5KZHA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
239
Chain Sequence
DEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 79
structure length 239
sequence length 240
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kzhA00
3G35A 3MBZA 3ZGAB 1PYYA 3WS4A 1N4OA 1Z6FA 4R4SA 3ZDJA 2RCXA 3HLDA 3FZCA 4Z9QA 4P85A 4OQIA 1XGJA 3FYZA 1YMXA 3BECA 5EECA 2HDSA 3LEZA 3CJMA 5CERA 3VSLA 3N6IA 4S2PA 1YMSA 3GVBA 4QU3A 2WADA 4XUXA 2OV5A 2ZJ9A 3RJUA 4RVAA 1WYCA 4KZBA 3V3SA 1J9MA 1FQGA 1JTDA 3WS5A 4EBPA 2EFXA 3HUOA 1NJ4A 1PI4A 1C3BA 2H0TA 2ZQ7A 3N8LA 1QMFA 1H8ZA 2V20A 1RGZA 1CI9A 1RP5A 2DNSA 3UDIA 4KQOA 2P9VA 1GA0A 3A3DA 4KZ7A 4N9LA 5FQ9A 3ITAA 3N8SA 2EXBA 5EVIB 1G6AA 2HDUA 2R9WA 2PU4A 3HLWA 4GDBA 1FR6A 1GHMA 4JXVA 3UPPA 4IEDA 1IKGA 1I2WA 2B5RA 4DDYA 4Q8IA 1BLSA 5EOOA 1O07A 5FA7A 5CEBA 3IF5A 2HP9A 2WAEA 3V3RA 1XA1A 3G32A 3VP3A 2EX6A 2OLUA 1BUEA 1FOFA 4OOMA 2G2WA 3QHYA 1WYBA 4JXGA 1ONHA 3CMZA 2Y59A 4KZ8A 2XD1A 4GB7A 3G31A 3UN7A 4GOGA 2XEPA 2XFSA 1W8QA 4FD8A 4LV3A 5CHMA 2Y2LA 1OMEA 1YQSA 4IVIA 5DTTA 3G30A 5E2HA 1HVBA 3G34A 5GLAA 4JXSA 3BRMA 4P6BA 3UE3A 5JYPA 2J9OA 1CEFA 1IEMA 2PBYA 3PBQA 4E3LA 4WM9A 3HVFA 1BLHA 1FCNA 4XUZA 2E8IA 5FQMA 4BQMA 1XXMA 1E3UA 3PBOA 1E4DA 1YLTA 4ID4A 4S2NA 3NY4A 4BENA 1FR1A 3FKVA 5JYOA 4OOLA 1ERMA 1BTLA 3CZDA 3PBNA 4IBRA 5HAPA 2QMIA 3GSGA 3PBRA 3C5AA 1K4EA 1PZPA 1YT4A 1XP4A 3PAEA 2FFYA 4WYYA 2J7VA 3NC8A 2ZC7A 1AXBA 3SS5A 4WZ5A 4QY6A 4WEJA 4JBFA 1ES3A 1XA7A 5CHJA 5GHZA 1E3UD 4KZ5A 4BD1A 1W5DA 1L2SA 4MLLA 1FSWA 2JE5A 2Y2PA 3M2KA 1H8YA 4WZ5C 4HEFA 2Y2QA 2Z2MB 3P98A 3S4XA 3VFHA 2ZC3B 5HAIA 4BJPA 2VGKA 5FQQA 3MZDA 1VM1A 2PU2A 1LHYA 3TSGA 4S2JA 4H8RA 4UHUA 3WS1A 3BLMA 2XDMA 1M6KA 1LLBA 2ZQAA 2WYXA 4S2NC 2V1ZA 5FATA 1SHVA 2FFFB 1XGIA 1ALQA 4LCMA 1DJCA 4JPMA 4ZBEA 1KE0A 3PTEA 2ZQCA 5TGFA 4OQGA 3Q81A 4L0LA 5EVIA 4LV2A 4HESA 4BD0A 4UA9A 1NZOA 3MFDA 4N92A 5CRFA 5M18A 5CGXA 3TOIA 3VSKA 1PWGA 3AGFA 2ZM8A 5FQKA 2ZQ9A 4PM6A 2V2FF 5EPHA 3VP0A 3VP2A 1NYMA 4FSFA 1BLCA 2Y55A 3SS3A 3MXRA 4QY5A 2R9XA 1XKZA 3ITBA 3VOYA 2WKEA 2XR0A 5E43A 3FWLA 1IYPA 3GV9A 4IBXA 4JXWA 1IYOA 3MZFA 3SH8A 2XH9A 1Q2QA 4E3IA 5HW3A 2ZMAA 1IKIA 1LL5A 4WBGA 4HBTA 4LV0A 1JWZA 4DXCA 3G2ZA 4WELA 1MWSA 5GHXA 3QNCA 4MBHA 3RXWA 3C4PA 5FQIA 1CEGA 1KE3A 1L0DA 2HP5A 3NIAA 4GZBA 1MWUA 4PM5A 4UA6A 3HLEA 1YLJA 5F1GA 4OONA 1EI5A 2WZZA 3UDFA 2IWBA 5KSCA 4GD8A 3DW0A 1U60A 5FAPA 2RL3A 4B88A 3GR2A 1BZAA 3BEBA 5EE8A 1E25A 1LL9A 1SKFA 3O86A 3SOIA 3A3JA 5TFQA 3IXHA 4FH4A 2WK0A 3ZG9B 4Y0TA 4E6XA 5FQJA 4DE1A 4UA7A 3Q7ZA 1L0EA 1MKIA 3HLFA 2ZC5B 4QB8A 4DF6A 3O3VA 2J8YA 3C7VA 1BSGA 3M2JA 5AQ9A 4DKIA 1TDGA 2Q9MA 1PWCA 5CTMA 1HTZA 2X71A 4U0TA 4WMCD 3ZG8B 2Y4AA 5FASA 3IWOA 3G2YA 3WWXA 1EROA 1W7FA 3UPOA 5FI2A 4OOYA 5CHUA 3FKWA 5AQAA 3OCLA 4M3KA 2WAFA 2Y2GA 1NYYA 1MWTA 1JTGA 3BFDA 1HZOA 4PPRA 4YINA 5GL9A 1K55A 3S1YA 3NBLA 3IWIA 3MZEA 1K55C 3EQVA 4X69A 1K57A 4OQHA 4QHCA 1GHPA 3Q7VB 5DF8A 3ZFZA 4E3NA 1HD8A 5G18A 5FDHA 1KVLA 2XD5A 2HDRA 5IHVA 2X01A 5GLCA 4BL2A 1ERQA 1I5QA 4RA7A 5E2EA 1ES2A 3IWQA 4LCLA 4PMAA 5DTKA 3N8RA 1S6RA 5FAQA 2WGWB 2Y2KA 4UAAA 2XFTA 3IF6B 3PBTA 1K54A 3IXBA 3OCNA 2ZQ8A 3Q7VA 2ZC4B 1TEMA 3A3IA 2ZM0A 1LI9A 3OPLA 3SH7A 3V39A 2QPNA 3PBSA 4EWFA 2P9VB 1MBLA 3BFFA 1ZKJA 4A5RA 2WUQA 5E2FA 5EVIC 1TDLA 5J8XA 5CECA 3IH9A 5CXWA 4C75A 2UWXA 4ZJ2A 2GDNA 2G2UA 3IH8A 1K6SA 4DXBA 5L2FA 3E2LA 3WS0A 4OPZA 4KZ6A 3W4PA 4GDNA 3CG5A 3HLBA 4RYEA 3VOZA 2WGWA 4R23A 4S2OA 2OSUA 3OC2A 1IYQA 5GLBA 4ZDXA 4EUZA 3UDXA 3GRJA 3QNBA 5DVAA 3ZNYA 5F1FA 3G4PA 3W8KA 1DJAA 1PI5A 3UNWA 2HPBA 1ES5A 3N7WA 3DTMA 1BT5A 1NRFA 3HLGA 1Q2PA 2P74A 1WE4A 3MXSA 2VGJA 2X02A 1NZUA 1LI0A 1K6RA 4EBNA 4OKPA 5KMWA 1W8YA 3LO7A 2H10A 1SDEA 3ZG7B 1G68A 1JWVA 4BLMA 1YLZA 4K91A 4ZJ3A 3ZG5A 3UPNA 4E3JA 1K25A 1K56D 3DWKA 3OZHA 4XXRA 5HX9A 3AGEA 1FCOA 3BFCA 3ZVWA 2ZQDA 2JBFA 4OPRA 4P87A 1SDNA 1I2SA 2C6WB 2IWDA 3C4OA 4OH0A 1KGEA 3D4FA 1L0GA 4KENB 1XX2A 4YFMA 5KZHA 1MXOA 3SH9A 2H0YA 4DE0A 1RCJA 1NXYA 1BULA 3BFEA 3HUMA 3LY3A 4N1XA 4LENA 1M40A 4C6YA 3UE1A 5M19A 1K4FA 1ZC2A 2Y2MA 5AQ7A 1YLPA 3EQUA 3V5MA 4S2IA 5KSHA 4O7DA 3A3FA 3Q07A 4KQRA 5GLDA 4R1GA 3HL9A 1JVJA 4MEZA 4KQQA 3WRZA 3M6BA 4X68A 3BYDA 4IVKA 4Y0UA 1DY6A 4FH2A 1ES4A 4DRTA 3M6HA 3NDGA 1ESUA 2DCFA 3IQAA 4JKTA 1ZG4A 3HBRA 5HARA 4MNRA 1FSYA 1BLPA 4R3JA 5EUAA 3Q1FA 4KG2A 4ZAMA 1K56A 2EXAA 4X6TA 5A92A 2Q9NA 3BFGA 1MWRA 5FAOA 2JCHA 2EX2A 3OPRA 4OLDA 4ZTKA 4CJNA 2IWCA 4D2OA 2DRWA 3ZCZA 5TR7A 4EV4A 3SS4A 5HL1A 3ISGA 4GNUA 1DJBA 4NETA 4KZ9A 2XLNA 4PM8A 4BL3A 3UE0A 5U47A 5CGSA 3IF6C 1GA9A 2WKHA 1KGFA 2ZD8A 4Y7PA 4DE2A 3IT9A 3HREA 1JWPA 3PAGA 4QD4A 1O7EA 3JYIA 2H5SA 2EX8A 4OPQA 3ZHHA 1PIOA 5I94A 3IHAA 4WMCA 2ZC6B 5F82A 2WGIA 4OP5A 3UO9A 5DF7A 3O87A 3DWZA 3W4QA 2EX9A 2XGNA 3ZNTA 1N9BA 1K38A 3B3XA 4NK3A 2HP6A 3GQZA 3IF6A 4WZ4A 3ZVTA 5HAQA 2XQZA 4FCFA 4OQ0A 3IHBA 4MBFA 2QZ6A 1CK3A 5A91A 4E3KA 3A3EA 2ZLYA 3AGDA 4PM9A 2Y2IA 1GHIA 1KDSA 4R0QA 5D3OA 5F83A 1MY8A 4KZAA 1MPLA 3LY4A 5GHYA 5A93A 2EFUA 1YLYA 2HDQA 2JC7A 4RX3A 3IXGA 1YLWA 2C5WB 2Z2LB 4S2LA 4DE3A 1PW8A 3O88A 2Y2OA 4E6WA 3BM6A 4JF4A 4P0MA 3HLCA 3Q82A 3NCKA 4GD6A 5M1AA 1FCMA 4K0XA 3V50A 2OLVA 1KDWA 1KE4A 2Y2HA 3GMWA 5AQBA 1YM1A 3E2KA 4OVDA 4Y0OA 4JF6A 1PWDA 4E3OA 3FV7A 3VFFA 1IYSA 1ESIA 4JLFA 1NY0A 4OPYA 1RGYA 5EVLA 5EVID 4KZ4A 1CI8A 1PZOA 3VP4A 1PW1A 1EWZA 4X53A 3BLSA 3HUNA 4GKUA 3IXDA 4PM7A 4KG6A 2XF3A 4LV1A 2Y91A 4N1HA 4OLGA 3N4IA 3ZG0A 4WEKA 4ZJ1A 1QMEA 3NDEA 4OP8A 3OPHA 4CPKA 5BOHA 3W4OA 4JF5A 3MKEA 4B4ZA 2XK1A 2BLSA 3S22A 4EBLA 4KZ3A 4RX2A 3TG9A 5HFOA 5CGWA 5DF9A 4B4XA 4DDSA 4S2KA 2I72A 3NI9A 3I7JA 2J9PA 1K54C 3GTCA 2BG1A 1TVFA 5CEDA 2ZM2A 5FI7A 5FSRA 4MBKA 2A3UA 2Y2NA 5DTSA 3OPPA 1S0WA 1ONGA 4R3BA 5E2GA 4HBUA 4S2MA 3RXXA 5EOEA 5A90A 1KVMA 4R4RA 2A49A 1GCEA 4U3TA 4X55A 5FI6A 1H5XA 4GN2A 4K0WA 4QJGA 3UY6A 3WS2A 3VP1A 2CC1A 3C7UA 2WKIA 4U0XA 3MKFA 4N9KA 4X56A 3VMAA 1KGGA 4KG5A 4E3MA 1XPBA 1W79A 1K57C 1Y54A 1ZG6A 3P09A 1L0FA 4EQIA 2Y2JA 1VQQA 5CTNA 2WGVA 4F94A 3LCEA 4C3QA 2WZXA 3WRTA 1SCWA 1IELA
chains in the Genus database with same CATH superfamily
