5KZHA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
239
Chain Sequence
DEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 79
structure length 239
sequence length 240
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kzhA00
4FCFA 4EQIA 1K55C 2Y2KA 3NDEA 3HREA 1FR6A 1L0FA 4M3KA 4X55A 5FA7A 3UDFA 5CXWA 5TR7A 1PW8A 4WZ5A 4DXCA 3A3IA 2CC1A 3ITBA 3A3EA 2Y59A 1RCJA 3WS0A 3FV7A 3P98A 4E3OA 3IT9A 4OOMA 4JF5A 2WADA 4MBKA 3BFFA 2PU4A 3G34A 3VFHA 2JCHA 3MKEA 2DCFA 3PBOA 1EI5A 3PAEA 3W4QA 2JBFA 4R23A 2WGVA 1MWRA 3BLSA 2GDNA 3SS5A 1IKIA 1O07A 5CHMA 5GLAA 2I72A 1VM1A 2ZQCA 4IBXA 4OP5A 1PW1A 4LV1A 4Y0UA 1BLCA 3DWKA 1ALQA 1S6RA 3G31A 3VOYA 4GNUA 5CTMA 5GHXA 2ZM8A 4DXBA 1EWZA 1K6SA 3D4FA 1BZAA 3IF6C 4RX2A 3RXXA 5DVAA 4C75A 1Q2QA 2ZQ7A 3VP3A 2XFSA 2HPBA 2QZ6A 2Y2HA 5CRFA 2WK0A 4U0XA 1WYBA 3C7UA 2XEPA 3C7VA 3IH8A 1QMEA 2ZQ9A 4X68A 3FKVA 5CGXA 3V3RA 4RA7A 1DY6A 3UDXA 3TG9A 1XXMA 1XA1A 2G2WA 3GMWA 3V5MA 4LV0A 4JXGA 1SHVA 4S2NC 4XUZA 3ZVWA 4BLMA 4E3LA 5KSHA 2A49A 4HBTA 4DF6A 3EQVA 4IVKA 2EX2A 4DE2A 5EPHA 2Y2NA 3HUMA 1H8ZA 3PBNA 4JXSA 5EVIB 3TOIA 1ZKJA 4P87A 5HX9A 1GCEA 4K0XA 5E2EA 1LHYA 3Q7VB 2B5RA 2WAEA 3OPRA 5G18A 1K25A 1BLHA 4KZ7A 5E2HA 4OPZA 2WGWA 3G2ZA 1NZOA 3PAGA 1XGJA 1KVLA 4RYEA 2P9VB 2C5WB 2WKIA 1PZPA 4E3IA 3NBLA 3GRJA 3PTEA 3RJUA 2Y2GA 4WZ5C 1ZG6A 3RXWA 4GDBA 2ZM0A 3UDIA 5F1FA 1FQGA 2Y2QA 4KG5A 1NRFA 2H5SA 3LO7A 3WS4A 1K6RA 4GB7A 4C6YA 4WELA 4GD6A 1HZOA 3VP0A 1LL9A 3DWZA 3NDGA 4E6XA 3HUOA 4JBFA 5HAIA 5CECA 4MBHA 4ZJ3A 2H0YA 4IVIA 2WKEA 1CI9A 3VSKA 1G6AA 5FQIA 4R1GA 4FD8A 5FI2A 5M1AA 3WS5A 1DJAA 3IF6A 3IH9A 3BFEA 3FYZA 5F83A 4DKIA 2ZC3B 4OQGA 4S2JA 3ZVTA 3G35A 2HDUA 3UE3A 1MPLA 2ZC7A 2UWXA 2J9OA 1NZUA 2WKHA 2WGWB 1YQSA 3S22A 3UPPA 4WMCA 5HAPA 3M2KA 4Q8IA 3CG5A 1ES4A 4LCLA 5D3OA 3PBSA 4ZBEA 4B4XA 3E2KA 3FKWA 1I2WA 3HLBA 3MZEA 4Y0OA 1ESIA 1IKGA 1XP4A 3HUNA 3V39A 3ZCZA 1CEFA 3OPPA 3GVBA 1IYQA 4S2MA 2Y2LA 4WEJA 4N1XA 3A3DA 3S1YA 1HTZA 1GHMA 1W7FA 1PIOA 4L0LA 1NY0A 1JWZA 5E43A 2X01A 4B88A 4KG2A 1PZOA 5M18A 3G4PA 2ZD8A 5JYOA 3JYIA 3UN7A 1K4EA 2XLNA 5HFOA 3VP4A 2OLVA 3LEZA 1H8YA 2OV5A 2QMIA 3ZG7B 4DE0A 3IF6B 4E3KA 1KE4A 2ZJ9A 1FSYA 1NYMA 3M6HA 2EX6A 1JWPA 2R9XA 4N1HA 4P85A 5EUAA 4KQOA 3UE0A 3UNWA 4OVDA 5AQAA 1JVJA 5DF8A 1ESUA 4WEKA 1KGFA 2P74A 1ONGA 3OPLA 4KG6A 1SKFA 4Y7PA 3AGFA 4OONA 4OQ0A 3VP1A 4FH2A 5GLBA 1ES5A 1LLBA 3PBTA 3BECA 3V3SA 5HAQA 2DNSA 3SS4A 2WZZA 4JXWA 3CMZA 1G68A 2Y2OA 5TGFA 2XD5A 3IXDA 1U60A 1Q2PA 1WE4A 5CHJA 1CEGA 5A92A 5EOOA 2ZLYA 5U47A 1DJCA 4GKUA 3Q82A 2Y55A 4LENA 2V20A 4WBGA 5FQKA 2ZC6B 2FFYA 5IHVA 5A90A 5CEDA 3QNBA 3GTCA 3V50A 5J8XA 5EOEA 4JXVA 1MWTA 2EFXA 1NJ4A 5EECA 1L0DA 4ZJ2A 1GHIA 5CHUA 4HBUA 4KZBA 1ES3A 1YLYA 1BLSA 1BLPA 3M6BA 3WS1A 3OPHA 3ZG9B 5I94A 4CPKA 3HLDA 1W79A 3G32A 2QPNA 1J9MA 5F82A 4KZ9A 4KZ6A 1YMSA 4K0WA 2R9WA 5DF9A 2Y2PA 4RX3A 4Y0TA 4QY6A 4OOYA 1BUEA 4OQIA 3O86A 5A91A 2WGIA 1YM1A 1ZG4A 2X71A 1E3UA 2IWDA 1FCMA 1K54C 2RL3A 3HLEA 2EX8A 3MBZA 4E3JA 4BD1A 5CERA 4P6BA 4WMCD 1CK3A 3O87A 4DRTA 4GZBA 2J9PA 3VP2A 1MY8A 4MLLA 4DDYA 5EE8A 3BEBA 2DRWA 1S0WA 3BFCA 5HARA 1IELA 4WM9A 2ZC4B 1M40A 4WZ4A 4XUXA 4ID4A 3ZG5A 3LCEA 5E2GA 3VMAA 3LY3A 4P0MA 2H0TA 1VQQA 5TFQA 3IXHA 3NI9A 4QJGA 4N9LA 3BM6A 3N8LA 1YLTA 1W8QA 3SOIA 3Q07A 4XXRA 4DDSA 4S2OA 1TEMA 2EFUA 4OLGA 4KZAA 2XDMA 3IHBA 2X02A 1K4FA 3ZG8B 1ERQA 2RCXA 1LI9A 5JYPA 3OCNA 4OPYA 1L2SA 1SDNA 1N4OA 4OQHA 1KDSA 4KQRA 1KGEA 4S2KA 3VSLA 1OMEA 4YFMA 4PM7A 3ZGAB 3I7JA 1Y54A 3S4XA 3SH7A 1JWVA 1XPBA 4GD8A 4BJPA 2EXAA 3C4PA 4NK3A 4EWFA 1HVBA 5CGSA 3IWIA 3BRMA 1PWCA 3C4OA 4X6TA 3WRZA 3QHYA 1GA9A 4UHUA 2J8YA 3HVFA 3W4PA 4X69A 5FAPA 5CEBA 4E3MA 4R3JA 5GLDA 1PYYA 3IWOA 4PM9A 1JTGA 1GA0A 1GHPA 2WYXA 2HP9A 1I5QA 2ZQ8A 1ONHA 4QB8A 1YLPA 4QD4A 1YLZA 2WAFA 1RGYA 3B3XA 3IXBA 4UA7A 1XGIA 4LCMA 4GOGA 2XGNA 4X53A 2ZC5B 3IF5A 4EBLA 4KQQA 5CTNA 1K54A 1NXYA 2PU2A 1HD8A 3DTMA 2Y2IA 4ZTKA 1H5XA 1W5DA 4OOLA 3NIAA 2Q9MA 2OSUA 3SS3A 1MKIA 5FAQA 4PM8A 3ZDJA 3BLMA 3G30A 4K91A 3UPOA 1JTDA 5HL1A 3N8RA 3HLFA 1XKZA 3N6IA 4LV2A 1YT4A 3W4OA 4EUZA 2IWCA 3ZHHA 4DE3A 1BSGA 5L2FA 1ERMA 5FI7A 4CJNA 4OKPA 3VFFA 4YINA 3OCLA 3MXRA 4E3NA 2ZMAA 1KGGA 4OP8A 1SCWA 1BT5A 1EROA 4KZ3A 3N8SA 1KE0A 4N92A 5M19A 4KZ5A 4R0QA 3MZFA 3NCKA 1IYOA 3HL9A 4R3BA 1L0GA 1QMFA 3GV9A 3WWXA 1RP5A 1E3UD 2FFFB 1ES2A 4KZ8A 3SH8A 3BFGA 3MZDA 4OLDA 4EV4A 1YLWA 3EQUA 5FQMA 3IQAA 4KENB 3HLCA 5GL9A 4OPRA 4PMAA 5E2FA 3ISGA 1CI8A 1K56A 2OLUA 5EVLA 5EVIA 3ITAA 3N4IA 4BL3A 1K57C 1WYCA 2ZQDA 5KMWA 3Q7VA 2VGJA 3GR2A 4UA6A 5GHYA 2A3UA 1TVFA 3CZDA 1YLJA 1MXOA 3IHAA 4FSFA 4MNRA 3QNCA 1AXBA 5GHZA 2P9VA 1FSWA 1KDWA 2XQZA 5FATA 4UA9A 1M6KA 1E25A 4QY5A 2Q9NA 1FOFA 2JE5A 2Y4AA 4KZ4A 5HW3A 3TSGA 2EX9A 2ZM2A 5FAOA 2IWBA 1XX2A 5GLCA 3WRTA 4IBRA 2XH9A 4JLFA 2ZQAA 4QU3A 1FR1A 5AQBA 3UO9A 4JKTA 1IYSA 1O7EA 5KZHA 4BQMA 3OC2A 4ZJ1A 5AQ7A 4PM6A 3UE1A 3WS2A 3C5AA 1MWUA 4U3TA 3LY4A 2V1ZA 3Q7ZA 1KE3A 2XD1A 5KSCA 2BG1A 3Q81A 1E4DA 4E6WA 2HDQA 1FCNA 5A93A 2BLSA 1K55A 4B4ZA 5DF7A 5FSRA 2XFTA 4MBFA 2HDRA 5DTKA 3DW0A 3CJMA 3MFDA 3P09A 4GN2A 2XK1A 1TDGA 1IEMA 5FQQA 1BTLA 2XR0A 1DJBA 2HP5A 4HESA 1W8YA 1PI5A 4MEZA 4UAAA 4D2OA 3UPNA 4Z9QA 1IYPA 2JC7A 2V2FF 1MWSA 1Z6FA 3GSGA 3PBRA 2C6WB 2Z2MB 3O3VA 1L0EA 3AGEA 4BENA 4DE1A 4JPMA 3M2JA 4LV3A 2Y2MA 4R4RA 1NYYA 4F94A 5F1GA 1K57A 3GQZA 4NETA 4HEFA 4X56A 3G2YA 2HDSA 1FCOA 2Y2JA 3ZG0A 5EVIC 4ZDXA 3AGDA 5FQJA 4BD0A 4PPRA 2E8IA 3BFDA 2WZXA 1PWGA 4EBNA 2EXBA 5FASA 1TDLA 4N9KA 5FI6A 1PI4A 4C3QA 4WYYA 4A5RA 2HP6A 1LL5A 2VGKA 3BYDA 3Q1FA 2PBYA 2WUQA 1MBLA 3HBRA 3UY6A 1LI0A 2XF3A 1I2SA 4S2IA 3E2LA 1KVMA 2J7VA 3HLGA 4O7DA 4QHCA 1ZC2A 3ZNTA 4R4SA 4RVAA 4JF6A 1K38A 4S2PA 1K56D 1BULA 1C3BA 3MXSA 1RGZA 3NY4A 5DTSA 3FZCA 4S2NA 1XA7A 3PBQA 5EVID 3VOZA 3ZFZA 4ZAMA 3ZNYA 3FWLA 3IWQA 1YMXA 3IXGA 4PM5A 5DTTA 4OPQA 3N7WA 2Y91A 1PWDA 2G2UA 4H8RA 2Z2LB 5AQ9A 3OZHA 4BL2A 1N9BA 2H10A 3A3FA 5FQ9A 5CGWA 4JF4A 1SDEA 3A3JA 3NC8A 4S2LA 3SH9A 4U0TA 5BOHA 3W8KA 4FH4A 4EBPA 4GDNA 4OH0A 3HLWA 3MKFA 4IEDA 3O88A 5FDHA
chains in the Genus database with same CATH superfamily
