2X71A

Structural basis for the interaction of lactivicins with serine beta- lactamases
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords BETA-LACTAMASE
publication title Structural Basis for the Interaction of Lactivicins with Serine Beta-Lactamases.
pubmed doi rcsb
total genus 88
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2x71A00
4JXGA 3AGFA 1TDLA 1MXOA 3ZNYA 1YM1A 1XGIA 3HL9A 4OVDA 1K6SA 1YLTA 3EQUA 3JYIA 3NC8A 3QNCA 4WEJA 4DE0A 3FKWA 1JTGA 4R1GA 1BSGA 4P0MA 4BL3A 2A3UA 3QNBA 2Y4AA 3NBLA 2HDRA 4JF4A 3HBRA 1GA9A 3PBRA 3UO9A 1IEMA 2ZC5B 1BULA 1JWZA 1JWPA 4OPZA 2H0TA 1K54C 5FATA 3CMZA 1GHMA 4DKIA 2Y2MA 4MNRA 2EX2A 4OPYA 3BFGA 3SS3A 5E43A 4B4ZA 1K38A 2FFYA 1FOFA 2Y2PA 1OMEA 4GN2A 4OQHA 3ISGA 3W4OA 3WRZA 4CJNA 1Q2QA 3ITAA 4ZAMA 5F82A 5I94A 2P9VB 4GD6A 3FV7A 4R0QA 1K55C 3UDXA 5EE8A 3MXSA 4D2OA 5GHYA 3VP2A 4JBFA 5AQ7A 3ZGAB 2HP9A 3OCLA 3Q1FA 4NK3A 4O7DA 2GDNA 1MBLA 2EX9A 2OSUA 5FQ9A 4EUZA 2E8IA 4CPKA 4EQIA 5KZHA 2P9VA 1NJ4A 4BENA 2HP5A 1E25A 1E3UD 2Y2NA 1LL9A 1DJCA 1NZUA 4JXVA 2CC1A 3HUOA 4WBGA 4S2NC 1NZOA 3OPHA 4E3JA 2H10A 2WGIA 4PM6A 3BFDA 3SS4A 3Q82A 3IH8A 3WS2A 1YLYA 3O86A 4KZ5A 2OLVA 3O88A 1JTDA 1PI5A 3FKVA 3BFEA 1RGZA 3D4FA 5FAQA 4Q8IA 4ZJ1A 1U60A 4FH4A 2XD5A 4Y0UA 1JVJA 2WAEA 3ZG7B 3HREA 4ZBEA 5A92A 3N7WA 3ZCZA 4WELA 1EROA 3CG5A 4IVIA 4KQOA 4GNUA 3TG9A 1GHIA 3VOZA 1ESUA 1CK3A 1K4FA 2Y2JA 2XF3A 5CRFA 5IHVA 3UN7A 4EWFA 1RGYA 2IWCA 4OP8A 5KSCA 4XUZA 4P87A 3IXBA 4XUXA 5FQIA 4JKTA 2HP6A 1Y54A 3UPPA 4KG6A 1ES3A 1HTZA 2Y2HA 4Y0OA 5JYPA 2JBFA 1YMSA 2UWXA 4IEDA 2QMIA 1XX2A 3HVFA 4Y0TA 4OPQA 3G2YA 3IXHA 1KDWA 4OOYA 2XGNA 1YLWA 2ZQAA 2V1ZA 4B4XA 2WK0A 5CEDA 4FCFA 1J9MA 4FD8A 4R3BA 2Y2KA 5DTKA 4WZ4A 1ES2A 1PWDA 4DDSA 3IT9A 4S2LA 1BZAA 3ZG9B 3RXXA 1PW8A 2ZC3B 5A91A 3N6IA 4MBHA 4R3JA 2C5WB 2B5RA 3C7UA 5M19A 3AGDA 4RVAA 1K57A 4OQGA 4RX3A 5GLBA 4E6WA 3DWZA 2ZQ7A 4HBTA 4WEKA 4N9KA 1PZPA 5GL9A 3V5MA 1FSYA 3HLGA 3IQAA 4DRTA 4F94A 3A3EA 4LV3A 2P74A 1WYBA 1CEGA 4GZBA 3ZG8B 2OV5A 3TOIA 3VSKA 1XA7A 4BD1A 1IKGA 5CERA 5A90A 3NDEA 2J9OA 1XA1A 5EOOA 3OC2A 3LEZA 2PBYA 4M3KA 5FI7A 5CHUA 4EBLA 3SH8A 5TR7A 3IWIA 3A3FA 4UAAA 4HEFA 2BLSA 2WKHA 4OOLA 3G32A 4MLLA 4X68A 3ZHHA 4LENA 4UA7A 2QZ6A 3UDFA 2DCFA 1K56D 5D3OA 4JXSA 5HW3A 3V39A 3NY4A 4ID4A 4EV4A 3G30A 2FFFB 2RL3A 1GCEA 3AGEA 3IWOA 3PBNA 2XK1A 4GB7A 4KZ7A 1L0EA 5DF8A 5DTTA 3UPNA 4GD8A 1W8YA 3VP0A 4KG2A 4MBFA 5FQKA 5GLAA 5CGSA 2Y2QA 1C3BA 3A3JA 2EFUA 5E2EA 2OLUA 3TSGA 3BEBA 2Y91A 3BFFA 3PAEA 3PBTA 2DRWA 3WS1A 1I2SA 4UHUA 5FASA 1PWGA 3A3DA 4H8RA 1ONGA 3GSGA 4GKUA 4QB8A 2X02A 3OPRA 3BLSA 3GR2A 5EECA 1BLPA 1BUEA 3MBZA 3E2LA 4DE3A 1ESIA 2EX6A 2G2UA 3WS4A 3OPLA 2WUQA 3BFCA 4JLFA 4KZAA 5FQJA 4WZ5A 1KVLA 5FI6A 1VM1A 1ERMA 2HDUA 2ZQDA 4S2KA 1LI9A 5EVIB 4WMCD 2IWBA 4HBUA 5CECA 4P6BA 3ZG0A 2I72A 5U47A 5GLDA 3W4QA 4X53A 4E3OA 1NYYA 3SH9A 1CI8A 2WGVA 4S2JA 4S2OA 5HX9A 4E3KA 4PM5A 4KG5A 3IWQA 2H0YA 4GDBA 5EVIA 3VFHA 3PBQA 3IF6B 2XFSA 3B3XA 4QHCA 1LI0A 1PW1A 1WYCA 1KVMA 4KQRA 4LV2A 4XXRA 3UE0A 3IF5A 3UY6A 2WKEA 4ZDXA 2WZXA 1ZKJA 5CGWA 4E3MA 1XKZA 1LL5A 3M2JA 3FZCA 4RX2A 3ZG5A 2J7VA 3M6HA 3IF6A 4DDYA 5EPHA 1MWRA 3NCKA 3MZEA 2Z2MB 5F1GA 5EUAA 3GQZA 3V3RA 1L0GA 2JC7A 3WS0A 5E2GA 2Z2LB 4K0WA 5FSRA 4E3LA 1ZC2A 3PBSA 1SDEA 3CZDA 3GVBA 4K91A 4S2NA 4OQIA 4ZJ2A 1W7FA 5FDHA 3M6BA 1FCOA 3M2KA 1W5DA 4QD4A 4S2MA 1BLSA 2WGWB 3NDGA 5HAQA 4X6TA 1MWUA 4OLGA 4ZTKA 2XFTA 4OH0A 3SS5A 4OKPA 4N92A 1ES5A 3LY4A 2G2WA 1H5XA 1W8QA 1K6RA 1L2SA 1K57C 5M18A 4DF6A 4KZ3A 2Y2LA 1DJAA 4OONA 3QHYA 5CHMA 4OLDA 3GMWA 2WGWA 3P98A 5JYOA 3ZVTA 5J8XA 1NYMA 1XP4A 4JF6A 1FSWA 5FI2A 1S6RA 1TEMA 4A5RA 1KE4A 1M40A 2XEPA 3HLEA 4MBKA 5HFOA 2HDSA 1IELA 4OP5A 3PTEA 3LO7A 5CEBA 1PYYA 1BT5A 3OZHA 4QY6A 4EBPA 3G35A 4Y7PA 4X55A 3MFDA 2HPBA 3NI9A 5CXWA 1HVBA 4EBNA 1FQGA 1BLHA 1L0FA 3N8RA 3Q7VA 3ZVWA 1YLZA 4N1HA 5DTSA 4U0TA 4DXBA 5GHZA 1IYQA 3C4OA 4GOGA 2ZM2A 3HUNA 4E3IA 3DWKA 4Z9QA 1KGGA 3OPPA 1L0DA 3N8SA 4C3QA 1MKIA 1EI5A 2BG1A 1FCMA 1Q2PA 2QPNA 3Q07A 4OOMA 1SDNA 1KDSA 4UA6A 4ZJ3A 2ZC6B 3MKFA 4RA7A 4PMAA 3UPOA 4S2PA 1SCWA 4C75A 3Q81A 5FAOA 1O07A 1S0WA 5HAIA 3RJUA 3RXWA 4R4SA 4YFMA 2Y2IA 3BLMA 2Q9MA 3V3SA 3LCEA 4L0LA 1M6KA 2XLNA 4IBXA 3WWXA 2J8YA 3P09A 4KENB 3PBOA 3C7VA 2PU4A 1MPLA 1ONHA 1TDGA 3HLCA 5E2FA 5F83A 1KGEA 4E3NA 5CTMA 3VSLA 1IYPA 5HAPA 2V2FF 1YT4A 1HZOA 3MXRA 3NIAA 4PM7A 2JE5A 2XD1A 4KZBA 5CHJA 3HLWA 3O87A 3S22A 4GDNA 4IVKA 4KZ8A 4WZ5C 2ZC4B 5E2HA 2ZQCA 3C5AA 1DJBA 4NETA 5FA7A 4UA9A 3WS5A 4U0XA 2ZC7A 1O7EA 5TFQA 2ZQ8A 1NY0A 3G4PA 1ZG4A 2EXBA 1HD8A 2XDMA 1XGJA 2X71A 3N4IA 4E6XA 2WAFA 3DTMA 3BRMA 1K4EA 3I7JA 3UDIA 4OQ0A 5DVAA 5F1FA 1AXBA 3IH9A 2H5SA 1RP5A 1JWVA 4QU3A 1E3UA 2R9XA 4WMCA 2WYXA 4X56A 5EVIC 2WADA 5DF9A 3VMAA 1LLBA 1RCJA 2Y55A 3MZFA 4S2IA 2ZJ9A 5AQBA 1K54A 5G18A 1PZOA 4OPRA 3OCNA 4QY5A 1PWCA 4N1XA 3PAGA 4X69A 4LV1A 3ITBA 2EFXA 5EVLA 1KE3A 2ZQ9A 4JPMA 4LCLA 1MY8A 2V20A 4HESA 1ERQA 1EWZA 1KGFA 1PI4A 3IF6C 3VP1A 2C6WB 3V50A 1GHPA 1WE4A 1I2WA 1K55A 1YQSA 2PU2A 4LCMA 4BD0A 3EQVA 4BQMA 1IYSA 5DF7A 4R4RA 3W4PA 3N8LA 3ZDJA 3C4PA 2J9PA 2Q9NA 1H8YA 4K0XA 5AQAA 1ZG6A 4WM9A 1NXYA 1PIOA 4KQQA 2ZM8A 3LY3A 1YLPA 1YMXA 4PPRA 3UE3A 3HLBA 4R23A 1IKIA 4BLMA 1GA0A 1W79A 3G31A 2DNSA 3Q7ZA 3VOYA 5EVID 2ZD8A 1G6AA 3BYDA 3O3VA 4PM8A 1BLCA 5FQQA 5KSHA 2R9WA 1YLJA 5HARA 5M1AA 1XXMA 2EX8A 3BECA 4WYYA 3SOIA 3GTCA 3ZFZA 5HL1A 4JF5A 3SH7A 4QJGA 1MWSA 1ES4A 1N9BA 2EXAA 3CJMA 4LV0A 3E2KA 5CGXA 1I5QA 1XPBA 3DW0A 3HLFA 3A3IA 3IHAA 3IXDA 3MZDA 4YINA 1QMEA 1CI9A 3W8KA 1Z6FA 4FH2A 1CEFA 4KZ9A 1NRFA 3IXGA 4P85A 1MWTA 5BOHA 1BTLA 4RYEA 4U3TA 1SHVA 4BL2A 2A49A 5A93A 4KZ6A 2VGJA 3HLDA 4B88A 5KMWA 1FCNA 1N4OA 1E4DA 3Q7VB 2ZMAA 3BM6A 5TGFA 4BJPA 2X01A 2RCXA 2WZZA 3VP4A 3GV9A 2XQZA 2XH9A 1K25A 3VP3A 3G34A 1TVFA 3IHBA 5GHXA 5FAPA 1QMFA 4JXWA 5AQ9A 4MEZA 4DE2A 5L2FA 5GLCA 2Y59A 5CTNA 1FR1A 1SKFA 3HUMA 2ZLYA 3WRTA 5FQMA 3ZNTA 4DXCA 3FWLA 3G2ZA 4DE1A 3GRJA 2HDQA 1ALQA 1LHYA 1VQQA 2Y2OA 2JCHA 2WKIA 4KZ4A 4FSFA 3UNWA 3FYZA 3VFFA 4N9LA 5EOEA 3MKEA 3UE1A 2XR0A 1DY6A 4C6YA 2VGKA 1H8ZA 2ZM0A 1G68A 4PM9A 1K56A 4IBRA 2IWDA 3S1YA 3S4XA 1IYOA 2Y2GA 1FR6A 1KE0A
chains in the Genus database with same CATH superfamily
