 3RPUD 1S3JA 2KZVA 2ZBKA 5CJ9A 1YLJA 2WGIA 3LSIA 2VBWA 3RJUA 3FKWA 1FOFA 3UE0A 2EQRA 3BG5A 1RIOH 4QPOA 2M7AA 1Z3XA 4E6WA 1FILA 1R36A 1A36A 1YKDA 3U4LP 2RL3A 3H82B 3ZDJA 1MBHA 2VJIA 5EZGA 2VPRA 3BLYA 2V79A 4QWQA 4XORA 3KYLA 1E17A 1L0EA 1LFPA 3H35A 3NAUA 2CQKA 5A93A 3IWQA 2A68F 5H20A 1JUSA 2L7ZA 4MEZA 2KDZA 1XJ3A 2E7WA 2VBYA 1YLZA 4I76A 1BIBA 1HZOA 3S7OA 2Z6DA 2DLLA 4IQJA 2V6CA 4WL9A 5DCFA 3T12B 2R7TA 3TJZC 3MZEA 2BBYA 2XFTA 4WELA 4LMYA 3NECA 2DA6A 1S72I 2IWBA 5J1RA 4GYGA 2O9AA 2BHYA 2KRHA 3T0YA 2R78A 3CJRB 2KISA 3ZCZA 5FKKA 1ETWA 4N92A 2QWWA 3VE4A 2PU2A 1CF7A 1KYWA 2V8CA 2EIJH 2DA4A 4A5MA 1ZG4A 2HQNA 5TISC 1STZA 3U9GA 4OAZA 5GPCA 2PI0A 2VKVA 1C3BA 4FH2A 1I27A 3DLAA 2HZDA 3T4OA 2I72A 1WA9A 2CO5A 4R1HA 2Z5UA 1DU0A 3HCYA 3CJNA 5FJ8J 3NCKA 2CQ7A 2P7JA 1FMVA 1K79A 2HP6A 2PJPA 3JRDA 1ZN2A 1IV6A 5GHXA 4IJAA 3E5UA 1IF1A 3HJKA 1PVEA 3BJOA 5I94A 4FCYA 1BC7C 4OLDA 3ZMDA 4C6YA 2ICWG 2EBIA 1Z9CA 3VP1A 4FQGA 1DY6A 4GW9A 4EMSA 4E7JA 1D7EA 2J9PA 3OCLA 1RZ4A 2MLGA 4IRHA 3IF5A 2AVXA 4PM6A 3F6OA 3SFIA 3T50A 1BIAA 3WG7H 2VZWA 4OQGA 2ME6A 3GTJJ 5CXWA 2IGOA 3UB9A 5DV5A 4CO8A 4A3LJ 5HWVA 2VI6A 2XSDC 2XA7S 2PX9A 4Y7NJ 4CA0A 2JKFA 1WHUA 3KZZA 5EJCA 4I98B 4M73A 2Z6CA 4XXRA 1IYOA 3BWGA 4DQ2A 3LY4A 4A5RA 2IT0A 1GVJA 4EGYA 2K31A 1MKIA 1WWXA 3DTIA 3PJRA 3BFEA 4B43A 2PMZA 4EM1A 2MLKA 2W7NA 3CCYA 3K4JA 2OAQ1 5FDHA 3S4XA 1OQYA 2R3SA 4NHJA 5D5VB 3MZDA 3W3CA 4HBTA 1YLYA 4G12A 2M7BA 3CJMA 3NJAA 4O3MA 5EPHA 3UDXA 4RGRA 3CC4I 2CRGA 1ETOA 3O8GA 1K4FA 1XGNA 1E25A 5J7EA 4E7ZA 3FISA 1ZGWA 1VEUA 1CEFA 2VV6A 2WZZA 3DW0A 4IJGA 1UCRA 5JLWA 4R3JA 1A6QA 3UDIA 5DD8A 2RNGA 1G5UA 3C2BA 2UXNA 1RCJA 1MWSA 1QA6A 3FG8A 3EWKA 3ICYA 5L09A 3IF6A 1AKHA 3DTEA 3IH8A 2Y69H 1B9MA 2ZLYA 1R5HA 4U87A 1HSTA 5DS9A 4D7NA 2NS0A 2H8RA 1HBXG 3A02A 3ROUA 1X1DA 2W3GA 2HF6A 1BI2A 1TC3C 4BBUA 1WJEA 4F92B 4JF6A 4LIVA 5D8LB 2EV0A 2LVSA 1CI9A 1GCEA 2WY7Q 2BY3A 1XKZA 4HX8A 5EVIA 5F04A 1IN4A 3U2AA 5F1GA 3JTGA 1ZC2A 1RNLA 4JGPA 1HTZA 2OZ6A 3R0JA 2VLAA 2OAZA 3PBOA 2COMA 3JPUA 1IC8A 3LSRA 3P98A 3I71A 2QGUA 4P5OA 3K4MA 3H3UA 3SQNA 1GXPA 4LLNA 1JT0A 4BHPA 1KQ8A 3L2QA 2K86A 3JVUA 4S2MA 1NRJA 3K1PA 4S2NA 1V9YA 5BMZA 5EE8A 1WCMJ 2XAHA 2WZXA 1RPWA 5LBRA 3VYRB 5DCMB 1ZAOA 4ESBA 3MCZA 4B9OA 3BROA 3GYHX 5L3EA 1LL5A 1F5TA 2UV0E 2VEAA 4JBFA 5E43A 3HHHA 2ZQ9A 1BR4A 1OJ5A 3HRUA 2ADUA 2MH2A 3H3VK 4ENMA 2WKHA 1SKFA 4P6BA 1DGRM 4QHCA 5L10A 5L07A 1IDYA 3BLSA 2O9CA 4EXOA 2ZC6B 4Y0TA 2DPUA 4XT2A 1LLBA 1AWIA 2JKRM 4WEJA 1MIJA 4DJ2A 1T18A 2XA7M 4RS8A 1PRQA 3SH8A 3V8JA 3WU0A 2QCOA 4WUJA 5EZHA 2QJ7A 1K6OA 4KJZA 3RI4A 5IYBJ 1FOWA 2XIGA 1D8JA 2QQ8A 3MAJA 2Q9NA 2ZNYA 5G18A 2EFWA 4U0XA 1TT0A 3OR2C 4BLMA 5AIQA 2LRDA 1CGPA 2W48A 2RREA 5LEJA 5FQQA 2F5FA 3IKTA 2PHYA 3VP2A 3ZHHA 2XC7A 4OQIA 2W0NA 5HODA 3LY3A 5CHMA 1FOYA 1OTDA 2X1EA 3LSGA 3S7QA 5KMWA 3KZYA 1DDNA 3SS3A 3IHUA 3T4TA 2Z2LB 2WBMA 3H92A 2HFHA 1XMAA 5JR3A 5L3CA 2OTJI 5IT9K 4JGOA 2HQ5A 2LY1A 4IVNA 2ZD8A 5LGTA 4ZH4F 1F4KA 1G6AA 4EBNA 5ICFA 1N9BA 4L9NA 1Y0NA 2CJJA 1UZCA 4BU2A 2OF7A 3OWTA 4FE7A 3K7AJ 1LDDA 3ZQFA 1TWFJ 5FD6A 5AONA 1OTAA 4IHXA 1YLTA 4LG0A 3SS4A 1SHVA 3BFFA 2WADA 4HF1A 2XRNA 1MH4A 3I3LA 2F48A 5J47A 3FHZA 3HLDA 4M3KA 5B66C 2AXTC 1D8KA 2ZB9A 3OYKA 3OYGA 1ACFA 1H8ZA 3UE3A 2M30A 1K7AA 5K5RA 5M1AA 3ECOA 1XXMA 3F1OB 2CS3A 3P9KA 2EFNA 5IS1A 3J80K 3DPUA 3LIEA 1RGYA 4M3GA 1ZYRF 5CPRB 5JHFA 2GIZA 3SZGA 3PO2J 2RDPA 3CO6C 1Y4OA 2OAP1 2TCTA 3KX0X 3CP2A 2XRLA 2Z16A 4BEHB 1N9OA 3F1NB 1W5TA 2CSOA 2RNJA 2AQEA 1ZRDA 1TBXA 3HEFA 3I4PA 1YX3A 3DPLC 2V4JC 1Z7LA 3CCRI 4BE0A 1P9RA 3C5AA 3HZJA 2H09A 