2X71A

Structural basis for the interaction of lactivicins with serine beta- lactamases
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
molecule tags Hydrolase/antibiotic
publication title Structural Basis for the Interaction of Lactivicins with Serine Beta-Lactamases.
pubmed doi rcsb
total genus 88
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2x71A00
2WKIA 1L0FA 1PYYA 1GA9A 1PI4A 4WZ5C 1NJ4A 4N1XA 1RGZA 4JXSA 2OLUA 1ES2A 1PZOA 4JF5A 4HBUA 3Q81A 1BT5A 3Q1FA 4E3MA 2Y91A 3M6BA 2E8IA 4CPKA 5FQIA 3HLWA 1K54C 3I7JA 2Y2JA 3NY4A 4ID4A 2ZQ7A 1BZAA 2HDRA 5M19A 4JKTA 2WKEA 3CJMA 1KDSA 3NI9A 1L0GA 4N9KA 1BLPA 4JXGA 2H0TA 4QB8A 4BL2A 4MBFA 3PBRA 1IELA 4QHCA 4S2JA 1L0DA 3MZDA 3UPNA 3VOYA 1IKIA 4KZAA 5EECA 1U60A 2XDMA 4WM9A 3QHYA 3WRTA 3DW0A 3OPPA 3PBOA 3SH8A 5EPHA 2OSUA 2XGNA 2Y4AA 4RVAA 1PWDA 1YT4A 5GHXA 4DE3A 5I94A 2H10A 1I5QA 4FCFA 3FZCA 4BLMA 2Y2KA 1H8YA 4B4XA 4S2PA 2ZQ8A 1NYMA 3A3FA 3OPHA 4FD8A 3B3XA 5HX9A 5GLCA 3IH8A 3N8RA 4RYEA 1QMEA 1E3UD 3IT9A 5DF9A 3NDGA 5CECA 3HBRA 2HPBA 3UN7A 2XQZA 2JCHA 1HZOA 4E3NA 1GHPA 1OMEA 2EFUA 1O07A 4OPRA 4X68A 3ZG9B 2XD5A 1NRFA 5U47A 4P85A 1BTLA 2ZQDA 1FR6A 4A5RA 4E3LA 4ZAMA 3S22A 4E6XA 3EQVA 5A90A 4LV3A 1WYCA 5KMWA 2WUQA 1VQQA 5E2GA 4JLFA 1ESUA 5AQAA 4K0WA 3C4PA 5FAOA 4NK3A 1G68A 5CEBA 4OPZA 5FQKA 4IBRA 5KZHA 4H8RA 5EOOA 4LV0A 4KZ9A 3WRZA 1ES5A 1XPBA 2Q9NA 2ZC4B 3N4IA 4IBXA 3SS3A 4BD0A 1NZUA 4OP5A 3WS5A 3IQAA 4FSFA 4L0LA 3WS1A 1DJCA 4QD4A 1YM1A 4YINA 1BULA 3HUOA 2HP5A 3UY6A 2HDSA 3V39A 1K56D 2WADA 4KZ5A 4DRTA 4N9LA 5E2FA 5GLAA 3G2YA 1EROA 1YLWA 4DE0A 3MZFA 4ZJ2A 3RXWA 4JF6A 1L2SA 2DCFA 2JC7A 2Y2IA 3BRMA 3IXGA 4GZBA 4OH0A 1BSGA 1K6SA 2HDUA 4WYYA 2V20A 2XH9A 5FDHA 1Q2PA 1M6KA 3VOZA 4OPYA 3VP4A 5E2EA 1XKZA 1SHVA 3A3IA 3DWZA 1IKGA 1E3UA 1ONGA 4S2MA 5FQ9A 3DWKA 3RJUA 3ZG7B 2EXAA 2R9XA 2FFFB 5DVAA 1K55C 1PWCA 2QZ6A 4C3QA 4WEJA 3TG9A 3IWOA 1KGFA 4OQ0A 3V3RA 1CI8A 2Y2NA 3S4XA 3HUNA 3UNWA 2JE5A 4JPMA 4OLGA 3FKWA 3W4QA 3IF5A 4KQQA 4N92A 2EX2A 3C7VA 5HFOA 3N8LA 3V50A 3G2ZA 4GN2A 4MLLA 1PW1A 3BECA 3C5AA 3HLCA 1ZG4A 2J7VA 1S0WA 2PU2A 3SOIA 1AXBA 1QMFA 1KGGA 4JXWA 3ZVTA 1WE4A 4DXBA 4N1HA 4KQRA 2WZXA 1YLTA 1JTGA 3HREA 3MKEA 5A92A 4E3OA 4K91A 1CK3A 1SKFA 3MKFA 4X56A 5FI2A 3G32A 4OOLA 3V5MA 5GL9A 5CRFA 3GTCA 5HARA 4WMCA 4EBPA 3OCLA 1K4EA 2IWBA 1TDLA 5FQJA 1Q2QA 2X71A 3OC2A 2HP9A 3M6HA 4MNRA 4KZ4A 2OV5A 3UE1A 5DF8A 5FASA 1LL9A 2Y2GA 1MWSA 1W5DA 1IYPA 2HP6A 3A3EA 3E2KA 4LV2A 1KVMA 4O7DA 3MFDA 1MKIA 1IYQA 1XXMA 5CTNA 3VP2A 3O87A 2P9VB 3HLBA 4OQGA 5D3OA 2RCXA 3M2JA 5EVLA 1N9BA 4CJNA 3G34A 3LY3A 1K4FA 3NBLA 4EV4A 1K57C 4QU3A 4IVKA 2XFSA 3LY4A 2EX6A 3OCNA 1XA7A 3VFHA 3IXDA 1L0EA 3BYDA 4DDSA 5GHZA 2VGKA 5A91A 4B88A 2ZJ9A 4IEDA 4GD6A 3OPRA 1KDWA 3VMAA 4KZBA 5G18A 1TDGA 4OP8A 5F82A 2ZM2A 4BQMA 2C6WB 4P0MA 3N6IA 4U3TA 1ZC2A 1TEMA 4R3JA 4UAAA 1KE4A 5TFQA 5DTTA 1GCEA 4ZJ1A 1GHIA 1PZPA 4U0TA 5L2FA 1YLYA 3O88A 4OQHA 1GA0A 3CMZA 3G4PA 1KVLA 1BUEA 2Y2LA 5CTMA 3IHAA 4U0XA 4S2NC 1FCNA 5FAPA 1YLZA 1YMSA 3UDFA 1CEFA 3O3VA 4FH2A 4UA7A 1JVJA 3UO9A 3MZEA 1LL5A 3NDEA 2ZM8A 3HLDA 3ZNTA 1SDNA 1K25A 3PBSA 1EI5A 4Y0OA 3IXBA 5EE8A 3QNBA 5EVID 3ZFZA 5FA7A 1HVBA 5EVIC 1Y54A 1FR1A 3SS4A 1NZOA 5GLDA 4GNUA 3ZHHA 4PM5A 3A3JA 4B4ZA 1DY6A 4LV1A 5CGSA 5J8XA 1KE3A 2UWXA 4R23A 1K56A 1ALQA 2V1ZA 3C4OA 3VP0A 1FCMA 1CI9A 1CEGA 2XD1A 3GR2A 3IF6A 5HAPA 1EWZA 4R0QA 1I2WA 2WYXA 4LENA 1DJBA 2P9VA 1ZKJA 5FI6A 1ERMA 3P09A 4PPRA 2HDQA 2ZC5B 2A49A 1H5XA 3UDXA 2XR0A 3FKVA 2ZD8A 3PAEA 3ZNYA 3BM6A 5CGWA 1HD8A 5EOEA 4S2KA 1LI9A 4OQIA 5BOHA 2G2WA 1K55A 5E43A 4WZ5A 4WEKA 5CXWA 3BLSA 5JYOA 1MXOA 3UPOA 2J8YA 4OOYA 5HL1A 5FQMA 3VFFA 4GDBA 1E25A 3MXSA 4KENB 4WZ4A 3GQZA 3S1YA 2PBYA 3JYIA 2ZMAA 4OLDA 3GRJA 4Z9QA 4DXCA 4GD8A 3LO7A 4XUXA 5F1GA 4EWFA 3W8KA 3BLMA 4X55A 4S2OA 3AGEA 5DTSA 2H5SA 3NC8A 1XGJA 1YMXA 2P74A 4X69A 3VP1A 3OZHA 4GB7A 5EVIB 4DE2A 5AQBA 3BFCA 4JBFA 3Q7ZA 2B5RA 3PTEA 3MXRA 3AGDA 1IYOA 1WYBA 4R3BA 3TOIA 3FWLA 4EUZA 4PMAA 5HW3A 3CZDA 4WMCD 1G6AA 3GV9A 4KZ7A 1ONHA 1PW8A 1SCWA 1Z6FA 3HL9A 3WS4A 3W4OA 2ZLYA 4ZJ3A 4R4RA 5A93A 2Z2MB 2WKHA 2X01A 3BFGA 3FV7A 4MBHA 3SS5A 3ZVWA 4ZBEA 2CC1A 4RX3A 1M40A 2ZC7A 5E2HA 3VSLA 3BFFA 2WAFA 4Y0TA 2I72A 4DF6A 3ZG5A 3PBQA 4GOGA 4UA9A 3UE3A 4DDYA 4E3IA 2QPNA 1PIOA 3PBTA 3Q82A 5EUAA 1MWUA 4RA7A 2H0YA 1SDEA 5F83A 2WGVA 4OPQA 5FSRA 5CGXA 2A3UA 1FOFA 2ZC3B 4BL3A 1MWRA 4S2NA 1K54A 2C5WB 1BLCA 3IWIA 4WBGA 2ZM0A 3D4FA 4P6BA 2IWCA 3G30A 5HAIA 5M1AA 3G35A 4DKIA 4QJGA 4EBNA 3SH7A 4C6YA 2Z2LB 3GSGA 1YLJA 2ZC6B 1DJAA 3DTMA 1JWPA 1JWZA 3N8SA 5CHJA 2EFXA 4NETA 4OONA 3ZG8B 2RL3A 4IVIA 3VSKA 4LCMA 4OVDA 3BFDA 3ITAA 4Q8IA 3PBNA 4KG5A 5DF7A 3ZG0A 4R4SA 4ZDXA 5FATA 3V3SA 2XFTA 5IHVA 2WGWA 2Y2HA 3IF6C 3BEBA 3ZGAB 3HLGA 4KG6A 4UHUA 3UPPA 2Y2MA 2EX8A 3EQUA 4K0XA 2OLVA 2Y55A 3WS0A 1XP4A 4PM8A 3HLEA 2WZZA 5CEDA 1XX2A 1NXYA 4UA6A 3BFEA 2DNSA 3UDIA 1NYYA 1RP5A 4QY5A 1RCJA 4GKUA 4QY6A 1GHMA 5AQ9A 4Y0UA 1JWVA 1W8QA 2Y2PA 3AGFA 3Q7VA 4S2LA 1H8ZA 5FAQA 4BD1A 2GDNA 1FCOA 1K6RA 4EBLA 4MEZA 3ZDJA 4WELA 1PI5A 2FFYA 3GMWA 1FQGA 2ZQAA 1W79A 3HUMA 1K38A 2XK1A 3M2KA 2IWDA 5CHUA 1PWGA 1XGIA 2ZQ9A 3P98A 1O7EA 4PM6A 2WAEA 3NCKA 3PAGA 5TGFA 1JTDA 1ERQA 4OOMA 4EQIA 3G31A 1NY0A 5HAQA 2BLSA 1FSYA 1K57A 1RGYA 2J9PA 4YFMA 4XXRA 1BLHA 2R9WA 5DTKA 3MBZA 2Q9MA 5KSHA 1MBLA 1YQSA 3TSGA 3RXXA 3C7UA 4HBTA 5CHMA 1YLPA 1W7FA 4X53A 2X02A 2XEPA 4DE1A 4KZ8A 1KE0A 1BLSA 2JBFA 5FQQA 4KZ3A 4Y7PA 4KZ6A 2BG1A 4C75A 2DRWA 4E3JA 1J9MA 5AQ7A 1MWTA 5TR7A 4ZTKA 3SH9A 3IHBA 1C3BA 3IF6B 3O86A 4BENA 5F1FA 1W8YA 3GVBA 4JF4A 3IWQA 3N7WA 4HESA 4R1GA 3Q7VB 1FSWA 4PM9A 2XF3A 3CG5A 4MBKA 1LHYA 3IH9A 5FI7A 1ES4A 3LEZA 2XLNA 1LLBA 5M18A 2WK0A 3HLFA 1VM1A 3ISGA 4PM7A 2EXBA 4KG2A 2Y2QA 2Y59A 2QMIA 3HVFA 3OPLA 4GDNA 1IEMA 1HTZA 3VP3A 1N4OA 2J9OA 3ZCZA 4E6WA 2WGWB 1LI0A 3FYZA 4M3KA 1ZG6A 2EX9A 1KGEA 2PU4A 4JXVA 1ESIA 2V2FF 3E2LA 1IYSA 3IXHA 1ES3A 3Q07A 4OKPA 4RX2A 3ITBA 2Y2OA 5CERA 3WWXA 1I2SA 3A3DA 2VGJA 4F94A 5JYPA 1TVFA 3UE0A 2WGIA 3LCEA 4HEFA 4KQOA 4LCLA 3W4PA 5KSCA 1E4DA 5GHYA 4X6TA 3QNCA 4E3KA 1S6RA 4D2OA 1MY8A 1XA1A 2G2UA 4FH4A 4XUZA 4BJPA 3NIAA 2ZQCA 4P87A 5EVIA 4S2IA 3WS2A 1MPLA 5GLBA
chains in the Genus database with same CATH superfamily
