2X71A

Structural basis for the interaction of lactivicins with serine beta- lactamases
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structural Basis for the Interaction of Lactivicins with Serine Beta-Lactamases.
pubmed doi rcsb
molecule tags Hydrolase/antibiotic
total genus 88
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2x71A00
2R9XA 4OPRA 3IHAA 4S2JA 2RCXA 1PW1A 5F82A 3TOIA 1QMEA 1ONHA 4E3LA 4B4XA 2JC7A 1CI8A 1YLWA 1E3UA 3HLEA 5TFQA 3HUOA 4RX3A 1S6RA 4YINA 1PZOA 3FZCA 4RX2A 3WWXA 2EXAA 4LV0A 3ZG5A 1S0WA 1GCEA 4UAAA 1MY8A 5E2EA 2J7VA 5FQ9A 3VP2A 2JBFA 5G18A 4ZJ2A 3GQZA 5E2HA 4H8RA 4DE1A 1TVFA 2HP5A 1K55C 3IH8A 5DTKA 1G68A 4KG5A 2WGIA 3VOZA 3AGEA 2Y2JA 5CGWA 2DCFA 4GKUA 2Q9NA 2WKHA 3FV7A 4JXGA 4R23A 5HX9A 4Y0TA 2Y2IA 1RP5A 3M6HA 4NK3A 2HDUA 5EE8A 2EX8A 3VP0A 3IT9A 3O3VA 4X56A 3UE3A 1KDWA 4IVIA 4PPRA 4UA7A 5DTSA 3W4QA 2WGWB 3OCNA 4MBHA 1IYOA 3E2LA 2ZQDA 4OOMA 1U60A 4GNUA 5TR7A 1E3UD 4HEFA 4ZTKA 5HAQA 4Q8IA 4QU3A 5GHXA 2P9VA 3HBRA 1DJCA 2ZC5B 1VQQA 5EOOA 5HL1A 4OLDA 5GLCA 1KVMA 1YMXA 2Y2LA 1E4DA 1NY0A 4OPZA 2P74A 1DY6A 1J9MA 4P87A 2HDQA 1W79A 1XGIA 5KSHA 4U3TA 3HLCA 3SOIA 3IH9A 4BL3A 2XEPA 5E2FA 5EVIB 1NXYA 3PBRA 3FWLA 3ZVWA 4R1GA 1QMFA 4F94A 1XA1A 4FH2A 4E3IA 4P0MA 1XGJA 3MXSA 4E3JA 2J9OA 2R9WA 4X68A 1M40A 4S2PA 1NJ4A 2EFXA 4K91A 1EROA 5FI2A 1FSWA 2WKEA 3BRMA 3PBOA 4S2NA 5JYOA 2C6WB 2EX6A 4IBXA 4QY6A 3NI9A 5EVIC 3UDIA 4S2KA 1XP4A 2H10A 1O7EA 3IXGA 4RYEA 2HPBA 3IF6B 4KQRA 3ISGA 4BD0A 3DWKA 2WZXA 1PIOA 4JPMA 2OSUA 4ZDXA 3GRJA 3SH7A 3BFDA 3O86A 1YMSA 1IELA 1CI9A 2UWXA 4GDNA 2XDMA 4OP5A 3N4IA 3SS4A 4O7DA 5GHYA 1PZPA 2I72A 1K25A 3LCEA 3G4PA 4BENA 2Y59A 5DF8A 3IF6C 4EUZA 2A49A 4OQ0A 3BFFA 1PWCA 2WGVA 2FFFB 3N7WA 4KG6A 4OVDA 5A92A 3VP1A 3PBQA 3G30A 3E2KA 4KQQA 3P09A 1OMEA 3ZNTA 1IEMA 1HVBA 2PBYA 4S2LA 3MZDA 1IKGA 3VFHA 1Q2PA 5HW3A 4OONA 2WADA 4OQIA 3SS5A 3RJUA 3PBSA 2GDNA 3Q82A 5FSRA 4MBKA 3LO7A 4A5RA 2HP6A 4Y0OA 3FKVA 3GV9A 2QZ6A 4WZ5A 2WKIA 3VP4A 1K56A 4MEZA 3BFGA 5TGFA 2OV5A 4DE0A 4MBFA 2C5WB 1PYYA 1ZG6A 4OOLA 4OPQA 4B88A 3VP3A 2Y2HA 4HESA 4RVAA 2ZQCA 4KZ4A 3HUMA 3C5AA 1N9BA 2ZQ8A 4R4SA 3W8KA 3IXHA 1RGYA 1SCWA 2H0YA 1JTGA 3M2JA 4B4ZA 4IBRA 3HLBA 1KE0A 3LEZA 4S2MA 1JWPA 4OOYA 4X6TA 5DF9A 3BLMA 2Q9MA 5CRFA 3G32A 3Q07A 3TSGA 3ZDJA 5J8XA 3UY6A 4DXBA 2ZC4B 2HP9A 4KENB 4P6BA 1BSGA 3V3SA 4L0LA 3TG9A 5F1FA 3VOYA 4WYYA 2A3UA 5EECA 1MWRA 5KMWA 1ALQA 2XD5A 3GR2A 3GTCA 3CG5A 1K56D 1AXBA 2BLSA 3GSGA 4S2OA 4OKPA 4DKIA 4OQGA 2Y2MA 1K54A 3AGFA 4DF6A 3BEBA 4DRTA 3OPLA 3IF5A 3WS5A 3UO9A 4BD1A 1SHVA 3GMWA 2PU2A 2H5SA 3OCLA 1W5DA 3B3XA 3Q7VA 2B5RA 5U47A 1ES3A 2DRWA 3V5MA 3ZVTA 1K4FA 4JF5A 4E3OA 1BLHA 4JF4A 2VGKA 2ZM0A 3BM6A 1MXOA 4PM6A 4PM5A 1O07A 1FQGA 1L0DA 1ES4A 4N9LA 1MPLA 1TEMA 4R3JA 1ESIA 1XPBA 3MFDA 1K6SA 3N8SA 1JWVA 2JCHA 5FASA 5FATA 2XFTA 1FOFA 3VFFA 3WS0A 1TDLA 3UDFA 3ZG9B 3HUNA 4KZAA 3SS3A 3IWQA 2WZZA 4WM9A 5FA7A 1BUEA 1HTZA 1SKFA 3C7UA 3RXXA 2EXBA 1K57C 2IWCA 3ZG8B 4OQHA 4JF6A 3MZFA 4LCMA 3MKFA 1WYCA 5CGSA 2QPNA 3NDEA 4JKTA 2XFSA 2ZQAA 3ZHHA 4LENA 4XXRA 3FKWA 2ZLYA 3RXWA 4LV1A 5A90A 4HBTA 1K55A 2WAFA 3NDGA 5F1GA 4C3QA 5M19A 4X55A 5BOHA 1IKIA 4CPKA 1W8QA 4P85A 4QHCA 3PAEA 4QB8A 3G2ZA 3NCKA 3HLDA 4K0WA 4EBNA 4C75A 2JE5A 3IXDA 4N9KA 5AQAA 3V39A 4MNRA 3PTEA 1NZUA 4OPYA 5D3OA 5FAOA 1CEFA 3VSLA 4DE2A 1C3BA 4EQIA 2X02A 3A3FA 3Q81A 1MWTA 2BG1A 1ZG4A 2DNSA 2WAEA 4WZ5C 5FDHA 3I7JA 4LCLA 4LV2A 4XUXA 3EQVA 3S4XA 5CEBA 4U0XA 5HARA 1ES2A 2EFUA 4OP8A 1NYYA 3WS2A 3QNBA 4DDSA 3ZNYA 5FI7A 2J9PA 4NETA 3OPRA 2IWBA 3G34A 1RCJA 2ZC7A 4IEDA 1LLBA 3A3JA 5FQMA 3UPPA 4UA6A 4UHUA 3D4FA 1KGEA 4GZBA 1PWGA 2ZC3B 3PBNA 3O87A 4KZBA 4R3BA 5CECA 3NBLA 2ZQ9A 3IHBA 3WRZA 3MZEA 3EQUA 4ZJ3A 4DE3A 4DDYA 1H8YA 2HDSA 2ZQ7A 2OLVA 2V20A 4IVKA 5FQQA 4E6WA 4GB7A 4UA9A 1YM1A 1ERMA 1MWUA 4D2OA 5I94A 2WUQA 4X53A 4N1HA 4ZAMA 4C6YA 1H5XA 1SDNA 5FAQA 5CHJA 1WYBA 1NYMA 2PU4A 3HVFA 1LL5A 2P9VB 3UDXA 3N8LA 4E3MA 3O88A 1GHIA 3ITAA 1RGZA 1I2SA 1CEGA 4DXCA 2H0TA 5CTNA 3C4OA 1PI4A 2E8IA 2CC1A 3UPNA 2WYXA 4N92A 1JWZA 3V3RA 5KZHA 3OZHA 4OLGA 3OC2A 5E43A 4KZ5A 2Y2OA 4HBUA 4EWFA 5GLDA 3FYZA 3HL9A 2V2FF 1LI9A 1BLPA 1KVLA 3DTMA 3IQAA 3HLGA 5E2GA 1L0EA 3LY3A 4E3NA 4LV3A 3CMZA 1TDGA 2VGJA 2ZD8A 4PM7A 3VMAA 4FD8A 3HREA 3UE1A 4FH4A 3SH8A 1YLJA 5CEDA 1W7FA 3CJMA 2ZJ9A 3N6IA 3P98A 3PAGA 4WZ4A 5M1AA 4R4RA 3DW0A 3QHYA 5CHMA 4KZ3A 3UE0A 4WELA 1KE3A 1SDEA 3WS1A 3GVBA 4JXWA 1FR6A 3A3EA 3G35A 1I5QA 4ZJ1A 4U0TA 4KZ8A 4E3KA 3HLFA 1EI5A 2Y2GA 2XQZA 1WE4A 2Y2NA 4XUZA 4QJGA 1N4OA 1PI5A 1BT5A 1HD8A 2EX2A 3BLSA 3LY4A 4S2IA 3BFEA 2Y55A 3BECA 4WMCA 3IWIA 1H8ZA 1Y54A 4JXVA 4E6XA 5A93A 1YLTA 2Y2QA 3Q1FA 4MLLA 4GOGA 1VM1A 1YLYA 2J8YA 2Y2KA 1HZOA 1W8YA 2WK0A 2IWDA 4FCFA 4S2NC 3ZCZA 5EVLA 3ITBA 5FI6A 3WRTA 2OLUA 1ES5A 3Q7ZA 3IWOA 1YLPA 4Y0UA 3IXBA 5JYPA 1LHYA 4BJPA 4CJNA 5HAIA 3WS4A 2XF3A 5EPHA 3BYDA 4FSFA 3CZDA 1YT4A 1XKZA 3N8RA 3PBTA 5IHVA 1I2WA 4QY5A 1IYSA 3S1YA 1Q2QA 1XA7A 1GHMA 3M2KA 2G2UA 1K6RA 5CERA 4BL2A 2XLNA 1XXMA 1IYQA 4GDBA 1NZOA 1FR1A 2XD1A 1XX2A 1YQSA 3JYIA 4K0XA 4KZ7A 3SH9A 3ZG7B 3OPPA 1EWZA 1JVJA 1MWSA 1GA0A 3HLWA 2RL3A 3OPHA 5F83A 4WMCD 3C7VA 4GN2A 4RA7A 2Y4AA 3BFCA 3V50A 1PWDA 1L0GA 3MXRA 1DJBA 4EBPA 4R0QA 4EV4A 2V1ZA 1JTDA 2G2WA 3ZGAB 5CHUA 3UNWA 2XK1A 1K4EA 5AQBA 2XGNA 2XR0A 4Y7PA 5GHZA 1LI0A 3M6BA 3MBZA 2FFYA 1MBLA 4GD8A 4Z9QA 4JBFA 5CGXA 3NIAA 5EOEA 2ZC6B 4BLMA 4OH0A 3S22A 1NRFA 1KDSA 5FQIA 1KE4A 4KZ6A 2WGWA 4X69A 2ZMAA 2X01A 1KGFA 1BULA 3G31A 1LL9A 2EX9A 1ZKJA 5M18A 5GLBA 3W4OA 4JLFA 3A3IA 1K57A 3UN7A 5GLAA 2ZM8A 2Y91A 5CXWA 3A3DA 3NC8A 4N1XA 4KQOA 4KG2A 3ZG0A 4GD6A 3UPOA 3DWZA 5AQ7A 4PM9A 1BTLA 4QD4A 1L2SA 5FQKA 1L0FA 3Q7VB 3QNCA 4WEJA 5EVIA 5CTMA 1GA9A 3VSKA 4WBGA 1DJAA 1MKIA 5AQ9A 2Z2LB 4M3KA 5DTTA 1ONGA 2ZM2A 4YFMA 4EBLA 1FSYA 1K38A 1KGGA 1M6KA 1ZC2A 1K54C 5DF7A 3C4PA 3G2YA 4BQMA 1IYPA 1ERQA 3W4PA 1GHPA 3AGDA 1G6AA 2X71A 1BLSA 5GL9A 1PW8A 4WEKA 5HFOA 3ZFZA 2Y2PA 3NY4A 4ID4A 2HDRA 4KZ9A 1FCOA 5L2FA 1YLZA 1Z6FA 2QMIA 4JXSA 3IF6A 2Z2MB 5DVAA 5HAPA 5A91A 1FCMA 5FQJA 1CK3A 5KSCA 4ZBEA 3MKEA 1FCNA 4PM8A 1BZAA 1ESUA 1BLCA 5FAPA 4PMAA 5EUAA 2XH9A 5EVID 1E25A
chains in the Genus database with same CATH superfamily