3ONQA 1P7IA 2DOFA 3S3OA 1EH8A 3OYLA 3G32A 3G31A 2QKLB 2VJ5A 4NUBA 3L2UA 2QBYB 2V9PA 3N8LA 3RH8B 1QVUA 2ID6A 4RDUA 3N4IA 3HOWJ 2CU7A 3JR9A 4OPQA 2JK3A 2KLOA 2CV0A 1LDKB 2E2JJ 3OL3A 4DNCA 5AQBA 1Z09A 1YW8A 5ERIA 3I59B 2J3TC 5FI6A 5FKLA 2HPBA 2FOKA 2LOOA 5LBQA 3PL8A 1MBJA 2WGWB 2VE8A 2XSJC 4LFUA 2K7SA 3NOTC 4G3KA 4QY6A 2HXIA 2WB1N 1SFUA 3MXRA 5E18F 3T1SA 4YFNF 2K2NA 1Z21A 2HOAA 5FQKA 2VGKA 4ZBEA 2WUQA 4HQMA 2DN0A 1SD6A 4JYKA 3V7CA 3G1LA 3G2ZA 1IN6A 1MBEA 1ITYA 3WS5A 3B6CA 3F21A 2R7UA 3LSHA 4XMYA 4MEXF 3G2YA 2YU9J 5F1JA 3ECHA 1OTBA 3WTVC 3BZKA 4WCGA 2NVUB 3ZFZA 1H88C 5DF9A 1U9NA 5B1BH 4JXSA 3BP8A 3HRSA 4L5JA 1FBUA 2EH3A 3PUFA 3VWBA 3A0RA 3ZPLA 3P01A 2R5YA 3NDGA 3EGXC 1LE8B 1UFMA 2M8EA 3AGEA 3IX3A 5CVIA 2MABA 2EFQA 2UWMA 1FSHA 2GWRA 1R23A 4A3CJ 2Y2IA 4JOMA 4GZBA 4RQ9A 5GHZA 2LKXA 1QU3A 3F1OA 3MMHA 2P7VB 2NVXJ 4F7ZA 4KQQA 1EH6A 3NY4A 4L0LA 2K3PA 3UKGA 3S1RJ 4NXGA 2NUPC 2W3DA 2OWJA 2CUJA 2X1CA 4E3OA 4Z1WA 4XSXF 5LRSA 2ZM0A 2P9VA 4MN6A 4PMAA 4AD9A 2NOJB 2V9KA 3F1NA 4M6YA 4AIHA 3G6OA 1V5FA 4L0YB 3LEZA 3UB6A 3M1CA 1Y8RB 4O6JA 1Z6TA 3SZTA 2DA3A 3JRFA 2M87A 1YT4A 1ALQA 4CSWA 4KQRA 3Q9VA 1LSWA 5BQTA 2QBYA 2BXYA 1V5EA 1GLNA 4HP4A 1HVBA 2M3AA 4E04A 3S1YA 3PBQA 1ETQA 1QQIA 2HQAA 1Z77A 2VOOA 2ME0A 5H2FC 5TGFA 2ZM2A 2Y0SA 1BW5A 3FC7A 3G4SI 3LO7A 3NWTA 4IUHA 1WI9A 2XPVA 2L01A 1CQTA 4CLCE 4FISA 2JRTA 3GTLJ 4KUOA 2IW5A 3JRAA 3ESWB 3CF2A 1NXYA 2K3FA 2QLZA 2V7FA 5F0CA 2QA4I 4LIUA 4XM3A 3GSGA 4G3VA 2FMLA 2K5CA 3GFMA 2IBDA 1XSVA 3BR3A 4S05A 2VPLA 3ABKH 3HKZA 1G6OA 1K25A 3P9IA 2IGMA 1SANA 1QRYA 2L0WA 4H4KC 3A3JA 3HJIA 2L02A 1GSXA 3JVVA 1MMNA 1USSA 2BY2A 2D1HA 4G8XA 4FASD 3WE3A 3L00A 4HF0A 5L3FA 3BJNA 2VJWA 5EM0A 4BWIA 2K9SA 3KP4A 4U0TA 4C2MJ 4OWRB 4BL2A 1F98A 2M1BA 2WAEA 3ERMA 3C4OA 4GOGA 4II2A 4LPZA 1JTDA 2HKOA 4Q5SF 3RJPA 1VZ0A 2F2EA 2FQ3A 3BOQA 4WMCD 2R7DA 1NG7A 3UR3C 3E6CC 2KDKA 5CVVA 4PGGA 2J8YA 3KLOA 1UELB 4DBQA 1XGMA 4XKWA 2W24A 5D4SA 4Q0JA 1YHQI 5ILSA 2Y2NA 3FZCA 3Q81A 5DEQA 1OPXA 2YR2A 1R1TA 2AO9A 4GCVA 5HWTA 1Z7UA 1F36A 1GSWA 1K57C 3VFFA 1ES5A 2ZMAA 2QYBA 2V0UA 2A05A 2FNPA 4G3WA 2CYYA 5B1AH 1WJDA 1X3ZB 1EH7A 1HKQA 1LNWA 4HEA2 3IWIA 3H5RA 4KZ8A 1FBSA 4MFEA 4R79A 2E1MB 4I01A 4ENNA 2R93J 1K61A 4QU3A 4YNRA 3RSNA 5M3MJ 4EJUA 5F1FA 2G7UA 1JWPA 2BY0A 2XGCA 2KX6A 3Q7VB 4WZ4A 4BE1A 3GMEA 3EEAA 2AS5F 5F1RA 2UXXA 3R4KA 2OCCH 1CEGA 4GD8A 1ZG6A 3ZR8X 1XGOA 5FI2A 4RB0A 2L2OA 1HLVA 5FEGA 5FKNA 4IKFA 3CPTA 2ZXJA 1IKIA 3A0HC 1ERQA 2WGVA 3PAEA 2JUCA 3WRTA 3V3SA 4GGGA 1KYZA 1C0WA 5A8BA 5J8XA 4MFDA 1R22A 1O57A 2QHKA 1REPC 2ID3A 2K85A 3K4KA 1KGEA 3L7HA 5DUIA 1IOUA 1D0ZA 4B09A 2XAUA 3CCSI 1MNMC 3TW7A 5C44J 1MH3A 4I0BA 1SDEA 1X1AA 5KSHA 2IA2A 2MH9A 4C3HJ 2RQPA 3WODF 2QQAA 4MN7A 1BA5A 3A0BC 5HL6A 2DK8A 3DWKA 4HQAA 4M3FA 3GTKJ 1U5TC 4IRGA 4S2KA 5EFWA 4AIKA 1Q1VA 1GHPA 4H8RA 3IBJA 4WXHA 3MKWB 4QWOA 4X56A 3VSLA 3JTHA 4DJAA 3T1RA 4M6VA 1V3FA 1KONA 3M3YJ 3H7WA 4E3KA 3TBIA 4FD8A 2M4KA 1VQ4I 2FOWA 4OOLA 1WJ5A 4B4CA 4CCOA 3S93A 4KUKA 3DXJF 1JVJA 4H6JA 4CYCB 1BR2A 1RKTA 5LHHA 1I3AA 3WTSC 3GZ5A 3R7WA 1HW5A 2FXAA 3I0TA 2HP5A 3LSJA 4BQMA 3EOIA 3F72A 3KP3A 4M4XA 3HPHA 4OIRF 4BGDA 2MSYA 2OA4A 2WY8Q 2Y75A 3LQRA 2ZC2A 4N9IA 3VEPA 5LEKA 3FXMA 2JA7J 1GUUA 5KAIC 4LITA 1NJ4A 2OC6A 1TS6A 3PBTA 3T4SA 4D7MA 2EXAA 5FQIA 1XFNA 1ZR2A 4XSZF 2VIXA 5D3OA 5GL9A 2DFIA 5HARA 1J3WA 4IHWA 1TZLA 3K1MA 5IYDJ 3LA3A 1RRJA 2IPQX 3VDXA 4GJ4A 1WJAA 3HGYA 1CK3A 1ZHFA 2XVCA 3RKQA 1H0MA 1X1BA 1DGWY 3DFGA 2PRFA 1ZKGA 2GQQA 2VKDA 2HYJA 4XRSG 4DZJA 3PR6A 5IT9Z 4NETA 3T4JA 3K70C 1KU7A 1P0ZA 2Y9YA 1KGSA 3E6DA 5HLIA 4PJNA 