4Y5FA 1OTEA 3T1QB 4CLCB 1RGZA 2OLUA 1ES2A 1PZOA 3HJKA 3MFXA 2ZQ7A 1BZAA 2WKEA 1KDSA 3VV4A 4N9KA 2H0TA 4QB8A 3S7OA 1IELA 2XDMA 3OPPA 3SH8A 4EERA 4RVAA 2XGNA 2H10A 3P7NA 4BLMA 1H8YA 4B93A 4S2PA 3B3XA 2PYPA 1VB6A 3N8RA 4RYEA 4EEPA 4WLAA 2CMNA 5CECA 4E3NA 2XQZA 2JCHA 4GS9A 4AFIA 1GHPA 3T4KA 1YPRA 4LRXC 2JKTM 1NLYA 1FR6A 4A5RA 4ZAMA 4IJGA 4E6XA 5A90A 1WYCA 5KMWA 3T4SA 4JLFA 3C4PA 5HDSA 1G68A 1LSXA 3ZQ5A 4DN0A 5EOOA 4KZ9A 1ES5A 1XPBA 4IBXA 3SS3A 4BD0A 1DJCA 4YINA 1BULA 1FIKA 4KZ5A 4N9LA 2HZ5A 1OTIA 4ZRRA 4DE0A 3RXWA 1L2SA 2JC7A 3K2NA 3EWKA 2KX6A 3IX4A 4HIAA 3H82B 1M6KA 3VOZA 1XKZA 1SHVA 4QWOA 1E3UA 4S2MA 3MMHA 3ZG7B 2FFFB 2R9XA 2V0WA 2V9AA 1LSVA 2J3WA 1D06A 3BJNA 4IUKA 4OLGA 3W4QA 3IS2B 4N92A 2JKTI 2HJEA 3G2ZA 3LIFA 1PW1A 1ZG4A 3CUEC 2PU2A 3SOIA 1AXBA 4DXBA 4N1HA 4HP9A 4ARZA 3C30A 4KQRA 1ZHHB 3HREA 1Y28A 4X56A 4LRZE 5FI2A 4HY8A 5CRFA 3GTCA 5AVFA 1XJ3A 3IBJA 5HARA 5FQJA 2HP9A 4G3VA 3UE1A 3E0YA 1T19A 4NXBA 1MWSA 1W5DA 2HP6A 3A3EA 4LV2A 2UV0E 4O7DA 4JGOA 5K5BA 4HJ4A 1UWPX 1MKIA 3VP2A 3O87A 3M2JA 2BTFP 3G34A 1NWZA 4EV4A 3NBLA 2LB9A 3LY4A 2EX6A 3OCNA 3VFHA 5A91A 1P0ZA 1TF1A 4GHIB 2ZJ9A 4IEDA 4KZBA 5G18A 4BQMA 3EEAA 4U0TA 5L2FA 1BUEA 2Y2LA 2VA0A 1ACFA 4U0XA 1YLZA 2QHKA 4UA7A 1T1CA 3PXPA 3NDEA 3S7QA 4Y0OA 3CPTB 3ZFZA 1FR1A 3SS4A 4GNUA 3ZHHA 2YKHA 3A3JA 3FPVA 1KE3A 1K56A 1ALQA 2V1ZA 3C4OA 5HL6A 4RQ9A 2XD1A 3GR2A 3LYXA 2HGVA 1ZKJA 2L1MA 3KYZA 3C8CA 4PPRA 2HDQA 4ME4A 2XR0A 2ZD8A 2Z6DA 3PAEA 5CGWA 1LI9A 5DFYA 5BOHA 2G2WA 4WEKA 5JYOA 1MXOA 4OOYA 4GDBA 4EETB 3F1OB 3GQZA 1UWNX 2PBYA 2K31A 4Z9QA 4L9GA 3BLMA 4S2OA 1GSVA 3AGEA 2H5SA 4X69A 3OZHA 4DE2A 1DP9A 2W3GA 5G4ZA 3QP6A 1K0KA 4XT2B 1TS7A 5HW3A 4WMCD 1HLUP 1Z6FA 3WS4A 3LICA 3CITA 4ZJ3A 3TE8A 1OTAA 4HJ6A 2ZC7A 5E2HA 3UE3A 4GOGA 2QPNA 1PIOA 3Q82A 4RA7A 4BBVA 4OPQA 3DBAA 2A3UA 3A0VA 4S2NA 4WBGA 3BQAA 3D4FA 4EU0A 5M1AA 4EBNA 4C6YA 4ETZA 3DTMA 3KO6A 5L10A 4F3LB 1PRQA 4IVIA 3VSKA 4IHQA 4ZDXA 5DF7A 3ZGAB 4GCZA 4KG6A 4UHUA 3EQUA 3MJQA 3UE6A 3WS0A 2WZZA 1XX2A 2PBDP 3NHQA 3BFEA 1NYYA 1RCJA 4GKUA 1GHMA 2QKPA 4Y0UA 4LLOB 3Q7VA 4S2LA 3UMDA 1T1AA 5FAQA 4PHTA 1FCOA 1K6RA 4LGWA 3ZDJA 4WELA 1PI5A 3GMWA 2FFYA 2ZQAA 1W79A 1K38A 4HJ3A 1XGIA 2XA7S 2WAEA 3PAGA 5TGFA 2W0NA 1FSYA 1RGYA 4XXRA 1YQSA 2PDRA 4KUOA 4YWZA 4KZ8A 5FQQA 5AQ7A 4WUJA 2NUPC 5F1FA 1W8YA 4JF4A 2O99A 3IWQA 2VEAA 2VLGA 3Q7VB 1FSWA 3CG5A 3DTKA 2KLIA 2WK0A 1VM1A 2Y2QA 2Y59A 3F1PA 3QP4A 3FYZA 2EX9A 1KGEA 4JXVA 3IXHA 3Q07A 2OOLA 4P6ZS 2Y2OA 3A3DA 3F1PB 5JYPA 4HEFA 2OWJA 4HH3A 3W4PA 4LCLA 1E4DA 3C2WA 2D02A 1MY8A 1XA1A 5LBRA 5GLBA 2NUTC 2WKIA 1PYYA 4N1XA 2B02A 1P9WA 1BT5A 2Y91A 3M6BA 2J3TD 5FQIA 3NY4A 2HDRA 5M19A 3CJMA 3NI9A 1BLPA 4JXGA 4BL2A 2OAQ1 3KSHA 3QP1A 4HQAA 3UPNA 3VOYA 5EECA 3WRTA 1F9IA 2PHYA 3NECA 1TS6A 4FOFA 2OSUA 2Y4AA 2XA7M 1PWDA 4DE3A 4FCFA 4JGQA 3A3FA 3K3CA 3OPHA 4FD8A 3IT9A 1HZOA 2B18A 2VK3A 1OMEA 2EFUA 4OPRA 3ZG9B 1NRFA 2WKPA 4P85A 2ZQDA 1BYWA 1J3WA 5E2GA 5J4EA 4MN5A 5FAOA 1OT6A 4OPZA 5KZHA 2V8FA 2ZC4B 4G3WA 4OP5A 3IQAA 4FSFA 2J80A 3WS1A 4QD4A 2HDSA 4DRTA 5E2FA 1YLWA 4ZJ2A 4JF6A 4BL3A 1BSGA 3DTEA 4WYYA 2XH9A 5FDHA 1Q2PA 3VP4A 5EM0A 4Q0JA 5E2EA 3DWZA 1IKGA 1ONGA 4CQHA 2EXAA 5J3WA 2B95A 1ODVA 4R70A 1PWCA 5DFXA 2Y2NA 2VV8A 1SKOB 3BQ8A 3T1XA 2GJ3A 3IF5A 1N9LA 4O0PA 1XFQA 5HFOA 2JKRI 5C5KA 1OPXA 4EUVA 3LI8A 1L3LA 2J7VA 5AVEA 3KYQA 5HDCA 4MN7A 3LI9A 2Y8HA 3MKEA 5MC7A 1SKFA 2ZOIA 3MKFA 3G32A 4I3JA 4EBPA 4NXFA 4MNRA 3M6HA 3NOTC 4KZ4A 2OV5A 5DF8A 1P97A 1CJFA 3P01A 4I39A 2VKSA 2P9VB 3HLBA 5D3OA 5EVLA 4QU3A 1YKDA 5IS1A 4IVKA 4UQIM 3IXDA 3BYDA 4DDSA 5GHZA 4ARZB 4GD6A 3VMAA 3LR3A 4OP8A 2FZ0A 2C6WB 3DTIA 1G6OA 5TFQA 4ZJ1A 1PZPA 1YLYA 2BASA 3MQOA 4OQHA 3T12B 1GA0A 3K3DA 2DMWA 2QWSA 5CTMA 4L9FA 4F3LA 1FCNA 2INWA 1JVJA 2PAVP 1K25A 1EI5A 3IXBA 5EVID 4GW9A 5GLDA 1IOUA 2PD7A 2UWXA 3NOPC 4R23A 1FCMA 3LIAA 2W27A 2Z6CA 4LENA 1D1JA 1T18A 5FDSA 3FKVA 3EGXC 1XJ6A 3BM6A 1HD8A 4OQIA 3BLSA 4I38A 3T1RA 3UPOA 3VFFA 3MXSA 5EM1A 4O01A 3O5YA 4OLDA 4XUXA 1VETB 3CI6A 4X55A 1YSQA 4DMZA 3NULA 3T4QA 3MXRA 4Z1WA 3AGDA 3TOIA 2I9VA 4PMAA 3CZDA 3IBRA 1N9OA 4NEED 4KZ7A 1ONHA 1SCWA 1TD5A 4R4RA 1S66L 2WKHA 3SS5A 3BFGA 3KX0X 3ZVWA 4ZBEA 3T4TA 2W3HA 3VSLA 4Y0TA 4DDYA 2G7UA 4E3IA 1OTBA 4HH2A 2W3EA 2R78A 3LEQA 2W1TB 1FOFA 5DJUA 2VJWA 4BBUA 1MWRA 1NRJA 1K54A 4P6BA 3G30A 4DKIA 3SH7A 2Z2LB 3KSFA 2ZC6B 4MDZA 1JWPA 1JWZA 4EW7A 2EFXA 2OAP1 1X0OA 4HI4A 4EQ1A 3PBNA 3V3SA 2XFTA 2WGWA 3F1NA 3HLGA 4DJ2A 2Y2MA 4BWIA 1XP4A 3UDIA 4QY5A 1H8ZA 4EBLA 1VETA 3LFVA 1FQGA 3HUMA 2JKRM 2IWDA 1PWGA 2ZQ9A 1O7EA 3T1SA 1JTDA 1SKOA 3G31A 1NY0A 2J9PA 2V1BA 2O9CA 5DTKA 1MBLA 3RXXA 5HPIA 3C7UA 4HBTA 1W7FA 3T4JA 2X02A 4Y7PA 4KZ6A 4C75A 1W63Q 2DRWA 5TR7A 3RTYA 1S1YA 1DP8A 3IHBA 3IF6B 2O9BA 5FEFA 1DP6A 4MBKA 3IH9A 3G6OA 5FI7A 1LLBA 3HLFA 2EXBA 2J9OA 2WGWB 3F1NB 4LPZA 4M3KA 1ESIA 4JGPA 1IYSA 3W2ZA 4OKPA 3WWXA 1I2SA 4F94A 1MC0A 4II7A 5KSCA 5FL3A 4X6TA 3PR6A 2G2UA 4P87A 2PYRA 4S2IA 3WS2A 1L0FA 1G5UA 1GA9A 1Z09A 3HJIA 4JF5A 3Q1FA 5TBMA 4E3MA 2E8IA 4CPKA 3HLWA 3I7JA 2Y2JA 4ID4A 3CAXA 4HOIA 4X1LA 1L0GA 3PBRA 3HCYA 4S2JA 3MZDA 1EW0A 1IKIA 3MXQA 4WM9A 3QHYA 3DW0A 5EPHA 2GZAA 5GHXA 3QP5A 2IA2A 3UMEA 1I5QA 3FZCA 2Y2KA 3BY8A 2M1CA 1LSWA 1NYMA 1ZTUA 1QMEA 1E3UD 2WKRA 3NDGA 3R7WA 3HBRA 1O07A 4X68A 3NJAA 2XD5A 5U47A 4E3LA 3JVUA 5HD3A 3S22A 3V67A 2P08A 3EQVA 4LV3A 1VQQA 1ESUA 3BW6A 4K0WA 4NK3A 5CEBA 4H8RA 4KQDA 4MMNA 3WS5A 2K2NA 3L9KA 1YM1A 5HWTA 3UY6A 1K56D 3OLOA 1GSWA 5GLAA 1EROA 3TW8A 3BRMA 3IXGA 1K6SA 2V20A 3CHWP 3FPWA 2KDKA 2KOIA 2JHEA 3RJUA 2EA9A 1K55C 4C3QA 3TG9A 3IWOA 3V3RA 1CI8A 3S4XA 3HUNA 4JPMA 2O0YA 3FKWA 2EX2A 3H7WB 2E8JA 3C7VA 3N8LA 4GN2A 3ICYA 4MLLA 4X25A 1KGGA 3KYEA 3GECA 4JXWA 5F6AA 2WZXA 1YLTA 1JTGA 5A92A 4E3OA 1Y4OA 1CK3A 2A2LA 4OOLA 5GL9A 4WMCA 3OCLA 1TDLA 1Q2QA 1STZA 2VZWA 1LL9A 2Y2GA 1IYPA 3E2KA 1KVMA 4Y15A 2M7VA 1IYQA 1XXMA 4OQGA 2K7SA 2RCXA 5FEGA 3LR0A 3LY3A 2XFSA 1XA7A 4LFUA 1L0EA 4R6LA 5HZHA 2A24B 4DJ3A 5KIZA 4B9OA 3OPRA 1D7EA 2ZM2A 2PT7A 4HNBA 2H28A 1VEUB 4U3TA 1ZC2A 1TEMA 4R3JA 4UAAA 5DTTA 1GHIA 4Q0IA 1KVLA 1N9NA 2JN7A 5FAPA 4S2NC 3MQQA 1YMSA 1CEFA 3O3VA 2VGLS 1LL5A 2ZM8A 2JKFA 1SDNA 1CQAA 1S1ZA 3QNBA 5FA7A 1HVBA 5EVIC 1NZOA 3CUEA 3GDIA 4B4ZA 4LV1A 5CGSA 5J8XA 1PNEA 3VP0A 4R3AA 4NXEA 1LT0A 1CI9A 1EWZA 2WYXA 2P9VA 5IT5A 4H6JA 5FI6A 3NOUC 3P09A 3D72A 2ZC5B 2A49A 1H5XA 5G4YA 3UDXA 3C38A 1XJ4A 1TS0A 3ZNYA 5EOEA 2ZOHA 5E43A 5L07A 3SW1A 2ZBBA 5HL1A 1OJGA 1GSXA 4BMWA 1FILA 4H6JB 3B47A 3JYIA 4EWFA 4GD8A 3VOLA 3NC8A 1XGJA 1YMXA 3VP1A 3SZTA 3BFCA 4Y2FA 3Q7ZA 4NKPA 3PYPA 1IYOA 1WYBA 4R3BA 3FWLA 1TS8A 5L8MA 4Y17A 3EEHA 3GV9A 1PW8A 3HL9A 4FUWA 3W4OA 2ZLYA 5A93A 4EEUA 2ZL1B 2CC1A 4RX3A 1M40A 1VEUA 2WAFA 1T1BA 4DF6A 3ZG5A 3PBQA 1OJ5A 2M7UA 3PBTA 5EUAA 4GHIA 1MWUA 2WGVA 5FSRA 5CGXA 3EOIA 4PKYA 1DRMA 1MKMA 1VHMA 2ZC3B 2C5WB 1BLCA 2W1RA 5EVEA 5HPFA 1XFNA 4GJ4A 3GSGA 3N8SA 5AJGA 2RL3A 3BFDA 3ITAA 4Q8IA 4R4SA 5FATA 4EXOA 4MCWA 1PFLA 5F69A 2Y2HA 1P9RA 3UPPA 2EX8A 4K0XA 5HDDA 2Y55A 5F68A 4PM8A 3U2AA 1NXYA 4UA6A 2Y79A 1W63M 4QY6A 5AQ9A 1JWVA 1W8QA 3AGFA 4BD1A 4MEZA 3FC7A 5HSQA 5EFWA 5CHUA 3P98A 2J3TC 4PM6A 1ERQA 4EQIA 2BLSA 1K57A 4YFMA 2R9WA 3MR0A 2Q9MA 5KSHA 1S67L 1XJ2A 3TSGA 3MF0A 3QP8A 2P04A 1KE0A 1BLSA 2JBFA 3E4OA 2VV7A 3IX8A 5CX7A 2BG1A 1S4SA 1J9MA 3LUQA 1MWTA 3SH9A 3O86A 4CLCC 3GVBA 4UQIS 3N7WA 4HESA 5F5YA 2XF3A 3LEZA 5M18A 4JGRA 4YNRA 4KG2A 2QMIA 3HVFA 1HTZA 1N4OA 4K08A 4E6WA 1ZG6A 2PU4A 4L9EA 4FTXA 4LRYC 3TRCA 3ITBA 3D9YA 