1PYYA 3ZDJA 5K5BA 3HLDA 2M1CA 1XGJA 4CLCA 3VSLA 3N6IA 1YAXA 1P0ZA 4RVAA 3WS5A 4EBPA 3LUQA 2GNXA 2H0TA 2V20A 2DNSA 5FQ9A 1GA0A 3N8SA 5EVIB 1G6AA 2PU4A 2R9WA 3ZYTA 3HLWA 2M7UA 5EM1A 4IEDA 1KOUA 1IKGA 1I2WA 2B5RA 3DAVA 4DDYA 1BLSA 4Q8IA 4UEYA 1WA9A 3EOIA 3FG8A 4MCWA 2G2WA 4OOMA 5HWWA 1ONHA 2Y59A 5DJUA 3G31A 3UN7A 4I39A 4FD8A 3BQ8A 1OMEA 5F6AA 3G30A 3G34A 3UE3A 1CEFA 4O01A 5IT5A 4WM9A 1BLHA 1FCNA 2E8IA 3IS2A 3BW6A 1XXMA 3E4QA 1YLTA 4OOLA 4GS9B 3PBNA 2QMIA 3GSGA 3TW8A 3C5AA 1YT4A 3PAEA 2FFYA 4PAUA 5EVEA 3SS5A 4LPZA 4WLAA 1XA7A 3EEAA 4KZ5A 4BD1A 3C30A 4EU0A 1FSWA 2Y2PA 4WZ5C 1H8YA 3MS6A 2A24A 4BJPA 1TD5A 2PU2A 3TSGA 4MMNA 3BLMA 1V9YA 2WYXA 1F9IA 1N9OA 1XGIA 1ALQA 4ZBEA 2NUPC 1KE0A 2ZQCA 4QPRA 5EVIA 1YSPA 4NXEA 2G7UA 2VGLS 3AGFA 4UQIS 2ZM8A 4ETXA 2ZQ9A 2V2FF 1S1ZA 5EPHA 4FSFA 3RFBA 4FUWA 1XKZA 2XR0A 1VETB 5HL6A 1IYPA 3GV9A 1OTDA 4WBGA 4LV0A 4MDZA 1NLYA 3G2ZA 3GECA 1CEGA 1KE3A 1L0DA 4EUVA 1YLJA 5KSCA 3DW0A 3KO6A 3BEBA 1CF0A 5AJGA 3A3JA 2VGLM 3UB6A 2WK0A 4NEED 4EEUA 4E6XA 3Q7ZA 2ZC5B 1TS6A 1XFQA 1BSGA 2Q9MA 1HTZA 2X71A 2Y4AA 1W7FA 3T4LA 3BFDA 4PPRA 4HJ6A 1K55C 4OQHA 1GHPA 3Q7VB 3F1NB 4CLCD 1KVLA 2XD5A 2PR5A 5IHVA 2X01A 4BL2A 1ERQA 4RA7A 4LCLA 3T4TA 3N8RA 1S6RA 4Y5FA 2PAVP 3IF6B 3V67A 2ZQ8A 2QPNA 4ME4A 1MBLA 1VB6A 3U2AA 2V1AA 1G5UA 2HV1A 5J8XA 4C75A 2UWXA 2GDNA 4HJ3A 1K6SA 5L2FA 3PXPA 3R7WA 4OPZA 3SW1A 4R70A 4RYEA 3VOZA 2JKRI 3SZTA 3OC2A 5GLBA 4B9OA 3GRJA 2QJ5A 3QNBA 1DJAA 1PI5A 1MKMA 3DTMA 4HH3A 1DP8A 1NRFA 3C38A 3HLGA 3QP5A 1WE4A 3O5YA 3G6OA 4EBNA 1W8YA 5C5KA 3KSHA 1SDEA 3ZG7B 1JWVA 3FC7A 4BLMA 4K91A 4ZJ3A 2HGVA 3EWKA 3DWKA 3OZHA 3BFCA 3KSGA 4I3JA 4ETZA 1T19A 1KGEA 5LBRA 3D4FA 4YFMA 3SH9A 4L9EA 5TBMB 4DE0A 1RCJA 1NXYA 4N1XA 5DKKA 2P7JA 4C6YA 3R4KA 1YLPA 4S2IA 4O7DA 4KQRA 4R1GA 1OJ5A 1P97A 2DCFA 3IQAA 4WL9A 2ZOIA 5EUAA 2V0WA 4ZAMA 5A92A 4BBUA 3BFGA 1H3QA 3IX8A 1STZA 2J3TC 3C8CA 5HL1A 4GNUA 4NETA 4KZ9A 4PM8A 4BL3A 3R7WB 4GJ4A 2WKHA 1JWPA 3PAGA 3JYIA 2XRNA 3ZHHA 1PIOA 4WMCA 2J3TD 5F82A 4L9FA 3UO9A 5DF7A 3O87A 2P08A 3W4QA 1K38A 2JKTI 3GQZA 4Y3IA 4FCFA 4OQ0A 2PDRA 3IS2B 3BY8A 4LGWA 3AGDA 4PM9A 2KDKA 5F83A 4R0QA 5D3OA 1MY8A 2JC7A 3IXGA 2FH5A 4JF4A 2JKRM 3MSHA 4GD6A 3V50A 2Y2HA 1KE4A 1PWDA 4II7A 1S67L 1NY0A 4OPYA 3F1PA 2VV6A 1RGYA 2JKTM 1CI8A 1PZOA 2V8CA 3VP4A 1PW1A 1EWZA 2ZMFA 4X53A 3OOVA 3IXDA 3B47A 4OLGA 4WEKA 4EEPA 1S1YA 4Y13A 4LRZE 3W4OA 3H82B 4HOIA 4YOFA 2XK1A 2BLSA 2J3WA 3MJQA 4KZ3A 1G6OA 4B4XA 4DDSA 3NI9A 1K54C 2BG1A 2ZM2A 1SKOA 2W3DA 1ONGA 4R3BA 4X55A 4GN2A 4I3IA 3WS2A 4O8GA 4U0XA 3MKFA 4KG5A 3MMHA 1K57C 3P01A 4IJGA 4FTXA 2Y2JA 3ULFA 2WGVA 2VKSA 3MQOA 3UMDA 3T1SA 4MN5A 3DTEA 1IELA 3G35A 4BBVA 4R4SA 2K2NA 1YMXA 2E8JA 2HDSA 3LEZA 4QU3A 3RJUA 2WADA 3PHYA 1WYCA 5HSQA 4HQAA 1PI4A 4Y17A 3N8LA 1H8ZA 1RP5A 3UDIA 3A3DA 1ZTUA 4N9LA 2B02A 3QP1A 5EOOA 5CEBA 3HJIA 1XA1A 2W1RA 3VP3A 2OLUA 2O9CA 4ARZB 2JKGA 3CMZA 3KSFA 1SKOB 4KZ8A 2XD1A 4GB7A 2Y8HA 4GOGA 5CHMA 2Y2LA 4Z1WA 2PBDP 4NXFA 1HVBA 3BRMA 4P6BA 2V8FA 5JYPA 2W27A 3HVFA 4H6JA 4G3VA 4XUZA 5FQMA 1E3UA 1E4DA 4S2NA 3NY4A 4BENA 1FR1A 3DTKA 3LIAA 1F2KA 5HAPA 1T1AA 3PBRA 1A0KA 4WYYA 1YPRA 1AXBA 3UB7A 2D02A 1ES3A 5CHJA 5GHZA 4EXOA 1L2SA 4MLLA 2KOIA 2GX5A 4HEFA 2Y2QA 3K2NA 2VGKA 3WS1A 4GW9A 3ICYA 1LLBA 4S2NC 2V1ZA 1L3LA 2FFFB 1AWIA 4JGQA 2OAP1 1DP9A 3CHWP 2PHYA 4LV2A 3MF0A 4HESA 3LIDA 4BD0A 5CRFA 1MZUA 5CGXA 1PWGA 5FQKA 3LGOA 3LI8A 3SS3A 2R9XA 2WKEA 4PHTA 3MZFA 2XH9A 2ZMAA 3BQAA 3QNCA 4MBHA 3C4PA 2KX6A 4PM5A 4UA6A 2XSSA 3MQ0A 4OONA 1EI5A 2RL3A 1BZAA 1SKFA 5TFQA 3IXHA 3ZG9B 5FQJA 4DE1A 5MC7A 4QB8A 3KYEA 4CQHA 2J8YA 5AQ9A 5HDSA 5HPFA 4U0TA 3ZG8B 1GSVA 3G2YA 4HP9A 1EROA 3WWXA 5CHUA 5AQAA 2V9AA 2WAFA 5GL9A 3S1YA 3NBLA 4L9GA 3MZEA 2P04A 1K57A 4QHCA 4E3NA 4ZRRA 2BASA 1UGUA 3NULA 5FDHA 2GZAA 2O99A 4R38A 2HDRA 5E2EA 3IWQA 1VEUA 5FAQA 2WKRA 4UAAA 4JGOA 4EETB 3MQQA 3V39A 2ZM0A 1LI9A 3T4QA 3PBSA 2OWJA 3LICA 1NRJA 5E2FA 3IH9A 4K08A 1S66L 3RTYA 3E2LA 4ARZA 3W4PA 3JPUA 3HLBA 1LT0A 4R23A 2OSUA 3T4SA 3ZNYA 5DVAA 3K3DA 1ES5A 1IFQA 3N7WA 1Q2PA 4NXGA 2X02A 1NZUA 3BY9A 2XA7M 4OKPA 5J4EA 2EWWA 2H10A 3HJKA 1G68A 3IX3A 1YLZA 3UPNA 4E3JA 1K56D 3AGEA 2ZQDA 1TS0A 2IWDA 5I5LA 1L0GA 1XX2A 5KZHA 2LB9A 2H0YA 2ACGA 1GSXA 1BULA 1S4RA 3UE1A 1ZC2A 3E98A 3V5MA 4YNRA 4MN6A 1UWNX 3H9WA 3Q07A 1JVJA 1XJ4A 3EEHA 3M6BA 4X68A 4FH2A 4DRTA 3M6HA 3NDGA 4JKTA 5HPIA 3S7PA 3HBRA 4MNRA 4DJ2A 4Q0HA 1BLPA 4KG2A 2EA9A 1K56A 2EXAA 5L09A 3LIFA 1MWRA 4OLDA 2EX2A 3LIBA 3OPRA 4CJNA 2IWCA 4D2OA 3ISGA 1LSWA 4M4XA 1GA9A 1KGFA 2ZD8A 1SZVA 4QD4A 5I94A 3U4LP 2PYPA 3TRCA 2WGIA 3S7OA 3A0SA 3DWZA 3ZNTA 1OT9A 3B3XA 4WZ4A 5HAQA 5A8BA 2QZ6A 1CK3A 5A91A 1OTAA 3C2WA 4G3WA 5GHYA 4RX3A 3JVVA 1YLWA 2C5WB 4S2LA 1PW8A 4E6WA 3HLCA 1KDWA 1YM1A 4I3AA 4GLQA 4Y0OA 3UMEA 4E3OA 1IYSA 4P6ZS 5HD3A 3VE3A 4EQ1A 4PM7A 4CLCC 4IUKA 4CPKA 5BOHA 2B18A 3S22A 4EBLA 5CGWA 5HDCA 1DP6A 3GTCA 1TVFA 3HCYA 4G3KA 1PNEA 5FI7A 5FSRA 2Y2NA 3T50A 1S0WA 5E2GA 4HBUA 5EOEA 5A90A 5FI6A 4U3TA 2A24B 3CWFA 1W79A 2Z6CA 1L0FA 4EQIA 1VQQA 5CTNA 3WRTA 2QHKA 4S2OA 3WS4A 1Z6FA 4P85A 3S7NA 3BECA 4P6ZM 4S2PA 1Y28A 1YMSA 4KZBA 3V3SA 1J9MA 1FQGA 1JTDA 4GHIB 2W1TA 2QJ7A 3HUOA 1NJ4A 1C3BA 3RH8B 1VHMA 1RGZA 1CI9A 4KQOA 4KZ7A 4HP4A 4E04A 3ITAA 2EXBA 1DRMA 1FR6A 1GHMA 4JXVA 2PD7A 1O07A 3CUEA 2HP9A 3V3RA 4GCZA 2EX6A 1CJFA 1FOFA 3A0VA 1WYBA 4O0PA 2DMWA 4HIAA 4IVIA 5E2HA 2V0UA 5GLAA 4JXSA 2PBYA 1IEMA 4E3LA 3PBOA 1LSXA 4KUKA 4ESPA 4ID4A 3FKVA 4XT2B 5CX7A 1ERMA 3T12B 1BTLA 4IBRA 3F1NA 1K4EA 2W3HA 1XP4A 3DTIA 3DBAA 2VLGA 1ACFA 2J7VA 2ZC7A 4WZ5A 4QY6A 4WEJA 4JBFA 1W5DA 3E4OA 2JE5A 3M2KA 3S4XA 2VV7A 1VM1A 1LHYA 4S2JA 3NJAA 2XDMA 1M6KA 3D72A 4LCMA 5HDDA 4JPMA 5HWTA 5DFYA 3PTEA 5TGFA 4RQ9A 2W3FA 2K31A 1K0KA 5F5YA 4UA9A 1GSWA 4N92A 3TOIA 4IUHA 4QY5A 3VOYA 5E43A 3FWLA 3QP8A 4IBXA 1NLZA 4JXWA 1IYOA 3SH8A 3LR0A 5HW3A 3OLOA 1LL5A 4HBTA 1MWSA 5TJJA 2HP5A 3NIAA 4GZBA 1MWUA 3LR4A 5F1GA 1OJGA 3UDFA 1XJ3A 4GD8A 4KUOA 5FAPA 4B88A 3GR2A 2VV8A 3SOIA 1E25A 5EE8A 3F1OA 1OTEA 4WF0A 3EGDC 4FH4A 2VK3A 4Y0TA 4UA7A 3O3VA 4DKIA 1TDGA 5CTMA 5FASA 2R78A 3IWOA 3UPOA 5FI2A 1S4SA 3QP4A 2YKHA 2HZ5A 3QP6A 3FKWA 3OCLA 3T1QB 1NYYA 1MWTA 4PKYA 1K55A 4EESA 3NOUC 2HJ9C 2B95A 5HD5A 5IU1A 3ZFZA 1HD8A 2D01A 3MFXA 5GLCA 5G4YA 4PMAA 4DN0A 2Y2KA 4XT2A 4X1MA 3PBTA 1K54A 3OCNA 3Q7VA 4WUJA 2ZC4B 3OPLA 4F94A 4EWFA 5KIZA 2P9VB 1ZKJA 1YSQA 4HHDA 5EVIC 5CECA 4ZJ2A 5DFXA 2G2UA 3WS0A 2L0WA 3CG5A 2WGWA 4ZDXA 2ZOHA 4EUZA 3UDXA 1OT6A 5F1FA 1OTBA 3G4PA 3NOPC 2YKFA 1OPXA 2JN7A 1BT5A 2OOLA 3MXSA 3FPVA 3L9KA 1K6RA 5KMWA 2KLIA 3LO7A 3ZG5A 2W1TB 2JBFA 4OPRA 4P87A 5G4ZA 2L1MA 3QP2A 1YKDA 4AFIA 2CMNA 3BFEA 4CLCB 3LY3A 1M40A 4I5SA 5M19A 2Y2MA 5AQ7A 4MN7A 3A3FA 5GLDA 3K3CA 1D06A 3BYDA 1DY6A 1ESUA 1ZG4A 5HARA 1XJ2A 4R3JA 4KQDA 4X6TA 2Q9NA 3CITA 2MJ6A 1LSVA 5TR7A 4EV4A 3SS4A 3A0RA 3JVUA 1DJBA 5J3WA 5CGSA 4Y7PA 2VA0A 1G28A 3UB5P 3UB8A 3T1RA 2H5SA 2EX8A 1XFNA 3IHAA 5DJTA 2BTFP 4OP5A 4JGRA 1TS7A 2XGNA 3S7QA 4NK3A 3IF6A 3ZVTA 4MBFA 1W63Q 3A3EA 2ZLYA 1GHIA 1H8MA 4WN5A 2HJEA 3KYQA 4KZAA 2HDQA 1N9NA 2UV0E 3IX4A 3O88A 4DE3A 3PR6A 4PKYG 3BM6A 3Q82A 3NCKA 2H28A 3VE4A 5M1AA 1FCMA 4K0XA 4HH2A 3TJZC 2ZMVA 3E2KA 4JF6A 1ZHHB 3FV7A 3T4JA 1FIKA 1ESIA 1W63M 5FEFA 5EVID 4KZ4A 3BLSA 3HUNA 4GKUA 1JNUA 5EM0A 4LV1A 2Y91A 4OP8A 3OBFA 3OPHA 3T4KA 4RX2A 5DF9A 4F3LA 2PR6A 2I72A 3I7JA 5CEDA 1MC0A 2A3UA 2O0YA 2VX8A 3RXXA 1GCEA 4K0WA 2Y79A 4QJGA 4Q0IA 2CC1A 5AVEA 2WKIA 4QWOA 1KGGA 1P9RA 2VZWA 1XPBA 1CQAA 1Y54A 2EWVA 4LLOB 5EV0A 2XROA 3KYZA 3LCEA 3IBJA 5F69A 1SCWA 3VP1A 3ZGAB 3MBZA 1FILA 4X1LA 1N4OA 2RCXA 4Z9QA 3FZCA 