1VQ7I 4G9YA 4HJ6A 3DCFA 4C30A 2R5ZB 1XPBA 3A01A 4E7KA 1NWZA 2IRFG 2ZC4B 1RR8C 2LTPA 3FZVA 2VKSA 1IJWC 2ZQ8A 1IUYA 1QVTA 1SD5A 1T1CA 3ZP5A 4EATA 4A3MJ 1DP8A 3RXWA 1K83J 3BG9A 3TG9A 4QJGA 1U9OA 2PYPA 3DV8A 1MJBA 5EDNA 2M45A 2X6XA 5F27A 1U78A 4ZYHA 1FOXA 1XMXA 3S16J 3BY8A 3M2JA 5CHJA 4OLGA 3H36A 4Y4RA 2FNAA 4U0VA 2PBYA 3L2WA 1BJZA 2VA0A 1G4DA 1KQ0A 4EM2A 3LGOA 2Q1ZB 4XR6A 3J80Z 5C5KA 2A5YB 4NB5A 2L0KA 1LQ1A 4HLYA 2JKGA 3UB8A 3ZQ5A 1E3UA 5CTMA 5LFAA 5AVEA 2DRWA 4FTHA 5FLVA 5HOOA 2EZKA 5EUAA 3GZNB 4M74A 4XICA 2KZGA 4LV2A 2UV1A 3KX2A 5TRDA 2X1DA 2XGXA 1T38A 4UAAA 4KZ9A 2XGEA 2A49A 3WS0A 2ZL1B 1IN7A 2JA8J 3W4OA 2DFEA 1I5QA 2KMUA 3HUOA 4HP9A 3KYCB 3LMMA 4RB2C 1FLIA 1IW7F 1IXCA 4WWCA 1O7FA 2ZBBA 4LENA 3I64A 2VODA 4HH3A 4OKPA 3S22A 3CUQC 5CGSA 1SZVA 2K27A 3UE6A 2L9NA 3LIDA 2R4GA 1QHGA 2VXZA 1FIAA 3GFLA 2XAGA 3ERED 3I56I 3Q5FA 4UUSB 2B9SA 1O4XA 2OLUA 3JYIA 4GLQA 5AQAA 1B1BA 5EVEA 1PUFB 3OS1A 4BYYA 1XPXA 3ZG5A 4D5CA 4DE1A 1R1VA 2P6TA 4EQ1A 3BG3A 2QMIA 5M18A 4YELA 4PM5A 1I1GA 2HTJA 1W36C 4A3BJ 2R7XA 4PJMA 2HDRA 1Z05A 1ULYA 1LI9A 3P09A 3B42A 3PTEA 4Y7PA 4LRXC 4ZRRA 2WKEA 3PO3J 1S5LC 4J19A 4YWZA 4EBLA 1O3TA 2QSGX 1MZUA 1XG1A 2ZM8A 2JN7A 1MBFA 3NHQA 5DUKA 2M1CA 2O6GE 1ENHA 3HUGA 1HCRA 2H5SA 2CMNA 5DF7A 3RTRA 3DBHB 2JKTI 3FK6A 1R9TJ 2FU4A 4LOCA 2LYCA 3I4NJ 4CCMA 5GAEJ 3FV7A 2WC2A 4CUGA 1Y8QB 2ZCWA 1IDZA 1MWRA 2PMUA 1W7FA 3MS6A 3GTMJ 1GHMA 2ZMEA 1K0KA 2OPTA 2B7EA 1QZEA 2H1KA 4UB8C 2J3TD 3ML6A 5FLMJ 1XCBA 3KP2A 2L54A 2ECBA 2PBDP 4NG2A 2CW8A 1Y39A 3Q07A 4G6QA 4AIJA 5EF6A 5HNHA 1S7AA 5EGOA 1K56D 4OIPF 3QP5A 3LCEA 2Y0SN 4AYBN 5BOXA 2XQZA 3VSKA 3M4OJ 4N1XA 2HVQA 5HAQA 4IX7A 4IOCF 3DKWA 4XN3A 2DCFA 1T6SA 4P55A 5HNFA 5M3FJ 3CCUI 1Q2PA 4MLLA 1TWGJ 1LEBA 1XDSA 4Q8IA 1FYKA 1P4WA 2MGQA 3QNCA 3BZCA 3E7LA 4U3TA 2GOXB 3GO5A 1EF4A 2W3FA 4BS9A 4KNYA 1DRMA 4NKPA 2A61A 2ZL1A 4ENKA 2A07F 1W7PD 2KIFA 4PAUA 5IOYA 1BLPA 4DDYA 3PSIA 3UO9A 3MKYB 3SJMA 1WJBA 1K54A 3NDEA 3OZHA 3K69A 3MD2A 3KIOA 1ES3A 3S14J 1WSUA 3MZYA 1Y54A 3BPXA 3E0YA 1P4AA 1UHWA 2XAFA 5KK1A 1HC8A 1ONVA 3E5XA 3IH2A 2BY1A 3J7ZI 1PUFA 2PYRA 1LPQA 3GQZA 5CHUA 2EIKH 3HLCA 1S4RA 3H0GJ 4MDZA 4Y5FA 3UPPA 4DDSA 1GHCA 3IAS2 3F1PA 3OLOA 3V7RA 1KGFA 5CVUA 3PQKA 2ZC5B 2ZQDA 3T4KA 4BJ5C 1O3QA 1X4PA 1H9TA 1HDDC 2X01A 4ABZA 4ID4A 4A0ZA 1JTYA 2KL4A 4JX5A 4M72A 5J1YA 3IWOA 4UEYA 3G71I 2ZO4A 1JKPC 1PW8A 1YLFA 2JQ7A 1OT6A 1W8YA 3ZQLA 4FT8A 2Y55A 4G7OF 4LCLA 2H94A 2Z2MB 3MFKA 3CJTB 2DAOA 3CCEI 1VQ8I 3JW4A 2NVTJ 3GDIA 3QPLA 3QYBA 1YQAA 4N4NB 3AGFA 3GLLA 1A5JA 3W2WA 4DW6A 2WB1A 2Z1DA 1S4SA 2O61A 2L4RA 1SD7A 4X53A 5AVFA 2NNYA 4EEFG 2OTLI 3KO6A 5GLBA 1BI1A 2X6WA 4CHUA 4A3GJ 4CPKA 5E79C 4NQWA 3C2GA 3WGIA 2L5QA 4KZ6A 4E6XA 3MKLA 1T33A 2KIMA 2DMTA 3GTCA 2HYFA 4BUPA 4D60A 3Q7ZA 5HDKA 3I55I 1ERMA 5F0FA 1VQQA 1LDJA 3BY6A 1YRNA 3KYZA 4UV8A 1VETB 3TDZC 4EESA 1TQIA 3IP4B 4OPZA 3GVBA 4IO9F 1SVMA 2L9VA 2EJRA 1TQMA 1QHHD 5FATA 2Z3YA 4RX3A 2HDWA 3AKZA 4P0MA 2IXSA 1Z6FA 2V9VA 1FOKA 4XLHA 1PZPA 2PMHA 1GHIA 2OU2A 2RN7A 1WI3A 3TOIA 4HAMA 3IWZA 3WTWC 1I2WA 3PM1A 2RVCA 3OYNA 4CLCA 4JX4A 5J1UA 3O3VA 4PZJA 4LLOB 2L9RA 4HDVA 5CVRA 3W2ZA 3N6IA 5EG0B 5HAPA 4EWFA 1OTEA 4DIQA 5E3OA 3E4QA 1PYVA 2E1OA 2DYSH 1XN7A 2LNBA 5DJTA 4RM2A 4Z6YA 3DF8A 5F5YA 2LG4A 4IPAA 2L1MA 4I3IA 2F4OB 1IZ1A 4EQQA 1YSQA 3OYHA 1S66L 2ZMFA 3MZ8A 3K4NA 3A0SA 3DEWA 5HS8A 2EB7A 2XPWA 1FWZA 4E7LA 3S1NJ 3ZQGA 3UN7A 2Q9MA 4GO1A 1JUMA 4N9HA 1MC0A 2BW3B 3SXYA 1OYWA 2H10A 3IV5A 1N9LA 1NZOA 5F0HA 1Y28A 5GTHC 1XS9A 4B47A 3SOIA 3LA7A 4GN2A 2QPNA 2ZMVA 4UY8I 1O7LA 3CDIA 2XAQA 2QVOA 1ZKJA 4OOMA 