1P0ZA 3TOIA 4E3LA 2JC7A 3HLEA 1E3UA 3ZQ5A 4F3LA 4Q0HA 3G6OA 4LV0A 4PKYA 4O8GA 4Q0IA 3R4KA 4DE1A 4AFIA 3U2AA 1TS7A 5G4ZA 2WGIA 3VOZA 2ZOIA 5CGWA 3FV7A 4R23A 1XJ2A 3M6HA 3O3VA 4PPRA 2ZL1A 4LRXC 5DTSA 3IBJA 2QYBA 3E2LA 4OOMA 4GNUA 1E3UD 3LI8A 2GJ3A 5HAQA 5HWVA 3CPTB 4OLDA 3RFBA 5GLCA 1KVMA 4EUVA 2Y2LA 1LL8A 2P74A 1DY6A 3NECA 1W79A 4G3VA 3SOIA 3IH9A 1H0MA 3ZVWA 4R1GA 4CLCC 2PR5A 4ETXA 2R9WA 4BBVA 4L9FA 4I38A 1EROA 4QY6A 2EX6A 4O01A 1OPXA 2JKGA 4IHQA 3IF6B 4BD0A 3DWKA 1LSVA 1PIOA 2WZXA 4JPMA 2OSUA 5DFYA 2MJ6A 3U4LP 1IELA 1CI9A 4II7A 3BW6A 2PD7A 3V67A 2Y59A 5DF8A 3LR5A 2A49A 1Y28A 2FFFB 3S7PA 3FPWA 3G30A 1OMEA 4HJ3A 2PBYA 2HV1A 4S2LA 5HW3A 2J3WA 4DN0A 3RJUA 3CUEC 4A5RA 4Y0OA 5TGFA 4DE0A 4G3WA 4EESA 4HESA 4JGRA 3HUMA 3C5AA 1RGYA 2FZ0A 4B4ZA 3LEZA 1KE0A 1JWPA 4EERA 1S67L 2OAQ1 3T4OA 3BLMA 2Q9MA 3TSGA 2HP9A 4KENB 4P6BA 3VOYA 5EECA 4PHTA 1ALQA 3CG5A 3EEHA 4L9EA 4OQGA 2PYRA 3AGFA 4DF6A 4BBUA 1SHVA 3GMWA 3CLOA 3BY8A 3OCLA 1W5DA 2B5RA 1K4FA 4JF5A 1MZUA 3T4LA 4PM6A 1L0DA 1TEMA 2OOLA 2DMWA 4R3JA 4Y5FA 1XPBA 1ODVA 5L8MA 5FASA 3F1PB 2P7JA 1ACFA 1TDLA 3FG8A 3ZG9B 3IWQA 2PYPA 2W0NA 3ZG8B 1PRQA 4HH2A 4JF6A 2UV0E 3F1OB 4WL9A 4LENA 4XXRA 5A90A 2V0UA 4C3QA 3NDGA 4HH3A 4X55A 4CPKA 4QHCA 3PAEA 1OTIA 3HLDA 4EBNA 2JE5A 5AQAA 3V39A 5IT5A 1V9YA 1NZUA 1P97A 4OPYA 5D3OA 5FL3A 3VSLA 4DE2A 1C3BA 4Y3IA 2QJ5A 1YSPA 1OTEA 2DNSA 4WZ5C 5FDHA 4UEYA 4XUXA 3S4XA 1NLZA 3WS2A 2J9PA 2IWBA 2JKRI 1AWIA 2ZC7A 3A3JA 3P01A 1F2KA 3UPPA 1L3LA 4UA6A 4UHUA 4GZBA 3R7WA 2K7SA 1CF0A 3O87A 4ZJ3A 3EQUA 1H8YA 2HDSA 2ZQ7A 3MQOA 1WA9A 4GB7A 4EU0A 4D2OA 1VEUB 4KQDA 4YNRA 1VETA 1SDNA 1PFLA 5A8BA 1GHIA 1RGZA 1N9OA 2O9AA 4B9OA 4LRYC 2Y2OA 1S66L 4HBUA 4EEPA 1IFQA 4E3NA 3CMZA 1TDGA 3IBRA 4FH4A 3SH8A 4WZ4A 3QHYA 5CHMA 3SZTA 3WS1A 5J4EA 1FR6A 2W1RA 3G35A 1I5QA 3MR0A 4ZJ1A 4U0TA 4ETZA 1EI5A 2Y2NA 1HD8A 4S2IA 3LY4A 3BECA 3IWIA 2Y2QA 4MLLA 1VM1A 2J8YA 3CWFA 4S2NC 5HPIA 2IWDA 2QHKA 3ZCZA 1D1JA 5CX7A 3Q7ZA 3BQAA 4WF0A 2V0WA 3WS4A 3S7OA 3PBTA 1I2WA 1IYSA 3S1YA 4X25A 4P6ZM 1K6RA 2XLNA 1FR1A 4GHIB 4K0XA 3FPVA 3SH9A 1G28A 1EWZA 1JVJA 2Y4AA 3V50A 1PWDA 1L0GA 4EBPA 4EV4A 3JVVA 3UNWA 4WLAA 5FEFA 3LR0A 5AQBA 2XGNA 2XR0A 3MBZA 4GD8A 2ZC6B 4R38A 3H7WA 4OH0A 1KDSA 1UWPX 2ZMAA 5MC7A 5L09A 3OBFA 1LL9A 2A24B 5M18A 3HCYA 4JLFA 1K57A 3UN7A 2Y91A 3A3DA 4KG2A 3ZG0A 4NEED 5HWTA 4QD4A 5FQKA 3Q7VB 2R78A 3LIFA 5EVIA 5CTMA 1GA9A 4WBGA 1TS0A 4ARZB 3G2YA 4BQMA 2GZAA 1GHPA 3NHQA 5GL9A 2EA9A 4HQAA 3NJAA 3IS2B 4KZ9A 1GSXA 1G5UA 2QMIA 4JXSA 2Z2MB 5A91A 1FCMA 3MKEA 1P9RA 5EUAA 5EVID 1E25A 2R9XA 4S2JA 3IHAA 2RCXA 1PW1A 5F82A 1ONHA 1CI8A 1YLWA 3EWKA 4RX3A 5L07A 5FEGA 4RX2A 2HGVA 5J3WA 2EXAA 3ZG5A 5E2EA 4UQIS 1NRJA 3QP2A 1TVFA 1K55C 2ZBBA 4KG5A 3AGEA 3NOTC 4GKUA 2WKHA 3EEAA 2HDUA 3IT9A 2D02A 3RTYA 4GCZA 3W4QA 2M1CA 2WGWB 3OCNA 3LIAA 4HEFA 4ZRRA 4ZTKA 2PHYA 2ZC5B 5HL1A 1E4DA 4OPZA 1J9MA 3OOVA 1DRMA 2VV8A 4U3TA 4IJGA 3QP4A 1QMFA 5KIZA 4GLQA 4FH2A 2J80A 4E3JA 2J9OA 3KSHA 2JN7A 4GS9B 3KX0X 5FI2A 3BRMA 5JYOA 1TD5A 2C6WB 4IBXA 3NI9A 4S2KA 1XP4A 2H10A 4RYEA 3IXGA 2OAP1 2HPBA 4KQRA 4YWZA 3GRJA 5AVEA 3LICA 2XDMA 4OP5A 3SS4A 4O7DA 3TW8A 3LCEA 4BENA 3QP5A 4M4XA 4EUZA 4OQ0A 5A92A 4KG6A 3D9YA 2ZMFA 1JNUA 2P04A 3ZNTA 3CAXA 3MZDA 4H6JB 3VFHA 1Q2PA 2WADA 1N9LA 2QZ6A 3VP4A 3BFGA 2OV5A 4OOLA 4B88A 3VP3A 2GNXA 1N9BA 4IUKA 5TBMB 3IXHA 2H0YA 1JTGA 3M2JA 3C2WA 4X6TA 4IUHA 5J8XA 5EM1A 3T1QB 3EGXC 1YPRA 3UY6A 2ZC4B 5HDCA 1BSGA 3V3SA 3TG9A 5F1FA 3UE6A 3MF0A 2O0YA 2KLIA 5IS1A 3IX3A 3GR2A 3L7HA 3DBAA 3TE8A 3GSGA 4S2OA 3KSGA 3WS5A 4KUKA 2H5SA 3Q7VA 5U47A 3V5MA 1TS6A 2XSSA 2ZM0A 1O07A 4WN5A 3MFDA 2OWJA 1K6SA 3N8SA 1V9ZA 4NXGA 3VFFA 3WS0A 3UDFA 4KZAA 3SS3A 2WZZA 4WM9A 1BUEA 1HTZA 5DKLA 4Z1WA 2EXBA 3MKFA 2ACGA 3NDEA 1NLYA 2ZLYA 4LV1A 3VV4A 4HBTA 5F1GA 2W1TA 3E4PA 4P85A 5F69A 3NCKA 5HPFA 3IXDA 4N9KA 1T1AA 3MSHA 5FAOA 1CEFA 2X02A 3ZYTA 1S4SA 2K31A 4LCLA 4NXFA 3EQVA 4I3IA 5CEBA 1ES2A 2EFUA 3HJKA 2V1BA 4DDSA 3ZNYA 4QPRA 4IEDA 4CLCA 4BMWA 3D4FA 2ZC3B 3PBNA 2ZQ9A 4FUWA 3EOIA 1EW0A 2V20A 4IVKA 5FQQA 1HLUP 4DMZA 4E6WA 3BY9A 4BWIA 5I94A 4I3AA 4YOFA 4X53A 4N1HA 1LL5A 2P9VB 3UDXA 4E3MA 3ITAA 3H82A 1CEGA 2H0TA 3EGDC 3C4OA 4KUOA 3UPNA 2CC1A 2WYXA 4N92A 2HZ5A 5J7EA 5KZHA 4CLCD 1P9WA 3OC2A 1OTDA 4HJ4A 3ICYA 3FYZA 1LI9A 1BLPA 3HLGA 3RH8B 4LV3A 4PM7A 3KSIA 3LIEA 3HREA 1G6OA 2BTFP 2VV6A 3CUEA 3MQQA 4KZ3A 3UE0A 1KE3A 2HF6A 3A3EA 4E3KA 2I9VA 3UB8A 1N4OA 1PI5A 1SKOB 3BLSA 3BFEA 2Y55A 2JKRM 4WMCA 5EFWA 1H8ZA 1Y54A 4JXVA 2P08A 4GOGA 1HZOA 1W8YA 2WK0A 5EVLA 4JGOA 2OLUA 3IWOA 4Y0UA 4DJ3A 3IXBA 4CJNA 4FSFA 3CZDA 1XKZA 5HD5A 2XA7S 1XA7A 3LGOA 5TBMA 3M2KA 1XFNA 2G2UA 3W2ZA 3F1NB 2Q0OA 2XD1A 1XX2A 3JYIA 1MWSA 5F83A 1DP9A 4WMCD 5HSQA 3C7VA 3T4KA 4GN2A 4FTXA 5FDSA 2OWHA 2VX8A 4EW7A 4LLOB 3ZGAB 4PAUA 3LR4A 1K4EA 2E8JA 4MN6A 5GHZA 5F6AA 1MBLA 2H28A 2JHEA 5EV0A 3S22A 4Y15A 4MDZA 4R70A 2X01A 1KGFA 1OTAA 2EX9A 4L9GA 5GLAA 3L9KA 3CPTA 4KQOA 4PM9A 3T4TA 3VSKA 1MKIA 2WKQA 5G4YA 1ONGA 2VK3A 4EBLA 2VGLS 1K54C 2PDRA 5HFOA 4WEKA 3ZFZA 4ID4A 1FCOA 4DJ2A 1YLZA 3IF6A 5DVAA 3BJNA 1UGUA 5FQJA 4ZBEA 3B33A 1BLCA 2JKFA 3GECA 4OPRA 4HOIA 2HJ9C 1QMEA 1F5MA 2D01A 3HUOA 2B18A 4YINA 3FZCA 3WWXA 3LIBA 1S0WA 3CI6A 4UAAA 5FQ9A 2J7VA 3VP2A 5G18A 3GQZA 1VHMA 5E2HA 4H8RA 1T1CA 2HP5A 3IH8A 5DTKA 1YKDA 4LPZA 3T1XA 2AVXA 2Y2JA 2Q9NA 5HX9A 2Y2IA 1RP5A 2XROA 5EE8A 2EX8A 3K3DA 4X56A 4IVIA 4UA7A 1S1YA 1IYOA 2ZQDA 5TR7A 4Q8IA 5GHXA 2P9VA 3HBRA 1VQQA 1LT0A 3LYXA 4Q0JA 4P87A 2HDQA 1XGIA 1H8MA 3LI9A 1ZHHB 4GJ4A 4BL3A 5E2FA 1TS8A 2J3TC 4F94A 2L4RA 4E3IA 4HNBA 1XGJA 3MXSA 1M40A 4K91A 2ZMVA 2O9CA 2WKEA 3PBOA 4S2NA 5EVIC 5C5KA 1O7EA 4JGQA 1F9IA 1CQAA 3SH7A 3MFXA 3BFDA 3N4IA 3G4PA 3F1PA 3BFFA 2WGVA 4OVDA 3CITA 5EM0A 3T4JA 4HP4A 3PBQA 2LB9A 3DTIA 1IKGA 3F1OA 4OQIA 3SS5A 1F98A 3Q82A 5FSRA 3KYQA 3LO7A 4MBKA 2W3GA 3FKVA 2WKIA 1K56A 4UQIM 4X1MA 4MBFA 2C5WB 2QKPA 1KOUA 2Y2HA 3T4QA 2VEAA 2ZQ8A 1GSVA 1SCWA 4MMNA 2JKTI 4IBRA 3E0YA 2EWWA 4OOYA 3G32A 3Q07A 3ZDJA 3KYZA 4DXBA 3K2NA 2ZOHA 4L0LA 4WYYA 5KMWA 2XD5A 1UWNX 1LSXA 1K56D 4X1LA 3T50A 4OKPA 1K0KA 4DKIA 2Y2MA 3BEBA 4LFUA 3T1SA 3UO9A 4BD1A 2PU2A 4I3JA 3LUQA 2W3EA 2INWA 1VEUA 2DRWA 1BLHA 3E4OA 2VGKA 3BM6A 1FQGA 1ES4A 4N9LA 2Z6DA 1ESIA 2VV7A 1JWVA 1NWZA 1S4RA 1W63M 3MJQA 2XFTA 3VE4A 2B95A 4O0PA 3C7UA 2IWCA 4OQHA 4LCMA 4E04A 2XFSA 2ZQAA 3ZHHA 4MN5A 1K55A 2WAFA 5M19A 4Y2FA 1IKIA 4HI4A 1Z09A 2VLGA 2VA0A 3KYEA 4K0WA 3DTEA 1YAXA 5K5BA 3PTEA 4EQIA 3Q81A 5I5LA 1OT6A 2BG1A 1H3QA 3T1RA 2WAEA 4EQ1A 3LR3A 4Y17A 5HARA 1NYYA 3QNBA 5FI7A 4NETA 1YSQA 3OPRA 3NOPC 2QJ7A 5FQMA 2HJEA 2BASA 1KGEA 1DP6A 5F68A 4KZBA 2WKRA 4R3BA 5CECA 3E98A 4GHIA 4NG2A 3MZEA 4DE3A 4DDYA 2OLVA 3UMEA 1YM1A 1ERMA 2WUQA 1IOUA 1OTBA 4C6YA 1H5XA 2PU4A 3HVFA 3PHYA 3N8LA 3O88A 5HDDA 3C8CA 4DXCA 5DFXA 5CTNA 2LB5A 1PI4A 2E8IA 2O9BA 1T18A 4OLGA 1LSWA 5GLDA 2V2FF 1SZVA 3DTMA 1KVLA 2A24A 3IQAA 1L0EA 4PKYG 3VMAA 2VKSA 3PYPA 5CEDA 1W7FA 3CJMA 2ZJ9A 3N6IA 3P98A 3PAGA 4WUJA 5L10A 3DW0A 3K3CA 3GVBA 4JXWA 2CMNA 4K08A 2FH5A 4KZ8A 3HLFA 2XQZA 4ARZA 1BT5A 4EEUA 5A93A 5HL6A 1YLTA 2Y2KA 4FCFA 3ITBA 5FI6A 3WRTA 1ES5A 3IS2A 1LHYA 3N8RA 3VOLA 1TF1A 3R7WB 4BL2A 1XXMA 1NZOA 4BBTA 2KOIA 4KZ7A 5AVFA 3S7QA 1XJ3A 1Y4OA 3OPPA 1GA0A 2PD8A 3HLWA 3OPHA 4RA7A 3BFCA 3MXRA 1VETB 1JTDA 5CHUA 1XJ6A 1W63Q 3MS6A 4B93A 1LI0A 3M6BA 3UB9A 2L1MA 3CHWP 2FFYA 4Z9QA 5CGXA 3NIAA 5EOEA 1NRFA 5FQIA 1KE4A 4KZ6A 4ESPA 4HJ6A 2KX6A 2WGWA 1DP8A 3PR6A 4CLCE 3W4OA 5CXWA 2PAVP 4GD6A 3UPOA 2M7UA 1L0FA 3QNCA 