5KZHA

High resolution structure of acinetobacter baumannii beta-lactamase oxa-51
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
240
structure length
239
Chain Sequence
b'DEKAEKIKNLFNEVHTTGVLVIQQGQTQQSYGNDLARASTEYVPASTFMLNALIGLEHHKATTTEVFKWDGQKRLFPEWEKDMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSPKVQDEVQSMLFIEEKNGNKIYAKSGWGWDVDPQVGWLTGWVVQPQGNIVAFSLNLEMKKGIPSSVRKEITYKSLEQLGIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title The structure of a doripenem-bound OXA-51 class D beta-lactamase variant with enhanced carbapenemase activity.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 79
structure length 239
sequence length 240
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5kzhA00
4YINA 4KG6A 2JCHA 5DTKA 4OQIA 3IF5A 1NRFA 5FAQA 3RXWA 1LL9A 5EPHA 3SS3A 2V20A 1SHVA 1Y54A 2ZD8A 2HDRA 1N9BA 2Y2GA 4ID4A 5DVAA 1MBLA 4BLMA 3WS1A 2Y4AA 1SCWA 1K6RA 4IBXA 3WWXA 4JLFA 5EE8A 5GLCA 1IYSA 3VSKA 2QZ6A 5CEDA 1H8ZA 3RJUA 4JF4A 3FYZA 4OONA 3IXDA 5G18A 5DTTA 3O88A 2OLVA 4LV3A 2ZC4B 5L2FA 4U0XA 3P98A 4DRTA 4S2KA 2Y2IA 5GL9A 5CGWA 3G31A 3V5MA 1CI8A 1YM1A 3VP1A 4MBFA 1K56D 3IF6B 1XGJA 3G30A 4L0LA 4P0MA 3IWIA 1BLSA 2G2UA 1SDNA 5EVIB 1K55C 3ZG5A 2CC1A 1YQSA 5M18A 4KZ8A 3GTCA 2VGKA 3IXGA 2EXAA 2WGVA 1E4DA 3HLEA 1LI9A 2WGWA 5IHVA 3UDIA 4MNRA 1OMEA 4X68A 3V39A 3S4XA 4GD6A 1O7EA 4QHCA 3UN7A 2EX2A 2H0TA 2B5RA 5TGFA 4LCLA 5HAQA 4U3TA 4ZJ1A 4H8RA 1VQQA 1DJAA 3PBOA 3HLFA 1PWCA 5FSRA 3VP3A 3CG5A 3GQZA 2BLSA 3N8SA 3V3RA 1E3UD 1ES5A 2R9WA 2X01A 3Q07A 3ZVWA 2JBFA 3MXSA 4S2MA 1MY8A 5F82A 1BULA 4DKIA 2ZQ9A 3LY4A 3MKEA 3E2LA 3NC8A 3Q82A 3ITAA 1L0DA 2J7VA 4E3KA 1BLCA 3G2YA 3VP0A 2Y2NA 4Y0TA 4R3BA 4DE0A 3FKWA 2WKIA 1LHYA 3VFFA 4RX2A 5HL1A 5GHYA 3WS4A 4DF6A 1NYMA 2ZQAA 5F83A 1Q2PA 4N1HA 1CEFA 1KVMA 1MWUA 3TOIA 1GHMA 1G68A 4R3JA 1IEMA 3EQVA 4OOMA 1IYOA 4JKTA 1FR1A 3MZDA 1HD8A 1PW8A 3UNWA 4NK3A 5JYOA 2Y2JA 4GB7A 3A3JA 3WRTA 2XR0A 1BUEA 4LCMA 5CGXA 1L0FA 3N4IA 4O7DA 3S1YA 4D2OA 1NY0A 1WE4A 2IWCA 4OQGA 5M1AA 4HEFA 1IYPA 4ZJ2A 4DDSA 1S6RA 4GN2A 1YLTA 1HZOA 4E3JA 1AXBA 3C4OA 4M3KA 5HARA 2XLNA 4S2NA 1XA7A 5FDHA 1Z6FA 3HLBA 3DW0A 3PBRA 4RA7A 3GMWA 1L0GA 5DF9A 4EUZA 5FATA 1RP5A 4FH2A 3D4FA 4UA7A 4PM9A 4KG2A 2EX6A 2WZZA 3C7UA 1NJ4A 4OOLA 4ZAMA 1YT4A 2Y2PA 4DE2A 3FWLA 3ZG7B 2R9XA 1KVLA 4WEJA 4QD4A 3N8RA 4C75A 1BSGA 1HVBA 1ZKJA 4WELA 4BL2A 4C3QA 4PPRA 4QB8A 2XD5A 3AGFA 3IF6A 4K0XA 3NDEA 3O3VA 1DJBA 1H8YA 1WYBA 5EVLA 1TEMA 4PMAA 3BFEA 3MFDA 1W8QA 4FCFA 4S2PA 1FSYA 4JXGA 4OPQA 4UHUA 5HW3A 1E25A 1K57A 1MXOA 3BYDA 3BFCA 3ZCZA 1K6SA 2Z2MB 3BLSA 4Q8IA 2VGJA 4E3IA 1J9MA 2WAEA 1BZAA 2WK0A 1M6KA 3SS5A 2XF3A 3DWKA 2WGIA 1XA1A 2ZLYA 5U47A 1SKFA 3SH7A 1XP4A 3I7JA 2XDMA 1YMSA 3MXRA 4ZDXA 4E6XA 3HLDA 2P9VB 1PWDA 4Y0OA 1MPLA 1S0WA 3ZFZA 5CHMA 3A3DA 3UO9A 4WYYA 4JF5A 5A92A 2ZC5B 5J8XA 1DJCA 3G4PA 3OPHA 4GDBA 4HBTA 4N1XA 2EFXA 1GCEA 2X02A 3ZNTA 4EBNA 5F1GA 4S2OA 3OPRA 2ZJ9A 4OP5A 1KGGA 2GDNA 5D3OA 5DF8A 1XKZA 1I5QA 5EOOA 4UAAA 1KE0A 3IXHA 4X6TA 4KQQA 3N6IA 3OPLA 3O86A 3C7VA 2ZQ8A 2BG1A 4GDNA 4YFMA 3QNBA 2Y59A 2FFYA 3UPNA 2ZQ7A 1N4OA 4XUXA 4LV2A 1ZC2A 4QJGA 3BFDA 2Y2LA 3OCLA 5E2EA 4KG5A 2QMIA 4IEDA 1M40A 5AQAA 4E3MA 3LY3A 2HDQA 5CXWA 3N7WA 1CEGA 3SS4A 4A5RA 5EVIC 4DE3A 3VOYA 3A3EA 3M2JA 3BLMA 3PBSA 4R1GA 1FOFA 1W79A 4BD0A 3Q7ZA 4OKPA 4WZ4A 4OPZA 2WZXA 2ZC3B 2Y2OA 1QMFA 3ITBA 3HREA 3ZG9B 5AQ9A 1MWTA 4BENA 4JPMA 1I2SA 2JE5A 3ZGAB 3G35A 1JVJA 5A93A 1ES3A 1EWZA 1HTZA 4QY5A 1MWRA 2Z2LB 3W4PA 4E3LA 3CZDA 5EVID 4OPRA 3ZG8B 3BEBA 4R0QA 1K4FA 4RX3A 1JWPA 3WS5A 4ZJ3A 3O87A 2XFTA 1L0EA 1CK3A 2DNSA 3TG9A 3MBZA 3IXBA 1PIOA 1ERMA 2HP9A 4EBLA 1YLWA 3QHYA 4KENB 3UE0A 4OLGA 4ZBEA 4PM8A 2UWXA 5FI6A 3CMZA 4B88A 4F94A 2C6WB 3UE3A 1JTGA 3IHBA 1GA0A 1KGFA 1NXYA 3DTMA 3GRJA 4P87A 1YMXA 2EFUA 2RCXA 2WKEA 5CERA 3HBRA 5JYPA 2E8IA 3PBNA 3BFFA 4IBRA 2A49A 4R4SA 2WYXA 5GLDA 1PW1A 2X71A 5FQJA 4BL3A 3HUOA 4JXWA 1IELA 5CGSA 1VM1A 3HVFA 4BQMA 4JXVA 1GA9A 1IYQA 3ZNYA 4JF6A 1PYYA 2P9VA 1O07A 1FCOA 1K54A 1RGYA 1NZUA 2OLUA 4KZ9A 4OPYA 4ZTKA 1FCMA 5TFQA 4X55A 3ZG0A 4OQHA 4XUZA 5CECA 2DCFA 3PBTA 1PZOA 5GHZA 4EWFA 1WYCA 3QNCA 3GR2A 4OP8A 1PI5A 4X69A 1SDEA 3BM6A 5CHJA 2HP5A 4KZ6A 1ONHA 2WUQA 2XD1A 1NZOA 2J9OA 2Y55A 3AGEA 2ZC7A 3M2KA 4OH0A 4MBHA 1ALQA 3FKVA 3ZDJA 1I2WA 3E2KA 2HDSA 4KQRA 3UE1A 4K0WA 3BFGA 3EQUA 2ZM0A 1E3UA 1ES2A 4GNUA 3C5AA 4P6BA 1W8YA 2ZQCA 3TSGA 2Y2HA 3IT9A 5DF7A 2J8YA 4Y7PA 2EX8A 1Q2QA 4B4XA 4HBUA 4GZBA 1LI0A 3HL9A 4DXBA 1KE3A 4C6YA 2HP6A 5M19A 3IH9A 1FSWA 5CHUA 1L2SA 4E3OA 3VP2A 5FASA 3P09A 4UA6A 1TDGA 4EQIA 1XXMA 1YLJA 4PM6A 3IQAA 5GLBA 1LLBA 1U60A 3HLCA 4WMCA 5E2GA 2EX9A 4FSFA 1ZG6A 1KGEA 3UDFA 2WAFA 3A3IA 2J9PA 5CRFA 2QPNA 1YLPA 3MZFA 3DWZA 3Q7VB 4LENA 3N8LA 4WM9A 5E2HA 5EOEA 3GV9A 1GHPA 3GSGA 1ESIA 4S2NC 3Q1FA 4OOYA 3S22A 2Q9NA 5DTSA 1JWZA 2EXBA 5AQBA 5TR7A 1BT5A 4KZ3A 5E43A 3W4QA 1JTDA 2OSUA 4RVAA 4WEKA 4R4RA 4N9KA 1K54C 2ZM2A 5CTNA 3Q81A 1TVFA 4KQOA 5FA7A 3VMAA 4Y0UA 2Y2KA 1QMEA 3OC2A 4IVKA 3NCKA 1RGZA 5KSHA 5KSCA 3HUMA 3OCNA 4FD8A 2FFFB 3W8KA 1CI9A 4GD8A 4RYEA 5FAPA 4X53A 1PI4A 4E3NA 4WZ5A 3IF6C 1ES4A 1KE4A 3WS2A 3ISGA 1XPBA 1GHIA 4S2JA 1YLZA 1IKIA 1K38A 1NYYA 2Q9MA 4MLLA 4R23A 4B4ZA 5HFOA 4EBPA 1W7FA 4S2LA 4OVDA 1K57C 5A91A 4JBFA 1FQGA 4DXCA 2I72A 3W4OA 1PZPA 4IVIA 1YLYA 3SH8A 5CTMA 1BLHA 2XQZA 2WKHA 2V2FF 3LO7A 5FQ9A 4QY6A 1XGIA 3HLWA 4KZ7A 3GVBA 5HX9A 4CPKA 4PM7A 3SOIA 1W5DA 3WRZA 4BJPA 3PTEA 5EUAA 3JYIA 4XXRA 4DE1A 4U0TA 2ZQDA 3G2ZA 5E2FA 5CEBA 3IWOA 3UY6A 1K4EA 4GOGA 3IH8A 3SH9A 1C3BA 2XEPA 2H10A 2ZC6B 4S2IA 2WADA 5KMWA 1EI5A 1BTLA 2H0YA 4KZAA 3MZEA 2XGNA 1FR6A 2ZMAA 3LEZA 4CJNA 3A3FA 2P74A 3G32A 