1L0DA 4I3JA 3WHCA 1S1ZA 3V3RA 2M2EA 3GZ6A 3C30A 3E1SA 3CJQB 2ZFUA 3VFZA 2A24B 2VJJA 3HBLA 2B0LA 1S6RA 3LFVA 4XOTA 2E36A 5E2GA 3VOYA 4EW7A 4L5EA 2BGCA 4A3DJ 4CDGA 3H82A 5JHUA 2NXNB 2VK3A 2FMYA 1S8NA 2EZLA 2VX8A 2WAQN 1VQOI 3TW6A 2VONA 4H0EA 1ZRCA 4M3BA 1B9NA 1TW2A 4HBLA 4IOAF 2IS1A 1WPKA 3KSIA 4B4XA 5JVGF 1XGIA 2QEXI 1XMKA 2LF8A 3NC8A 3LI8A 2C6WB 4HV6A 1E3PA 5GPAA 3FXQA 1VETA 5IPAA 3G1OA 3PFYA 1B72B 1MDMB 3QYEA 4JF4A 1NYMA 2P8TA 2GNXA 1CQAA 2VGLS 1IUFA 4AC0A 5ICCA 2BOLA 4A5NA 3WTUC 1LI0A 2J9OA 1KDSA 2F5EA 3QOEA 4F3QA 2EFUA 2J80A 4D1QA 1UJ8A 3HYIA 3CUEA 2FFFB 1J2XA 2R7SA 1OKRA 3CMMA 3DWLE 3KEYA 2HV1A 1QGPA 3L9FA 2OUMA 2L3DA 1D0XA 2HPMA 1M6KA 4KZ7A 4B4ZA 4NNJA 1H8MA 1YQSA 3UY6A 3F8CA 3C4PA 2WWYA 2WKPA 4CLCC 4BACA 3N97A 1YMSA 1SMTA 1IXSB 1E4DA 4EUZA 3TMOA 1BN5A 5DKKA 1BLSA 3L7WA 1T1BA 5L3BA 1BR1A 3WTTC 3H9QA 5E1XA 1EV7A 3IF6C 1OCPA 4DZPA 1R7JA 2DI3A 4CZZA 5C4JJ 4AFIA 2XB5A 1TS0A 3RQ4A 5KNLA 4KG2A 1WGXA 2GLOA 4PM8A 2IJLA 4ETXA 4EV4A 2Z2SB 2E5NA 4NC6A 4U7BA 3LR4A 2DOAA 3RCOA 1ERDA 4LK1F 2QZ8A 5EVIC 3ZVTA 5DTKA 2ISZA 2R7ZJ 2A24A 3SW1A 1D1AA 4EBPA 3F8BA 1IRGA 4MCWA 1T98A 2LF7A 4PGHA 4F93B 5J8FA 1H5XA 2NYXA 2P0WA 2B02A 3BEBA 2LH9A 2H27A 3PIPF 2GJ3A 3DWZA 3M9AA 4XRMA 1WYBA 2NNNA 4WZ5A 2XAJA 3CZ6A 3BRMA 3VODA 3BY9A 3JREA 1ZG1A 1HW2A 4GDNA 2E1CA 2C5WB 5HDCA 4G6DA 3QP6A 4XUXA 1OJGA 4S2NC 5AQ7A 1OR7A 4GDFA 1Z3YA 4MNRA 1W7PB 5HLTA 4ETSA 2BG1A 1J7KA 4M3DA 3NOUC 2CFOA 5D5UB 4B3XA 4QSHA 1ORKA 2EPFA 3SHFA 4ETZA 4ZDPA 4PKYG 5GP9A 3N4MA 5G4YA 1L0GA 1RC9A 2FA5A 4Y17A 3D5RC 1ZRFA 2Z33A 3D4FA 3KEOA 3K10A 4F91B 4ESJA 3WS2A 2V1XA 3CC7I 1XJ4A 4KA4A 4B8XA 1SFOJ 2GXBA 4Y15A 1ODDA 4BBSJ 4D5FA 4HHDA 4DE2A 4WK8F 3ULQB 1I3QJ 3LL7A 2VGLM 4JGQA 1MPLA 1ESIA 5K5BA 2V1NA 3PFIA 1FT9A 2OQRA 3O6BB 5GLDA 2IWDA 1ZARA 1QZYA 3QOPA 3RIRA 4DJ3A 3NOPC 2LP0A 4MBFA 3HUNA 2YX4A 4XNFA 3OSGA 4YEJA 2EX2A 3OOVA 3HC7A 4F52A 2BTFP 4E3MA 1UB9A 4MQVA 1XCVA 3FXLA 4QD4A 3H9JA 3AG3H 2K9LA 2JPBA 5IT3A 2XSSA 5HPFA 2Y2GA 4CICA 5EOOA 1X1PA 5DCMA 3C7UA 1W36D 4HYEA 3FKIJ 1W63M 2P5LC 1KQ9A 3FPWA 1XX5A 4ZAMA 1FIKA 3A3FA 3BPVA 4K0XA 5GADJ 3AGDA 2DT6A 4NXEA 5F82A 1NYYA 4M71A 1U8RA 3G35A 4YIIA 2O5RA 2ZQCA 1FQGA 3D72A 3GTPJ 3BM6A 2Q2EB 2IS4A 2LLKA 3CDLA 1G3YA 3W6VA 3S3MA 2Q8KA 1PWCA 1X19A 1K56A 4JP0A 3QHYA 2DYRH 4RGUA 2K7LA 2DMNA 2ZKZA 3D9YA 1R5GA 2HR3A 4F55A 3P5JA 3MMYB 1RR7A 3WGGA 2X48A 1E3OC 1BLHA 2EWWA 2OLVA 3FHNA 2D45A 4KMUX 3J7AY 4XUZA 2FH5A 4JKTA 5K7HA 3MSHA 3IS2B 3IH4A 2ZJRF 1IEMA 1TDLA 1USTA 4HA8A 4DOZA 2W1TB 1DP7P 4P85A 3HSEA 3V39A 3M8EA 3R60A 5F64A 4OINF 1FTZA 3ZMUA 2OQGA 1X0OA 4O5VA 1F1ZA 2L7MP 3TW8A 2X6OA 2KPMA 3LYXA 2CGPA 4IHYA 1XB4A 4BBTA 2DMWA 2XH9A 3BCAA 3TRCA 2XD1A 5HPIA 3JRHA 1LKXA 2PJRB 2HDDA 4OONA 1K6RA 4PHTA 4XKCA 3ZXSA 4G6TB 1ES2A 4BQQA 2ZJ2A 3Q0WA 2FEZA 2ACGA 1BUEA 5ILUA 1FNNA 1YYVA 4MTDA 1J0RA 4CH7A 4NC7A 1JHHA 3IH3A 4Y33A 3TOBA 5IP9J 2VV8A 5FAOA 1EWZA 3P7NA 4CCNA 2Y30A 2Y59A 3LR0A 1R4NB 4AUXA 4A2UA 4BKXA 2V8FA 4U88A 3Q1FA 1QMEA 4KISA 3NULA 5F83A 4ESFA 3RPUA 4ARZB 4HOBA 4FX4A 4GDBA 2R7VA 1YI2I 3BCBA 1I1SA 4X25A 3BJAA 1D06A 1XJ6A 1YM1A 3BTIA 1BI3A 4LV3A 2L7FP 1S7OA 3PHYA 3S1MJ 3D3OA 4C3IJ 4BEHA 2XKOA 2PD8A 1PI5A 3BQAA 2VQHA 1CI8A 3RKXA 3VPRA 3V67A 2EX8A 4CYDA 4I6ZA 5E2FA 2LR8A 5EM1A 1MWTA 3BR2A 4HX4A 4OMZA 1DP6A 3M6HA 5HSQA 5AJGA 2PEXA 4JXVA 2Y0MA 4E7HA 4RAGA 2DT7B 2Q2EA 2VBXA 4Y3OA 2CWEA 2QQBA 1FSWA 2HDCA 2K9QA 2MC4A 3FDYA 4D0PA 1L0FA 1YLWA 4E7SA 3BR0A 2P74A 4CJNA 1U5TB 3ZVWA 4DN0A 2A6HF 2MC3A 4A0XA 1R5ID 4XLAA 4LB5A 2VKHA 4IVIA 1A0KA 3OYMA 4P9UA 1JKQC 4AYBA 3I59A 3T5XA 4OOYA 3W4QA 