1D7EA 4OQIA 3FYZA 5EECA 3LYXA 3CJMA 5CERA 1T18A 3GVBA 2OV5A 4HY8A 4XUXA 2ZJ9A 2PT7A 3P7NA 4X25A 2EFXA 2ZQ7A 1QMFA 2P9VA 2QKPA 2HDUA 3LFVA 4LRYC 2VJWA 3CPTA 2ZL1A 4GDBA 2PRFA 3UPPA 2I9VA 2NUTC 3H7WB 5FA7A 3LI9A 1ODVA 3IF5A 2WAEA 2JHEA 3G32A 3NECA 1BUEA 2M7VA 2O9BA 2WKQA 3QHYA 4JXGA 3UB9A 1F98A 3T4OA 5IS1A 2XEPA 2XFSA 1W8QA 4LV3A 1YQSA 5DTTA 3H82A 4BMWA 5AVFA 2J9OA 3PBQA 3CLOA 4BQMA 1XJ6A 3B42A 3PYPA 5JYOA 1IOUA 3CZDA 1PZPA 1D1JA 3NC8A 1E3UD 2LB5A 2J80A 4IHQA 2Z2MB 3P98A 3VFHA 2ZC3B 5HAIA 2QYBA 5FQQA 2AVXA 3MZDA 4H8RA 4UHUA 4R3AA 2Q0OA 1VETA 2ZQAA 3H7WA 2FZ0A 5FATA 1SHVA 4GS9A 1DJCA 5FEGA 4OQGA 3Q81A 4L0LA 3CPTB 1F5MA 1HLUP 1NZOA 3MFDA 5FDSA 5M18A 3VSKA 2OWHA 5L8MA 4PM6A 3VP0A 3BJNA 3VP2A 1NYMA 1BLCA 2Y55A 3MXRA 3ITBA 2VEAA 3LIEA 1Q2QA 4E3IA 1IKIA 1JWZA 3FPWA 4DXCA 4WELA 5GHXA 3RXWA 5FQIA 3ZQ5A 3LEQA 3HLEA 2WZZA 2IWBA 4NG2A 1U60A 1LL9A 3O86A 3LR3A 5L07A 1X0OA 3B33A 1UWPX 1L0EA 1MKIA 3HLFA 4DF6A 5TBMA 3M2JA 3C7VA 1PWCA 4LRXC 4WMCD 3BWLA 3W2ZA 4OOYA 4DJ3A 4M3KA 2Y2GA 2Z6DA 1JTGA 1HZOA 4YINA 4F3LB 4I38A 3IWIA 3UE6A 3EQVA 3EGXC 4X69A 5DKLA 3KSIA 5DF8A 2O9AA 5G18A 2ZBBA 1T1CA 1I5QA 1ES2A 1P9WA 5DTKA 2WGWB 2XFTA 3IXBA 1Y4OA 1TEMA 3A3IA 3SH7A 2GJ3A 3BFFA 4A5RA 4NXBA 2WUQA 3NHQA 1TDLA 5CXWA 3NOTC 3IH8A 4DXBA 4GHIA 3IBRA 5J7EA 4KZ6A 4GDNA 4UQIM 4LFUA 1IYQA 2QWSA 1PFLA 4FOFA 3W8KA 3CI6A 3UNWA 2HPBA 4JGPA 4EERA 4B93A 5L10A 2P74A 2VGJA 1LI0A 5HWVA 1PRQA 1K25A 1EW0A 4XXRA 5HX9A 1FCOA 3ZVWA 1SDNA 1I2SA 2C6WB 3C4OA 2W3GA 2HF6A 4OH0A 2L4RA 2A2LA 3CAXA 4KENB 3E0YA 1MXOA 5EFWA 3HUMA 4Q0JA 4LENA 1K4FA 3TE8A 5KSHA 3EQUA 2INWA 3HL9A 4MEZA 4KQQA 3WRZA 4IVKA 4Y0UA 4BWIA 3VOLA 1ES4A 1H0MA 1FSYA 3Q1FA 5FAOA 2WKPA 2JCHA 3LR5A 4ZTKA 3GDIA 2DRWA 3ZCZA 2XLNA 3VV4A 1TF1A 3UE0A 5U47A 3IF6C 4DE2A 3IT9A 1J3WA 3HREA 4CLCE 1O7EA 3D9YA 2XA7S 4OPQA 4NKPA 2ZC6B 3L7HA 2OAQ1 1TS8A 4HJ4A 2EX9A 2IA2A 1VEUB 3MR0A 1N9BA 5HZHA 2HP6A 4D60A 2K7SA 2XQZA 3IHBA 4DMZA 4E3KA 3F1PB 3CUEC 4H6JB 2W0NA 2Y2IA 1KDSA 1MPLA 3LY4A 5A93A 2EFUA 1YLYA 2Z2LB 2Y2OA 4Y2FA 1Z09A 4P0MA 4YWZA 2OLVA 3GMWA 5AQBA 1BYWA 4EW7A 4OVDA 1LL8A 1NWZA 3VFFA 1OTIA 2JKFA 4JLFA 5EVLA 2ZL1B 4KG6A 2XF3A 4N1HA 3ZG0A 3N4IA 4ZJ1A 1QMEA 3NDEA 4HNBA 2PD8A 3E4PA 3T1XA 5F68A 3MXQA 4JF5A 3MKEA 4B4ZA 3TG9A 3KX0X 5HFOA 2W3EA 2PYRA 4S2KA 2J9PA 4MBKA 5DTSA 4HI4A 3OPPA 1T1BA 4S2MA 1KVMA 4R4RA 2A49A 1H5XA 3UY6A 3D3OA 4BBTA 3C7UA 4X56A 4N9KA 3VMAA 1V9ZA 4E3MA 3F1OB 1ZG6A 3P09A 4R6LA 4C3QA 2WZXA 4Y15A 2V1BA 5FL3A 1N9LA
chains in the Genus database with same CATH topology
3G35A 3MBZA 3ZGAB 1PYYA 3WS4A 1N4OA 1Z6FA 4R4SA 3ZDJA 2RCXA 3HLDA 3FZCA 4Z9QA 4P85A 4OQIA 1XGJA 3FYZA 1YMXA 3BECA 5EECA 2HDSA 3LEZA 3CJMA 5CERA 3VSLA 3N6IA 4S2PA 1YMSA 3GVBA 4QU3A 2WADA 4XUXA 2OV5A 2ZJ9A 3RJUA 4RVAA 1WYCA 4KZBA 3V3SA 1J9MA 1FQGA 1JTDA 3WS5A 4EBPA 2EFXA 3HUOA 1NJ4A 1PI4A 1C3BA 2H0TA 2ZQ7A 3N8LA 1QMFA 1H8ZA 2V20A 1RGZA 1CI9A 1RP5A 2DNSA 3UDIA 4KQOA 2P9VA 1GA0A 3A3DA 4KZ7A 4N9LA 5FQ9A 3ITAA 3N8SA 2EXBA 5EVIB 1G6AA 2HDUA 2R9WA 2PU4A 3HLWA 4GDBA 1FR6A 1GHMA 4JXVA 3UPPA 4IEDA 1IKGA 1I2WA 2B5RA 4DDYA 4Q8IA 1BLSA 5EOOA 1O07A 5FA7A 5CEBA 3IF5A 2HP9A 2WAEA 3V3RA 1XA1A 3G32A 3VP3A 2EX6A 2OLUA 1BUEA 1FOFA 4OOMA 2G2WA 3QHYA 1WYBA 4JXGA 1ONHA 3CMZA 2Y59A 4KZ8A 2XD1A 4GB7A 3G31A 3UN7A 4GOGA 2XEPA 2XFSA 1W8QA 4FD8A 4LV3A 5CHMA 2Y2LA 1OMEA 1YQSA 4IVIA 5DTTA 3G30A 5E2HA 1HVBA 3G34A 5GLAA 4JXSA 3BRMA 4P6BA 3UE3A 5JYPA 2J9OA 1CEFA 1IEMA 2PBYA 3PBQA 4E3LA 4WM9A 3HVFA 1BLHA 1FCNA 4XUZA 2E8IA 5FQMA 4BQMA 1XXMA 1E3UA 3PBOA 1E4DA 1YLTA 4ID4A 4S2NA 3NY4A 4BENA 1FR1A 3FKVA 5JYOA 4OOLA 1ERMA 1BTLA 3CZDA 3PBNA 4IBRA 5HAPA 2QMIA 3GSGA 3PBRA 3C5AA 1K4EA 1PZPA 1YT4A 1XP4A 3PAEA 2FFYA 4WYYA 2J7VA 3NC8A 2ZC7A 1AXBA 3SS5A 4WZ5A 4QY6A 4WEJA 4JBFA 1ES3A 1XA7A 5CHJA 5GHZA 1E3UD 4KZ5A 4BD1A 1W5DA 1L2SA 4MLLA 1FSWA 2JE5A 2Y2PA 3M2KA 1H8YA 4WZ5C 4HEFA 2Y2QA 2Z2MB 3P98A 3S4XA 3VFHA 2ZC3B 5HAIA 4BJPA 2VGKA 5FQQA 3MZDA 1VM1A 2PU2A 1LHYA 3TSGA 4S2JA 4H8RA 4UHUA 3WS1A 3BLMA 2XDMA 1M6KA 1LLBA 2ZQAA 2WYXA 4S2NC 2V1ZA 5FATA 1SHVA 2FFFB 1XGIA 1ALQA 4LCMA 1DJCA 4JPMA 4ZBEA 1KE0A 3PTEA 2ZQCA 5TGFA 4OQGA 3Q81A 4L0LA 5EVIA 4LV2A 4HESA 4BD0A 4UA9A 1NZOA 3MFDA 4N92A 5CRFA 5M18A 5CGXA 3TOIA 3VSKA 1PWGA 3AGFA 2ZM8A 5FQKA 2ZQ9A 4PM6A 2V2FF 5EPHA 3VP0A 3VP2A 1NYMA 4FSFA 1BLCA 2Y55A 3SS3A 3MXRA 4QY5A 2R9XA 1XKZA 3ITBA 3VOYA 2WKEA 2XR0A 5E43A 3FWLA 1IYPA 3GV9A 4IBXA 4JXWA 1IYOA 3MZFA 3SH8A 2XH9A 1Q2QA 4E3IA 5HW3A 2ZMAA 1IKIA 1LL5A 4WBGA 4HBTA 4LV0A 1JWZA 4DXCA 3G2ZA 4WELA 1MWSA 5GHXA 3QNCA 4MBHA 3RXWA 3C4PA 5FQIA 1CEGA 1KE3A 1L0DA 2HP5A 3NIAA 4GZBA 1MWUA 4PM5A 4UA6A 3HLEA 1YLJA 5F1GA 4OONA 1EI5A 2WZZA 3UDFA 2IWBA 5KSCA 4GD8A 3DW0A 1U60A 5FAPA 2RL3A 4B88A 3GR2A 1BZAA 3BEBA 5EE8A 1E25A 1LL9A 1SKFA 3O86A 3SOIA 3A3JA 5TFQA 3IXHA 4FH4A 2WK0A 3ZG9B 4Y0TA 4E6XA 5FQJA 4DE1A 4UA7A 3Q7ZA 1L0EA 1MKIA 3HLFA 2ZC5B 4QB8A 4DF6A 3O3VA 2J8YA 3C7VA 1BSGA 3M2JA 5AQ9A 4DKIA 1TDGA 2Q9MA 1PWCA 5CTMA 1HTZA 2X71A 4U0TA 4WMCD 3ZG8B 2Y4AA 5FASA 3IWOA 3G2YA 3WWXA 1EROA 1W7FA 3UPOA 5FI2A 4OOYA 5CHUA 3FKWA 5AQAA 3OCLA 4M3KA 2WAFA 2Y2GA 1NYYA 1MWTA 1JTGA 3BFDA 1HZOA 4PPRA 4YINA 5GL9A 1K55A 3S1YA 3NBLA 3IWIA 3MZEA 1K55C 3EQVA 4X69A 1K57A 4OQHA 4QHCA 1GHPA 3Q7VB 5DF8A 3ZFZA 4E3NA 1HD8A 5G18A 5FDHA 1KVLA 2XD5A 2HDRA 5IHVA 2X01A 5GLCA 4BL2A 1ERQA 1I5QA 4RA7A 5E2EA 1ES2A 3IWQA 4LCLA 4PMAA 5DTKA 3N8RA 1S6RA 5FAQA 2WGWB 2Y2KA 4UAAA 2XFTA 3IF6B 3PBTA 1K54A 3IXBA 3OCNA 2ZQ8A 3Q7VA 2ZC4B 1TEMA 3A3IA 2ZM0A 1LI9A 3OPLA 3SH7A 3V39A 2QPNA 3PBSA 4EWFA 2P9VB 1MBLA 3BFFA 1ZKJA 4A5RA 2WUQA 5E2FA 5EVIC 1TDLA 5J8XA 5CECA 3IH9A 5CXWA 4C75A 2UWXA 4ZJ2A 2GDNA 2G2UA 3IH8A 1K6SA 4DXBA 5L2FA 3E2LA 3WS0A 4OPZA 4KZ6A 3W4PA 4GDNA 3CG5A 3HLBA 4RYEA 3VOZA 2WGWA 4R23A 4S2OA 2OSUA 3OC2A 1IYQA 5GLBA 4ZDXA 4EUZA 3UDXA 3GRJA 3QNBA 5DVAA 3ZNYA 5F1FA 3G4PA 3W8KA 1DJAA 1PI5A 3UNWA 2HPBA 1ES5A 3N7WA 3DTMA 1BT5A 1NRFA 3HLGA 1Q2PA 2P74A 1WE4A 3MXSA 2VGJA 2X02A 1NZUA 1LI0A 1K6RA 4EBNA 4OKPA 5KMWA 1W8YA 3LO7A 2H10A 1SDEA 3ZG7B 1G68A 1JWVA 4BLMA 1YLZA 4K91A 4ZJ3A 3ZG5A 3UPNA 4E3JA 1K25A 1K56D 3DWKA 3OZHA 4XXRA 5HX9A 3AGEA 1FCOA 3BFCA 3ZVWA 2ZQDA 2JBFA 4OPRA 4P87A 1SDNA 1I2SA 2C6WB 2IWDA 3C4OA 4OH0A 1KGEA 3D4FA 1L0GA 4KENB 1XX2A 4YFMA 5KZHA 1MXOA 3SH9A 2H0YA 4DE0A 1RCJA 1NXYA 1BULA 3BFEA 3HUMA 3LY3A 4N1XA 4LENA 1M40A 4C6YA 3UE1A 5M19A 1K4FA 1ZC2A 2Y2MA 5AQ7A 1YLPA 3EQUA 3V5MA 4S2IA 5KSHA 4O7DA 3A3FA 3Q07A 4KQRA 5GLDA 4R1GA 3HL9A 1JVJA 4MEZA 4KQQA 3WRZA 3M6BA 4X68A 3BYDA 4IVKA 4Y0UA 1DY6A 4FH2A 1ES4A 4DRTA 3M6HA 3NDGA 1ESUA 2DCFA 3IQAA 4JKTA 1ZG4A 3HBRA 5HARA 4MNRA 1FSYA 1BLPA 4R3JA 5EUAA 3Q1FA 4KG2A 4ZAMA 1K56A 2EXAA 4X6TA 5A92A 2Q9NA 3BFGA 1MWRA 5FAOA 2JCHA 2EX2A 3OPRA 4OLDA 4ZTKA 4CJNA 2IWCA 4D2OA 2DRWA 3ZCZA 5TR7A 4EV4A 3SS4A 5HL1A 3ISGA 4GNUA 1DJBA 4NETA 4KZ9A 2XLNA 4PM8A 4BL3A 