3DTKA 4LGWA 4G3KA 3QP1A 1CJFA 5AQ9A 4M3KA 2ZM2A 1FSYA 1K38A 1KGGA 1M6KA 5DF7A 3VE3A 3C4PA 3W4PA 4GS9A 2X71A 1BLSA 4HY8A 2Y2PA 3JPUA 3PXPA 2M7VA 5L2FA 1N9NA 2NUTC 4PM8A 1BZAA 3HJIA 4PMAA 2K2NA 4GW9A 3MMHA 4B4XA 3BWLA 5TFQA 4R3AA 3MQ0A 1S6RA 1PZOA 3UB7A 2XA7M 4D60A 3LFVA 1GCEA 1MY8A 2JBFA 4ZJ2A 4H6JA 1S1ZA 3B47A 1G68A 2DCFA 4JXGA 4Y0TA 2XRNA 4NK3A 3H7WB 3VP0A 3UE3A 1KDWA 3NOUC 3O5YA 4MBHA 2WKPA 3H9WA 1U60A 4JGPA 4QU3A 4XT2B 1DJCA 5EOOA 1YMXA 1T19A 2NUPC 1NY0A 3S7NA 3NULA 3OLOA 3A0VA 5KSHA 3HLCA 2XEPA 5EVIB 1NXYA 3PBRA 1FIKA 3FWLA 4HIAA 3T12B 3A0SA 1XA1A 4EXOA 1XFQA 4P0MA 2PR6A 4X68A 1OT9A 4S2PA 1NJ4A 2EFXA 1FSWA 2B02A 3UDIA 4MCWA 2VGLM 3ISGA 4ME4A 4ZDXA 3O86A 1A0KA 1YMSA 1X0OA 2UWXA 4GDNA 3C30A 5GHYA 1PZPA 2I72A 1K25A 1J3WA 2V8FA 3IF6C 1PWCA 3N7WA 3VP1A 3E2KA 4KQQA 3P09A 3D3OA 3BQ8A 1IEMA 1HVBA 4OONA 3T4SA 5DKKA 3KO6A 2GDNA 3PBSA 2W3HA 2HP6A 3GV9A 3B42A 4WZ5A 4MEZA 1PYYA 1ZG6A 4OPQA 5DJTA 4RVAA 2ZQCA 4KZ4A 4R4SA 3W8KA 4LRZE 3HLBA 4S2MA 2Y79A 5DF9A 3ULFA 5CRFA 1STZA 2YKHA 3E4QA 4R6LA 2A3UA 1MWRA 1ZTUA 3GTCA 4HHDA 1AXBA 1XJ4A 2BLSA 1K54A 4DRTA 3OPLA 3IF5A 5HZHA 2V8CA 1D7EA 3B3XA 3LIDA 1ES3A 3ZVTA 4E3OA 4JF4A 2QWSA 1MXOA 4PM5A 5DJUA 1MPLA 2JCHA 2W3DA 1MC0A 5FATA 1FOFA 2IA2A 3HUNA 5FA7A 3UB5P 1SKFA 3RXXA 1K57C 2EWVA 3MZFA 5LBRA 1WYCA 5CGSA 2QPNA 4JKTA 3FKWA 3D72A 3QP6A 3RXWA 2JKTM 2G7UA 4NXBA 5BOHA 5F5YA 2Z6CA 1W8QA 3TJZC 4QB8A 3G2ZA 3QP8A 3IX4A 1BYWA 4C75A 3IX8A 4MNRA 1SKOA 4FOFA 5HD3A 2W3FA 3A3FA 1MWTA 4Y13A 1ZG4A 4QWOA 5HWWA 3I7JA 4LV2A 4P6ZS 4U0XA 4OP8A 4MN7A 4F3LB 2W27A 2KDKA 3G34A 1RCJA 1LLBA 4EETB 2GX5A 4XT2A 5IU1A 1MKMA 1PWGA 2VJWA 3F1NA 3NBLA 3IHBA 3WRZA 4UA9A 2ZL1B 1MWUA 3C38A 1GSWA 4ZAMA 2V1AA 5FAQA 5CHJA 1WYBA 1NYMA 2YKFA 1I2SA 4I39A 4HP9A 2J3TD 1JWZA 3V3RA 3OZHA 5E43A 4KZ5A 3DAVA 4EWFA 2PRFA 3HL9A 5E2GA 4I5SA 3LY3A 2VGJA 2ZD8A 4FD8A 3SW1A 3UE1A 1VB6A 1YLJA 5M1AA 2W1TB 4R4RA 1T1BA 4WELA 1SDEA 1OJ5A 2Y2GA 1WE4A 4XUZA 4QJGA 2EX2A 3TRCA 4E6XA 3Q1FA 1YLYA 3A0RA 2PBDP 1YLPA 5AJGA 5JYPA 4BJPA 5HAIA 2XF3A 4NKPA 3BYDA 5EPHA 1YT4A 2O99A 5IHVA 4QY5A 1D06A 4RQ9A 1Q2QA 4CLCB 1GHMA 5CERA 2L0WA 3UMDA 1IYQA 4GDBA 1YQSA 3GDIA 3ZG7B 3UB6A 2RL3A 3LEQA 1DJBA 4R0QA 1FILA 2V1ZA 2G2WA 2XK1A 2VZWA 4Y7PA 3H82B 3KSFA 4JBFA 2A2LA 2PT7A 4BLMA 4X69A 1BULA 3G31A 1ZKJA 5GLBA 3A3IA 4CQHA 2ZM8A 3NC8A 4N1XA 2V9AA 3DWZA 5AQ7A 1BTLA 1L2SA 3P7NA 4WEJA 1DJAA 3JVUA 5EVEA 5TJJA 2Y8HA 2Z2LB 5DTTA 4YFMA 1ZC2A 1IYPA 1ERQA 1PNEA 3AGDA 1G6AA 1PW8A 1OJGA 3NY4A 2HDRA 1Z6FA 3FC7A 5HAPA 1CK3A 5KSCA 1FCNA 3MXQA 4NXEA 1ESUA 5FAPA 2XH9A 5HDSA
chains in the Genus database with same CATH topology
2R9XA 4OPRA 3IHAA 4S2JA 2RCXA 1PW1A 5F82A 3TOIA 1QMEA 1ONHA 4E3LA 4B4XA 2JC7A 1CI8A 1YLWA 1E3UA 3HLEA 5TFQA 3HUOA 4RX3A 1S6RA 4YINA 1PZOA 3FZCA 4RX2A 3WWXA 2EXAA 4LV0A 3ZG5A 1S0WA 1GCEA 4UAAA 1MY8A 5E2EA 2J7VA 5FQ9A 3VP2A 2JBFA 5G18A 4ZJ2A 3GQZA 5E2HA 4H8RA 4DE1A 1TVFA 2HP5A 1K55C 3IH8A 5DTKA 1G68A 4KG5A 2WGIA 3VOZA 3AGEA 2Y2JA 5CGWA 2DCFA 4GKUA 2Q9NA 2WKHA 3FV7A 4JXGA 4R23A 5HX9A 4Y0TA 2Y2IA 1RP5A 3M6HA 4NK3A 2HDUA 5EE8A 2EX8A 3VP0A 3IT9A 3O3VA 4X56A 3UE3A 1KDWA 4IVIA 4PPRA 4UA7A 5DTSA 3W4QA 2WGWB 3OCNA 4MBHA 1IYOA 3E2LA 2ZQDA 4OOMA 1U60A 4GNUA 5TR7A 1E3UD 4HEFA 4ZTKA 5HAQA 4Q8IA 4QU3A 5GHXA 2P9VA 3HBRA 1DJCA 2ZC5B 1VQQA 5EOOA 5HL1A 4OLDA 5GLCA 1KVMA 1YMXA 2Y2LA 1E4DA 1NY0A 4OPZA 2P74A 1DY6A 1J9MA 4P87A 2HDQA 1W79A 1XGIA 5KSHA 4U3TA 3HLCA 3SOIA 3IH9A 4BL3A 2XEPA 5E2FA 5EVIB 1NXYA 3PBRA 3FWLA 3ZVWA 4R1GA 1QMFA 4F94A 1XA1A 4FH2A 4E3IA 4P0MA 1XGJA 3MXSA 4E3JA 2J9OA 2R9WA 4X68A 1M40A 4S2PA 1NJ4A 2EFXA 4K91A 1EROA 5FI2A 1FSWA 2WKEA 3BRMA 3PBOA 4S2NA 5JYOA 2C6WB 2EX6A 4IBXA 4QY6A 3NI9A 5EVIC 3UDIA 4S2KA 1XP4A 2H10A 1O7EA 3IXGA 4RYEA 2HPBA 3IF6B 4KQRA 3ISGA 4BD0A 3DWKA 2WZXA 1PIOA 4JPMA 2OSUA 4ZDXA 3GRJA 3SH7A 3BFDA 3O86A 1YMSA 1IELA 1CI9A 2UWXA 4GDNA 2XDMA 4OP5A 3N4IA 3SS4A 4O7DA 5GHYA 1PZPA 2I72A 1K25A 3LCEA 3G4PA 4BENA 2Y59A 5DF8A 3IF6C 4EUZA 2A49A 4OQ0A 3BFFA 1PWCA 2WGVA 2FFFB 3N7WA 4KG6A 4OVDA 5A92A 3VP1A 3PBQA 3G30A 3E2KA 4KQQA 3P09A 1OMEA 3ZNTA 1IEMA 1HVBA 2PBYA 4S2LA 3MZDA 1IKGA 3VFHA 1Q2PA 5HW3A 4OONA 2WADA 4OQIA 3SS5A 3RJUA 3PBSA 2GDNA 3Q82A 5FSRA 4MBKA 3LO7A 4A5RA 2HP6A 4Y0OA 3FKVA 3GV9A 2QZ6A 4WZ5A 2WKIA 3VP4A 1K56A 4MEZA 3BFGA 5TGFA 2OV5A 4DE0A 4MBFA 2C5WB 1PYYA 1ZG6A 4OOLA 4OPQA 4B88A 3VP3A 2Y2HA 4HESA 4RVAA 2ZQCA 4KZ4A 3HUMA 3C5AA 1N9BA 2ZQ8A 4R4SA 3W8KA 3IXHA 1RGYA 1SCWA 2H0YA 1JTGA 3M2JA 4B4ZA 4IBRA 3HLBA 1KE0A 3LEZA 4S2MA 1JWPA 4OOYA 4X6TA 5DF9A 3BLMA 2Q9MA 5CRFA 3G32A 3Q07A 3TSGA 3ZDJA 5J8XA 3UY6A 4DXBA 2ZC4B 2HP9A 4KENB 4P6BA 1BSGA 3V3SA 4L0LA 3TG9A 5F1FA 3VOYA 4WYYA 2A3UA 5EECA 1MWRA 5KMWA 1ALQA 2XD5A 3GR2A 3GTCA 3CG5A 1K56D 1AXBA 2BLSA 3GSGA 4S2OA 4OKPA 4DKIA 4OQGA 2Y2MA 1K54A 3AGFA 4DF6A 3BEBA 4DRTA 3OPLA 3IF5A 3WS5A 3UO9A 4BD1A 1SHVA 3GMWA 2PU2A 2H5SA 3OCLA 1W5DA 3B3XA 3Q7VA 2B5RA 5U47A 1ES3A 2DRWA 3V5MA 3ZVTA 1K4FA 4JF5A 4E3OA 1BLHA 4JF4A 2VGKA 2ZM0A 3BM6A 1MXOA 4PM6A 4PM5A 1O07A 1FQGA 1L0DA 1ES4A 4N9LA 1MPLA 1TEMA 4R3JA 1ESIA 1XPBA 3MFDA 1K6SA 3N8SA 1JWVA 2JCHA 5FASA 5FATA 2XFTA 1FOFA 3VFFA 3WS0A 1TDLA 3UDFA 3ZG9B 3HUNA 4KZAA 3SS3A 3IWQA 2WZZA 4WM9A 5FA7A 1BUEA 1HTZA 1SKFA 3C7UA 3RXXA 2EXBA 1K57C 2IWCA 3ZG8B 4OQHA 4JF6A 3MZFA 4LCMA 3MKFA 1WYCA 5CGSA 2QPNA 3NDEA 4JKTA 2XFSA 2ZQAA 3ZHHA 4LENA 4XXRA 3FKWA 2ZLYA 3RXWA 4LV1A 5A90A 4HBTA 1K55A 2WAFA 3NDGA 5F1GA 4C3QA 5M19A 4X55A 5BOHA 1IKIA 4CPKA 1W8QA 4P85A 4QHCA 3PAEA 4QB8A 3G2ZA 3NCKA 3HLDA 4K0WA 4EBNA 4C75A 2JE5A 3IXDA 4N9KA 5AQAA 3V39A 4MNRA 3PTEA 1NZUA 4OPYA 5D3OA 5FAOA 1CEFA 3VSLA 4DE2A 1C3BA 4EQIA 2X02A 3A3FA 3Q81A 1MWTA 2BG1A 1ZG4A 2DNSA 2WAEA 4WZ5C 5FDHA 3I7JA 4LCLA 4LV2A 4XUXA 3EQVA 3S4XA 5CEBA 4U0XA 5HARA 1ES2A 2EFUA 4OP8A 1NYYA 3WS2A 3QNBA 4DDSA 3ZNYA 5FI7A 2J9PA 4NETA 3OPRA 2IWBA 3G34A 1RCJA 2ZC7A 4IEDA 1LLBA 3A3JA 5FQMA 3UPPA 4UA6A 4UHUA 3D4FA 1KGEA 4GZBA 1PWGA 2ZC3B 3PBNA 3O87A 4KZBA 4R3BA 5CECA 3NBLA 2ZQ9A 3IHBA 3WRZA 3MZEA 3EQUA 4ZJ3A 4DE3A 4DDYA 1H8YA 2HDSA 2ZQ7A 2OLVA 2V20A 4IVKA 5FQQA 4E6WA 4GB7A 4UA9A 1YM1A 1ERMA 1MWUA 4D2OA 5I94A 2WUQA 4X53A 4N1HA 4ZAMA 4C6YA 1H5XA 1SDNA 5FAQA 5CHJA 1WYBA 1NYMA 2PU4A 3HVFA 1LL5A 2P9VB 3UDXA 3N8LA 4E3MA 3O88A 1GHIA 3ITAA 1RGZA 1I2SA 1CEGA 4DXCA 2H0TA 5CTNA 3C4OA 1PI4A 2E8IA 2CC1A 3UPNA 2WYXA 4N92A 1JWZA 3V3RA 5KZHA 3OZHA 4OLGA 3OC2A 5E43A 4KZ5A 2Y2OA 4HBUA 4EWFA 5GLDA 3FYZA 3HL9A 2V2FF 1LI9A 1BLPA 1KVLA 3DTMA 3IQAA 3HLGA 5E2GA 1L0EA 3LY3A 4E3NA 4LV3A 3CMZA 1TDGA 2VGJA 2ZD8A 4PM7A 3VMAA 4FD8A 3HREA 3UE1A 4FH4A 3SH8A 1YLJA 5CEDA 1W7FA 3CJMA 2ZJ9A 3N6IA 3P98A 3PAGA 4WZ4A 5M1AA 4R4RA 3DW0A 3QHYA 5CHMA 4KZ3A 3UE0A 4WELA 1KE3A 1SDEA 3WS1A 3GVBA 4JXWA 1FR6A 3A3EA 3G35A 1I5QA 4ZJ1A 4U0TA 4KZ8A 4E3KA 3HLFA 1EI5A 2Y2GA 2XQZA 1WE4A 2Y2NA 4XUZA 4QJGA 1N4OA 1PI5A 1BT5A 1HD8A 2EX2A 3BLSA 3LY4A 