4JXGA 4ETXA 4Y5FA 5EM0A 3ZNYA 1XGIA 3E98A 4G3WA 3QNCA 3E4PA 2ZL1A 4ARZB 3LIAA 4G3VA 4BL3A 3QNBA 4JF4A 3FG8A 3UO9A 3C8CA 1BULA 4I5SA 5FATA 4OPYA 3BFGA 5E43A 3WRZA 2JKTI 1Q2QA 5J3WA 4ZAMA 3S7NA 2P9VB 4R0QA 2XA7M 4Y17A 1K55C 2M7VA 2QJ7A 2JKGA 4JBFA 2HP9A 2O9CA 3Q1FA 2GDNA 3BY9A 1VEUA 1E25A 4LGWA 2WKPA 2CC1A 2GX5A 4S2NC 5FEFA 2PR5A 4ETZA 2H10A 4GHIA 2NUTC 2JHEA 3H9WA 3GECA 3NOUC 3WS2A 3H82A 4KZ5A 3ZYTA 1PI5A 3BFEA 1RGZA 2GJ3A 3D4FA 5FAQA 2QHKA 2JKRI 1U60A 2XD5A 2HV1A 2VJWA 1SKOA 3CG5A 4GNUA 3TG9A 3VOZA 1UWNX 2J3WA 2VKSA 4P87A 1Y54A 3T1QB 4UQIS 1ES3A 5JYPA 4Y0OA 2JBFA 4P6ZM 2B18A 5L07A 1KDWA 1H0MA 5CEDA 1J9MA 4FD8A 3CUEA 1LT0A 4WZ4A 4DDSA 3IT9A 3RXXA 5A91A 4L9EA 2Z6DA 4R3JA 5DFXA 3T1XA 1DRMA 2C5WB 3C7UA 2EWVA 5M19A 4RVAA 1K57A 5K5BA 1S1YA 5GLBA 4WEKA 4N9KA 1PZPA 3V5MA 3BQ8A 3IQAA 4R70A 3ZG8B 3VSKA 2O99A 1IKGA 5A90A 2J9OA 5EOOA 2PBYA 4M3KA 5FI7A 5CHUA 3KO6A 3G32A 4MLLA 4X68A 4LENA 2DCFA 5HW3A 1F98A 1GCEA 1CF0A 3S7PA 5FQKA 1P97A 3NJAA 3O5YA 2DRWA 3WS1A 1PWGA 1LSVA 3A3DA 2CMNA 2O9AA 3K2NA 3OPRA 3GR2A 1BLPA 3CPTA 4BBTA 4DE3A 2WUQA 3BFCA 5FI6A 1VM1A 4S2KA 2QKPA 5DJTA 3W4QA 4X53A 4ME4A 3SH9A 1CI8A 4Y3IA 4E3KA 4PM5A 4JGQA 2H0YA 5EFWA 3DTEA 4Q0HA 1SKOB 4QHCA 1LI0A 3KSGA 4EEPA 1PW1A 3UE0A 2WKEA 4E04A 5CGWA 1OTIA 3M6HA 4P6ZS 3OBFA 3TRCA 1MWRA 3B33A 1DP9A 4LRXC 3WS0A 5FSRA 3PBSA 1SDEA 3CZDA 3GVBA 3VE3A 5AVFA 4OQIA 5TBMB 1FCOA 3FC7A 3M2KA 4QD4A 4CQHA 5IS1A 4X6TA 4OLGA 1W8QA 1T1BA 1K6RA 5M18A 4D60A 5KIZA 1DJAA 5L8MA 3QHYA 5CHMA 3GMWA 2WGWA 5JYOA 1N9OA 1KOUA 1D06A 1TEMA 4JGRA 1PYYA 2HPBA 1BLHA 2PHYA 1NRJA 5HPIA 5GHZA 3HUNA 1KGGA 3SW1A 4C3QA 1MKMA 1F9IA 1Q2PA 2QPNA 3MKFA 1FIKA 1SCWA 4C75A 3Q81A 4NXEA 3RFBA 1S0WA 3RJUA 3LR5A 2HF6A 4YFMA 3IS2A 5HWVA 1M6KA 4IBXA 3P09A 5J4EA 3PBOA 1KGEA 3LI9A 1TS8A 2M1CA 2V2FF 5CHJA 4GDNA 4KZ8A 3NOPC 3T4LA 2ZC4B 4EESA 2ZQCA 4NETA 4UA9A 1O7EA 5TFQA 4Y2FA 2ZQ8A 3G4PA 1ZG4A 5F6AA 3N4IA 4E6XA 2WAFA 2PYRA 3BRMA 1UGUA 3UDIA 1RP5A 1E3UA 3CI6A 1G5UA 1RCJA 1XJ6A 4QY5A 4N1XA 4X69A 5EVLA 4LCLA 4JPMA 4HESA 1ERQA 4I3IA 4LCMA 4F3LA 2D01A 3C4PA 2A2LA 4K0XA 1LL8A 3T4QA 2ZM8A 3L9KA 3KYEA 1YMXA 2GZAA 4BLMA 1W79A 3Q7ZA 4ESPA 2HJEA 3PXPA 5FQQA 3EEHA 3SOIA 3ZFZA 2P04A 4QJGA 1ES4A 3CJMA 3LR0A 4LV0A 1I5QA 3DW0A 3HLFA 3IHAA 2W3HA 4LLOB 1QMEA 4FH2A 1NRFA 1MWTA 5BOHA 4RYEA 1S4RA 4U3TA 4BL2A 5A93A 3HLDA 5KMWA 1E4DA 4H6JA 3UE6A 2XQZA 1K25A 4O0PA 4JXWA 4DE2A 5GLCA 2Y59A 1AWIA 2J3TD 4EW7A 1FR1A 2ZLYA 1IFQA 1NLYA 3HJKA 3TW8A 3G2ZA 4B93A 4DE1A 1ZHHB 3GRJA 1LHYA 4KZ4A 2Y2OA 2JCHA 2WKIA 4FSFA 3UE1A 4HOIA 4LRYC 4C6YA 1K56A 5EM1A 2IWDA 2Y2GA 2Q0OA 2Z6CA 4HI4A 1TDLA 2BASA 3IX8A 3NECA 1YM1A 3HL9A 1YPRA 4Y13A 1YLTA 3NC8A 4EQ1A 4R1GA 2IA2A 2A3UA 2Y4AA 2M7UA 3NBLA 3PBRA 1JWZA 1K54C 3BQAA 4LRZE 1CQAA 3MXQA 1IOUA 4B4ZA 1S1ZA 3SS3A 1FOFA 5EE8A 3MXSA 1L3LA 4D2OA 3TE8A 3OCLA 2OSUA 2EX9A 2E8IA 4EQIA 2P9VA 1E3UD 2Y2NA 1F5MA 3TJZC 1NZUA 1DJCA 4WBGA 4E3JA 2WGIA 1A0KA 4PM6A 3MQ0A 3IH8A 1EW0A 5HWWA 3FKVA 5EVEA 5HPFA 4M4XA 1JVJA 3HREA 3ZCZA 4BMWA 1EROA 4KQOA 1K4FA 2XF3A 5CRFA 5IHVA 3DTIA 4EWFA 3LGOA 1RGYA 2IWCA 4OP8A 4XUZA 4XUXA 5FQIA 4II7A 2W3GA 3UB7A 1HTZA 2Y2HA 2I9VA 3KSHA 3HVFA 4Y0TA 5F5YA 4OPQA 1YLWA 1OPXA 2V1ZA 2WK0A 4FCFA 1PWDA 2VK3A 4QWOA 4S2LA 3N6IA 3QP5A 3AGDA 4RX3A 5HL6A 4F94A 4DRTA 1WYBA 4GZBA 2PYPA 3TOIA 3LI8A 3NDEA 1XA1A 3P7NA 4HNBA 4EBLA 5TR7A 3IWIA 3A3FA 4UAAA 3IX3A 2BLSA 2WKHA 5FEGA 2W3FA 3ZHHA 5MC7A 4GCZA 4UA7A 3F1OB 3UDFA 1K56D 5D3OA 4JXSA 3NY4A 3IWOA 3AGEA 4KZ7A 5DTTA 4GB7A 3VP0A 3LIDA 4PAUA 4CLCA 5GLAA 5CGSA 4I3AA 3A3JA 5TJJA 3BEBA 2Y91A 3NULA 1SZVA 3PAEA 3T4SA 4H8RA 3T1SA 4QB8A 1G6OA 3UB8A 5EECA 1BUEA 3E4OA 1GSWA 4DJ2A 4MN6A 3OPLA 4KZAA 1KVLA 1JNUA 5EVIB 4WMCD 1D7EA 5DFYA 3T1RA 1TS6A 4P6BA 2I72A 5U47A 2PAVP 4S2JA 4KG5A 3PBQA 4YNRA 3IF6B 3T12B 3B3XA 4PHTA 1KVMA 4KQRA 4LV2A 1BYWA 1S4SA 3UY6A 1TF1A 1ZKJA 4E3MA 1LL5A 3M2JA 3FZCA 4O01A 1Y4OA 5FDSA 4R6LA 2HZ5A 3MZEA 2V1BA 3GQZA 3V3RA 4R38A 4KQDA 1T19A 4K0WA 4E3LA 1MC0A 5I5LA 2B02A 4S2NA 3T4OA 3DBAA 1MZUA 3CUEC 1W7FA 2ACGA 1BLSA 4ZRRA 3KSIA 3SS5A 4OH0A 4N92A 5TBMA 1K57C 2PR6A 2PRFA 3P98A 1XP4A 4JF6A 1FSWA 3F1PA 1KE4A 3F1NB 3HLEA 1J3WA 2VV7A 4OP5A 3LO7A 3LR4A 4EERA 2P08A 4EBPA 3G35A 4Y7PA 1GSVA 4R3AA 4EBNA 4UEYA 1CJFA 5DKLA 3N8RA 3ZVWA 1HLUP 4N1HA 5DTSA 2PD8A 3C4OA 3FPWA 2ZM2A 4E3IA 2PT7A 3DWKA 1L0DA 2V9AA 2BG1A 1FCMA 3IX4A 3Q07A 2LB5A 3CAXA 4UA6A 2ZC6B 4CLCB 4S2PA 2BTFP 3BW6A 5FAOA 2KLIA 5HAIA 2XA7S 3BLMA 2Q9MA 2OAQ1 2NUPC 2W1TA 2K7SA 3HLCA 5F83A 3VSLA 1YT4A 3NIAA 3MXRA 4PM7A 2XD1A 4KUOA 4FTXA 1XJ2A 1NY0A 2A24B 1K4EA 4BBUA 3KSFA 4OQ0A 4XT2A 2H5SA 4QU3A 4GLQA 2WYXA 2Y55A 1OTEA 3B47A 3LIBA 4DJ3A 3KYZA 3GDIA 3ITBA 3KX0X 3LIEA 1KE3A 2ZQ9A 1PRQA 2R78A 1EWZA 2PU2A 1YQSA 3LUQA 1IYSA 4R4RA 1YSPA 3HCYA 2PBDP 1H8YA 1DP8A 3DTKA 4KQQA 3HLBA 1IKIA 3T4KA 1Z09A 3EEAA 2J3TC 1VB6A 2R9WA 1YLJA 1XFQA 1XXMA 2EX8A 3CITA 3BECA 3T4TA 4LFUA 4JF5A 3E2KA 5CGXA 2FH5A 1ACFA 3A3IA 3F1PB 2ZMVA 4Q0IA 1CEFA 1SHVA 4KZ6A 4B88A 1N4OA 2ZMAA 2X01A 1Y28A 2WZZA 3VP4A 4NXFA 2QYBA 3IHBA 5FAPA 5AJGA 1T1CA 5AQ9A 5L2FA 1UWPX 1H3QA 3L7HA 4HP9A 2GNXA 4HQAA 5FQMA 3ZNTA 3VOLA 3FWLA 4EETB 1VQQA 3UNWA 3VMAA 4N9LA 5EOEA 1OTDA 2W1TB 3MQOA 1G68A 4IBRA 3S1YA 2W3DA 1KE0A 3AGFA 1WA9A 1K6SA 3EQUA 4WEJA 2Y79A 4DE0A 3FKWA 1JTGA 3BWLA 4P0MA 4XT2B 5FL3A 4Q0JA 5HZHA 5J7EA 2HDRA 1GA9A 4OPZA 2H0TA 3CMZA 3SZTA 1GHMA 2Y2MA 4MNRA 2EX2A 3OLOA 4YOFA 4CJNA 4OQHA 3ISGA 5I94A 3ITAA 4GD6A 3UDXA 4CLCE 5AQ7A 3ZGAB 3S7QA 2V8FA 2VZWA 4NK3A 4EUZA 4CPKA 1NJ4A 4NXBA 4BENA 3UB6A 2HP5A 2B95A 4JXVA 4WUJA 3HUOA 1NZOA 5EV0A 3Q82A 2JKFA 1W63M 3O86A 5G4ZA 2OLVA 2XRNA 4HH2A 1JTDA 2OOLA 2OWHA 2Y8HA 4FH4A 4Y0UA 2JN7A 4ZBEA 5A92A 3N7WA 3IBRA 4IVIA 3MQQA 1ESUA 1CK3A 2Y2JA 3LIFA 4KUKA 3PHYA 5KSCA 4JKTA 2HP6A 4IEDA 2G7UA 2UWXA 2QMIA 5LBRA 4MCWA 3G6OA 3IXHA 3T50A 5F68A 2ZQAA 1VETB 2VEAA 2L1MA 3K3CA 2W3EA 4R3BA 2Y2KA 3LICA 1BZAA 3ZG9B 2O9BA 4MBHA 2QWSA 4B9OA 3HJIA 4OQGA 2ZQ7A 4HBTA 3HLGA 2W1RA 3E0YA 2OV5A 1XA7A 3JPUA 4BD1A 3QP4A 1OTBA 3OC2A 3LEZA 4MN7A 4EU0A 3ZQ5A 4HP4A 2V0UA 1K0KA 4GJ4A 2UV0E 1P0ZA 3V39A 4ID4A 1S66L 3PBNA 4DN0A 3SS4A 4HJ3A 5DF8A 1W8YA 3LFVA 3F1OA 2EFUA 5E2EA 3TSGA 2OAP1 3BFFA 1I2SA 4UHUA 5FASA 4HJ6A 4GKUA 2X02A 1OTAA 3BLSA 3E2LA 1ESIA 2EX6A 2G2UA 3NOTC 4JLFA 4EXOA 4WZ5A 2HDUA 2ZQDA 3QP2A 1LI9A 2WKRA 4HBUA 4G3KA 3ZG0A 4E3OA 1NYYA 3P01A 3UB9A 4HH3A 4S2OA 5HX9A 3IWQA 4GDBA 5EVIA 4JGPA 1T18A 3VFHA 2XFSA 3R7WA 1WYCA 2WZXA 2V8CA 3ZG5A 2J7VA 2EWWA 3IF6A 1X0OA 5EPHA 3NCKA 3V67A 5F1GA 5EUAA 5HDDA 1L0GA 3C30A 3H7WA 1YKDA 3VE4A 1ZC2A 4K91A 3M6BA 2KDKA 3EWKA 4S2MA 3NDGA 4EUVA 4ZTKA 4OKPA 1ES5A 5HWTA 2XROA 2H28A 1L2SA 2Y2LA 4IUHA 4OONA 3ZVTA 1NYMA 3MJQA 2KOIA 4NEED 4A5RA 1OJ5A 2XEPA 5HFOA 2HDSA 1IELA 3PTEA 3OZHA 3MSHA 4X55A 3NI9A 5IT5A 5CXWA 1HVBA 1FQGA 4L9FA 4MDZA 3Q7VA 3F1NA 4U0TA 2ZBBA 4DXBA 4UQIM 1IYQA 5L10A 4GOGA 4Z9QA 3OOVA 3OPPA 1MKIA 1EI5A 4OOMA 3MFXA 1SDNA 3CWFA 3EOIA 4ZJ3A 1S67L 4X1MA 4PMAA 3UPOA 1O07A 3RXWA 4HY8A 4EEUA 3LCEA 4L0LA 2XLNA 1T1AA 2VX8A 3WWXA 2J8YA 2PU4A 1MPLA 1TDGA 1P9RA 5CTMA 1IYPA 5HAPA 4YWZA 3T4JA 2K31A 2JE5A 4KZBA 3O87A 3S22A 4IVKA 2LB9A 5E2HA 3C5AA 1DJBA 4WLAA 2ZC7A 3S7OA 1XGJA 2X71A 5DVAA 5F1FA 2L0WA 3IH9A 2R9XA 2WADA 3RTYA 3LYXA 3R7WB 2ZJ9A 3B42A 5G18A 1PZOA 2A24A 3OCNA 1FILA 3PAGA 2EFXA 4WF0A 2V20A 2C6WB 3V50A 1I2WA 1K55A 3H7WB 3EQVA 4HJ4A 3W4PA 2Q9NA 5AQAA 4WM9A 2YKFA 3JVVA 3LY3A 4PPRA 4R23A 1GA0A 3G31A 5EVID 3BYDA 3O3VA 1BLCA 5M1AA 4WYYA 3GTCA 2ZOIA 5HL1A 1MWSA 2EXAA 