1TVFA 5HD5A 2WGIA 2PD8A 4X1MA 3A0SA 4E3KA 4R38A 3QNCA 2L0WA 4D2OA 2VGLM 1H8MA 4I5SA 4Y3IA 2ZMVA 4WZ5C 1PI4A 1NJ4A 1G28A 4JXSA 3VE3A 4HBUA 3Q81A 4Y13A 4UEYA 1K54C 4JKTA 3ZYTA 3LIEA 3LIBA 4MBFA 5J7EA 4QHCA 3L7HA 1CF0A 1L0DA 1YAXA 4KZAA 3T4OA 1KOUA 1U60A 1YSPA 2ZL1A 3IX3A 3PBOA 2HJ9C 3H82A 1YT4A 3R4KA 2YKFA 5I94A 4B4XA 2ZQ8A 4G3KA 5HX9A 5GLCA 3IH8A 2HF6A 5DF9A 3PHYA 2HPBA 4M4XA 3UN7A 3UB8A 1SZVA 2QYBA 1BTLA 4ESPA 5I5LA 4CLCE 2WUQA 1F5MA 5AQAA 2VX8A 5FQKA 3H9WA 4IBRA 3WRZA 4LV0A 2Q9NA 3N4IA 1NZUA 4L0LA 4HP4A 3E4PA 3HUOA 2HP5A 3V39A 4I3IA 2WADA 3G2YA 3MZFA 2DCFA 2Y2IA 4GZBA 4OH0A 2HDUA 3LR5A 2V1AA 4OPYA 2PRFA 1OT9A 3A3IA 5FQ9A 2P7JA 3DWKA 5A8BA 5DVAA 2QZ6A 4PAUA 4WEJA 1KGFA 4OQ0A 2XSSA 2W3DA 3UNWA 2JE5A 2EWWA 3A0RA 4BBTA 4KQQA 3S7PA 3V50A 4MN6A 4GS9B 3BECA 3C5AA 3HLCA 3MS6A 1S0WA 2MJ6A 1QMFA 3ZVTA 1WE4A 4D60A 2XROA 1WA9A 2LB5A 4K91A 3F1OA 4NG2A 3V5MA 4P6ZM 3OBFA 5L09A 1K4EA 2IWBA 1IFQA 2X71A 3LIDA 3OC2A 5FASA 2AVXA 3MFDA 5CTNA 4QPRA 3S7NA 2XRNA 1N9BA 4CJNA 1K4FA 3LR4A 1K57C 4YOFA 1LL8A 2VGKA 4B88A 2QJ5A 2VV6A 1KDWA 2PR5A 4IUHA 1TDGA 5F82A 4P0MA 3N6IA 3QP2A 2Q0OA 3LGOA 1KE4A 3BWLA 1GCEA 1S4RA 3O88A 1V9YA 3CMZA 3G4PA 3IHAA 3UDFA 4FH2A 2V0UA 3UO9A 3MZEA 3HLDA 3ZNTA 3PBSA 2JKGA 3OOVA 3JPUA 5EE8A 1Y54A 4PM5A 1DY6A 2GNXA 3RH8B 1CEGA 3IF6A 5HAPA 2OWHA 3T50A 4R0QA 1I2WA 1DJBA 1ERMA 3CPTA 3EGDC 4S2KA 1K55A 4WZ5A 5CXWA 3JVVA 4GLQA 2J8YA 3UB9A 5FQMA 3MQ0A 1E25A 5DKLA 4KENB 4WZ4A 2QJ7A 3S1YA 4XT2A 1F2KA 2ZMAA 3GRJA 4CLCD 4DXCA 3LO7A 5F1GA 3W8KA 5IU1A 5DTSA 2P74A 1H0MA 4GB7A 5EVIB 5AQBA 4JBFA 4KUKA 2B5RA 3PTEA 2O9AA 3H7WA 2V8CA 4EUZA 1H3QA 1G6AA 5HWWA 2Z2MB 3E98A 2X01A 3FV7A 4MBHA 3UB7A 4I3AA 4WL9A 5EV0A 2W3FA 4O8GA 5DJTA 3BFFA 2I72A 2ACGA 4UA9A 3B33A 2H0YA 5DKKA 1SDEA 3CLOA 4PKYG 5F83A 3T4LA 2W1TA 3KSIA 4ETXA 3MSHA 1V9ZA 3IWIA 2ZM0A 2IWCA 5HAIA 3BY9A 3G35A 4QJGA 1YLJA 3UB6A 3E4QA 1DJAA 3IS2A 5CHJA 3ZG8B 4NETA 4OONA 4LCMA 1MZUA 4OVDA 4KG5A 3ZG0A 3VE4A 5IHVA 1OTDA 3IF6C 3BEBA 2EWVA 4WF0A 2OLVA 3HLEA 3CWFA 3TJZC 5CEDA 2DNSA 1RP5A 2A24A 4NXGA 2Y2PA 2GDNA 4EESA 2WKQA 3M2KA 2XK1A 3ULFA 4HHDA 3KSGA 3NCKA 5HAQA 4OOMA 1AWIA 1NLZA 1BLHA 3MBZA 3B42A 5CHMA 3D3OA 1YLPA 2D01A 4X53A 2XEPA 4DE1A 2ZMFA 3DAVA 4KZ3A 4E3JA 4ZTKA 5TBMB 1C3BA 2HV1A 3RFBA 4BENA 2GX5A 4WN5A 1UGUA 4CLCA 4R1GA 4PM9A 3R7WB 3UB5P 1LHYA 1ES4A 4E04A 2XLNA 1A0KA 2PR6A 3ISGA 4PM7A 5TJJA 3OPLA 4GDNA 1IEMA 3VP3A 3ZCZA 1LI0A 4Q0HA 5HWVA 2V2FF 3E2LA 1ES3A 4RX2A 5CERA 2VGJA 1JNUA 3UE0A 3LCEA 4KQOA 5GHYA 1S6RA 3FG8A 2FH5A 4FH4A 3U4LP 4XUZA 4BJPA 3NIAA 2ZQCA 5EVIA 2L4RA 1F98A 1MPLA
chains in the Genus database with same CATH topology
2WKIA 1L0FA 1PYYA 1GA9A 1PI4A 4WZ5C 1NJ4A 4N1XA 1RGZA 4JXSA 2OLUA 1ES2A 1PZOA 4JF5A 4HBUA 3Q81A 1BT5A 3Q1FA 4E3MA 2Y91A 3M6BA 2E8IA 4CPKA 5FQIA 3HLWA 1K54C 3I7JA 2Y2JA 3NY4A 4ID4A 2ZQ7A 1BZAA 2HDRA 5M19A 4JKTA 2WKEA 3CJMA 1KDSA 3NI9A 1L0GA 4N9KA 1BLPA 4JXGA 2H0TA 4QB8A 4BL2A 4MBFA 3PBRA 1IELA 4QHCA 4S2JA 1L0DA 3MZDA 3UPNA 3VOYA 1IKIA 4KZAA 5EECA 1U60A 2XDMA 4WM9A 3QHYA 3WRTA 3DW0A 3OPPA 3PBOA 3SH8A 5EPHA 2OSUA 2XGNA 2Y4AA 4RVAA 1PWDA 1YT4A 5GHXA 4DE3A 5I94A 2H10A 1I5QA 4FCFA 3FZCA 4BLMA 2Y2KA 1H8YA 4B4XA 4S2PA 2ZQ8A 1NYMA 3A3FA 3OPHA 4FD8A 3B3XA 5HX9A 5GLCA 3IH8A 3N8RA 4RYEA 1QMEA 1E3UD 3IT9A 5DF9A 3NDGA 5CECA 3HBRA 2HPBA 3UN7A 2XQZA 2JCHA 1HZOA 4E3NA 1GHPA 1OMEA 2EFUA 1O07A 4OPRA 4X68A 3ZG9B 2XD5A 1NRFA 5U47A 4P85A 1BTLA 2ZQDA 1FR6A 4A5RA 4E3LA 4ZAMA 3S22A 4E6XA 3EQVA 5A90A 4LV3A 1WYCA 5KMWA 2WUQA 1VQQA 5E2GA 4JLFA 1ESUA 5AQAA 4K0WA 3C4PA 5FAOA 4NK3A 1G68A 5CEBA 4OPZA 5FQKA 4IBRA 5KZHA 4H8RA 5EOOA 4LV0A 4KZ9A 3WRZA 1ES5A 1XPBA 2Q9NA 2ZC4B 3N4IA 4IBXA 3SS3A 4BD0A 1NZUA 4OP5A 3WS5A 3IQAA 4FSFA 4L0LA 3WS1A 1DJCA 4QD4A 1YM1A 4YINA 1BULA 3HUOA 2HP5A 3UY6A 2HDSA 3V39A 1K56D 2WADA 4KZ5A 4DRTA 4N9LA 5E2FA 5GLAA 3G2YA 1EROA 1YLWA 4DE0A 3MZFA 4ZJ2A 3RXWA 4JF6A 1L2SA 2DCFA 2JC7A 2Y2IA 3BRMA 3IXGA 4GZBA 4OH0A 1BSGA 1K6SA 2HDUA 4WYYA 2V20A 2XH9A 5FDHA 1Q2PA 1M6KA 3VOZA 4OPYA 3VP4A 5E2EA 1XKZA 1SHVA 3A3IA 3DWZA 1IKGA 1E3UA 1ONGA 4S2MA 5FQ9A 3DWKA 3RJUA 3ZG7B 2EXAA 2R9XA 2FFFB 5DVAA 1K55C 1PWCA 2QZ6A 4C3QA 4WEJA 3TG9A 3IWOA 1KGFA 4OQ0A 3V3RA 1CI8A 2Y2NA 3S4XA 3HUNA 3UNWA 2JE5A 4JPMA 4OLGA 3FKWA 3W4QA 3IF5A 4KQQA 4N92A 2EX2A 3C7VA 5HFOA 3N8LA 3V50A 3G2ZA 4GN2A 4MLLA 1PW1A 3BECA 3C5AA 3HLCA 1ZG4A 2J7VA 1S0WA 2PU2A 3SOIA 1AXBA 1QMFA 1KGGA 4JXWA 3ZVTA 1WE4A 4DXBA 4N1HA 4KQRA 2WZXA 1YLTA 1JTGA 3HREA 3MKEA 5A92A 4E3OA 4K91A 1CK3A 1SKFA 3MKFA 4X56A 5FI2A 3G32A 4OOLA 3V5MA 5GL9A 5CRFA 3GTCA 5HARA 4WMCA 4EBPA 3OCLA 1K4EA 2IWBA 1TDLA 5FQJA 1Q2QA 2X71A 3OC2A 2HP9A 3M6HA 4MNRA 4KZ4A 2OV5A 3UE1A 5DF8A 5FASA 1LL9A 2Y2GA 1MWSA 1W5DA 1IYPA 2HP6A 3A3EA 3E2KA 4LV2A 1KVMA 4O7DA 3MFDA 1MKIA 1IYQA 1XXMA 5CTNA 3VP2A 3O87A 2P9VB 3HLBA 4OQGA 5D3OA 2RCXA 3M2JA 5EVLA 1N9BA 4CJNA 3G34A 3LY3A 1K4FA 3NBLA 4EV4A 1K57C 4QU3A 4IVKA 2XFSA 3LY4A 2EX6A 3OCNA 1XA7A 3VFHA 3IXDA 1L0EA 3BYDA 4DDSA 5GHZA 2VGKA 5A91A 4B88A 2ZJ9A 4IEDA 4GD6A 3OPRA 1KDWA 3VMAA 4KZBA 5G18A 1TDGA 4OP8A 5F82A 2ZM2A 4BQMA 2C6WB 4P0MA 3N6IA 4U3TA 1ZC2A 1TEMA 4R3JA 4UAAA 1KE4A 5TFQA 5DTTA 1GCEA 4ZJ1A 1GHIA 1PZPA 4U0TA 5L2FA 1YLYA 3O88A 4OQHA 1GA0A 3CMZA 3G4PA 1KVLA 1BUEA 2Y2LA 5CTMA 3IHAA 4U0XA 4S2NC 1FCNA 5FAPA 1YLZA 1YMSA 3UDFA 1CEFA 3O3VA 4FH2A 4UA7A 1JVJA 3UO9A 3MZEA 1LL5A 3NDEA 2ZM8A 3HLDA 3ZNTA 1SDNA 1K25A 3PBSA 1EI5A 4Y0OA 3IXBA 5EE8A 3QNBA 5EVID 3ZFZA 5FA7A 1HVBA 5EVIC 1Y54A 1FR1A 3SS4A 1NZOA 5GLDA 4GNUA 3ZHHA 4PM5A 3A3JA 4B4ZA 1DY6A 4LV1A 5CGSA 5J8XA 1KE3A 2UWXA 4R23A 1K56A 1ALQA 2V1ZA 3C4OA 3VP0A 1FCMA 1CI9A 1CEGA 2XD1A 3GR2A 3IF6A 5HAPA 1EWZA 4R0QA 1I2WA 2WYXA 4LENA 1DJBA 2P9VA 1ZKJA 5FI6A 1ERMA 3P09A 4PPRA 2HDQA 2ZC5B 2A49A 1H5XA 3UDXA 2XR0A 3FKVA 2ZD8A 3PAEA 3ZNYA 3BM6A 5CGWA 1HD8A 5EOEA 4S2KA 1LI9A 4OQIA 5BOHA 2G2WA 1K55A 5E43A 4WZ5A 4WEKA 5CXWA 3BLSA 5JYOA 1MXOA 3UPOA 2J8YA 4OOYA 5HL1A 5FQMA 3VFFA 4GDBA 1E25A 3MXSA 4KENB 4WZ4A 3GQZA 3S1YA 2PBYA 3JYIA 2ZMAA 4OLDA 3GRJA 4Z9QA 4DXCA 4GD8A 3LO7A 4XUXA 5F1GA 4EWFA 3W8KA 3BLMA 4X55A 4S2OA 3AGEA 5DTSA 2H5SA 3NC8A 1XGJA 1YMXA 2P74A 4X69A 3VP1A 3OZHA 4GB7A 5EVIB 4DE2A 5AQBA 3BFCA 4JBFA 3Q7ZA 2B5RA 3PTEA 3MXRA 3AGDA 1IYOA 1WYBA 4R3BA 3TOIA 3FWLA 4EUZA 4PMAA 5HW3A 3CZDA 4WMCD 1G6AA 3GV9A 4KZ7A 1ONHA 1PW8A 1SCWA 1Z6FA 3HL9A 3WS4A 3W4OA 2ZLYA 4ZJ3A 4R4RA 5A93A 2Z2MB 2WKHA 2X01A 3BFGA 3FV7A 4MBHA 3SS5A 3ZVWA 4ZBEA 2CC1A 4RX3A 1M40A 2ZC7A 5E2HA 3VSLA 3BFFA 2WAFA 4Y0TA 2I72A 4DF6A 3ZG5A 3PBQA 4GOGA 4UA9A 3UE3A 4DDYA 4E3IA 2QPNA 1PIOA 3PBTA 3Q82A 5EUAA 1MWUA 4RA7A 2H0YA 1SDEA 5F83A 2WGVA 4OPQA 5FSRA 5CGXA 2A3UA 1FOFA 2ZC3B 4BL3A 1MWRA 4S2NA 1K54A 2C5WB 1BLCA 3IWIA 4WBGA 2ZM0A 3D4FA 4P6BA 2IWCA 3G30A 5HAIA 5M1AA 3G35A 4DKIA 4QJGA 4EBNA 3SH7A 4C6YA 2Z2LB 3GSGA 1YLJA 2ZC6B 1DJAA 3DTMA 1JWPA 1JWZA 3N8SA 5CHJA 2EFXA 4NETA 