3UE0A 5U47A 5CGSA 3IF6C 1GA9A 2WKHA 1KGFA 2ZD8A 4Y7PA 4DE2A 3IT9A 3HREA 1JWPA 3PAGA 4QD4A 1O7EA 3JYIA 2H5SA 2EX8A 4OPQA 3ZHHA 1PIOA 5I94A 3IHAA 4WMCA 2ZC6B 5F82A 2WGIA 4OP5A 3UO9A 5DF7A 3O87A 3DWZA 3W4QA 2EX9A 2XGNA 3ZNTA 1N9BA 1K38A 3B3XA 4NK3A 2HP6A 3GQZA 3IF6A 4WZ4A 3ZVTA 5HAQA 2XQZA 4FCFA 4OQ0A 3IHBA 4MBFA 2QZ6A 1CK3A 5A91A 4E3KA 3A3EA 2ZLYA 3AGDA 4PM9A 2Y2IA 1GHIA 1KDSA 4R0QA 5D3OA 5F83A 1MY8A 4KZAA 1MPLA 3LY4A 5GHYA 5A93A 2EFUA 1YLYA 2HDQA 2JC7A 4RX3A 3IXGA 1YLWA 2C5WB 2Z2LB 4S2LA 4DE3A 1PW8A 3O88A 2Y2OA 4E6WA 3BM6A 4JF4A 4P0MA 3HLCA 3Q82A 3NCKA 4GD6A 5M1AA 1FCMA 4K0XA 3V50A 2OLVA 1KDWA 1KE4A 2Y2HA 3GMWA 5AQBA 1YM1A 3E2KA 4OVDA 4Y0OA 4JF6A 1PWDA 4E3OA 3FV7A 3VFFA 1IYSA 1ESIA 4JLFA 1NY0A 4OPYA 1RGYA 5EVLA 5EVID 4KZ4A 1CI8A 1PZOA 3VP4A 1PW1A 1EWZA 4X53A 3BLSA 3HUNA 4GKUA 3IXDA 4PM7A 4KG6A 2XF3A 4LV1A 2Y91A 4N1HA 4OLGA 3N4IA 3ZG0A 4WEKA 4ZJ1A 1QMEA 3NDEA 4OP8A 3OPHA 4CPKA 5BOHA 3W4OA 4JF5A 3MKEA 4B4ZA 2XK1A 2BLSA 3S22A 4EBLA 4KZ3A 4RX2A 3TG9A 5HFOA 5CGWA 5DF9A 4B4XA 4DDSA 4S2KA 2I72A 3NI9A 3I7JA 2J9PA 1K54C 3GTCA 2BG1A 1TVFA 5CEDA 2ZM2A 5FI7A 5FSRA 4MBKA 2A3UA 2Y2NA 5DTSA 3OPPA 1S0WA 1ONGA 4R3BA 5E2GA 4HBUA 4S2MA 3RXXA 5EOEA 5A90A 1KVMA 4R4RA 2A49A 1GCEA 4U3TA 4X55A 5FI6A 1H5XA 4GN2A 4K0WA 4QJGA 3UY6A 3WS2A 3VP1A 2CC1A 3C7UA 2WKIA 4U0XA 3MKFA 4N9KA 4X56A 3VMAA 1KGGA 4KG5A 4E3MA 1XPBA 1W79A 1K57C 1Y54A 1ZG6A 3P09A 1L0FA 4EQIA 2Y2JA 1VQQA 5CTNA 2WGVA 4F94A 3LCEA 4C3QA 2WZXA 3WRTA 1SCWA 1IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G35 A;  3MBZ A;  3ZGA B;  1PYY A;  3WS4 A;  1N4O A;  1Z6F A;  4R4S A;  3ZDJ A;  2RCX A;  3HLD A;  3FZC A;  4Z9Q A;  4P85 A;  4OQI A;  1XGJ A;  3FYZ A;  1YMX A;  3BEC A;  5EEC A;  2HDS A;  3LEZ A;  3CJM A;  5CER A;  3VSL A;  3N6I A;  4S2P A;  1YMS A;  3GVB A;  4QU3 A;  2WAD A;  4XUX A;  2OV5 A;  2ZJ9 A;  3RJU A;  4RVA A;  1WYC A;  4KZB A;  3V3S A;  1J9M A;  1FQG A;  1JTD A;  3WS5 A;  4EBP A;  2EFX A;  3HUO A;  1NJ4 A;  1PI4 A;  1C3B A;  2H0T A;  2ZQ7 A;  3N8L A;  1QMF A;  1H8Z A;  2V20 A;  1RGZ A;  1CI9 A;  1RP5 A;  2DNS A;  3UDI A;  4KQO A;  2P9V A;  1GA0 A;  3A3D A;  4KZ7 A;  4N9L A;  5FQ9 A;  3ITA A;  3N8S A;  2EXB A;  5EVI B;  1G6A A;  2HDU A;  2R9W A;  2PU4 A;  3HLW A;  4GDB A;  1FR6 A;  1GHM A;  4JXV A;  3UPP A;  4IED A;  1IKG A;  1I2W A;  2B5R A;  4DDY A;  4Q8I A;  1BLS A;  5EOO A;  1O07 A;  5FA7 A;  5CEB A;  3IF5 A;  2HP9 A;  2WAE A;  3V3R A;  1XA1 A;  3G32 A;  3VP3 A;  2EX6 A;  2OLU A;  1BUE A;  1FOF A;  4OOM A;  2G2W A;  3QHY A;  1WYB A;  4JXG A;  1ONH A;  3CMZ A;  2Y59 A;  4KZ8 A;  2XD1 A;  4GB7 A;  3G31 A;  3UN7 A;  4GOG A;  2XEP A;  2XFS A;  1W8Q A;  4FD8 A;  4LV3 A;  5CHM A;  2Y2L A;  1OME A;  1YQS A;  4IVI A;  5DTT A;  3G30 A;  5E2H A;  1HVB A;  3G34 A;  5GLA A;  4JXS A;  3BRM A;  4P6B A;  3UE3 A;  5JYP A;  2J9O A;  1CEF A;  1IEM A;  2PBY A;  3PBQ A;  4E3L A;  4WM9 A;  3HVF A;  1BLH A;  1FCN A;  4XUZ A;  2E8I A;  5FQM A;  4BQM A;  1XXM A;  1E3U A;  3PBO A;  1E4D A;  1YLT A;  4ID4 A;  4S2N A;  3NY4 A;  4BEN A;  1FR1 A;  3FKV A;  5JYO A;  4OOL A;  1ERM A;  1BTL A;  3CZD A;  3PBN A;  4IBR A;  5HAP A;  2QMI A;  3GSG A;  3PBR A;  3C5A A;  1K4E A;  1PZP A;  1YT4 A;  1XP4 A;  3PAE A;  2FFY A;  4WYY A;  2J7V A;  3NC8 A;  2ZC7 A;  1AXB A;  3SS5 A;  4WZ5 A;  4QY6 A;  4WEJ A;  4JBF A;  1ES3 A;  1XA7 A;  5CHJ A;  5GHZ A;  1E3U D;  4KZ5 A;  4BD1 A;  1W5D A;  1L2S A;  4MLL A;  1FSW A;  2JE5 A;  2Y2P A;  3M2K A;  1H8Y A;  4WZ5 C;  4HEF A;  2Y2Q A;  2Z2M B;  3P98 A;  3S4X A;  3VFH A;  2ZC3 B;  5HAI A;  4BJP A;  2VGK A;  5FQQ A;  3MZD A;  1VM1 A;  2PU2 A;  1LHY A;  3TSG A;  4S2J A;  4H8R A;  4UHU A;  3WS1 A;  3BLM A;  2XDM A;  1M6K A;  1LLB A;  2ZQA A;  2WYX A;  4S2N C;  2V1Z A;  5FAT A;  1SHV A;  2FFF B;  1XGI A;  1ALQ A;  4LCM A;  1DJC A;  4JPM A;  4ZBE A;  1KE0 A;  3PTE A;  2ZQC A;  5TGF A;  4OQG A;  3Q81 A;  4L0L A;  5EVI A;  4LV2 A;  4HES A;  4BD0 A;  4UA9 A;  1NZO A;  3MFD A;  4N92 A;  5CRF A;  5M18 A;  5CGX A;  3TOI A;  3VSK A;  1PWG A;  3AGF A;  2ZM8 A;  5FQK A;  2ZQ9 A;  4PM6 A;  2V2F F;  5EPH A;  3VP0 A;  3VP2 A;  1NYM A;  4FSF A;  1BLC A;  2Y55 A;  3SS3 A;  3MXR A;  4QY5 A;  2R9X A;  1XKZ A;  3ITB A;  3VOY A;  2WKE A;  2XR0 A;  5E43 A;  3FWL A;  1IYP A;  3GV9 A;  4IBX A;  4JXW A;  1IYO A;  3MZF A;  3SH8 A;  2XH9 A;  1Q2Q A;  4E3I A;  5HW3 A;  2ZMA A;  1IKI A;  1LL5 A;  4WBG A;  4HBT A;  4LV0 A;  1JWZ A;  4DXC A;  3G2Z A;  4WEL A;  1MWS A;  5GHX A;  3QNC A;  4MBH A;  3RXW A;  3C4P A;  5FQI A;  1CEG A;  1KE3 A;  1L0D A;  2HP5 A;  3NIA A;  4GZB A;  1MWU A;  4PM5 A;  4UA6 A;  3HLE A;  1YLJ A;  5F1G A;  4OON A;  1EI5 A;  2WZZ A;  3UDF A;  2IWB A;  5KSC A;  4GD8 A;  3DW0 A;  1U60 A;  5FAP A;  2RL3 A;  4B88 A;  3GR2 A;  1BZA A;  3BEB A;  5EE8 A;  1E25 A;  1LL9 A;  1SKF A;  3O86 A;  3SOI A;  3A3J A;  5TFQ A;  3IXH A;  4FH4 A;  2WK0 A;  3ZG9 B;  4Y0T A;  4E6X A;  5FQJ A;  4DE1 A;  4UA7 A;  3Q7Z A;  1L0E A;  1MKI A;  3HLF A;  2ZC5 B;  4QB8 A;  4DF6 A;  3O3V A;  2J8Y A;  3C7V A;  1BSG A;  3M2J A;  5AQ9 A;  4DKI A;  1TDG A;  2Q9M A;  1PWC A;  5CTM A;  1HTZ A;  2X71 A;  4U0T A;  4WMC D;  3ZG8 B;  2Y4A A;  5FAS A;  3IWO A;  3G2Y A;  3WWX A;  1ERO A;  1W7F A;  3UPO A;  5FI2 A;  4OOY A;  5CHU A;  3FKW A;  5AQA A;  3OCL A;  4M3K A;  2WAF A;  2Y2G A;  1NYY A;  1MWT A;  1JTG A;  3BFD A;  1HZO A;  4PPR A;  4YIN A;  5GL9 A;  1K55 A;  3S1Y A;  3NBL A;  3IWI A;  3MZE A;  1K55 C;  3EQV A;  4X69 A;  1K57 A;  4OQH A;  4QHC A;  1GHP A;  3Q7V B;  5DF8 A;  3ZFZ A;  4E3N A;  1HD8 A;  5G18 A;  5FDH A;  1KVL A;  2XD5 A;  2HDR A;  5IHV A;  2X01 A;  5GLC A;  4BL2 A;  1ERQ A;  1I5Q A;  4RA7 A;  5E2E A;  1ES2 A;  3IWQ A;  4LCL A;  4PMA A;  5DTK A;  3N8R A;  1S6R A;  5FAQ A;  2WGW B;  2Y2K A;  4UAA A;  2XFT A;  3IF6 B;  3PBT A;  1K54 A;  3IXB A;  3OCN A;  2ZQ8 A;  3Q7V A;  2ZC4 B;  1TEM A;  3A3I A;  2ZM0 A;  1LI9 A;  3OPL A;  3SH7 A;  3V39 A;  2QPN A;  3PBS A;  4EWF A;  2P9V B;  1MBL A;  3BFF A;  1ZKJ A;  4A5R A;  2WUQ A;  5E2F A;  5EVI C;  1TDL A;  5J8X A;  5CEC A;  3IH9 A;  5CXW A;  4C75 A;  2UWX A;  4ZJ2 A;  2GDN A;  2G2U A;  3IH8 A;  1K6S A;  4DXB A;  5L2F A;  3E2L A;  3WS0 A;  4OPZ A;  4KZ6 A;  3W4P A;  4GDN A;  3CG5 A;  3HLB A;  4RYE A;  3VOZ A;  2WGW A;  4R23 A;  4S2O A;  2OSU A;  3OC2 A;  1IYQ A;  5GLB A;  4ZDX A;  4EUZ A;  3UDX A;  3GRJ A;  3QNB A;  5DVA A;  3ZNY A;  5F1F A;  3G4P A;  3W8K A;  1DJA A;  1PI5 A;  3UNW A;  2HPB A;  1ES5 A;  3N7W A;  3DTM A;  1BT5 A;  1NRF A;  3HLG A;  1Q2P A;  2P74 A;  1WE4 A;  3MXS A;  2VGJ A;  2X02 A;  1NZU A;  1LI0 A;  1K6R A;  4EBN A;  4OKP A;  5KMW A;  1W8Y A;  3LO7 A;  2H10 A;  1SDE A;  3ZG7 B;  1G68 A;  1JWV A;  4BLM A;  1YLZ A;  4K91 A;  4ZJ3 A;  3ZG5 A;  3UPN A;  4E3J A;  