4S2IA 3BFEA 2Y55A 3BECA 4WMCA 3IWIA 1H8ZA 1Y54A 4JXVA 4E6XA 5A93A 1YLTA 2Y2QA 3Q1FA 4MLLA 4GOGA 1VM1A 1YLYA 2J8YA 2Y2KA 1HZOA 1W8YA 2WK0A 2IWDA 4FCFA 4S2NC 3ZCZA 5EVLA 3ITBA 5FI6A 3WRTA 2OLUA 1ES5A 3Q7ZA 3IWOA 1YLPA 4Y0UA 3IXBA 5JYPA 1LHYA 4BJPA 4CJNA 5HAIA 3WS4A 2XF3A 5EPHA 3BYDA 4FSFA 3CZDA 1YT4A 1XKZA 3N8RA 3PBTA 5IHVA 1I2WA 4QY5A 1IYSA 3S1YA 1Q2QA 1XA7A 1GHMA 3M2KA 2G2UA 1K6RA 5CERA 4BL2A 2XLNA 1XXMA 1IYQA 4GDBA 1NZOA 1FR1A 2XD1A 1XX2A 1YQSA 3JYIA 4K0XA 4KZ7A 3SH9A 3ZG7B 3OPPA 1EWZA 1JVJA 1MWSA 1GA0A 3HLWA 2RL3A 3OPHA 5F83A 4WMCD 3C7VA 4GN2A 4RA7A 2Y4AA 3BFCA 3V50A 1PWDA 1L0GA 3MXRA 1DJBA 4EBPA 4R0QA 4EV4A 2V1ZA 1JTDA 2G2WA 3ZGAB 5CHUA 3UNWA 2XK1A 1K4EA 5AQBA 2XGNA 2XR0A 4Y7PA 5GHZA 1LI0A 3M6BA 3MBZA 2FFYA 1MBLA 4GD8A 4Z9QA 4JBFA 5CGXA 3NIAA 5EOEA 2ZC6B 4BLMA 4OH0A 3S22A 1NRFA 1KDSA 5FQIA 1KE4A 4KZ6A 2WGWA 4X69A 2ZMAA 2X01A 1KGFA 1BULA 3G31A 1LL9A 2EX9A 1ZKJA 5M18A 5GLBA 3W4OA 4JLFA 3A3IA 1K57A 3UN7A 5GLAA 2ZM8A 2Y91A 5CXWA 3A3DA 3NC8A 4N1XA 4KQOA 4KG2A 3ZG0A 4GD6A 3UPOA 3DWZA 5AQ7A 4PM9A 1BTLA 4QD4A 1L2SA 5FQKA 1L0FA 3Q7VB 3QNCA 4WEJA 5EVIA 5CTMA 1GA9A 3VSKA 4WBGA 1DJAA 1MKIA 5AQ9A 2Z2LB 4M3KA 5DTTA 1ONGA 2ZM2A 4YFMA 4EBLA 1FSYA 1K38A 1KGGA 1M6KA 1ZC2A 1K54C 5DF7A 3C4PA 3G2YA 4BQMA 1IYPA 1ERQA 3W4PA 1GHPA 3AGDA 1G6AA 2X71A 1BLSA 5GL9A 1PW8A 4WEKA 5HFOA 3ZFZA 2Y2PA 3NY4A 4ID4A 2HDRA 4KZ9A 1FCOA 5L2FA 1YLZA 1Z6FA 2QMIA 4JXSA 3IF6A 2Z2MB 5DVAA 5HAPA 5A91A 1FCMA 5FQJA 1CK3A 5KSCA 4ZBEA 3MKEA 1FCNA 4PM8A 1BZAA 1ESUA 1BLCA 5FAPA 4PMAA 5EUAA 2XH9A 5EVID 1E25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9X A;  4OPR A;  3IHA A;  4S2J A;  2RCX A;  1PW1 A;  5F82 A;  3TOI A;  1QME A;  1ONH A;  4E3L A;  4B4X A;  2JC7 A;  1CI8 A;  1YLW A;  1E3U A;  3HLE A;  5TFQ A;  3HUO A;  4RX3 A;  1S6R A;  4YIN A;  1PZO A;  3FZC A;  4RX2 A;  3WWX A;  2EXA A;  4LV0 A;  3ZG5 A;  1S0W A;  1GCE A;  4UAA A;  1MY8 A;  5E2E A;  2J7V A;  5FQ9 A;  3VP2 A;  2JBF A;  5G18 A;  4ZJ2 A;  3GQZ A;  5E2H A;  4H8R A;  4DE1 A;  1TVF A;  2HP5 A;  1K55 C;  3IH8 A;  5DTK A;  1G68 A;  4KG5 A;  2WGI A;  3VOZ A;  3AGE A;  2Y2J A;  5CGW A;  2DCF A;  4GKU A;  2Q9N A;  2WKH A;  3FV7 A;  4JXG A;  4R23 A;  5HX9 A;  4Y0T A;  2Y2I A;  1RP5 A;  3M6H A;  4NK3 A;  2HDU A;  5EE8 A;  2EX8 A;  3VP0 A;  3IT9 A;  3O3V A;  4X56 A;  3UE3 A;  1KDW A;  4IVI A;  4PPR A;  4UA7 A;  5DTS A;  3W4Q A;  2WGW B;  3OCN A;  4MBH A;  1IYO A;  3E2L A;  2ZQD A;  4OOM A;  1U60 A;  4GNU A;  5TR7 A;  1E3U D;  4HEF A;  4ZTK A;  5HAQ A;  4Q8I A;  4QU3 A;  5GHX A;  2P9V A;  3HBR A;  1DJC A;  2ZC5 B;  1VQQ A;  5EOO A;  5HL1 A;  4OLD A;  5GLC A;  1KVM A;  1YMX A;  2Y2L A;  1E4D A;  1NY0 A;  4OPZ A;  2P74 A;  1DY6 A;  1J9M A;  4P87 A;  2HDQ A;  1W79 A;  1XGI A;  5KSH A;  4U3T A;  3HLC A;  3SOI A;  3IH9 A;  4BL3 A;  2XEP A;  5E2F A;  5EVI B;  1NXY A;  3PBR A;  3FWL A;  3ZVW A;  4R1G A;  1QMF A;  4F94 A;  1XA1 A;  4FH2 A;  4E3I A;  4P0M A;  1XGJ A;  3MXS A;  4E3J A;  2J9O A;  2R9W A;  4X68 A;  1M40 A;  4S2P A;  1NJ4 A;  2EFX A;  4K91 A;  1ERO A;  5FI2 A;  1FSW A;  2WKE A;  3BRM A;  3PBO A;  4S2N A;  5JYO A;  2C6W B;  2EX6 A;  4IBX A;  4QY6 A;  3NI9 A;  5EVI C;  3UDI A;  4S2K A;  1XP4 A;  2H10 A;  1O7E A;  3IXG A;  4RYE A;  2HPB A;  3IF6 B;  4KQR A;  3ISG A;  4BD0 A;  3DWK A;  2WZX A;  1PIO A;  4JPM A;  2OSU A;  4ZDX A;  3GRJ A;  3SH7 A;  3BFD A;  3O86 A;  1YMS A;  1IEL A;  1CI9 A;  2UWX A;  4GDN A;  2XDM A;  4OP5 A;  3N4I A;  3SS4 A;  4O7D A;  5GHY A;  1PZP A;  2I72 A;  1K25 A;  3LCE A;  3G4P A;  4BEN A;  2Y59 A;  5DF8 A;  3IF6 C;  4EUZ A;  2A49 A;  4OQ0 A;  3BFF A;  1PWC A;  2WGV A;  2FFF B;  3N7W A;  4KG6 A;  4OVD A;  5A92 A;  3VP1 A;  3PBQ A;  3G30 A;  3E2K A;  4KQQ A;  3P09 A;  1OME A;  3ZNT A;  1IEM A;  1HVB A;  2PBY A;  4S2L A;  3MZD A;  1IKG A;  3VFH A;  1Q2P A;  5HW3 A;  4OON A;  2WAD A;  4OQI A;  3SS5 A;  3RJU A;  3PBS A;  2GDN A;  3Q82 A;  5FSR A;  4MBK A;  3LO7 A;  4A5R A;  2HP6 A;  4Y0O A;  3FKV A;  3GV9 A;  2QZ6 A;  4WZ5 A;  2WKI A;  3VP4 A;  1K56 A;  4MEZ A;  3BFG A;  5TGF A;  2OV5 A;  4DE0 A;  4MBF A;  2C5W B;  1PYY A;  1ZG6 A;  4OOL A;  4OPQ A;  4B88 A;  3VP3 A;  2Y2H A;  4HES A;  4RVA A;  2ZQC A;  4KZ4 A;  3HUM A;  3C5A A;  1N9B A;  2ZQ8 A;  4R4S A;  3W8K A;  3IXH A;  1RGY A;  1SCW A;  2H0Y A;  1JTG A;  3M2J A;  4B4Z A;  4IBR A;  3HLB A;  1KE0 A;  3LEZ A;  4S2M A;  1JWP A;  4OOY A;  4X6T A;  5DF9 A;  3BLM A;  2Q9M A;  5CRF A;  3G32 A;  3Q07 A;  3TSG A;  3ZDJ A;  5J8X A;  3UY6 A;  4DXB A;  2ZC4 B;  2HP9 A;  4KEN B;  4P6B A;  1BSG A;  3V3S A;  4L0L A;  3TG9 A;  5F1F A;  3VOY A;  4WYY A;  2A3U A;  5EEC A;  1MWR A;  5KMW A;  1ALQ A;  2XD5 A;  3GR2 A;  3GTC A;  3CG5 A;  1K56 D;  1AXB A;  2BLS A;  3GSG A;  4S2O A;  4OKP A;  4DKI A;  4OQG A;  2Y2M A;  1K54 A;  3AGF A;  4DF6 A;  3BEB A;  4DRT A;  3OPL A;  3IF5 A;  3WS5 A;  3UO9 A;  4BD1 A;  1SHV A;  3GMW A;  2PU2 A;  2H5S A;  3OCL A;  1W5D A;  3B3X A;  3Q7V A;  2B5R A;  5U47 A;  1ES3 A;  2DRW A;  3V5M A;  3ZVT A;  1K4F A;  4JF5 A;  4E3O A;  1BLH A;  4JF4 A;  2VGK A;  2ZM0 A;  3BM6 A;  1MXO A;  4PM6 A;  4PM5 A;  1O07 A;  1FQG A;  1L0D A;  1ES4 A;  4N9L A;  1MPL A;  1TEM A;  4R3J A;  1ESI A;  1XPB A;  3MFD A;  1K6S A;  3N8S A;  1JWV A;  2JCH A;  5FAS A;  5FAT A;  2XFT A;  1FOF A;  3VFF A;  3WS0 A;  1TDL A;  3UDF A;  3ZG9 B;  3HUN A;  4KZA A;  3SS3 A;  3IWQ A;  2WZZ A;  4WM9 A;  5FA7 A;  1BUE A;  1HTZ A;  1SKF A;  3C7U A;  3RXX A;  2EXB A;  1K57 C;  2IWC A;  3ZG8 B;  4OQH A;  4JF6 A;  3MZF A;  4LCM A;  3MKF A;  1WYC A;  5CGS A;  2QPN A;  3NDE A;  4JKT A;  2XFS A;  2ZQA A;  3ZHH A;  4LEN A;  4XXR A;  3FKW A;  2ZLY A;  3RXW A;  4LV1 A;  5A90 A;  4HBT A;  1K55 A;  2WAF A;  3NDG A;  5F1G A;  4C3Q A;  5M19 A;  4X55 A;  5BOH A;  1IKI A;  4CPK A;  1W8Q A;  4P85 A;  4QHC A;  3PAE A;  4QB8 A;  3G2Z A;  3NCK A;  3HLD A;  4K0W A;  4EBN A;  4C75 A;  2JE5 A;  3IXD A;  4N9K A;  5AQA A;  3V39 A;  4MNR A;  3PTE A;  1NZU A;  4OPY A;  5D3O A;  5FAO A;  1CEF A;  3VSL A;  4DE2 A;  1C3B A;  4EQI A;  2X02 A;  3A3F A;  3Q81 A;  1MWT A;  2BG1 A;  1ZG4 A;  2DNS A;  2WAE A;  4WZ5 C;  5FDH A;  3I7J A;  4LCL A;  4LV2 A;  4XUX A;  3EQV A;  3S4X A;  5CEB A;  4U0X A;  5HAR A;  1ES2 A;  2EFU A;  4OP8 A;  1NYY A;  3WS2 A;  3QNB A;  4DDS A;  3ZNY A;  5FI7 A;  2J9P A;  4NET A;  3OPR A;  2IWB A;  3G34 A;  1RCJ A;  2ZC7 A;  4IED A;  1LLB A;  3A3J A;  5FQM A;  3UPP A;  4UA6 A;  4UHU A;  3D4F A;  1KGE A;  4GZB A;  1PWG A;  2ZC3 B;  3PBN A;  3O87 A;  4KZB A;  4R3B A;  5CEC A;  3NBL A;  2ZQ9 A;  3IHB A;  3WRZ A;  3MZE A;  3EQU A;  4ZJ3 A;  4DE3 A;  4DDY A;  1H8Y A;  2HDS A;  2ZQ7 A;  2OLV A;  2V20 A;  4IVK A;  5FQQ A;  4E6W A;  4GB7 A;  4UA9 A;  1YM1 A;  1ERM A;  1MWU A;  4D2O A;  5I94 A;  2WUQ A;  4X53 A;  