3HREA 1FR6A 5G4ZA 5CXWA 3IBRA 3E4QA 1F98A 4DXCA 2BTFP 3A3EA 1H3QA 2Y59A 1RCJA 3FV7A 4JF5A 2PU4A 2JCHA 3PBOA 3SS5A 1O07A 1VM1A 4Y0UA 1S6RA 3VOYA 3KSIA 2ZM8A 1EWZA 1BYWA 5TBMA 4RX2A 4C75A 1Q2QA 2PT7A 1VHMA 2QZ6A 1WYBA 2XEPA 3V3RA 4I3IA 4RA7A 3CITA 1DY6A 4L9FA 3UMEA 1SHVA 3ZVWA 5KSHA 4H6JA 4DE2A 4LRZE 2B02A 1H8ZA 4JXSA 3TOIA 5EVIB 1ZKJA 1GCEA 3OPRA 3G2ZA 1NZOA 4I39A 2P9VB 2C5WB 1ZG6A 3UDIA 3SW1A 1NRFA 1K6RA 1ZHHB 2W1TB 3HUOA 5CECA 4ZJ3A 4X1MA 5FQIA 4R1GA 4FD8A 4NXGA 3U2AA 5F83A 4R3AA 3ZVTA 5HL6A 3G35A 3UE3A 1MPLA 2J3WA 3S22A 3QP8A 4XT2A 3E4OA 2MJ6A 4ZBEA 3HUNA 1CEFA 4N1XA 1J3WA 1GHMA 3EWKA 5HD5A 5M18A 3G4PA 2ZD8A 2XLNA 4LRXC 2OLVA 1KE4A 2ZL1B 2ZJ9A 1NYMA 3A0RA 1STZA 4HJ4A 5EUAA 4GHIA 4KQOA 3UNWA 4NXEA 5DF8A 1KOUA 3KSGA 1MC0A 3BQAA 3KYEA 4OONA 1IFQA 4JXWA 1G68A 1HLUP 2Y2OA 4ZRRA 1U60A 1Q2PA 3E98A 5CHJA 5EOOA 2ZMVA 1XJ6A 3MQOA 4HNBA 1TS6A 2ZC6B 5IHVA 3GTCA 3LIBA 1MWTA 1NRJA 4KZBA 1ES3A 4BWIA 1BLSA 1D1JA 2QPNA 5F82A 4YOFA 2R9WA 4JGRA 4Q0JA 2GJ3A 2P04A 4OOYA 3FPVA 5A91A 2WGIA 3LFVA 1LL8A 4GLQA 2EX8A 2J9PA 4ETXA 4DDYA 2DRWA 1S0WA 1IELA 2W27A 3W2ZA 5E2GA 3VMAA 5TFQA 3IXHA 3NI9A 4N9LA 3N8LA 1YLTA 3SOIA 4DDSA 4S2OA 1TEMA 2EFUA 4OLGA 5FDSA 2XDMA 1ERQA 4OPYA 1KDSA 3VSLA 4S2KA 4YFMA 3T1XA 3JVUA 3BY9A 4Y17A 1JWVA 4GD8A 4BJPA 2OOLA 5IU1A 1LSVA 4EWFA 3BRMA 1PWCA 3C4OA 4GW9A 1F5MA 3G6OA 2PBDP 1GHPA 2ZQ8A 1I5QA 3NOPC 1ONHA 2I9VA 5F68A 2INWA 2YKFA 2LB5A 3B3XA 4LCMA 2W3FA 2HZ5A 3IF5A 3QP5A 4EBLA 4Q0IA 1NXYA 3KX0X 3R7WA 3VE4A 2Y2IA 4OOLA 3NIAA 3NECA 1AWIA 1JTDA 5HWTA 2O9CA 3HLFA 4LV2A 3W4OA 2W1RA 4OKPA 4YINA 4B9OA 1G5UA 4OP8A 1XFNA 1BT5A 4KZ3A 5AVFA 4NXFA 1GSVA 1E3UD 2FFFB 4DN0A 2IA2A 2JKRM 2DMWA 1F9IA 2QWSA 5AVEA 5GL9A 3ISGA 4EERA 4MN6A 2PDRA 3IHAA 2V9AA 2GNXA 1FSWA 5HPFA 4UA9A 4EEUA 2PD8A 2Q9NA 2JE5A 2Y4AA 3H82B 3TSGA 3WRTA 2XH9A 3P7NA 1FR1A 5AQBA 1IYSA 1O7EA 5KZHA 2KLIA 3OC2A 2PR5A 4PM6A 3C5AA 1MWUA 4UQIS 4MMNA 2FH5A 2V0WA 3LY4A 2XD1A 2D02A 1YKDA 2BG1A 1Z09A 3Q81A 3LIEA 2HDQA 2BLSA 4EQ1A 1YSQA 2AVXA 4B4ZA 2JHEA 2PHYA 2HV1A 4EW7A 3CJMA 3P09A 4GN2A 3C8CA 1TDGA 1IEMA 3KO6A 3UPNA 3PBRA 3O3VA 1L0EA 3AGEA 1W63M 2Y2MA 4ARZB 3G2YA 3U4LP 5DFYA 3UB8A 4EBNA 4IUHA 5EM1A 4C3QA 3LUQA 4A5RA 3RH8B 3DTIA 2VGKA 2PBYA 3UY6A 2XF3A 1I2SA 3E2LA 4PHTA 4EXOA 4R4SA 5HZHA 5DJTA 5J4EA 1K38A 4S2PA 1C3BA 3NY4A 4S2NA 5EVID 1DP6A 2L4RA 2V8CA 2L0WA 3PBQA 4ZAMA 4F3LA 2YKHA 3P01A 3IWQA 4PKYA 4H8RA 3OZHA 4U0TA 3W8KA 1G28A 5FDHA 4FCFA 1K55C 4X55A 5FA7A 5KIZA 2KDKA 4IJGA 2JKGA 2ZOIA 2KX6A 3VV4A 2VV7A 1OT9A 2R78A 4I5SA 2JN7A 3IT9A 3C30A 4UQIM 2DCFA 1EI5A 4CLCB 2JBFA 4DJ2A 4EUVA 2WGVA 3CAXA 1MWRA 4FUWA 5GLAA 2I72A 4OP5A 4I38A 3UMDA 3DWKA 4CLCE 3D4FA 1BZAA 3F1PB 3IF6C 3RXXA 2A24B 5DVAA 4O8GA 3E0YA 5CRFA 4U0XA 3C7UA 3K2NA 2KOIA 1QMEA 2ZQ9A 3FKVA 5HDDA 3UDXA 3GMWA 2G2WA 4JXGA 2A49A 2EX2A 2W3EA 3HUMA 3RFBA 3PBNA 3Q7VB 2WAEA 1K25A 3DBAA 5DFXA 2WGWA 3GECA 4DJ3A 2WKIA 4HI4A 1PZPA 3UB6A 1N9OA 3RJUA 5TBMB 2E8JA 3B42A 2Y2QA 4KG5A 2H5SA 3LO7A 3O5YA 4GB7A 4JGQA 4WELA 3K3DA 5EVEA 1LL9A 3DWZA 1PFLA 1CI9A 4EEPA 4H6JB 5FI2A 5M1AA 1OTBA 3WS5A 3C2WA 3IF6A 3IH9A 3BFEA 3FYZA 2ZC3B 1OTEA 2HDUA 2UWXA 1YQSA 3CG5A 2V8FA 1I2WA 3HLBA 1IKGA 2Z6CA 3GVBA 1PIOA 5FL3A 4L0LA 5J7EA 4B88A 2X01A 4B93A 5JYOA 2M1CA 1K4EA 3VP4A 5DKKA 3LEZA 2QMIA 4DE0A 5HSQA 4E3KA 2EX6A 3LGOA 3UE0A 4OVDA 1IOUA 4QPRA 1ESUA 4WEKA 2P74A 4XT2B 1ONGA 1S1ZA 1SKFA 4GS9B 3T4OA 4O0PA 3VP1A 4O01A 5GLBA 3PBTA 3BECA 2PAVP 5HAQA 2DNSA 3LIDA 2WZZA 3CMZA 4PKYG 2OAP1 4EETB 2B95A 1CEGA 1TS8A 4G3WA 4QWOA 5U47A 1DJCA 2V20A 2VZWA 4WBGA 2FFYA 5CEDA 1UWNX 4NXBA 4JXVA 2EFXA 1NJ4A 5CHUA 1YLYA 1BLPA 4GHIB 3D9YA 3ZG9B 4CPKA 3EOIA 1W79A 3G32A 1J9MA 4Y0TA 4G3KA 4KUOA 3O86A 1ZG4A 1E3UA 2EA9A 2RL3A 2UV0E 4BD1A 4P6BA 4WMCD 1CK3A 3OLOA 1SKOB 4DRTA 4GZBA 1MY8A 2BASA 5EE8A 5HARA 3LY3A 1JNUA 1OTIA 1W8QA 4XXRA 4HH2A 4L9EA 4NKPA 5EV0A 3IHBA 2RCXA 5HDSA 2P7JA 4OQHA 1KGEA 3KYZA 1OMEA 1T18A 4NG2A 1XPBA 1Y4OA 3C4PA 4NK3A 3IWIA 4HY8A 3HVFA 4X69A 4R6LA 4E3MA 2VV8A 1PYYA 3IWOA 1JTGA 1GA0A 3NULA 4QB8A 2WAFA 4UA7A 3ZQ5A 2XGNA 4X53A 2ZC5B 5CTNA 5L07A 2OWJA 1OTAA 1MKMA 4ZTKA 1H5XA 3OOVA 3VOLA 2Q9MA 3SS3A 5FAQA 3BLMA 3G30A 2W3HA 4K91A 3UPOA 4DMZA 5HL1A 1XKZA 4MN7A 1YT4A 3IX3A 2NUTC 5L2FA 2JKFA 1OTDA 5EFWA 4P6ZS 2ZMAA 1SCWA 4HQAA 2NUPC 1EROA 1KE0A 3F1OB 4N92A 4R0QA 1P9RA 4D60A 3HL9A 1QMFA 3WWXA 1GSXA 4WLAA 5FQMA 4KENB 3BW6A 1WA9A 3MQQA 3MSHA 2OLUA 3NHQA 4LGWA 5EVIA 5EVLA 1P9WA 4BL3A 2PRFA 1WYCA 2A2LA 1NLZA 2J3TD 2EWWA 3PR6A 3CZDA 1YLJA 1MXOA 4HJ3A 3QNCA 4LPZA 5GHZA 2P9VA 5FATA 5GLCA 4IBRA 1F2KA 3UO9A 2W1TA 4BBTA 1CQAA 4BQMA 3WS2A 5EM0A 3F1NA 5TJJA 1E4DA 4E6WA 3CLOA 5DF7A 2XFTA 4MBFA 3DW0A 4E04A 2XK1A 4WN5A 5FQQA 2XR0A 1DJBA 2HP5A 1PI5A 4CLCD 4D2OA 4Z9QA 2JC7A 4FTXA 4DE1A 4I3JA 2PYRA 4R4RA 3FPWA 4II7A 3MJQA 4X56A 1FCOA 2Y2JA 4WUJA 4Y5FA 3AGDA 4P6ZM 5FQJA 4M4XA 2VX8A 2E8IA 2WZXA 1PWGA 5FASA 4YNRA 4N9KA 1LL5A 2ZL1A 5I5LA 1S4SA 1MBLA 1YSPA 4S2IA 2L1MA 3EGDC 1KVMA 3HLGA 4O7DA 3ZNTA 3HJIA 4RVAA 4LFUA 1K56D 2V1BA 5DTSA 3FZCA 1YMXA 4PM5A 5DTTA 1MZUA 5AQ9A 5A8BA 3NJAA 5CGWA 5BOHA 4FH4A 1VEUB 3LYXA 4GDNA 3HLWA 3MKFA 2VEAA 1T1CA 2VJWA 3NDEA 1L0FA 3UDFA 5TR7A 1PW8A 4WZ5A 4G3VA 4WF0A 3ITBA 3JPUA 4E3OA 4OOMA 2WADA 4MBKA 3G34A 3VFHA 4UEYA 3LIFA 3PAEA 2O9AA 2K2NA 4Q0HA 4R23A 2K7SA 3BLSA 4F3LB 4Y15A 1IKIA 3S7NA 1PW1A 4LV1A 1BLCA 1TS7A 3G31A 3QP6A 2XRNA 5MC7A 5L09A 2VLGA 2ZQ7A 3VP3A 2HPBA 4MCWA 3QP4A 2WK0A 3C7VA 3IH8A 1XXMA 3S7QA 3V5MA 4XUZA 4S2NC 4HBTA 3EQVA 4IVKA 4JGOA 5EPHA 4HH3A 3DAVA 5K5BA 5HX9A 3T50A 1X0OA 5E2EA 2B5RA 4KZ7A 1BLHA 5E2HA 1KVLA 1VETA 4E3IA 3NBLA 3MS6A 3NOTC 3R4KA 2Y2GA 3RXWA 2ZM0A 3T4KA 1FQGA 3WS4A 3MXQA 1NLYA 4C6YA 4Z1WA 3NDGA 4E6XA 2H0YA 2WKEA 1G6AA 1DJAA 1GSWA 3EGXC 4DKIA 3IS2B 4OQGA 4S2JA 3HCYA 3H7WB 2WGWB 4WMCA 4Q8IA 4LCLA 3PBSA 4B4XA 3E2KA 3FKWA 1XP4A 3V39A 4L9GA 3ZCZA 5HPIA 1IYQA 1SZVA 3S1YA 1HTZA 2Y8HA 1W7FA 1CF0A 1NY0A 3T12B 1XJ3A 5E43A 4KG2A 1PZOA 3JYIA 3UN7A 2WKPA 5HFOA 1H8YA 3ZG7B 3IF6B 4HOIA 1OT6A 1FSYA 1JWPA 2WKQA 3B47A 4P85A 1L3LA 1JVJA 4Y7PA 1NWZA 1ES5A 1LLBA 3SS4A 3IXDA 1TS0A 5A92A 4RQ9A 4HJ6A 5CX7A 3Q82A 2Y55A 4LENA 1A0KA 5J8XA 1D7EA 1D06A 1L0DA 1GHIA 4HBUA 2GZAA 3M6BA 3OPHA 5I94A 4ESPA 4KZ6A 1YMSA 4K0WA 5DF9A 4QY6A 1FILA 2W0NA 3L9KA 2GX5A 1BUEA 4OQIA 1UWPX 3T4TA 2X71A 3LR4A 1FCMA 3HLEA 5CERA 3VP2A 3BEBA 3BFCA 2Q0OA 4XUXA 1M40A 4WZ4A 5F6AA 2JKRI 2H0TA 1YPRA 4LLOB 4QJGA 3BM6A 4Y3IA 2PR6A 3UB9A 3Q07A 3C38A 4KZAA 2H28A 3ZG8B 2X02A 5JYPA 1LI9A 1L2SA 1N4OA 4KQRA 3ZGAB 2M7UA 3EEHA 4PAUA 3I7JA 1Y54A 3SH7A 2VA0A 2EXAA 2VK3A 5HWWA 4X6TA 3WRZA 4UHUA 1GA9A 5CEBA 5GLDA 4PM9A 1PRQA 2V1AA 4MN5A 4QD4A 3CPTA 4GOGA 4YWZA 4ETZA 1HD8A 2CMNA 3DTMA 4HHDA 1W5DA 4CLCA 1MKIA 3ZDJA 3CI6A 4EUZA 2IWCA 1G6OA 3ZHHA 4DE3A 1BSGA 5FI7A 4CJNA 4KQDA 1CJFA 3N8SA 4KZ5A 1H0MA 3NCKA 1IYOA 3GV9A 1RP5A 1ES2A 3BFGA 4OLDA 4EV4A 1YLWA 1CI8A 1K56A 3ITAA 3N4IA 1K57C 2ZQDA 5KMWA 3Q7VA 2VGJA 2M7VA 1TVFA 5FEGA 4MNRA 5IS1A 1M6KA 5HW3A 5FAOA 2IWBA 1XX2A 3H9WA 4JLFA 2ZQAA 4QU3A 2XROA 3BQ8A 2Z6DA 4ZJ1A 2O9BA 4GCZA 4U3TA 3CUEC 2V1ZA 3Q7ZA 1KE3A 5KSCA 2PD7A 3D3OA 5A93A 1FCNA 5FSRA 1T1AA 4I3AA 3A0SA 5DTKA 2W3GA 3MFDA 4MDZA 4HESA 4MEZA 1MWSA 1V9YA 3GSGA 3UE6A 2Z2MB 4JPMA 3M2JA 4LV3A 4F94A 5F1GA 1K57A 3GQZA 4NETA 1UGUA 2HF6A 5EVIC 4PPRA 4JGPA 1TDLA 3PXPA 3F1NB 1PI4A 5LBRA 1H8MA 2O0YA 2HP6A 3BYDA 2Y79A 2WUQA 2J7VA 4QHCA 3LR0A 4AFIA 3T1QB 3MXSA 4GS9A 1XA7A 3JVVA 3VOZA 3ZFZA 2QYBA 1T19A 2PYPA 3CUEA 5HD3A 3N7WA 2Y91A 1PWDA 5F5YA 1N9BA 2H10A 3T4SA 5FQ9A 3V67A 4JF4A 1SDEA 3A3JA 3SH9A 4EBPA 2VKSA 4IEDA 4ME4A 4EQIA 2Y2KA 