4OONA 3ZG8B 2RL3A 4IVIA 3VSKA 4LCMA 4OVDA 3BFDA 3ITAA 4Q8IA 3PBNA 4KG5A 5DF7A 3ZG0A 4R4SA 4ZDXA 5FATA 3V3SA 2XFTA 5IHVA 2WGWA 2Y2HA 3IF6C 3BEBA 3ZGAB 3HLGA 4KG6A 4UHUA 3UPPA 2Y2MA 2EX8A 3EQUA 4K0XA 2OLVA 2Y55A 3WS0A 1XP4A 4PM8A 3HLEA 2WZZA 5CEDA 1XX2A 1NXYA 4UA6A 3BFEA 2DNSA 3UDIA 1NYYA 1RP5A 4QY5A 1RCJA 4GKUA 4QY6A 1GHMA 5AQ9A 4Y0UA 1JWVA 1W8QA 2Y2PA 3AGFA 3Q7VA 4S2LA 1H8ZA 5FAQA 4BD1A 2GDNA 1FCOA 1K6RA 4EBLA 4MEZA 3ZDJA 4WELA 1PI5A 2FFYA 3GMWA 1FQGA 2ZQAA 1W79A 3HUMA 1K38A 2XK1A 3M2KA 2IWDA 5CHUA 1PWGA 1XGIA 2ZQ9A 3P98A 1O7EA 4PM6A 2WAEA 3NCKA 3PAGA 5TGFA 1JTDA 1ERQA 4OOMA 4EQIA 3G31A 1NY0A 5HAQA 2BLSA 1FSYA 1K57A 1RGYA 2J9PA 4YFMA 4XXRA 1BLHA 2R9WA 5DTKA 3MBZA 2Q9MA 5KSHA 1MBLA 1YQSA 3TSGA 3RXXA 3C7UA 4HBTA 5CHMA 1YLPA 1W7FA 4X53A 2X02A 2XEPA 4DE1A 4KZ8A 1KE0A 1BLSA 2JBFA 5FQQA 4KZ3A 4Y7PA 4KZ6A 2BG1A 4C75A 2DRWA 4E3JA 1J9MA 5AQ7A 1MWTA 5TR7A 4ZTKA 3SH9A 3IHBA 1C3BA 3IF6B 3O86A 4BENA 5F1FA 1W8YA 3GVBA 4JF4A 3IWQA 3N7WA 4HESA 4R1GA 3Q7VB 1FSWA 4PM9A 2XF3A 3CG5A 4MBKA 1LHYA 3IH9A 5FI7A 1ES4A 3LEZA 2XLNA 1LLBA 5M18A 2WK0A 3HLFA 1VM1A 3ISGA 4PM7A 2EXBA 4KG2A 2Y2QA 2Y59A 2QMIA 3HVFA 3OPLA 4GDNA 1IEMA 1HTZA 3VP3A 1N4OA 2J9OA 3ZCZA 4E6WA 2WGWB 1LI0A 3FYZA 4M3KA 1ZG6A 2EX9A 1KGEA 2PU4A 4JXVA 1ESIA 2V2FF 3E2LA 1IYSA 3IXHA 1ES3A 3Q07A 4OKPA 4RX2A 3ITBA 2Y2OA 5CERA 3WWXA 1I2SA 3A3DA 2VGJA 4F94A 5JYPA 1TVFA 3UE0A 2WGIA 3LCEA 4HEFA 4KQOA 4LCLA 3W4PA 5KSCA 1E4DA 5GHYA 4X6TA 3QNCA 4E3KA 1S6RA 4D2OA 1MY8A 1XA1A 2G2UA 4FH4A 4XUZA 4BJPA 3NIAA 2ZQCA 4P87A 5EVIA 4S2IA 3WS2A 1MPLA 5GLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKI A;  1L0F A;  1PYY A;  1GA9 A;  1PI4 A;  4WZ5 C;  1NJ4 A;  4N1X A;  1RGZ A;  4JXS A;  2OLU A;  1ES2 A;  1PZO A;  4JF5 A;  4HBU A;  3Q81 A;  1BT5 A;  3Q1F A;  4E3M A;  2Y91 A;  3M6B A;  2E8I A;  4CPK A;  5FQI A;  3HLW A;  1K54 C;  3I7J A;  2Y2J A;  3NY4 A;  4ID4 A;  2ZQ7 A;  1BZA A;  2HDR A;  5M19 A;  4JKT A;  2WKE A;  3CJM A;  1KDS A;  3NI9 A;  1L0G A;  4N9K A;  1BLP A;  4JXG A;  2H0T A;  4QB8 A;  4BL2 A;  4MBF A;  3PBR A;  1IEL A;  4QHC A;  4S2J A;  1L0D A;  3MZD A;  3UPN A;  3VOY A;  1IKI A;  4KZA A;  5EEC A;  1U60 A;  2XDM A;  4WM9 A;  3QHY A;  3WRT A;  3DW0 A;  3OPP A;  3PBO A;  3SH8 A;  5EPH A;  2OSU A;  2XGN A;  2Y4A A;  4RVA A;  1PWD A;  1YT4 A;  5GHX A;  4DE3 A;  5I94 A;  2H10 A;  1I5Q A;  4FCF A;  3FZC A;  4BLM A;  2Y2K A;  1H8Y A;  4B4X A;  4S2P A;  2ZQ8 A;  1NYM A;  3A3F A;  3OPH A;  4FD8 A;  3B3X A;  5HX9 A;  5GLC A;  3IH8 A;  3N8R A;  4RYE A;  1QME A;  1E3U D;  3IT9 A;  5DF9 A;  3NDG A;  5CEC A;  3HBR A;  2HPB A;  3UN7 A;  2XQZ A;  2JCH A;  1HZO A;  4E3N A;  1GHP A;  1OME A;  2EFU A;  1O07 A;  4OPR A;  4X68 A;  3ZG9 B;  2XD5 A;  1NRF A;  5U47 A;  4P85 A;  1BTL A;  2ZQD A;  1FR6 A;  4A5R A;  4E3L A;  4ZAM A;  3S22 A;  4E6X A;  3EQV A;  5A90 A;  4LV3 A;  1WYC A;  5KMW A;  2WUQ A;  1VQQ A;  5E2G A;  4JLF A;  1ESU A;  5AQA A;  4K0W A;  3C4P A;  5FAO A;  4NK3 A;  1G68 A;  5CEB A;  4OPZ A;  5FQK A;  4IBR A;  5KZH A;  4H8R A;  5EOO A;  4LV0 A;  4KZ9 A;  3WRZ A;  1ES5 A;  1XPB A;  2Q9N A;  2ZC4 B;  3N4I A;  4IBX A;  3SS3 A;  4BD0 A;  1NZU A;  4OP5 A;  3WS5 A;  3IQA A;  4FSF A;  4L0L A;  3WS1 A;  1DJC A;  4QD4 A;  1YM1 A;  4YIN A;  1BUL A;  3HUO A;  2HP5 A;  3UY6 A;  2HDS A;  3V39 A;  1K56 D;  2WAD A;  4KZ5 A;  4DRT A;  4N9L A;  5E2F A;  5GLA A;  3G2Y A;  1ERO A;  1YLW A;  4DE0 A;  3MZF A;  4ZJ2 A;  3RXW A;  4JF6 A;  1L2S A;  2DCF A;  2JC7 A;  2Y2I A;  3BRM A;  3IXG A;  4GZB A;  4OH0 A;  1BSG A;  1K6S A;  2HDU A;  4WYY A;  2V20 A;  2XH9 A;  5FDH A;  1Q2P A;  1M6K A;  3VOZ A;  4OPY A;  3VP4 A;  5E2E A;  1XKZ A;  1SHV A;  3A3I A;  3DWZ A;  1IKG A;  1E3U A;  1ONG A;  4S2M A;  5FQ9 A;  3DWK A;  3RJU A;  3ZG7 B;  2EXA A;  2R9X A;  2FFF B;  5DVA A;  1K55 C;  1PWC A;  2QZ6 A;  4C3Q A;  4WEJ A;  3TG9 A;  3IWO A;  1KGF A;  4OQ0 A;  3V3R A;  1CI8 A;  2Y2N A;  3S4X A;  3HUN A;  3UNW A;  2JE5 A;  4JPM A;  4OLG A;  3FKW A;  3W4Q A;  3IF5 A;  4KQQ A;  4N92 A;  2EX2 A;  3C7V A;  5HFO A;  3N8L A;  3V50 A;  3G2Z A;  4GN2 A;  4MLL A;  1PW1 A;  3BEC A;  3C5A A;  3HLC A;  1ZG4 A;  2J7V A;  1S0W A;  2PU2 A;  3SOI A;  1AXB A;  1QMF A;  1KGG A;  4JXW A;  3ZVT A;  1WE4 A;  4DXB A;  4N1H A;  4KQR A;  2WZX A;  1YLT A;  1JTG A;  3HRE A;  3MKE A;  5A92 A;  4E3O A;  4K91 A;  1CK3 A;  1SKF A;  3MKF A;  4X56 A;  5FI2 A;  3G32 A;  4OOL A;  3V5M A;  5GL9 A;  5CRF A;  3GTC A;  5HAR A;  4WMC A;  4EBP A;  3OCL A;  1K4E A;  2IWB A;  1TDL A;  5FQJ A;  1Q2Q A;  2X71 A;  3OC2 A;  2HP9 A;  3M6H A;  4MNR A;  4KZ4 A;  2OV5 A;  3UE1 A;  5DF8 A;  5FAS A;  1LL9 A;  2Y2G A;  1MWS A;  1W5D A;  1IYP A;  2HP6 A;  3A3E A;  3E2K A;  4LV2 A;  1KVM A;  4O7D A;  3MFD A;  1MKI A;  1IYQ A;  1XXM A;  5CTN A;  3VP2 A;  3O87 A;  2P9V B;  3HLB A;  4OQG A;  5D3O A;  2RCX A;  3M2J A;  5EVL A;  1N9B A;  4CJN A;  3G34 A;  3LY3 A;  1K4F A;  3NBL A;  4EV4 A;  1K57 C;  4QU3 A;  4IVK A;  2XFS A;  3LY4 A;  2EX6 A;  3OCN A;  1XA7 A;  3VFH A;  3IXD A;  1L0E A;  3BYD A;  4DDS A;  5GHZ A;  2VGK A;  5A91 A;  4B88 A;  2ZJ9 A;  4IED A;  4GD6 A;  3OPR A;  1KDW A;  3VMA A;  4KZB A;  5G18 A;  1TDG A;  4OP8 A;  5F82 A;  2ZM2 A;  4BQM A;  2C6W B;  4P0M A;  3N6I A;  4U3T A;  1ZC2 A;  1TEM A;  4R3J A;  4UAA A;  1KE4 A;  5TFQ A;  5DTT A;  1GCE A;  4ZJ1 A;  1GHI A;  1PZP A;  4U0T A;  5L2F A;  1YLY A;  3O88 A;  4OQH A;  1GA0 A;  3CMZ A;  3G4P A;  1KVL A;  1BUE A;  2Y2L A;  5CTM A;  3IHA A;  4U0X A;  4S2N C;  1FCN A;  5FAP A;  1YLZ A;  1YMS A;  3UDF A;  1CEF A;  3O3V A;  4FH2 A;  4UA7 A;  1JVJ A;  3UO9 A;  3MZE A;  1LL5 A;  3NDE A;  2ZM8 A;  3HLD A;  3ZNT A;  1SDN A;  1K25 A;  3PBS A;  1EI5 A;  4Y0O A;  3IXB A;  5EE8 A;  3QNB A;  5EVI D;  3ZFZ A;  5FA7 A;  1HVB A;  5EVI C;  1Y54 A;  1FR1 A;  3SS4 A;  1NZO A;  5GLD A;  4GNU A;  3ZHH A;  4PM5 A;  3A3J A;  4B4Z A;  1DY6 A;  4LV1 A;  5CGS A;  5J8X A;  1KE3 A;  2UWX A;  4R23 A;  1K56 A;  1ALQ A;  2V1Z A;  3C4O A;  3VP0 A;  1FCM A;  1CI9 A;  1CEG A;  2XD1 A;  3GR2 A;  3IF6 A;  5HAP A;  1EWZ A;  4R0Q A;  1I2W A;  2WYX A;  4LEN A;  1DJB A;  2P9V A;  1ZKJ A;  5FI6 A;  1ERM A;  3P09 A;  4PPR A;  2HDQ A;  2ZC5 B;  2A49 A;  1H5X A;  3UDX A;  2XR0 A;  3FKV A;  2ZD8 A;  3PAE A;  3ZNY A;  3BM6 A;  5CGW A;  1HD8 A;  5EOE A;  4S2K A;  1LI9 A;  4OQI A;  5BOH A;  2G2W A;  1K55 A;  5E43 A;  4WZ5 A;  4WEK A;  5CXW A;  3BLS A;  5JYO A;  1MXO A;  3UPO A;  2J8Y A;  4OOY A;  5HL1 A;  5FQM A;  3VFF A;  4GDB A;  1E25 A;  3MXS A;  4KEN B;  4WZ4 A;  3GQZ A;  3S1Y A;  2PBY A;  3JYI A;  2ZMA A;  4OLD A;  3GRJ A;  4Z9Q A;  4DXC A;  4GD8 A;  3LO7 A;  4XUX A;  5F1G A;  4EWF A;  3W8K A;  3BLM A;  4X55 A;  4S2O A;  3AGE A;  5DTS A;  2H5S A;  3NC8 A;  1XGJ A;  1YMX A;  2P74 A;  4X69 A;  3VP1 A;  