4N1H A;  4ZAM A;  4C6Y A;  1H5X A;  1SDN A;  5FAQ A;  5CHJ A;  1WYB A;  1NYM A;  2PU4 A;  3HVF A;  1LL5 A;  2P9V B;  3UDX A;  3N8L A;  4E3M A;  3O88 A;  1GHI A;  3ITA A;  1RGZ A;  1I2S A;  1CEG A;  4DXC A;  2H0T A;  5CTN A;  3C4O A;  1PI4 A;  2E8I A;  2CC1 A;  3UPN A;  2WYX A;  4N92 A;  1JWZ A;  3V3R A;  5KZH A;  3OZH A;  4OLG A;  3OC2 A;  5E43 A;  4KZ5 A;  2Y2O A;  4HBU A;  4EWF A;  5GLD A;  3FYZ A;  3HL9 A;  2V2F F;  1LI9 A;  1BLP A;  1KVL A;  3DTM A;  3IQA A;  3HLG A;  5E2G A;  1L0E A;  3LY3 A;  4E3N A;  4LV3 A;  3CMZ A;  1TDG A;  2VGJ A;  2ZD8 A;  4PM7 A;  3VMA A;  4FD8 A;  3HRE A;  3UE1 A;  4FH4 A;  3SH8 A;  1YLJ A;  5CED A;  1W7F A;  3CJM A;  2ZJ9 A;  3N6I A;  3P98 A;  3PAG A;  4WZ4 A;  5M1A A;  4R4R A;  3DW0 A;  3QHY A;  5CHM A;  4KZ3 A;  3UE0 A;  4WEL A;  1KE3 A;  1SDE A;  3WS1 A;  3GVB A;  4JXW A;  1FR6 A;  3A3E A;  3G35 A;  1I5Q A;  4ZJ1 A;  4U0T A;  4KZ8 A;  4E3K A;  3HLF A;  1EI5 A;  2Y2G A;  2XQZ A;  1WE4 A;  2Y2N A;  4XUZ A;  4QJG A;  1N4O A;  1PI5 A;  1BT5 A;  1HD8 A;  2EX2 A;  3BLS A;  3LY4 A;  4S2I A;  3BFE A;  2Y55 A;  3BEC A;  4WMC A;  3IWI A;  1H8Z A;  1Y54 A;  4JXV A;  4E6X A;  5A93 A;  1YLT A;  2Y2Q A;  3Q1F A;  4MLL A;  4GOG A;  1VM1 A;  1YLY A;  2J8Y A;  2Y2K A;  1HZO A;  1W8Y A;  2WK0 A;  2IWD A;  4FCF A;  4S2N C;  3ZCZ A;  5EVL A;  3ITB A;  5FI6 A;  3WRT A;  2OLU A;  1ES5 A;  3Q7Z A;  3IWO A;  1YLP A;  4Y0U A;  3IXB A;  5JYP A;  1LHY A;  4BJP A;  4CJN A;  5HAI A;  3WS4 A;  2XF3 A;  5EPH A;  3BYD A;  4FSF A;  3CZD A;  1YT4 A;  1XKZ A;  3N8R A;  3PBT A;  5IHV A;  1I2W A;  4QY5 A;  1IYS A;  3S1Y A;  1Q2Q A;  1XA7 A;  1GHM A;  3M2K A;  2G2U A;  1K6R A;  5CER A;  4BL2 A;  2XLN A;  1XXM A;  1IYQ A;  4GDB A;  1NZO A;  1FR1 A;  2XD1 A;  1XX2 A;  1YQS A;  3JYI A;  4K0X A;  4KZ7 A;  3SH9 A;  3ZG7 B;  3OPP A;  1EWZ A;  1JVJ A;  1MWS A;  1GA0 A;  3HLW A;  2RL3 A;  3OPH A;  5F83 A;  4WMC D;  3C7V A;  4GN2 A;  4RA7 A;  2Y4A A;  3BFC A;  3V50 A;  1PWD A;  1L0G A;  3MXR A;  1DJB A;  4EBP A;  4R0Q A;  4EV4 A;  2V1Z A;  1JTD A;  2G2W A;  3ZGA B;  5CHU A;  3UNW A;  2XK1 A;  1K4E A;  5AQB A;  2XGN A;  2XR0 A;  4Y7P A;  5GHZ A;  1LI0 A;  3M6B A;  3MBZ A;  2FFY A;  1MBL A;  4GD8 A;  4Z9Q A;  4JBF A;  5CGX A;  3NIA A;  5EOE A;  2ZC6 B;  4BLM A;  4OH0 A;  3S22 A;  1NRF A;  1KDS A;  5FQI A;  1KE4 A;  4KZ6 A;  2WGW A;  4X69 A;  2ZMA A;  2X01 A;  1KGF A;  1BUL A;  3G31 A;  1LL9 A;  2EX9 A;  1ZKJ A;  5M18 A;  5GLB A;  3W4O A;  4JLF A;  3A3I A;  1K57 A;  3UN7 A;  5GLA A;  2ZM8 A;  2Y91 A;  5CXW A;  3A3D A;  3NC8 A;  4N1X A;  4KQO A;  4KG2 A;  3ZG0 A;  4GD6 A;  3UPO A;  3DWZ A;  5AQ7 A;  4PM9 A;  1BTL A;  4QD4 A;  1L2S A;  5FQK A;  1L0F A;  3Q7V B;  3QNC A;  4WEJ A;  5EVI A;  5CTM A;  1GA9 A;  3VSK A;  4WBG A;  1DJA A;  1MKI A;  5AQ9 A;  2Z2L B;  4M3K A;  5DTT A;  1ONG A;  2ZM2 A;  4YFM A;  4EBL A;  1FSY A;  1K38 A;  1KGG A;  1M6K A;  1ZC2 A;  1K54 C;  5DF7 A;  3C4P A;  3G2Y A;  4BQM A;  1IYP A;  1ERQ A;  3W4P A;  1GHP A;  3AGD A;  1G6A A;  2X71 A;  1BLS A;  5GL9 A;  1PW8 A;  4WEK A;  5HFO A;  3ZFZ A;  2Y2P A;  3NY4 A;  4ID4 A;  2HDR A;  4KZ9 A;  1FCO A;  5L2F A;  1YLZ A;  1Z6F A;  2QMI A;  4JXS A;  3IF6 A;  2Z2M B;  5DVA A;  5HAP A;  5A91 A;  1FCM A;  5FQJ A;  1CK3 A;  5KSC A;  4ZBE A;  3MKE A;  1FCN A;  4PM8 A;  1BZA A;  1ESU A;  1BLC A;  5FAP A;  4PMA A;  5EUA A;  2XH9 A;  5EVI D;  1E25 A; 
#chains in the Genus database with same CATH topology
 1P0Z A;  3TOI A;  4E3L A;  2JC7 A;  3HLE A;  1E3U A;  3ZQ5 A;  4F3L A;  4Q0H A;  3G6O A;  4LV0 A;  4PKY A;  4O8G A;  4Q0I A;  3R4K A;  4DE1 A;  4AFI A;  3U2A A;  1TS7 A;  5G4Z A;  2WGI A;  3VOZ A;  2ZOI A;  5CGW A;  3FV7 A;  4R23 A;  1XJ2 A;  3M6H A;  3O3V A;  4PPR A;  2ZL1 A;  4LRX C;  5DTS A;  3IBJ A;  2QYB A;  3E2L A;  4OOM A;  4GNU A;  1E3U D;  3LI8 A;  2GJ3 A;  5HAQ A;  5HWV A;  3CPT B;  4OLD A;  3RFB A;  5GLC A;  1KVM A;  4EUV A;  2Y2L A;  1LL8 A;  2P74 A;  1DY6 A;  3NEC A;  1W79 A;  4G3V A;  3SOI A;  3IH9 A;  1H0M A;  3ZVW A;  4R1G A;  4CLC C;  2PR5 A;  4ETX A;  2R9W A;  4BBV A;  4L9F A;  4I38 A;  1ERO A;  4QY6 A;  2EX6 A;  4O01 A;  1OPX A;  2JKG A;  4IHQ A;  3IF6 B;  4BD0 A;  3DWK A;  1LSV A;  1PIO A;  2WZX A;  4JPM A;  2OSU A;  5DFY A;  2MJ6 A;  3U4L P;  1IEL A;  1CI9 A;  4II7 A;  3BW6 A;  2PD7 A;  3V67 A;  2Y59 A;  5DF8 A;  3LR5 A;  2A49 A;  1Y28 A;  2FFF B;  3S7P A;  3FPW A;  3G30 A;  1OME A;  4HJ3 A;  2PBY A;  2HV1 A;  4S2L A;  5HW3 A;  2J3W A;  4DN0 A;  3RJU A;  3CUE C;  4A5R A;  4Y0O A;  5TGF A;  4DE0 A;  4G3W A;  4EES A;  4HES A;  4JGR A;  3HUM A;  3C5A A;  1RGY A;  2FZ0 A;  4B4Z A;  3LEZ A;  1KE0 A;  1JWP A;  4EER A;  1S67 L;  2OAQ 1;  3T4O A;  3BLM A;  2Q9M A;  3TSG A;  2HP9 A;  4KEN B;  4P6B A;  3VOY A;  5EEC A;  4PHT A;  1ALQ A;  3CG5 A;  3EEH A;  4L9E A;  4OQG A;  2PYR A;  3AGF A;  4DF6 A;  4BBU A;  1SHV A;  3GMW A;  3CLO A;  3BY8 A;  3OCL A;  1W5D A;  2B5R A;  1K4F A;  4JF5 A;  1MZU A;  3T4L A;  4PM6 A;  1L0D A;  1TEM A;  2OOL A;  2DMW A;  4R3J A;  4Y5F A;  1XPB A;  1ODV A;  5L8M A;  5FAS A;  3F1P B;  2P7J A;  1ACF A;  1TDL A;  3FG8 A;  3ZG9 B;  3IWQ A;  2PYP A;  2W0N A;  3ZG8 B;  1PRQ A;  4HH2 A;  4JF6 A;  2UV0 E;  3F1O B;  4WL9 A;  4LEN A;  4XXR A;  5A90 A;  2V0U A;  4C3Q A;  3NDG A;  4HH3 A;  4X55 A;  4CPK A;  4QHC A;  3PAE A;  1OTI A;  3HLD A;  4EBN A;  2JE5 A;  5AQA A;  3V39 A;  5IT5 A;  1V9Y A;  1NZU A;  1P97 A;  4OPY A;  5D3O A;  5FL3 A;  3VSL A;  4DE2 A;  1C3B A;  4Y3I A;  2QJ5 A;  1YSP A;  1OTE A;  2DNS A;  4WZ5 C;  5FDH A;  4UEY A;  4XUX A;  3S4X A;  1NLZ A;  3WS2 A;  2J9P A;  2IWB A;  2JKR I;  1AWI A;  2ZC7 A;  3A3J A;  3P01 A;  1F2K A;  3UPP A;  1L3L A;  4UA6 A;  4UHU A;  4GZB A;  3R7W A;  2K7S A;  1CF0 A;  3O87 A;  4ZJ3 A;  3EQU A;  1H8Y A;  2HDS A;  2ZQ7 A;  3MQO A;  1WA9 A;  4GB7 A;  4EU0 A;  4D2O A;  1VEU B;  4KQD A;  4YNR A;  1VET A;  1SDN A;  1PFL A;  5A8B A;  1GHI A;  1RGZ A;  1N9O A;  2O9A A;  4B9O A;  4LRY C;  2Y2O A;  1S66 L;  4HBU A;  4EEP A;  1IFQ A;  4E3N A;  3CMZ A;  1TDG A;  3IBR A;  4FH4 A;  3SH8 A;  4WZ4 A;  3QHY A;  5CHM A;  3SZT A;  3WS1 A;  5J4E A;  1FR6 A;  2W1R A;  3G35 A;  1I5Q A;  3MR0 A;  4ZJ1 A;  4U0T A;  4ETZ A;  1EI5 A;  2Y2N A;  1HD8 A;  4S2I A;  3LY4 A;  3BEC A;  3IWI A;  2Y2Q A;  4MLL A;  1VM1 A;  2J8Y A;  3CWF A;  4S2N C;  5HPI A;  2IWD A;  2QHK A;  3ZCZ A;  1D1J A;  5CX7 A;  3Q7Z A;  3BQA A;  4WF0 A;  2V0W A;  3WS4 A;  3S7O A;  3PBT A;  1I2W A;  1IYS A;  3S1Y A;  4X25 A;  4P6Z M;  1K6R A;  2XLN A;  1FR1 A;  4GHI B;  4K0X A;  3FPV A;  3SH9 A;  1G28 A;  1EWZ A;  1JVJ A;  2Y4A A;  3V50 A;  1PWD A;  1L0G A;  4EBP A;  4EV4 A;  3JVV A;  3UNW A;  4WLA A;  5FEF A;  3LR0 A;  5AQB A;  2XGN A;  2XR0 A;  3MBZ A;  4GD8 A;  2ZC6 B;  4R38 A;  3H7W A;  