1XPBA 4BBVA 3MZDA 4KZ9A 3IXGA 4P85A 1BTLA 2A49A 3MF0A 2VGJA 1STZA 3Q7VB 4Z1WA 5TGFA 2JKTM 3UB5P 2RCXA 3GV9A 2XH9A 3VP3A 4GS9B 3G34A 1TVFA 4X1LA 1QMFA 4O8GA 3U2AA 5CTNA 3QP6A 1H8MA 5HD3A 3HUMA 3WRTA 4DXCA 4IHQA 2L4RA 1TS7A 3KYQA 2ZOHA 2HGVA 1DY6A 2OWJA 2VGKA 2ZL1B 1FR6A 3UE3A 5A8BA 2P7JA 1MXOA 2JKRM 3QP8A 2KX6A 4OVDA 3JYIA 5C5KA 1BSGA 3A0SA 1OT6A 3HBRA 1IEMA 4FUWA 2ZC5B 1JWPA 3D72A 3MS6A 3RH8B 2D02A 2QJ5A 4CLCD 1OT9A 5HDCA 1K38A 2FFYA 4GN2A 2Y2PA 1OMEA 3W4OA 4DMZA 5F82A 3FV7A 5DJUA 1VEUB 5GHYA 3VP2A 1YAXA 2VGLM 5IU1A 4GHIB 2PDRA 4O7DA 1MBLA 5FQ9A 5KZHA 3H82B 1LL9A 3BJNA 4BWIA 3OPHA 4NKPA 3BFDA 4K08A 3PYPA 1G28A 1N9NA 5HD5A 3QP1A 1YLYA 2XSSA 3O88A 2HJ9C 4Q8IA 4ZJ1A 3LEQA 2WAEA 3ZG7B 1V9ZA 4WELA 1GHIA 3E4QA 4MN5A 3UN7A 1OJGA 3IXBA 3PR6A 3UPPA 4KG6A 1DP6A 1YMSA 3ICYA 5HDSA 1XX2A 4GW9A 3G2YA 4OOYA 2XGNA 4B4XA 2YKHA 3K3DA 4I3JA 3IBJA 5DTKA 1ES2A 4IUKA 4JGOA 1PW8A 2ZC3B 3A0VA 3UMDA 3EGXC 1VETA 2B5RA 1D1JA 4E6WA 3DWZA 5GL9A 1FSYA 3A3EA 4LV3A 2P74A 1CEGA 5CERA 3SH8A 3EGDC 4HEFA 4OOLA 1PNEA 2QZ6A 4NG2A 4EV4A 3G30A 2FFFB 2RL3A 3MR0A 3UPNA 2XK1A 4X25A 1L0EA 3A0RA 3MMHA 4GD8A 2PD7A 2VGLS 4KG2A 4MBFA 2Y2QA 2V1AA 1C3BA 3CPTB 2WKQA 2OLUA 2AVXA 3PBTA 1ONGA 3GSGA 5AVEA 2O0YA 3MBZA 2V0WA 3WS4A 3W2ZA 5FQJA 1TD5A 1ERMA 2IWBA 5CECA 2VA0A 5GLDA 2WGVA 2VV6A 1N9LA 3D3OA 2J80A 4XXRA 3IF5A 4ZDXA 4I38A 1W63Q 1XKZA 4RX2A 4DDYA 2Z2MB 2JC7A 5E2GA 2Z2LB 1XJ3A 4ZJ2A 5FDHA 3DAVA 1W5DA 2WGWB 1VHMA 5HAQA 4PKYG 3C38A 1MWUA 3UMEA 2INWA 2XFTA 3LY4A 2G2WA 1H5XA 3LR3A 4DF6A 4KZ3A 3ULFA 4OLDA 5J8XA 5FI2A 1S6RA 1M40A 4MBKA 5CEBA 3CHWP 3R4KA 1BT5A 4QY6A 3MFDA 2ZMFA 3JVUA 5HSQA 1L0FA 1YLZA 4IJGA 3C2WA 4L9GA 3N8SA 5CX7A 3IS2B 1KDSA 3BY8A 4RA7A 4I39A 4R4SA 2Y2IA 1YSQA 3V3SA 5DKKA 3CLOA 4KENB 3C7VA 4NXGA 1ONHA 5E2FA 4E3NA 5F69A 1PFLA 1HZOA 4WL9A 1ODVA 3HLWA 4WZ5C 1NWZA 5FA7A 3U4LP 3WS5A 4U0XA 2EXBA 1HD8A 2W27A 2XDMA 1F2KA 4AFIA 3DTMA 4RQ9A 3I7JA 4ARZA 1AXBA 4WMCA 1JWVA 4X56A 5EVIC 5DF9A 1LLBA 3MZFA 4S2IA 1P9WA 4F3LB 5AQBA 1K54A 3FPVA 4OPRA 1GSXA 1PWCA 4FOFA 4LPZA 4LV1A 5L09A 1MY8A 2VV8A 5G4YA 1KGFA 3IF6C 1PI4A 3VP1A 1GHPA 1WE4A 4QPRA 4BD0A 1TS0A 1XJ4A 4BQMA 5DF7A 3N8LA 3ZDJA 2J9PA 1ZG6A 1NXYA 1PIOA 1LSWA 1YLPA 2DMWA 2DNSA 3VOYA 2ZD8A 1G6AA 4PM8A 5KSHA 4HIAA 5HARA 4MMNA 3SH7A 1NLZA 1N9BA 4H6JB 3IXDA 4YINA 1CI9A 3D9YA 3W8KA 1Z6FA 4HHDA 1XFNA 1LSXA 4Y15A 1FCNA 2MJ6A 2EA9A 4PKYA 3BM6A 4WN5A 4BJPA 3NHQA 2E8JA 5GHXA 4MEZA 3VV4A 1SKFA 2VLGA 1ZTUA 4GS9A 2HDQA 1ALQA 4DKIA 3VFFA 3FYZA 3MKEA 2XR0A 4CLCC 1H8ZA 2ZM0A 4PM9A 2FZ0A 2K2NA 3S4XA 1IYOA 2W0NA 1V9YA
chains in the Genus database with same CATH topology
4JXGA 3AGFA 1TDLA 1MXOA 3ZNYA 1YM1A 1XGIA 3HL9A 4OVDA 1K6SA 1YLTA 3EQUA 3JYIA 3NC8A 3QNCA 4WEJA 4DE0A 3FKWA 1JTGA 4R1GA 1BSGA 4P0MA 4BL3A 2A3UA 3QNBA 2Y4AA 3NBLA 2HDRA 4JF4A 3HBRA 1GA9A 3PBRA 3UO9A 1IEMA 2ZC5B 1BULA 1JWZA 1JWPA 4OPZA 2H0TA 1K54C 5FATA 3CMZA 1GHMA 4DKIA 2Y2MA 4MNRA 2EX2A 4OPYA 3BFGA 3SS3A 5E43A 4B4ZA 1K38A 2FFYA 1FOFA 2Y2PA 1OMEA 4GN2A 4OQHA 3ISGA 3W4OA 3WRZA 4CJNA 1Q2QA 3ITAA 4ZAMA 5F82A 5I94A 2P9VB 4GD6A 3FV7A 4R0QA 1K55C 3UDXA 5EE8A 3MXSA 4D2OA 5GHYA 3VP2A 4JBFA 5AQ7A 3ZGAB 2HP9A 3OCLA 3Q1FA 4NK3A 4O7DA 2GDNA 1MBLA 2EX9A 2OSUA 5FQ9A 4EUZA 2E8IA 4CPKA 4EQIA 5KZHA 2P9VA 1NJ4A 4BENA 2HP5A 1E25A 1E3UD 2Y2NA 1LL9A 1DJCA 1NZUA 4JXVA 2CC1A 3HUOA 4WBGA 4S2NC 1NZOA 3OPHA 4E3JA 2H10A 2WGIA 4PM6A 3BFDA 3SS4A 3Q82A 3IH8A 3WS2A 1YLYA 3O86A 4KZ5A 2OLVA 3O88A 1JTDA 1PI5A 3FKVA 3BFEA 1RGZA 3D4FA 5FAQA 4Q8IA 4ZJ1A 1U60A 4FH4A 2XD5A 4Y0UA 1JVJA 2WAEA 3ZG7B 3HREA 4ZBEA 5A92A 3N7WA 3ZCZA 4WELA 1EROA 3CG5A 4IVIA 4KQOA 4GNUA 3TG9A 1GHIA 3VOZA 1ESUA 1CK3A 1K4FA 2Y2JA 2XF3A 5CRFA 5IHVA 3UN7A 4EWFA 1RGYA 2IWCA 4OP8A 5KSCA 4XUZA 4P87A 3IXBA 4XUXA 5FQIA 4JKTA 2HP6A 1Y54A 3UPPA 4KG6A 1ES3A 1HTZA 2Y2HA 4Y0OA 5JYPA 2JBFA 1YMSA 2UWXA 4IEDA 2QMIA 1XX2A 3HVFA 4Y0TA 4OPQA 3G2YA 3IXHA 1KDWA 4OOYA 2XGNA 1YLWA 2ZQAA 2V1ZA 4B4XA 2WK0A 5CEDA 4FCFA 1J9MA 4FD8A 4R3BA 2Y2KA 5DTKA 4WZ4A 1ES2A 1PWDA 4DDSA 3IT9A 4S2LA 1BZAA 3ZG9B 3RXXA 1PW8A 2ZC3B 5A91A 3N6IA 4MBHA 4R3JA 2C5WB 2B5RA 3C7UA 5M19A 3AGDA 4RVAA 1K57A 4OQGA 4RX3A 5GLBA 4E6WA 3DWZA 2ZQ7A 4HBTA 4WEKA 4N9KA 1PZPA 5GL9A 3V5MA 1FSYA 3HLGA 3IQAA 4DRTA 4F94A 3A3EA 4LV3A 2P74A 1WYBA 1CEGA 4GZBA 3ZG8B 2OV5A 3TOIA 3VSKA 1XA7A 4BD1A 1IKGA 5CERA 5A90A 3NDEA 2J9OA 1XA1A 5EOOA 3OC2A 3LEZA 2PBYA 4M3KA 5FI7A 5CHUA 4EBLA 3SH8A 5TR7A 3IWIA 3A3FA 4UAAA 4HEFA 2BLSA 2WKHA 4OOLA 3G32A 4MLLA 4X68A 3ZHHA 4LENA 4UA7A 2QZ6A 3UDFA 2DCFA 1K56D 5D3OA 4JXSA 5HW3A 3V39A 3NY4A 4ID4A 4EV4A 3G30A 2FFFB 2RL3A 1GCEA 3AGEA 3IWOA 3PBNA 2XK1A 4GB7A 4KZ7A 1L0EA 5DF8A 5DTTA 3UPNA 4GD8A 1W8YA 3VP0A 4KG2A 4MBFA 5FQKA 5GLAA 5CGSA 2Y2QA 1C3BA 3A3JA 2EFUA 5E2EA 2OLUA 3TSGA 3BEBA 2Y91A 3BFFA 3PAEA 3PBTA 2DRWA 3WS1A 1I2SA 4UHUA 5FASA 1PWGA 3A3DA 4H8RA 1ONGA 3GSGA 4GKUA 4QB8A 2X02A 3OPRA 3BLSA 3GR2A 5EECA 1BLPA 1BUEA 3MBZA 3E2LA 4DE3A 1ESIA 2EX6A 2G2UA 3WS4A 3OPLA 2WUQA 3BFCA 4JLFA 4KZAA 5FQJA 4WZ5A 1KVLA 5FI6A 1VM1A 1ERMA 2HDUA 2ZQDA 4S2KA 1LI9A 5EVIB 4WMCD 2IWBA 4HBUA 5CECA 4P6BA 3ZG0A 2I72A 5U47A 5GLDA 3W4QA 4X53A 4E3OA 1NYYA 3SH9A 1CI8A 2WGVA 4S2JA 4S2OA 5HX9A 4E3KA 4PM5A 4KG5A 3IWQA 2H0YA 4GDBA 5EVIA 3VFHA 3PBQA 3IF6B 2XFSA 3B3XA 4QHCA 1LI0A 1PW1A 1WYCA 1KVMA 4KQRA 4LV2A 4XXRA 3UE0A 3IF5A 3UY6A 2WKEA 4ZDXA 2WZXA 1ZKJA 5CGWA 4E3MA 1XKZA 1LL5A 3M2JA 3FZCA 4RX2A 3ZG5A 2J7VA 3M6HA 3IF6A 4DDYA 5EPHA 1MWRA 3NCKA 3MZEA 2Z2MB 5F1GA 5EUAA 3GQZA 3V3RA 1L0GA 2JC7A 3WS0A 5E2GA 2Z2LB 4K0WA 5FSRA 4E3LA 1ZC2A 3PBSA 1SDEA 3CZDA 3GVBA 4K91A 4S2NA 4OQIA 4ZJ2A 1W7FA 5FDHA 3M6BA 1FCOA 3M2KA 1W5DA 4QD4A 4S2MA 1BLSA 2WGWB 3NDGA 5HAQA 4X6TA 1MWUA 4OLGA 4ZTKA 2XFTA 4OH0A 3SS5A 4OKPA 4N92A 1ES5A 3LY4A 2G2WA 1H5XA 1W8QA 1K6RA 1L2SA 1K57C 5M18A 4DF6A 4KZ3A 2Y2LA 1DJAA 4OONA 3QHYA 5CHMA 4OLDA 3GMWA 2WGWA 3P98A 5JYOA 3ZVTA 5J8XA 1NYMA 1XP4A 4JF6A 1FSWA 5FI2A 1S6RA 1TEMA 4A5RA 1KE4A 1M40A 2XEPA 3HLEA 4MBKA 5HFOA 2HDSA 1IELA 4OP5A 3PTEA 3LO7A 5CEBA 1PYYA 1BT5A 3OZHA 4QY6A 4EBPA 3G35A 4Y7PA 4X55A 3MFDA 2HPBA 3NI9A 5CXWA 1HVBA 4EBNA 1FQGA 1BLHA 1L0FA 3N8RA 3Q7VA 3ZVWA 1YLZA 4N1HA 5DTSA 4U0TA 4DXBA 5GHZA 1IYQA 3C4OA 4GOGA 2ZM2A 3HUNA 4E3IA 3DWKA 4Z9QA 1KGGA 3OPPA 1L0DA 3N8SA 4C3QA 1MKIA 1EI5A 2BG1A 1FCMA 1Q2PA 2QPNA 3Q07A 4OOMA 1SDNA 1KDSA 4UA6A 4ZJ3A 2ZC6B 3MKFA 4RA7A 4PMAA 3UPOA 4S2PA 1SCWA 4C75A 3Q81A 5FAOA 1O07A 1S0WA 5HAIA 3RJUA 3RXWA 4R4SA 4YFMA 2Y2IA 3BLMA 2Q9MA 3V3SA 3LCEA 4L0LA 1M6KA 2XLNA 4IBXA 3WWXA 2J8YA 3P09A 4KENB 3PBOA 3C7VA 2PU4A 1MPLA 1ONHA 1TDGA 3HLCA 5E2FA 5F83A 1KGEA 4E3NA 5CTMA 3VSLA 1IYPA 5HAPA 2V2FF 1YT4A 1HZOA 3MXRA 3NIAA 4PM7A 2JE5A 2XD1A 4KZBA 5CHJA 3HLWA 3O87A 3S22A 4GDNA 4IVKA 4KZ8A 4WZ5C 2ZC4B 5E2HA 2ZQCA 3C5AA 1DJBA 4NETA 5FA7A 4UA9A 3WS5A 4U0XA 2ZC7A 1O7EA 5TFQA 2ZQ8A 1NY0A 3G4PA 1ZG4A 2EXBA 1HD8A 2XDMA 