3UPPA 3BECA 4LV1A 3NI9A 4MBKA 1KDSA 4LV0A 2Y2QA 4BD1A 4KZBA 2ZM8A 1K25A 4N92A 5GLAA 1ERQA 4GKUA 4QU3A 5FQMA 2IWDA 3OZHA 1ZG4A 4WMCD 2XH9A 1K56A 2WGWB 3M6BA 1MKIA 1TDLA 4K91A 5FI7A 3PAEA 3AGDA 3IWQA 5FQKA 1DY6A 3LCEA 3VP4A 3C4PA 3PAGA 4WZ5C 3G34A 2Y91A 1XX2A 2A3UA 1ONGA 3HLGA 3RXXA 2OV5A 3VFHA 4DDYA 5BOHA 5KZHA 3Q7VA 1IKGA 4KZ5A 5F1FA 3NY4A 3UDXA 4FH4A 3FV7A 4X56A 4WBGA 1MWSA 2G2WA 3ZVTA 2JC7A 3NBLA 4Z9QA 2RL3A 4P85A 3M6HA 3PBQA 2XFSA 3CJMA 2H5SA 1K55A 5EECA 1RCJA 3VOZA 1EROA 4PM5A 3WS0A 1FCNA 2HPBA 2PU2A 5A90A 4N9LA 4OQ0A 3VSLA 1BLPA 1H5XA 3IHAA 5GHXA 2PBYA 4MEZA 2V1ZA 3V3SA 4UA9A 3UPOA 1G6AA 3HUNA 4OLDA 2C5WB 1KDWA 5FAOA 2DRWA 5FQIA 1ESUA 3B3XA 3BRMA 3MKFA 3OPPA 1LL5A 3V50A 4NETA 3ZHHA 5HAPA 4HESA 5EVIA 5HAIA 4KZ4A 1JWVA 1PWGA 2XK1A 5I94A 4JXSA 2Y2MA 5FI2A 5AQ7A 4E6WA 5FQQA 4EV4A 3NIAA 3NDGA 3FZCA 2IWBA 2PU4A 2HDUA
chains in the Genus database with same CATH superfamily
4YINA 1DP6A 5DTKA 3IF5A 1NRFA 5EPHA 1SHVA 2ZD8A 2HDRA 2Y2GA 4ID4A 4BLMA 1MBLA 4GS9A 2Y4AA 1K6RA 4IBXA 3T4SA 3WWXA 4JLFA 1IYSA 1H0MA 2QZ6A 5CEDA 5DTTA 5L10A 2OLVA 3LFVA 4U0XA 1H3QA 1YM1A 1K56D 3G30A 5EVIB 1K55C 2CC1A 3CHWP 3LIAA 5FEGA 3UDIA 1OMEA 4X68A 2MJ6A 3NOUC 3UN7A 4QHCA 2EX2A 3T4QA 4HP9A 4H8RA 5DKKA 1PWCA 4CLCB 2P7JA 4G3KA 3VP3A 1ES5A 3LIFA 2M7VA 3CWFA 3MXSA 1BULA 3E2LA 3NC8A 2Z6DA 3BY9A 4RX2A 5HL1A 4DF6A 1N9OA 2VK3A 1CEFA 1G28A 3EQVA 1T1CA 4JKTA 3T4KA 2H28A 4WL9A 4GB7A 2W3GA 3A3JA 3QP1A 2XR0A 3DBAA 4E04A 5J3WA 4O7DA 4UEYA 1NY0A 2IWCA 3T4TA 4HEFA 2HJ9C 4DDSA 4GN2A 1HZOA 1MKMA 4E3JA 4X1MA 3C4OA 4M3KA 1UWNX 2DMWA 2VZWA 3PBRA 2ZOIA 4KG2A 4IHQA 1ZHHB 1YT4A 5G4YA 4WEJA 1BSGA 1ZKJA 1ACFA 4C3QA 4QB8A 2XD5A 2E8JA 4G3VA 3AGFA 2Q0OA 3ZYTA 4PMAA 3MFDA 2KLIA 4JXGA 4EW7A 5HW3A 1MXOA 1K57A 3BYDA 4HJ4A 3DWKA 4QPRA 2ZLYA 3I7JA 4CLCA 5IS1A 3MXRA 1XFQA 1OJ5A 2PR5A 1PWDA 1MPLA 4X1LA 1TD5A 2YKFA 3A3DA 3K2NA 1VB6A 2EFXA 1GCEA 5F1GA 3QP8A 4HOIA 5K5BA 1KGGA 4O01A 3C2WA 4KQQA 4I39A 3O86A 3C7VA 2OAP1 4JGOA 3UPNA 2FZ0A 5E2EA 3A0VA 3S7NA 2QMIA 2JKRM 1M40A 5AQAA 5CXWA 2HDQA 1CEGA 2FH5A 1FILA 3A3EA 1W79A 3Q7ZA 4OKPA 4OPZA 1XFNA 5IT5A 2Y2OA 3HREA 2NUPC 3ZG9B 4I3JA 3U2AA 1ODVA 3BEBA 4RX3A 2D01A 3WS5A 4I38A 1CK3A 3MBZA 5AJGA 1ERMA 2HP9A 4KENB 4LPZA 3UE0A 4ZBEA 3CMZA 2PRFA 3LR5A 3DTMA 2PT7A 1A0KA 3GRJA 2EFUA 4FOFA 4L9EA 4IBRA 4R4SA 1YPRA 4F3LB 2JKGA 1VM1A 5CGSA 1L3LA 4MN5A 3U4LP 5HDCA 4JF6A 4ZTKA 5TFQA 3KSHA 2DCFA 3HJIA 3PBTA 1OPXA 1EW0A 3GR2A 1UWPX 3CUEC 5HPIA 2HP5A 4EEUA 1NZOA 2J9OA 2Y55A 3MFXA 2ZC7A 3M2KA 5HL6A 3ZDJA 4K0WA 4Y17A 4GNUA 3C5AA 2ZQCA 4Y7PA 2EX8A 3DTEA 1LI0A 3HL9A 4YNRA 2XRNA 3CPTB 1L2SA 3F1NB 3KYZA 1TDGA 1XXMA 4PM6A 5GLBA 1LLBA 4WMCA 2EX9A 4ME4A 2V9AA 2WAFA 2J9PA 2VA0A 3Q7VB 4WM9A 1ESIA 2Q9NA 5DTSA 1JWZA 5TR7A 1F9IA 4KZ3A 2OSUA 4WEKA 4N9KA 4R3AA 1K54C 5CTNA 3T12B 1RGZA 1Z09A 5KSCA 4E3NA 1KE4A 3WS2A 2QJ5A 4S2JA 1YLZA 3MQQA 3PR6A 1G6OA 2HZ5A 3LR0A 3C8CA 4S2LA 4JBFA 4F3LA 4DXCA 1YLYA 3SH8A 1BLHA 2QKPA 4QY6A 1F98A 4KZ7A 2JKRI 3QP5A 4PM7A 1W5DA 3WRZA 5EUAA 1DP8A 3DAVA 5HSQA 5CEBA 3UY6A 1OT9A 3IH8A 2XEPA 1EI5A 4KZAA 3MZEA 1FR6A 4CJNA 1DP9A 3A3FA 3G32A 3BECA 4LV0A 1K25A 2L0WA 1ERQA 4GKUA 3OZHA 1K56A 3M6BA 4NEED 5MC7A 3CPTA 3F1NA 3IWQA 3LCEA 3PAGA 4WZ5C 1XX2A 5DJUA 3Q7VA 3P7NA 1CJFA 3UDXA 4X56A 3FV7A 5EV0A 2WKPA 3ZVTA 2LB9A 3BJNA 3CJMA 2EWWA 3K3DA 1FCNA 2HPBA 1BLPA 2W1TB 3V3SA 4UA9A 2C5WB 1KDWA 5FQIA 2AVXA 1NLYA 1LL5A 3H9WA 3R7WB 1PWGA 5I94A 3MSHA 1NWZA 5FQQA 3A0RA 2M7UA 1D06A 3RTYA 4OQIA 5FAQA 3E0YA 1Y54A 1LSWA 4MCWA 5DVAA 3WS1A 1SCWA 2EA9A 5EE8A 3VSKA 1H8ZA 4I3IA 4JF4A 3IXDA 3O88A 4EESA 2ZC4B 5L2FA 4DRTA 5CGWA 3T4LA 4EEPA 1CI8A 3JVUA 1J3WA 4L0LA 3IWIA 1BLSA 2G2UA 3ZG5A 4KZ8A 3GTCA 4HH2A 2VGKA 2EXAA 1T1AA 4YOFA 3S4XA 3B42A 1O7EA 2B5RA 1TS0A 4KQDA 3BQAA 5HDDA 1VQQA 1DJAA 3IBJA 1NRJA 5DFYA 3GQZA 4WF0A 3V3RA 4WUJA 3ZVWA 1MY8A 5F82A 2ZQ9A 3MKEA 4E3KA 3VP0A 4Y0TA 4R3BA 3VFFA 2W1TA 1NYMA 1W63Q 2W1RA 1MWUA 3TOIA 1GHMA 3H7WB 4L9FA 1FR1A 3MZDA 1PW8A 4NK3A 3R7WA 3WRTA 1VHMA 4D2OA 1WE4A 5M1AA 5FEFA 1S6RA 1YLTA 3FPVA 2PYRA 1YSPA 1XJ4A 1PNEA 5HARA 2XLNA 4S2NA 1HLUP 4RA7A 4EUZA 2EX6A 2WZZA 3C7UA 2P04A 4ZAMA 3TE8A 2Y79A 2R9XA 1KVLA 1HVBA 4PPRA 3RH8B 3SW1A 3O3VA 1DJBA 5EVLA 4K08A 3BFEA 2ZOHA 3BY8A 1S67L 4UHUA 1E25A 4I3AA 2XF3A 2WGIA 1XA1A 2YKHA 1SKFA 2XDMA 1OTIA 1GSWA 4E6XA 2P9VB 3UB7A 1N9NA 3LR3A 4Y0OA 4LGWA 3GDIA 1S0WA 5CHMA 4EUVA 3UO9A 4WYYA 5A92A 3C38A 2X02A 3OPRA 3F1OB 3UB5P 5D3OA 4B9OA 4UAAA 3EEHA 3H7WA 4EERA 4YFMA 4LV2A 4GJ4A 3EWKA 3N7WA 5EVIC 4DE3A 3G6OA 1S66L 3VOYA 3BLMA 3PBSA 1FOFA 4IJGA 4WZ4A 4HQAA 4NXEA 2OAQ1 5HWWA 5J4EA 5HD3A 1QMFA 3ITBA 2Y8HA 5AQ9A 3CAXA 1I2SA 2JE5A 4GHIB 5A93A 1ES3A 1EWZA 4CLCC 4QY5A 1PRQA 2Z2LB 3W4PA 1DRMA 3CZDA 1P9RA 3K3CA 4OPRA 2W3HA 4ZJ3A 3O87A 2DNSA 3TG9A 3CI6A 1PIOA 1W63M 3VE3A 3QHYA 4JGPA 4PAUA 1XJ3A 4PM8A 2UWXA 3V67A 2C6WB 3IHBA 1GA0A 1NXYA 4EQ1A 1FIKA 3RFBA 3QP6A 2WYXA 5GLDA 5FQJA 1IELA 1IYQA 2P9VA 1RGYA 2V1BA 5JYPA 1FCMA 5CECA 4XUZA 2VV7A 3NOPC 3PHYA 1WYCA 4EWFA 4H6JB 2L1MA 4X69A 3BM6A 3MJQA 5CHJA 1UGUA 2WUQA 3AGEA 4OH0A 3F1OA 1I2WA 4KQRA 3EQUA 3IX4A 1E3UA 2Y2HA 3IT9A 2J8YA 1Q2QA 4GZBA 3NECA 4C6YA 5M19A 1MC0A 5HPFA 2PD7A 4E3OA 1U60A 1WA9A 1KGEA 2UV0E 5CRFA 3IX3A 4R70A 4LENA 5EOEA 2JN7A 5E2HA 4GHIA 3Q1FA 4OOYA 3H82B 1JTDA 2ZM2A 1QMEA 1X0OA 5EM1A 1IOUA 3MR0A 3D72A 1CI9A 3NJAA 4RYEA 5FAPA 1LL8A 5AVFA 3IF6C 1ES4A 3ISGA 1GHIA 3TJZC 1OTEA 3B47A 3MXQA 2Q9MA 1Y28A 5HFOA 4EBPA 4LRXC 4MN6A 5A91A 3PXPA 4IVIA 1G5UA 1CQAA 2A2LA 2WKHA 3LO7A 3GVBA 5HX9A 4CPKA 3SOIA 3FPWA 4XXRA 2WKRA 4H6JA 4DE1A 3G2ZA 3SH9A 2ZC6B 3OOVA 2ZMAA 3UPPA 3NI9A 3P01A 4BD1A 4NXFA 1P0ZA 2J3TC 4QU3A 5FQMA 2IWDA 2WGWB 