4OH0 A;  1KDS A;  1UWP X;  2ZMA A;  5MC7 A;  5L09 A;  3OBF A;  1LL9 A;  2A24 B;  5M18 A;  3HCY A;  4JLF A;  1K57 A;  3UN7 A;  2Y91 A;  3A3D A;  4KG2 A;  3ZG0 A;  4NEE D;  5HWT A;  4QD4 A;  5FQK A;  3Q7V B;  2R78 A;  3LIF A;  5EVI A;  5CTM A;  1GA9 A;  4WBG A;  1TS0 A;  4ARZ B;  3G2Y A;  4BQM A;  2GZA A;  1GHP A;  3NHQ A;  5GL9 A;  2EA9 A;  4HQA A;  3NJA A;  3IS2 B;  4KZ9 A;  1GSX A;  1G5U A;  2QMI A;  4JXS A;  2Z2M B;  5A91 A;  1FCM A;  3MKE A;  1P9R A;  5EUA A;  5EVI D;  1E25 A;  2R9X A;  4S2J A;  3IHA A;  2RCX A;  1PW1 A;  5F82 A;  1ONH A;  1CI8 A;  1YLW A;  3EWK A;  4RX3 A;  5L07 A;  5FEG A;  4RX2 A;  2HGV A;  5J3W A;  2EXA A;  3ZG5 A;  5E2E A;  4UQI S;  1NRJ A;  3QP2 A;  1TVF A;  1K55 C;  2ZBB A;  4KG5 A;  3AGE A;  3NOT C;  4GKU A;  2WKH A;  3EEA A;  2HDU A;  3IT9 A;  2D02 A;  3RTY A;  4GCZ A;  3W4Q A;  2M1C A;  2WGW B;  3OCN A;  3LIA A;  4HEF A;  4ZRR A;  4ZTK A;  2PHY A;  2ZC5 B;  5HL1 A;  1E4D A;  4OPZ A;  1J9M A;  3OOV A;  1DRM A;  2VV8 A;  4U3T A;  4IJG A;  3QP4 A;  1QMF A;  5KIZ A;  4GLQ A;  4FH2 A;  2J80 A;  4E3J A;  2J9O A;  3KSH A;  2JN7 A;  4GS9 B;  3KX0 X;  5FI2 A;  3BRM A;  5JYO A;  1TD5 A;  2C6W B;  4IBX A;  3NI9 A;  4S2K A;  1XP4 A;  2H10 A;  4RYE A;  3IXG A;  2OAP 1;  2HPB A;  4KQR A;  4YWZ A;  3GRJ A;  5AVE A;  3LIC A;  2XDM A;  4OP5 A;  3SS4 A;  4O7D A;  3TW8 A;  3LCE A;  4BEN A;  3QP5 A;  4M4X A;  4EUZ A;  4OQ0 A;  5A92 A;  4KG6 A;  3D9Y A;  2ZMF A;  1JNU A;  2P04 A;  3ZNT A;  3CAX A;  3MZD A;  4H6J B;  3VFH A;  1Q2P A;  2WAD A;  1N9L A;  2QZ6 A;  3VP4 A;  3BFG A;  2OV5 A;  4OOL A;  4B88 A;  3VP3 A;  2GNX A;  1N9B A;  4IUK A;  5TBM B;  3IXH A;  2H0Y A;  1JTG A;  3M2J A;  3C2W A;  4X6T A;  4IUH A;  5J8X A;  5EM1 A;  3T1Q B;  3EGX C;  1YPR A;  3UY6 A;  2ZC4 B;  5HDC A;  1BSG A;  3V3S A;  3TG9 A;  5F1F A;  3UE6 A;  3MF0 A;  2O0Y A;  2KLI A;  5IS1 A;  3IX3 A;  3GR2 A;  3L7H A;  3DBA A;  3TE8 A;  3GSG A;  4S2O A;  3KSG A;  3WS5 A;  4KUK A;  2H5S A;  3Q7V A;  5U47 A;  3V5M A;  1TS6 A;  2XSS A;  2ZM0 A;  1O07 A;  4WN5 A;  3MFD A;  2OWJ A;  1K6S A;  3N8S A;  1V9Z A;  4NXG A;  3VFF A;  3WS0 A;  3UDF A;  4KZA A;  3SS3 A;  2WZZ A;  4WM9 A;  1BUE A;  1HTZ A;  5DKL A;  4Z1W A;  2EXB A;  3MKF A;  2ACG A;  3NDE A;  1NLY A;  2ZLY A;  4LV1 A;  3VV4 A;  4HBT A;  5F1G A;  2W1T A;  3E4P A;  4P85 A;  5F69 A;  3NCK A;  5HPF A;  3IXD A;  4N9K A;  1T1A A;  3MSH A;  5FAO A;  1CEF A;  2X02 A;  3ZYT A;  1S4S A;  2K31 A;  4LCL A;  4NXF A;  3EQV A;  4I3I A;  5CEB A;  1ES2 A;  2EFU A;  3HJK A;  2V1B A;  4DDS A;  3ZNY A;  4QPR A;  4IED A;  4CLC A;  4BMW A;  3D4F A;  2ZC3 B;  3PBN A;  2ZQ9 A;  4FUW A;  3EOI A;  1EW0 A;  2V20 A;  4IVK A;  5FQQ A;  1HLU P;  4DMZ A;  4E6W A;  3BY9 A;  4BWI A;  5I94 A;  4I3A A;  4YOF A;  4X53 A;  4N1H A;  1LL5 A;  2P9V B;  3UDX A;  4E3M A;  3ITA A;  3H82 A;  1CEG A;  2H0T A;  3EGD C;  3C4O A;  4KUO A;  3UPN A;  2CC1 A;  2WYX A;  4N92 A;  2HZ5 A;  5J7E A;  5KZH A;  4CLC D;  1P9W A;  3OC2 A;  1OTD A;  4HJ4 A;  3ICY A;  3FYZ A;  1LI9 A;  1BLP A;  3HLG A;  3RH8 B;  4LV3 A;  4PM7 A;  3KSI A;  3LIE A;  3HRE A;  1G6O A;  2BTF P;  2VV6 A;  3CUE A;  3MQQ A;  4KZ3 A;  3UE0 A;  1KE3 A;  2HF6 A;  3A3E A;  4E3K A;  2I9V A;  3UB8 A;  1N4O A;  1PI5 A;  1SKO B;  3BLS A;  3BFE A;  2Y55 A;  2JKR M;  4WMC A;  5EFW A;  1H8Z A;  1Y54 A;  4JXV A;  2P08 A;  4GOG A;  1HZO A;  1W8Y A;  2WK0 A;  5EVL A;  4JGO A;  2OLU A;  3IWO A;  4Y0U A;  4DJ3 A;  3IXB A;  4CJN A;  4FSF A;  3CZD A;  1XKZ A;  5HD5 A;  2XA7 S;  1XA7 A;  3LGO A;  5TBM A;  3M2K A;  1XFN A;  2G2U A;  3W2Z A;  3F1N B;  2Q0O A;  2XD1 A;  1XX2 A;  3JYI A;  1MWS A;  5F83 A;  1DP9 A;  4WMC D;  5HSQ A;  3C7V A;  3T4K A;  4GN2 A;  4FTX A;  5FDS A;  2OWH A;  2VX8 A;  4EW7 A;  4LLO B;  3ZGA B;  4PAU A;  3LR4 A;  1K4E A;  2E8J A;  4MN6 A;  5GHZ A;  5F6A A;  1MBL A;  2H28 A;  2JHE A;  5EV0 A;  3S22 A;  4Y15 A;  4MDZ A;  4R70 A;  2X01 A;  1KGF A;  1OTA A;  2EX9 A;  4L9G A;  5GLA A;  3L9K A;  3CPT A;  4KQO A;  4PM9 A;  3T4T A;  3VSK A;  1MKI A;  2WKQ A;  5G4Y A;  1ONG A;  2VK3 A;  4EBL A;  2VGL S;  1K54 C;  2PDR A;  5HFO A;  4WEK A;  3ZFZ A;  4ID4 A;  1FCO A;  4DJ2 A;  1YLZ A;  3IF6 A;  5DVA A;  3BJN A;  1UGU A;  5FQJ A;  4ZBE A;  3B33 A;  1BLC A;  2JKF A;  3GEC A;  4OPR A;  4HOI A;  2HJ9 C;  1QME A;  1F5M A;  2D01 A;  3HUO A;  2B18 A;  4YIN A;  3FZC A;  3WWX A;  3LIB A;  1S0W A;  3CI6 A;  4UAA A;  5FQ9 A;  2J7V A;  3VP2 A;  5G18 A;  3GQZ A;  1VHM A;  5E2H A;  4H8R A;  1T1C A;  2HP5 A;  3IH8 A;  5DTK A;  1YKD A;  4LPZ A;  3T1X A;  2AVX A;  2Y2J A;  2Q9N A;  5HX9 A;  2Y2I A;  1RP5 A;  2XRO A;  5EE8 A;  2EX8 A;  3K3D A;  4X56 A;  4IVI A;  4UA7 A;  1S1Y A;  1IYO A;  2ZQD A;  5TR7 A;  4Q8I A;  5GHX A;  2P9V A;  3HBR A;  1VQQ A;  1LT0 A;  3LYX A;  4Q0J A;  4P87 A;  2HDQ A;  1XGI A;  1H8M A;  3LI9 A;  1ZHH B;  4GJ4 A;  4BL3 A;  5E2F A;  1TS8 A;  2J3T C;  4F94 A;  2L4R A;  4E3I A;  4HNB A;  1XGJ A;  3MXS A;  1M40 A;  4K91 A;  2ZMV A;  2O9C A;  2WKE A;  3PBO A;  4S2N A;  5EVI C;  5C5K A;  1O7E A;  4JGQ A;  1F9I A;  1CQA A;  3SH7 A;  3MFX A;  3BFD A;  3N4I A;  3G4P A;  3F1P A;  3BFF A;  2WGV A;  4OVD A;  3CIT A;  5EM0 A;  3T4J A;  4HP4 A;  3PBQ A;  2LB9 A;  3DTI A;  1IKG A;  3F1O A;  4OQI A;  3SS5 A;  1F98 A;  3Q82 A;  5FSR A;  3KYQ A;  3LO7 A;  4MBK A;  2W3G A;  3FKV A;  2WKI A;  1K56 A;  4UQI M;  4X1M A;  4MBF A;  2C5W B;  2QKP A;  1KOU A;  2Y2H A;  3T4Q A;  2VEA A;  2ZQ8 A;  1GSV A;  1SCW A;  4MMN A;  2JKT I;  4IBR A;  3E0Y A;  2EWW A;  4OOY A;  3G32 A;  3Q07 A;  3ZDJ A;  3KYZ A;  4DXB A;  3K2N A;  2ZOH A;  4L0L A;  4WYY A;  5KMW A;  2XD5 A;  1UWN X;  1LSX A;  1K56 D;  4X1L A;  3T50 A;  4OKP A;  1K0K A;  4DKI A;  2Y2M A;  3BEB A;  4LFU A;  3T1S A;  3UO9 A;  4BD1 A;  2PU2 A;  4I3J A;  3LUQ A;  2W3E A;  2INW A;  1VEU A;  2DRW A;  1BLH A;  3E4O A;  2VGK A;  3BM6 A;  1FQG A;  1ES4 A;  4N9L A;  2Z6D A;  1ESI A;  2VV7 A;  1JWV A;  1NWZ A;  1S4R A;  1W63 M;  3MJQ A;  2XFT A;  3VE4 A;  2B95 A;  4O0P A;  3C7U A;  2IWC A;  4OQH A;  4LCM A;  4E04 A;  2XFS A;  2ZQA A;  3ZHH A;  4MN5 A;  1K55 A;  2WAF A;  5M19 A;  4Y2F A;  1IKI A;  4HI4 A;  1Z09 A;  2VLG A;  2VA0 A;  3KYE A;  4K0W A;  3DTE A;  1YAX A;  5K5B A;  3PTE A;  4EQI A;  3Q81 A;  5I5L A;  1OT6 A;  2BG1 A;  1H3Q A;  3T1R A;  2WAE A;  4EQ1 A;  3LR3 A;  4Y17 A;  5HAR A;  1NYY A;  3QNB A;  5FI7 A;  4NET A;  1YSQ A;  3OPR A;  3NOP C;  2QJ7 A;  5FQM A;  2HJE A;  2BAS A;  1KGE A;  1DP6 A;  5F68 A;  4KZB A;  2WKR A;  4R3B A;  5CEC A;  3E98 A;  4GHI A;  4NG2 A;  3MZE A;  4DE3 A;  4DDY A;  2OLV A;  3UME A;  1YM1 A;  1ERM A;  2WUQ A;  1IOU A;  1OTB A;  4C6Y A;  1H5X A;  2PU4 A;  3HVF A;  3PHY A;  3N8L A;  3O88 A;  5HDD A;  3C8C A;  4DXC A;  5DFX A;  5CTN A;  2LB5 A;  1PI4 