1XGJA 2X71A 3N4IA 4E6XA 2WAFA 3DTMA 3BRMA 1K4EA 3I7JA 3UDIA 4OQ0A 5DVAA 5F1FA 1AXBA 3IH9A 2H5SA 1RP5A 1JWVA 4QU3A 1E3UA 2R9XA 4WMCA 2WYXA 4X56A 5EVIC 2WADA 5DF9A 3VMAA 1LLBA 1RCJA 2Y55A 3MZFA 4S2IA 2ZJ9A 5AQBA 1K54A 5G18A 1PZOA 4OPRA 3OCNA 4QY5A 1PWCA 4N1XA 3PAGA 4X69A 4LV1A 3ITBA 2EFXA 5EVLA 1KE3A 2ZQ9A 4JPMA 4LCLA 1MY8A 2V20A 4HESA 1ERQA 1EWZA 1KGFA 1PI4A 3IF6C 3VP1A 2C6WB 3V50A 1GHPA 1WE4A 1I2WA 1K55A 1YQSA 2PU2A 4LCMA 4BD0A 3EQVA 4BQMA 1IYSA 5DF7A 4R4RA 3W4PA 3N8LA 3ZDJA 3C4PA 2J9PA 2Q9NA 1H8YA 4K0XA 5AQAA 1ZG6A 4WM9A 1NXYA 1PIOA 4KQQA 2ZM8A 3LY3A 1YLPA 1YMXA 4PPRA 3UE3A 3HLBA 4R23A 1IKIA 4BLMA 1GA0A 1W79A 3G31A 2DNSA 3Q7ZA 3VOYA 5EVID 2ZD8A 1G6AA 3BYDA 3O3VA 4PM8A 1BLCA 5FQQA 5KSHA 2R9WA 1YLJA 5HARA 5M1AA 1XXMA 2EX8A 3BECA 4WYYA 3SOIA 3GTCA 3ZFZA 5HL1A 4JF5A 3SH7A 4QJGA 1MWSA 1ES4A 1N9BA 2EXAA 3CJMA 4LV0A 3E2KA 5CGXA 1I5QA 1XPBA 3DW0A 3HLFA 3A3IA 3IHAA 3IXDA 3MZDA 4YINA 1QMEA 1CI9A 3W8KA 1Z6FA 4FH2A 1CEFA 4KZ9A 1NRFA 3IXGA 4P85A 1MWTA 5BOHA 1BTLA 4RYEA 4U3TA 1SHVA 4BL2A 2A49A 5A93A 4KZ6A 2VGJA 3HLDA 4B88A 5KMWA 1FCNA 1N4OA 1E4DA 3Q7VB 2ZMAA 3BM6A 5TGFA 4BJPA 2X01A 2RCXA 2WZZA 3VP4A 3GV9A 2XQZA 2XH9A 1K25A 3VP3A 3G34A 1TVFA 3IHBA 5GHXA 5FAPA 1QMFA 4JXWA 5AQ9A 4MEZA 4DE2A 5L2FA 5GLCA 2Y59A 5CTNA 1FR1A 1SKFA 3HUMA 2ZLYA 3WRTA 5FQMA 3ZNTA 4DXCA 3FWLA 3G2ZA 4DE1A 3GRJA 2HDQA 1ALQA 1LHYA 1VQQA 2Y2OA 2JCHA 2WKIA 4KZ4A 4FSFA 3UNWA 3FYZA 3VFFA 4N9LA 5EOEA 3MKEA 3UE1A 2XR0A 1DY6A 4C6YA 2VGKA 1H8ZA 2ZM0A 1G68A 4PM9A 1K56A 4IBRA 2IWDA 3S1YA 3S4XA 1IYOA 2Y2GA 1FR6A 1KE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXG A;  3AGF A;  1TDL A;  1MXO A;  3ZNY A;  1YM1 A;  1XGI A;  3HL9 A;  4OVD A;  1K6S A;  1YLT A;  3EQU A;  3JYI A;  3NC8 A;  3QNC A;  4WEJ A;  4DE0 A;  3FKW A;  1JTG A;  4R1G A;  1BSG A;  4P0M A;  4BL3 A;  2A3U A;  3QNB A;  2Y4A A;  3NBL A;  2HDR A;  4JF4 A;  3HBR A;  1GA9 A;  3PBR A;  3UO9 A;  1IEM A;  2ZC5 B;  1BUL A;  1JWZ A;  1JWP A;  4OPZ A;  2H0T A;  1K54 C;  5FAT A;  3CMZ A;  1GHM A;  4DKI A;  2Y2M A;  4MNR A;  2EX2 A;  4OPY A;  3BFG A;  3SS3 A;  5E43 A;  4B4Z A;  1K38 A;  2FFY A;  1FOF A;  2Y2P A;  1OME A;  4GN2 A;  4OQH A;  3ISG A;  3W4O A;  3WRZ A;  4CJN A;  1Q2Q A;  3ITA A;  4ZAM A;  5F82 A;  5I94 A;  2P9V B;  4GD6 A;  3FV7 A;  4R0Q A;  1K55 C;  3UDX A;  5EE8 A;  3MXS A;  4D2O A;  5GHY A;  3VP2 A;  4JBF A;  5AQ7 A;  3ZGA B;  2HP9 A;  3OCL A;  3Q1F A;  4NK3 A;  4O7D A;  2GDN A;  1MBL A;  2EX9 A;  2OSU A;  5FQ9 A;  4EUZ A;  2E8I A;  4CPK A;  4EQI A;  5KZH A;  2P9V A;  1NJ4 A;  4BEN A;  2HP5 A;  1E25 A;  1E3U D;  2Y2N A;  1LL9 A;  1DJC A;  1NZU A;  4JXV A;  2CC1 A;  3HUO A;  4WBG A;  4S2N C;  1NZO A;  3OPH A;  4E3J A;  2H10 A;  2WGI A;  4PM6 A;  3BFD A;  3SS4 A;  3Q82 A;  3IH8 A;  3WS2 A;  1YLY A;  3O86 A;  4KZ5 A;  2OLV A;  3O88 A;  1JTD A;  1PI5 A;  3FKV A;  3BFE A;  1RGZ A;  3D4F A;  5FAQ A;  4Q8I A;  4ZJ1 A;  1U60 A;  4FH4 A;  2XD5 A;  4Y0U A;  1JVJ A;  2WAE A;  3ZG7 B;  3HRE A;  4ZBE A;  5A92 A;  3N7W A;  3ZCZ A;  4WEL A;  1ERO A;  3CG5 A;  4IVI A;  4KQO A;  4GNU A;  3TG9 A;  1GHI A;  3VOZ A;  1ESU A;  1CK3 A;  1K4F A;  2Y2J A;  2XF3 A;  5CRF A;  5IHV A;  3UN7 A;  4EWF A;  1RGY A;  2IWC A;  4OP8 A;  5KSC A;  4XUZ A;  4P87 A;  3IXB A;  4XUX A;  5FQI A;  4JKT A;  2HP6 A;  1Y54 A;  3UPP A;  4KG6 A;  1ES3 A;  1HTZ A;  2Y2H A;  4Y0O A;  5JYP A;  2JBF A;  1YMS A;  2UWX A;  4IED A;  2QMI A;  1XX2 A;  3HVF A;  4Y0T A;  4OPQ A;  3G2Y A;  3IXH A;  1KDW A;  4OOY A;  2XGN A;  1YLW A;  2ZQA A;  2V1Z A;  4B4X A;  2WK0 A;  5CED A;  4FCF A;  1J9M A;  4FD8 A;  4R3B A;  2Y2K A;  5DTK A;  4WZ4 A;  1ES2 A;  1PWD A;  4DDS A;  3IT9 A;  4S2L A;  1BZA A;  3ZG9 B;  3RXX A;  1PW8 A;  2ZC3 B;  5A91 A;  3N6I A;  4MBH A;  4R3J A;  2C5W B;  2B5R A;  3C7U A;  5M19 A;  3AGD A;  4RVA A;  1K57 A;  4OQG A;  4RX3 A;  5GLB A;  4E6W A;  3DWZ A;  2ZQ7 A;  4HBT A;  4WEK A;  4N9K A;  1PZP A;  5GL9 A;  3V5M A;  1FSY A;  3HLG A;  3IQA A;  4DRT A;  4F94 A;  3A3E A;  4LV3 A;  2P74 A;  1WYB A;  1CEG A;  4GZB A;  3ZG8 B;  2OV5 A;  3TOI A;  3VSK A;  1XA7 A;  4BD1 A;  1IKG A;  5CER A;  5A90 A;  3NDE A;  2J9O A;  1XA1 A;  5EOO A;  3OC2 A;  3LEZ A;  2PBY A;  4M3K A;  5FI7 A;  5CHU A;  4EBL A;  3SH8 A;  5TR7 A;  3IWI A;  3A3F A;  4UAA A;  4HEF A;  2BLS A;  2WKH A;  4OOL A;  3G32 A;  4MLL A;  4X68 A;  3ZHH A;  4LEN A;  4UA7 A;  2QZ6 A;  3UDF A;  2DCF A;  1K56 D;  5D3O A;  4JXS A;  5HW3 A;  3V39 A;  3NY4 A;  4ID4 A;  4EV4 A;  3G30 A;  2FFF B;  2RL3 A;  1GCE A;  3AGE A;  3IWO A;  3PBN A;  2XK1 A;  4GB7 A;  4KZ7 A;  1L0E A;  5DF8 A;  5DTT A;  3UPN A;  4GD8 A;  1W8Y A;  3VP0 A;  4KG2 A;  4MBF A;  5FQK A;  5GLA A;  5CGS A;  2Y2Q A;  1C3B A;  3A3J A;  2EFU A;  5E2E A;  2OLU A;  3TSG A;  3BEB A;  2Y91 A;  3BFF A;  3PAE A;  3PBT A;  2DRW A;  3WS1 A;  1I2S A;  4UHU A;  5FAS A;  1PWG A;  3A3D A;  4H8R A;  1ONG A;  3GSG A;  4GKU A;  4QB8 A;  2X02 A;  3OPR A;  3BLS A;  3GR2 A;  5EEC A;  1BLP A;  1BUE A;  3MBZ A;  3E2L A;  4DE3 A;  1ESI A;  2EX6 A;  2G2U A;  3WS4 A;  3OPL A;  2WUQ A;  3BFC A;  4JLF A;  4KZA A;  5FQJ A;  4WZ5 A;  1KVL A;  5FI6 A;  1VM1 A;  1ERM A;  2HDU A;  2ZQD A;  4S2K A;  1LI9 A;  5EVI B;  4WMC D;  2IWB A;  4HBU A;  5CEC A;  4P6B A;  3ZG0 A;  2I72 A;  5U47 A;  5GLD A;  3W4Q A;  4X53 A;  4E3O A;  1NYY A;  3SH9 A;  1CI8 A;  2WGV A;  4S2J A;  4S2O A;  5HX9 A;  4E3K A;  4PM5 A;  4KG5 A;  3IWQ A;  2H0Y A;  4GDB A;  5EVI A;  3VFH A;  3PBQ A;  3IF6 B;  2XFS A;  3B3X A;  4QHC A;  1LI0 A;  1PW1 A;  1WYC A;  1KVM A;  4KQR A;  4LV2 A;  4XXR A;  3UE0 A;  3IF5 A;  3UY6 A;  2WKE A;  4ZDX A;  2WZX A;  1ZKJ A;  5CGW A;  4E3M A;  1XKZ A;  1LL5 A;  3M2J A;  3FZC A;  4RX2 A;  3ZG5 A;  2J7V A;  3M6H A;  3IF6 A;  4DDY A;  5EPH A;  1MWR A;  3NCK A;  3MZE A;  2Z2M B;  5F1G A;  5EUA A;  3GQZ A;  3V3R A;  1L0G A;  2JC7 A;  3WS0 A;  5E2G A;  2Z2L B;  4K0W A;  5FSR A;  4E3L A;  1ZC2 A;  3PBS A;  1SDE A;  3CZD A;  3GVB A;  4K91 A;  4S2N A;  4OQI A;  4ZJ2 A;  1W7F A;  5FDH A;  3M6B A;  1FCO A;  3M2K A;  1W5D A;  4QD4 A;  4S2M A;  1BLS A;  2WGW B;  3NDG A;  5HAQ A;  4X6T A;  1MWU A;  4OLG A;  4ZTK A;  2XFT A;  4OH0 A;  3SS5 A;  4OKP A;  4N92 A;  1ES5 A;  3LY4 A;  2G2W A;  1H5X A;  1W8Q A;  1K6R A;  1L2S A;  1K57 C;  5M18 A;  4DF6 A;  4KZ3 A;  2Y2L A;  1DJA A;  4OON A;  3QHY A;  5CHM A;  4OLD A;  3GMW A;  2WGW A;  3P98 A;  5JYO A;  3ZVT A;  5J8X A;  1NYM A;  1XP4 A;  4JF6 A;  1FSW A;  5FI2 A;  1S6R A;  1TEM A;  4A5R A;  1KE4 A;  1M40 A;  2XEP A;  3HLE A;  4MBK A;  5HFO A;  2HDS A;  1IEL A;  4OP5 A;  3PTE A;  3LO7 A;  5CEB A;  1PYY A;  1BT5 A;  3OZH A;  4QY6 A;  4EBP A;  3G35 A;  4Y7P A;  4X55 A;  3MFD A;  2HPB A;  3NI9 A;  5CXW A;  1HVB A;  4EBN A;  1FQG A;  1BLH A;  1L0F A;  3N8R A;  3Q7V A;  3ZVW