4NXGA 1MKIA 5FI7A 3AGDA 3HLGA 2A3UA 2LB5A 2R78A 4DDYA 3KYQA 5BOHA 2QYBA 5G4ZA 5L09A 1IKGA 4KZ5A 3NY4A 3H82A 3OBFA 4WBGA 1MWSA 4HIAA 3NBLA 4Z9QA 3PBQA 3HCYA 5EECA 3VOZA 4PM5A 4HI4A 3WS0A 4OQ0A 1H5XA 2V1ZA 2O9AA 4ETZA 2VLGA 4OLDA 5FAOA 1ESUA 3OPPA 3ZHHA 3NHQA 4NETA 5HAIA 1JWVA 2Y2MA 4E6WA 3NIAA 3NDGA 2IWBA 2HDUA 4Y2FA 4KG6A 4Y3IA 1N9LA 2GZAA 4XT2B 3RXWA 2V20A 1AWIA 2W3FA 2ZMFA 3LICA 3EOIA 4RQ9A 3QP2A 5L07A 3RJUA 3FYZA 2A24B 3P98A 4S2KA 5GL9A 1OTBA 4MBFA 1BYWA 4WLAA 1XGJA 4P0MA 2G7UA 1YQSA 2WGVA 2CMNA 3HLEA 1LI9A 2WGWA 4ESPA 3V39A 2PAVP 2H0TA 4LCLA 5FDSA 4ZJ1A 3PBOA 3HLFA 3CG5A 3N8SA 1E3UD 2R9WA 3CUEA 3QP4A 2JBFA 3EEAA 4DKIA 3LY4A 3Q82A 3G2YA 2Y2NA 4GW9A 4DE0A 2WKIA 2B02A 5TBMA 3WS4A 3D9YA 1Q2PA 1G68A 1IEMA 3NULA 3MF0A 3D3OA 2O99A 4DJ2A 5JYOA 2V0UA 1BUEA 4LCMA 5CGXA 2PR6A 3N4IA 3S1YA 1XJ2A 3LUQA 4ZJ2A 3T1SA 4XT2A 4PHTA 5FDHA 1XA7A 1Z6FA 3DW0A 5DF9A 5FATA 3T1XA 4KUOA 4PM9A 1NJ4A 2KOIA 2A24A 3ZG7B 4QD4A 1PFLA 4WELA 4FTXA 4ZRRA 4K0XA 1S1ZA 2NUTC 1TF1A 1WYBA 1TEMA 3EGXC 2O9BA 4S2PA 1FSYA 4OPQA 3ZCZA 3BFCA 2Z2MB 3BLSA 1P97A 3E4QA 3IX8A 4E3IA 1J9MA 2WAEA 1M6KA 1TS7A 3SH7A 2M1CA 3ZQ5A 4ZDXA 1SZVA 3S7QA 1DJCA 5J8XA 3G4PA 3OPHA 4HBTA 4EBNA 2PD8A 2ZJ9A 2HV1A 2VEAA 1I5QA 5EOOA 2K7SA 3IXHA 4X6TA 3N6IA 3ICYA 2ZQ8A 2BG1A 4GDNA 3LR4A 3VE4A 2ZQ7A 4QJGA 3OCLA 4KG5A 4IEDA 4E3MA 3LY3A 4A5RA 5F5YA 1T18A 3M2JA 5J7EA 4BD0A 1T19A 4D60A 4LRZE 2ZBBA 3DTIA 2Z6CA 3ZGAB 3G35A 2BASA 5KIZA 4E3LA 4CQHA 3HJKA 1YKDA 5F68A 1S4RA 2VJWA 2HJEA 2XFTA 4EBLA 4OLGA 3UE3A 2V1AA 2QJ7A 3LIBA 4P87A 1YMXA 2WKEA 5HDSA 3T50A 3GECA 1PW1A 4BL3A 3HUOA 3HVFA 4JXVA 2J80A 3ZNYA 3TRCA 1O07A 1NZUA 4OPYA 4X55A 4OQHA 3W2ZA 1PZOA 4Y15A 5GHZA 3QNCA 1PI5A 1SKOB 1ONHA 1V9YA 2XD1A 3FKVA 3T1RA 3E2KA 2HDSA 3UE1A 4ARZB 3BFGA 1OTDA 1MZUA 4P6BA 1W8YA 2XA7S 4B4XA 3SZTA 2PYPA 1KE3A 2HP6A 2OWHA 3IH9A 5CHUA 4BWIA 5LBRA 3UB6A 4X25A 3P09A 4EQIA 3HLCA 2HF6A 4FSFA 1ZG6A 2XA7M 3A3IA 2QPNA 1YLPA 3LEQA 3MZFA 2QWSA 3CITA 3N8LA 1GHPA 3GSGA 1BT5A 4R4RA 5HZHA 5FA7A 3VMAA 4I5SA 3Q81A 1TVFA 4KQOA 4LFUA 2Y2KA 4IVKA 5KSHA 5F6AA 3HUMA 3OCNA 3W8KA 4GD8A 4X53A 1PI4A 3CLOA 4BBTA 3O5YA 1IKIA 1NYYA 2W3EA 4B4ZA 1K57C 2XROA 2I72A 3E4PA 3W4OA 1PZPA 2VGLS 5CTMA 1K0KA 2V2FF 2EWVA 2GJ3A 3HLWA 4R38A 1F2KA 4NG2A 1OTAA 3PTEA 3JYIA 4R6LA 4AFIA 4U0TA 4ETXA 1SKOA 5E2FA 5CX7A 1C3BA 5KMWA 2D02A 1BTLA 2H0YA 4NXBA 4ARZA 2XGNA 3LEZA 2VGLM 4LV1A 4MBKA 1KDSA 2Y2QA 2GNXA 1LSVA 4KZBA 5DFXA 4N92A 4JGQA 2W3DA 1ZG4A 2XH9A 2OOLA 1TDLA 4K91A 5HWTA 2ZMVA 3MMHA 3C4PA 1TS8A 3FC7A 3T1QB 3G34A 3L7HA 1ONGA 3RXXA 3VFHA 2OV5A 1TS6A 4DN0A 5A8BA 3KX0X 5L8MA 4PKYA 3UE6A 4FH4A 5AVEA 1T1BA 2RL3A 4Y5FA 3LIEA 4P85A 4EETB 2XFSA 1K55A 1RCJA 2GX5A 2PU2A 4N9LA 3L9KA 3F1PB 1V9ZA 1Y4OA 4MMNA 2DRWA 3UMDA 3B3XA 3BRMA 3MKFA 4II7A 4HESA 5EVIA 2XK1A 5AQ7A 3LYXA 3FZCA 3S22A 2PU4A 2JCHA 1YAXA 4LLOB 1LL9A 3MS6A 3SS3A 1N9BA 3A0SA 2JKFA 4HP4A 5GLCA 4OONA 5G18A 4HNBA 4LV3A 1P9WA 2Y2IA 3DTKA 3G31A 3V5MA 5EVEA 3VP1A 3IF6B 3S7OA 1SDNA 5M18A 3VOLA 3IXGA 1E4DA 2JKTM 2V0WA 2XSSA 5IHVA 3BW6A 4MNRA 1JNUA 4DMZA 4DJ3A 4GD6A 5TGFA 5HAQA 4U3TA 5FSRA 2INWA 5DKLA 2BLSA 1ZTUA 2O9CA 4LRYC 3FG8A 2X01A 3Q07A 4S2MA 3LI8A 3NOTC 1KOUA 3ITAA 1L0DA 2J7VA 1BLCA 1GSXA 3F1PA 3FKWA 1LHYA 5GHYA 5F83A 2ZQAA 4N1HA 1KVMA 4R3JA 1VEUB 4L9GA 4OOMA 1IYOA 1LT0A 4M4XA 4EXOA 1HD8A 3UNWA 2Y2JA 1L0FA 4OQGA 2V8CA 2V8FA 1IYPA 1AXBA 1S4SA 3HLBA 3GMWA 1L0GA 1RP5A 4FH2A 3D4FA 4UA7A 4FUWA 4OOLA 1S1YA 2Y2PA 4DE2A 2PHYA 3FWLA 1OJGA 5TBMB 2J3WA 3N8RA 4C75A 1VETB 4BL2A 5IU1A 3IF6A 3NDEA 1H8YA 1W8QA 4FCFA 3T4OA 1K6SA 4Q8IA 2VGJA 1BZAA 2WK0A 3SS5A 2VKSA 5U47A 1XP4A 4HY8A 2O0YA 1YMSA 3HLDA 3KSGA 4IUHA 1D7EA 1H8MA 3JPUA 4HJ6A 5FL3A 3BWLA 3ZFZA 5I5LA 4JF5A 2ZC5B 4GDBA 2PDRA 4N1XA 2QHKA 3ZNTA 4S2OA 4OP5A 2GDNA 5DF8A 1XKZA 1KE0A 4PKYG 4WN5A 1VEUA 3OPLA 4MDZA 3JVVA 3LI9A 4MN7A 3QNBA 2Y59A 2FFYA 1N4OA 4XUXA 1ZC2A 3BFDA 2Y2LA 4Q0HA 1STZA 3SS4A 5HD5A 4R1GA 4O0PA 3S7PA 2JKTI 2WZXA 2ZC3B 3OLOA 3VV4A 4HJ3A 3R4KA 1MWTA 4BENA 4JPMA 4O8GA 1JVJA 1F5MA 1HTZA 1MWRA 5EVID 3ZG8B 4R0QA 1K4FA 1JWPA 1VETA 2B95A 4HHDA 1L0EA 4BMWA 4Q0JA 3IXBA 1YLWA 5FI6A 4B88A 4P6ZS 4F94A 1JTGA 1KGFA 3UB8A 2WKQA 5EFWA 2RCXA 5CERA 4CLCD 3HBRA 4GLQA 2E8IA 4BBUA 3PBNA 3BFFA 2A49A 2X71A 3MQOA 4JXWA 1D1JA 4BQMA 1GA9A 1PYYA 1FCOA 1K54A 2OLUA 4KZ9A 3ZG0A 3ULFA 4P6ZM 4QWOA 4OP8A 1SDEA 1NLZA 4KZ6A 1OT6A 2I9VA 3KO6A 4MBHA 1ALQA 2HGVA 4B93A 4KUKA 3IS2B 2ZM0A 2IA2A 1ES2A 2OWJA 3TSGA 5DF7A 4NKPA 4HBUA 4DXBA 5F69A 2PBDP 3B33A 1FSWA 3TW8A 3VP2A 5FASA 4UA6A 3E98A 1YLJA 3IQAA 5E2GA 3UDFA 3DWZA 3GV9A 4S2NC 5TJJA 4G3WA 2EXBA 5AQBA 4EU0A 5E43A 3W4QA 4RVAA 4Q0IA 2VV8A 4Y0UA 3OC2A 3NCKA 5HWVA 2L4RA 4FD8A 2FFFB 5EM0A 2K31A 4JGRA 3EGDC 4UQIS 4WZ5A 2VX8A 4Y13A 1XPBA 2W0NA 5DJTA 1XJ6A 1K38A 4MLLA 3UB9A 4R23A 1W7FA 4OVDA 1FQGA 2B18A 2ZL1B 3BQ8A 2XQZA 5FQ9A 1IFQA 1XGIA 1YSQA 3T4JA 2VV6A 4GCZA 3C30A 4BJPA 3LIDA 4GS9B 4UQIM 2ZQDA 2P08A 3IWOA 1K4EA 4GOGA 3UMEA 2H10A 4YWZA 4S2IA 2WADA 2BTFP 3IS2A 2P74A 1GSVA 2ZM8A 5GLAA 2ACGA 4WMCD 3PYPA 3E4OA 3PAEA 5FQKA 1DY6A 4Z1WA 1CF0A 3VP4A 2Y91A 5KZHA 5C5KA 4BBVA 2K2NA 2J3TD 1LSXA 4IUKA 5F1FA 2G2WA 2JC7A 3IBRA 2KX6A 3M6HA 3KSIA 2H5SA 1EROA 2JHEA 5A90A 3LGOA 3KSFA 3VSLA 3IHAA 5GHXA 2PBYA 4MEZA 3UPOA 1G6AA 3HUNA 3KYEA 3V50A 3MQ0A 5HAPA 4CLCE 2W27A 4KZ4A 2KDKA 4HH3A 4JXSA 5FI2A 4EV4A 2ZL1A
chains in the Genus database with same CATH topology