A;  2E8I A;  2O9B A;  1T18 A;  4OLG A;  1LSW A;  5GLD A;  2V2F F;  1SZV A;  3DTM A;  1KVL A;  2A24 A;  3IQA A;  1L0E A;  4PKY G;  3VMA A;  2VKS A;  3PYP A;  5CED A;  1W7F A;  3CJM A;  2ZJ9 A;  3N6I A;  3P98 A;  3PAG A;  4WUJ A;  5L10 A;  3DW0 A;  3K3C A;  3GVB A;  4JXW A;  2CMN A;  4K08 A;  2FH5 A;  4KZ8 A;  3HLF A;  2XQZ A;  4ARZ A;  1BT5 A;  4EEU A;  5A93 A;  5HL6 A;  1YLT A;  2Y2K A;  4FCF A;  3ITB A;  5FI6 A;  3WRT A;  1ES5 A;  3IS2 A;  1LHY A;  3N8R A;  3VOL A;  1TF1 A;  3R7W B;  4BL2 A;  1XXM A;  1NZO A;  4BBT A;  2KOI A;  4KZ7 A;  5AVF A;  3S7Q A;  1XJ3 A;  1Y4O A;  3OPP A;  1GA0 A;  2PD8 A;  3HLW A;  3OPH A;  4RA7 A;  3BFC A;  3MXR A;  1VET B;  1JTD A;  5CHU A;  1XJ6 A;  1W63 Q;  3MS6 A;  4B93 A;  1LI0 A;  3M6B A;  3UB9 A;  2L1M A;  3CHW P;  2FFY A;  4Z9Q A;  5CGX A;  3NIA A;  5EOE A;  1NRF A;  5FQI A;  1KE4 A;  4KZ6 A;  4ESP A;  4HJ6 A;  2KX6 A;  2WGW A;  1DP8 A;  3PR6 A;  4CLC E;  3W4O A;  5CXW A;  2PAV P;  4GD6 A;  3UPO A;  2M7U A;  1L0F A;  3QNC A;  3DTK A;  4LGW A;  4G3K A;  3QP1 A;  1CJF A;  5AQ9 A;  4M3K A;  2ZM2 A;  1FSY A;  1K38 A;  1KGG A;  1M6K A;  5DF7 A;  3VE3 A;  3C4P A;  3W4P A;  4GS9 A;  2X71 A;  1BLS A;  4HY8 A;  2Y2P A;  3JPU A;  3PXP A;  2M7V A;  5L2F A;  1N9N A;  2NUT C;  4PM8 A;  1BZA A;  3HJI A;  4PMA A;  2K2N A;  4GW9 A;  3MMH A;  4B4X A;  3BWL A;  5TFQ A;  4R3A A;  3MQ0 A;  1S6R A;  1PZO A;  3UB7 A;  2XA7 M;  4D60 A;  3LFV A;  1GCE A;  1MY8 A;  2JBF A;  4ZJ2 A;  4H6J A;  1S1Z A;  3B47 A;  1G68 A;  2DCF A;  4JXG A;  4Y0T A;  2XRN A;  4NK3 A;  3H7W B;  3VP0 A;  3UE3 A;  1KDW A;  3NOU C;  3O5Y A;  4MBH A;  2WKP A;  3H9W A;  1U60 A;  4JGP A;  4QU3 A;  4XT2 B;  1DJC A;  5EOO A;  1YMX A;  1T19 A;  2NUP C;  1NY0 A;  3S7N A;  3NUL A;  3OLO A;  3A0V A;  5KSH A;  3HLC A;  2XEP A;  5EVI B;  1NXY A;  3PBR A;  1FIK A;  3FWL A;  4HIA A;  3T12 B;  3A0S A;  1XA1 A;  4EXO A;  1XFQ A;  4P0M A;  2PR6 A;  4X68 A;  1OT9 A;  4S2P A;  1NJ4 A;  2EFX A;  1FSW A;  2B02 A;  3UDI A;  4MCW A;  2VGL M;  3ISG A;  4ME4 A;  4ZDX A;  3O86 A;  1A0K A;  1YMS A;  1X0O A;  2UWX A;  4GDN A;  3C30 A;  5GHY A;  1PZP A;  2I72 A;  1K25 A;  1J3W A;  2V8F A;  3IF6 C;  1PWC A;  3N7W A;  3VP1 A;  3E2K A;  4KQQ A;  3P09 A;  3D3O A;  3BQ8 A;  1IEM A;  1HVB A;  4OON A;  3T4S A;  5DKK A;  3KO6 A;  2GDN A;  3PBS A;  2W3H A;  2HP6 A;  3GV9 A;  3B42 A;  4WZ5 A;  4MEZ A;  1PYY A;  1ZG6 A;  4OPQ A;  5DJT A;  4RVA A;  2ZQC A;  4KZ4 A;  4R4S A;  3W8K A;  4LRZ E;  3HLB A;  4S2M A;  2Y79 A;  5DF9 A;  3ULF A;  5CRF A;  1STZ A;  2YKH A;  3E4Q A;  4R6L A;  2A3U A;  1MWR A;  1ZTU A;  3GTC A;  4HHD A;  1AXB A;  1XJ4 A;  2BLS A;  1K54 A;  4DRT A;  3OPL A;  3IF5 A;  5HZH A;  2V8C A;  1D7E A;  3B3X A;  3LID A;  1ES3 A;  3ZVT A;  4E3O A;  4JF4 A;  2QWS A;  1MXO A;  4PM5 A;  5DJU A;  1MPL A;  2JCH A;  2W3D A;  1MC0 A;  5FAT A;  1FOF A;  2IA2 A;  3HUN A;  5FA7 A;  3UB5 P;  1SKF A;  3RXX A;  1K57 C;  2EWV A;  3MZF A;  5LBR A;  1WYC A;  5CGS A;  2QPN A;  4JKT A;  3FKW A;  3D72 A;  3QP6 A;  3RXW A;  2JKT M;  2G7U A;  4NXB A;  5BOH A;  5F5Y A;  2Z6C A;  1W8Q A;  3TJZ C;  4QB8 A;  3G2Z A;  3QP8 A;  3IX4 A;  1BYW A;  4C75 A;  3IX8 A;  4MNR A;  1SKO A;  4FOF A;  5HD3 A;  2W3F A;  3A3F A;  1MWT A;  4Y13 A;  1ZG4 A;  4QWO A;  5HWW A;  3I7J A;  4LV2 A;  4P6Z S;  4U0X A;  4OP8 A;  4MN7 A;  4F3L B;  2W27 A;  2KDK A;  3G34 A;  1RCJ A;  1LLB A;  4EET B;  2GX5 A;  4XT2 A;  5IU1 A;  1MKM A;  1PWG A;  2VJW A;  3F1N A;  3NBL A;  3IHB A;  3WRZ A;  4UA9 A;  2ZL1 B;  1MWU A;  3C38 A;  1GSW A;  4ZAM A;  2V1A A;  5FAQ A;  5CHJ A;  1WYB A;  1NYM A;  2YKF A;  1I2S A;  4I39 A;  4HP9 A;  2J3T D;  1JWZ A;  3V3R A;  3OZH A;  5E43 A;  4KZ5 A;  3DAV A;  4EWF A;  2PRF A;  3HL9 A;  5E2G A;  4I5S A;  3LY3 A;  2VGJ A;  2ZD8 A;  4FD8 A;  3SW1 A;  3UE1 A;  1VB6 A;  1YLJ A;  5M1A A;  2W1T B;  4R4R A;  1T1B A;  4WEL A;  1SDE A;  1OJ5 A;  2Y2G A;  1WE4 A;  4XUZ A;  4QJG A;  2EX2 A;  3TRC A;  4E6X A;  3Q1F A;  1YLY A;  3A0R A;  2PBD P;  1YLP A;  5AJG A;  5JYP A;  4BJP A;  5HAI A;  2XF3 A;  4NKP A;  3BYD A;  5EPH A;  1YT4 A;  2O99 A;  5IHV A;  4QY5 A;  1D06 A;  4RQ9 A;  1Q2Q A;  4CLC B;  1GHM A;  5CER A;  2L0W A;  3UMD A;  1IYQ A;  4GDB A;  1YQS A;  3GDI A;  3ZG7 B;  3UB6 A;  2RL3 A;  3LEQ A;  1DJB A;  4R0Q A;  1FIL A;  2V1Z A;  2G2W A;  2XK1 A;  2VZW A;  4Y7P A;  3H82 B;  3KSF A;  4JBF A;  2A2L A;  2PT7 A;  4BLM A;  4X69 A;  1BUL A;  3G31 A;  1ZKJ A;  5GLB A;  3A3I A;  4CQH A;  2ZM8 A;  3NC8 A;  4N1X A;  2V9A A;  3DWZ A;  5AQ7 A;  1BTL A;  1L2S A;  3P7N A;  4WEJ A;  1DJA A;  3JVU A;  5EVE A;  5TJJ A;  2Y8H A;  2Z2L B;  5DTT A;  4YFM A;  1ZC2 A;  1IYP A;  1ERQ A;  1PNE A;  3AGD A;  1G6A A;  1PW8 A;  1OJG A;  3NY4 A;  2HDR A;  1Z6F A;  3FC7 A;  5HAP A;  1CK3 A;  5KSC A;  1FCN A;  3MXQ A;  4NXE A;  1ESU A;  5FAP A;  2XH9 A;  5HDS A; 
#chains in the Genus database with same CATH homology
 2R9X A;  4OPR A;  3IHA A;  4S2J A;  2RCX A;  1PW1 A;  5F82 A;  3TOI A;  1QME A;  1ONH A;  4E3L A;  4B4X A;  2JC7 A;  1CI8 A;  1YLW A;  1E3U A;  3HLE A;  5TFQ A;  3HUO A;  4RX3 A;  1S6R A;  4YIN A;  1PZO A;  3FZC A;  4RX2 A;  3WWX A;  2EXA A;  4LV0 A;  3ZG5 A;  1S0W A;  1GCE A;  4UAA A;  1MY8 A;  5E2E A;  2J7V A;  5FQ9 A;  3VP2 A;  2JBF A;  5G18 A;  4ZJ2 A;  3GQZ A;  5E2H A;  4H8R A;  4DE1 A;  1TVF A;  2HP5 A;  1K55 C;  3IH8 A;  5DTK A;  1G68 A;  4KG5 A;  2WGI A;  3VOZ A;  3AGE A;  2Y2J A;  5CGW A;  2DCF A;  4GKU A;  2Q9N A;  2WKH A;  3FV7 A;  4JXG A;  4R23 A;  5HX9 A;  4Y0T A;  2Y2I A;  1RP5 A;  3M6H A;  4NK3 A;  2HDU A;  5EE8 A;  2EX8 A;  3VP0 A;  3IT9 A;  3O3V A;  4X56 A;  3UE3 A;  1KDW A;  4IVI A;  4PPR A;  4UA7 A;  5DTS A;  3W4Q A;  2WGW B;  3OCN A;  4MBH A;  1IYO A;  3E2L A;  2ZQD A;  4OOM A;  1U60 A;  4GNU A;  5TR7 A;  1E3U D;  4HEF A;  4ZTK A;  5HAQ A;  4Q8I A;  4QU3 A;  5GHX A;  2P9V A;  3HBR A;  1DJC A;  2ZC5 B;  1VQQ A;  5EOO A;  5HL1 A;  4OLD A;  5GLC A;  1KVM A;  1YMX A;  2Y2L A;  1E4D A;  1NY0 A;  4OPZ A;  2P74 A;  1DY6 A;  1J9M A;  4P87 A;  2HDQ A;  1W79 A;  1XGI A;  5KSH A;  4U3T A;  3HLC A;  3SOI A;  3IH9 A;  4BL3 A;  2XEP A;  5E2F A;  5EVI B;  1NXY A;  3PBR A;  3FWL A;  3ZVW A;  4R1G A;  1QMF A;  4F94 A;  1XA1 A;  4FH2 A;  4E3I A;  4P0M A;  1XGJ A;  3MXS A;  4E3J A;  2J9O A;  2R9W A;  4X68 A;  1M40 A;  4S2P A;  1NJ4 A;  2EFX A;  4K91 A;  1ERO A;  5FI2 A;  1FSW A;  2WKE A;  3BRM A;  3PBO A;  4S2N A;  5JYO A;  2C6W B;  2EX6 A;  4IBX A;  4QY6 A;  3NI9 A;  5EVI C;  3UDI A;  4S2K A;  1XP4 A;  2H10 A;  1O7E A;  3IXG A;  4RYE A;  2HPB A;  3IF6 B;  4KQR A;  3ISG A;  4BD0 A;  3DWK A;  2WZX A;  1PIO A;  4JPM A;  2OSU A;  4ZDX A;  3GRJ A;  3SH7 A;  3BFD A;  3O86 A;  1YMS A;  1IEL A;  1CI9 A;  2UWX A;  4GDN A;  2XDM A;  4OP5 A;  3N4I