1K25 A;  1K56 D;  3DWK A;  3OZH A;  4XXR A;  5HX9 A;  3AGE A;  1FCO A;  3BFC A;  3ZVW A;  2ZQD A;  2JBF A;  4OPR A;  4P87 A;  1SDN A;  1I2S A;  2C6W B;  2IWD A;  3C4O A;  4OH0 A;  1KGE A;  3D4F A;  1L0G A;  4KEN B;  1XX2 A;  4YFM A;  5KZH A;  1MXO A;  3SH9 A;  2H0Y A;  4DE0 A;  1RCJ A;  1NXY A;  1BUL A;  3BFE A;  3HUM A;  3LY3 A;  4N1X A;  4LEN A;  1M40 A;  4C6Y A;  3UE1 A;  5M19 A;  1K4F A;  1ZC2 A;  2Y2M A;  5AQ7 A;  1YLP A;  3EQU A;  3V5M A;  4S2I A;  5KSH A;  4O7D A;  3A3F A;  3Q07 A;  4KQR A;  5GLD A;  4R1G A;  3HL9 A;  1JVJ A;  4MEZ A;  4KQQ A;  3WRZ A;  3M6B A;  4X68 A;  3BYD A;  4IVK A;  4Y0U A;  1DY6 A;  4FH2 A;  1ES4 A;  4DRT A;  3M6H A;  3NDG A;  1ESU A;  2DCF A;  3IQA A;  4JKT A;  1ZG4 A;  3HBR A;  5HAR A;  4MNR A;  1FSY A;  1BLP A;  4R3J A;  5EUA A;  3Q1F A;  4KG2 A;  4ZAM A;  1K56 A;  2EXA A;  4X6T A;  5A92 A;  2Q9N A;  3BFG A;  1MWR A;  5FAO A;  2JCH A;  2EX2 A;  3OPR A;  4OLD A;  4ZTK A;  4CJN A;  2IWC A;  4D2O A;  2DRW A;  3ZCZ A;  5TR7 A;  4EV4 A;  3SS4 A;  5HL1 A;  3ISG A;  4GNU A;  1DJB A;  4NET A;  4KZ9 A;  2XLN A;  4PM8 A;  4BL3 A;  3UE0 A;  5U47 A;  5CGS A;  3IF6 C;  1GA9 A;  2WKH A;  1KGF A;  2ZD8 A;  4Y7P A;  4DE2 A;  3IT9 A;  3HRE A;  1JWP A;  3PAG A;  4QD4 A;  1O7E A;  3JYI A;  2H5S A;  2EX8 A;  4OPQ A;  3ZHH A;  1PIO A;  5I94 A;  3IHA A;  4WMC A;  2ZC6 B;  5F82 A;  2WGI A;  4OP5 A;  3UO9 A;  5DF7 A;  3O87 A;  3DWZ A;  3W4Q A;  2EX9 A;  2XGN A;  3ZNT A;  1N9B A;  1K38 A;  3B3X A;  4NK3 A;  2HP6 A;  3GQZ A;  3IF6 A;  4WZ4 A;  3ZVT A;  5HAQ A;  2XQZ A;  4FCF A;  4OQ0 A;  3IHB A;  4MBF A;  2QZ6 A;  1CK3 A;  5A91 A;  4E3K A;  3A3E A;  2ZLY A;  3AGD A;  4PM9 A;  2Y2I A;  1GHI A;  1KDS A;  4R0Q A;  5D3O A;  5F83 A;  1MY8 A;  4KZA A;  1MPL A;  3LY4 A;  5GHY A;  5A93 A;  2EFU A;  1YLY A;  2HDQ A;  2JC7 A;  4RX3 A;  3IXG A;  1YLW A;  2C5W B;  2Z2L B;  4S2L A;  4DE3 A;  1PW8 A;  3O88 A;  2Y2O A;  4E6W A;  3BM6 A;  4JF4 A;  4P0M A;  3HLC A;  3Q82 A;  3NCK A;  4GD6 A;  5M1A A;  1FCM A;  4K0X A;  3V50 A;  2OLV A;  1KDW A;  1KE4 A;  2Y2H A;  3GMW A;  5AQB A;  1YM1 A;  3E2K A;  4OVD A;  4Y0O A;  4JF6 A;  1PWD A;  4E3O A;  3FV7 A;  3VFF A;  1IYS A;  1ESI A;  4JLF A;  1NY0 A;  4OPY A;  1RGY A;  5EVL A;  5EVI D;  4KZ4 A;  1CI8 A;  1PZO A;  3VP4 A;  1PW1 A;  1EWZ A;  4X53 A;  3BLS A;  3HUN A;  4GKU A;  3IXD A;  4PM7 A;  4KG6 A;  2XF3 A;  4LV1 A;  2Y91 A;  4N1H A;  4OLG A;  3N4I A;  3ZG0 A;  4WEK A;  4ZJ1 A;  1QME A;  3NDE A;  4OP8 A;  3OPH A;  4CPK A;  5BOH A;  3W4O A;  4JF5 A;  3MKE A;  4B4Z A;  2XK1 A;  2BLS A;  3S22 A;  4EBL A;  4KZ3 A;  4RX2 A;  3TG9 A;  5HFO A;  5CGW A;  5DF9 A;  4B4X A;  4DDS A;  4S2K A;  2I72 A;  3NI9 A;  3I7J A;  2J9P A;  1K54 C;  3GTC A;  2BG1 A;  1TVF A;  5CED A;  2ZM2 A;  5FI7 A;  5FSR A;  4MBK A;  2A3U A;  2Y2N A;  5DTS A;  3OPP A;  1S0W A;  1ONG A;  4R3B A;  5E2G A;  4HBU A;  4S2M A;  3RXX A;  5EOE A;  5A90 A;  1KVM A;  4R4R A;  2A49 A;  1GCE A;  4U3T A;  4X55 A;  5FI6 A;  1H5X A;  4GN2 A;  4K0W A;  4QJG A;  3UY6 A;  3WS2 A;  3VP1 A;  2CC1 A;  3C7U A;  2WKI A;  4U0X A;  3MKF A;  4N9K A;  4X56 A;  3VMA A;  1KGG A;  4KG5 A;  4E3M A;  1XPB A;  1W79 A;  1K57 C;  1Y54 A;  1ZG6 A;  3P09 A;  1L0F A;  4EQI A;  2Y2J A;  1VQQ A;  5CTN A;  2WGV A;  4F94 A;  3LCE A;  4C3Q A;  2WZX A;  3WRT A;  1SCW A;  1IEL A; 
#chains in the Genus database with same CATH topology
 1PYY A;  3ZDJ A;  5K5B A;  3HLD A;  2M1C A;  1XGJ A;  4CLC A;  3VSL A;  3N6I A;  1YAX A;  1P0Z A;  4RVA A;  3WS5 A;  4EBP A;  3LUQ A;  2GNX A;  2H0T A;  2V20 A;  2DNS A;  5FQ9 A;  1GA0 A;  3N8S A;  5EVI B;  1G6A A;  2PU4 A;  2R9W A;  3ZYT A;  3HLW A;  2M7U A;  5EM1 A;  4IED A;  1KOU A;  1IKG A;  1I2W A;  2B5R A;  3DAV A;  4DDY A;  1BLS A;  4Q8I A;  4UEY A;  1WA9 A;  3EOI A;  3FG8 A;  4MCW A;  2G2W A;  4OOM A;  5HWW A;  1ONH A;  2Y59 A;  5DJU A;  3G31 A;  3UN7 A;  4I39 A;  4FD8 A;  3BQ8 A;  1OME A;  5F6A A;  3G30 A;  3G34 A;  3UE3 A;  1CEF A;  4O01 A;  5IT5 A;  4WM9 A;  1BLH A;  1FCN A;  2E8I A;  3IS2 A;  3BW6 A;  1XXM A;  3E4Q A;  1YLT A;  4OOL A;  4GS9 B;  3PBN A;  2QMI A;  3GSG A;  3TW8 A;  3C5A A;  1YT4 A;  3PAE A;  2FFY A;  4PAU A;  5EVE A;  3SS5 A;  4LPZ A;  4WLA A;  1XA7 A;  3EEA A;  4KZ5 A;  4BD1 A;  3C30 A;  4EU0 A;  1FSW A;  2Y2P A;  4WZ5 C;  1H8Y A;  3MS6 A;  2A24 A;  4BJP A;  1TD5 A;  2PU2 A;  3TSG A;  4MMN A;  3BLM A;  1V9Y A;  2WYX A;  1F9I A;  1N9O A;  1XGI A;  1ALQ A;  4ZBE A;  2NUP C;  1KE0 A;  2ZQC A;  4QPR A;  5EVI A;  1YSP A;  4NXE A;  2G7U A;  2VGL S;  3AGF A;  4UQI S;  2ZM8 A;  4ETX A;  2ZQ9 A;  2V2F F;  1S1Z A;  5EPH A;  4FSF A;  3RFB A;  4FUW A;  1XKZ A;  2XR0 A;  1VET B;  5HL6 A;  1IYP A;  3GV9 A;  1OTD A;  4WBG A;  4LV0 A;  4MDZ A;  1NLY A;  3G2Z A;  3GEC A;  1CEG A;  1KE3 A;  1L0D A;  4EUV A;  1YLJ A;  5KSC A;  3DW0 A;  3KO6 A;  3BEB A;  1CF0 A;  5AJG A;  3A3J A;  2VGL M;  3UB6 A;  2WK0 A;  4NEE D;  4EEU A;  4E6X A;  3Q7Z A;  2ZC5 B;  1TS6 A;  1XFQ A;  1BSG A;  2Q9M A;  1HTZ A;  2X71 A;  2Y4A A;  1W7F A;  3T4L A;  3BFD A;  4PPR A;  4HJ6 A;  1K55 C;  4OQH A;  1GHP A;  3Q7V B;  3F1N B;  4CLC D;  1KVL A;  2XD5 A;  2PR5 A;  5IHV A;  2X01 A;  4BL2 A;  1ERQ A;  4RA7 A;  4LCL A;  3T4T A;  3N8R A;  1S6R A;  4Y5F A;  2PAV P;  3IF6 B;  3V67 A;  2ZQ8 A;  2QPN A;  4ME4 A;  1MBL A;  1VB6 A;  3U2A A;  2V1A A;  1G5U A;  2HV1 A;  5J8X A;  4C75 A;  2UWX A;  2GDN A;  4HJ3 A;  1K6S A;  5L2F A;  3PXP A;  3R7W A;  4OPZ A;  3SW1 A;  4R70 A;  4RYE A;  3VOZ A;  2JKR I;  3SZT A;  3OC2 A;  5GLB A;  4B9O A;  3GRJ A;  2QJ5 A;  3QNB A;  1DJA A;  1PI5 A;  1MKM A;  3DTM A;  4HH3 A;  1DP8 A;  1NRF A;  3C38 A;  3HLG A;  3QP5 A;  1WE4 A;  3O5Y A;  3G6O A;  4EBN A;  1W8Y A;  5C5K A;  3KSH A;  1SDE A;  3ZG7 B;  1JWV A;  3FC7 A;  4BLM A;  4K91 A;  4ZJ3 A;  2HGV A;  3EWK A;  3DWK A;  3OZH A;  3BFC A;  3KSG A;  4I3J A;  4ETZ A;  1T19 A;  1KGE A;  5LBR A;  3D4F A;  4YFM A;  3SH9 A;  4L9E A;  5TBM B;  4DE0 A;  1RCJ A;  1NXY A;  4N1X A;  5DKK A;  2P7J A;  4C6Y A;  3R4K A;  1YLP A;  4S2I A;  4O7D A;  4KQR A;  4R1G A;  1OJ5 A;  1P97 A;  2DCF A;  3IQA A;  4WL9 A;  2ZOI A;  5EUA A;  2V0W A;  4ZAM A;  5A92 A;  4BBU A;  3BFG A;  1H3Q A;  3IX8 A;  1STZ A;  2J3T C;  3C8C A;  5HL1 A;  4GNU A;  4NET A;  4KZ9 A;  4PM8 A;  4BL3 A;  3R7W B;  4GJ4 A;  2WKH A;  1JWP A;  3PAG A;  3JYI A;  2XRN A;  3ZHH A;  1PIO A;  4WMC A;  2J3T D;  5F82 A;  4L9F A;  3UO9 A;  5DF7 A;  3O87 A;  2P08 A;  3W4Q A;  1K38 A;  2JKT I;  3GQZ A;  4Y3I A;  4FCF A;  4OQ0 A;  2PDR A;  3IS2 B;  3BY8 A;  4LGW A;  3AGD A;  4PM9 A;  2KDK A;  5F83 A;  4R0Q A;  5D3O A;  1MY8 A;  2JC7 A;  3IXG A;  2FH5 A;  4JF4 A;  2JKR M;  3MSH A;  4GD6 A;  3V50 A;  2Y2H A;  1KE4 A;  1PWD A;  4II7 A;  1S67 L;  1NY0 A;  4OPY