3D1NI 3D0SA 4NEED 3BR1A 1P9WA 2WGWA 3BQ8A 3N8SA 4XIDA 3O86A 2YSRA 4HW0A 1F9IA 3SEZA 3HUMA 3F22A 3IS2A 5J40A 2KOIA 4UV9A 3E5QA 2DQRA 2OV7A 3S2WA 1VQNI 5K1YA 4PFPA 4KFCA 4I2OA 5DTSA 3BYDA 1DQUA 2HJ9C 1WJCA 5K5OA 5CEDA 2DFHA 2ZXIA 5LGUA 3LICA 1LSXA 4OP8A 2L4MA 3HB9A 3LIBA 4I99C 1UG2A 5FAPA 4E3JA 2M4GA 1TWCJ 2B18A 1PJRA 4JLFA 3NIAA 5TJJA 4HOIA 4UA6A 1K55A 2YKHA 4YRVA 5E1ZB 3CMYA 1HA8A 3HIFA 2VKEA 4L9VA 5LD2C 2JKRI 1IKGA 3IT9A 3N8RA 3TE8A 3REOA 1YX5A 5FD5A 4OOIA 3V8KA 2M9HA 4PJ0C 3EQLF 3IUOA 4I3AA 2OBPA 1MSEC 3IH9A 2HNHA 4MTEA 3ZGKA 4PUSA 5E2HA 3OV8A 5HDGA 3E97A 1LE8A 1A31A 4UHUA 2GDNA 4JX6A 3HRMA 5EECA 4I02A 2XROA 2Y2ZA 2LBFB 3EQVA 4RVAA 4OQHA 1GV2A 5ILVA 3AL0C 4Q4ZF 5D6FA 3QP4A 4C2UA 1T0FA 2YS9A 3HOVJ 3UB5P 3UNWA 3QODA 3VOLA 4E3IA 2FUG2 2O9LA 2CMPA 4Y3IA 1D1CA 3MBZA 3Q82A 3ZG9B 3WTYC 4ENJA 3NI9A 1FC3A 3HLBA 4YIFA 5FQJA 1BC8C 1RP5A 1Z67A 3DKYA 3OIPA 1ZGAA 5LRRA 3HBRA 3TO7A 1P4XA 5CVJA 1VQ6I 4R6LA 3BFCA 3FWLA 5FFZA 4B93A 5GLAA 1KVLA 3EEHA 5BPDA 4BBRJ 1ZREA 4OH0A 4Q0HA 3VYUB 2QENA 1JUPA 4WM9A 3OL4A 2H0YA 2OZUA 3IAM2 5FQ9A 2DMUA 5KHDA 3DU6A 5J4YA 5D5WB 4BMWA 2INWA 4DF6A 1T08B 3S15J 2Y9ZA 5FASA 2DBBA 5M5YJ 4CQHA 1IELA 1TS7A 4UA9A 4QY5A 2X71A 3D5LA 2DA2A 2QKMB 4HNTA 1Y1WJ 1B8IB 4O01A 5DTTA 3VP3A 3A3IA 1OCRH 4OPYA 1XSXA 5B5EC 2QZ6A 2R7OA 5BPIA 5E8IA 1IRZA 1LFUP 1FSYA 1XJ2A 1IV8A 2W25A 5H6QA 2VQLA 3UE1A 2EWVA 3AG4H 2P81A 3V4GA 4DXCA 4ZDOA 2A6EF 2E1NA 4B3AA 5HS7A 1TLHB 1W5CC 4Q48A 3CUQB 2CFXA 1NK3P 1KU9A 3W2AA 4X6TA 1TS8A 3F8MA 1P92A 3GCMA 4RYEA 3OPPA 3QU6A 1T39A 1KE3A 1S0WA 3UB7A 2DDBA 3LQQA 5HDDA 5KZHA 2BYVE 2GAUA 1NHAA 4LJZF 1SKOB 4FCFA 2JWTA 3LNQA 1K78B 2VOPA 3EYIA 1TD5A 3CMEI 2JT1A 2EWNA 2YUSA 3E98A 5J4EA 5HLHA 2L4AA 5FKOA 4BHBA 1I50J 1QPMA 2R7QA 1L3LA 3A4CA 3GTQJ 2EA2A 1UMQA 2DK5A 1I6HJ 2WYXA 3FWEA 1S67L 3SS5A 3ULFA 3ZQHA 1XA1A 2ZC3B 4JXGA 3ZN0A 5HAIA 3MQOA 3PIOF 3CZDA 1VQMI 2HP9A 2G9WA 4IF4A 4KZAA 2VE9A 1X4OA 1YW9A 2OOLA 1VNDA 2KT0A 2V20A 3HHGA 1JGSA 4M3EA 3H1CA 3ZMVA 3I4MJ 4R3AA 5EV0A 3Q3SA 4KIFA 4CLCD 1N78A 2OV5A 3BQZA 3L09A 2WV1A 3O2PE 3LAJA 3KSFA 3UDFA 1QZZA 1ONHA 3E6MA 4GS9B 3L2VA 2LC2A 4ANJA 2Z9OA 1VFCA 3LR5A 1U0JA 4XLEA 5JVTA 3KZIC 5D5XB 2DJNA 5C4XJ 3ZMTA 2FX0A 4BL0B 5J8CA 3K1NA 1B6AA 4IXAA 2GZWA 2JPCA 4NDLA 2W82A 1IG7A 3TSGA 3UPNA 3S3NA 2JCHA 4P96A 2F5DA 2ZJQF 3Q7VA 2LMDA 4ZC3A 5DM7F 3OBFA 4GYIA 3BW6A 5IYCJ 3LUQA 5EVID 1OISA 3M7GA 1Y56A 1QO0D 2WAQA 2FD5A 3OYJA 2CC1A 3A3DA 1FP1D 1ON1A 5HS9A 5IU1A 3GUDA 4NBQA 3JRCA 4F3LB 2JSCA 1VI0A 3G34A 2FZ0A 4OIOF 2CH0A 1MNEA 4MGRA 4KZ4A 4L9GA 3AG1H 2DMPA 2DMQA 3T1BA 3ZQQA 1XP4A 1P9QC 1T2KA 2IWCA 3GF2A 3IC7A 4D9JA 3O88A 4EJVA 1AU7A 3LR3A 3ZYTA 2M8GX 1FSEA 2NS7A 4QPRA 4S2LA 1LL9A 1IO2A 3GEZA 1X2MA 5TBMB 2M7UA 2JRMA 4KMFA 2STWA 1IGNA 5FAQA 3ZNTA 1I5ZA 2G7HA 3WG9A 1MKMA 3H5AA 2Y2LA 3OPHA 3ABUA 2TRTA 2A69F 2NVQJ 4KZBA 2CQQA 1MW7A 4WX9A 2ZJPF 2I10A 3HDDA 1LHYA 1WYCA 2Y2OA 5JYOA 2M0MA 4DYRA 1O3RA 1MD0A 5J3WA 1VB6A 4BXFA 4CYCA 2KFDA 3JSPA 2DDAA 1KE0A 3DBAA 2DA1A 1WE4A 4V2GA 2Q0OA 2DTZA 4HV5A 4KG5A 3OYEA 1YLPA 2XDVA 3KSGA 4I5SA 2JJ7A 4L9TA 1J09A 1YIJI 1JKRC 1FPQA 1R1UA 2ELKA 2RC4A 3WHBA 4C3JJ 3AAFA 4ON0A 3QWLA 5E3LA 1IYSA 1ACIA 3H3ZA 4LD5A 4ESPA 1LT0A 3EETA 1FJLA 2EA9A 1MZBA 1SFXA 1L2SA 1FBQA 3LEQA 3VOZA 4GXOA 4MHGA 5EEAA 5FFXA 1PWGA 2XLNA 5GTIC 2FFYA 1XD7A 2FJ1A 3V8LA 4O8GA 1YG2A 2GBYA 4PSWA 3P9CA 2UUZA 4G94A 1PZOA 1H3QA 1TWAJ 4P6ZM 4S2OA 2GM4A 2LD5A 1H9GA 3PSFA 3OPLA 1QNTA 4FTXA 1QMFA 3LSTA 1IRXA 3ZOBA 1Y1VJ 1IYPA 2GZAA 4CCKA 3T1XA 3TO6A 1AWCA 2J5OA 3ZQIA 2R5ZA 5FKMA 1G2HA 4WYYA 3B47A 2W4SA 4IZZA 