4YINA 4KG6A 2JCHA 5DTKA 4OQIA 3IF5A 1NRFA 5FAQA 3RXWA 1LL9A 5EPHA 3SS3A 2V20A 1SHVA 1Y54A 2ZD8A 2HDRA 1N9BA 2Y2GA 4ID4A 5DVAA 1MBLA 4BLMA 3WS1A 2Y4AA 1SCWA 1K6RA 4IBXA 3WWXA 4JLFA 5EE8A 5GLCA 1IYSA 3VSKA 2QZ6A 5CEDA 1H8ZA 3RJUA 4JF4A 3FYZA 4OONA 3IXDA 5G18A 5DTTA 3O88A 2OLVA 4LV3A 2ZC4B 5L2FA 4U0XA 3P98A 4DRTA 4S2KA 2Y2IA 5GL9A 5CGWA 3G31A 3V5MA 1CI8A 1YM1A 3VP1A 4MBFA 1K56D 3IF6B 1XGJA 3G30A 4L0LA 4P0MA 3IWIA 1BLSA 2G2UA 1SDNA 5EVIB 1K55C 3ZG5A 2CC1A 1YQSA 5M18A 4KZ8A 3GTCA 2VGKA 3IXGA 2EXAA 2WGVA 1E4DA 3HLEA 1LI9A 2WGWA 5IHVA 3UDIA 4MNRA 1OMEA 4X68A 3V39A 3S4XA 4GD6A 1O7EA 4QHCA 3UN7A 2EX2A 2H0TA 2B5RA 5TGFA 4LCLA 5HAQA 4U3TA 4ZJ1A 4H8RA 1VQQA 1DJAA 3PBOA 3HLFA 1PWCA 5FSRA 3VP3A 3CG5A 3GQZA 2BLSA 3N8SA 3V3RA 1E3UD 1ES5A 2R9WA 2X01A 3Q07A 3ZVWA 2JBFA 3MXSA 4S2MA 1MY8A 5F82A 1BULA 4DKIA 2ZQ9A 3LY4A 3MKEA 3E2LA 3NC8A 3Q82A 3ITAA 1L0DA 2J7VA 4E3KA 1BLCA 3G2YA 3VP0A 2Y2NA 4Y0TA 4R3BA 4DE0A 3FKWA 2WKIA 1LHYA 3VFFA 4RX2A 5HL1A 5GHYA 3WS4A 4DF6A 1NYMA 2ZQAA 5F83A 1Q2PA 4N1HA 1CEFA 1KVMA 1MWUA 3TOIA 1GHMA 1G68A 4R3JA 1IEMA 3EQVA 4OOMA 1IYOA 4JKTA 1FR1A 3MZDA 1HD8A 1PW8A 3UNWA 4NK3A 5JYOA 2Y2JA 4GB7A 3A3JA 3WRTA 2XR0A 1BUEA 4LCMA 5CGXA 1L0FA 3N4IA 4O7DA 3S1YA 4D2OA 1NY0A 1WE4A 2IWCA 4OQGA 5M1AA 4HEFA 1IYPA 4ZJ2A 4DDSA 1S6RA 4GN2A 1YLTA 1HZOA 4E3JA 1AXBA 3C4OA 4M3KA 5HARA 2XLNA 4S2NA 1XA7A 5FDHA 1Z6FA 3HLBA 3DW0A 3PBRA 4RA7A 3GMWA 1L0GA 5DF9A 4EUZA 5FATA 1RP5A 4FH2A 3D4FA 4UA7A 4PM9A 4KG2A 2EX6A 2WZZA 3C7UA 1NJ4A 4OOLA 4ZAMA 1YT4A 2Y2PA 4DE2A 3FWLA 3ZG7B 2R9XA 1KVLA 4WEJA 4QD4A 3N8RA 4C75A 1BSGA 1HVBA 1ZKJA 4WELA 4BL2A 4C3QA 4PPRA 4QB8A 2XD5A 3AGFA 3IF6A 4K0XA 3NDEA 3O3VA 1DJBA 1H8YA 1WYBA 5EVLA 1TEMA 4PMAA 3BFEA 3MFDA 1W8QA 4FCFA 4S2PA 1FSYA 4JXGA 4OPQA 4UHUA 5HW3A 1E25A 1K57A 1MXOA 3BYDA 3BFCA 3ZCZA 1K6SA 2Z2MB 3BLSA 4Q8IA 2VGJA 4E3IA 1J9MA 2WAEA 1BZAA 2WK0A 1M6KA 3SS5A 2XF3A 3DWKA 2WGIA 1XA1A 2ZLYA 5U47A 1SKFA 3SH7A 1XP4A 3I7JA 2XDMA 1YMSA 3MXRA 4ZDXA 4E6XA 3HLDA 2P9VB 1PWDA 4Y0OA 1MPLA 1S0WA 3ZFZA 5CHMA 3A3DA 3UO9A 4WYYA 4JF5A 5A92A 2ZC5B 5J8XA 1DJCA 3G4PA 3OPHA 4GDBA 4HBTA 4N1XA 2EFXA 1GCEA 2X02A 3ZNTA 4EBNA 5F1GA 4S2OA 3OPRA 2ZJ9A 4OP5A 1KGGA 2GDNA 5D3OA 5DF8A 1XKZA 1I5QA 5EOOA 4UAAA 1KE0A 3IXHA 4X6TA 4KQQA 3N6IA 3OPLA 3O86A 3C7VA 2ZQ8A 2BG1A 4GDNA 4YFMA 3QNBA 2Y59A 2FFYA 3UPNA 2ZQ7A 1N4OA 4XUXA 4LV2A 1ZC2A 4QJGA 3BFDA 2Y2LA 3OCLA 5E2EA 4KG5A 2QMIA 4IEDA 1M40A 5AQAA 4E3MA 3LY3A 2HDQA 5CXWA 3N7WA 1CEGA 3SS4A 4A5RA 5EVIC 4DE3A 3VOYA 3A3EA 3M2JA 3BLMA 3PBSA 4R1GA 1FOFA 1W79A 4BD0A 3Q7ZA 4OKPA 4WZ4A 4OPZA 2WZXA 2ZC3B 2Y2OA 1QMFA 3ITBA 3HREA 3ZG9B 5AQ9A 1MWTA 4BENA 4JPMA 1I2SA 2JE5A 3ZGAB 3G35A 1JVJA 5A93A 1ES3A 1EWZA 1HTZA 4QY5A 1MWRA 2Z2LB 3W4PA 4E3LA 3CZDA 5EVID 4OPRA 3ZG8B 3BEBA 4R0QA 1K4FA 4RX3A 1JWPA 3WS5A 4ZJ3A 3O87A 2XFTA 1L0EA 1CK3A 2DNSA 3TG9A 3MBZA 3IXBA 1PIOA 1ERMA 2HP9A 4EBLA 1YLWA 3QHYA 4KENB 3UE0A 4OLGA 4ZBEA 4PM8A 2UWXA 5FI6A 3CMZA 4B88A 4F94A 2C6WB 3UE3A 1JTGA 3IHBA 1GA0A 1KGFA 1NXYA 3DTMA 3GRJA 4P87A 1YMXA 2EFUA 2RCXA 2WKEA 5CERA 3HBRA 5JYPA 2E8IA 3PBNA 3BFFA 4IBRA 2A49A 4R4SA 2WYXA 5GLDA 1PW1A 2X71A 5FQJA 4BL3A 3HUOA 4JXWA 1IELA 5CGSA 1VM1A 3HVFA 4BQMA 4JXVA 1GA9A 1IYQA 3ZNYA 4JF6A 1PYYA 2P9VA 1O07A 1FCOA 1K54A 1RGYA 1NZUA 2OLUA 4KZ9A 4OPYA 4ZTKA 1FCMA 5TFQA 4X55A 3ZG0A 4OQHA 4XUZA 5CECA 2DCFA 3PBTA 1PZOA 5GHZA 4EWFA 1WYCA 3QNCA 3GR2A 4OP8A 1PI5A 4X69A 1SDEA 3BM6A 5CHJA 2HP5A 4KZ6A 1ONHA 2WUQA 2XD1A 1NZOA 2J9OA 2Y55A 3AGEA 2ZC7A 3M2KA 4OH0A 4MBHA 1ALQA 3FKVA 3ZDJA 1I2WA 3E2KA 2HDSA 4KQRA 3UE1A 4K0WA 3BFGA 3EQUA 2ZM0A 1E3UA 1ES2A 4GNUA 3C5AA 4P6BA 1W8YA 2ZQCA 3TSGA 2Y2HA 3IT9A 5DF7A 2J8YA 4Y7PA 2EX8A 1Q2QA 4B4XA 4HBUA 4GZBA 1LI0A 3HL9A 4DXBA 1KE3A 4C6YA 2HP6A 5M19A 3IH9A 1FSWA 5CHUA 1L2SA 4E3OA 3VP2A 5FASA 3P09A 4UA6A 1TDGA 4EQIA 1XXMA 1YLJA 4PM6A 3IQAA 5GLBA 1LLBA 1U60A 3HLCA 4WMCA 5E2GA 2EX9A 4FSFA 1ZG6A 1KGEA 3UDFA 2WAFA 3A3IA 2J9PA 5CRFA 2QPNA 1YLPA 3MZFA 3DWZA 3Q7VB 4LENA 3N8LA 4WM9A 5E2HA 5EOEA 3GV9A 1GHPA 3GSGA 1ESIA 4S2NC 3Q1FA 4OOYA 3S22A 2Q9NA 5DTSA 1JWZA 2EXBA 5AQBA 5TR7A 1BT5A 4KZ3A 5E43A 3W4QA 1JTDA 2OSUA 4RVAA 4WEKA 4R4RA 4N9KA 1K54C 2ZM2A 5CTNA 3Q81A 1TVFA 4KQOA 5FA7A 3VMAA 4Y0UA 2Y2KA 1QMEA 3OC2A 4IVKA 3NCKA 1RGZA 5KSHA 5KSCA 3HUMA 3OCNA 4FD8A 2FFFB 3W8KA 1CI9A 4GD8A 4RYEA 5FAPA 4X53A 1PI4A 4E3NA 4WZ5A 3IF6C 1ES4A 1KE4A 3WS2A 3ISGA 1XPBA 1GHIA 4S2JA 1YLZA 1IKIA 1K38A 1NYYA 2Q9MA 4MLLA 4R23A 4B4ZA 5HFOA 4EBPA 1W7FA 4S2LA 4OVDA 1K57C 5A91A 4JBFA 1FQGA 4DXCA 2I72A 3W4OA 1PZPA 4IVIA 1YLYA 3SH8A 5CTMA 1BLHA 2XQZA 2WKHA 2V2FF 3LO7A 5FQ9A 4QY6A 1XGIA 3HLWA 4KZ7A 3GVBA 5HX9A 4CPKA 4PM7A 3SOIA 1W5DA 3WRZA 4BJPA 3PTEA 5EUAA 3JYIA 4XXRA 4DE1A 4U0TA 2ZQDA 3G2ZA 5E2FA 5CEBA 3IWOA 3UY6A 1K4EA 4GOGA 3IH8A 3SH9A 1C3BA 2XEPA 2H10A 2ZC6B 4S2IA 2WADA 5KMWA 1EI5A 1BTLA 2H0YA 4KZAA 3MZEA 2XGNA 1FR6A 2ZMAA 3LEZA 4CJNA 3A3FA 2P74A 3G32A 3UPPA 3BECA 4LV1A 3NI9A 4MBKA 1KDSA 4LV0A 2Y2QA 4BD1A 4KZBA 2ZM8A 1K25A 4N92A 5GLAA 1ERQA 4GKUA 4QU3A 5FQMA 2IWDA 3OZHA 1ZG4A 4WMCD 2XH9A 1K56A 2WGWB 3M6BA 1MKIA 1TDLA 4K91A 5FI7A 3PAEA 3AGDA 3IWQA 5FQKA 1DY6A 3LCEA 3VP4A 3C4PA 3PAGA 4WZ5C 3G34A 2Y91A 1XX2A 2A3UA 1ONGA 3HLGA 3RXXA 2OV5A 3VFHA 4DDYA 5BOHA 5KZHA 3Q7VA 1IKGA 4KZ5A 5F1FA 3NY4A 3UDXA 4FH4A 3FV7A 4X56A 4WBGA 1MWSA 2G2WA 3ZVTA 2JC7A 3NBLA 4Z9QA 2RL3A 4P85A 3M6HA 3PBQA 2XFSA 3CJMA 2H5SA 1K55A 5EECA 1RCJA 3VOZA 1EROA 4PM5A 3WS0A 1FCNA 2HPBA 2PU2A 5A90A 4N9LA 4OQ0A 3VSLA 1BLPA 1H5XA 3IHAA 5GHXA 2PBYA 4MEZA 2V1ZA 3V3SA 4UA9A 3UPOA 1G6AA 3HUNA 4OLDA 2C5WB 1KDWA 5FAOA 2DRWA 5FQIA 1ESUA 3B3XA 3BRMA 3MKFA 3OPPA 1LL5A 3V50A 4NETA 3ZHHA 5HAPA 4HESA 5EVIA 5HAIA 4KZ4A 1JWVA 1PWGA 2XK1A 5I94A 4JXSA 2Y2MA 5FI2A 5AQ7A 4E6WA 5FQQA 4EV4A 3NIAA 3NDGA 3FZCA 2IWBA 2PU4A 2HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIN A;  4KG6 A;  2JCH A;  5DTK A;  4OQI A;  3IF5 A;  1NRF A;  5FAQ A;  3RXW A;  1LL9 A;  5EPH A;  