3T4JA 4M3KA 3A3IA 2CC1A 2EWVA 1P97A 3WS0A 3P98A 3BFFA 3R7WB 1ODVA 3MKEA 3ZYTA 3W4QA 3IX4A 2GDNA 5CHMA 1OPXA 2ZQCA 4IBXA 1S67L 1ALQA 1SKOA 3UB7A 4GNUA 5CTMA 5GHXA 4DXBA 1K6SA 2OWHA 3DTEA 1ZTUA 4BBUA 2XFSA 3FC7A 2Y2HA 5CGXA 4CQHA 3L7HA 4X68A 3QP2A 2HJEA 3TG9A 1XA1A 4LV0A 4BLMA 4E3LA 4DF6A 2B18A 2Y2NA 3DTKA 1ACFA 4P87A 4K0XA 1LHYA 5G18A 4OPZA 3PAGA 1XGJA 4RYEA 2OAQ1 3GRJA 3PTEA 4WZ5C 3TE8A 4GDBA 5F1FA 2W3DA 5J3WA 1YAXA 1LSWA 1XJ4A 2QHKA 4GD6A 1HZOA 3VP0A 3E4PA 4JBFA 5HAIA 2QJ7A 3LR3A 4MBHA 4IVIA 1S1YA 3VSKA 1W63Q 4BBVA 4WL9A 2XSSA 3KSFA 3HJKA 3IX8A 3PYPA 2ZC7A 3A0VA 3T4QA 3MFXA 2J9OA 1NZUA 2WKHA 2FZ0A 2XA7S 3UPPA 5HAPA 3M2KA 1ES4A 5D3OA 1VETB 2D01A 3MZEA 4Y0OA 1ESIA 4K08A 3KSHA 3F1OA 3OPPA 4S2MA 2Y2LA 4WEJA 3A3DA 2JKTM 1JWZA 2P08A 4Y13A 1PNEA 2OV5A 3LI9A 3LR5A 3M6HA 5HWVA 5L10A 2R9XA 4N1HA 4LRYC 5AQAA 2ZMFA 1KGFA 1K0KA 1DP8A 3OPLA 4KG6A 3AGFA 4OQ0A 4HP9A 4FH2A 5DKLA 1TD5A 3V3SA 1LT0A 4EESA 5TGFA 2XD5A 1WE4A 2ZBBA 2ZLYA 1XJ2A 4GKUA 5FQKA 5A90A 2WKRA 3QNBA 3V50A 2ACGA 1V9ZA 5EOEA 3OBFA 3MMHA 5EECA 4ZJ2A 3EEAA 3WS1A 4IUKA 3HLDA 3QP1A 2VV6A 2G7UA 4KZ9A 2Y2PA 4HIAA 4RX3A 4IHQA 2VGLS 1S4RA 4KUKA 4NEED 1YM1A 3IBJA 3K3CA 2IWDA 1K54C 3TW8A 3MBZA 4E3JA 2XA7M 3FG8A 3MF0A 3O87A 3B33A 4MLLA 3NOUC 5IT5A 4WM9A 2ZC4B 3ZG5A 4ID4A 3LCEA 4X1LA 4P0MA 3BJNA 1VQQA 1EW0A 5AJGA 5FEFA 2QJ5A 5F69A 1N9NA 5DJUA 1K4FA 3OCNA 1SDNA 2QKPA 4PM7A 3S4XA 1HVBA 1VEUA 5CGSA 3BWLA 3QHYA 2J8YA 1DP9A 3W4PA 1TF1A 5FAPA 3ULFA 4R3JA 2WYXA 2HP9A 1S66L 1P0ZA 1YLPA 1YLZA 1OJGA 1RGYA 3IXBA 1XGIA 3TRCA 4KQQA 1K54A 3CWFA 2PU2A 3SZTA 2K31A 3S7OA 2OSUA 1VB6A 4PM8A 1OJ5A 3N8RA 4EU0A 3N6IA 2O99A 5G4YA 3VE3A 1ERMA 3VFFA 4GJ4A 3OCLA 3MXRA 4E3NA 1KGGA 3LI8A 2J3TC 3D72A 1T1BA 3H82A 5L8MA 5M19A 3MZFA 4R3BA 2VGLM 1L0GA 4KZ8A 4X25A 3SH8A 3MZDA 1N9LA 3CPTB 3EQUA 3KYQA 3S7PA 3UB5P 3IQAA 2J80A 3HLCA 1DRMA 4OPRA 4PMAA 5E2FA 1XFQA 2V0UA 4UA6A 3GR2A 5GHYA 2A3UA 4FSFA 1AXBA 1Y28A 1KDWA 2XQZA 4Y2FA 4BMWA 1E25A 4QY5A 3RTYA 3LICA 1FOFA 5HDCA 4KZ4A 2EX9A 2HGVA 2ZM2A 2JKTI 4ARZA 4JKTA 3PHYA 3TJZC 4CLCC 5AQ7A 3UE1A 4R70A 5C5KA 1LSXA 3IS2A 3H7WA 1K55A 3T4LA 2HDRA 3MQ0A 3CHWP 1BTLA 3GDIA 2HJ9C 1W8YA 4UAAA 1IYPA 2V2FF 3T1RA 1Z6FA 4BENA 2C6WB 1NYYA 4HEFA 2HDSA 3ZG0A 4ZDXA 3LEQA 4BD0A 3BY8A 3BFDA 2EXBA 5FI6A 4WYYA 1FIKA 3Q1FA 3HBRA 1LI0A 1ZC2A 3MR0A 4JF6A 1BULA 1RGZA 2LB9A 3LIAA 3T1SA 3ZNYA 3FWLA 3IXGA 4FOFA 4OPQA 2G2UA 4R38A 2Z2LB 4BL2A 3A3FA 2ZOHA 4S2LA 3NC8A 3ICYA 4HP4A 3F1PA 2A24A 4OH0A 3O88A
chains in the Genus database with same CATH topology
4FCFA 4EQIA 1K55C 2Y2KA 3NDEA 3HREA 1FR6A 1L0FA 4M3KA 4X55A 5FA7A 3UDFA 5CXWA 5TR7A 1PW8A 4WZ5A 4DXCA 3A3IA 2CC1A 3ITBA 3A3EA 2Y59A 1RCJA 3WS0A 3FV7A 3P98A 4E3OA 3IT9A 4OOMA 4JF5A 2WADA 4MBKA 3BFFA 2PU4A 3G34A 3VFHA 2JCHA 3MKEA 2DCFA 3PBOA 1EI5A 3PAEA 3W4QA 2JBFA 4R23A 2WGVA 1MWRA 3BLSA 2GDNA 3SS5A 1IKIA 1O07A 5CHMA 5GLAA 2I72A 1VM1A 2ZQCA 4IBXA 4OP5A 1PW1A 4LV1A 4Y0UA 1BLCA 3DWKA 1ALQA 1S6RA 3G31A 3VOYA 4GNUA 5CTMA 5GHXA 2ZM8A 4DXBA 1EWZA 1K6SA 3D4FA 1BZAA 3IF6C 4RX2A 3RXXA 5DVAA 4C75A 1Q2QA 2ZQ7A 3VP3A 2XFSA 2HPBA 2QZ6A 2Y2HA 5CRFA 2WK0A 4U0XA 1WYBA 3C7UA 2XEPA 3C7VA 3IH8A 1QMEA 2ZQ9A 4X68A 3FKVA 5CGXA 3V3RA 4RA7A 1DY6A 3UDXA 3TG9A 1XXMA 1XA1A 2G2WA 3GMWA 3V5MA 4LV0A 4JXGA 1SHVA 4S2NC 4XUZA 3ZVWA 4BLMA 4E3LA 5KSHA 2A49A 4HBTA 4DF6A 3EQVA 4IVKA 2EX2A 4DE2A 5EPHA 2Y2NA 3HUMA 1H8ZA 3PBNA 4JXSA 5EVIB 3TOIA 1ZKJA 4P87A 5HX9A 1GCEA 4K0XA 5E2EA 1LHYA 3Q7VB 2B5RA 2WAEA 3OPRA 5G18A 1K25A 1BLHA 4KZ7A 5E2HA 4OPZA 2WGWA 3G2ZA 1NZOA 3PAGA 1XGJA 1KVLA 4RYEA 2P9VB 2C5WB 2WKIA 1PZPA 4E3IA 3NBLA 3GRJA 3PTEA 3RJUA 2Y2GA 4WZ5C 1ZG6A 3RXWA 4GDBA 2ZM0A 3UDIA 5F1FA 1FQGA 2Y2QA 4KG5A 1NRFA 2H5SA 3LO7A 3WS4A 1K6RA 4GB7A 4C6YA 4WELA 4GD6A 1HZOA 3VP0A 1LL9A 3DWZA 3NDGA 4E6XA 3HUOA 4JBFA 5HAIA 5CECA 4MBHA 4ZJ3A 2H0YA 4IVIA 2WKEA 1CI9A 3VSKA 1G6AA 5FQIA 4R1GA 4FD8A 5FI2A 5M1AA 3WS5A 1DJAA 3IF6A 3IH9A 3BFEA 3FYZA 5F83A 4DKIA 2ZC3B 4OQGA 4S2JA 3ZVTA 3G35A 2HDUA 3UE3A 1MPLA 2ZC7A 2UWXA 2J9OA 1NZUA 2WKHA 2WGWB 1YQSA 3S22A 3UPPA 4WMCA 5HAPA 3M2KA 4Q8IA 3CG5A 1ES4A 4LCLA 5D3OA 3PBSA 4ZBEA 4B4XA 3E2KA 3FKWA 1I2WA 3HLBA 3MZEA 4Y0OA 1ESIA 1IKGA 1XP4A 3HUNA 3V39A 3ZCZA 1CEFA 3OPPA 3GVBA 1IYQA 4S2MA 2Y2LA 4WEJA 4N1XA 3A3DA 3S1YA 1HTZA 1GHMA 1W7FA 1PIOA 4L0LA 1NY0A 1JWZA 5E43A 2X01A 4B88A 4KG2A 1PZOA 5M18A 3G4PA 2ZD8A 5JYOA 3JYIA 3UN7A 1K4EA 2XLNA 5HFOA 3VP4A 2OLVA 3LEZA 1H8YA 2OV5A 2QMIA 3ZG7B 4DE0A 3IF6B 4E3KA 1KE4A 2ZJ9A 1FSYA 1NYMA 3M6HA 2EX6A 1JWPA 2R9XA 4N1HA 4P85A 5EUAA 4KQOA 3UE0A 3UNWA 4OVDA 5AQAA 1JVJA 5DF8A 1ESUA 4WEKA 1KGFA 2P74A 1ONGA 3OPLA 4KG6A 1SKFA 4Y7PA 3AGFA 4OONA 4OQ0A 3VP1A 4FH2A 5GLBA 1ES5A 1LLBA 3PBTA 3BECA 3V3SA 5HAQA 2DNSA 3SS4A 2WZZA 4JXWA 3CMZA 1G68A 2Y2OA 5TGFA 2XD5A 3IXDA 1U60A 1Q2PA 1WE4A 5CHJA 1CEGA 5A92A 5EOOA 2ZLYA 5U47A 1DJCA 4GKUA 3Q82A 2Y55A 4LENA 2V20A 4WBGA 5FQKA 2ZC6B 2FFYA 5IHVA 5A90A 5CEDA 3QNBA 3GTCA 3V50A 5J8XA 5EOEA 4JXVA 1MWTA 2EFXA 1NJ4A 5EECA 1L0DA 4ZJ2A 1GHIA 5CHUA 4HBUA 4KZBA 1ES3A 1YLYA 1BLSA 1BLPA 3M6BA 3WS1A 3OPHA 3ZG9B 5I94A 4CPKA 3HLDA 1W79A 3G32A 2QPNA 1J9MA 5F82A 4KZ9A 4KZ6A 1YMSA 4K0WA 2R9WA 5DF9A 2Y2PA 4RX3A 4Y0TA 4QY6A 4OOYA 1BUEA 4OQIA 3O86A 5A91A 2WGIA 1YM1A 1ZG4A 2X71A 1E3UA 2IWDA 1FCMA 1K54C 2RL3A 3HLEA 2EX8A 3MBZA 4E3JA 4BD1A 5CERA 4P6BA 4WMCD 1CK3A 3O87A 4DRTA 4GZBA 2J9PA 3VP2A 1MY8A 4MLLA 4DDYA 5EE8A 3BEBA 2DRWA 1S0WA 3BFCA 5HARA 1IELA 4WM9A 2ZC4B 1M40A 4WZ4A 4XUXA 4ID4A 3ZG5A 3LCEA 5E2GA 3VMAA 3LY3A 4P0MA 2H0TA 1VQQA 5TFQA 3IXHA 3NI9A 4QJGA 4N9LA 3BM6A 3N8LA 1YLTA 1W8QA 3SOIA 3Q07A 4XXRA 4DDSA 4S2OA 1TEMA 2EFUA 4OLGA 4KZAA 2XDMA 3IHBA 2X02A 1K4FA 3ZG8B 1ERQA 2RCXA 1LI9A 5JYPA 3OCNA 4OPYA 1L2SA 1SDNA 1N4OA 4OQHA 1KDSA 4KQRA 1KGEA 4S2KA 3VSLA 1OMEA 4YFMA 4PM7A 3ZGAB 3I7JA 1Y54A 3S4XA 3SH7A 1JWVA 1XPBA 4GD8A 4BJPA 2EXAA 3C4PA 4NK3A 4EWFA 1HVBA 5CGSA 3IWIA 3BRMA 1PWCA 3C4OA 4X6TA 3WRZA 3QHYA 1GA9A 4UHUA 2J8YA 3HVFA 3W4PA 4X69A 5FAPA 5CEBA 4E3MA 4R3JA 5GLDA 1PYYA 3IWOA 4PM9A 1JTGA 1GA0A 1GHPA 2WYXA 2HP9A 1I5QA 2ZQ8A 1ONHA 4QB8A 1YLPA 4QD4A 1YLZA 2WAFA 1RGYA 3B3XA 3IXBA 4UA7A 1XGIA 4LCMA 4GOGA 2XGNA 4X53A 2ZC5B 3IF5A 4EBLA 4KQQA 5CTNA 1K54A 1NXYA 2PU2A 1HD8A 3DTMA 2Y2IA 4ZTKA 1H5XA 1W5DA 4OOLA 3NIAA 2Q9MA 2OSUA 3SS3A 1MKIA 5FAQA 4PM8A 3ZDJA 3BLMA 3G30A 4K91A 3UPOA 1JTDA 5HL1A 3N8RA 3HLFA 1XKZA 3N6IA 4LV2A 1YT4A 3W4OA 4EUZA 2IWCA 3ZHHA 4DE3A 1BSGA 5L2FA 1ERMA 5FI7A 4CJNA 4OKPA 3VFFA 4YINA 3OCLA 3MXRA 4E3NA 2ZMAA 1KGGA 4OP8A 1SCWA 1BT5A 1EROA 4KZ3A 3N8SA 1KE0A 4N92A 5M19A 4KZ5A 4R0QA 3MZFA 3NCKA 1IYOA 3HL9A 4R3BA 1L0GA 1QMFA 3GV9A 3WWXA 1RP5A 1E3UD 2FFFB 1ES2A 4KZ8A 3SH8A 3BFGA 3MZDA 4OLDA 4EV4A 1YLWA 3EQUA 5FQMA 3IQAA 4KENB 3HLCA 5GL9A 4OPRA 4PMAA 5E2FA 3ISGA 1CI8A 1K56A 2OLUA 5EVLA 5EVIA 3ITAA 3N4IA 4BL3A 1K57C 1WYCA 2ZQDA 5KMWA 3Q7VA 2VGJA 