4HIAA 3SEQA 3MFDA 2V1DA 3M07A 1KVMA 3TEDA 4IBRA 3VV4A 4ZTFA 3G30A 3GLXA 4A12A 2ZJ9A 2RKHA 1VQ9I 3FPVA 3WS1A 3OOUA 4S2PA 3BTCA 4W1UA 3C1DA 3VMAA 4X6AJ 1J5YA 3K6GA 4XLCA 1K38A 1N4OA 2GXGA 2GXAA 3VP0A 1FY7A 4PM7A 1MBGA 4L0ZB 2OJED 2VB6A 1IYQA 4RLQA 4HLXA 3TOAA 3ZNYA 3BLMA 3BTJA 1OYIA 3M8JA 4UUVA 4RLFA 3C7JA 2V2FF 1ZGJA 3SZPA 4IVKA 3IKVA 3ZRGA 2ZQAA 3PYPA 1WQ2A 1TW3A 2ISYA 2V26A 3EDPA 1POGA 4BDYA 2IA1A 4KYWA 2NS8A 2ELJA 3OIQA 3CQZJ 2DA7A 1YOVB 3HRTA 4IEJA 2FBHA 4LLGF 3GBGA 4M6XA 3ZG0A 1IAWA 2EZIA 3TDUC 1JTXA 1FP2A 1U6GA 4EJTA 1HW1A 2EA4A 1QPIA 1YAXA 2F4MB 4P87A 5GAGJ 3D5SC 2FF4A 3GW2A 4EGZA 1HD8A 1RETA 1ZLJA 4BQOA 1OFCX 4L9JA 4KG6A 2JBFA 1UWNX 2VGJA 2P5VA 3MQ0A 1G68A 1U60A 4BDZA 1Q1HA 1R00A 2NOGA 3SDBA 1RUNA 3QPHA 5A2QK 2Y2JA 4N9KA 4LB6B 4OP5A 4I0AA 1X58A 3W6KB 4OVDA 2ZMEC 4N4OB 1I39A 1MMAA 3EUHA 2Y2MA 2XR0A 2FSWA 5DVAA 3TO9A 2VL8A 4EETB 4UUSA 3Q0VA 4HJ3A 2ZXHA 3DBLB 2L7KA 3RFBA 4BJPA 2I8DA 2ESHA 3BTLA 3R6SA 3EYYA 3MKFA 4RM3A 3LAPA 3K4CA 2BASA 2YPRA 3C7VA 4CZCA 2BEOA 3I53A 3CITA 5CGXA 4FOFA 5IT5A 2X51A 4AVZA 2J7VA 3ASNH 4NC8A 3MXQA 2HS5A 1A04A 4A3JJ 3O3KA 3OYCA 1HQCA 4OU0A 2A6TA 2V9AA 1F43A 1BBYA 1UHMA 1XGJA 2R0QC 1RI7A 3CC2I 1BULA 4HY8A 5CRFA 2P04A 3Q9SA 1MXOA 4BL3A 2DJIA 4HESA 2Z99A 3DBRB 3E0JB 2UWXA 4GD6A 4MIMA 3J7YJ 4K0WA 3CTAA 3OS2A 3CMAI 2J5PA 2A3UA 1K54C 4TV7A 4EEPA 1GVDA 1GT0C 3A1YA 4AU7A 3HOSA 5JFRA 5A90A 1RUOA 1W1WE 3CAXA 3GR2A 1IN8A 2MFZA 2RV8A 2WAFA 2LKPA 3L2CA 4U0WA 4QTRA 1K4SA 4XRSA 4F94A 4MBHA 2CG4A 4RAZA 5J4VA 4CCLA 5LHIA 4JBAA 4BNCA 1YFHA 4KENB 4WMCA 3U1DA 2VLGA 1EKEA 4AIDA 4O7DA 5DYMA 1UAAA 4C9YA 5CEBA 2CV1A 1YJNI 2O7OA 3BDDA 4KN7X 4DBRA 3S32A 4GRIA 3WTXC 1LSVA 3FXUA 4HBUA 4R38A 2O03A 5E3NA 3B73A 3FIWA 5DKLA 4B44A 2O8KA 2PT7A 5D8KB 3A3EA 1EW0A 1Y0UA 3VYTB 1JWZA 5JI6A 1XGSA 1HOMA 1LUJB 1VEUB 2MD0A 4PCQA 1EI5A 4R1GA 4S2JA 1HLUP 2P08A 3VE3A 2E60A 5HD3A 4DGWB 3M6BA 4L18B 1LEAA 2DTRA 2NVYJ 3DU5A 1VF9A 5E20A 3DTKA 1AKHB 1FR1A 3RKWA 3IF6B 1S29A 4HNVA 4ZZDA 3EQUA 3ABMH 5D6EA 2CV2A 1J9MA 1LJ9A 2HKXA 3LWFA 1R71A 4R4SA 2F6CA 3HOUJ 2VASA 4EVIA 3I7JA 4A69C 3CLQA 5EVIB 3DLLF 3COAC 5HD5A 1ETXA 3ZMSA 3QPTA 5FI7A 3OSFA 1MMDA 3CD6I 2BXZA 3KSHA 1LB2A 4OPRA 6PAXA 3AG2H 4X68A 2KP6A 4QPQA 5FRMA 4FHTA 3HJEA 4WXCA 3F8NA 2LY2A 5L3DA 3WWXA 1G6NA 1MNDA 2F5CA 3ABTA 1OCOH 4HG2A 2LK2A 1YJ9I 2STTA 3M8FA 1DPUA 2BZTA 5EVLA 2R7FA 2E5ZA 3M1EA 1GA9A 3HXLA 1S1YA 2EX6A 4B1RA 2RCXA 4FX0A 2JTVA 1FR6A 3K3CA 3WU2C 1E0EA 3CCJI 2F4IA 1AXBA 1PIOA 1Z1DA 3DQVC 3HOTA 2PLYA 2HU9A 3BWLA 4XLFA 4BXXJ 5DF8A 3UMDA 3F6VA 4A3FJ 2KJBA 4RGXA 3B33A 1ZQ3P 4UVCA 1W79A 2B5RA 4ZJZA 1NLZA 2I9VA 3DTMA 1T1AA 3CO7C 1TP4A 3JSOA 2EX9A 3IXDA 3GFJA 3H9WA 2FQ4A 3L1PA 3NRVA 4WBGA 2XUBA 2HVRA 3W6JB 5U47A 1W63Q 1U2WA 1MWUA 3OYIA 4XT2B 1OLTA 4HJ4A 4MO7A 5AQ9A 1TWHJ 2XF7A 4BHCA 4DE3A 5A92A 2WV0A 3HSFA 2O9BA 4HNUA 4X69A 3ASOH 3CCMI 1TF1A 1Y6IA 3FM5A 4ZJ3A 5HDSA 1Q2QA 4YOFA 4IQ4A 3R61A 4BH9A 3EUKL 2XD5A 1FCOA 2V0WA 3IQAA 2W3EA 2RAEA 4LGWA 4BAYA 4JXWA 2GA1A 1NK2P 4R8HA 1O3SA 4PK4A 1SC7A 3S2DJ 3JCUC 1D1BA 5EG0A 1W0UA 2R7RA 1B59A 3KP5A 3JAMK 2PU4A 1N9NA 2ESNA 1S9HA 3MZHA 3AFHA 4Y52J 3FKVA 1AHDP 2XGNA 2HDUA 3E3VA 3V5MA 5M19A 1FEXA 3GRJA 4XKVA 3K4LA 4HPQA 4PFOA 5HZHA 2G2UA 5DFXA 4LG0B 4BY7J 1Z6RA 2BW3A 2O3FA 4CCJA 1VTNC 1N77A 3MKEA 4K08A 1P7JA 1WZ2A 1PWDA 4DRTA 3FXOA 1FX7A 1RESA 3CLOA 2LY9A 3HPGA 3K4BA 4RAFA 4E70A 1IN5A 2FBKA 4ZYDA 1K6YA 3RZOJ 1FCNA 3K70D 1VM1A 1W8QA 2O8XA 3WRZA 3IBRA 4N0BA 2OCEA 2HXOA 3HG9A 3LSKA 2Y2KA 3OC2A 4C75A 4X1MA 4DE0A 2M34A 2JE5A 3QQAA 4B48A 1S7EA 1PW1A 1SCWA 2BVMA 3RTYA 2V1AA 