3SS3 A;  2V20 A;  1SHV A;  1Y54 A;  2ZD8 A;  2HDR A;  1N9B A;  2Y2G A;  4ID4 A;  5DVA A;  1MBL A;  4BLM A;  3WS1 A;  2Y4A A;  1SCW A;  1K6R A;  4IBX A;  3WWX A;  4JLF A;  5EE8 A;  5GLC A;  1IYS A;  3VSK A;  2QZ6 A;  5CED A;  1H8Z A;  3RJU A;  4JF4 A;  3FYZ A;  4OON A;  3IXD A;  5G18 A;  5DTT A;  3O88 A;  2OLV A;  4LV3 A;  2ZC4 B;  5L2F A;  4U0X A;  3P98 A;  4DRT A;  4S2K A;  2Y2I A;  5GL9 A;  5CGW A;  3G31 A;  3V5M A;  1CI8 A;  1YM1 A;  3VP1 A;  4MBF A;  1K56 D;  3IF6 B;  1XGJ A;  3G30 A;  4L0L A;  4P0M A;  3IWI A;  1BLS A;  2G2U A;  1SDN A;  5EVI B;  1K55 C;  3ZG5 A;  2CC1 A;  1YQS A;  5M18 A;  4KZ8 A;  3GTC A;  2VGK A;  3IXG A;  2EXA A;  2WGV A;  1E4D A;  3HLE A;  1LI9 A;  2WGW A;  5IHV A;  3UDI A;  4MNR A;  1OME A;  4X68 A;  3V39 A;  3S4X A;  4GD6 A;  1O7E A;  4QHC A;  3UN7 A;  2EX2 A;  2H0T A;  2B5R A;  5TGF A;  4LCL A;  5HAQ A;  4U3T A;  4ZJ1 A;  4H8R A;  1VQQ A;  1DJA A;  3PBO A;  3HLF A;  1PWC A;  5FSR A;  3VP3 A;  3CG5 A;  3GQZ A;  2BLS A;  3N8S A;  3V3R A;  1E3U D;  1ES5 A;  2R9W A;  2X01 A;  3Q07 A;  3ZVW A;  2JBF A;  3MXS A;  4S2M A;  1MY8 A;  5F82 A;  1BUL A;  4DKI A;  2ZQ9 A;  3LY4 A;  3MKE A;  3E2L A;  3NC8 A;  3Q82 A;  3ITA A;  1L0D A;  2J7V A;  4E3K A;  1BLC A;  3G2Y A;  3VP0 A;  2Y2N A;  4Y0T A;  4R3B A;  4DE0 A;  3FKW A;  2WKI A;  1LHY A;  3VFF A;  4RX2 A;  5HL1 A;  5GHY A;  3WS4 A;  4DF6 A;  1NYM A;  2ZQA A;  5F83 A;  1Q2P A;  4N1H A;  1CEF A;  1KVM A;  1MWU A;  3TOI A;  1GHM A;  1G68 A;  4R3J A;  1IEM A;  3EQV A;  4OOM A;  1IYO A;  4JKT A;  1FR1 A;  3MZD A;  1HD8 A;  1PW8 A;  3UNW A;  4NK3 A;  5JYO A;  2Y2J A;  4GB7 A;  3A3J A;  3WRT A;  2XR0 A;  1BUE A;  4LCM A;  5CGX A;  1L0F A;  3N4I A;  4O7D A;  3S1Y A;  4D2O A;  1NY0 A;  1WE4 A;  2IWC A;  4OQG A;  5M1A A;  4HEF A;  1IYP A;  4ZJ2 A;  4DDS A;  1S6R A;  4GN2 A;  1YLT A;  1HZO A;  4E3J A;  1AXB A;  3C4O A;  4M3K A;  5HAR A;  2XLN A;  4S2N A;  1XA7 A;  5FDH A;  1Z6F A;  3HLB A;  3DW0 A;  3PBR A;  4RA7 A;  3GMW A;  1L0G A;  5DF9 A;  4EUZ A;  5FAT A;  1RP5 A;  4FH2 A;  3D4F A;  4UA7 A;  4PM9 A;  4KG2 A;  2EX6 A;  2WZZ A;  3C7U A;  1NJ4 A;  4OOL A;  4ZAM A;  1YT4 A;  2Y2P A;  4DE2 A;  3FWL A;  3ZG7 B;  2R9X A;  1KVL A;  4WEJ A;  4QD4 A;  3N8R A;  4C75 A;  1BSG A;  1HVB A;  1ZKJ A;  4WEL A;  4BL2 A;  4C3Q A;  4PPR A;  4QB8 A;  2XD5 A;  3AGF A;  3IF6 A;  4K0X A;  3NDE A;  3O3V A;  1DJB A;  1H8Y A;  1WYB A;  5EVL A;  1TEM A;  4PMA A;  3BFE A;  3MFD A;  1W8Q A;  4FCF A;  4S2P A;  1FSY A;  4JXG A;  4OPQ A;  4UHU A;  5HW3 A;  1E25 A;  1K57 A;  1MXO A;  3BYD A;  3BFC A;  3ZCZ A;  1K6S A;  2Z2M B;  3BLS A;  4Q8I A;  2VGJ A;  4E3I A;  1J9M A;  2WAE A;  1BZA A;  2WK0 A;  1M6K A;  3SS5 A;  2XF3 A;  3DWK A;  2WGI A;  1XA1 A;  2ZLY A;  5U47 A;  1SKF A;  3SH7 A;  1XP4 A;  3I7J A;  2XDM A;  1YMS A;  3MXR A;  4ZDX A;  4E6X A;  3HLD A;  2P9V B;  1PWD A;  4Y0O A;  1MPL A;  1S0W A;  3ZFZ A;  5CHM A;  3A3D A;  3UO9 A;  4WYY A;  4JF5 A;  5A92 A;  2ZC5 B;  5J8X A;  1DJC A;  3G4P A;  3OPH A;  4GDB A;  4HBT A;  4N1X A;  2EFX A;  1GCE A;  2X02 A;  3ZNT A;  4EBN A;  5F1G A;  4S2O A;  3OPR A;  2ZJ9 A;  4OP5 A;  1KGG A;  2GDN A;  5D3O A;  5DF8 A;  1XKZ A;  1I5Q A;  5EOO A;  4UAA A;  1KE0 A;  3IXH A;  4X6T A;  4KQQ A;  3N6I A;  3OPL A;  3O86 A;  3C7V A;  2ZQ8 A;  2BG1 A;  4GDN A;  4YFM A;  3QNB A;  2Y59 A;  2FFY A;  3UPN A;  2ZQ7 A;  1N4O A;  4XUX A;  4LV2 A;  1ZC2 A;  4QJG A;  3BFD A;  2Y2L A;  3OCL A;  5E2E A;  4KG5 A;  2QMI A;  4IED A;  1M40 A;  5AQA A;  4E3M A;  3LY3 A;  2HDQ A;  5CXW A;  3N7W A;  1CEG A;  3SS4 A;  4A5R A;  5EVI C;  4DE3 A;  3VOY A;  3A3E A;  3M2J A;  3BLM A;  3PBS A;  4R1G A;  1FOF A;  1W79 A;  4BD0 A;  3Q7Z A;  4OKP A;  4WZ4 A;  4OPZ A;  2WZX A;  2ZC3 B;  2Y2O A;  1QMF A;  3ITB A;  3HRE A;  3ZG9 B;  5AQ9 A;  1MWT A;  4BEN A;  4JPM A;  1I2S A;  2JE5 A;  3ZGA B;  3G35 A;  1JVJ A;  5A93 A;  1ES3 A;  1EWZ A;  1HTZ A;  4QY5 A;  1MWR A;  2Z2L B;  3W4P A;  4E3L A;  3CZD A;  5EVI D;  4OPR A;  3ZG8 B;  3BEB A;  4R0Q A;  1K4F A;  4RX3 A;  1JWP A;  3WS5 A;  4ZJ3 A;  3O87 A;  2XFT A;  1L0E A;  1CK3 A;  2DNS A;  3TG9 A;  3MBZ A;  3IXB A;  1PIO A;  1ERM A;  2HP9 A;  4EBL A;  1YLW A;  3QHY A;  4KEN B;  3UE0 A;  4OLG A;  4ZBE A;  4PM8 A;  2UWX A;  5FI6 A;  3CMZ A;  4B88 A;  4F94 A;  2C6W B;  3UE3 A;  1JTG A;  3IHB A;  1GA0 A;  1KGF A;  1NXY A;  3DTM A;  3GRJ A;  4P87 A;  1YMX A;  2EFU A;  2RCX A;  2WKE A;  5CER A;  3HBR A;  5JYP A;  2E8I A;  3PBN A;  3BFF A;  4IBR A;  2A49 A;  4R4S A;  2WYX A;  5GLD A;  1PW1 A;  2X71 A;  5FQJ A;  4BL3 A;  3HUO A;  4JXW A;  1IEL A;  5CGS A;  1VM1 A;  3HVF A;  4BQM A;  4JXV A;  1GA9 A;  1IYQ A;  3ZNY A;  4JF6 A;  1PYY A;  2P9V A;  1O07 A;  1FCO A;  1K54 A;  1RGY A;  1NZU A;  2OLU A;  4KZ9 A;  4OPY A;  4ZTK A;  1FCM A;  5TFQ A;  4X55 A;  3ZG0 A;  4OQH A;  4XUZ A;  5CEC A;  2DCF A;  3PBT A;  1PZO A;  5GHZ A;  4EWF A;  1WYC A;  3QNC A;  3GR2 A;  4OP8 A;  1PI5 A;  4X69 A;  1SDE A;  3BM6 A;  5CHJ A;  2HP5 A;  4KZ6 A;  1ONH A;  2WUQ A;  2XD1 A;  1NZO A;  2J9O A;  2Y55 A;  3AGE A;  2ZC7 A;  3M2K A;  4OH0 A;  4MBH A;  1ALQ A;  3FKV A;  3ZDJ A;  1I2W A;  3E2K A;  2HDS A;  4KQR A;  3UE1 A;  4K0W A;  3BFG A;  3EQU A;  2ZM0 A;  1E3U A;  1ES2 A;  4GNU A;  3C5A A;  4P6B A;  1W8Y A;  2ZQC A;  3TSG A;  2Y2H A;  3IT9 A;  5DF7 A;  2J8Y A;  4Y7P A;  2EX8 A;  1Q2Q A;  4B4X A;  4HBU A;  4GZB A;  1LI0 A;  3HL9 A;  4DXB A;  1KE3 A;  4C6Y A;  2HP6 A;  5M19 A;  3IH9 A;  1FSW A;  5CHU A;  1L2S A;  4E3O A;  3VP2 A;  5FAS A;  3P09 A;  4UA6 A;  1TDG A;  4EQI A;  1XXM A;  1YLJ A;  4PM6 A;  3IQA A;  