A;  3F1P A;  2VV6 A;  1RGY A;  2JKT M;  1CI8 A;  1PZO A;  2V8C A;  3VP4 A;  1PW1 A;  1EWZ A;  2ZMF A;  4X53 A;  3OOV A;  3IXD A;  3B47 A;  4OLG A;  4WEK A;  4EEP A;  1S1Y A;  4Y13 A;  4LRZ E;  3W4O A;  3H82 B;  4HOI A;  4YOF A;  2XK1 A;  2BLS A;  2J3W A;  3MJQ A;  4KZ3 A;  1G6O A;  4B4X A;  4DDS A;  3NI9 A;  1K54 C;  2BG1 A;  2ZM2 A;  1SKO A;  2W3D A;  1ONG A;  4R3B A;  4X55 A;  4GN2 A;  4I3I A;  3WS2 A;  4O8G A;  4U0X A;  3MKF A;  4KG5 A;  3MMH A;  1K57 C;  3P01 A;  4IJG A;  4FTX A;  2Y2J A;  3ULF A;  2WGV A;  2VKS A;  3MQO A;  3UMD A;  3T1S A;  4MN5 A;  3DTE A;  1IEL A;  3G35 A;  4BBV A;  4R4S A;  2K2N A;  1YMX A;  2E8J A;  2HDS A;  3LEZ A;  4QU3 A;  3RJU A;  2WAD A;  3PHY A;  1WYC A;  5HSQ A;  4HQA A;  1PI4 A;  4Y17 A;  3N8L A;  1H8Z A;  1RP5 A;  3UDI A;  3A3D A;  1ZTU A;  4N9L A;  2B02 A;  3QP1 A;  5EOO A;  5CEB A;  3HJI A;  1XA1 A;  2W1R A;  3VP3 A;  2OLU A;  2O9C A;  4ARZ B;  2JKG A;  3CMZ A;  3KSF A;  1SKO B;  4KZ8 A;  2XD1 A;  4GB7 A;  2Y8H A;  4GOG A;  5CHM A;  2Y2L A;  4Z1W A;  2PBD P;  4NXF A;  1HVB A;  3BRM A;  4P6B A;  2V8F A;  5JYP A;  2W27 A;  3HVF A;  4H6J A;  4G3V A;  4XUZ A;  5FQM A;  1E3U A;  1E4D A;  4S2N A;  3NY4 A;  4BEN A;  1FR1 A;  3DTK A;  3LIA A;  1F2K A;  5HAP A;  1T1A A;  3PBR A;  1A0K A;  4WYY A;  1YPR A;  1AXB A;  3UB7 A;  2D02 A;  1ES3 A;  5CHJ A;  5GHZ A;  4EXO A;  1L2S A;  4MLL A;  2KOI A;  2GX5 A;  4HEF A;  2Y2Q A;  3K2N A;  2VGK A;  3WS1 A;  4GW9 A;  3ICY A;  1LLB A;  4S2N C;  2V1Z A;  1L3L A;  2FFF B;  1AWI A;  4JGQ A;  2OAP 1;  1DP9 A;  3CHW P;  2PHY A;  4LV2 A;  3MF0 A;  4HES A;  3LID A;  4BD0 A;  5CRF A;  1MZU A;  5CGX A;  1PWG A;  5FQK A;  3LGO A;  3LI8 A;  3SS3 A;  2R9X A;  2WKE A;  4PHT A;  3MZF A;  2XH9 A;  2ZMA A;  3BQA A;  3QNC A;  4MBH A;  3C4P A;  2KX6 A;  4PM5 A;  4UA6 A;  2XSS A;  3MQ0 A;  4OON A;  1EI5 A;  2RL3 A;  1BZA A;  1SKF A;  5TFQ A;  3IXH A;  3ZG9 B;  5FQJ A;  4DE1 A;  5MC7 A;  4QB8 A;  3KYE A;  4CQH A;  2J8Y A;  5AQ9 A;  5HDS A;  5HPF A;  4U0T A;  3ZG8 B;  1GSV A;  3G2Y A;  4HP9 A;  1ERO A;  3WWX A;  5CHU A;  5AQA A;  2V9A A;  2WAF A;  5GL9 A;  3S1Y A;  3NBL A;  4L9G A;  3MZE A;  2P04 A;  1K57 A;  4QHC A;  4E3N A;  4ZRR A;  2BAS A;  1UGU A;  3NUL A;  5FDH A;  2GZA A;  2O99 A;  4R38 A;  2HDR A;  5E2E A;  3IWQ A;  1VEU A;  5FAQ A;  2WKR A;  4UAA A;  4JGO A;  4EET B;  3MQQ A;  3V39 A;  2ZM0 A;  1LI9 A;  3T4Q A;  3PBS A;  2OWJ A;  3LIC A;  1NRJ A;  5E2F A;  3IH9 A;  4K08 A;  1S66 L;  3RTY A;  3E2L A;  4ARZ A;  3W4P A;  3JPU A;  3HLB A;  1LT0 A;  4R23 A;  2OSU A;  3T4S A;  3ZNY A;  5DVA A;  3K3D A;  1ES5 A;  1IFQ A;  3N7W A;  1Q2P A;  4NXG A;  2X02 A;  1NZU A;  3BY9 A;  2XA7 M;  4OKP A;  5J4E A;  2EWW A;  2H10 A;  3HJK A;  1G68 A;  3IX3 A;  1YLZ A;  3UPN A;  4E3J A;  1K56 D;  3AGE A;  2ZQD A;  1TS0 A;  2IWD A;  5I5L A;  1L0G A;  1XX2 A;  5KZH A;  2LB9 A;  2H0Y A;  2ACG A;  1GSX A;  1BUL A;  1S4R A;  3UE1 A;  1ZC2 A;  3E98 A;  3V5M A;  4YNR A;  4MN6 A;  1UWN X;  3H9W A;  3Q07 A;  1JVJ A;  1XJ4 A;  3EEH A;  3M6B A;  4X68 A;  4FH2 A;  4DRT A;  3M6H A;  3NDG A;  4JKT A;  5HPI A;  3S7P A;  3HBR A;  4MNR A;  4DJ2 A;  4Q0H A;  1BLP A;  4KG2 A;  2EA9 A;  1K56 A;  2EXA A;  5L09 A;  3LIF A;  1MWR A;  4OLD A;  2EX2 A;  3LIB A;  3OPR A;  4CJN A;  2IWC A;  4D2O A;  3ISG A;  1LSW A;  4M4X A;  1GA9 A;  1KGF A;  2ZD8 A;  1SZV A;  4QD4 A;  5I94 A;  3U4L P;  2PYP A;  3TRC A;  2WGI A;  3S7O A;  3A0S A;  3DWZ A;  3ZNT A;  1OT9 A;  3B3X A;  4WZ4 A;  5HAQ A;  5A8B A;  2QZ6 A;  1CK3 A;  5A91 A;  1OTA A;  3C2W A;  4G3W A;  5GHY A;  4RX3 A;  3JVV A;  1YLW A;  2C5W B;  4S2L A;  1PW8 A;  4E6W A;  3HLC A;  1KDW A;  1YM1 A;  4I3A A;  4GLQ A;  4Y0O A;  3UME A;  4E3O A;  1IYS A;  4P6Z S;  5HD3 A;  3VE3 A;  4EQ1 A;  4PM7 A;  4CLC C;  4IUK A;  4CPK A;  5BOH A;  2B18 A;  3S22 A;  4EBL A;  5CGW A;  5HDC A;  1DP6 A;  3GTC A;  1TVF A;  3HCY A;  4G3K A;  1PNE A;  5FI7 A;  5FSR A;  2Y2N A;  3T50 A;  1S0W A;  5E2G A;  4HBU A;  5EOE A;  5A90 A;  5FI6 A;  4U3T A;  2A24 B;  3CWF A;  1W79 A;  2Z6C A;  1L0F A;  4EQI A;  1VQQ A;  5CTN A;  3WRT A;  2QHK A;  4S2O A;  3WS4 A;  1Z6F A;  4P85 A;  3S7N A;  3BEC A;  4P6Z M;  4S2P A;  1Y28 A;  1YMS A;  4KZB A;  3V3S A;  1J9M A;  1FQG A;  1JTD A;  4GHI B;  2W1T A;  2QJ7 A;  3HUO A;  1NJ4 A;  1C3B A;  3RH8 B;  1VHM A;  1RGZ A;  1CI9 A;  4KQO A;  4KZ7 A;  4HP4 A;  4E04 A;  3ITA A;  2EXB A;  1DRM A;  1FR6 A;  1GHM A;  4JXV A;  2PD7 A;  1O07 A;  3CUE A;  2HP9 A;  3V3R A;  4GCZ A;  2EX6 A;  1CJF A;  1FOF A;  3A0V A;  1WYB A;  4O0P A;  2DMW A;  4HIA A;  4IVI A;  5E2H A;  2V0U A;  5GLA A;  4JXS A;  2PBY A;  1IEM A;  4E3L A;  3PBO A;  1LSX A;  4KUK A;  4ESP A;  4ID4 A;  3FKV A;  4XT2 B;  5CX7 A;  1ERM A;  3T12 B;  1BTL A;  4IBR A;  3F1N A;  1K4E A;  2W3H A;  1XP4 A;  3DTI A;  3DBA A;  2VLG A;  1ACF A;  2J7V A;  2ZC7 A;  4WZ5 A;  4QY6 A;  4WEJ A;  4JBF A;  1W5D A;  3E4O A;  2JE5 A;  3M2K A;  3S4X A;  2VV7 A;  1VM1 A;  1LHY A;  4S2J A;  3NJA A;  2XDM A;  1M6K A;  3D72 A;  4LCM A;  5HDD A;  4JPM A;  5HWT A;  5DFY A;  3PTE A;  5TGF A;  4RQ9 A;  2W3F A;  2K31 A;  1K0K A;  5F5Y A;  4UA9 A;  1GSW A;  4N92 A;  3TOI A;  4IUH A;  4QY5 A;  3VOY A;  5E43 A;  3FWL A;  3QP8 A;  4IBX A;  1NLZ A;  4JXW A;  1IYO A;  3SH8 A;  3LR0 A;  5HW3 A;  3OLO A;  1LL5 A;  4HBT A;  1MWS A;  5TJJ A;  2HP5 A;  3NIA A;  4GZB A;  1MWU A;  3LR4 A;  5F1G A;  1OJG A;  3UDF A;  1XJ3 A;  4GD8 A;  4KUO A;  5FAP A;  4B88 A;  3GR2 A;  2VV8 A;  3SOI A;  1E25 A;  5EE8 A;  3F1O A;  1OTE A;  4WF0 A;  3EGD C;  4FH4 A;  2VK3 A;  4Y0T A;  4UA7 A;  3O3V A;  4DKI A;  1TDG A;  5CTM A;  5FAS A;  2R78 A;  3IWO A;  3UPO A;  5FI2 A;  1S4S A;  3QP4 A;  2YKH A;  2HZ5 A;  3QP6 A;  3FKW A;  3OCL A;  3T1Q B;  1NYY A;  1MWT A;  4PKY A;  1K55 A;  4EES A;  3NOU C;  2HJ9 C;  2B95 A;  5HD5 A;  5IU1 A;  3ZFZ A;  1HD8 A;  2D01 A;  3MFX A;  5GLC A;  5G4Y A;  4PMA A;  4DN0 A;  2Y2K A;  4XT2 A;  4X1M A;  3PBT A;  1K54 A;  3OCN A;  3Q7V A;  4WUJ A;  2ZC4 B;  3OPL A;  4F94 A;  4EWF A;  5KIZ A;  2P9V B;  1ZKJ A;  1YSQ A;  4HHD A;  5EVI C;  5CEC A;  4ZJ2 A;  5DFX A;  2G2U A;  3WS0 A;  2L0W A;  3CG5 A;  2WGW A;  4ZDX A;  2ZOH A;  4EUZ A;  3UDX A;  1OT6 A;  5F1F A;  1OTB A;  3G4P A;  3NOP C;  2YKF A;  1OPX A;  2JN7 A;  1BT5 A;  2OOL A;  3MXS A;  3FPV A;  3L9K A;  1K6R A;  5KMW A;  2KLI A;  3LO7 A;  3ZG5 A;  2W1T B;  2JBF A;  4OPR A;  4P87 A;  5G4Z A;  2L1M A;  3QP2 A;  1YKD A;  4AFI A;  2CMN A;  3BFE A;  4CLC B;  3LY3 A;  1M40 A;  4I5S A;  5M19 A;  2Y2M A;  5AQ7 A;  4MN7 A;  3A3F A;  5GLD A;  3K3C A;  1D06 A;  3BYD A;  1DY6 A;  1ESU A;  1ZG4 A;  5HAR A;  1XJ2 A;  4R3J A;  4KQD A;  4X6T A;  2Q9N A;  3CIT A;  2MJ6 A;  1LSV A;  5TR7 A;  4EV4 A;  3SS4 A;  3A0R A;  