A;  1YLZ A;  4N1H A;  5DTS A;  4U0T A;  4DXB A;  5GHZ A;  1IYQ A;  3C4O A;  4GOG A;  2ZM2 A;  3HUN A;  4E3I A;  3DWK A;  4Z9Q A;  1KGG A;  3OPP A;  1L0D A;  3N8S A;  4C3Q A;  1MKI A;  1EI5 A;  2BG1 A;  1FCM A;  1Q2P A;  2QPN A;  3Q07 A;  4OOM A;  1SDN A;  1KDS A;  4UA6 A;  4ZJ3 A;  2ZC6 B;  3MKF A;  4RA7 A;  4PMA A;  3UPO A;  4S2P A;  1SCW A;  4C75 A;  3Q81 A;  5FAO A;  1O07 A;  1S0W A;  5HAI A;  3RJU A;  3RXW A;  4R4S A;  4YFM A;  2Y2I A;  3BLM A;  2Q9M A;  3V3S A;  3LCE A;  4L0L A;  1M6K A;  2XLN A;  4IBX A;  3WWX A;  2J8Y A;  3P09 A;  4KEN B;  3PBO A;  3C7V A;  2PU4 A;  1MPL A;  1ONH A;  1TDG A;  3HLC A;  5E2F A;  5F83 A;  1KGE A;  4E3N A;  5CTM A;  3VSL A;  1IYP A;  5HAP A;  2V2F F;  1YT4 A;  1HZO A;  3MXR A;  3NIA A;  4PM7 A;  2JE5 A;  2XD1 A;  4KZB A;  5CHJ A;  3HLW A;  3O87 A;  3S22 A;  4GDN A;  4IVK A;  4KZ8 A;  4WZ5 C;  2ZC4 B;  5E2H A;  2ZQC A;  3C5A A;  1DJB A;  4NET A;  5FA7 A;  4UA9 A;  3WS5 A;  4U0X A;  2ZC7 A;  1O7E A;  5TFQ A;  2ZQ8 A;  1NY0 A;  3G4P A;  1ZG4 A;  2EXB A;  1HD8 A;  2XDM A;  1XGJ A;  2X71 A;  3N4I A;  4E6X A;  2WAF A;  3DTM A;  3BRM A;  1K4E A;  3I7J A;  3UDI A;  4OQ0 A;  5DVA A;  5F1F A;  1AXB A;  3IH9 A;  2H5S A;  1RP5 A;  1JWV A;  4QU3 A;  1E3U A;  2R9X A;  4WMC A;  2WYX A;  4X56 A;  5EVI C;  2WAD A;  5DF9 A;  3VMA A;  1LLB A;  1RCJ A;  2Y55 A;  3MZF A;  4S2I A;  2ZJ9 A;  5AQB A;  1K54 A;  5G18 A;  1PZO A;  4OPR A;  3OCN A;  4QY5 A;  1PWC A;  4N1X A;  3PAG A;  4X69 A;  4LV1 A;  3ITB A;  2EFX A;  5EVL A;  1KE3 A;  2ZQ9 A;  4JPM A;  4LCL A;  1MY8 A;  2V20 A;  4HES A;  1ERQ A;  1EWZ A;  1KGF A;  1PI4 A;  3IF6 C;  3VP1 A;  2C6W B;  3V50 A;  1GHP A;  1WE4 A;  1I2W A;  1K55 A;  1YQS A;  2PU2 A;  4LCM A;  4BD0 A;  3EQV A;  4BQM A;  1IYS A;  5DF7 A;  4R4R A;  3W4P A;  3N8L A;  3ZDJ A;  3C4P A;  2J9P A;  2Q9N A;  1H8Y A;  4K0X A;  5AQA A;  1ZG6 A;  4WM9 A;  1NXY A;  1PIO A;  4KQQ A;  2ZM8 A;  3LY3 A;  1YLP A;  1YMX A;  4PPR A;  3UE3 A;  3HLB A;  4R23 A;  1IKI A;  4BLM A;  1GA0 A;  1W79 A;  3G31 A;  2DNS A;  3Q7Z A;  3VOY A;  5EVI D;  2ZD8 A;  1G6A A;  3BYD A;  3O3V A;  4PM8 A;  1BLC A;  5FQQ A;  5KSH A;  2R9W A;  1YLJ A;  5HAR A;  5M1A A;  1XXM A;  2EX8 A;  3BEC A;  4WYY A;  3SOI A;  3GTC A;  3ZFZ A;  5HL1 A;  4JF5 A;  3SH7 A;  4QJG A;  1MWS A;  1ES4 A;  1N9B A;  2EXA A;  3CJM A;  4LV0 A;  3E2K A;  5CGX A;  1I5Q A;  1XPB A;  3DW0 A;  3HLF A;  3A3I A;  3IHA A;  3IXD A;  3MZD A;  4YIN A;  1QME A;  1CI9 A;  3W8K A;  1Z6F A;  4FH2 A;  1CEF A;  4KZ9 A;  1NRF A;  3IXG A;  4P85 A;  1MWT A;  5BOH A;  1BTL A;  4RYE A;  4U3T A;  1SHV A;  4BL2 A;  2A49 A;  5A93 A;  4KZ6 A;  2VGJ A;  3HLD A;  4B88 A;  5KMW A;  1FCN A;  1N4O A;  1E4D A;  3Q7V B;  2ZMA A;  3BM6 A;  5TGF A;  4BJP A;  2X01 A;  2RCX A;  2WZZ A;  3VP4 A;  3GV9 A;  2XQZ A;  2XH9 A;  1K25 A;  3VP3 A;  3G34 A;  1TVF A;  3IHB A;  5GHX A;  5FAP A;  1QMF A;  4JXW A;  5AQ9 A;  4MEZ A;  4DE2 A;  5L2F A;  5GLC A;  2Y59 A;  5CTN A;  1FR1 A;  1SKF A;  3HUM A;  2ZLY A;  3WRT A;  5FQM A;  3ZNT A;  4DXC A;  3FWL A;  3G2Z A;  4DE1 A;  3GRJ A;  2HDQ A;  1ALQ A;  1LHY A;  1VQQ A;  2Y2O A;  2JCH A;  2WKI A;  4KZ4 A;  4FSF A;  3UNW A;  3FYZ A;  3VFF A;  4N9L A;  5EOE A;  3MKE A;  3UE1 A;  2XR0 A;  1DY6 A;  4C6Y A;  2VGK A;  1H8Z A;  2ZM0 A;  1G68 A;  4PM9 A;  1K56 A;  4IBR A;  2IWD A;  3S1Y A;  3S4X A;  1IYO A;  2Y2G A;  1FR6 A;  1KE0 A; 
#chains in the Genus database with same CATH topology
 4JXG A;  4ETX A;  4Y5F A;  5EM0 A;  3ZNY A;  1XGI A;  3E98 A;  4G3W A;  3QNC A;  3E4P A;  2ZL1 A;  4ARZ B;  3LIA A;  4G3V A;  4BL3 A;  3QNB A;  4JF4 A;  3FG8 A;  3UO9 A;  3C8C A;  1BUL A;  4I5S A;  5FAT A;  4OPY A;  3BFG A;  5E43 A;  3WRZ A;  2JKT I;  1Q2Q A;  5J3W A;  4ZAM A;  3S7N A;  2P9V B;  4R0Q A;  2XA7 M;  4Y17 A;  1K55 C;  2M7V A;  2QJ7 A;  2JKG A;  4JBF A;  2HP9 A;  2O9C A;  3Q1F A;  2GDN A;  3BY9 A;  1VEU A;  1E25 A;  4LGW A;  2WKP A;  2CC1 A;  2GX5 A;  4S2N C;  5FEF A;  2PR5 A;  4ETZ A;  2H10 A;  4GHI A;  2NUT C;  2JHE A;  3H9W A;  3GEC A;  3NOU C;  3WS2 A;  3H82 A;  4KZ5 A;  3ZYT A;  1PI5 A;  3BFE A;  1RGZ A;  2GJ3 A;  3D4F A;  5FAQ A;  2QHK A;  2JKR I;  1U60 A;  2XD5 A;  2HV1 A;  2VJW A;  1SKO A;  3CG5 A;  4GNU A;  3TG9 A;  3VOZ A;  1UWN X;  2J3W A;  2VKS A;  4P87 A;  1Y54 A;  3T1Q B;  4UQI S;  1ES3 A;  5JYP A;  4Y0O A;  2JBF A;  4P6Z M;  2B18 A;  5L07 A;  1KDW A;  1H0M A;  5CED A;  1J9M A;  4FD8 A;  3CUE A;  1LT0 A;  4WZ4 A;  4DDS A;  3IT9 A;  3RXX A;  5A91 A;  4L9E A;  2Z6D A;  4R3J A;  5DFX A;  3T1X A;  1DRM A;  2C5W B;  3C7U A;  2EWV A;  5M19 A;  4RVA A;  1K57 A;  5K5B A;  1S1Y A;  5GLB A;  4WEK A;  4N9K A;  1PZP A;  3V5M A;  3BQ8 A;  3IQA A;  4R70 A;  3ZG8 B;  3VSK A;  2O99 A;  1IKG A;  5A90 A;  2J9O A;  5EOO A;  2PBY A;  4M3K A;  5FI7 A;  5CHU A;  3KO6 A;  3G32 A;  4MLL A;  4X68 A;  4LEN A;  2DCF A;  5HW3 A;  1F98 A;  1GCE A;  1CF0 A;  3S7P A;  5FQK A;  1P97 A;  3NJA A;  3O5Y A;  2DRW A;  3WS1 A;  1PWG A;  1LSV A;  3A3D A;  2CMN A;  2O9A A;  3K2N A;  3OPR A;  3GR2 A;  1BLP A;  3CPT A;  4BBT A;  4DE3 A;  2WUQ A;  3BFC A;  5FI6 A;  1VM1 A;  4S2K A;  2QKP A;  5DJT A;  3W4Q A;  4X53 A;  4ME4 A;  3SH9 A;  1CI8 A;  4Y3I A;  4E3K A;  4PM5 A;  4JGQ A;  2H0Y A;  5EFW A;  3DTE A;  4Q0H A;  1SKO B;  4QHC A;  1LI0 A;  3KSG A;  4EEP A;  1PW1 A;  3UE0 A;  2WKE A;  4E04 A;  5CGW A;  1OTI A;  3M6H A;  4P6Z S;  3OBF A;  3TRC A;  1MWR A;  3B33 A;  1DP9 A;  4LRX C;  3WS0 A;  5FSR A;  3PBS A;  1SDE A;  3CZD A;  3GVB A;  3VE3 A;  5AVF A;  4OQI A;  5TBM B;  1FCO A;  3FC7 A;  3M2K A;  4QD4 A;  4CQH A;  5IS1 A;  4X6T A;  4OLG A;  1W8Q A;  1T1B A;  1K6R A;  5M18 A;  4D60 A;  5KIZ A;  1DJA A;  5L8M A;  3QHY A;  5CHM A;  3GMW A;  2WGW A;  5JYO A;  1N9O A;  1KOU A;  1D06 A;  1TEM A;  4JGR A;  1PYY A;  2HPB A;  1BLH A;  2PHY A;  1NRJ A;  5HPI A;  5GHZ A;  3HUN A;  1KGG A;  3SW1 A;  4C3Q A;  1MKM A;  1F9I A;  1Q2P A;  2QPN A;  3MKF A;  1FIK A;  1SCW A;  4C75 A;  3Q81 A;  4NXE A;  3RFB A;  1S0W A;  3RJU A;  3LR5 A;  2HF6 A;  4YFM A;  3IS2 A;  5HWV A;  1M6K A;  4IBX A;  3P09 A;  5J4E A;  3PBO A;  1KGE A;  3LI9 A;  1TS8 A;  2M1C A;  2V2F F;  5CHJ A;  4GDN A;  4KZ8 A;  3NOP C;  3T4L A;  2ZC4 B;  4EES A;  2ZQC A;  4NET A;  4UA9 A;  1O7E A;  5TFQ A;  4Y2F A;  2ZQ8 A;  3G4P A;  1ZG4 A;  5F6A A;  3N4I A;  4E6X A;  2WAF A;  2PYR A;  3BRM A;  1UGU A;  3UDI A;  1RP5 A;  1E3U A;  3CI6 A;  1G5U A;  1RCJ A;  1XJ6 A;  4QY5 A;  4N1X A;  4X69 A;  5EVL A;  4LCL A;  4JPM A;  4HES A;  1ERQ A;  4I3I A;  4LCM A;  4F3L A;  2D01 A;  3C4P A;  2A2L A;  4K0X A;  1LL8 A;  3T4Q A;  2ZM8 A;  3L9K A;  3KYE A;  1YMX A;  2GZA A;  4BLM A;  1W79 A;  3Q7Z A;  4ESP A;  2HJE A;  3PXP A;  5FQQ A;  3EEH A;  3SOI A;  3ZFZ A;  2P04 A;  4QJG A;  1ES4 A;  