5GLB A;  1LLB A;  1U60 A;  3HLC A;  4WMC A;  5E2G A;  2EX9 A;  4FSF A;  1ZG6 A;  1KGE A;  3UDF A;  2WAF A;  3A3I A;  2J9P A;  5CRF A;  2QPN A;  1YLP A;  3MZF A;  3DWZ A;  3Q7V B;  4LEN A;  3N8L A;  4WM9 A;  5E2H A;  5EOE A;  3GV9 A;  1GHP A;  3GSG A;  1ESI A;  4S2N C;  3Q1F A;  4OOY A;  3S22 A;  2Q9N A;  5DTS A;  1JWZ A;  2EXB A;  5AQB A;  5TR7 A;  1BT5 A;  4KZ3 A;  5E43 A;  3W4Q A;  1JTD A;  2OSU A;  4RVA A;  4WEK A;  4R4R A;  4N9K A;  1K54 C;  2ZM2 A;  5CTN A;  3Q81 A;  1TVF A;  4KQO A;  5FA7 A;  3VMA A;  4Y0U A;  2Y2K A;  1QME A;  3OC2 A;  4IVK A;  3NCK A;  1RGZ A;  5KSH A;  5KSC A;  3HUM A;  3OCN A;  4FD8 A;  2FFF B;  3W8K A;  1CI9 A;  4GD8 A;  4RYE A;  5FAP A;  4X53 A;  1PI4 A;  4E3N A;  4WZ5 A;  3IF6 C;  1ES4 A;  1KE4 A;  3WS2 A;  3ISG A;  1XPB A;  1GHI A;  4S2J A;  1YLZ A;  1IKI A;  1K38 A;  1NYY A;  2Q9M A;  4MLL A;  4R23 A;  4B4Z A;  5HFO A;  4EBP A;  1W7F A;  4S2L A;  4OVD A;  1K57 C;  5A91 A;  4JBF A;  1FQG A;  4DXC A;  2I72 A;  3W4O A;  1PZP A;  4IVI A;  1YLY A;  3SH8 A;  5CTM A;  1BLH A;  2XQZ A;  2WKH A;  2V2F F;  3LO7 A;  5FQ9 A;  4QY6 A;  1XGI A;  3HLW A;  4KZ7 A;  3GVB A;  5HX9 A;  4CPK A;  4PM7 A;  3SOI A;  1W5D A;  3WRZ A;  4BJP A;  3PTE A;  5EUA A;  3JYI A;  4XXR A;  4DE1 A;  4U0T A;  2ZQD A;  3G2Z A;  5E2F A;  5CEB A;  3IWO A;  3UY6 A;  1K4E A;  4GOG A;  3IH8 A;  3SH9 A;  1C3B A;  2XEP A;  2H10 A;  2ZC6 B;  4S2I A;  2WAD A;  5KMW A;  1EI5 A;  1BTL A;  2H0Y A;  4KZA A;  3MZE A;  2XGN A;  1FR6 A;  2ZMA A;  3LEZ A;  4CJN A;  3A3F A;  2P74 A;  3G32 A;  3UPP A;  3BEC A;  4LV1 A;  3NI9 A;  4MBK A;  1KDS A;  4LV0 A;  2Y2Q A;  4BD1 A;  4KZB A;  2ZM8 A;  1K25 A;  4N92 A;  5GLA A;  1ERQ A;  4GKU A;  4QU3 A;  5FQM A;  2IWD A;  3OZH A;  1ZG4 A;  4WMC D;  2XH9 A;  1K56 A;  2WGW B;  3M6B A;  1MKI A;  1TDL A;  4K91 A;  5FI7 A;  3PAE A;  3AGD A;  3IWQ A;  5FQK A;  1DY6 A;  3LCE A;  3VP4 A;  3C4P A;  3PAG A;  4WZ5 C;  3G34 A;  2Y91 A;  1XX2 A;  2A3U A;  1ONG A;  3HLG A;  3RXX A;  2OV5 A;  3VFH A;  4DDY A;  5BOH A;  5KZH A;  3Q7V A;  1IKG A;  4KZ5 A;  5F1F A;  3NY4 A;  3UDX A;  4FH4 A;  3FV7 A;  4X56 A;  4WBG A;  1MWS A;  2G2W A;  3ZVT A;  2JC7 A;  3NBL A;  4Z9Q A;  2RL3 A;  4P85 A;  3M6H A;  3PBQ A;  2XFS A;  3CJM A;  2H5S A;  1K55 A;  5EEC A;  1RCJ A;  3VOZ A;  1ERO A;  4PM5 A;  3WS0 A;  1FCN A;  2HPB A;  2PU2 A;  5A90 A;  4N9L A;  4OQ0 A;  3VSL A;  1BLP A;  1H5X A;  3IHA A;  5GHX A;  2PBY A;  4MEZ A;  2V1Z A;  3V3S A;  4UA9 A;  3UPO A;  1G6A A;  3HUN A;  4OLD A;  2C5W B;  1KDW A;  5FAO A;  2DRW A;  5FQI A;  1ESU A;  3B3X A;  3BRM A;  3MKF A;  3OPP A;  1LL5 A;  3V50 A;  4NET A;  3ZHH A;  5HAP A;  4HES A;  5EVI A;  5HAI A;  4KZ4 A;  1JWV A;  1PWG A;  2XK1 A;  5I94 A;  4JXS A;  2Y2M A;  5FI2 A;  5AQ7 A;  4E6W A;  5FQQ A;  4EV4 A;  3NIA A;  3NDG A;  3FZC A;  2IWB A;  2PU4 A;  2HDU A; 
#chains in the Genus database with same CATH topology
 4YIN A;  1DP6 A;  5DTK A;  3IF5 A;  1NRF A;  5EPH A;  1SHV A;  2ZD8 A;  2HDR A;  2Y2G A;  4ID4 A;  4BLM A;  1MBL A;  4GS9 A;  2Y4A A;  1K6R A;  4IBX A;  3T4S A;  3WWX A;  4JLF A;  1IYS A;  1H0M A;  2QZ6 A;  5CED A;  5DTT A;  5L10 A;  2OLV A;  3LFV A;  4U0X A;  1H3Q A;  1YM1 A;  1K56 D;  3G30 A;  5EVI B;  1K55 C;  2CC1 A;  3CHW P;  3LIA A;  5FEG A;  3UDI A;  1OME A;  4X68 A;  2MJ6 A;  3NOU C;  3UN7 A;  4QHC A;  2EX2 A;  3T4Q A;  4HP9 A;  4H8R A;  5DKK A;  1PWC A;  4CLC B;  2P7J A;  4G3K A;  3VP3 A;  1ES5 A;  3LIF A;  2M7V A;  3CWF A;  3MXS A;  1BUL A;  3E2L A;  3NC8 A;  2Z6D A;  3BY9 A;  4RX2 A;  5HL1 A;  4DF6 A;  1N9O A;  2VK3 A;  1CEF A;  1G28 A;  3EQV A;  1T1C A;  4JKT A;  3T4K A;  2H28 A;  4WL9 A;  4GB7 A;  2W3G A;  3A3J A;  3QP1 A;  2XR0 A;  3DBA A;  4E04 A;  5J3W A;  4O7D A;  4UEY A;  1NY0 A;  2IWC A;  3T4T A;  4HEF A;  2HJ9 C;  4DDS A;  4GN2 A;  1HZO A;  1MKM A;  4E3J A;  4X1M A;  3C4O A;  4M3K A;  1UWN X;  2DMW A;  2VZW A;  3PBR A;  2ZOI A;  4KG2 A;  4IHQ A;  1ZHH B;  1YT4 A;  5G4Y A;  4WEJ A;  1BSG A;  1ZKJ A;  1ACF A;  4C3Q A;  4QB8 A;  2XD5 A;  2E8J A;  4G3V A;  3AGF A;  2Q0O A;  3ZYT A;  4PMA A;  3MFD A;  2KLI A;  4JXG A;  4EW7 A;  5HW3 A;  1MXO A;  1K57 A;  3BYD A;  4HJ4 A;  3DWK A;  4QPR A;  2ZLY A;  3I7J A;  4CLC A;  5IS1 A;  3MXR A;  1XFQ A;  1OJ5 A;  2PR5 A;  1PWD A;  1MPL A;  4X1L A;  1TD5 A;  2YKF A;  3A3D A;  3K2N A;  1VB6 A;  2EFX A;  1GCE A;  5F1G A;  3QP8 A;  4HOI A;  5K5B A;  1KGG A;  4O01 A;  3C2W A;  4KQQ A;  4I39 A;  3O86 A;  3C7V A;  2OAP 1;  4JGO A;  3UPN A;  2FZ0 A;  5E2E A;  3A0V A;  3S7N A;  2QMI A;  2JKR M;  1M40 A;  5AQA A;  5CXW A;  2HDQ A;  1CEG A;  2FH5 A;  1FIL A;  3A3E A;  1W79 A;  3Q7Z A;  4OKP A;  4OPZ A;  1XFN A;  5IT5 A;  2Y2O A;  3HRE A;  2NUP C;  3ZG9 B;  4I3J A;  3U2A A;  1ODV A;  3BEB A;  4RX3 A;  2D01 A;  3WS5 A;  4I38 A;  1CK3 A;  3MBZ A;  5AJG A;  1ERM A;  2HP9 A;  4KEN B;  4LPZ A;  3UE0 A;  4ZBE A;  3CMZ A;  2PRF A;  3LR5 A;  3DTM A;  2PT7 A;  1A0K A;  3GRJ A;  2EFU A;  4FOF A;  4L9E A;  4IBR A;  4R4S A;  1YPR A;  4F3L B;  2JKG A;  1VM1 A;  5CGS A;  1L3L A;  4MN5 A;  3U4L P;  5HDC A;  4JF6 A;  4ZTK A;  5TFQ A;  3KSH A;  2DCF A;  3HJI A;  3PBT A;  1OPX A;  1EW0 A;  3GR2 A;  1UWP X;  3CUE C;  5HPI A;  2HP5 A;  4EEU A;  1NZO A;  2J9O A;  2Y55 A;  3MFX A;  2ZC7 A;  3M2K A;  5HL6 A;  3ZDJ A;  4K0W A;  4Y17 A;  4GNU A;  3C5A A;  2ZQC A;  4Y7P A;  2EX8 A;  3DTE A;  1LI0 A;  3HL9 A;  4YNR A;  2XRN A;  3CPT B;  1L2S A;  3F1N B;  3KYZ A;  1TDG A;  1XXM A;  4PM6 A;  5GLB A;  1LLB A;  4WMC A;  2EX9 A;  4ME4 A;  2V9A A;  2WAF A;  2J9P A;  2VA0 A;  3Q7V B;  4WM9 A;  1ESI A;  2Q9N