3GR2A 4UA6A 5GHYA 2A3UA 1TVFA 3CZDA 1YLJA 1MXOA 3IHAA 4FSFA 4MNRA 3QNCA 1AXBA 5GHZA 2P9VA 1FSWA 1KDWA 2XQZA 5FATA 4UA9A 1M6KA 1E25A 4QY5A 2Q9NA 1FOFA 2JE5A 2Y4AA 4KZ4A 5HW3A 3TSGA 2EX9A 2ZM2A 5FAOA 2IWBA 1XX2A 5GLCA 3WRTA 4IBRA 2XH9A 4JLFA 2ZQAA 4QU3A 1FR1A 5AQBA 3UO9A 4JKTA 1IYSA 1O7EA 5KZHA 4BQMA 3OC2A 4ZJ1A 5AQ7A 4PM6A 3UE1A 3WS2A 3C5AA 1MWUA 4U3TA 3LY4A 2V1ZA 3Q7ZA 1KE3A 2XD1A 5KSCA 2BG1A 3Q81A 1E4DA 4E6WA 2HDQA 1FCNA 5A93A 2BLSA 1K55A 4B4ZA 5DF7A 5FSRA 2XFTA 4MBFA 2HDRA 5DTKA 3DW0A 3CJMA 3MFDA 3P09A 4GN2A 2XK1A 1TDGA 1IEMA 5FQQA 1BTLA 2XR0A 1DJBA 2HP5A 4HESA 1W8YA 1PI5A 4MEZA 4UAAA 4D2OA 3UPNA 4Z9QA 1IYPA 2JC7A 2V2FF 1MWSA 1Z6FA 3GSGA 3PBRA 2C6WB 2Z2MB 3O3VA 1L0EA 3AGEA 4BENA 4DE1A 4JPMA 3M2JA 4LV3A 2Y2MA 4R4RA 1NYYA 4F94A 5F1GA 1K57A 3GQZA 4NETA 4HEFA 4X56A 3G2YA 2HDSA 1FCOA 2Y2JA 3ZG0A 5EVIC 4ZDXA 3AGDA 5FQJA 4BD0A 4PPRA 2E8IA 3BFDA 2WZXA 1PWGA 4EBNA 2EXBA 5FASA 1TDLA 4N9KA 5FI6A 1PI4A 4C3QA 4WYYA 4A5RA 2HP6A 1LL5A 2VGKA 3BYDA 3Q1FA 2PBYA 2WUQA 1MBLA 3HBRA 3UY6A 1LI0A 2XF3A 1I2SA 4S2IA 3E2LA 1KVMA 2J7VA 3HLGA 4O7DA 4QHCA 1ZC2A 3ZNTA 4R4SA 4RVAA 4JF6A 1K38A 4S2PA 1K56D 1BULA 1C3BA 3MXSA 1RGZA 3NY4A 5DTSA 3FZCA 4S2NA 1XA7A 3PBQA 5EVID 3VOZA 3ZFZA 4ZAMA 3ZNYA 3FWLA 3IWQA 1YMXA 3IXGA 4PM5A 5DTTA 4OPQA 3N7WA 2Y91A 1PWDA 2G2UA 4H8RA 2Z2LB 5AQ9A 3OZHA 4BL2A 1N9BA 2H10A 3A3FA 5FQ9A 5CGWA 4JF4A 1SDEA 3A3JA 3NC8A 4S2LA 3SH9A 4U0TA 5BOHA 3W8KA 4FH4A 4EBPA 4GDNA 4OH0A 3HLWA 3MKFA 4IEDA 3O88A 5FDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCF A;  4EQI A;  1K55 C;  2Y2K A;  3NDE A;  3HRE A;  1FR6 A;  1L0F A;  4M3K A;  4X55 A;  5FA7 A;  3UDF A;  5CXW A;  5TR7 A;  1PW8 A;  4WZ5 A;  4DXC A;  3A3I A;  2CC1 A;  3ITB A;  3A3E A;  2Y59 A;  1RCJ A;  3WS0 A;  3FV7 A;  3P98 A;  4E3O A;  3IT9 A;  4OOM A;  4JF5 A;  2WAD A;  4MBK A;  3BFF A;  2PU4 A;  3G34 A;  3VFH A;  2JCH A;  3MKE A;  2DCF A;  3PBO A;  1EI5 A;  3PAE A;  3W4Q A;  2JBF A;  4R23 A;  2WGV A;  1MWR A;  3BLS A;  2GDN A;  3SS5 A;  1IKI A;  1O07 A;  5CHM A;  5GLA A;  2I72 A;  1VM1 A;  2ZQC A;  4IBX A;  4OP5 A;  1PW1 A;  4LV1 A;  4Y0U A;  1BLC A;  3DWK A;  1ALQ A;  1S6R A;  3G31 A;  3VOY A;  4GNU A;  5CTM A;  5GHX A;  2ZM8 A;  4DXB A;  1EWZ A;  1K6S A;  3D4F A;  1BZA A;  3IF6 C;  4RX2 A;  3RXX A;  5DVA A;  4C75 A;  1Q2Q A;  2ZQ7 A;  3VP3 A;  2XFS A;  2HPB A;  2QZ6 A;  2Y2H A;  5CRF A;  2WK0 A;  4U0X A;  1WYB A;  3C7U A;  2XEP A;  3C7V A;  3IH8 A;  1QME A;  2ZQ9 A;  4X68 A;  3FKV A;  5CGX A;  3V3R A;  4RA7 A;  1DY6 A;  3UDX A;  3TG9 A;  1XXM A;  1XA1 A;  2G2W A;  3GMW A;  3V5M A;  4LV0 A;  4JXG A;  1SHV A;  4S2N C;  4XUZ A;  3ZVW A;  4BLM A;  4E3L A;  5KSH A;  2A49 A;  4HBT A;  4DF6 A;  3EQV A;  4IVK A;  2EX2 A;  4DE2 A;  5EPH A;  2Y2N A;  3HUM A;  1H8Z A;  3PBN A;  4JXS A;  5EVI B;  3TOI A;  1ZKJ A;  4P87 A;  5HX9 A;  1GCE A;  4K0X A;  5E2E A;  1LHY A;  3Q7V B;  2B5R A;  2WAE A;  3OPR A;  5G18 A;  1K25 A;  1BLH A;  4KZ7 A;  5E2H A;  4OPZ A;  2WGW A;  3G2Z A;  1NZO A;  3PAG A;  1XGJ A;  1KVL A;  4RYE A;  2P9V B;  2C5W B;  2WKI A;  1PZP A;  4E3I A;  3NBL A;  3GRJ A;  3PTE A;  3RJU A;  2Y2G A;  4WZ5 C;  1ZG6 A;  3RXW A;  4GDB A;  2ZM0 A;  3UDI A;  5F1F A;  1FQG A;  2Y2Q A;  4KG5 A;  1NRF A;  2H5S A;  3LO7 A;  3WS4 A;  1K6R A;  4GB7 A;  4C6Y A;  4WEL A;  4GD6 A;  1HZO A;  3VP0 A;  1LL9 A;  3DWZ A;  3NDG A;  4E6X A;  3HUO A;  4JBF A;  5HAI A;  5CEC A;  4MBH A;  4ZJ3 A;  2H0Y A;  4IVI A;  2WKE A;  1CI9 A;  3VSK A;  1G6A A;  5FQI A;  4R1G A;  4FD8 A;  5FI2 A;  5M1A A;  3WS5 A;  1DJA A;  3IF6 A;  3IH9 A;  3BFE A;  3FYZ A;  5F83 A;  4DKI A;  2ZC3 B;  4OQG A;  4S2J A;  3ZVT A;  3G35 A;  2HDU A;  3UE3 A;  1MPL A;  2ZC7 A;  2UWX A;  2J9O A;  1NZU A;  2WKH A;  2WGW B;  1YQS A;  3S22 A;  3UPP A;  4WMC A;  5HAP A;  3M2K A;  4Q8I A;  3CG5 A;  1ES4 A;  4LCL A;  5D3O A;  3PBS A;  4ZBE A;  4B4X A;  3E2K A;  3FKW A;  1I2W A;  3HLB A;  3MZE A;  4Y0O A;  1ESI A;  1IKG A;  1XP4 A;  3HUN A;  3V39 A;  3ZCZ A;  1CEF A;  3OPP A;  3GVB A;  1IYQ A;  4S2M A;  2Y2L A;  4WEJ A;  4N1X A;  3A3D A;  3S1Y A;  1HTZ A;  1GHM A;  1W7F A;  1PIO A;  4L0L A;  1NY0 A;  1JWZ A;  5E43 A;  2X01 A;  4B88 A;  4KG2 A;  1PZO A;  5M18 A;  3G4P A;  2ZD8 A;  5JYO A;  3JYI A;  3UN7 A;  1K4E A;  2XLN A;  5HFO A;  3VP4 A;  2OLV A;  3LEZ A;  1H8Y A;  2OV5 A;  2QMI A;  3ZG7 B;  4DE0 A;  3IF6 B;  4E3K A;  1KE4 A;  2ZJ9 A;  1FSY A;  1NYM A;  3M6H A;  2EX6 A;  1JWP A;  2R9X A;  4N1H A;  4P85 A;  5EUA A;  4KQO A;  3UE0 A;  3UNW A;  4OVD A;  5AQA A;  1JVJ A;  5DF8 A;  1ESU A;  4WEK A;  1KGF A;  2P74 A;  1ONG A;  3OPL A;  4KG6 A;  1SKF A;  4Y7P A;  3AGF A;  4OON A;  4OQ0 A;  3VP1 A;  4FH2 A;  5GLB A;  1ES5 A;  1LLB A;  3PBT A;  3BEC A;  3V3S A;  5HAQ A;  2DNS A;  3SS4 A;  2WZZ A;  4JXW A;  3CMZ A;  1G68 A;  2Y2O A;  5TGF A;  2XD5 A;  3IXD A;  1U60 A;  1Q2P A;  1WE4 A;  5CHJ A;  1CEG A;  5A92 A;  5EOO A;  2ZLY A;  5U47 A;  1DJC A;  4GKU A;  3Q82 A;  2Y55 A;  4LEN A;  2V20 A;  4WBG A;  5FQK A;  2ZC6 B;  2FFY A;  5IHV A;  5A90 A;  5CED A;  3QNB A;  3GTC A;  3V50 A;  5J8X A;  5EOE A;  4JXV A;  1MWT A;  2EFX A;  1NJ4 A;  5EEC A;  1L0D A;  4ZJ2 A;  1GHI A;  5CHU A;  4HBU A;  4KZB A;  1ES3 A;  1YLY A;  1BLS A;  1BLP A;  3M6B A;  3WS1 A;  3OPH A;  3ZG9 B;  5I94 A;  4CPK A;  3HLD A;  1W79 A;  3G32 A;  2QPN A;  1J9M A;  5F82 A;  4KZ9 A;  4KZ6 A;  1YMS A;  4K0W A;  2R9W A;  5DF9 A;  2Y2P A;  4RX3 A;  4Y0T A;  4QY6 A;  4OOY A;  1BUE A;  4OQI A;  3O86 A;  5A91 A;  2WGI A;  1YM1 A;  1ZG4 A;  2X71 A;  1E3U A;  2IWD A;  1FCM A;  1K54 C;  2RL3 A;  3HLE A;  2EX8 A;  3MBZ A;  4E3J A;  4BD1 A;  5CER A;  4P6B A;  4WMC D;  1CK3 A;  3O87 A;  4DRT A;  4GZB A;  2J9P A;  3VP2 A;  1MY8 A;  4MLL A;  4DDY A;  5EE8 A;  3BEB A;  2DRW A;  1S0W A;  3BFC A;  5HAR A;  1IEL A;  4WM9 A;  2ZC4 B;  1M40 A;  4WZ4 A;  4XUX A;  4ID4 A;  3ZG5 A;  3LCE A;  5E2G A;  3VMA A;  3LY3 A;  4P0M A;  2H0T A;  1VQQ A;  5TFQ A;  3IXH A;  3NI9 A;  4QJG A;  4N9L A;  3BM6 A;  3N8L A;  1YLT A;  1W8Q A;  3SOI A;  3Q07 A;  4XXR A;  4DDS A;  4S2O A;  1TEM A;  2EFU A;  4OLG A;  4KZA A;  2XDM A;  3IHB A;  2X02 A;  1K4F A;  3ZG8 B;  1ERQ A;  2RCX A;  1LI9 A;  5JYP A;  3OCN A;  4OPY A;  1L2S A;  1SDN A;  1N4O A;  4OQH A;  1KDS A;  4KQR A;  1KGE A;  4S2K A;  3VSL A;  1OME A;  4YFM A;  4PM7 A;  3ZGA B;  3I7J A;  1Y54 A;  3S4X A;  3SH7 A;  1JWV A;  1XPB A;  4GD8 A;  4BJP A;  2EXA A;  3C4P A;  4NK3 A;  4EWF A;  1HVB A;  5CGS A;  3IWI A;  3BRM A;  1PWC A;  3C4O A;  4X6T A;  3WRZ A;  3QHY A;  1GA9 A;  4UHU A;  2J8Y A;  3HVF A;  3W4P A;  4X69 A;  5FAP A;  5CEB A;  4E3M A;  4R3J A;  5GLD A;  1PYY A;  3IWO A;  4PM9 A;  1JTG A;  1GA0 A;  1GHP A;  2WYX A;  2HP9 A;  1I5Q A;  2ZQ8 A;  1ONH A;  4QB8 A;  1YLP A;  4QD4 A;  