3JVU A;  1DJB A;  5J3W A;  5CGS A;  4Y7P A;  2VA0 A;  1G28 A;  3UB5 P;  3UB8 A;  3T1R A;  2H5S A;  2EX8 A;  1XFN A;  3IHA A;  5DJT A;  2BTF P;  4OP5 A;  4JGR A;  1TS7 A;  2XGN A;  3S7Q A;  4NK3 A;  3IF6 A;  3ZVT A;  4MBF A;  1W63 Q;  3A3E A;  2ZLY A;  1GHI A;  1H8M A;  4WN5 A;  2HJE A;  3KYQ A;  4KZA A;  2HDQ A;  1N9N A;  2UV0 E;  3IX4 A;  3O88 A;  4DE3 A;  3PR6 A;  4PKY G;  3BM6 A;  3Q82 A;  3NCK A;  2H28 A;  3VE4 A;  5M1A A;  1FCM A;  4K0X A;  4HH2 A;  3TJZ C;  2ZMV A;  3E2K A;  4JF6 A;  1ZHH B;  3FV7 A;  3T4J A;  1FIK A;  1ESI A;  1W63 M;  5FEF A;  5EVI D;  4KZ4 A;  3BLS A;  3HUN A;  4GKU A;  1JNU A;  5EM0 A;  4LV1 A;  2Y91 A;  4OP8 A;  3OBF A;  3OPH A;  3T4K A;  4RX2 A;  5DF9 A;  4F3L A;  2PR6 A;  2I72 A;  3I7J A;  5CED A;  1MC0 A;  2A3U A;  2O0Y A;  2VX8 A;  3RXX A;  1GCE A;  4K0W A;  2Y79 A;  4QJG A;  4Q0I A;  2CC1 A;  5AVE A;  2WKI A;  4QWO A;  1KGG A;  1P9R A;  2VZW A;  1XPB A;  1CQA A;  1Y54 A;  2EWV A;  4LLO B;  5EV0 A;  2XRO A;  3KYZ A;  3LCE A;  3IBJ A;  5F69 A;  1SCW A;  3VP1 A;  3ZGA B;  3MBZ A;  1FIL A;  4X1L A;  1N4O A;  2RCX A;  4Z9Q A;  3FZC A;  1D7E A;  4OQI A;  3FYZ A;  5EEC A;  3LYX A;  3CJM A;  5CER A;  1T18 A;  3GVB A;  2OV5 A;  4HY8 A;  4XUX A;  2ZJ9 A;  2PT7 A;  3P7N A;  4X25 A;  2EFX A;  2ZQ7 A;  1QMF A;  2P9V A;  2QKP A;  2HDU A;  3LFV A;  4LRY C;  2VJW A;  3CPT A;  2ZL1 A;  4GDB A;  2PRF A;  3UPP A;  2I9V A;  2NUT C;  3H7W B;  5FA7 A;  3LI9 A;  1ODV A;  3IF5 A;  2WAE A;  2JHE A;  3G32 A;  3NEC A;  1BUE A;  2M7V A;  2O9B A;  2WKQ A;  3QHY A;  4JXG A;  3UB9 A;  1F98 A;  3T4O A;  5IS1 A;  2XEP A;  2XFS A;  1W8Q A;  4LV3 A;  1YQS A;  5DTT A;  3H82 A;  4BMW A;  5AVF A;  2J9O A;  3PBQ A;  3CLO A;  4BQM A;  1XJ6 A;  3B42 A;  3PYP A;  5JYO A;  1IOU A;  3CZD A;  1PZP A;  1D1J A;  3NC8 A;  1E3U D;  2LB5 A;  2J80 A;  4IHQ A;  2Z2M B;  3P98 A;  3VFH A;  2ZC3 B;  5HAI A;  2QYB A;  5FQQ A;  2AVX A;  3MZD A;  4H8R A;  4UHU A;  4R3A A;  2Q0O A;  1VET A;  2ZQA A;  3H7W A;  2FZ0 A;  5FAT A;  1SHV A;  4GS9 A;  1DJC A;  5FEG A;  4OQG A;  3Q81 A;  4L0L A;  3CPT B;  1F5M A;  1HLU P;  1NZO A;  3MFD A;  5FDS A;  5M18 A;  3VSK A;  2OWH A;  5L8M A;  4PM6 A;  3VP0 A;  3BJN A;  3VP2 A;  1NYM A;  1BLC A;  2Y55 A;  3MXR A;  3ITB A;  2VEA A;  3LIE A;  1Q2Q A;  4E3I A;  1IKI A;  1JWZ A;  3FPW A;  4DXC A;  4WEL A;  5GHX A;  3RXW A;  5FQI A;  3ZQ5 A;  3LEQ A;  3HLE A;  2WZZ A;  2IWB A;  4NG2 A;  1U60 A;  1LL9 A;  3O86 A;  3LR3 A;  5L07 A;  1X0O A;  3B33 A;  1UWP X;  1L0E A;  1MKI A;  3HLF A;  4DF6 A;  5TBM A;  3M2J A;  3C7V A;  1PWC A;  4LRX C;  4WMC D;  3BWL A;  3W2Z A;  4OOY A;  4DJ3 A;  4M3K A;  2Y2G A;  2Z6D A;  1JTG A;  1HZO A;  4YIN A;  4F3L B;  4I38 A;  3IWI A;  3UE6 A;  3EQV A;  3EGX C;  4X69 A;  5DKL A;  3KSI A;  5DF8 A;  2O9A A;  5G18 A;  2ZBB A;  1T1C A;  1I5Q A;  1ES2 A;  1P9W A;  5DTK A;  2WGW B;  2XFT A;  3IXB A;  1Y4O A;  1TEM A;  3A3I A;  3SH7 A;  2GJ3 A;  3BFF A;  4A5R A;  4NXB A;  2WUQ A;  3NHQ A;  1TDL A;  5CXW A;  3NOT C;  3IH8 A;  4DXB A;  4GHI A;  3IBR A;  5J7E A;  4KZ6 A;  4GDN A;  4UQI M;  4LFU A;  1IYQ A;  2QWS A;  1PFL A;  4FOF A;  3W8K A;  3CI6 A;  3UNW A;  2HPB A;  4JGP A;  4EER A;  4B93 A;  5L10 A;  2P74 A;  2VGJ A;  1LI0 A;  5HWV A;  1PRQ A;  1K25 A;  1EW0 A;  4XXR A;  5HX9 A;  1FCO A;  3ZVW A;  1SDN A;  1I2S A;  2C6W B;  3C4O A;  2W3G A;  2HF6 A;  4OH0 A;  2L4R A;  2A2L A;  3CAX A;  4KEN B;  3E0Y A;  1MXO A;  5EFW A;  3HUM A;  4Q0J A;  4LEN A;  1K4F A;  3TE8 A;  5KSH A;  3EQU A;  2INW A;  3HL9 A;  4MEZ A;  4KQQ A;  3WRZ A;  4IVK A;  4Y0U A;  4BWI A;  3VOL A;  1ES4 A;  1H0M A;  1FSY A;  3Q1F A;  5FAO A;  2WKP A;  2JCH A;  3LR5 A;  4ZTK A;  3GDI A;  2DRW A;  3ZCZ A;  2XLN A;  3VV4 A;  1TF1 A;  3UE0 A;  5U47 A;  3IF6 C;  4DE2 A;  3IT9 A;  1J3W A;  3HRE A;  4CLC E;  1O7E A;  3D9Y A;  2XA7 S;  4OPQ A;  4NKP A;  2ZC6 B;  3L7H A;  2OAQ 1;  1TS8 A;  4HJ4 A;  2EX9 A;  2IA2 A;  1VEU B;  3MR0 A;  1N9B A;  5HZH A;  2HP6 A;  4D60 A;  2K7S A;  2XQZ A;  3IHB A;  4DMZ A;  4E3K A;  3F1P B;  3CUE C;  4H6J B;  2W0N A;  2Y2I A;  1KDS A;  1MPL A;  3LY4 A;  5A93 A;  2EFU A;  1YLY A;  2Z2L B;  2Y2O A;  4Y2F A;  1Z09 A;  4P0M A;  4YWZ A;  2OLV A;  3GMW A;  5AQB A;  1BYW A;  4EW7 A;  4OVD A;  1LL8 A;  1NWZ A;  3VFF A;  1OTI A;  2JKF A;  4JLF A;  5EVL A;  2ZL1 B;  4KG6 A;  2XF3 A;  4N1H A;  3ZG0 A;  3N4I A;  4ZJ1 A;  1QME A;  3NDE A;  4HNB A;  2PD8 A;  3E4P A;  3T1X A;  5F68 A;  3MXQ A;  4JF5 A;  3MKE A;  4B4Z A;  3TG9 A;  3KX0 X;  5HFO A;  2W3E A;  2PYR A;  4S2K A;  2J9P A;  4MBK A;  5DTS A;  4HI4 A;  3OPP A;  1T1B A;  4S2M A;  1KVM A;  4R4R A;  2A49 A;  1H5X A;  3UY6 A;  3D3O A;  4BBT A;  3C7U A;  4X56 A;  4N9K A;  3VMA A;  1V9Z A;  4E3M A;  3F1O B;  1ZG6 A;  3P09 A;  4R6L A;  4C3Q A;  2WZX A;  4Y15 A;  2V1B A;  5FL3 A;  1N9L A; 
#chains in the Genus database with same CATH homology
 3G35 A;  3MBZ A;  3ZGA B;  1PYY A;  3WS4 A;  1N4O A;  1Z6F A;  4R4S A;  3ZDJ A;  2RCX A;  3HLD A;  3FZC A;  4Z9Q A;  4P85 A;  4OQI A;  1XGJ A;  3FYZ A;  1YMX A;  3BEC A;  5EEC A;  2HDS A;  3LEZ A;  3CJM A;  5CER A;  3VSL A;  3N6I A;  4S2P A;  1YMS A;  3GVB A;  4QU3 A;  2WAD A;  4XUX A;  2OV5 A;  2ZJ9 A;  3RJU A;  4RVA A;  1WYC A;  4KZB A;  3V3S A;  1J9M A;  1FQG A;  1JTD A;  3WS5 A;  4EBP A;  2EFX A;  3HUO A;  1NJ4 A;  1PI4 A;  1C3B A;  2H0T A;  2ZQ7 A;  3N8L A;  1QMF A;  1H8Z A;  2V20 A;  1RGZ A;  1CI9 A;  1RP5 A;  2DNS A;  3UDI A;  4KQO A;  2P9V A;  1GA0 A;  3A3D A;  4KZ7 A;  4N9L A;  5FQ9 A;  3ITA A;  3N8S A;  2EXB A;  5EVI B;  1G6A A;  2HDU A;  2R9W A;  2PU4 A;  3HLW A;  4GDB A;  1FR6 A;  1GHM A;  4JXV A;  3UPP A;  4IED A;  1IKG A;  1I2W A;  2B5R A;  4DDY A;  4Q8I A;  1BLS A;  5EOO A;  1O07 A;  5FA7 A;  5CEB A;  3IF5 A;  2HP9 A;  2WAE A;  3V3R A;  1XA1 A;  3G32 A;  3VP3 A;  2EX6 A;  2OLU A;  1BUE A;  1FOF A;  4OOM A;  2G2W A;  3QHY A;  1WYB A;  4JXG A;  1ONH A;  3CMZ A;  2Y59 A;  4KZ8 A;  2XD1 A;  4GB7 A;  3G31 A;  3UN7 A;  4GOG A;  2XEP A;  2XFS A;  1W8Q A;  4FD8 A;  4LV3 A;  5CHM A;  2Y2L A;  1OME A;  1YQS A;  4IVI A;  5DTT A;  3G30 A;  5E2H A;  1HVB A;  3G34 A;  5GLA A;  4JXS A;  3BRM A;  4P6B A;  3UE3 A;  5JYP A;  2J9O A;  1CEF A;  1IEM A;  2PBY A;  3PBQ A;  4E3L A;  4WM9 A;  3HVF A;  1BLH A;  1FCN A;  4XUZ A;  2E8I A;  5FQM A;  4BQM A;  1XXM A;  1E3U A;  3PBO A;  1E4D A;  1YLT A;  4ID4 A;  4S2N A;  3NY4 A;  4BEN A;  1FR1 A;  3FKV A;  5JYO A;  4OOL A;  1ERM A;  1BTL A;  3CZD A;  3PBN A;  4IBR A;  5HAP A;  2QMI A;  3GSG A;  3PBR A;  3C5A A;  1K4E A;  1PZP A;  1YT4 A;  1XP4 A;  3PAE A;  2FFY A;  4WYY A;  2J7V A;  3NC8 A;  2ZC7 A;  1AXB A;  3SS5 A;  4WZ5 A;  4QY6 A;  4WEJ A;  4JBF A;  1ES3 A;  1XA7 A;  5CHJ A;  5GHZ A;  1E3U D;  4KZ5 A;  4BD1 A;  