A;  5DTS A;  1JWZ A;  5TR7 A;  1F9I A;  4KZ3 A;  2OSU A;  4WEK A;  4N9K A;  4R3A A;  1K54 C;  5CTN A;  3T12 B;  1RGZ A;  1Z09 A;  5KSC A;  4E3N A;  1KE4 A;  3WS2 A;  2QJ5 A;  4S2J A;  1YLZ A;  3MQQ A;  3PR6 A;  1G6O A;  2HZ5 A;  3LR0 A;  3C8C A;  4S2L A;  4JBF A;  4F3L A;  4DXC A;  1YLY A;  3SH8 A;  1BLH A;  2QKP A;  4QY6 A;  1F98 A;  4KZ7 A;  2JKR I;  3QP5 A;  4PM7 A;  1W5D A;  3WRZ A;  5EUA A;  1DP8 A;  3DAV A;  5HSQ A;  5CEB A;  3UY6 A;  1OT9 A;  3IH8 A;  2XEP A;  1EI5 A;  4KZA A;  3MZE A;  1FR6 A;  4CJN A;  1DP9 A;  3A3F A;  3G32 A;  3BEC A;  4LV0 A;  1K25 A;  2L0W A;  1ERQ A;  4GKU A;  3OZH A;  1K56 A;  3M6B A;  4NEE D;  5MC7 A;  3CPT A;  3F1N A;  3IWQ A;  3LCE A;  3PAG A;  4WZ5 C;  1XX2 A;  5DJU A;  3Q7V A;  3P7N A;  1CJF A;  3UDX A;  4X56 A;  3FV7 A;  5EV0 A;  2WKP A;  3ZVT A;  2LB9 A;  3BJN A;  3CJM A;  2EWW A;  3K3D A;  1FCN A;  2HPB A;  1BLP A;  2W1T B;  3V3S A;  4UA9 A;  2C5W B;  1KDW A;  5FQI A;  2AVX A;  1NLY A;  1LL5 A;  3H9W A;  3R7W B;  1PWG A;  5I94 A;  3MSH A;  1NWZ A;  5FQQ A;  3A0R A;  2M7U A;  1D06 A;  3RTY A;  4OQI A;  5FAQ A;  3E0Y A;  1Y54 A;  1LSW A;  4MCW A;  5DVA A;  3WS1 A;  1SCW A;  2EA9 A;  5EE8 A;  3VSK A;  1H8Z A;  4I3I A;  4JF4 A;  3IXD A;  3O88 A;  4EES A;  2ZC4 B;  5L2F A;  4DRT A;  5CGW A;  3T4L A;  4EEP A;  1CI8 A;  3JVU A;  1J3W A;  4L0L A;  3IWI A;  1BLS A;  2G2U A;  3ZG5 A;  4KZ8 A;  3GTC A;  4HH2 A;  2VGK A;  2EXA A;  1T1A A;  4YOF A;  3S4X A;  3B42 A;  1O7E A;  2B5R A;  1TS0 A;  4KQD A;  3BQA A;  5HDD A;  1VQQ A;  1DJA A;  3IBJ A;  1NRJ A;  5DFY A;  3GQZ A;  4WF0 A;  3V3R A;  4WUJ A;  3ZVW A;  1MY8 A;  5F82 A;  2ZQ9 A;  3MKE A;  4E3K A;  3VP0 A;  4Y0T A;  4R3B A;  3VFF A;  2W1T A;  1NYM A;  1W63 Q;  2W1R A;  1MWU A;  3TOI A;  1GHM A;  3H7W B;  4L9F A;  1FR1 A;  3MZD A;  1PW8 A;  4NK3 A;  3R7W A;  3WRT A;  1VHM A;  4D2O A;  1WE4 A;  5M1A A;  5FEF A;  1S6R A;  1YLT A;  3FPV A;  2PYR A;  1YSP A;  1XJ4 A;  1PNE A;  5HAR A;  2XLN A;  4S2N A;  1HLU P;  4RA7 A;  4EUZ A;  2EX6 A;  2WZZ A;  3C7U A;  2P04 A;  4ZAM A;  3TE8 A;  2Y79 A;  2R9X A;  1KVL A;  1HVB A;  4PPR A;  3RH8 B;  3SW1 A;  3O3V A;  1DJB A;  5EVL A;  4K08 A;  3BFE A;  2ZOH A;  3BY8 A;  1S67 L;  4UHU A;  1E25 A;  4I3A A;  2XF3 A;  2WGI A;  1XA1 A;  2YKH A;  1SKF A;  2XDM A;  1OTI A;  1GSW A;  4E6X A;  2P9V B;  3UB7 A;  1N9N A;  3LR3 A;  4Y0O A;  4LGW A;  3GDI A;  1S0W A;  5CHM A;  4EUV A;  3UO9 A;  4WYY A;  5A92 A;  3C38 A;  2X02 A;  3OPR A;  3F1O B;  3UB5 P;  5D3O A;  4B9O A;  4UAA A;  3EEH A;  3H7W A;  4EER A;  4YFM A;  4LV2 A;  4GJ4 A;  3EWK A;  3N7W A;  5EVI C;  4DE3 A;  3G6O A;  1S66 L;  3VOY A;  3BLM A;  3PBS A;  1FOF A;  4IJG A;  4WZ4 A;  4HQA A;  4NXE A;  2OAQ 1;  5HWW A;  5J4E A;  5HD3 A;  1QMF A;  3ITB A;  2Y8H A;  5AQ9 A;  3CAX A;  1I2S A;  2JE5 A;  4GHI B;  5A93 A;  1ES3 A;  1EWZ A;  4CLC C;  4QY5 A;  1PRQ A;  2Z2L B;  3W4P A;  1DRM A;  3CZD A;  1P9R A;  3K3C A;  4OPR A;  2W3H A;  4ZJ3 A;  3O87 A;  2DNS A;  3TG9 A;  3CI6 A;  1PIO A;  1W63 M;  3VE3 A;  3QHY A;  4JGP A;  4PAU A;  1XJ3 A;  4PM8 A;  2UWX A;  3V67 A;  2C6W B;  3IHB A;  1GA0 A;  1NXY A;  4EQ1 A;  1FIK A;  3RFB A;  3QP6 A;  2WYX A;  5GLD A;  5FQJ A;  1IEL A;  1IYQ A;  2P9V A;  1RGY A;  2V1B A;  5JYP A;  1FCM A;  5CEC A;  4XUZ A;  2VV7 A;  3NOP C;  3PHY A;  1WYC A;  4EWF A;  4H6J B;  2L1M A;  4X69 A;  3BM6 A;  3MJQ A;  5CHJ A;  1UGU A;  2WUQ A;  3AGE A;  4OH0 A;  3F1O A;  1I2W A;  4KQR A;  3EQU A;  3IX4 A;  1E3U A;  2Y2H A;  3IT9 A;  2J8Y A;  1Q2Q A;  4GZB A;  3NEC A;  4C6Y A;  5M19 A;  1MC0 A;  5HPF A;  2PD7 A;  4E3O A;  1U60 A;  1WA9 A;  1KGE A;  2UV0 E;  5CRF A;  3IX3 A;  4R70 A;  4LEN A;  5EOE A;  2JN7 A;  5E2H A;  4GHI A;  3Q1F A;  4OOY A;  3H82 B;  1JTD A;  2ZM2 A;  1QME A;  1X0O A;  5EM1 A;  1IOU A;  3MR0 A;  3D72 A;  1CI9 A;  3NJA A;  4RYE A;  5FAP A;  1LL8 A;  5AVF A;  3IF6 C;  1ES4 A;  3ISG A;  1GHI A;  3TJZ C;  1OTE A;  3B47 A;  3MXQ A;  2Q9M A;  1Y28 A;  5HFO A;  4EBP A;  4LRX C;  4MN6 A;  5A91 A;  3PXP A;  4IVI A;  1G5U A;  1CQA A;  2A2L A;  2WKH A;  3LO7 A;  3GVB A;  5HX9 A;  4CPK A;  3SOI A;  3FPW A;  4XXR A;  2WKR A;  4H6J A;  4DE1 A;  3G2Z A;  3SH9 A;  2ZC6 B;  3OOV A;  2ZMA A;  3UPP A;  3NI9 A;  3P01 A;  4BD1 A;  4NXF A;  1P0Z A;  2J3T C;  4QU3 A;  5FQM A;  2IWD A;  2WGW B;  4NXG A;  1MKI A;  5FI7 A;  3AGD A;  3HLG A;  2A3U A;  2LB5 A;  2R78 A;  4DDY A;  3KYQ A;  5BOH A;  2QYB A;  5G4Z A;  5L09 A;  1IKG A;  4KZ5 A;  3NY4 A;  3H82 A;  3OBF A;  4WBG A;  1MWS A;  4HIA A;  3NBL A;  4Z9Q A;  3PBQ A;  3HCY A;  5EEC A;  3VOZ A;  4PM5 A;  4HI4 A;  3WS0 A;  4OQ0 A;  1H5X A;  2V1Z A;  2O9A A;  4ETZ A;  2VLG A;  4OLD A;  5FAO A;  1ESU A;  3OPP A;  3ZHH A;  3NHQ A;  4NET A;  5HAI A;  1JWV A;  2Y2M A;  4E6W A;  3NIA A;  3NDG A;  2IWB A;  2HDU A;  4Y2F A;  4KG6 A;  4Y3I A;  1N9L A;  2GZA A;  4XT2 B;  3RXW A;  2V20 A;  1AWI A;  2W3F A;  2ZMF A;  3LIC A;  3EOI A;  4RQ9 A;  3QP2 A;  5L07 A;  3RJU A;  3FYZ A;  2A24 B;  3P98 A;  4S2K A;  5GL9 A;  1OTB A;  4MBF A;  1BYW A;  4WLA A;  1XGJ A;  4P0M A;  2G7U A;  1YQS A;  2WGV A;  2CMN A;  3HLE A;  1LI9 A;  2WGW A;  4ESP A;  3V39 A;  2PAV P;  2H0T A;  4LCL A;  5FDS A;  4ZJ1 A;  3PBO A;  3HLF A;  3CG5 A;  3N8S A;  1E3U D;  2R9W A;  3CUE A;  3QP4 A;  2JBF A;  3EEA A;  4DKI A;  3LY4 A;  3Q82 A;  3G2Y A;  2Y2N A;  4GW9 A;  4DE0 A;  2WKI A;  2B02 A;  5TBM A;  3WS4 A;  3D9Y A;  1Q2P A;  1G68 A;  1IEM A;  3NUL A;  3MF0 A;  3D3O A;  2O99 A;  4DJ2 A;  5JYO A;  2V0U A;  1BUE A;  4LCM A;  5CGX A;  2PR6 A;  3N4I A;  3S1Y A;  1XJ2 A;  3LUQ A;  4ZJ2 A;  