1YLZ A;  2WAF A;  1RGY A;  3B3X A;  3IXB A;  4UA7 A;  1XGI A;  4LCM A;  4GOG A;  2XGN A;  4X53 A;  2ZC5 B;  3IF5 A;  4EBL A;  4KQQ A;  5CTN A;  1K54 A;  1NXY A;  2PU2 A;  1HD8 A;  3DTM A;  2Y2I A;  4ZTK A;  1H5X A;  1W5D A;  4OOL A;  3NIA A;  2Q9M A;  2OSU A;  3SS3 A;  1MKI A;  5FAQ A;  4PM8 A;  3ZDJ A;  3BLM A;  3G30 A;  4K91 A;  3UPO A;  1JTD A;  5HL1 A;  3N8R A;  3HLF A;  1XKZ A;  3N6I A;  4LV2 A;  1YT4 A;  3W4O A;  4EUZ A;  2IWC A;  3ZHH A;  4DE3 A;  1BSG A;  5L2F A;  1ERM A;  5FI7 A;  4CJN A;  4OKP A;  3VFF A;  4YIN A;  3OCL A;  3MXR A;  4E3N A;  2ZMA A;  1KGG A;  4OP8 A;  1SCW A;  1BT5 A;  1ERO A;  4KZ3 A;  3N8S A;  1KE0 A;  4N92 A;  5M19 A;  4KZ5 A;  4R0Q A;  3MZF A;  3NCK A;  1IYO A;  3HL9 A;  4R3B A;  1L0G A;  1QMF A;  3GV9 A;  3WWX A;  1RP5 A;  1E3U D;  2FFF B;  1ES2 A;  4KZ8 A;  3SH8 A;  3BFG A;  3MZD A;  4OLD A;  4EV4 A;  1YLW A;  3EQU A;  5FQM A;  3IQA A;  4KEN B;  3HLC A;  5GL9 A;  4OPR A;  4PMA A;  5E2F A;  3ISG A;  1CI8 A;  1K56 A;  2OLU A;  5EVL A;  5EVI A;  3ITA A;  3N4I A;  4BL3 A;  1K57 C;  1WYC A;  2ZQD A;  5KMW A;  3Q7V A;  2VGJ A;  3GR2 A;  4UA6 A;  5GHY A;  2A3U A;  1TVF A;  3CZD A;  1YLJ A;  1MXO A;  3IHA A;  4FSF A;  4MNR A;  3QNC A;  1AXB A;  5GHZ A;  2P9V A;  1FSW A;  1KDW A;  2XQZ A;  5FAT A;  4UA9 A;  1M6K A;  1E25 A;  4QY5 A;  2Q9N A;  1FOF A;  2JE5 A;  2Y4A A;  4KZ4 A;  5HW3 A;  3TSG A;  2EX9 A;  2ZM2 A;  5FAO A;  2IWB A;  1XX2 A;  5GLC A;  3WRT A;  4IBR A;  2XH9 A;  4JLF A;  2ZQA A;  4QU3 A;  1FR1 A;  5AQB A;  3UO9 A;  4JKT A;  1IYS A;  1O7E A;  5KZH A;  4BQM A;  3OC2 A;  4ZJ1 A;  5AQ7 A;  4PM6 A;  3UE1 A;  3WS2 A;  3C5A A;  1MWU A;  4U3T A;  3LY4 A;  2V1Z A;  3Q7Z A;  1KE3 A;  2XD1 A;  5KSC A;  2BG1 A;  3Q81 A;  1E4D A;  4E6W A;  2HDQ A;  1FCN A;  5A93 A;  2BLS A;  1K55 A;  4B4Z A;  5DF7 A;  5FSR A;  2XFT A;  4MBF A;  2HDR A;  5DTK A;  3DW0 A;  3CJM A;  3MFD A;  3P09 A;  4GN2 A;  2XK1 A;  1TDG A;  1IEM A;  5FQQ A;  1BTL A;  2XR0 A;  1DJB A;  2HP5 A;  4HES A;  1W8Y A;  1PI5 A;  4MEZ A;  4UAA A;  4D2O A;  3UPN A;  4Z9Q A;  1IYP A;  2JC7 A;  2V2F F;  1MWS A;  1Z6F A;  3GSG A;  3PBR A;  2C6W B;  2Z2M B;  3O3V A;  1L0E A;  3AGE A;  4BEN A;  4DE1 A;  4JPM A;  3M2J A;  4LV3 A;  2Y2M A;  4R4R A;  1NYY A;  4F94 A;  5F1G A;  1K57 A;  3GQZ A;  4NET A;  4HEF A;  4X56 A;  3G2Y A;  2HDS A;  1FCO A;  2Y2J A;  3ZG0 A;  5EVI C;  4ZDX A;  3AGD A;  5FQJ A;  4BD0 A;  4PPR A;  2E8I A;  3BFD A;  2WZX A;  1PWG A;  4EBN A;  2EXB A;  5FAS A;  1TDL A;  4N9K A;  5FI6 A;  1PI4 A;  4C3Q A;  4WYY A;  4A5R A;  2HP6 A;  1LL5 A;  2VGK A;  3BYD A;  3Q1F A;  2PBY A;  2WUQ A;  1MBL A;  3HBR A;  3UY6 A;  1LI0 A;  2XF3 A;  1I2S A;  4S2I A;  3E2L A;  1KVM A;  2J7V A;  3HLG A;  4O7D A;  4QHC A;  1ZC2 A;  3ZNT A;  4R4S A;  4RVA A;  4JF6 A;  1K38 A;  4S2P A;  1K56 D;  1BUL A;  1C3B A;  3MXS A;  1RGZ A;  3NY4 A;  5DTS A;  3FZC A;  4S2N A;  1XA7 A;  3PBQ A;  5EVI D;  3VOZ A;  3ZFZ A;  4ZAM A;  3ZNY A;  3FWL A;  3IWQ A;  1YMX A;  3IXG A;  4PM5 A;  5DTT A;  4OPQ A;  3N7W A;  2Y91 A;  1PWD A;  2G2U A;  4H8R A;  2Z2L B;  5AQ9 A;  3OZH A;  4BL2 A;  1N9B A;  2H10 A;  3A3F A;  5FQ9 A;  5CGW A;  4JF4 A;  1SDE A;  3A3J A;  3NC8 A;  4S2L A;  3SH9 A;  4U0T A;  5BOH A;  3W8K A;  4FH4 A;  4EBP A;  4GDN A;  4OH0 A;  3HLW A;  3MKF A;  4IED A;  3O88 A;  5FDH A; 
#chains in the Genus database with same CATH topology
 3HRE A;  1FR6 A;  5G4Z A;  5CXW A;  3IBR A;  3E4Q A;  1F98 A;  4DXC A;  2BTF P;  3A3E A;  1H3Q A;  2Y59 A;  1RCJ A;  3FV7 A;  4JF5 A;  2PU4 A;  2JCH A;  3PBO A;  3SS5 A;  1O07 A;  1VM1 A;  4Y0U A;  1S6R A;  3VOY A;  3KSI A;  2ZM8 A;  1EWZ A;  1BYW A;  5TBM A;  4RX2 A;  4C75 A;  1Q2Q A;  2PT7 A;  1VHM A;  2QZ6 A;  1WYB A;  2XEP A;  3V3R A;  4I3I A;  4RA7 A;  3CIT A;  1DY6 A;  4L9F A;  3UME A;  1SHV A;  3ZVW A;  5KSH A;  4H6J A;  4DE2 A;  4LRZ E;  2B02 A;  1H8Z A;  4JXS A;  3TOI A;  5EVI B;  1ZKJ A;  1GCE A;  3OPR A;  3G2Z A;  1NZO A;  4I39 A;  2P9V B;  2C5W B;  1ZG6 A;  3UDI A;  3SW1 A;  1NRF A;  1K6R A;  1ZHH B;  2W1T B;  3HUO A;  5CEC A;  4ZJ3 A;  4X1M A;  5FQI A;  4R1G A;  4FD8 A;  4NXG A;  3U2A A;  5F83 A;  4R3A A;  3ZVT A;  5HL6 A;  3G35 A;  3UE3 A;  1MPL A;  2J3W A;  3S22 A;  3QP8 A;  4XT2 A;  3E4O A;  2MJ6 A;  4ZBE A;  3HUN A;  1CEF A;  4N1X A;  1J3W A;  1GHM A;  3EWK A;  5HD5 A;  5M18 A;  3G4P A;  2ZD8 A;  2XLN A;  4LRX C;  2OLV A;  1KE4 A;  2ZL1 B;  2ZJ9 A;  1NYM A;  3A0R A;  1STZ A;  4HJ4 A;  5EUA A;  4GHI A;  4KQO A;  3UNW A;  4NXE A;  5DF8 A;  1KOU A;  3KSG A;  1MC0 A;  3BQA A;  3KYE A;  4OON A;  1IFQ A;  4JXW A;  1G68 A;  1HLU P;  2Y2O A;  4ZRR A;  1U60 A;  1Q2P A;  3E98 A;  5CHJ A;  5EOO A;  2ZMV A;  1XJ6 A;  3MQO A;  4HNB A;  1TS6 A;  2ZC6 B;  5IHV A;  3GTC A;  3LIB A;  1MWT A;  1NRJ A;  4KZB A;  1ES3 A;  4BWI A;  1BLS A;  1D1J A;  2QPN A;  5F82 A;  4YOF A;  2R9W A;  4JGR A;  4Q0J A;  2GJ3 A;  2P04 A;  4OOY A;  3FPV A;  5A91 A;  2WGI A;  3LFV A;  1LL8 A;  4GLQ A;  2EX8 A;  2J9P A;  4ETX A;  4DDY A;  2DRW A;  1S0W A;  1IEL A;  2W27 A;  3W2Z A;  5E2G A;  3VMA A;  5TFQ A;  3IXH A;  3NI9 A;  4N9L A;  3N8L A;  1YLT A;  3SOI A;  4DDS A;  4S2O A;  1TEM A;  2EFU A;  4OLG A;  5FDS A;  2XDM A;  1ERQ A;  4OPY A;  1KDS A;  3VSL A;  4S2K A;  4YFM A;  3T1X A;  3JVU A;  3BY9 A;  4Y17 A;  1JWV A;  4GD8 A;  4BJP A;  2OOL A;  5IU1 A;  1LSV A;  4EWF A;  3BRM A;  1PWC A;  3C4O A;  4GW9 A;  1F5M A;  3G6O A;  2PBD P;  1GHP A;  2ZQ8 A;  1I5Q A;  3NOP C;  1ONH A;  2I9V A;  5F68 A;  2INW A;  2YKF A;  2LB5 A;  3B3X A;  4LCM A;  2W3F A;  2HZ5 A;  3IF5 A;  3QP5 A;  4EBL A;  4Q0I A;  1NXY A;  3KX0 X;  3R7W A;  3VE4 A;  2Y2I A;  4OOL A;  3NIA A;  3NEC A;  1AWI A;  1JTD A;  5HWT A;  2O9C A;  3HLF A;  4LV2 A;  3W4O A;  2W1R A;  4OKP A;  4YIN A;  4B9O A;  1G5U A;  4OP8 A;  1XFN A;  1BT5 A;  4KZ3 A;  5AVF A;  4NXF A;  1GSV A;  1E3U D;  2FFF B;  4DN0 A;  2IA2 A;  2JKR M;  2DMW A;  1F9I A;  2QWS A;  5AVE A;  5GL9 A;  3ISG A;  4EER A;  4MN6 A;  2PDR A;  3IHA A;  2V9A A;  2GNX A;  1FSW A;  5HPF A;  4UA9 A;  4EEU A;  2PD8 A;  2Q9N A;  2JE5 A;  2Y4A A;  3H82 B;  3TSG A;  3WRT A;  2XH9 A;  3P7N A;  1FR1 A;  5AQB A;  1IYS A;  1O7E A;  5KZH A;  2KLI A;  3OC2 A;  2PR5 A;  4PM6 A;  3C5A A;  1MWU A;  4UQI S;  4MMN A;  2FH5 A;  2V0W A;  3LY4 A;  2XD1 A;  2D02 A;  1YKD A;  2BG1 A;  1Z09 A;  3Q81 A;  3LIE A;  2HDQ A;  2BLS A;  4EQ1 A;  1YSQ A;  2AVX A;  4B4Z A;  2JHE A;  2PHY A;  2HV1 A;  4EW7 A;  3CJM A;  3P09 A;  4GN2 A;  3C8C A;  1TDG A;  1IEM A;  3KO6 A;  3UPN A;  3PBR A;  3O3V A;  1L0E A;  3AGE A;  1W63 M;  2Y2M A;  4ARZ B;  3G2Y A;  3U4L P;  5DFY A;  3UB8 A;  4EBN A;  4IUH A;  5EM1 A;  4C3Q A;  3LUQ A;  4A5R A;  3RH8 B;  3DTI A;  2VGK A;  2PBY A;  3UY6 A;  2XF3 A;  1I2S