1IXRC 3ZGAB 4MBKA 1T95A 3CCQI 2I5UA 3W2VA 1MBLA 4GKUA 3S8PA 3KYEA 5DJUA 4CXFA 3CUEC 1P6RA 3LSPA 1JJ6C 3ISPA 1OT9A 3FMSA 1WFXA 3OR1C 1G28A 2BV6A 1NRFA 2Y79A 4FSFA 3QP8A 3T4LA 4ZTJA 4EU0A 4UB6C 1BW6A 5FO5A 4HI4A 1J9IA 4AWXB 3VOEA 4ZDXA 2DO7A 3MVPA 3MJQA 1TQPA 3RDIA 1OTIA 4MQ9F 1PYYA 1R4MB 2GX5A 3LA2A 2WA0A 1BL0A 1GSVA 3HM5A 2VC1A 2VBZA 4L9EA 1SD4A 2E35A 3KP6A 1RGZA 2ZC7A 3CWFA 3E2KA 4JF5A 4UA7A 1B72A 1MDMA 3LIFA 1YIOA 2RQQA 2HZTA 5TFQA 5MC7A 2PBIA 1TT5B 2EFPA 4ZJ2A 2CQXA 3RKYA 1ZTRA 4LK0F 2ACJA 3BJ6A 2XK1A 2PFBA 4RX2A 3ISGA 2O0YA 3BC8A 3TL4X 5FQMA 2HYGD 3S7NA 2DNSA 4BQNA 3FX3A 3RQIA 5IP7J 1JGGA 4CGZA 1T19A 4KQDA 3W4PA 3I5UA 4WZ5C 3TP0A 1D1JA 3T8RA 3GWZA 1A35A 4YFKF 5DDGA 2XV4S 2MA3A 1OR7C 4I09A 1XTAA 4R4RA 2QM3A 2KLIA 2DQLA 3KP7A 3CHWP 3E4OA 5IY5H 3PXPA 3FF5A 4DYCA 5GAHJ 1H89C 2JVGA 1R6RA 1ZR4A 4BE2A 4IL6C 1UG0A 3ZCOA 2JA5J 1E3UD 3CG5A 4XQFA 1MGTA 2R5YB 2Y4AA 2VC0A 4XOPA 1FIPA 3IRQA 4EQIA 3CCVI 4UNOA 1ON2A 3CESA 4EJOA 4QB8A 2XF6A 1VQ5I 3PUBA 3GFIA 4HQEA 3BG7A 4PPRA 2O99A 5GHYA 2EXBA 2QF7A 2ZXWH 3FXJA 3HTSB 2ZOHA 2JA2A 1N75A 2MD5A 4KZ3A 1KU2A 1YS7A 1TTYA 3DP7A 2XGDA 3ZG7B 2XB0X 5A2QZ 2P9VB 3C3WA 3OYDA 2PAVP 3KE2A 3EPZA 3O87A 3OYFA 4G7HF 5CQGA 2ELHA 2K4BA 3KETA 2FE3A 3NBLA 4NK3A 4WXDA 4NXFA 3C2HA 3HVFA 3TKYA 3SH9A 3FKJA 3GX4X 5G4ZA 1TL8A 2CUEA 1LFBA 4Y13A 1OJLA 3J81K 1BOAA 3NEUA 1DJBA 1W7PA 1IFQA 3C38A 3MFXA 1KU3A 2HGCA 3FM3A 1YE9A 4N1HA 1D3YA 3OOPA 3A0VA 1O07A 1ZG3A 5HW3A 5FLXK 3B6AA 1W0TA 2K9NA 2V6EA 1SFKA 2EFXA 4A3EJ 2DXIA 4GFBA 2G2WA 3MR0A 1SDNA 2FRHA 2WKQA 5BS6A 4UVBA 4N9LA 3F23A 2XEPA 1FTTA 4Z2YA 3JRBA 1FMWA 2VQCA 4GHIB 1ETKA 2G0EA 2Y31A 4JK1X 3GV9A 3OMYA 3AL0B 1BYWA 1GV5A 3PBSA 3RYRA 1ZLKA 2M5WA 2JHEA 4HF2A 1ES4A 1G59A 5L3GA 3ITBA 3IXGA 5FA7A 3QRFF 4YFXF 4HZFA 1PNEA 5HVQC 2MJ6A 5CKTA 4XONA 3LOCA 5D4RA 5FRNA 1JTGA 1PI4A 3IRRA 5BNGA 2WKRA 2XASA 2M7VA 3EUAA 4RBOA 1JE8A 3WE2A 3WU1B 3CUOA 5IOZA 5F69A 3SDGA 3I54A 3OYAA 1FZPB 3GTGJ 3M2KA 4ZYEA 2Y48A 4PJJA 4UVAA 3V42A 1OMIA 2AHQA 1BI0A 2JN6A 5KAFC 5HDNA 2QKPA 3HL9A 3I9V2 3PBRA 3QYFA 4IBXA 4LRYC 1DP9A 4EV0A 1Z91A 2C6YA 2DOEA 2ZFWA 3PQJA 3CCLI 4LV1A 4LG3A 3RZDJ 3QP2A 5J3LA 2IEKA 1ZELA 4XKBA 1MY8A 3SFZA 1TEMA 4Y0UA 3WTZA 1LL8A 1LVKA 2W3HA 3TQNA 3OCNA 1GXQA 3X2QH 2CUFA 2DT5A 2LREA 2MG4A 4AM3A 1P97A 2HTSA 4UXNA 4EJWA 1ODVA 2Y2PA 3KYQA 1P2FA 5KSCA 1FYMA 1UWPX 2IA0A 1ETVA 3U21A 2B63J 2PR5A 2H1LA 3BR5A 4U7DA 4HDUA 1KDWA 1JXSA 3DAVA 1MJ9A 3H0DA 3BFGA 3G2BA 4KT6A 4FH4A 2GIVA 4S0HB 1D5VA 4XL9A 4RB3C 4Q0IA 1WH5A 2W1TA 1VQPI 5DFYA 1HSJA 9ANTA 3FXRA 2JA6J 1JKOC 1GDTA 4X1LA 4PJLA 4EERA 3GECA 4A6EA 3CPTB 4YINA 2ZOIA 3B02A 3RPQA 2V1ZA 3ITAA 2Y2HA 5ICEA 2IAIA 4EM0B 3MZFA 4XLNF 2LB9A 2EILH 2PJRA 3KEQA 1PDNC 5JLXA 4C2TA 2VUMJ 2L9SA 2DU9A 1W4MA 2M0CA 3O8HA 3BECA 5HL1A 3T8TA 1FYLA 2KQRA 4IRIA 2JC7A 2PMZN 2EZHA 4GHIA 1K57A 2JVHA 4E6KG 2X0LA 3GXOA 3TP3A 4Q47A 2IGNA 5L2FA 4IHVA 2W57A 2UZKA 2DFFA 2AQFA 2E8JA 3RXXA 1T56A 4FETA 3UMEA 1N25A 1MMSA 1JNUA 2EV5A 2VV7A 3H7WB 4RGSA 4D2OA 1SVLA 4HNBA 3DPTA 2XHKA 1G8XA 1SVOA 4ZZLA 1YO5C 4I38A 4BQAA 1B4AA 3PBNA 4ARZA 2LKSA 2MBFA 3MKZA 4PKYA 1SAUA 4H6JB 2H8WA 1MSFC 4OIQF 2HJEA 2DODA 2QYOA 4MLOA 1NG6A 4S04A 3K9TA 1WRJA 5DM6F 4IUKA 2JKTM 3R7WB 3UPOA 2IS6A 4BD0A 1MMGA 1WVRA 5AIPA 2IVMA 2VN2A 4IHTA 5E2EA 5E17F 3PNVA 2W85A 5CERA 2XF3A 1AA7A 1BOBA 1K55C 3E6BA 5FDSA 3NQOA 5B3SH 1XX2A 4II3A 3QP1A 4LCMA 2PQ8A 2JUGA 1ETYA 1GA0A 5F08A 5F68A 1TNTA 5EEHA 4C3QA 3IHAA 2HEOA 4ME4A 3S7PA 4E3NA 3H5NA 1U5TA 3LFKA 5CLSA 3HTUA 4R70A 1OCCH 3KLNA 2J3WA 3QPSA 2NUTC 2OD5A 4RMNA 4QIWN 3JAMZ 3VB2A 