3OZH A;  4GB7 A;  5EVI B;  4DE2 A;  5AQB A;  3BFC A;  4JBF A;  3Q7Z A;  2B5R A;  3PTE A;  3MXR A;  3AGD A;  1IYO A;  1WYB A;  4R3B A;  3TOI A;  3FWL A;  4EUZ A;  4PMA A;  5HW3 A;  3CZD A;  4WMC D;  1G6A A;  3GV9 A;  4KZ7 A;  1ONH A;  1PW8 A;  1SCW A;  1Z6F A;  3HL9 A;  3WS4 A;  3W4O A;  2ZLY A;  4ZJ3 A;  4R4R A;  5A93 A;  2Z2M B;  2WKH A;  2X01 A;  3BFG A;  3FV7 A;  4MBH A;  3SS5 A;  3ZVW A;  4ZBE A;  2CC1 A;  4RX3 A;  1M40 A;  2ZC7 A;  5E2H A;  3VSL A;  3BFF A;  2WAF A;  4Y0T A;  2I72 A;  4DF6 A;  3ZG5 A;  3PBQ A;  4GOG A;  4UA9 A;  3UE3 A;  4DDY A;  4E3I A;  2QPN A;  1PIO A;  3PBT A;  3Q82 A;  5EUA A;  1MWU A;  4RA7 A;  2H0Y A;  1SDE A;  5F83 A;  2WGV A;  4OPQ A;  5FSR A;  5CGX A;  2A3U A;  1FOF A;  2ZC3 B;  4BL3 A;  1MWR A;  4S2N A;  1K54 A;  2C5W B;  1BLC A;  3IWI A;  4WBG A;  2ZM0 A;  3D4F A;  4P6B A;  2IWC A;  3G30 A;  5HAI A;  5M1A A;  3G35 A;  4DKI A;  4QJG A;  4EBN A;  3SH7 A;  4C6Y A;  2Z2L B;  3GSG A;  1YLJ A;  2ZC6 B;  1DJA A;  3DTM A;  1JWP A;  1JWZ A;  3N8S A;  5CHJ A;  2EFX A;  4NET A;  4OON A;  3ZG8 B;  2RL3 A;  4IVI A;  3VSK A;  4LCM A;  4OVD A;  3BFD A;  3ITA A;  4Q8I A;  3PBN A;  4KG5 A;  5DF7 A;  3ZG0 A;  4R4S A;  4ZDX A;  5FAT A;  3V3S A;  2XFT A;  5IHV A;  2WGW A;  2Y2H A;  3IF6 C;  3BEB A;  3ZGA B;  3HLG A;  4KG6 A;  4UHU A;  3UPP A;  2Y2M A;  2EX8 A;  3EQU A;  4K0X A;  2OLV A;  2Y55 A;  3WS0 A;  1XP4 A;  4PM8 A;  3HLE A;  2WZZ A;  5CED A;  1XX2 A;  1NXY A;  4UA6 A;  3BFE A;  2DNS A;  3UDI A;  1NYY A;  1RP5 A;  4QY5 A;  1RCJ A;  4GKU A;  4QY6 A;  1GHM A;  5AQ9 A;  4Y0U A;  1JWV A;  1W8Q A;  2Y2P A;  3AGF A;  3Q7V A;  4S2L A;  1H8Z A;  5FAQ A;  4BD1 A;  2GDN A;  1FCO A;  1K6R A;  4EBL A;  4MEZ A;  3ZDJ A;  4WEL A;  1PI5 A;  2FFY A;  3GMW A;  1FQG A;  2ZQA A;  1W79 A;  3HUM A;  1K38 A;  2XK1 A;  3M2K A;  2IWD A;  5CHU A;  1PWG A;  1XGI A;  2ZQ9 A;  3P98 A;  1O7E A;  4PM6 A;  2WAE A;  3NCK A;  3PAG A;  5TGF A;  1JTD A;  1ERQ A;  4OOM A;  4EQI A;  3G31 A;  1NY0 A;  5HAQ A;  2BLS A;  1FSY A;  1K57 A;  1RGY A;  2J9P A;  4YFM A;  4XXR A;  1BLH A;  2R9W A;  5DTK A;  3MBZ A;  2Q9M A;  5KSH A;  1MBL A;  1YQS A;  3TSG A;  3RXX A;  3C7U A;  4HBT A;  5CHM A;  1YLP A;  1W7F A;  4X53 A;  2X02 A;  2XEP A;  4DE1 A;  4KZ8 A;  1KE0 A;  1BLS A;  2JBF A;  5FQQ A;  4KZ3 A;  4Y7P A;  4KZ6 A;  2BG1 A;  4C75 A;  2DRW A;  4E3J A;  1J9M A;  5AQ7 A;  1MWT A;  5TR7 A;  4ZTK A;  3SH9 A;  3IHB A;  1C3B A;  3IF6 B;  3O86 A;  4BEN A;  5F1F A;  1W8Y A;  3GVB A;  4JF4 A;  3IWQ A;  3N7W A;  4HES A;  4R1G A;  3Q7V B;  1FSW A;  4PM9 A;  2XF3 A;  3CG5 A;  4MBK A;  1LHY A;  3IH9 A;  5FI7 A;  1ES4 A;  3LEZ A;  2XLN A;  1LLB A;  5M18 A;  2WK0 A;  3HLF A;  1VM1 A;  3ISG A;  4PM7 A;  2EXB A;  4KG2 A;  2Y2Q A;  2Y59 A;  2QMI A;  3HVF A;  3OPL A;  4GDN A;  1IEM A;  1HTZ A;  3VP3 A;  1N4O A;  2J9O A;  3ZCZ A;  4E6W A;  2WGW B;  1LI0 A;  3FYZ A;  4M3K A;  1ZG6 A;  2EX9 A;  1KGE A;  2PU4 A;  4JXV A;  1ESI A;  2V2F F;  3E2L A;  1IYS A;  3IXH A;  1ES3 A;  3Q07 A;  4OKP A;  4RX2 A;  3ITB A;  2Y2O A;  5CER A;  3WWX A;  1I2S A;  3A3D A;  2VGJ A;  4F94 A;  5JYP A;  1TVF A;  3UE0 A;  2WGI A;  3LCE A;  4HEF A;  4KQO A;  4LCL A;  3W4P A;  5KSC A;  1E4D A;  5GHY A;  4X6T A;  3QNC A;  4E3K A;  1S6R A;  4D2O A;  1MY8 A;  1XA1 A;  2G2U A;  4FH4 A;  4XUZ A;  4BJP A;  3NIA A;  2ZQC A;  4P87 A;  5EVI A;  4S2I A;  3WS2 A;  1MPL A;  5GLB A; 
#chains in the Genus database with same CATH topology
 4Y5F A;  1OTE A;  3T1Q B;  4CLC B;  1RGZ A;  2OLU A;  1ES2 A;  1PZO A;  3HJK A;  3MFX A;  2ZQ7 A;  1BZA A;  2WKE A;  1KDS A;  3VV4 A;  4N9K A;  2H0T A;  4QB8 A;  3S7O A;  1IEL A;  2XDM A;  3OPP A;  3SH8 A;  4EER A;  4RVA A;  2XGN A;  2H10 A;  3P7N A;  4BLM A;  1H8Y A;  4B93 A;  4S2P A;  3B3X A;  2PYP A;  1VB6 A;  3N8R A;  4RYE A;  4EEP A;  4WLA A;  2CMN A;  5CEC A;  4E3N A;  2XQZ A;  2JCH A;  4GS9 A;  4AFI A;  1GHP A;  3T4K A;  1YPR A;  4LRX C;  2JKT M;  1NLY A;  1FR6 A;  4A5R A;  4ZAM A;  4IJG A;  4E6X A;  5A90 A;  1WYC A;  5KMW A;  3T4S A;  4JLF A;  3C4P A;  5HDS A;  1G68 A;  1LSX A;  3ZQ5 A;  4DN0 A;  5EOO A;  4KZ9 A;  1ES5 A;  1XPB A;  4IBX A;  3SS3 A;  4BD0 A;  1DJC A;  4YIN A;  1BUL A;  1FIK A;  4KZ5 A;  4N9L A;  2HZ5 A;  1OTI A;  4ZRR A;  4DE0 A;  3RXW A;  1L2S A;  2JC7 A;  3K2N A;  3EWK A;  2KX6 A;  3IX4 A;  4HIA A;  3H82 B;  1M6K A;  3VOZ A;  1XKZ A;  1SHV A;  4QWO A;  1E3U A;  4S2M A;  3MMH A;  3ZG7 B;  2FFF B;  2R9X A;  2V0W A;  2V9A A;  1LSV A;  2J3W A;  1D06 A;  3BJN A;  4IUK A;  4OLG A;  3W4Q A;  3IS2 B;  4N92 A;  2JKT I;  2HJE A;  3G2Z A;  3LIF A;  1PW1 A;  1ZG4 A;  3CUE C;  2PU2 A;  3SOI A;  1AXB A;  4DXB A;  4N1H A;  4HP9 A;  4ARZ A;  3C30 A;  4KQR A;  1ZHH B;  3HRE A;  1Y28 A;  4X56 A;  4LRZ E;  5FI2 A;  4HY8 A;  5CRF A;  3GTC A;  5AVF A;  1XJ3 A;  3IBJ A;  5HAR A;  5FQJ A;  2HP9 A;  4G3V A;  3UE1 A;  3E0Y A;  1T19 A;  4NXB A;  1MWS A;  1W5D A;  2HP6 A;  3A3E A;  4LV2 A;  2UV0 E;  4O7D A;  4JGO A;  5K5B A;  4HJ4 A;  1UWP X;  1MKI A;  3VP2 A;  3O87 A;  3M2J A;  2BTF P;  3G34 A;  1NWZ A;  4EV4 A;  3NBL A;  2LB9 A;  3LY4 A;  2EX6 A;  3OCN A;  3VFH A;  5A91 A;  1P0Z A;  1TF1 A;  4GHI B;  2ZJ9 A;  4IED A;  4KZB A;  5G18 A;  4BQM A;  3EEA A;  4U0T A;  5L2F A;  1BUE A;  2Y2L A;  2VA0 A;  1ACF A;  4U0X A;  1YLZ A;  2QHK A;  4UA7 A;  1T1C A;  3PXP A;  3NDE A;  3S7Q A;  4Y0O A;  3CPT B;  3ZFZ A;  1FR1 A;  3SS4 A;  4GNU A;  3ZHH A;  2YKH A;  3A3J A;  3FPV A;  1KE3 A;  1K56 A;  1ALQ A;  2V1Z A;  3C4O A;  5HL6 A;  4RQ9 A;  2XD1 A;  3GR2 A;  3LYX A;  2HGV A;  1ZKJ A;  2L1M A;  3KYZ A;  3C8C A;  4PPR A;  2HDQ A;  4ME4 A;  2XR0 A;  2ZD8 A;  2Z6D A;  3PAE A;  5CGW A;  1LI9 A;  5DFY A;  5BOH A;  2G2W A;  4WEK A;  5JYO A;  1MXO A;  4OOY A;  4GDB A;  4EET B;  3F1O B;  3GQZ A;  1UWN X;  2PBY A;  2K31 A;  4Z9Q A;  4L9G A;  3BLM A;  4S2O A;  1GSV A;  3AGE A;  2H5S A;  4X69 A;  3OZH A;  4DE2 A;  1DP9 A;  2W3G A;  5G4Z A;  3QP6 A;  1K0K A;  4XT2 B;  1TS7 A;  5HW3 A;  4WMC D;  1HLU P;  1Z6F A;  3WS4 A;  3LIC A;  3CIT A;  4ZJ3 A;  3TE8 A;  1OTA A;  4HJ6 A;  2ZC7 A;  5E2H A;  3UE3 A;  4GOG A;  2QPN A;  1PIO A;  3Q82 A;  4RA7 A;  4BBV A;  4OPQ A;  3DBA A;  2A3U A;  3A0V A;  4S2N A;  4WBG A;  3BQA A;  3D4F A;  4EU0 A;  5M1A A;  4EBN A;  4C6Y A;  4ETZ A;  3DTM A;  3KO6 A;  5L10 A;  4F3L B;  1PRQ A;  4IVI A;  3VSK A;  4IHQ A;  4ZDX A;  5DF7 A;  3ZGA B;  4GCZ A;  4KG6 A;  4UHU A;  3EQU A;  3MJQ A;  3UE6 A;  3WS0 A;  2WZZ A;  1XX2 A;  2PBD P;  3NHQ A;  3BFE A;  1NYY A;  1RCJ A;  4GKU A;  1GHM A;  2QKP A;  4Y0U A;  4LLO B;  3Q7V A;  4S2L A;  3UMD A;  1T1A A;  5FAQ A;  4PHT A;  1FCO A;  1K6R A;  4LGW A;  3ZDJ A;  4WEL A;  1PI5 A;  3GMW A;  2FFY A;  2ZQA A;  1W79 A;  1K38 A;  4HJ3 A;  1XGI A;  2XA7 S;  2WAE A;  