A;  3E2L A;  4PHT A;  4EXO A;  4R4S A;  5HZH A;  5DJT A;  5J4E A;  1K38 A;  4S2P A;  1C3B A;  3NY4 A;  4S2N A;  5EVI D;  1DP6 A;  2L4R A;  2V8C A;  2L0W A;  3PBQ A;  4ZAM A;  4F3L A;  2YKH A;  3P01 A;  3IWQ A;  4PKY A;  4H8R A;  3OZH A;  4U0T A;  3W8K A;  1G28 A;  5FDH A;  4FCF A;  1K55 C;  4X55 A;  5FA7 A;  5KIZ A;  2KDK A;  4IJG A;  2JKG A;  2ZOI A;  2KX6 A;  3VV4 A;  2VV7 A;  1OT9 A;  2R78 A;  4I5S A;  2JN7 A;  3IT9 A;  3C30 A;  4UQI M;  2DCF A;  1EI5 A;  4CLC B;  2JBF A;  4DJ2 A;  4EUV A;  2WGV A;  3CAX A;  1MWR A;  4FUW A;  5GLA A;  2I72 A;  4OP5 A;  4I38 A;  3UMD A;  3DWK A;  4CLC E;  3D4F A;  1BZA A;  3F1P B;  3IF6 C;  3RXX A;  2A24 B;  5DVA A;  4O8G A;  3E0Y A;  5CRF A;  4U0X A;  3C7U A;  3K2N A;  2KOI A;  1QME A;  2ZQ9 A;  3FKV A;  5HDD A;  3UDX A;  3GMW A;  2G2W A;  4JXG A;  2A49 A;  2EX2 A;  2W3E A;  3HUM A;  3RFB A;  3PBN A;  3Q7V B;  2WAE A;  1K25 A;  3DBA A;  5DFX A;  2WGW A;  3GEC A;  4DJ3 A;  2WKI A;  4HI4 A;  1PZP A;  3UB6 A;  1N9O A;  3RJU A;  5TBM B;  2E8J A;  3B42 A;  2Y2Q A;  4KG5 A;  2H5S A;  3LO7 A;  3O5Y A;  4GB7 A;  4JGQ A;  4WEL A;  3K3D A;  5EVE A;  1LL9 A;  3DWZ A;  1PFL A;  1CI9 A;  4EEP A;  4H6J B;  5FI2 A;  5M1A A;  1OTB A;  3WS5 A;  3C2W A;  3IF6 A;  3IH9 A;  3BFE A;  3FYZ A;  2ZC3 B;  1OTE A;  2HDU A;  2UWX A;  1YQS A;  3CG5 A;  2V8F A;  1I2W A;  3HLB A;  1IKG A;  2Z6C A;  3GVB A;  1PIO A;  5FL3 A;  4L0L A;  5J7E A;  4B88 A;  2X01 A;  4B93 A;  5JYO A;  2M1C A;  1K4E A;  3VP4 A;  5DKK A;  3LEZ A;  2QMI A;  4DE0 A;  5HSQ A;  4E3K A;  2EX6 A;  3LGO A;  3UE0 A;  4OVD A;  1IOU A;  4QPR A;  1ESU A;  4WEK A;  2P74 A;  4XT2 B;  1ONG A;  1S1Z A;  1SKF A;  4GS9 B;  3T4O A;  4O0P A;  3VP1 A;  4O01 A;  5GLB A;  3PBT A;  3BEC A;  2PAV P;  5HAQ A;  2DNS A;  3LID A;  2WZZ A;  3CMZ A;  4PKY G;  2OAP 1;  4EET B;  2B95 A;  1CEG A;  1TS8 A;  4G3W A;  4QWO A;  5U47 A;  1DJC A;  2V20 A;  2VZW A;  4WBG A;  2FFY A;  5CED A;  1UWN X;  4NXB A;  4JXV A;  2EFX A;  1NJ4 A;  5CHU A;  1YLY A;  1BLP A;  4GHI B;  3D9Y A;  3ZG9 B;  4CPK A;  3EOI A;  1W79 A;  3G32 A;  1J9M A;  4Y0T A;  4G3K A;  4KUO A;  3O86 A;  1ZG4 A;  1E3U A;  2EA9 A;  2RL3 A;  2UV0 E;  4BD1 A;  4P6B A;  4WMC D;  1CK3 A;  3OLO A;  1SKO B;  4DRT A;  4GZB A;  1MY8 A;  2BAS A;  5EE8 A;  5HAR A;  3LY3 A;  1JNU A;  1OTI A;  1W8Q A;  4XXR A;  4HH2 A;  4L9E A;  4NKP A;  5EV0 A;  3IHB A;  2RCX A;  5HDS A;  2P7J A;  4OQH A;  1KGE A;  3KYZ A;  1OME A;  1T18 A;  4NG2 A;  1XPB A;  1Y4O A;  3C4P A;  4NK3 A;  3IWI A;  4HY8 A;  3HVF A;  4X69 A;  4R6L A;  4E3M A;  2VV8 A;  1PYY A;  3IWO A;  1JTG A;  1GA0 A;  3NUL A;  4QB8 A;  2WAF A;  4UA7 A;  3ZQ5 A;  2XGN A;  4X53 A;  2ZC5 B;  5CTN A;  5L07 A;  2OWJ A;  1OTA A;  1MKM A;  4ZTK A;  1H5X A;  3OOV A;  3VOL A;  2Q9M A;  3SS3 A;  5FAQ A;  3BLM A;  3G30 A;  2W3H A;  4K91 A;  3UPO A;  4DMZ A;  5HL1 A;  1XKZ A;  4MN7 A;  1YT4 A;  3IX3 A;  2NUT C;  5L2F A;  2JKF A;  1OTD A;  5EFW A;  4P6Z S;  2ZMA A;  1SCW A;  4HQA A;  2NUP C;  1ERO A;  1KE0 A;  3F1O B;  4N92 A;  4R0Q A;  1P9R A;  4D60 A;  3HL9 A;  1QMF A;  3WWX A;  1GSX A;  4WLA A;  5FQM A;  4KEN B;  3BW6 A;  1WA9 A;  3MQQ A;  3MSH A;  2OLU A;  3NHQ A;  4LGW A;  5EVI A;  5EVL A;  1P9W A;  4BL3 A;  2PRF A;  1WYC A;  2A2L A;  1NLZ A;  2J3T D;  2EWW A;  3PR6 A;  3CZD A;  1YLJ A;  1MXO A;  4HJ3 A;  3QNC A;  4LPZ A;  5GHZ A;  2P9V A;  5FAT A;  5GLC A;  4IBR A;  1F2K A;  3UO9 A;  2W1T A;  4BBT A;  1CQA A;  4BQM A;  3WS2 A;  5EM0 A;  3F1N A;  5TJJ A;  1E4D A;  4E6W A;  3CLO A;  5DF7 A;  2XFT A;  4MBF A;  3DW0 A;  4E04 A;  2XK1 A;  4WN5 A;  5FQQ A;  2XR0 A;  1DJB A;  2HP5 A;  1PI5 A;  4CLC D;  4D2O A;  4Z9Q A;  2JC7 A;  4FTX A;  4DE1 A;  4I3J A;  2PYR A;  4R4R A;  3FPW A;  4II7 A;  3MJQ A;  4X56 A;  1FCO A;  2Y2J A;  4WUJ A;  4Y5F A;  3AGD A;  4P6Z M;  5FQJ A;  4M4X A;  2VX8 A;  2E8I A;  2WZX A;  1PWG A;  5FAS A;  4YNR A;  4N9K A;  1LL5 A;  2ZL1 A;  5I5L A;  1S4S A;  1MBL A;  1YSP A;  4S2I A;  2L1M A;  3EGD C;  1KVM A;  3HLG A;  4O7D A;  3ZNT A;  3HJI A;  4RVA A;  4LFU A;  1K56 D;  2V1B A;  5DTS A;  3FZC A;  1YMX A;  4PM5 A;  5DTT A;  1MZU A;  5AQ9 A;  5A8B A;  3NJA A;  5CGW A;  5BOH A;  4FH4 A;  1VEU B;  3LYX A;  4GDN A;  3HLW A;  3MKF A;  2VEA A;  1T1C A;  2VJW A;  3NDE A;  1L0F A;  3UDF A;  5TR7 A;  1PW8 A;  4WZ5 A;  4G3V A;  4WF0 A;  3ITB A;  3JPU A;  4E3O A;  4OOM A;  2WAD A;  4MBK A;  3G34 A;  3VFH A;  4UEY A;  3LIF A;  3PAE A;  2O9A A;  2K2N A;  4Q0H A;  4R23 A;  2K7S A;  3BLS A;  4F3L B;  4Y15 A;  1IKI A;  3S7N A;  1PW1 A;  4LV1 A;  1BLC A;  1TS7 A;  3G31 A;  3QP6 A;  2XRN A;  5MC7 A;  5L09 A;  2VLG A;  2ZQ7 A;  3VP3 A;  2HPB A;  4MCW A;  3QP4 A;  2WK0 A;  3C7V A;  3IH8 A;  1XXM A;  3S7Q A;  3V5M A;  4XUZ A;  4S2N C;  4HBT A;  3EQV A;  4IVK A;  4JGO A;  5EPH A;  4HH3 A;  3DAV A;  5K5B A;  5HX9 A;  3T50 A;  1X0O A;  5E2E A;  2B5R A;  4KZ7 A;  1BLH A;  5E2H A;  1KVL A;  1VET A;  4E3I A;  3NBL A;  3MS6 A;  3NOT C;  3R4K A;  2Y2G A;  3RXW A;  2ZM0 A;  3T4K A;  1FQG A;  3WS4 A;  3MXQ A;  1NLY A;  4C6Y A;  4Z1W A;  3NDG A;  4E6X A;  2H0Y A;  2WKE A;  1G6A A;  1DJA A;  1GSW A;  3EGX C;  4DKI A;  3IS2 B;  4OQG A;  4S2J A;  3HCY A;  3H7W B;  2WGW B;  4WMC A;  4Q8I A;  4LCL A;  3PBS A;  4B4X A;  3E2K A;  3FKW A;  1XP4 A;  3V39 A;  4L9G A;  3ZCZ A;  5HPI A;  1IYQ A;  1SZV A;  3S1Y A;  1HTZ A;  2Y8H A;  1W7F A;  1CF0 A;  1NY0 A;  3T12 B;  1XJ3 A;  5E43 A;  4KG2 A;  1PZO A;  3JYI A;  3UN7 A;  2WKP A;  5HFO A;  1H8Y A;  3ZG7 B;  3IF6 B;  4HOI A;  1OT6 A;  1FSY A;  1JWP A;  2WKQ A;  3B47 A;  4P85 A;  1L3L A;  1JVJ A;  4Y7P A;  1NWZ A;  1ES5 A;  1LLB A;  3SS4 A;  3IXD A;  1TS0 A;  5A92 A;  4RQ9 A;  4HJ6 A;  5CX7 A;  3Q82 A;  2Y55 A;  4LEN A;  1A0K A;  5J8X A;  1D7E A;  1D06 A;  1L0D A;  1GHI A;  4HBU A;  2GZA A;  3M6B A;  3OPH A;  5I94 A;  4ESP A;  4KZ6 A;  1YMS A;  4K0W A;  5DF9 A;  4QY6 A;  1FIL A;  2W0N A;  3L9K A;  2GX5 A;  1BUE A;  4OQI A;  1UWP X;  3T4T A;  2X71 A;  3LR4 A;  1FCM A;  3HLE A;  5CER A;  3VP2 A;  3BEB A;  3BFC A;  2Q0O A;  4XUX A;  1M40 A;  4WZ4 A;  5F6A A;  2JKR I;  2H0T A;  1YPR A;  4LLO B;  4QJG A;  3BM6 A;  4Y3I A;  2PR6 A;  3UB9 A;  3Q07 A;  3C38 A;  4KZA A;  2H28 A;  3ZG8 B;  2X02 A;  5JYP A;  1LI9 A;  1L2S A;  1N4O A;  4KQR A;  3ZGA B;  2M7U A;  3EEH A;  4PAU A;  3I7J A;  1Y54 A;  3SH7 A;  2VA0 A;  2EXA A;  2VK3 A;  5HWW A;  4X6T A;  3WRZ A;  4UHU A;  1GA9 A;  5CEB A;  5GLD A;  4PM9 A;  1PRQ A;  2V1A A;  4MN5 A;  4QD4 A;  3CPT A;  4GOG A;  4YWZ A;  4ETZ A;  1HD8 A;  2CMN A;  3DTM A;  4HHD A;  1W5D A;  4CLC A;  1MKI A;  3ZDJ A;  3CI6 A;  4EUZ A;  2IWC A;  1G6O A;  3ZHH A;  4DE3 A;  1BSG A;  5FI7 A;  4CJN A;  4KQD A;  1CJF A;  3N8S A;  4KZ5 A;  1H0M A;  3NCK A;  1IYO A;  3GV9 