A;  3SS4 A;  4O7D A;  5GHY A;  1PZP A;  2I72 A;  1K25 A;  3LCE A;  3G4P A;  4BEN A;  2Y59 A;  5DF8 A;  3IF6 C;  4EUZ A;  2A49 A;  4OQ0 A;  3BFF A;  1PWC A;  2WGV A;  2FFF B;  3N7W A;  4KG6 A;  4OVD A;  5A92 A;  3VP1 A;  3PBQ A;  3G30 A;  3E2K A;  4KQQ A;  3P09 A;  1OME A;  3ZNT A;  1IEM A;  1HVB A;  2PBY A;  4S2L A;  3MZD A;  1IKG A;  3VFH A;  1Q2P A;  5HW3 A;  4OON A;  2WAD A;  4OQI A;  3SS5 A;  3RJU A;  3PBS A;  2GDN A;  3Q82 A;  5FSR A;  4MBK A;  3LO7 A;  4A5R A;  2HP6 A;  4Y0O A;  3FKV A;  3GV9 A;  2QZ6 A;  4WZ5 A;  2WKI A;  3VP4 A;  1K56 A;  4MEZ A;  3BFG A;  5TGF A;  2OV5 A;  4DE0 A;  4MBF A;  2C5W B;  1PYY A;  1ZG6 A;  4OOL A;  4OPQ A;  4B88 A;  3VP3 A;  2Y2H A;  4HES A;  4RVA A;  2ZQC A;  4KZ4 A;  3HUM A;  3C5A A;  1N9B A;  2ZQ8 A;  4R4S A;  3W8K A;  3IXH A;  1RGY A;  1SCW A;  2H0Y A;  1JTG A;  3M2J A;  4B4Z A;  4IBR A;  3HLB A;  1KE0 A;  3LEZ A;  4S2M A;  1JWP A;  4OOY A;  4X6T A;  5DF9 A;  3BLM A;  2Q9M A;  5CRF A;  3G32 A;  3Q07 A;  3TSG A;  3ZDJ A;  5J8X A;  3UY6 A;  4DXB A;  2ZC4 B;  2HP9 A;  4KEN B;  4P6B A;  1BSG A;  3V3S A;  4L0L A;  3TG9 A;  5F1F A;  3VOY A;  4WYY A;  2A3U A;  5EEC A;  1MWR A;  5KMW A;  1ALQ A;  2XD5 A;  3GR2 A;  3GTC A;  3CG5 A;  1K56 D;  1AXB A;  2BLS A;  3GSG A;  4S2O A;  4OKP A;  4DKI A;  4OQG A;  2Y2M A;  1K54 A;  3AGF A;  4DF6 A;  3BEB A;  4DRT A;  3OPL A;  3IF5 A;  3WS5 A;  3UO9 A;  4BD1 A;  1SHV A;  3GMW A;  2PU2 A;  2H5S A;  3OCL A;  1W5D A;  3B3X A;  3Q7V A;  2B5R A;  5U47 A;  1ES3 A;  2DRW A;  3V5M A;  3ZVT A;  1K4F A;  4JF5 A;  4E3O A;  1BLH A;  4JF4 A;  2VGK A;  2ZM0 A;  3BM6 A;  1MXO A;  4PM6 A;  4PM5 A;  1O07 A;  1FQG A;  1L0D A;  1ES4 A;  4N9L A;  1MPL A;  1TEM A;  4R3J A;  1ESI A;  1XPB A;  3MFD A;  1K6S A;  3N8S A;  1JWV A;  2JCH A;  5FAS A;  5FAT A;  2XFT A;  1FOF A;  3VFF A;  3WS0 A;  1TDL A;  3UDF A;  3ZG9 B;  3HUN A;  4KZA A;  3SS3 A;  3IWQ A;  2WZZ A;  4WM9 A;  5FA7 A;  1BUE A;  1HTZ A;  1SKF A;  3C7U A;  3RXX A;  2EXB A;  1K57 C;  2IWC A;  3ZG8 B;  4OQH A;  4JF6 A;  3MZF A;  4LCM A;  3MKF A;  1WYC A;  5CGS A;  2QPN A;  3NDE A;  4JKT A;  2XFS A;  2ZQA A;  3ZHH A;  4LEN A;  4XXR A;  3FKW A;  2ZLY A;  3RXW A;  4LV1 A;  5A90 A;  4HBT A;  1K55 A;  2WAF A;  3NDG A;  5F1G A;  4C3Q A;  5M19 A;  4X55 A;  5BOH A;  1IKI A;  4CPK A;  1W8Q A;  4P85 A;  4QHC A;  3PAE A;  4QB8 A;  3G2Z A;  3NCK A;  3HLD A;  4K0W A;  4EBN A;  4C75 A;  2JE5 A;  3IXD A;  4N9K A;  5AQA A;  3V39 A;  4MNR A;  3PTE A;  1NZU A;  4OPY A;  5D3O A;  5FAO A;  1CEF A;  3VSL A;  4DE2 A;  1C3B A;  4EQI A;  2X02 A;  3A3F A;  3Q81 A;  1MWT A;  2BG1 A;  1ZG4 A;  2DNS A;  2WAE A;  4WZ5 C;  5FDH A;  3I7J A;  4LCL A;  4LV2 A;  4XUX A;  3EQV A;  3S4X A;  5CEB A;  4U0X A;  5HAR A;  1ES2 A;  2EFU A;  4OP8 A;  1NYY A;  3WS2 A;  3QNB A;  4DDS A;  3ZNY A;  5FI7 A;  2J9P A;  4NET A;  3OPR A;  2IWB A;  3G34 A;  1RCJ A;  2ZC7 A;  4IED A;  1LLB A;  3A3J A;  5FQM A;  3UPP A;  4UA6 A;  4UHU A;  3D4F A;  1KGE A;  4GZB A;  1PWG A;  2ZC3 B;  3PBN A;  3O87 A;  4KZB A;  4R3B A;  5CEC A;  3NBL A;  2ZQ9 A;  3IHB A;  3WRZ A;  3MZE A;  3EQU A;  4ZJ3 A;  4DE3 A;  4DDY A;  1H8Y A;  2HDS A;  2ZQ7 A;  2OLV A;  2V20 A;  4IVK A;  5FQQ A;  4E6W A;  4GB7 A;  4UA9 A;  1YM1 A;  1ERM A;  1MWU A;  4D2O A;  5I94 A;  2WUQ A;  4X53 A;  4N1H A;  4ZAM A;  4C6Y A;  1H5X A;  1SDN A;  5FAQ A;  5CHJ A;  1WYB A;  1NYM A;  2PU4 A;  3HVF A;  1LL5 A;  2P9V B;  3UDX A;  3N8L A;  4E3M A;  3O88 A;  1GHI A;  3ITA A;  1RGZ A;  1I2S A;  1CEG A;  4DXC A;  2H0T A;  5CTN A;  3C4O A;  1PI4 A;  2E8I A;  2CC1 A;  3UPN A;  2WYX A;  4N92 A;  1JWZ A;  3V3R A;  5KZH A;  3OZH A;  4OLG A;  3OC2 A;  5E43 A;  4KZ5 A;  2Y2O A;  4HBU A;  4EWF A;  5GLD A;  3FYZ A;  3HL9 A;  2V2F F;  1LI9 A;  1BLP A;  1KVL A;  3DTM A;  3IQA A;  3HLG A;  5E2G A;  1L0E A;  3LY3 A;  4E3N A;  4LV3 A;  3CMZ A;  1TDG A;  2VGJ A;  2ZD8 A;  4PM7 A;  3VMA A;  4FD8 A;  3HRE A;  3UE1 A;  4FH4 A;  3SH8 A;  1YLJ A;  5CED A;  1W7F A;  3CJM A;  2ZJ9 A;  3N6I A;  3P98 A;  3PAG A;  4WZ4 A;  5M1A A;  4R4R A;  3DW0 A;  3QHY A;  5CHM A;  4KZ3 A;  3UE0 A;  4WEL A;  1KE3 A;  1SDE A;  3WS1 A;  3GVB A;  4JXW A;  1FR6 A;  3A3E A;  3G35 A;  1I5Q A;  4ZJ1 A;  4U0T A;  4KZ8 A;  4E3K A;  3HLF A;  1EI5 A;  2Y2G A;  2XQZ A;  1WE4 A;  2Y2N A;  4XUZ A;  4QJG A;  1N4O A;  1PI5 A;  1BT5 A;  1HD8 A;  2EX2 A;  3BLS A;  3LY4 A;  4S2I A;  3BFE A;  2Y55 A;  3BEC A;  4WMC A;  3IWI A;  1H8Z A;  1Y54 A;  4JXV A;  4E6X A;  5A93 A;  1YLT A;  2Y2Q A;  3Q1F A;  4MLL A;  4GOG A;  1VM1 A;  1YLY A;  2J8Y A;  2Y2K A;  1HZO A;  1W8Y A;  2WK0 A;  2IWD A;  4FCF A;  4S2N C;  3ZCZ A;  5EVL A;  3ITB A;  5FI6 A;  3WRT A;  2OLU A;  1ES5 A;  3Q7Z A;  3IWO A;  1YLP A;  4Y0U A;  3IXB A;  5JYP A;  1LHY A;  4BJP A;  4CJN A;  5HAI A;  3WS4 A;  2XF3 A;  5EPH A;  3BYD A;  4FSF A;  3CZD A;  1YT4 A;  1XKZ A;  3N8R A;  3PBT A;  5IHV A;  1I2W A;  4QY5 A;  1IYS A;  3S1Y A;  1Q2Q A;  1XA7 A;  1GHM A;  3M2K A;  2G2U A;  1K6R A;  5CER A;  4BL2 A;  2XLN A;  1XXM A;  1IYQ A;  4GDB A;  1NZO A;  1FR1 A;  2XD1 A;  1XX2 A;  1YQS A;  3JYI A;  4K0X A;  4KZ7 A;  3SH9 A;  3ZG7 B;  3OPP A;  1EWZ A;  1JVJ A;  1MWS A;  1GA0 A;  3HLW A;  2RL3 A;  3OPH A;  5F83 A;  4WMC D;  3C7V A;  4GN2 A;  4RA7 A;  2Y4A A;  3BFC A;  3V50 A;  1PWD A;  1L0G A;  3MXR A;  1DJB A;  4EBP A;  4R0Q A;  4EV4 A;  2V1Z A;  1JTD A;  2G2W A;  3ZGA B;  5CHU A;  3UNW A;  2XK1 A;  1K4E A;  5AQB A;  2XGN A;  2XR0 A;  4Y7P A;  5GHZ A;  1LI0 A;  3M6B A;  3MBZ A;  2FFY A;  1MBL A;  4GD8 A;  4Z9Q A;  4JBF A;  5CGX A;  3NIA A;  5EOE A;  2ZC6 B;  4BLM A;  4OH0 A;  3S22 A;  1NRF A;  1KDS A;  5FQI A;  1KE4 A;  4KZ6 A;  2WGW A;  4X69 A;  2ZMA A;  2X01 A;  1KGF A;  1BUL A;  3G31 A;  1LL9 A;  2EX9 A;  1ZKJ A;  5M18 A;  5GLB A;  3W4O A;  4JLF A;  3A3I A;  1K57 A;  3UN7 A;  5GLA A;  2ZM8 A;  2Y91 A;  5CXW A;  3A3D A;  3NC8 A;  4N1X A;  4KQO A;  4KG2 A;  3ZG0 A;  4GD6 A;  3UPO A;  3DWZ A;  5AQ7 A;  4PM9 A;  1BTL A;  4QD4 A;  1L2S A;  5FQK A;  1L0F A;  3Q7V B;  3QNC A;  4WEJ A;  5EVI A;  5CTM A;  1GA9 A;  3VSK A;  4WBG A;  1DJA A;  1MKI A;  5AQ9 A;  2Z2L B;  4M3K A;  5DTT A;  1ONG A;  2ZM2 A;  4YFM A;  4EBL A;  1FSY A;  1K38 A;  1KGG A;  1M6K A;  1ZC2 A;  1K54 C;  5DF7 A;  3C4P A;  3G2Y A;  4BQM A;  1IYP A;  1ERQ A;  3W4P A;  1GHP A;  3AGD A;  1G6A A;  2X71 A;  1BLS A;  5GL9 A;  1PW8 A;  4WEK A;  5HFO A;  3ZFZ A;  2Y2P A;  3NY4 A;  4ID4 A;  2HDR A;  4KZ9 A;  1FCO A;  5L2F A;  1YLZ A;  1Z6F A;  2QMI A;  4JXS A;  3IF6 A;  2Z2M B;  5DVA A;  5HAP A;  5A91 A;  1FCM A;  5FQJ A;  1CK3 A;  5KSC A;  4ZBE A;  3MKE A;  1FCN A;  4PM8 A;  1BZA A;  1ESU A;  1BLC A;  5FAP A;  4PMA A;  5EUA A;  2XH9 A;  5EVI D;  1E25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...