3PAG A;  5TGF A;  2W0N A;  1FSY A;  1RGY A;  4XXR A;  1YQS A;  2PDR A;  4KUO A;  4YWZ A;  4KZ8 A;  5FQQ A;  5AQ7 A;  4WUJ A;  2NUP C;  5F1F A;  1W8Y A;  4JF4 A;  2O99 A;  3IWQ A;  2VEA A;  2VLG A;  3Q7V B;  1FSW A;  3CG5 A;  3DTK A;  2KLI A;  2WK0 A;  1VM1 A;  2Y2Q A;  2Y59 A;  3F1P A;  3QP4 A;  3FYZ A;  2EX9 A;  1KGE A;  4JXV A;  3IXH A;  3Q07 A;  2OOL A;  4P6Z S;  2Y2O A;  3A3D A;  3F1P B;  5JYP A;  4HEF A;  2OWJ A;  4HH3 A;  3W4P A;  4LCL A;  1E4D A;  3C2W A;  2D02 A;  1MY8 A;  1XA1 A;  5LBR A;  5GLB A;  2NUT C;  2WKI A;  1PYY A;  4N1X A;  2B02 A;  1P9W A;  1BT5 A;  2Y91 A;  3M6B A;  2J3T D;  5FQI A;  3NY4 A;  2HDR A;  5M19 A;  3CJM A;  3NI9 A;  1BLP A;  4JXG A;  4BL2 A;  2OAQ 1;  3KSH A;  3QP1 A;  4HQA A;  3UPN A;  3VOY A;  5EEC A;  3WRT A;  1F9I A;  2PHY A;  3NEC A;  1TS6 A;  4FOF A;  2OSU A;  2Y4A A;  2XA7 M;  1PWD A;  4DE3 A;  4FCF A;  4JGQ A;  3A3F A;  3K3C A;  3OPH A;  4FD8 A;  3IT9 A;  1HZO A;  2B18 A;  2VK3 A;  1OME A;  2EFU A;  4OPR A;  3ZG9 B;  1NRF A;  2WKP A;  4P85 A;  2ZQD A;  1BYW A;  1J3W A;  5E2G A;  5J4E A;  4MN5 A;  5FAO A;  1OT6 A;  4OPZ A;  5KZH A;  2V8F A;  2ZC4 B;  4G3W A;  4OP5 A;  3IQA A;  4FSF A;  2J80 A;  3WS1 A;  4QD4 A;  2HDS A;  4DRT A;  5E2F A;  1YLW A;  4ZJ2 A;  4JF6 A;  4BL3 A;  1BSG A;  3DTE A;  4WYY A;  2XH9 A;  5FDH A;  1Q2P A;  3VP4 A;  5EM0 A;  4Q0J A;  5E2E A;  3DWZ A;  1IKG A;  1ONG A;  4CQH A;  2EXA A;  5J3W A;  2B95 A;  1ODV A;  4R70 A;  1PWC A;  5DFX A;  2Y2N A;  2VV8 A;  1SKO B;  3BQ8 A;  3T1X A;  2GJ3 A;  3IF5 A;  1N9L A;  4O0P A;  1XFQ A;  5HFO A;  2JKR I;  5C5K A;  1OPX A;  4EUV A;  3LI8 A;  1L3L A;  2J7V A;  5AVE A;  3KYQ A;  5HDC A;  4MN7 A;  3LI9 A;  2Y8H A;  3MKE A;  5MC7 A;  1SKF A;  2ZOI A;  3MKF A;  3G32 A;  4I3J A;  4EBP A;  4NXF A;  4MNR A;  3M6H A;  3NOT C;  4KZ4 A;  2OV5 A;  5DF8 A;  1P97 A;  1CJF A;  3P01 A;  4I39 A;  2VKS A;  2P9V B;  3HLB A;  5D3O A;  5EVL A;  4QU3 A;  1YKD A;  5IS1 A;  4IVK A;  4UQI M;  3IXD A;  3BYD A;  4DDS A;  5GHZ A;  4ARZ B;  4GD6 A;  3VMA A;  3LR3 A;  4OP8 A;  2FZ0 A;  2C6W B;  3DTI A;  1G6O A;  5TFQ A;  4ZJ1 A;  1PZP A;  1YLY A;  2BAS A;  3MQO A;  4OQH A;  3T12 B;  1GA0 A;  3K3D A;  2DMW A;  2QWS A;  5CTM A;  4L9F A;  4F3L A;  1FCN A;  2INW A;  1JVJ A;  2PAV P;  1K25 A;  1EI5 A;  3IXB A;  5EVI D;  4GW9 A;  5GLD A;  1IOU A;  2PD7 A;  2UWX A;  3NOP C;  4R23 A;  1FCM A;  3LIA A;  2W27 A;  2Z6C A;  4LEN A;  1D1J A;  1T18 A;  5FDS A;  3FKV A;  3EGX C;  1XJ6 A;  3BM6 A;  1HD8 A;  4OQI A;  3BLS A;  4I38 A;  3T1R A;  3UPO A;  3VFF A;  3MXS A;  5EM1 A;  4O01 A;  3O5Y A;  4OLD A;  4XUX A;  1VET B;  3CI6 A;  4X55 A;  1YSQ A;  4DMZ A;  3NUL A;  3T4Q A;  3MXR A;  4Z1W A;  3AGD A;  3TOI A;  2I9V A;  4PMA A;  3CZD A;  3IBR A;  1N9O A;  4NEE D;  4KZ7 A;  1ONH A;  1SCW A;  1TD5 A;  4R4R A;  1S66 L;  2WKH A;  3SS5 A;  3BFG A;  3KX0 X;  3ZVW A;  4ZBE A;  3T4T A;  2W3H A;  3VSL A;  4Y0T A;  4DDY A;  2G7U A;  4E3I A;  1OTB A;  4HH2 A;  2W3E A;  2R78 A;  3LEQ A;  2W1T B;  1FOF A;  5DJU A;  2VJW A;  4BBU A;  1MWR A;  1NRJ A;  1K54 A;  4P6B A;  3G30 A;  4DKI A;  3SH7 A;  2Z2L B;  3KSF A;  2ZC6 B;  4MDZ A;  1JWP A;  1JWZ A;  4EW7 A;  2EFX A;  2OAP 1;  1X0O A;  4HI4 A;  4EQ1 A;  3PBN A;  3V3S A;  2XFT A;  2WGW A;  3F1N A;  3HLG A;  4DJ2 A;  2Y2M A;  4BWI A;  1XP4 A;  3UDI A;  4QY5 A;  1H8Z A;  4EBL A;  1VET A;  3LFV A;  1FQG A;  3HUM A;  2JKR M;  2IWD A;  1PWG A;  2ZQ9 A;  1O7E A;  3T1S A;  1JTD A;  1SKO A;  3G31 A;  1NY0 A;  2J9P A;  2V1B A;  2O9C A;  5DTK A;  1MBL A;  3RXX A;  5HPI A;  3C7U A;  4HBT A;  1W7F A;  3T4J A;  2X02 A;  4Y7P A;  4KZ6 A;  4C75 A;  1W63 Q;  2DRW A;  5TR7 A;  3RTY A;  1S1Y A;  1DP8 A;  3IHB A;  3IF6 B;  2O9B A;  5FEF A;  1DP6 A;  4MBK A;  3IH9 A;  3G6O A;  5FI7 A;  1LLB A;  3HLF A;  2EXB A;  2J9O A;  2WGW B;  3F1N B;  4LPZ A;  4M3K A;  1ESI A;  4JGP A;  1IYS A;  3W2Z A;  4OKP A;  3WWX A;  1I2S A;  4F94 A;  1MC0 A;  4II7 A;  5KSC A;  5FL3 A;  4X6T A;  3PR6 A;  2G2U A;  4P87 A;  2PYR A;  4S2I A;  3WS2 A;  1L0F A;  1G5U A;  1GA9 A;  1Z09 A;  3HJI A;  4JF5 A;  3Q1F A;  5TBM A;  4E3M A;  2E8I A;  4CPK A;  3HLW A;  3I7J A;  2Y2J A;  4ID4 A;  3CAX A;  4HOI A;  4X1L A;  1L0G A;  3PBR A;  3HCY A;  4S2J A;  3MZD A;  1EW0 A;  1IKI A;  3MXQ A;  4WM9 A;  3QHY A;  3DW0 A;  5EPH A;  2GZA A;  5GHX A;  3QP5 A;  2IA2 A;  3UME A;  1I5Q A;  3FZC A;  2Y2K A;  3BY8 A;  2M1C A;  1LSW A;  1NYM A;  1ZTU A;  1QME A;  1E3U D;  2WKR A;  3NDG A;  3R7W A;  3HBR A;  1O07 A;  4X68 A;  3NJA A;  2XD5 A;  5U47 A;  4E3L A;  3JVU A;  5HD3 A;  3S22 A;  3V67 A;  2P08 A;  3EQV A;  4LV3 A;  1VQQ A;  1ESU A;  3BW6 A;  4K0W A;  4NK3 A;  5CEB A;  4H8R A;  4KQD A;  4MMN A;  3WS5 A;  2K2N A;  3L9K A;  1YM1 A;  5HWT A;  3UY6 A;  1K56 D;  3OLO A;  1GSW A;  5GLA A;  1ERO A;  3TW8 A;  3BRM A;  3IXG A;  1K6S A;  2V20 A;  3CHW P;  3FPW A;  2KDK A;  2KOI A;  2JHE A;  3RJU A;  2EA9 A;  1K55 C;  4C3Q A;  3TG9 A;  3IWO A;  3V3R A;  1CI8 A;  3S4X A;  3HUN A;  4JPM A;  2O0Y A;  3FKW A;  2EX2 A;  3H7W B;  2E8J A;  3C7V A;  3N8L A;  4GN2 A;  3ICY A;  4MLL A;  4X25 A;  1KGG A;  3KYE A;  3GEC A;  4JXW A;  5F6A A;  2WZX A;  1YLT A;  1JTG A;  5A92 A;  4E3O A;  1Y4O A;  1CK3 A;  2A2L A;  4OOL A;  5GL9 A;  4WMC A;  3OCL A;  1TDL A;  1Q2Q A;  1STZ A;  2VZW A;  1LL9 A;  2Y2G A;  1IYP A;  3E2K A;  1KVM A;  4Y15 A;  2M7V A;  1IYQ A;  1XXM A;  4OQG A;  2K7S A;  2RCX A;  5FEG A;  3LR0 A;  3LY3 A;  2XFS A;  1XA7 A;  4LFU A;  1L0E A;  4R6L A;  5HZH A;  2A24 B;  4DJ3 A;  5KIZ A;  4B9O A;  3OPR A;  1D7E A;  2ZM2 A;  2PT7 A;  4HNB A;  2H28 A;  1VEU B;  4U3T A;  1ZC2 A;  1TEM A;  4R3J A;  4UAA A;  5DTT A;  1GHI A;  4Q0I A;  1KVL A;  1N9N A;  2JN7 A;  5FAP A;  4S2N C;  3MQQ A;  1YMS A;  1CEF A;  3O3V A;  2VGL S;  1LL5 A;  2ZM8 A;  2JKF A;  1SDN A;  1CQA A;  1S1Z A;  3QNB A;  5FA7 A;  1HVB A;  5EVI C;  1NZO A;  3CUE A;  3GDI A;  4B4Z A;  4LV1 A;  5CGS A;  5J8X A;  1PNE A;  3VP0 A;  4R3A A;  4NXE A;  1LT0 A;  1CI9 A;  1EWZ A;  2WYX A;  2P9V A;  5IT5 A;  4H6J A;  5FI6 A;  3NOU C;  3P09 A;  3D72 A;  2ZC5 B;  2A49 A;  1H5X A;  5G4Y A;  3UDX A;  3C38 A;  1XJ4 A;  1TS0 A;  3ZNY A;  5EOE A;  2ZOH A;  5E43 A;  5L07 A;  3SW1 A;  2ZBB A;  5HL1 A;  1OJG A;  1GSX A;  4BMW A;  1FIL A;  4H6J B;  3B47 A;  3JYI A;  4EWF A;  4GD8 A;  3VOL A;  3NC8 A;  1XGJ A;  1YMX A;  3VP1 A;  3SZT A;  3BFC A;  4Y2F A;  3Q7Z A;  4NKP A;  3PYP A;  1IYO A;  1WYB A;  4R3B A;  3FWL A;  1TS8 A;  5L8M A;  4Y17 A;  3EEH A;  3GV9 A;  1PW8 A;  3HL9 A;  4FUW A;  3W4O A;  2ZLY A;  5A93 A;  4EEU A;  2ZL1 B;  2CC1 A;  4RX3 A;  1M40 A;  1VEU A;  2WAF A;  1T1B A;  4DF6 A;  3ZG5 A;  3PBQ A;  1OJ5 A;  2M7U A;  3PBT A;  5EUA A;  4GHI A;  1MWU A;  2WGV A;  5FSR A;  5CGX A;  3EOI A;  4PKY