1W5D A;  1L2S A;  4MLL A;  1FSW A;  2JE5 A;  2Y2P A;  3M2K A;  1H8Y A;  4WZ5 C;  4HEF A;  2Y2Q A;  2Z2M B;  3P98 A;  3S4X A;  3VFH A;  2ZC3 B;  5HAI A;  4BJP A;  2VGK A;  5FQQ A;  3MZD A;  1VM1 A;  2PU2 A;  1LHY A;  3TSG A;  4S2J A;  4H8R A;  4UHU A;  3WS1 A;  3BLM A;  2XDM A;  1M6K A;  1LLB A;  2ZQA A;  2WYX A;  4S2N C;  2V1Z A;  5FAT A;  1SHV A;  2FFF B;  1XGI A;  1ALQ A;  4LCM A;  1DJC A;  4JPM A;  4ZBE A;  1KE0 A;  3PTE A;  2ZQC A;  5TGF A;  4OQG A;  3Q81 A;  4L0L A;  5EVI A;  4LV2 A;  4HES A;  4BD0 A;  4UA9 A;  1NZO A;  3MFD A;  4N92 A;  5CRF A;  5M18 A;  5CGX A;  3TOI A;  3VSK A;  1PWG A;  3AGF A;  2ZM8 A;  5FQK A;  2ZQ9 A;  4PM6 A;  2V2F F;  5EPH A;  3VP0 A;  3VP2 A;  1NYM A;  4FSF A;  1BLC A;  2Y55 A;  3SS3 A;  3MXR A;  4QY5 A;  2R9X A;  1XKZ A;  3ITB A;  3VOY A;  2WKE A;  2XR0 A;  5E43 A;  3FWL A;  1IYP A;  3GV9 A;  4IBX A;  4JXW A;  1IYO A;  3MZF A;  3SH8 A;  2XH9 A;  1Q2Q A;  4E3I A;  5HW3 A;  2ZMA A;  1IKI A;  1LL5 A;  4WBG A;  4HBT A;  4LV0 A;  1JWZ A;  4DXC A;  3G2Z A;  4WEL A;  1MWS A;  5GHX A;  3QNC A;  4MBH A;  3RXW A;  3C4P A;  5FQI A;  1CEG A;  1KE3 A;  1L0D A;  2HP5 A;  3NIA A;  4GZB A;  1MWU A;  4PM5 A;  4UA6 A;  3HLE A;  1YLJ A;  5F1G A;  4OON A;  1EI5 A;  2WZZ A;  3UDF A;  2IWB A;  5KSC A;  4GD8 A;  3DW0 A;  1U60 A;  5FAP A;  2RL3 A;  4B88 A;  3GR2 A;  1BZA A;  3BEB A;  5EE8 A;  1E25 A;  1LL9 A;  1SKF A;  3O86 A;  3SOI A;  3A3J A;  5TFQ A;  3IXH A;  4FH4 A;  2WK0 A;  3ZG9 B;  4Y0T A;  4E6X A;  5FQJ A;  4DE1 A;  4UA7 A;  3Q7Z A;  1L0E A;  1MKI A;  3HLF A;  2ZC5 B;  4QB8 A;  4DF6 A;  3O3V A;  2J8Y A;  3C7V A;  1BSG A;  3M2J A;  5AQ9 A;  4DKI A;  1TDG A;  2Q9M A;  1PWC A;  5CTM A;  1HTZ A;  2X71 A;  4U0T A;  4WMC D;  3ZG8 B;  2Y4A A;  5FAS A;  3IWO A;  3G2Y A;  3WWX A;  1ERO A;  1W7F A;  3UPO A;  5FI2 A;  4OOY A;  5CHU A;  3FKW A;  5AQA A;  3OCL A;  4M3K A;  2WAF A;  2Y2G A;  1NYY A;  1MWT A;  1JTG A;  3BFD A;  1HZO A;  4PPR A;  4YIN A;  5GL9 A;  1K55 A;  3S1Y A;  3NBL A;  3IWI A;  3MZE A;  1K55 C;  3EQV A;  4X69 A;  1K57 A;  4OQH A;  4QHC A;  1GHP A;  3Q7V B;  5DF8 A;  3ZFZ A;  4E3N A;  1HD8 A;  5G18 A;  5FDH A;  1KVL A;  2XD5 A;  2HDR A;  5IHV A;  2X01 A;  5GLC A;  4BL2 A;  1ERQ A;  1I5Q A;  4RA7 A;  5E2E A;  1ES2 A;  3IWQ A;  4LCL A;  4PMA A;  5DTK A;  3N8R A;  1S6R A;  5FAQ A;  2WGW B;  2Y2K A;  4UAA A;  2XFT A;  3IF6 B;  3PBT A;  1K54 A;  3IXB A;  3OCN A;  2ZQ8 A;  3Q7V A;  2ZC4 B;  1TEM A;  3A3I A;  2ZM0 A;  1LI9 A;  3OPL A;  3SH7 A;  3V39 A;  2QPN A;  3PBS A;  4EWF A;  2P9V B;  1MBL A;  3BFF A;  1ZKJ A;  4A5R A;  2WUQ A;  5E2F A;  5EVI C;  1TDL A;  5J8X A;  5CEC A;  3IH9 A;  5CXW A;  4C75 A;  2UWX A;  4ZJ2 A;  2GDN A;  2G2U A;  3IH8 A;  1K6S A;  4DXB A;  5L2F A;  3E2L A;  3WS0 A;  4OPZ A;  4KZ6 A;  3W4P A;  4GDN A;  3CG5 A;  3HLB A;  4RYE A;  3VOZ A;  2WGW A;  4R23 A;  4S2O A;  2OSU A;  3OC2 A;  1IYQ A;  5GLB A;  4ZDX A;  4EUZ A;  3UDX A;  3GRJ A;  3QNB A;  5DVA A;  3ZNY A;  5F1F A;  3G4P A;  3W8K A;  1DJA A;  1PI5 A;  3UNW A;  2HPB A;  1ES5 A;  3N7W A;  3DTM A;  1BT5 A;  1NRF A;  3HLG A;  1Q2P A;  2P74 A;  1WE4 A;  3MXS A;  2VGJ A;  2X02 A;  1NZU A;  1LI0 A;  1K6R A;  4EBN A;  4OKP A;  5KMW A;  1W8Y A;  3LO7 A;  2H10 A;  1SDE A;  3ZG7 B;  1G68 A;  1JWV A;  4BLM A;  1YLZ A;  4K91 A;  4ZJ3 A;  3ZG5 A;  3UPN A;  4E3J A;  1K25 A;  1K56 D;  3DWK A;  3OZH A;  4XXR A;  5HX9 A;  3AGE A;  1FCO A;  3BFC A;  3ZVW A;  2ZQD A;  2JBF A;  4OPR A;  4P87 A;  1SDN A;  1I2S A;  2C6W B;  2IWD A;  3C4O A;  4OH0 A;  1KGE A;  3D4F A;  1L0G A;  4KEN B;  1XX2 A;  4YFM A;  5KZH A;  1MXO A;  3SH9 A;  2H0Y A;  4DE0 A;  1RCJ A;  1NXY A;  1BUL A;  3BFE A;  3HUM A;  3LY3 A;  4N1X A;  4LEN A;  1M40 A;  4C6Y A;  3UE1 A;  5M19 A;  1K4F A;  1ZC2 A;  2Y2M A;  5AQ7 A;  1YLP A;  3EQU A;  3V5M A;  4S2I A;  5KSH A;  4O7D A;  3A3F A;  3Q07 A;  4KQR A;  5GLD A;  4R1G A;  3HL9 A;  1JVJ A;  4MEZ A;  4KQQ A;  3WRZ A;  3M6B A;  4X68 A;  3BYD A;  4IVK A;  4Y0U A;  1DY6 A;  4FH2 A;  1ES4 A;  4DRT A;  3M6H A;  3NDG A;  1ESU A;  2DCF A;  3IQA A;  4JKT A;  1ZG4 A;  3HBR A;  5HAR A;  4MNR A;  1FSY A;  1BLP A;  4R3J A;  5EUA A;  3Q1F A;  4KG2 A;  4ZAM A;  1K56 A;  2EXA A;  4X6T A;  5A92 A;  2Q9N A;  3BFG A;  1MWR A;  5FAO A;  2JCH A;  2EX2 A;  3OPR A;  4OLD A;  4ZTK A;  4CJN A;  2IWC A;  4D2O A;  2DRW A;  3ZCZ A;  5TR7 A;  4EV4 A;  3SS4 A;  5HL1 A;  3ISG A;  4GNU A;  1DJB A;  4NET A;  4KZ9 A;  2XLN A;  4PM8 A;  4BL3 A;  3UE0 A;  5U47 A;  5CGS A;  3IF6 C;  1GA9 A;  2WKH A;  1KGF A;  2ZD8 A;  4Y7P A;  4DE2 A;  3IT9 A;  3HRE A;  1JWP A;  3PAG A;  4QD4 A;  1O7E A;  3JYI A;  2H5S A;  2EX8 A;  4OPQ A;  3ZHH A;  1PIO A;  5I94 A;  3IHA A;  4WMC A;  2ZC6 B;  5F82 A;  2WGI A;  4OP5 A;  3UO9 A;  5DF7 A;  3O87 A;  3DWZ A;  3W4Q A;  2EX9 A;  2XGN A;  3ZNT A;  1N9B A;  1K38 A;  3B3X A;  4NK3 A;  2HP6 A;  3GQZ A;  3IF6 A;  4WZ4 A;  3ZVT A;  5HAQ A;  2XQZ A;  4FCF A;  4OQ0 A;  3IHB A;  4MBF A;  2QZ6 A;  1CK3 A;  5A91 A;  4E3K A;  3A3E A;  2ZLY A;  3AGD A;  4PM9 A;  2Y2I A;  1GHI A;  1KDS A;  4R0Q A;  5D3O A;  5F83 A;  1MY8 A;  4KZA A;  1MPL A;  3LY4 A;  5GHY A;  5A93 A;  2EFU A;  1YLY A;  2HDQ A;  2JC7 A;  4RX3 A;  3IXG A;  1YLW A;  2C5W B;  2Z2L B;  4S2L A;  4DE3 A;  1PW8 A;  3O88 A;  2Y2O A;  4E6W A;  3BM6 A;  4JF4 A;  4P0M A;  3HLC A;  3Q82 A;  3NCK A;  4GD6 A;  5M1A A;  1FCM A;  4K0X A;  3V50 A;  2OLV A;  1KDW A;  1KE4 A;  2Y2H A;  3GMW A;  5AQB A;  1YM1 A;  3E2K A;  4OVD A;  4Y0O A;  4JF6 A;  1PWD A;  4E3O A;  3FV7 A;  3VFF A;  1IYS A;  1ESI A;  4JLF A;  1NY0 A;  4OPY A;  1RGY A;  5EVL A;  5EVI D;  4KZ4 A;  1CI8 A;  1PZO A;  3VP4 A;  1PW1 A;  1EWZ A;  4X53 A;  3BLS A;  3HUN A;  4GKU A;  3IXD A;  4PM7 A;  4KG6 A;  2XF3 A;  4LV1 A;  2Y91 A;  4N1H A;  4OLG A;  3N4I A;  3ZG0 A;  4WEK A;  4ZJ1 A;  1QME A;  3NDE A;  4OP8 A;  3OPH A;  4CPK A;  5BOH A;  3W4O A;  4JF5 A;  3MKE A;  4B4Z A;  2XK1 A;  2BLS A;  3S22 A;  4EBL A;  4KZ3 A;  4RX2 A;  3TG9 A;  5HFO A;  5CGW A;  5DF9 A;  4B4X A;  4DDS A;  4S2K A;  2I72 A;  3NI9 A;  3I7J A;  2J9P A;  1K54 C;  3GTC A;  2BG1 A;  1TVF A;  5CED A;  2ZM2 A;  5FI7 A;  5FSR A;  4MBK A;  2A3U A;  2Y2N A;  5DTS A;  3OPP A;  1S0W A;  1ONG A;  4R3B A;  5E2G A;  4HBU A;  4S2M A;  3RXX A;  5EOE A;  5A90 A;  1KVM A;  4R4R A;  2A49 A;  1GCE A;  4U3T A;  4X55 A;  5FI6 A;  1H5X A;  4GN2 A;  4K0W A;  4QJG A;  3UY6 A;  3WS2 A;  3VP1 A;  2CC1 A;  3C7U A;  2WKI A;  4U0X A;  3MKF A;  4N9K A;  4X56 A;  3VMA A;  1KGG A;  4KG5 A;  4E3M A;  1XPB A;  1W79 A;  1K57 C;  1Y54 A;  1ZG6 A;  3P09 A;  1L0F A;  4EQI A;  2Y2J A;  1VQQ A;  5CTN A;  2WGV A;  4F94 A;  3LCE A;  4C3Q A;  2WZX A;  3WRT A;  1SCW A;  1IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...