3CJM A;  3LR0 A;  4LV0 A;  1I5Q A;  3DW0 A;  3HLF A;  3IHA A;  2W3H A;  4LLO B;  1QME A;  4FH2 A;  1NRF A;  1MWT A;  5BOH A;  4RYE A;  1S4R A;  4U3T A;  4BL2 A;  5A93 A;  3HLD A;  5KMW A;  1E4D A;  4H6J A;  3UE6 A;  2XQZ A;  1K25 A;  4O0P A;  4JXW A;  4DE2 A;  5GLC A;  2Y59 A;  1AWI A;  2J3T D;  4EW7 A;  1FR1 A;  2ZLY A;  1IFQ A;  1NLY A;  3HJK A;  3TW8 A;  3G2Z A;  4B93 A;  4DE1 A;  1ZHH B;  3GRJ A;  1LHY A;  4KZ4 A;  2Y2O A;  2JCH A;  2WKI A;  4FSF A;  3UE1 A;  4HOI A;  4LRY C;  4C6Y A;  1K56 A;  5EM1 A;  2IWD A;  2Y2G A;  2Q0O A;  2Z6C A;  4HI4 A;  1TDL A;  2BAS A;  3IX8 A;  3NEC A;  1YM1 A;  3HL9 A;  1YPR A;  4Y13 A;  1YLT A;  3NC8 A;  4EQ1 A;  4R1G A;  2IA2 A;  2A3U A;  2Y4A A;  2M7U A;  3NBL A;  3PBR A;  1JWZ A;  1K54 C;  3BQA A;  4LRZ E;  1CQA A;  3MXQ A;  1IOU A;  4B4Z A;  1S1Z A;  3SS3 A;  1FOF A;  5EE8 A;  3MXS A;  1L3L A;  4D2O A;  3TE8 A;  3OCL A;  2OSU A;  2EX9 A;  2E8I A;  4EQI A;  2P9V A;  1E3U D;  2Y2N A;  1F5M A;  3TJZ C;  1NZU A;  1DJC A;  4WBG A;  4E3J A;  2WGI A;  1A0K A;  4PM6 A;  3MQ0 A;  3IH8 A;  1EW0 A;  5HWW A;  3FKV A;  5EVE A;  5HPF A;  4M4X A;  1JVJ A;  3HRE A;  3ZCZ A;  4BMW A;  1ERO A;  4KQO A;  1K4F A;  2XF3 A;  5CRF A;  5IHV A;  3DTI A;  4EWF A;  3LGO A;  1RGY A;  2IWC A;  4OP8 A;  4XUZ A;  4XUX A;  5FQI A;  4II7 A;  2W3G A;  3UB7 A;  1HTZ A;  2Y2H A;  2I9V A;  3KSH A;  3HVF A;  4Y0T A;  5F5Y A;  4OPQ A;  1YLW A;  1OPX A;  2V1Z A;  2WK0 A;  4FCF A;  1PWD A;  2VK3 A;  4QWO A;  4S2L A;  3N6I A;  3QP5 A;  3AGD A;  4RX3 A;  5HL6 A;  4F94 A;  4DRT A;  1WYB A;  4GZB A;  2PYP A;  3TOI A;  3LI8 A;  3NDE A;  1XA1 A;  3P7N A;  4HNB A;  4EBL A;  5TR7 A;  3IWI A;  3A3F A;  4UAA A;  3IX3 A;  2BLS A;  2WKH A;  5FEG A;  2W3F A;  3ZHH A;  5MC7 A;  4GCZ A;  4UA7 A;  3F1O B;  3UDF A;  1K56 D;  5D3O A;  4JXS A;  3NY4 A;  3IWO A;  3AGE A;  4KZ7 A;  5DTT A;  4GB7 A;  3VP0 A;  3LID A;  4PAU A;  4CLC A;  5GLA A;  5CGS A;  4I3A A;  3A3J A;  5TJJ A;  3BEB A;  2Y91 A;  3NUL A;  1SZV A;  3PAE A;  3T4S A;  4H8R A;  3T1S A;  4QB8 A;  1G6O A;  3UB8 A;  5EEC A;  1BUE A;  3E4O A;  1GSW A;  4DJ2 A;  4MN6 A;  3OPL A;  4KZA A;  1KVL A;  1JNU A;  5EVI B;  4WMC D;  1D7E A;  5DFY A;  3T1R A;  1TS6 A;  4P6B A;  2I72 A;  5U47 A;  2PAV P;  4S2J A;  4KG5 A;  3PBQ A;  4YNR A;  3IF6 B;  3T12 B;  3B3X A;  4PHT A;  1KVM A;  4KQR A;  4LV2 A;  1BYW A;  1S4S A;  3UY6 A;  1TF1 A;  1ZKJ A;  4E3M A;  1LL5 A;  3M2J A;  3FZC A;  4O01 A;  1Y4O A;  5FDS A;  4R6L A;  2HZ5 A;  3MZE A;  2V1B A;  3GQZ A;  3V3R A;  4R38 A;  4KQD A;  1T19 A;  4K0W A;  4E3L A;  1MC0 A;  5I5L A;  2B02 A;  4S2N A;  3T4O A;  3DBA A;  1MZU A;  3CUE C;  1W7F A;  2ACG A;  1BLS A;  4ZRR A;  3KSI A;  3SS5 A;  4OH0 A;  4N92 A;  5TBM A;  1K57 C;  2PR6 A;  2PRF A;  3P98 A;  1XP4 A;  4JF6 A;  1FSW A;  3F1P A;  1KE4 A;  3F1N B;  3HLE A;  1J3W A;  2VV7 A;  4OP5 A;  3LO7 A;  3LR4 A;  4EER A;  2P08 A;  4EBP A;  3G35 A;  4Y7P A;  1GSV A;  4R3A A;  4EBN A;  4UEY A;  1CJF A;  5DKL A;  3N8R A;  3ZVW A;  1HLU P;  4N1H A;  5DTS A;  2PD8 A;  3C4O A;  3FPW A;  2ZM2 A;  4E3I A;  2PT7 A;  3DWK A;  1L0D A;  2V9A A;  2BG1 A;  1FCM A;  3IX4 A;  3Q07 A;  2LB5 A;  3CAX A;  4UA6 A;  2ZC6 B;  4CLC B;  4S2P A;  2BTF P;  3BW6 A;  5FAO A;  2KLI A;  5HAI A;  2XA7 S;  3BLM A;  2Q9M A;  2OAQ 1;  2NUP C;  2W1T A;  2K7S A;  3HLC A;  5F83 A;  3VSL A;  1YT4 A;  3NIA A;  3MXR A;  4PM7 A;  2XD1 A;  4KUO A;  4FTX A;  1XJ2 A;  1NY0 A;  2A24 B;  1K4E A;  4BBU A;  3KSF A;  4OQ0 A;  4XT2 A;  2H5S A;  4QU3 A;  4GLQ A;  2WYX A;  2Y55 A;  1OTE A;  3B47 A;  3LIB A;  4DJ3 A;  3KYZ A;  3GDI A;  3ITB A;  3KX0 X;  3LIE A;  1KE3 A;  2ZQ9 A;  1PRQ A;  2R78 A;  1EWZ A;  2PU2 A;  1YQS A;  3LUQ A;  1IYS A;  4R4R A;  1YSP A;  3HCY A;  2PBD P;  1H8Y A;  1DP8 A;  3DTK A;  4KQQ A;  3HLB A;  1IKI A;  3T4K A;  1Z09 A;  3EEA A;  2J3T C;  1VB6 A;  2R9W A;  1YLJ A;  1XFQ A;  1XXM A;  2EX8 A;  3CIT A;  3BEC A;  3T4T A;  4LFU A;  4JF5 A;  3E2K A;  5CGX A;  2FH5 A;  1ACF A;  3A3I A;  3F1P B;  2ZMV A;  4Q0I A;  1CEF A;  1SHV A;  4KZ6 A;  4B88 A;  1N4O A;  2ZMA A;  2X01 A;  1Y28 A;  2WZZ A;  3VP4 A;  4NXF A;  2QYB A;  3IHB A;  5FAP A;  5AJG A;  1T1C A;  5AQ9 A;  5L2F A;  1UWP X;  1H3Q A;  3L7H A;  4HP9 A;  2GNX A;  4HQA A;  5FQM A;  3ZNT A;  3VOL A;  3FWL A;  4EET B;  1VQQ A;  3UNW A;  3VMA A;  4N9L A;  5EOE A;  1OTD A;  2W1T B;  3MQO A;  1G68 A;  4IBR A;  3S1Y A;  2W3D A;  1KE0 A;  3AGF A;  1WA9 A;  1K6S A;  3EQU A;  4WEJ A;  2Y79 A;  4DE0 A;  3FKW A;  1JTG A;  3BWL A;  4P0M A;  4XT2 B;  5FL3 A;  4Q0J A;  5HZH A;  5J7E A;  2HDR A;  1GA9 A;  4OPZ A;  2H0T A;  3CMZ A;  3SZT A;  1GHM A;  2Y2M A;  4MNR A;  2EX2 A;  3OLO A;  4YOF A;  4CJN A;  4OQH A;  3ISG A;  5I94 A;  3ITA A;  4GD6 A;  3UDX A;  4CLC E;  5AQ7 A;  3ZGA B;  3S7Q A;  2V8F A;  2VZW A;  4NK3 A;  4EUZ A;  4CPK A;  1NJ4 A;  4NXB A;  4BEN A;  3UB6 A;  2HP5 A;  2B95 A;  4JXV A;  4WUJ A;  3HUO A;  1NZO A;  5EV0 A;  3Q82 A;  2JKF A;  1W63 M;  3O86 A;  5G4Z A;  2OLV A;  2XRN A;  4HH2 A;  1JTD A;  2OOL A;  2OWH A;  2Y8H A;  4FH4 A;  4Y0U A;  2JN7 A;  4ZBE A;  5A92 A;  3N7W A;  3IBR A;  4IVI A;  3MQQ A;  1ESU A;  1CK3 A;  2Y2J A;  3LIF A;  4KUK A;  3PHY A;  5KSC A;  4JKT A;  2HP6 A;  4IED A;  2G7U A;  2UWX A;  2QMI A;  5LBR A;  4MCW A;  3G6O A;  3IXH A;  3T50 A;  5F68 A;  2ZQA A;  1VET B;  2VEA A;  2L1M A;  3K3C A;  2W3E A;  4R3B A;  2Y2K A;  3LIC A;  1BZA A;  3ZG9 B;  2O9B A;  4MBH A;  2QWS A;  4B9O A;  3HJI A;  4OQG A;  2ZQ7 A;  4HBT A;  3HLG A;  2W1R A;  3E0Y A;  2OV5 A;  1XA7 A;  3JPU A;  4BD1 A;  3QP4 A;  1OTB A;  3OC2 A;  3LEZ A;  4MN7 A;  4EU0 A;  3ZQ5 A;  4HP4 A;  2V0U A;  1K0K A;  4GJ4 A;  2UV0 E;  1P0Z A;  3V39 A;  4ID4 A;  1S66 L;  3PBN A;  4DN0 A;  3SS4 A;  4HJ3 A;  5DF8 A;  1W8Y A;  3LFV A;  3F1O A;  2EFU A;  5E2E A;  3TSG A;  2OAP 1;  3BFF A;  1I2S A;  4UHU A;  5FAS A;  4HJ6 A;  4GKU A;  2X02 A;  1OTA A;  3BLS A;  3E2L A;  1ESI A;  2EX6 A;  2G2U A;  3NOT C;  4JLF A;  4EXO A;  4WZ5 A;  2HDU A;  2ZQD A;  3QP2 A;  1LI9 A;  2WKR A;  4HBU A;  4G3K A;  3ZG0 A;  4E3O A;  1NYY A;  3P01 A;  3UB9 A;  4HH3 A;  4S2O A;  5HX9 A;  3IWQ A;  4GDB A;  5EVI A;  4JGP A;  1T18 A;  3VFH A;  2XFS A;  3R7W A;  1WYC A;  2WZX A;  2V8C A;  3ZG5 A;  2J7V A;  2EWW A;  3IF6 A;  1X0O A;  5EPH A;  3NCK A;  3V67 A;  5F1G A;  5EUA A;  5HDD A;  1L0G A;  3C30 A;  3H7W A;  1YKD A;  3VE4 A;  1ZC2 A;  4K91 A;  3M6B A;  2KDK A;  3EWK A;  4S2M A;  3NDG A;  4EUV A;  4ZTK A;  4OKP A;  1ES5 A;  5HWT A;  2XRO A;  2H28 A;  1L2S A;  2Y2L A;  4IUH A;  4OON A;  3ZVT A;  1NYM A;  3MJQ A;  2KOI A;  4NEE D;  4A5R A;  1OJ5 A;  2XEP A;  5HFO A;  2HDS A;  1IEL A;  3PTE A;  3OZH A;  3MSH A;  4X55 A;  3NI9 A;  5IT5 A;  5CXW A;  1HVB A;  1FQG A;  4L9F A;  