A;  1DRM A;  1MKM A;  1VHM A;  2ZC3 B;  2C5W B;  1BLC A;  2W1R A;  5EVE A;  5HPF A;  1XFN A;  4GJ4 A;  3GSG A;  3N8S A;  5AJG A;  2RL3 A;  3BFD A;  3ITA A;  4Q8I A;  4R4S A;  5FAT A;  4EXO A;  4MCW A;  1PFL A;  5F69 A;  2Y2H A;  1P9R A;  3UPP A;  2EX8 A;  4K0X A;  5HDD A;  2Y55 A;  5F68 A;  4PM8 A;  3U2A A;  1NXY A;  4UA6 A;  2Y79 A;  1W63 M;  4QY6 A;  5AQ9 A;  1JWV A;  1W8Q A;  3AGF A;  4BD1 A;  4MEZ A;  3FC7 A;  5HSQ A;  5EFW A;  5CHU A;  3P98 A;  2J3T C;  4PM6 A;  1ERQ A;  4EQI A;  2BLS A;  1K57 A;  4YFM A;  2R9W A;  3MR0 A;  2Q9M A;  5KSH A;  1S67 L;  1XJ2 A;  3TSG A;  3MF0 A;  3QP8 A;  2P04 A;  1KE0 A;  1BLS A;  2JBF A;  3E4O A;  2VV7 A;  3IX8 A;  5CX7 A;  2BG1 A;  1S4S A;  1J9M A;  3LUQ A;  1MWT A;  3SH9 A;  3O86 A;  4CLC C;  3GVB A;  4UQI S;  3N7W A;  4HES A;  5F5Y A;  2XF3 A;  3LEZ A;  5M18 A;  4JGR A;  4YNR A;  4KG2 A;  2QMI A;  3HVF A;  1HTZ A;  1N4O A;  4K08 A;  4E6W A;  1ZG6 A;  2PU4 A;  4L9E A;  4FTX A;  4LRY C;  3TRC A;  3ITB A;  3D9Y A;  1TVF A;  5HD5 A;  2WGI A;  2PD8 A;  4X1M A;  3A0S A;  4E3K A;  4R38 A;  3QNC A;  2L0W A;  4D2O A;  2VGL M;  1H8M A;  4I5S A;  4Y3I A;  2ZMV A;  4WZ5 C;  1PI4 A;  1NJ4 A;  1G28 A;  4JXS A;  3VE3 A;  4HBU A;  3Q81 A;  4Y13 A;  4UEY A;  1K54 C;  4JKT A;  3ZYT A;  3LIE A;  3LIB A;  4MBF A;  5J7E A;  4QHC A;  3L7H A;  1CF0 A;  1L0D A;  1YAX A;  4KZA A;  3T4O A;  1KOU A;  1U60 A;  1YSP A;  2ZL1 A;  3IX3 A;  3PBO A;  2HJ9 C;  3H82 A;  1YT4 A;  3R4K A;  2YKF A;  5I94 A;  4B4X A;  2ZQ8 A;  4G3K A;  5HX9 A;  5GLC A;  3IH8 A;  2HF6 A;  5DF9 A;  3PHY A;  2HPB A;  4M4X A;  3UN7 A;  3UB8 A;  1SZV A;  2QYB A;  1BTL A;  4ESP A;  5I5L A;  4CLC E;  2WUQ A;  1F5M A;  5AQA A;  2VX8 A;  5FQK A;  3H9W A;  4IBR A;  3WRZ A;  4LV0 A;  2Q9N A;  3N4I A;  1NZU A;  4L0L A;  4HP4 A;  3E4P A;  3HUO A;  2HP5 A;  3V39 A;  4I3I A;  2WAD A;  3G2Y A;  3MZF A;  2DCF A;  2Y2I A;  4GZB A;  4OH0 A;  2HDU A;  3LR5 A;  2V1A A;  4OPY A;  2PRF A;  1OT9 A;  3A3I A;  5FQ9 A;  2P7J A;  3DWK A;  5A8B A;  5DVA A;  2QZ6 A;  4PAU A;  4WEJ A;  1KGF A;  4OQ0 A;  2XSS A;  2W3D A;  3UNW A;  2JE5 A;  2EWW A;  3A0R A;  4BBT A;  4KQQ A;  3S7P A;  3V50 A;  4MN6 A;  4GS9 B;  3BEC A;  3C5A A;  3HLC A;  3MS6 A;  1S0W A;  2MJ6 A;  1QMF A;  3ZVT A;  1WE4 A;  4D60 A;  2XRO A;  1WA9 A;  2LB5 A;  4K91 A;  3F1O A;  4NG2 A;  3V5M A;  4P6Z M;  3OBF A;  5L09 A;  1K4E A;  2IWB A;  1IFQ A;  2X71 A;  3LID A;  3OC2 A;  5FAS A;  2AVX A;  3MFD A;  5CTN A;  4QPR A;  3S7N A;  2XRN A;  1N9B A;  4CJN A;  1K4F A;  3LR4 A;  1K57 C;  4YOF A;  1LL8 A;  2VGK A;  4B88 A;  2QJ5 A;  2VV6 A;  1KDW A;  2PR5 A;  4IUH A;  1TDG A;  5F82 A;  4P0M A;  3N6I A;  3QP2 A;  2Q0O A;  3LGO A;  1KE4 A;  3BWL A;  1GCE A;  1S4R A;  3O88 A;  1V9Y A;  3CMZ A;  3G4P A;  3IHA A;  3UDF A;  4FH2 A;  2V0U A;  3UO9 A;  3MZE A;  3HLD A;  3ZNT A;  3PBS A;  2JKG A;  3OOV A;  3JPU A;  5EE8 A;  1Y54 A;  4PM5 A;  1DY6 A;  2GNX A;  3RH8 B;  1CEG A;  3IF6 A;  5HAP A;  2OWH A;  3T50 A;  4R0Q A;  1I2W A;  1DJB A;  1ERM A;  3CPT A;  3EGD C;  4S2K A;  1K55 A;  4WZ5 A;  5CXW A;  3JVV A;  4GLQ A;  2J8Y A;  3UB9 A;  5FQM A;  3MQ0 A;  1E25 A;  5DKL A;  4KEN B;  4WZ4 A;  2QJ7 A;  3S1Y A;  4XT2 A;  1F2K A;  2ZMA A;  3GRJ A;  4CLC D;  4DXC A;  3LO7 A;  5F1G A;  3W8K A;  5IU1 A;  5DTS A;  2P74 A;  1H0M A;  4GB7 A;  5EVI B;  5AQB A;  4JBF A;  4KUK A;  2B5R A;  3PTE A;  2O9A A;  3H7W A;  2V8C A;  4EUZ A;  1H3Q A;  1G6A A;  5HWW A;  2Z2M B;  3E98 A;  2X01 A;  3FV7 A;  4MBH A;  3UB7 A;  4I3A A;  4WL9 A;  5EV0 A;  2W3F A;  4O8G A;  5DJT A;  3BFF A;  2I72 A;  2ACG A;  4UA9 A;  3B33 A;  2H0Y A;  5DKK A;  1SDE A;  3CLO A;  4PKY G;  5F83 A;  3T4L A;  2W1T A;  3KSI A;  4ETX A;  3MSH A;  1V9Z A;  3IWI A;  2ZM0 A;  2IWC A;  5HAI A;  3BY9 A;  3G35 A;  4QJG A;  1YLJ A;  3UB6 A;  3E4Q A;  1DJA A;  3IS2 A;  5CHJ A;  3ZG8 B;  4NET A;  4OON A;  4LCM A;  1MZU A;  4OVD A;  4KG5 A;  3ZG0 A;  3VE4 A;  5IHV A;  1OTD A;  3IF6 C;  3BEB A;  2EWV A;  4WF0 A;  2OLV A;  3HLE A;  3CWF A;  3TJZ C;  5CED A;  2DNS A;  1RP5 A;  2A24 A;  4NXG A;  2Y2P A;  2GDN A;  4EES A;  2WKQ A;  3M2K A;  2XK1 A;  3ULF A;  4HHD A;  3KSG A;  3NCK A;  5HAQ A;  4OOM A;  1AWI A;  1NLZ A;  1BLH A;  3MBZ A;  3B42 A;  5CHM A;  3D3O A;  1YLP A;  2D01 A;  4X53 A;  2XEP A;  4DE1 A;  2ZMF A;  3DAV A;  4KZ3 A;  4E3J A;  4ZTK A;  5TBM B;  1C3B A;  2HV1 A;  3RFB A;  4BEN A;  2GX5 A;  4WN5 A;  1UGU A;  4CLC A;  4R1G A;  4PM9 A;  3R7W B;  3UB5 P;  1LHY A;  1ES4 A;  4E04 A;  2XLN A;  1A0K A;  2PR6 A;  3ISG A;  4PM7 A;  5TJJ A;  3OPL A;  4GDN A;  1IEM A;  3VP3 A;  3ZCZ A;  1LI0 A;  4Q0H A;  5HWV A;  2V2F F;  3E2L A;  1ES3 A;  4RX2 A;  5CER A;  2VGJ A;  1JNU A;  3UE0 A;  3LCE A;  4KQO A;  5GHY A;  1S6R A;  3FG8 A;  2FH5 A;  4FH4 A;  3U4L P;  4XUZ A;  4BJP A;  3NIA A;  2ZQC A;  5EVI A;  2L4R A;  1F98 A;  1MPL A; 
#chains in the Genus database with same CATH homology
 2WKI A;  1L0F A;  1PYY A;  1GA9 A;  1PI4 A;  4WZ5 C;  1NJ4 A;  4N1X A;  1RGZ A;  4JXS A;  2OLU A;  1ES2 A;  1PZO A;  4JF5 A;  4HBU A;  3Q81 A;  1BT5 A;  3Q1F A;  4E3M A;  2Y91 A;  3M6B A;  2E8I A;  4CPK A;  5FQI A;  3HLW A;  1K54 C;  3I7J A;  2Y2J A;  3NY4 A;  4ID4 A;  2ZQ7 A;  1BZA A;  2HDR A;  5M19 A;  4JKT A;  2WKE A;  3CJM A;  1KDS A;  3NI9 A;  1L0G A;  4N9K A;  1BLP A;  4JXG A;  2H0T A;  4QB8 A;  4BL2 A;  4MBF A;  3PBR A;  1IEL A;  4QHC A;  4S2J A;  1L0D A;  3MZD A;  3UPN A;  3VOY A;  1IKI A;  4KZA A;  5EEC A;  1U60 A;  2XDM A;  4WM9 A;  3QHY A;  3WRT A;  3DW0 A;  3OPP A;  3PBO A;  3SH8 A;  5EPH A;  2OSU A;  2XGN A;  2Y4A A;  4RVA A;  1PWD A;  1YT4 A;  5GHX A;  4DE3 A;  5I94 A;  2H10 A;  1I5Q A;  4FCF A;  3FZC A;  4BLM A;  2Y2K A;  1H8Y A;  4B4X A;  4S2P A;  2ZQ8 A;  1NYM A;  3A3F A;  3OPH A;  4FD8 A;  3B3X A;  5HX9 A;  5GLC A;  3IH8 A;  3N8R A;  4RYE A;  1QME A;  1E3U D;  3IT9 A;  5DF9 A;  3NDG A;  5CEC A;  3HBR A;  2HPB A;  3UN7 A;  2XQZ A;  2JCH A;  1HZO A;  4E3N A;  1GHP A;  1OME A;  2EFU A;  1O07 A;  4OPR A;  4X68 A;  3ZG9 B;  2XD5 A;  1NRF A;  5U47 A;  4P85 A;  1BTL A;  2ZQD A;  1FR6 A;  4A5R A;  4E3L A;  4ZAM A;  3S22 A;  4E6X A;  3EQV A;  5A90 A;  4LV3 A;  1WYC A;  5KMW A;  2WUQ A;  1VQQ A;  5E2G A;  4JLF A;  1ESU A;  5AQA A;  4K0W A;  3C4P A;  5FAO A;  4NK3 A;  1G68 A;  5CEB A;  4OPZ A;  5FQK A;  4IBR A;  5KZH A;  4H8R A;  5EOO A;  4LV0 A;  4KZ9 A;  3WRZ A;  1ES5 A;  1XPB A;  2Q9N A;  2ZC4 B;  3N4I A;  4IBX A;  3SS3 A;  4BD0 A;  1NZU A;  4OP5 A;  3WS5 A;  3IQA A;  4FSF A;  4L0L A;  3WS1 A;  1DJC A;  4QD4 A;  1YM1 A;  4YIN A;  1BUL A;  3HUO A;  2HP5 A;  3UY6 A;  2HDS A;  3V39 A;  1K56 D;  2WAD A;  4KZ5 A;  4DRT A;  4N9L A;  5E2F A;  5GLA A;  3G2Y A;  1ERO A;  1YLW A;  4DE0 A;  3MZF A;  4ZJ2 A;  3RXW A;  4JF6 A;  1L2S A;  