1HXDA 1F9NA 2R9WA 1EJ9A 1RKWA 4ZYGA 3BFDA 2KHMA 3HOYJ 3OIOA 1WJFA 3J7AO 1JWVA 3F9KA 2PD7A 4II7A 4DKIA 2W00A 2QWSA 5FEFA 1K4TA 3A01B 2H28A 2RGVA 3HL2A 1T0FC 3HOXJ 2EFOA 3OS0A 2F5VA 3K3DA 3PAGA 2GOMA 1ZG5A 4L9FA 1S6LA 3T1QB 1U3EM 2EK5A 2WK0A 4NXBA 5TR7A 4B88A 2D5VA 5IHVA 4KDPA 2Y2QA 1R49A 4BD1A 4WF2A 2E71A 2AXLA 3IWFA 2PR6A 1PFLA 5CQEA 1OMEA 4GNUA 3HLWA 1SFEA 4KT5C 5LHGA 2EV6A 3V50A 2WTEA 1H8AC 5HFOA 2XF5A 4MEYF 1UHSA 4JQFA 2DPDA 1OCTC 2OWHA 1ONGA 1X3WB 2KIUA 4OQ0A 2P5KA 4L5IA 3ABLH 2ZSIB 1V9ZA 3DEUA 2W1OA 3DKXA 2A2LA 1ZK8A 3PNYA 1BLCA 1K4EA 4DYQA 1ZTUA 2P6SA 4JGRA 3G3ZA 2XDMA 3G4PA 3N7WA 1XSDA 4R0QA 1VQLI 2VQGA 3QNBA 4IHSA 3FBNB 5EOEA 2LBFA 2W1RA 4P6ZS 4RAYA 3ZN1A 2E2HJ 3E4PA 2CW0F 2EIMH 4KN4X 2HPIA 1KGGA 4FUWA 5A91A 2VT2A 5CTNA 2ETHA 4HSTA 4E3LA 2HQRA 1OYYA 1EA3A 2CQNA 4Y2FA 1JI8A 1V54H 5K7FA 4I39A 3CF5F 1DPRA 2XFSA 2Y8HA 4ZJ1A 3NWSA 2QQ9A 4WN5A 4XN0A 2E8IA 3CMZA 3KFWX 4M9ZA 4P9FA 3B3XA 4R23A 3R0AA 5ED4A 3H9GA 2HVSA 1NY0A 1MBKA 1OPCA 5EYRA 5KIZA 1SAXA 1IRFA 3S1QJ 1HDPA 2E7XA 4RA7A 5FGMA 4G7ZF 1DJCA 2HDSA 2YKFA 1QBJA 2ZQ7A 5F6AA 1KA8A 2BLSA 2TDXA 3UNGC 4HH2A 1YTYA 2JSPA 3N05A 2X6YA 5DD4A 5EEGA 3I58A 4KUMA 2E19A 5E3MA 3BT9A 4FE4A 2WKIA 4R3BA 3O5YA 1B8IA 2LDUA 1BJAA 3G6EI 2D01A 3MF0A 4J01A 3FXKA 3HUGB 4X1EA 4UQIS 2H6BA 2EINH 1M40A 2W27A 2P4WA 4Y0OA 1D0YA 3BR6A 2VJ4A 3MXSA 3GVAA 4KITB
chains in the Genus database with same CATH topology
2A3SA 1G3WA 4K2EA 2ZMEB 1HKSA 3CUQA 4QLCU 4XBFA 4PDKA 2YU3A 4KICA 2H6CA 1K78A 3K2ZA 3IX8A 1J75A 1L0OC 3IX4A 2K02A 1SMYF 3QU3A 2XKPA 1E2XA 3FMRA 5CYVA 3WGHA 4MNUA 1BM9A 3J81Z 2D1VA 2QUFA 3K0LA 5H6RA 3ZMZA 1WKMA 5FB2A 4KIGA 4YG2F 1AOYA 5FLXZ 3F3XA 1LVAA 1PP7U 3V7SA 2PN6A 2JZYA 3KCCA 1I6XA 3TGNA 1J59A 1HKTA 4A6DA 1TNSA 4ASNA 4U0YA 1X3UA 1V4RA 2P7CB 1G3TA 3U2RA 2IP2A 2HOEA 3QAHA 4LLLA 2KJCA 4HX7A 3CDHA 2VT3A 5K5QA 4I7HA 2X4HA 3ZQ7A 2D2WA 1R58A 5KVRA 2YX7A 2ZNZA 3F8FA 5HLGA 2DW4A 2FBIA 2NAZA 3RYPA 2PG4A 2GA2A 1PP8F 1YW7A 1MJAA 2W84A 4OMYA 1DUXC 4M9SA 4RB1A 2HWVA 1XDUA 3G73A 3C18A 1JHFA 2K4JA 1G3SA 3FMQA 1CF7B 1W5SA 5E8GA 5E1WA 4XRFA 4BXUA 2BE5F 5F6FA 1YS6A 2V1UA 4M9XA 3IL2A 2LSOA 3HSRA 4KIBA 5ICGA 2NRAC 4UHTA 4AVPA 3BZ6A 5J6XA 1ZH5A 4A0YA 5LGNA 3MEXA 2KRFA 3MWMA 2KKOA 4XLPF 3ELKA 5LLQA 1S3JA 2ZBKA 5CJ9A 2VBWA 1RIOH 1R36A 4QWQA 2V79A 1E17A 2CQKA 2A68F 5H20A 2E7WA 2VBYA 1BIBA 2DLLA 2V6CA 5DCFA 2BBYA 4LMYA 4GYGA 3T0YA 2QWWA 1CF7A 1KYWA 4A5MA 2HQNA 1STZA 3U9GA 2PI0A 1I27A 2CO5A 4R1HA 2Z5UA 3CJNA 1K79A 2PJPA 1ZN2A 4IJAA 3E5UA 1IF1A 3BJOA 1BC7C 3ZMDA 1Z9CA 4EMSA 1RZ4A 2MLGA 4IRHA 2AVXA 3F6OA 1BIAA 5DV5A 4CO8A 3KZZA 4I98B 4M73A 3BWGA 4DQ2A 1GVJA 4EGYA 1WWXA 4EM1A 2MLKA 2R3SA 4NHJA 5D5VB 4O3MA 4RGRA 1XGNA 1UCRA 5DD8A 2UXNA 5L09A 1B9MA 1R5HA 1HSTA 2NS0A 1HBXG 3ROUA 1BI2A 5D8LB 2EV0A 4HX8A 1IN4A 3JTGA 1RNLA 2OZ6A 3R0JA 2OAZA 2COMA 3JPUA 3I71A 4P5OA 3H3UA 3SQNA 1GXPA 4LLNA 4BHPA 1KQ8A 2K86A 3K1PA 5BMZA 2XAHA 5DCMB 1ZAOA 4ESBA 3MCZA 3BROA 3GYHX 5L3EA 1F5TA 2UV0E 3HHHA 3HRUA 2ADUA 2MH2A 4ENMA 5L10A 5L07A 2DPUA 4RS8A 3V8JA 3WU0A 1K6OA 3RI4A 2XIGA 1D8JA 3MAJA 2ZNYA 2EFWA 5AIQA 1CGPA 5LEJA 2F5FA 3IKTA 3KZYA 1DDNA 3IHUA 5JR3A 3H92A 2HFHA 1XMAA 5L3CA 5IT9K 4IVNA 5LGTA 4ZH4F 1F4KA 5ICFA 4L9NA 1LDDA 5FD6A 5AONA 4LG0A 4HF1A 2XRNA 3FHZA 1D8KA 2M30A 1K7AA 5K5RA 3ECOA 3P9KA 2EFNA 3J80K 1ZYRF 2RDPA 3CO6C 1W5TA 2CSOA 2RNJA 1ZRDA 1TBXA 3I4PA 3DPLC 2H09A 1EH8A 2QBYB 1LDKB 4DNCA 1YW8A 5ERIA 3I59B 2FOKA 5LBQA 2VE8A 4LFUA 1SFUA 5E18F 4YFNF 4HQMA 1SD6A 3V7CA 1IN6A 3F21A 4MEXF 3ECHA 3WTVC 4WCGA 3BP8A 3HRSA 4L5JA 1FBUA 3ZPLA 1UFMA 2M8EA 3IX3A