4MDZ A;  3Q7V A;  3F1N A;  4U0T A;  2ZBB A;  4DXB A;  4UQI M;  1IYQ A;  5L10 A;  4GOG A;  4Z9Q A;  3OOV A;  3OPP A;  1MKI A;  1EI5 A;  4OOM A;  3MFX A;  1SDN A;  3CWF A;  3EOI A;  4ZJ3 A;  1S67 L;  4X1M A;  4PMA A;  3UPO A;  1O07 A;  3RXW A;  4HY8 A;  4EEU A;  3LCE A;  4L0L A;  2XLN A;  1T1A A;  2VX8 A;  3WWX A;  2J8Y A;  2PU4 A;  1MPL A;  1TDG A;  1P9R A;  5CTM A;  1IYP A;  5HAP A;  4YWZ A;  3T4J A;  2K31 A;  2JE5 A;  4KZB A;  3O87 A;  3S22 A;  4IVK A;  2LB9 A;  5E2H A;  3C5A A;  1DJB A;  4WLA A;  2ZC7 A;  3S7O A;  1XGJ A;  2X71 A;  5DVA A;  5F1F A;  2L0W A;  3IH9 A;  2R9X A;  2WAD A;  3RTY A;  3LYX A;  3R7W B;  2ZJ9 A;  3B42 A;  5G18 A;  1PZO A;  2A24 A;  3OCN A;  1FIL A;  3PAG A;  2EFX A;  4WF0 A;  2V20 A;  2C6W B;  3V50 A;  1I2W A;  1K55 A;  3H7W B;  3EQV A;  4HJ4 A;  3W4P A;  2Q9N A;  5AQA A;  4WM9 A;  2YKF A;  3JVV A;  3LY3 A;  4PPR A;  4R23 A;  1GA0 A;  3G31 A;  5EVI D;  3BYD A;  3O3V A;  1BLC A;  5M1A A;  4WYY A;  3GTC A;  2ZOI A;  5HL1 A;  1MWS A;  2EXA A;  1XPB A;  4BBV A;  3MZD A;  4KZ9 A;  3IXG A;  4P85 A;  1BTL A;  2A49 A;  3MF0 A;  2VGJ A;  1STZ A;  3Q7V B;  4Z1W A;  5TGF A;  2JKT M;  3UB5 P;  2RCX A;  3GV9 A;  2XH9 A;  3VP3 A;  4GS9 B;  3G34 A;  1TVF A;  4X1L A;  1QMF A;  4O8G A;  3U2A A;  5CTN A;  3QP6 A;  1H8M A;  5HD3 A;  3HUM A;  3WRT A;  4DXC A;  4IHQ A;  2L4R A;  1TS7 A;  3KYQ A;  2ZOH A;  2HGV A;  1DY6 A;  2OWJ A;  2VGK A;  2ZL1 B;  1FR6 A;  3UE3 A;  5A8B A;  2P7J A;  1MXO A;  2JKR M;  3QP8 A;  2KX6 A;  4OVD A;  3JYI A;  5C5K A;  1BSG A;  3A0S A;  1OT6 A;  3HBR A;  1IEM A;  4FUW A;  2ZC5 B;  1JWP A;  3D72 A;  3MS6 A;  3RH8 B;  2D02 A;  2QJ5 A;  4CLC D;  1OT9 A;  5HDC A;  1K38 A;  2FFY A;  4GN2 A;  2Y2P A;  1OME A;  3W4O A;  4DMZ A;  5F82 A;  3FV7 A;  5DJU A;  1VEU B;  5GHY A;  3VP2 A;  1YAX A;  2VGL M;  5IU1 A;  4GHI B;  2PDR A;  4O7D A;  1MBL A;  5FQ9 A;  5KZH A;  3H82 B;  1LL9 A;  3BJN A;  4BWI A;  3OPH A;  4NKP A;  3BFD A;  4K08 A;  3PYP A;  1G28 A;  1N9N A;  5HD5 A;  3QP1 A;  1YLY A;  2XSS A;  3O88 A;  2HJ9 C;  4Q8I A;  4ZJ1 A;  3LEQ A;  2WAE A;  3ZG7 B;  1V9Z A;  4WEL A;  1GHI A;  3E4Q A;  4MN5 A;  3UN7 A;  1OJG A;  3IXB A;  3PR6 A;  3UPP A;  4KG6 A;  1DP6 A;  1YMS A;  3ICY A;  5HDS A;  1XX2 A;  4GW9 A;  3G2Y A;  4OOY A;  2XGN A;  4B4X A;  2YKH A;  3K3D A;  4I3J A;  3IBJ A;  5DTK A;  1ES2 A;  4IUK A;  4JGO A;  1PW8 A;  2ZC3 B;  3A0V A;  3UMD A;  3EGX C;  1VET A;  2B5R A;  1D1J A;  4E6W A;  3DWZ A;  5GL9 A;  1FSY A;  3A3E A;  4LV3 A;  2P74 A;  1CEG A;  5CER A;  3SH8 A;  3EGD C;  4HEF A;  4OOL A;  1PNE A;  2QZ6 A;  4NG2 A;  4EV4 A;  3G30 A;  2FFF B;  2RL3 A;  3MR0 A;  3UPN A;  2XK1 A;  4X25 A;  1L0E A;  3A0R A;  3MMH A;  4GD8 A;  2PD7 A;  2VGL S;  4KG2 A;  4MBF A;  2Y2Q A;  2V1A A;  1C3B A;  3CPT B;  2WKQ A;  2OLU A;  2AVX A;  3PBT A;  1ONG A;  3GSG A;  5AVE A;  2O0Y A;  3MBZ A;  2V0W A;  3WS4 A;  3W2Z A;  5FQJ A;  1TD5 A;  1ERM A;  2IWB A;  5CEC A;  2VA0 A;  5GLD A;  2WGV A;  2VV6 A;  1N9L A;  3D3O A;  2J80 A;  4XXR A;  3IF5 A;  4ZDX A;  4I38 A;  1W63 Q;  1XKZ A;  4RX2 A;  4DDY A;  2Z2M B;  2JC7 A;  5E2G A;  2Z2L B;  1XJ3 A;  4ZJ2 A;  5FDH A;  3DAV A;  1W5D A;  2WGW B;  1VHM A;  5HAQ A;  4PKY G;  3C38 A;  1MWU A;  3UME A;  2INW A;  2XFT A;  3LY4 A;  2G2W A;  1H5X A;  3LR3 A;  4DF6 A;  4KZ3 A;  3ULF A;  4OLD A;  5J8X A;  5FI2 A;  1S6R A;  1M40 A;  4MBK A;  5CEB A;  3CHW P;  3R4K A;  1BT5 A;  4QY6 A;  3MFD A;  2ZMF A;  3JVU A;  5HSQ A;  1L0F A;  1YLZ A;  4IJG A;  3C2W A;  4L9G A;  3N8S A;  5CX7 A;  3IS2 B;  1KDS A;  3BY8 A;  4RA7 A;  4I39 A;  4R4S A;  2Y2I A;  1YSQ A;  3V3S A;  5DKK A;  3CLO A;  4KEN B;  3C7V A;  4NXG A;  1ONH A;  5E2F A;  4E3N A;  5F69 A;  1PFL A;  1HZO A;  4WL9 A;  1ODV A;  3HLW A;  4WZ5 C;  1NWZ A;  5FA7 A;  3U4L P;  3WS5 A;  4U0X A;  2EXB A;  1HD8 A;  2W27 A;  2XDM A;  1F2K A;  4AFI A;  3DTM A;  4RQ9 A;  3I7J A;  4ARZ A;  1AXB A;  4WMC A;  1JWV A;  4X56 A;  5EVI C;  5DF9 A;  1LLB A;  3MZF A;  4S2I A;  1P9W A;  4F3L B;  5AQB A;  1K54 A;  3FPV A;  4OPR A;  1GSX A;  1PWC A;  4FOF A;  4LPZ A;  4LV1 A;  5L09 A;  1MY8 A;  2VV8 A;  5G4Y A;  1KGF A;  3IF6 C;  1PI4 A;  3VP1 A;  1GHP A;  1WE4 A;  4QPR A;  4BD0 A;  1TS0 A;  1XJ4 A;  4BQM A;  5DF7 A;  3N8L A;  3ZDJ A;  2J9P A;  1ZG6 A;  1NXY A;  1PIO A;  1LSW A;  1YLP A;  2DMW A;  2DNS A;  3VOY A;  2ZD8 A;  1G6A A;  4PM8 A;  5KSH A;  4HIA A;  5HAR A;  4MMN A;  3SH7 A;  1NLZ A;  1N9B A;  4H6J B;  3IXD A;  4YIN A;  1CI9 A;  3D9Y A;  3W8K A;  1Z6F A;  4HHD A;  1XFN A;  1LSX A;  4Y15 A;  1FCN A;  2MJ6 A;  2EA9 A;  4PKY A;  3BM6 A;  4WN5 A;  4BJP A;  3NHQ A;  2E8J A;  5GHX A;  4MEZ A;  3VV4 A;  1SKF A;  2VLG A;  1ZTU A;  4GS9 A;  2HDQ A;  1ALQ A;  4DKI A;  3VFF A;  3FYZ A;  3MKE A;  2XR0 A;  4CLC C;  1H8Z A;  2ZM0 A;  4PM9 A;  2FZ0 A;  2K2N A;  3S4X A;  1IYO A;  2W0N A;  1V9Y A; 
#chains in the Genus database with same CATH homology
 4JXG A;  3AGF A;  1TDL A;  1MXO A;  3ZNY A;  1YM1 A;  1XGI A;  3HL9 A;  4OVD A;  1K6S A;  1YLT A;  3EQU A;  3JYI A;  3NC8 A;  3QNC A;  4WEJ A;  4DE0 A;  3FKW A;  1JTG A;  4R1G A;  1BSG A;  4P0M A;  4BL3 A;  2A3U A;  3QNB A;  2Y4A A;  3NBL A;  2HDR A;  4JF4 A;  3HBR A;  1GA9 A;  3PBR A;  3UO9 A;  1IEM A;  2ZC5 B;  1BUL A;  1JWZ A;  1JWP A;  4OPZ A;  2H0T A;  1K54 C;  5FAT A;  3CMZ A;  1GHM A;  4DKI A;  2Y2M A;  4MNR A;  2EX2 A;  4OPY A;  3BFG A;  3SS3 A;  5E43 A;  4B4Z A;  1K38 A;  2FFY A;  1FOF A;  2Y2P A;  1OME A;  4GN2 A;  4OQH A;  3ISG A;  3W4O A;  3WRZ A;  4CJN A;  1Q2Q A;  3ITA A;  4ZAM A;  5F82 A;  5I94 A;  2P9V B;  4GD6 A;  3FV7 A;  4R0Q A;  1K55 C;  3UDX A;  5EE8 A;  3MXS A;  4D2O A;  5GHY A;  3VP2 A;  4JBF A;  5AQ7 A;  3ZGA B;  2HP9 A;  3OCL A;  3Q1F A;  4NK3 A;  4O7D A;  2GDN A;  1MBL A;  2EX9 A;  2OSU A;  5FQ9 A;  4EUZ A;  2E8I A;  4CPK A;  4EQI A;  5KZH A;  2P9V A;  1NJ4 A;  4BEN A;  2HP5 A;  1E25 A;  1E3U D;  2Y2N A;  1LL9 A;  1DJC A;  1NZU A;  4JXV A;  2CC1 A;  3HUO A;  4WBG A;  4S2N C;  1NZO A;  3OPH A;  4E3J A;  2H10 A;  2WGI A;  4PM6 A;  3BFD A;  3SS4 A;  3Q82 A;  3IH8 A;  3WS2 A;  1YLY A;  3O86 A;  4KZ5 A;  2OLV A;  3O88 A;  1JTD A;  1PI5 A;  3FKV A;  3BFE A;  1RGZ A;  3D4F A;  5FAQ A;  4Q8I A;  4ZJ1 A;  1U60 A;  4FH4 A;  2XD5 A;  4Y0U A;  1JVJ A;  2WAE A;  3ZG7 B;  3HRE A;  4ZBE A;  5A92 A;  3N7W A;  3ZCZ A;  4WEL A;  1ERO A;  3CG5 A;  4IVI A;  4KQO A;  4GNU A;  3TG9 A;  1GHI A;  3VOZ A;  1ESU A;  1CK3 A;  1K4F A;  2Y2J A;  2XF3 A;  5CRF A;  5IHV A;  3UN7 A;  4EWF A;  1RGY A;  2IWC A;  4OP8 A;  5KSC A;  4XUZ A;  4P87 A;  3IXB A;  4XUX A;  5FQI A;  4JKT A;  2HP6 A;  1Y54 A;  3UPP A;  4KG6 A;  1ES3 A;  1HTZ A;  2Y2H A;  4Y0O A;  5JYP A;  2JBF A;  1YMS A;  2UWX A;  4IED A;  2QMI A;  1XX2 A;  3HVF A;  4Y0T A;  4OPQ A;  3G2Y