A;  1RP5 A;  1ES2 A;  3BFG A;  4OLD A;  4EV4 A;  1YLW A;  1CI8 A;  1K56 A;  3ITA A;  3N4I A;  1K57 C;  2ZQD A;  5KMW A;  3Q7V A;  2VGJ A;  2M7V A;  1TVF A;  5FEG A;  4MNR A;  5IS1 A;  1M6K A;  5HW3 A;  5FAO A;  2IWB A;  1XX2 A;  3H9W A;  4JLF A;  2ZQA A;  4QU3 A;  2XRO A;  3BQ8 A;  2Z6D A;  4ZJ1 A;  2O9B A;  4GCZ A;  4U3T A;  3CUE C;  2V1Z A;  3Q7Z A;  1KE3 A;  5KSC A;  2PD7 A;  3D3O A;  5A93 A;  1FCN A;  5FSR A;  1T1A A;  4I3A A;  3A0S A;  5DTK A;  2W3G A;  3MFD A;  4MDZ A;  4HES A;  4MEZ A;  1MWS A;  1V9Y A;  3GSG A;  3UE6 A;  2Z2M B;  4JPM A;  3M2J A;  4LV3 A;  4F94 A;  5F1G A;  1K57 A;  3GQZ A;  4NET A;  1UGU A;  2HF6 A;  5EVI C;  4PPR A;  4JGP A;  1TDL A;  3PXP A;  3F1N B;  1PI4 A;  5LBR A;  1H8M A;  2O0Y A;  2HP6 A;  3BYD A;  2Y79 A;  2WUQ A;  2J7V A;  4QHC A;  3LR0 A;  4AFI A;  3T1Q B;  3MXS A;  4GS9 A;  1XA7 A;  3JVV A;  3VOZ A;  3ZFZ A;  2QYB A;  1T19 A;  2PYP A;  3CUE A;  5HD3 A;  3N7W A;  2Y91 A;  1PWD A;  5F5Y A;  1N9B A;  2H10 A;  3T4S A;  5FQ9 A;  3V67 A;  4JF4 A;  1SDE A;  3A3J A;  3SH9 A;  4EBP A;  2VKS A;  4IED A;  4ME4 A;  4EQI A;  2Y2K A;  3T4J A;  4M3K A;  3A3I A;  2CC1 A;  2EWV A;  1P97 A;  3WS0 A;  3P98 A;  3BFF A;  3R7W B;  1ODV A;  3MKE A;  3ZYT A;  3W4Q A;  3IX4 A;  2GDN A;  5CHM A;  1OPX A;  2ZQC A;  4IBX A;  1S67 L;  1ALQ A;  1SKO A;  3UB7 A;  4GNU A;  5CTM A;  5GHX A;  4DXB A;  1K6S A;  2OWH A;  3DTE A;  1ZTU A;  4BBU A;  2XFS A;  3FC7 A;  2Y2H A;  5CGX A;  4CQH A;  3L7H A;  4X68 A;  3QP2 A;  2HJE A;  3TG9 A;  1XA1 A;  4LV0 A;  4BLM A;  4E3L A;  4DF6 A;  2B18 A;  2Y2N A;  3DTK A;  1ACF A;  4P87 A;  4K0X A;  1LHY A;  5G18 A;  4OPZ A;  3PAG A;  1XGJ A;  4RYE A;  2OAQ 1;  3GRJ A;  3PTE A;  4WZ5 C;  3TE8 A;  4GDB A;  5F1F A;  2W3D A;  5J3W A;  1YAX A;  1LSW A;  1XJ4 A;  2QHK A;  4GD6 A;  1HZO A;  3VP0 A;  3E4P A;  4JBF A;  5HAI A;  2QJ7 A;  3LR3 A;  4MBH A;  4IVI A;  1S1Y A;  3VSK A;  1W63 Q;  4BBV A;  4WL9 A;  2XSS A;  3KSF A;  3HJK A;  3IX8 A;  3PYP A;  2ZC7 A;  3A0V A;  3T4Q A;  3MFX A;  2J9O A;  1NZU A;  2WKH A;  2FZ0 A;  2XA7 S;  3UPP A;  5HAP A;  3M2K A;  1ES4 A;  5D3O A;  1VET B;  2D01 A;  3MZE A;  4Y0O A;  1ESI A;  4K08 A;  3KSH A;  3F1O A;  3OPP A;  4S2M A;  2Y2L A;  4WEJ A;  3A3D A;  2JKT M;  1JWZ A;  2P08 A;  4Y13 A;  1PNE A;  2OV5 A;  3LI9 A;  3LR5 A;  3M6H A;  5HWV A;  5L10 A;  2R9X A;  4N1H A;  4LRY C;  5AQA A;  2ZMF A;  1KGF A;  1K0K A;  1DP8 A;  3OPL A;  4KG6 A;  3AGF A;  4OQ0 A;  4HP9 A;  4FH2 A;  5DKL A;  1TD5 A;  3V3S A;  1LT0 A;  4EES A;  5TGF A;  2XD5 A;  1WE4 A;  2ZBB A;  2ZLY A;  1XJ2 A;  4GKU A;  5FQK A;  5A90 A;  2WKR A;  3QNB A;  3V50 A;  2ACG A;  1V9Z A;  5EOE A;  3OBF A;  3MMH A;  5EEC A;  4ZJ2 A;  3EEA A;  3WS1 A;  4IUK A;  3HLD A;  3QP1 A;  2VV6 A;  2G7U A;  4KZ9 A;  2Y2P A;  4HIA A;  4RX3 A;  4IHQ A;  2VGL S;  1S4R A;  4KUK A;  4NEE D;  1YM1 A;  3IBJ A;  3K3C A;  2IWD A;  1K54 C;  3TW8 A;  3MBZ A;  4E3J A;  2XA7 M;  3FG8 A;  3MF0 A;  3O87 A;  3B33 A;  4MLL A;  3NOU C;  5IT5 A;  4WM9 A;  2ZC4 B;  3ZG5 A;  4ID4 A;  3LCE A;  4X1L A;  4P0M A;  3BJN A;  1VQQ A;  1EW0 A;  5AJG A;  5FEF A;  2QJ5 A;  5F69 A;  1N9N A;  5DJU A;  1K4F A;  3OCN A;  1SDN A;  2QKP A;  4PM7 A;  3S4X A;  1HVB A;  1VEU A;  5CGS A;  3BWL A;  3QHY A;  2J8Y A;  1DP9 A;  3W4P A;  1TF1 A;  5FAP A;  3ULF A;  4R3J A;  2WYX A;  2HP9 A;  1S66 L;  1P0Z A;  1YLP A;  1YLZ A;  1OJG A;  1RGY A;  3IXB A;  1XGI A;  3TRC A;  4KQQ A;  1K54 A;  3CWF A;  2PU2 A;  3SZT A;  2K31 A;  3S7O A;  2OSU A;  1VB6 A;  4PM8 A;  1OJ5 A;  3N8R A;  4EU0 A;  3N6I A;  2O99 A;  5G4Y A;  3VE3 A;  1ERM A;  3VFF A;  4GJ4 A;  3OCL A;  3MXR A;  4E3N A;  1KGG A;  3LI8 A;  2J3T C;  3D72 A;  1T1B A;  3H82 A;  5L8M A;  5M19 A;  3MZF A;  4R3B A;  2VGL M;  1L0G A;  4KZ8 A;  4X25 A;  3SH8 A;  3MZD A;  1N9L A;  3CPT B;  3EQU A;  3KYQ A;  3S7P A;  3UB5 P;  3IQA A;  2J80 A;  3HLC A;  1DRM A;  4OPR A;  4PMA A;  5E2F A;  1XFQ A;  2V0U A;  4UA6 A;  3GR2 A;  5GHY A;  2A3U A;  4FSF A;  1AXB A;  1Y28 A;  1KDW A;  2XQZ A;  4Y2F A;  4BMW A;  1E25 A;  4QY5 A;  3RTY A;  3LIC A;  1FOF A;  5HDC A;  4KZ4 A;  2EX9 A;  2HGV A;  2ZM2 A;  2JKT I;  4ARZ A;  4JKT A;  3PHY A;  3TJZ C;  4CLC C;  5AQ7 A;  3UE1 A;  4R70 A;  5C5K A;  1LSX A;  3IS2 A;  3H7W A;  1K55 A;  3T4L A;  2HDR A;  3MQ0 A;  3CHW P;  1BTL A;  3GDI A;  2HJ9 C;  1W8Y A;  4UAA A;  1IYP A;  2V2F F;  3T1R A;  1Z6F A;  4BEN A;  2C6W B;  1NYY A;  4HEF A;  2HDS A;  3ZG0 A;  4ZDX A;  3LEQ A;  4BD0 A;  3BY8 A;  3BFD A;  2EXB A;  5FI6 A;  4WYY A;  1FIK A;  3Q1F A;  3HBR A;  1LI0 A;  1ZC2 A;  3MR0 A;  4JF6 A;  1BUL A;  1RGZ A;  2LB9 A;  3LIA A;  3T1S A;  3ZNY A;  3FWL A;  3IXG A;  4FOF A;  4OPQ A;  2G2U A;  4R38 A;  2Z2L B;  4BL2 A;  3A3F A;  2ZOH A;  4S2L A;  3NC8 A;  3ICY A;  4HP4 A;  3F1P A;  2A24 A;  4OH0 A;  3O88 A; 
#chains in the Genus database with same CATH homology
 4FCF A;  4EQI A;  1K55 C;  2Y2K A;  3NDE A;  3HRE A;  1FR6 A;  1L0F A;  4M3K A;  4X55 A;  5FA7 A;  3UDF A;  5CXW A;  5TR7 A;  1PW8 A;  4WZ5 A;  4DXC A;  3A3I A;  2CC1 A;  3ITB A;  3A3E A;  2Y59 A;  1RCJ A;  3WS0 A;  3FV7 A;  3P98 A;  4E3O A;  3IT9 A;  4OOM A;  4JF5 A;  2WAD A;  4MBK A;  3BFF A;  2PU4 A;  3G34 A;  3VFH A;  2JCH A;  3MKE A;  2DCF A;  3PBO A;  1EI5 A;  3PAE A;  3W4Q A;  2JBF A;  4R23 A;  2WGV A;  1MWR A;  3BLS A;  2GDN A;  3SS5 A;  1IKI A;  1O07 A;  5CHM A;  5GLA A;  2I72 A;  1VM1 A;  2ZQC A;  4IBX A;  4OP5 A;  1PW1 A;  4LV1 A;  4Y0U A;  1BLC A;  3DWK A;  1ALQ A;  1S6R A;  3G31 A;  3VOY A;  4GNU A;  5CTM A;  5GHX A;  2ZM8 A;  4DXB A;  1EWZ A;  1K6S A;  3D4F A;  1BZA A;  3IF6 C;  4RX2 A;  3RXX A;  5DVA A;  4C75 A;  1Q2Q A;  2ZQ7 A;  3VP3 A;  2XFS A;  2HPB A;  2QZ6 A;  2Y2H A;  5CRF A;  2WK0 A;  4U0X A;  1WYB A;  3C7U A;  2XEP A;  3C7V A;  3IH8 A;  1QME A;  2ZQ9 A;  4X68 A;  3FKV A;  5CGX A;  3V3R A;  4RA7 A;  1DY6 A;  3UDX A;  3TG9 A;  1XXM A;  1XA1 A;  2G2W A;  3GMW A;  3V5M A;  4LV0 A;  4JXG A;  1SHV A;  4S2N C;  4XUZ A;  3ZVW A;  4BLM A;  4E3L A;  5KSH A;  2A49 A;  4HBT A;  4DF6 A;  3EQV A;  4IVK A;  2EX2 A;  4DE2 A;  5EPH A;  2Y2N A;  3HUM A;  1H8Z A;  3PBN A;  4JXS A;  5EVI B;  3TOI A;  1ZKJ A;  4P87 A;  5HX9 A;  1GCE A;  4K0X A;  5E2E A;  1LHY A;  3Q7V B;  2B5R A;  2WAE A;  3OPR A;  5G18 A;  1K25 A;  1BLH A;  4KZ7 A;  5E2H A;  4OPZ A;  2WGW A;  3G2Z A;  1NZO A;  3PAG A;  1XGJ A;  1KVL A;  4RYE A;  2P9V B;  2C5W B;  2WKI A;  1PZP A;  4E3I A;  3NBL A;  3GRJ A;  3PTE A;  3RJU A;  2Y2G A;  4WZ5 C;  1ZG6 A;  3RXW A;  4GDB A;  2ZM0 A;  3UDI A;  5F1F A;  1FQG A;  2Y2Q A;  4KG5 A;  1NRF A;  2H5S A;  3LO7 A;  3WS4 A;  1K6R A;  4GB7 A;  4C6Y A;  4WEL A;  4GD6 A;  1HZO A;  3VP0 A;  1LL9 A;  3DWZ A;  3NDG A;  4E6X A;  3HUO A;  4JBF A;  5HAI A;  