2DCF A;  2JC7 A;  2Y2I A;  3BRM A;  3IXG A;  4GZB A;  4OH0 A;  1BSG A;  1K6S A;  2HDU A;  4WYY A;  2V20 A;  2XH9 A;  5FDH A;  1Q2P A;  1M6K A;  3VOZ A;  4OPY A;  3VP4 A;  5E2E A;  1XKZ A;  1SHV A;  3A3I A;  3DWZ A;  1IKG A;  1E3U A;  1ONG A;  4S2M A;  5FQ9 A;  3DWK A;  3RJU A;  3ZG7 B;  2EXA A;  2R9X A;  2FFF B;  5DVA A;  1K55 C;  1PWC A;  2QZ6 A;  4C3Q A;  4WEJ A;  3TG9 A;  3IWO A;  1KGF A;  4OQ0 A;  3V3R A;  1CI8 A;  2Y2N A;  3S4X A;  3HUN A;  3UNW A;  2JE5 A;  4JPM A;  4OLG A;  3FKW A;  3W4Q A;  3IF5 A;  4KQQ A;  4N92 A;  2EX2 A;  3C7V A;  5HFO A;  3N8L A;  3V50 A;  3G2Z A;  4GN2 A;  4MLL A;  1PW1 A;  3BEC A;  3C5A A;  3HLC A;  1ZG4 A;  2J7V A;  1S0W A;  2PU2 A;  3SOI A;  1AXB A;  1QMF A;  1KGG A;  4JXW A;  3ZVT A;  1WE4 A;  4DXB A;  4N1H A;  4KQR A;  2WZX A;  1YLT A;  1JTG A;  3HRE A;  3MKE A;  5A92 A;  4E3O A;  4K91 A;  1CK3 A;  1SKF A;  3MKF A;  4X56 A;  5FI2 A;  3G32 A;  4OOL A;  3V5M A;  5GL9 A;  5CRF A;  3GTC A;  5HAR A;  4WMC A;  4EBP A;  3OCL A;  1K4E A;  2IWB A;  1TDL A;  5FQJ A;  1Q2Q A;  2X71 A;  3OC2 A;  2HP9 A;  3M6H A;  4MNR A;  4KZ4 A;  2OV5 A;  3UE1 A;  5DF8 A;  5FAS A;  1LL9 A;  2Y2G A;  1MWS A;  1W5D A;  1IYP A;  2HP6 A;  3A3E A;  3E2K A;  4LV2 A;  1KVM A;  4O7D A;  3MFD A;  1MKI A;  1IYQ A;  1XXM A;  5CTN A;  3VP2 A;  3O87 A;  2P9V B;  3HLB A;  4OQG A;  5D3O A;  2RCX A;  3M2J A;  5EVL A;  1N9B A;  4CJN A;  3G34 A;  3LY3 A;  1K4F A;  3NBL A;  4EV4 A;  1K57 C;  4QU3 A;  4IVK A;  2XFS A;  3LY4 A;  2EX6 A;  3OCN A;  1XA7 A;  3VFH A;  3IXD A;  1L0E A;  3BYD A;  4DDS A;  5GHZ A;  2VGK A;  5A91 A;  4B88 A;  2ZJ9 A;  4IED A;  4GD6 A;  3OPR A;  1KDW A;  3VMA A;  4KZB A;  5G18 A;  1TDG A;  4OP8 A;  5F82 A;  2ZM2 A;  4BQM A;  2C6W B;  4P0M A;  3N6I A;  4U3T A;  1ZC2 A;  1TEM A;  4R3J A;  4UAA A;  1KE4 A;  5TFQ A;  5DTT A;  1GCE A;  4ZJ1 A;  1GHI A;  1PZP A;  4U0T A;  5L2F A;  1YLY A;  3O88 A;  4OQH A;  1GA0 A;  3CMZ A;  3G4P A;  1KVL A;  1BUE A;  2Y2L A;  5CTM A;  3IHA A;  4U0X A;  4S2N C;  1FCN A;  5FAP A;  1YLZ A;  1YMS A;  3UDF A;  1CEF A;  3O3V A;  4FH2 A;  4UA7 A;  1JVJ A;  3UO9 A;  3MZE A;  1LL5 A;  3NDE A;  2ZM8 A;  3HLD A;  3ZNT A;  1SDN A;  1K25 A;  3PBS A;  1EI5 A;  4Y0O A;  3IXB A;  5EE8 A;  3QNB A;  5EVI D;  3ZFZ A;  5FA7 A;  1HVB A;  5EVI C;  1Y54 A;  1FR1 A;  3SS4 A;  1NZO A;  5GLD A;  4GNU A;  3ZHH A;  4PM5 A;  3A3J A;  4B4Z A;  1DY6 A;  4LV1 A;  5CGS A;  5J8X A;  1KE3 A;  2UWX A;  4R23 A;  1K56 A;  1ALQ A;  2V1Z A;  3C4O A;  3VP0 A;  1FCM A;  1CI9 A;  1CEG A;  2XD1 A;  3GR2 A;  3IF6 A;  5HAP A;  1EWZ A;  4R0Q A;  1I2W A;  2WYX A;  4LEN A;  1DJB A;  2P9V A;  1ZKJ A;  5FI6 A;  1ERM A;  3P09 A;  4PPR A;  2HDQ A;  2ZC5 B;  2A49 A;  1H5X A;  3UDX A;  2XR0 A;  3FKV A;  2ZD8 A;  3PAE A;  3ZNY A;  3BM6 A;  5CGW A;  1HD8 A;  5EOE A;  4S2K A;  1LI9 A;  4OQI A;  5BOH A;  2G2W A;  1K55 A;  5E43 A;  4WZ5 A;  4WEK A;  5CXW A;  3BLS A;  5JYO A;  1MXO A;  3UPO A;  2J8Y A;  4OOY A;  5HL1 A;  5FQM A;  3VFF A;  4GDB A;  1E25 A;  3MXS A;  4KEN B;  4WZ4 A;  3GQZ A;  3S1Y A;  2PBY A;  3JYI A;  2ZMA A;  4OLD A;  3GRJ A;  4Z9Q A;  4DXC A;  4GD8 A;  3LO7 A;  4XUX A;  5F1G A;  4EWF A;  3W8K A;  3BLM A;  4X55 A;  4S2O A;  3AGE A;  5DTS A;  2H5S A;  3NC8 A;  1XGJ A;  1YMX A;  2P74 A;  4X69 A;  3VP1 A;  3OZH A;  4GB7 A;  5EVI B;  4DE2 A;  5AQB A;  3BFC A;  4JBF A;  3Q7Z A;  2B5R A;  3PTE A;  3MXR A;  3AGD A;  1IYO A;  1WYB A;  4R3B A;  3TOI A;  3FWL A;  4EUZ A;  4PMA A;  5HW3 A;  3CZD A;  4WMC D;  1G6A A;  3GV9 A;  4KZ7 A;  1ONH A;  1PW8 A;  1SCW A;  1Z6F A;  3HL9 A;  3WS4 A;  3W4O A;  2ZLY A;  4ZJ3 A;  4R4R A;  5A93 A;  2Z2M B;  2WKH A;  2X01 A;  3BFG A;  3FV7 A;  4MBH A;  3SS5 A;  3ZVW A;  4ZBE A;  2CC1 A;  4RX3 A;  1M40 A;  2ZC7 A;  5E2H A;  3VSL A;  3BFF A;  2WAF A;  4Y0T A;  2I72 A;  4DF6 A;  3ZG5 A;  3PBQ A;  4GOG A;  4UA9 A;  3UE3 A;  4DDY A;  4E3I A;  2QPN A;  1PIO A;  3PBT A;  3Q82 A;  5EUA A;  1MWU A;  4RA7 A;  2H0Y A;  1SDE A;  5F83 A;  2WGV A;  4OPQ A;  5FSR A;  5CGX A;  2A3U A;  1FOF A;  2ZC3 B;  4BL3 A;  1MWR A;  4S2N A;  1K54 A;  2C5W B;  1BLC A;  3IWI A;  4WBG A;  2ZM0 A;  3D4F A;  4P6B A;  2IWC A;  3G30 A;  5HAI A;  5M1A A;  3G35 A;  4DKI A;  4QJG A;  4EBN A;  3SH7 A;  4C6Y A;  2Z2L B;  3GSG A;  1YLJ A;  2ZC6 B;  1DJA A;  3DTM A;  1JWP A;  1JWZ A;  3N8S A;  5CHJ A;  2EFX A;  4NET A;  4OON A;  3ZG8 B;  2RL3 A;  4IVI A;  3VSK A;  4LCM A;  4OVD A;  3BFD A;  3ITA A;  4Q8I A;  3PBN A;  4KG5 A;  5DF7 A;  3ZG0 A;  4R4S A;  4ZDX A;  5FAT A;  3V3S A;  2XFT A;  5IHV A;  2WGW A;  2Y2H A;  3IF6 C;  3BEB A;  3ZGA B;  3HLG A;  4KG6 A;  4UHU A;  3UPP A;  2Y2M A;  2EX8 A;  3EQU A;  4K0X A;  2OLV A;  2Y55 A;  3WS0 A;  1XP4 A;  4PM8 A;  3HLE A;  2WZZ A;  5CED A;  1XX2 A;  1NXY A;  4UA6 A;  3BFE A;  2DNS A;  3UDI A;  1NYY A;  1RP5 A;  4QY5 A;  1RCJ A;  4GKU A;  4QY6 A;  1GHM A;  5AQ9 A;  4Y0U A;  1JWV A;  1W8Q A;  2Y2P A;  3AGF A;  3Q7V A;  4S2L A;  1H8Z A;  5FAQ A;  4BD1 A;  2GDN A;  1FCO A;  1K6R A;  4EBL A;  4MEZ A;  3ZDJ A;  4WEL A;  1PI5 A;  2FFY A;  3GMW A;  1FQG A;  2ZQA A;  1W79 A;  3HUM A;  1K38 A;  2XK1 A;  3M2K A;  2IWD A;  5CHU A;  1PWG A;  1XGI A;  2ZQ9 A;  3P98 A;  1O7E A;  4PM6 A;  2WAE A;  3NCK A;  3PAG A;  5TGF A;  1JTD A;  1ERQ A;  4OOM A;  4EQI A;  3G31 A;  1NY0 A;  5HAQ A;  2BLS A;  1FSY A;  1K57 A;  1RGY A;  2J9P A;  4YFM A;  4XXR A;  1BLH A;  2R9W A;  5DTK A;  3MBZ A;  2Q9M A;  5KSH A;  1MBL A;  1YQS A;  3TSG A;  3RXX A;  3C7U A;  4HBT A;  5CHM A;  1YLP A;  1W7F A;  4X53 A;  2X02 A;  2XEP A;  4DE1 A;  4KZ8 A;  1KE0 A;  1BLS A;  2JBF A;  5FQQ A;  4KZ3 A;  4Y7P A;  4KZ6 A;  2BG1 A;  4C75 A;  2DRW A;  4E3J A;  1J9M A;  5AQ7 A;  1MWT A;  5TR7 A;  4ZTK A;  3SH9 A;  3IHB A;  1C3B A;  3IF6 B;  3O86 A;  4BEN A;  5F1F A;  1W8Y A;  3GVB A;  4JF4 A;  3IWQ A;  3N7W A;  4HES A;  4R1G A;  3Q7V B;  1FSW A;  4PM9 A;  2XF3 A;  3CG5 A;  4MBK A;  1LHY A;  3IH9 A;  5FI7 A;  1ES4 A;  3LEZ A;  2XLN A;  1LLB A;  5M18 A;  2WK0 A;  3HLF A;  1VM1 A;  3ISG A;  4PM7 A;  2EXB A;  4KG2 A;  2Y2Q A;  2Y59 A;  2QMI A;  3HVF A;  3OPL A;  4GDN A;  1IEM A;  1HTZ A;  3VP3 A;  1N4O A;  2J9O A;  3ZCZ A;  4E6W A;  2WGW B;  1LI0 A;  3FYZ A;  4M3K A;  1ZG6 A;  2EX9 A;  1KGE A;  2PU4 A;  4JXV A;  1ESI A;  2V2F F;  3E2L A;  1IYS A;  3IXH A;  1ES3 A;  3Q07 A;  4OKP A;  4RX2 A;  3ITB A;  2Y2O A;  5CER A;  3WWX A;  1I2S A;  3A3D A;  2VGJ A;  4F94 A;  5JYP A;  1TVF A;  3UE0 A;  2WGI A;  3LCE A;  4HEF A;  4KQO A;  4LCL A;  3W4P A;  5KSC A;  1E4D A;  5GHY A;  4X6T A;  3QNC A;  4E3K A;  1S6R A;  4D2O A;  1MY8 A;  1XA1 A;  2G2U A;  4FH4 A;  4XUZ A;  4BJP A;  3NIA A;  2ZQC A;  4P87 A;  5EVI A;  4S2I A;  3WS2 A;  1MPL A;  5GLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...