A;  3IXH A;  1KDW A;  4OOY A;  2XGN A;  1YLW A;  2ZQA A;  2V1Z A;  4B4X A;  2WK0 A;  5CED A;  4FCF A;  1J9M A;  4FD8 A;  4R3B A;  2Y2K A;  5DTK A;  4WZ4 A;  1ES2 A;  1PWD A;  4DDS A;  3IT9 A;  4S2L A;  1BZA A;  3ZG9 B;  3RXX A;  1PW8 A;  2ZC3 B;  5A91 A;  3N6I A;  4MBH A;  4R3J A;  2C5W B;  2B5R A;  3C7U A;  5M19 A;  3AGD A;  4RVA A;  1K57 A;  4OQG A;  4RX3 A;  5GLB A;  4E6W A;  3DWZ A;  2ZQ7 A;  4HBT A;  4WEK A;  4N9K A;  1PZP A;  5GL9 A;  3V5M A;  1FSY A;  3HLG A;  3IQA A;  4DRT A;  4F94 A;  3A3E A;  4LV3 A;  2P74 A;  1WYB A;  1CEG A;  4GZB A;  3ZG8 B;  2OV5 A;  3TOI A;  3VSK A;  1XA7 A;  4BD1 A;  1IKG A;  5CER A;  5A90 A;  3NDE A;  2J9O A;  1XA1 A;  5EOO A;  3OC2 A;  3LEZ A;  2PBY A;  4M3K A;  5FI7 A;  5CHU A;  4EBL A;  3SH8 A;  5TR7 A;  3IWI A;  3A3F A;  4UAA A;  4HEF A;  2BLS A;  2WKH A;  4OOL A;  3G32 A;  4MLL A;  4X68 A;  3ZHH A;  4LEN A;  4UA7 A;  2QZ6 A;  3UDF A;  2DCF A;  1K56 D;  5D3O A;  4JXS A;  5HW3 A;  3V39 A;  3NY4 A;  4ID4 A;  4EV4 A;  3G30 A;  2FFF B;  2RL3 A;  1GCE A;  3AGE A;  3IWO A;  3PBN A;  2XK1 A;  4GB7 A;  4KZ7 A;  1L0E A;  5DF8 A;  5DTT A;  3UPN A;  4GD8 A;  1W8Y A;  3VP0 A;  4KG2 A;  4MBF A;  5FQK A;  5GLA A;  5CGS A;  2Y2Q A;  1C3B A;  3A3J A;  2EFU A;  5E2E A;  2OLU A;  3TSG A;  3BEB A;  2Y91 A;  3BFF A;  3PAE A;  3PBT A;  2DRW A;  3WS1 A;  1I2S A;  4UHU A;  5FAS A;  1PWG A;  3A3D A;  4H8R A;  1ONG A;  3GSG A;  4GKU A;  4QB8 A;  2X02 A;  3OPR A;  3BLS A;  3GR2 A;  5EEC A;  1BLP A;  1BUE A;  3MBZ A;  3E2L A;  4DE3 A;  1ESI A;  2EX6 A;  2G2U A;  3WS4 A;  3OPL A;  2WUQ A;  3BFC A;  4JLF A;  4KZA A;  5FQJ A;  4WZ5 A;  1KVL A;  5FI6 A;  1VM1 A;  1ERM A;  2HDU A;  2ZQD A;  4S2K A;  1LI9 A;  5EVI B;  4WMC D;  2IWB A;  4HBU A;  5CEC A;  4P6B A;  3ZG0 A;  2I72 A;  5U47 A;  5GLD A;  3W4Q A;  4X53 A;  4E3O A;  1NYY A;  3SH9 A;  1CI8 A;  2WGV A;  4S2J A;  4S2O A;  5HX9 A;  4E3K A;  4PM5 A;  4KG5 A;  3IWQ A;  2H0Y A;  4GDB A;  5EVI A;  3VFH A;  3PBQ A;  3IF6 B;  2XFS A;  3B3X A;  4QHC A;  1LI0 A;  1PW1 A;  1WYC A;  1KVM A;  4KQR A;  4LV2 A;  4XXR A;  3UE0 A;  3IF5 A;  3UY6 A;  2WKE A;  4ZDX A;  2WZX A;  1ZKJ A;  5CGW A;  4E3M A;  1XKZ A;  1LL5 A;  3M2J A;  3FZC A;  4RX2 A;  3ZG5 A;  2J7V A;  3M6H A;  3IF6 A;  4DDY A;  5EPH A;  1MWR A;  3NCK A;  3MZE A;  2Z2M B;  5F1G A;  5EUA A;  3GQZ A;  3V3R A;  1L0G A;  2JC7 A;  3WS0 A;  5E2G A;  2Z2L B;  4K0W A;  5FSR A;  4E3L A;  1ZC2 A;  3PBS A;  1SDE A;  3CZD A;  3GVB A;  4K91 A;  4S2N A;  4OQI A;  4ZJ2 A;  1W7F A;  5FDH A;  3M6B A;  1FCO A;  3M2K A;  1W5D A;  4QD4 A;  4S2M A;  1BLS A;  2WGW B;  3NDG A;  5HAQ A;  4X6T A;  1MWU A;  4OLG A;  4ZTK A;  2XFT A;  4OH0 A;  3SS5 A;  4OKP A;  4N92 A;  1ES5 A;  3LY4 A;  2G2W A;  1H5X A;  1W8Q A;  1K6R A;  1L2S A;  1K57 C;  5M18 A;  4DF6 A;  4KZ3 A;  2Y2L A;  1DJA A;  4OON A;  3QHY A;  5CHM A;  4OLD A;  3GMW A;  2WGW A;  3P98 A;  5JYO A;  3ZVT A;  5J8X A;  1NYM A;  1XP4 A;  4JF6 A;  1FSW A;  5FI2 A;  1S6R A;  1TEM A;  4A5R A;  1KE4 A;  1M40 A;  2XEP A;  3HLE A;  4MBK A;  5HFO A;  2HDS A;  1IEL A;  4OP5 A;  3PTE A;  3LO7 A;  5CEB A;  1PYY A;  1BT5 A;  3OZH A;  4QY6 A;  4EBP A;  3G35 A;  4Y7P A;  4X55 A;  3MFD A;  2HPB A;  3NI9 A;  5CXW A;  1HVB A;  4EBN A;  1FQG A;  1BLH A;  1L0F A;  3N8R A;  3Q7V A;  3ZVW A;  1YLZ A;  4N1H A;  5DTS A;  4U0T A;  4DXB A;  5GHZ A;  1IYQ A;  3C4O A;  4GOG A;  2ZM2 A;  3HUN A;  4E3I A;  3DWK A;  4Z9Q A;  1KGG A;  3OPP A;  1L0D A;  3N8S A;  4C3Q A;  1MKI A;  1EI5 A;  2BG1 A;  1FCM A;  1Q2P A;  2QPN A;  3Q07 A;  4OOM A;  1SDN A;  1KDS A;  4UA6 A;  4ZJ3 A;  2ZC6 B;  3MKF A;  4RA7 A;  4PMA A;  3UPO A;  4S2P A;  1SCW A;  4C75 A;  3Q81 A;  5FAO A;  1O07 A;  1S0W A;  5HAI A;  3RJU A;  3RXW A;  4R4S A;  4YFM A;  2Y2I A;  3BLM A;  2Q9M A;  3V3S A;  3LCE A;  4L0L A;  1M6K A;  2XLN A;  4IBX A;  3WWX A;  2J8Y A;  3P09 A;  4KEN B;  3PBO A;  3C7V A;  2PU4 A;  1MPL A;  1ONH A;  1TDG A;  3HLC A;  5E2F A;  5F83 A;  1KGE A;  4E3N A;  5CTM A;  3VSL A;  1IYP A;  5HAP A;  2V2F F;  1YT4 A;  1HZO A;  3MXR A;  3NIA A;  4PM7 A;  2JE5 A;  2XD1 A;  4KZB A;  5CHJ A;  3HLW A;  3O87 A;  3S22 A;  4GDN A;  4IVK A;  4KZ8 A;  4WZ5 C;  2ZC4 B;  5E2H A;  2ZQC A;  3C5A A;  1DJB A;  4NET A;  5FA7 A;  4UA9 A;  3WS5 A;  4U0X A;  2ZC7 A;  1O7E A;  5TFQ A;  2ZQ8 A;  1NY0 A;  3G4P A;  1ZG4 A;  2EXB A;  1HD8 A;  2XDM A;  1XGJ A;  2X71 A;  3N4I A;  4E6X A;  2WAF A;  3DTM A;  3BRM A;  1K4E A;  3I7J A;  3UDI A;  4OQ0 A;  5DVA A;  5F1F A;  1AXB A;  3IH9 A;  2H5S A;  1RP5 A;  1JWV A;  4QU3 A;  1E3U A;  2R9X A;  4WMC A;  2WYX A;  4X56 A;  5EVI C;  2WAD A;  5DF9 A;  3VMA A;  1LLB A;  1RCJ A;  2Y55 A;  3MZF A;  4S2I A;  2ZJ9 A;  5AQB A;  1K54 A;  5G18 A;  1PZO A;  4OPR A;  3OCN A;  4QY5 A;  1PWC A;  4N1X A;  3PAG A;  4X69 A;  4LV1 A;  3ITB A;  2EFX A;  5EVL A;  1KE3 A;  2ZQ9 A;  4JPM A;  4LCL A;  1MY8 A;  2V20 A;  4HES A;  1ERQ A;  1EWZ A;  1KGF A;  1PI4 A;  3IF6 C;  3VP1 A;  2C6W B;  3V50 A;  1GHP A;  1WE4 A;  1I2W A;  1K55 A;  1YQS A;  2PU2 A;  4LCM A;  4BD0 A;  3EQV A;  4BQM A;  1IYS A;  5DF7 A;  4R4R A;  3W4P A;  3N8L A;  3ZDJ A;  3C4P A;  2J9P A;  2Q9N A;  1H8Y A;  4K0X A;  5AQA A;  1ZG6 A;  4WM9 A;  1NXY A;  1PIO A;  4KQQ A;  2ZM8 A;  3LY3 A;  1YLP A;  1YMX A;  4PPR A;  3UE3 A;  3HLB A;  4R23 A;  1IKI A;  4BLM A;  1GA0 A;  1W79 A;  3G31 A;  2DNS A;  3Q7Z A;  3VOY A;  5EVI D;  2ZD8 A;  1G6A A;  3BYD A;  3O3V A;  4PM8 A;  1BLC A;  5FQQ A;  5KSH A;  2R9W A;  1YLJ A;  5HAR A;  5M1A A;  1XXM A;  2EX8 A;  3BEC A;  4WYY A;  3SOI A;  3GTC A;  3ZFZ A;  5HL1 A;  4JF5 A;  3SH7 A;  4QJG A;  1MWS A;  1ES4 A;  1N9B A;  2EXA A;  3CJM A;  4LV0 A;  3E2K A;  5CGX A;  1I5Q A;  1XPB A;  3DW0 A;  3HLF A;  3A3I A;  3IHA A;  3IXD A;  3MZD A;  4YIN A;  1QME A;  1CI9 A;  3W8K A;  1Z6F A;  4FH2 A;  1CEF A;  4KZ9 A;  1NRF A;  3IXG A;  4P85 A;  1MWT A;  5BOH A;  1BTL A;  4RYE A;  4U3T A;  1SHV A;  4BL2 A;  2A49 A;  5A93 A;  4KZ6 A;  2VGJ A;  3HLD A;  4B88 A;  5KMW A;  1FCN A;  1N4O A;  1E4D A;  3Q7V B;  2ZMA A;  3BM6 A;  5TGF A;  4BJP A;  2X01 A;  2RCX A;  2WZZ A;  3VP4 A;  3GV9 A;  2XQZ A;  2XH9 A;  1K25 A;  3VP3 A;  3G34 A;  1TVF A;  3IHB A;  5GHX A;  5FAP A;  1QMF A;  4JXW A;  5AQ9 A;  4MEZ A;  4DE2 A;  5L2F A;  5GLC A;  2Y59 A;  5CTN A;  1FR1 A;  1SKF A;  3HUM A;  2ZLY A;  3WRT A;  5FQM A;  3ZNT A;  4DXC A;  3FWL A;  3G2Z A;  4DE1 A;  3GRJ A;  2HDQ A;  1ALQ A;  1LHY A;  1VQQ A;  2Y2O A;  2JCH A;  2WKI A;  4KZ4 A;  4FSF A;  3UNW A;  3FYZ A;  3VFF A;  4N9L A;  5EOE A;  3MKE A;  3UE1 A;  2XR0 A;  1DY6 A;  4C6Y A;  2VGK A;  1H8Z A;  2ZM0 A;  1G68 A;  4PM9 A;  1K56 A;  4IBR A;  2IWD A;  3S1Y A;  3S4X A;  1IYO A;  2Y2G A;  1FR6 A;  1KE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...