5CEC A;  4MBH A;  4ZJ3 A;  2H0Y A;  4IVI A;  2WKE A;  1CI9 A;  3VSK A;  1G6A A;  5FQI A;  4R1G A;  4FD8 A;  5FI2 A;  5M1A A;  3WS5 A;  1DJA A;  3IF6 A;  3IH9 A;  3BFE A;  3FYZ A;  5F83 A;  4DKI A;  2ZC3 B;  4OQG A;  4S2J A;  3ZVT A;  3G35 A;  2HDU A;  3UE3 A;  1MPL A;  2ZC7 A;  2UWX A;  2J9O A;  1NZU A;  2WKH A;  2WGW B;  1YQS A;  3S22 A;  3UPP A;  4WMC A;  5HAP A;  3M2K A;  4Q8I A;  3CG5 A;  1ES4 A;  4LCL A;  5D3O A;  3PBS A;  4ZBE A;  4B4X A;  3E2K A;  3FKW A;  1I2W A;  3HLB A;  3MZE A;  4Y0O A;  1ESI A;  1IKG A;  1XP4 A;  3HUN A;  3V39 A;  3ZCZ A;  1CEF A;  3OPP A;  3GVB A;  1IYQ A;  4S2M A;  2Y2L A;  4WEJ A;  4N1X A;  3A3D A;  3S1Y A;  1HTZ A;  1GHM A;  1W7F A;  1PIO A;  4L0L A;  1NY0 A;  1JWZ A;  5E43 A;  2X01 A;  4B88 A;  4KG2 A;  1PZO A;  5M18 A;  3G4P A;  2ZD8 A;  5JYO A;  3JYI A;  3UN7 A;  1K4E A;  2XLN A;  5HFO A;  3VP4 A;  2OLV A;  3LEZ A;  1H8Y A;  2OV5 A;  2QMI A;  3ZG7 B;  4DE0 A;  3IF6 B;  4E3K A;  1KE4 A;  2ZJ9 A;  1FSY A;  1NYM A;  3M6H A;  2EX6 A;  1JWP A;  2R9X A;  4N1H A;  4P85 A;  5EUA A;  4KQO A;  3UE0 A;  3UNW A;  4OVD A;  5AQA A;  1JVJ A;  5DF8 A;  1ESU A;  4WEK A;  1KGF A;  2P74 A;  1ONG A;  3OPL A;  4KG6 A;  1SKF A;  4Y7P A;  3AGF A;  4OON A;  4OQ0 A;  3VP1 A;  4FH2 A;  5GLB A;  1ES5 A;  1LLB A;  3PBT A;  3BEC A;  3V3S A;  5HAQ A;  2DNS A;  3SS4 A;  2WZZ A;  4JXW A;  3CMZ A;  1G68 A;  2Y2O A;  5TGF A;  2XD5 A;  3IXD A;  1U60 A;  1Q2P A;  1WE4 A;  5CHJ A;  1CEG A;  5A92 A;  5EOO A;  2ZLY A;  5U47 A;  1DJC A;  4GKU A;  3Q82 A;  2Y55 A;  4LEN A;  2V20 A;  4WBG A;  5FQK A;  2ZC6 B;  2FFY A;  5IHV A;  5A90 A;  5CED A;  3QNB A;  3GTC A;  3V50 A;  5J8X A;  5EOE A;  4JXV A;  1MWT A;  2EFX A;  1NJ4 A;  5EEC A;  1L0D A;  4ZJ2 A;  1GHI A;  5CHU A;  4HBU A;  4KZB A;  1ES3 A;  1YLY A;  1BLS A;  1BLP A;  3M6B A;  3WS1 A;  3OPH A;  3ZG9 B;  5I94 A;  4CPK A;  3HLD A;  1W79 A;  3G32 A;  2QPN A;  1J9M A;  5F82 A;  4KZ9 A;  4KZ6 A;  1YMS A;  4K0W A;  2R9W A;  5DF9 A;  2Y2P A;  4RX3 A;  4Y0T A;  4QY6 A;  4OOY A;  1BUE A;  4OQI A;  3O86 A;  5A91 A;  2WGI A;  1YM1 A;  1ZG4 A;  2X71 A;  1E3U A;  2IWD A;  1FCM A;  1K54 C;  2RL3 A;  3HLE A;  2EX8 A;  3MBZ A;  4E3J A;  4BD1 A;  5CER A;  4P6B A;  4WMC D;  1CK3 A;  3O87 A;  4DRT A;  4GZB A;  2J9P A;  3VP2 A;  1MY8 A;  4MLL A;  4DDY A;  5EE8 A;  3BEB A;  2DRW A;  1S0W A;  3BFC A;  5HAR A;  1IEL A;  4WM9 A;  2ZC4 B;  1M40 A;  4WZ4 A;  4XUX A;  4ID4 A;  3ZG5 A;  3LCE A;  5E2G A;  3VMA A;  3LY3 A;  4P0M A;  2H0T A;  1VQQ A;  5TFQ A;  3IXH A;  3NI9 A;  4QJG A;  4N9L A;  3BM6 A;  3N8L A;  1YLT A;  1W8Q A;  3SOI A;  3Q07 A;  4XXR A;  4DDS A;  4S2O A;  1TEM A;  2EFU A;  4OLG A;  4KZA A;  2XDM A;  3IHB A;  2X02 A;  1K4F A;  3ZG8 B;  1ERQ A;  2RCX A;  1LI9 A;  5JYP A;  3OCN A;  4OPY A;  1L2S A;  1SDN A;  1N4O A;  4OQH A;  1KDS A;  4KQR A;  1KGE A;  4S2K A;  3VSL A;  1OME A;  4YFM A;  4PM7 A;  3ZGA B;  3I7J A;  1Y54 A;  3S4X A;  3SH7 A;  1JWV A;  1XPB A;  4GD8 A;  4BJP A;  2EXA A;  3C4P A;  4NK3 A;  4EWF A;  1HVB A;  5CGS A;  3IWI A;  3BRM A;  1PWC A;  3C4O A;  4X6T A;  3WRZ A;  3QHY A;  1GA9 A;  4UHU A;  2J8Y A;  3HVF A;  3W4P A;  4X69 A;  5FAP A;  5CEB A;  4E3M A;  4R3J A;  5GLD A;  1PYY A;  3IWO A;  4PM9 A;  1JTG A;  1GA0 A;  1GHP A;  2WYX A;  2HP9 A;  1I5Q A;  2ZQ8 A;  1ONH A;  4QB8 A;  1YLP A;  4QD4 A;  1YLZ A;  2WAF A;  1RGY A;  3B3X A;  3IXB A;  4UA7 A;  1XGI A;  4LCM A;  4GOG A;  2XGN A;  4X53 A;  2ZC5 B;  3IF5 A;  4EBL A;  4KQQ A;  5CTN A;  1K54 A;  1NXY A;  2PU2 A;  1HD8 A;  3DTM A;  2Y2I A;  4ZTK A;  1H5X A;  1W5D A;  4OOL A;  3NIA A;  2Q9M A;  2OSU A;  3SS3 A;  1MKI A;  5FAQ A;  4PM8 A;  3ZDJ A;  3BLM A;  3G30 A;  4K91 A;  3UPO A;  1JTD A;  5HL1 A;  3N8R A;  3HLF A;  1XKZ A;  3N6I A;  4LV2 A;  1YT4 A;  3W4O A;  4EUZ A;  2IWC A;  3ZHH A;  4DE3 A;  1BSG A;  5L2F A;  1ERM A;  5FI7 A;  4CJN A;  4OKP A;  3VFF A;  4YIN A;  3OCL A;  3MXR A;  4E3N A;  2ZMA A;  1KGG A;  4OP8 A;  1SCW A;  1BT5 A;  1ERO A;  4KZ3 A;  3N8S A;  1KE0 A;  4N92 A;  5M19 A;  4KZ5 A;  4R0Q A;  3MZF A;  3NCK A;  1IYO A;  3HL9 A;  4R3B A;  1L0G A;  1QMF A;  3GV9 A;  3WWX A;  1RP5 A;  1E3U D;  2FFF B;  1ES2 A;  4KZ8 A;  3SH8 A;  3BFG A;  3MZD A;  4OLD A;  4EV4 A;  1YLW A;  3EQU A;  5FQM A;  3IQA A;  4KEN B;  3HLC A;  5GL9 A;  4OPR A;  4PMA A;  5E2F A;  3ISG A;  1CI8 A;  1K56 A;  2OLU A;  5EVL A;  5EVI A;  3ITA A;  3N4I A;  4BL3 A;  1K57 C;  1WYC A;  2ZQD A;  5KMW A;  3Q7V A;  2VGJ A;  3GR2 A;  4UA6 A;  5GHY A;  2A3U A;  1TVF A;  3CZD A;  1YLJ A;  1MXO A;  3IHA A;  4FSF A;  4MNR A;  3QNC A;  1AXB A;  5GHZ A;  2P9V A;  1FSW A;  1KDW A;  2XQZ A;  5FAT A;  4UA9 A;  1M6K A;  1E25 A;  4QY5 A;  2Q9N A;  1FOF A;  2JE5 A;  2Y4A A;  4KZ4 A;  5HW3 A;  3TSG A;  2EX9 A;  2ZM2 A;  5FAO A;  2IWB A;  1XX2 A;  5GLC A;  3WRT A;  4IBR A;  2XH9 A;  4JLF A;  2ZQA A;  4QU3 A;  1FR1 A;  5AQB A;  3UO9 A;  4JKT A;  1IYS A;  1O7E A;  5KZH A;  4BQM A;  3OC2 A;  4ZJ1 A;  5AQ7 A;  4PM6 A;  3UE1 A;  3WS2 A;  3C5A A;  1MWU A;  4U3T A;  3LY4 A;  2V1Z A;  3Q7Z A;  1KE3 A;  2XD1 A;  5KSC A;  2BG1 A;  3Q81 A;  1E4D A;  4E6W A;  2HDQ A;  1FCN A;  5A93 A;  2BLS A;  1K55 A;  4B4Z A;  5DF7 A;  5FSR A;  2XFT A;  4MBF A;  2HDR A;  5DTK A;  3DW0 A;  3CJM A;  3MFD A;  3P09 A;  4GN2 A;  2XK1 A;  1TDG A;  1IEM A;  5FQQ A;  1BTL A;  2XR0 A;  1DJB A;  2HP5 A;  4HES A;  1W8Y A;  1PI5 A;  4MEZ A;  4UAA A;  4D2O A;  3UPN A;  4Z9Q A;  1IYP A;  2JC7 A;  2V2F F;  1MWS A;  1Z6F A;  3GSG A;  3PBR A;  2C6W B;  2Z2M B;  3O3V A;  1L0E A;  3AGE A;  4BEN A;  4DE1 A;  4JPM A;  3M2J A;  4LV3 A;  2Y2M A;  4R4R A;  1NYY A;  4F94 A;  5F1G A;  1K57 A;  3GQZ A;  4NET A;  4HEF A;  4X56 A;  3G2Y A;  2HDS A;  1FCO A;  2Y2J A;  3ZG0 A;  5EVI C;  4ZDX A;  3AGD A;  5FQJ A;  4BD0 A;  4PPR A;  2E8I A;  3BFD A;  2WZX A;  1PWG A;  4EBN A;  2EXB A;  5FAS A;  1TDL A;  4N9K A;  5FI6 A;  1PI4 A;  4C3Q A;  4WYY A;  4A5R A;  2HP6 A;  1LL5 A;  2VGK A;  3BYD A;  3Q1F A;  2PBY A;  2WUQ A;  1MBL A;  3HBR A;  3UY6 A;  1LI0 A;  2XF3 A;  1I2S A;  4S2I A;  3E2L A;  1KVM A;  2J7V A;  3HLG A;  4O7D A;  4QHC A;  1ZC2 A;  3ZNT A;  4R4S A;  4RVA A;  4JF6 A;  1K38 A;  4S2P A;  1K56 D;  1BUL A;  1C3B A;  3MXS A;  1RGZ A;  3NY4 A;  5DTS A;  3FZC A;  4S2N A;  1XA7 A;  3PBQ A;  5EVI D;  3VOZ A;  3ZFZ A;  4ZAM A;  3ZNY A;  3FWL A;  3IWQ A;  1YMX A;  3IXG A;  4PM5 A;  5DTT A;  4OPQ A;  3N7W A;  2Y91 A;  1PWD A;  2G2U A;  4H8R A;  2Z2L B;  5AQ9 A;  3OZH A;  4BL2 A;  1N9B A;  2H10 A;  3A3F A;  5FQ9 A;  5CGW A;  4JF4 A;  1SDE A;  3A3J A;  3NC8 A;  4S2L A;  3SH9 A;  4U0T A;  5BOH A;  3W8K A;  4FH4 A;  4EBP A;  4GDN A;  4OH0 A;  3HLW A;  3MKF A;  4IED A;  3O88 A;  5FDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...