3T1S A;  4XT2 A;  4PHT A;  5FDH A;  1XA7 A;  1Z6F A;  3DW0 A;  5DF9 A;  5FAT A;  3T1X A;  4KUO A;  4PM9 A;  1NJ4 A;  2KOI A;  2A24 A;  3ZG7 B;  4QD4 A;  1PFL A;  4WEL A;  4FTX A;  4ZRR A;  4K0X A;  1S1Z A;  2NUT C;  1TF1 A;  1WYB A;  1TEM A;  3EGX C;  2O9B A;  4S2P A;  1FSY A;  4OPQ A;  3ZCZ A;  3BFC A;  2Z2M B;  3BLS A;  1P97 A;  3E4Q A;  3IX8 A;  4E3I A;  1J9M A;  2WAE A;  1M6K A;  1TS7 A;  3SH7 A;  2M1C A;  3ZQ5 A;  4ZDX A;  1SZV A;  3S7Q A;  1DJC A;  5J8X A;  3G4P A;  3OPH A;  4HBT A;  4EBN A;  2PD8 A;  2ZJ9 A;  2HV1 A;  2VEA A;  1I5Q A;  5EOO A;  2K7S A;  3IXH A;  4X6T A;  3N6I A;  3ICY A;  2ZQ8 A;  2BG1 A;  4GDN A;  3LR4 A;  3VE4 A;  2ZQ7 A;  4QJG A;  3OCL A;  4KG5 A;  4IED A;  4E3M A;  3LY3 A;  4A5R A;  5F5Y A;  1T18 A;  3M2J A;  5J7E A;  4BD0 A;  1T19 A;  4D60 A;  4LRZ E;  2ZBB A;  3DTI A;  2Z6C A;  3ZGA B;  3G35 A;  2BAS A;  5KIZ A;  4E3L A;  4CQH A;  3HJK A;  1YKD A;  5F68 A;  1S4R A;  2VJW A;  2HJE A;  2XFT A;  4EBL A;  4OLG A;  3UE3 A;  2V1A A;  2QJ7 A;  3LIB A;  4P87 A;  1YMX A;  2WKE A;  5HDS A;  3T50 A;  3GEC A;  1PW1 A;  4BL3 A;  3HUO A;  3HVF A;  4JXV A;  2J80 A;  3ZNY A;  3TRC A;  1O07 A;  1NZU A;  4OPY A;  4X55 A;  4OQH A;  3W2Z A;  1PZO A;  4Y15 A;  5GHZ A;  3QNC A;  1PI5 A;  1SKO B;  1ONH A;  1V9Y A;  2XD1 A;  3FKV A;  3T1R A;  3E2K A;  2HDS A;  3UE1 A;  4ARZ B;  3BFG A;  1OTD A;  1MZU A;  4P6B A;  1W8Y A;  2XA7 S;  4B4X A;  3SZT A;  2PYP A;  1KE3 A;  2HP6 A;  2OWH A;  3IH9 A;  5CHU A;  4BWI A;  5LBR A;  3UB6 A;  4X25 A;  3P09 A;  4EQI A;  3HLC A;  2HF6 A;  4FSF A;  1ZG6 A;  2XA7 M;  3A3I A;  2QPN A;  1YLP A;  3LEQ A;  3MZF A;  2QWS A;  3CIT A;  3N8L A;  1GHP A;  3GSG A;  1BT5 A;  4R4R A;  5HZH A;  5FA7 A;  3VMA A;  4I5S A;  3Q81 A;  1TVF A;  4KQO A;  4LFU A;  2Y2K A;  4IVK A;  5KSH A;  5F6A A;  3HUM A;  3OCN A;  3W8K A;  4GD8 A;  4X53 A;  1PI4 A;  3CLO A;  4BBT A;  3O5Y A;  1IKI A;  1NYY A;  2W3E A;  4B4Z A;  1K57 C;  2XRO A;  2I72 A;  3E4P A;  3W4O A;  1PZP A;  2VGL S;  5CTM A;  1K0K A;  2V2F F;  2EWV A;  2GJ3 A;  3HLW A;  4R38 A;  1F2K A;  4NG2 A;  1OTA A;  3PTE A;  3JYI A;  4R6L A;  4AFI A;  4U0T A;  4ETX A;  1SKO A;  5E2F A;  5CX7 A;  1C3B A;  5KMW A;  2D02 A;  1BTL A;  2H0Y A;  4NXB A;  4ARZ A;  2XGN A;  3LEZ A;  2VGL M;  4LV1 A;  4MBK A;  1KDS A;  2Y2Q A;  2GNX A;  1LSV A;  4KZB A;  5DFX A;  4N92 A;  4JGQ A;  2W3D A;  1ZG4 A;  2XH9 A;  2OOL A;  1TDL A;  4K91 A;  5HWT A;  2ZMV A;  3MMH A;  3C4P A;  1TS8 A;  3FC7 A;  3T1Q B;  3G34 A;  3L7H A;  1ONG A;  3RXX A;  3VFH A;  2OV5 A;  1TS6 A;  4DN0 A;  5A8B A;  3KX0 X;  5L8M A;  4PKY A;  3UE6 A;  4FH4 A;  5AVE A;  1T1B A;  2RL3 A;  4Y5F A;  3LIE A;  4P85 A;  4EET B;  2XFS A;  1K55 A;  1RCJ A;  2GX5 A;  2PU2 A;  4N9L A;  3L9K A;  3F1P B;  1V9Z A;  1Y4O A;  4MMN A;  2DRW A;  3UMD A;  3B3X A;  3BRM A;  3MKF A;  4II7 A;  4HES A;  5EVI A;  2XK1 A;  5AQ7 A;  3LYX A;  3FZC A;  3S22 A;  2PU4 A;  2JCH A;  1YAX A;  4LLO B;  1LL9 A;  3MS6 A;  3SS3 A;  1N9B A;  3A0S A;  2JKF A;  4HP4 A;  5GLC A;  4OON A;  5G18 A;  4HNB A;  4LV3 A;  1P9W A;  2Y2I A;  3DTK A;  3G31 A;  3V5M A;  5EVE A;  3VP1 A;  3IF6 B;  3S7O A;  1SDN A;  5M18 A;  3VOL A;  3IXG A;  1E4D A;  2JKT M;  2V0W A;  2XSS A;  5IHV A;  3BW6 A;  4MNR A;  1JNU A;  4DMZ A;  4DJ3 A;  4GD6 A;  5TGF A;  5HAQ A;  4U3T A;  5FSR A;  2INW A;  5DKL A;  2BLS A;  1ZTU A;  2O9C A;  4LRY C;  3FG8 A;  2X01 A;  3Q07 A;  4S2M A;  3LI8 A;  3NOT C;  1KOU A;  3ITA A;  1L0D A;  2J7V A;  1BLC A;  1GSX A;  3F1P A;  3FKW A;  1LHY A;  5GHY A;  5F83 A;  2ZQA A;  4N1H A;  1KVM A;  4R3J A;  1VEU B;  4L9G A;  4OOM A;  1IYO A;  1LT0 A;  4M4X A;  4EXO A;  1HD8 A;  3UNW A;  2Y2J A;  1L0F A;  4OQG A;  2V8C A;  2V8F A;  1IYP A;  1AXB A;  1S4S A;  3HLB A;  3GMW A;  1L0G A;  1RP5 A;  4FH2 A;  3D4F A;  4UA7 A;  4FUW A;  4OOL A;  1S1Y A;  2Y2P A;  4DE2 A;  2PHY A;  3FWL A;  1OJG A;  5TBM B;  2J3W A;  3N8R A;  4C75 A;  1VET B;  4BL2 A;  5IU1 A;  3IF6 A;  3NDE A;  1H8Y A;  1W8Q A;  4FCF A;  3T4O A;  1K6S A;  4Q8I A;  2VGJ A;  1BZA A;  2WK0 A;  3SS5 A;  2VKS A;  5U47 A;  1XP4 A;  4HY8 A;  2O0Y A;  1YMS A;  3HLD A;  3KSG A;  4IUH A;  1D7E A;  1H8M A;  3JPU A;  4HJ6 A;  5FL3 A;  3BWL A;  3ZFZ A;  5I5L A;  4JF5 A;  2ZC5 B;  4GDB A;  2PDR A;  4N1X A;  2QHK A;  3ZNT A;  4S2O A;  4OP5 A;  2GDN A;  5DF8 A;  1XKZ A;  1KE0 A;  4PKY G;  4WN5 A;  1VEU A;  3OPL A;  4MDZ A;  3JVV A;  3LI9 A;  4MN7 A;  3QNB A;  2Y59 A;  2FFY A;  1N4O A;  4XUX A;  1ZC2 A;  3BFD A;  2Y2L A;  4Q0H A;  1STZ A;  3SS4 A;  5HD5 A;  4R1G A;  4O0P A;  3S7P A;  2JKT I;  2WZX A;  2ZC3 B;  3OLO A;  3VV4 A;  4HJ3 A;  3R4K A;  1MWT A;  4BEN A;  4JPM A;  4O8G A;  1JVJ A;  1F5M A;  1HTZ A;  1MWR A;  5EVI D;  3ZG8 B;  4R0Q A;  1K4F A;  1JWP A;  1VET A;  2B95 A;  4HHD A;  1L0E A;  4BMW A;  4Q0J A;  3IXB A;  1YLW A;  5FI6 A;  4B88 A;  4P6Z S;  4F94 A;  1JTG A;  1KGF A;  3UB8 A;  2WKQ A;  5EFW A;  2RCX A;  5CER A;  4CLC D;  3HBR A;  4GLQ A;  2E8I A;  4BBU A;  3PBN A;  3BFF A;  2A49 A;  2X71 A;  3MQO A;  4JXW A;  1D1J A;  4BQM A;  1GA9 A;  1PYY A;  1FCO A;  1K54 A;  2OLU A;  4KZ9 A;  3ZG0 A;  3ULF A;  4P6Z M;  4QWO A;  4OP8 A;  1SDE A;  1NLZ A;  4KZ6 A;  1OT6 A;  2I9V A;  3KO6 A;  4MBH A;  1ALQ A;  2HGV A;  4B93 A;  4KUK A;  3IS2 B;  2ZM0 A;  2IA2 A;  1ES2 A;  2OWJ A;  3TSG A;  5DF7 A;  4NKP A;  4HBU A;  4DXB A;  5F69 A;  2PBD P;  3B33 A;  1FSW A;  3TW8 A;  3VP2 A;  5FAS A;  4UA6 A;  3E98 A;  1YLJ A;  3IQA A;  5E2G A;  3UDF A;  3DWZ A;  3GV9 A;  4S2N C;  5TJJ A;  4G3W A;  2EXB A;  5AQB A;  4EU0 A;  5E43 A;  3W4Q A;  4RVA A;  4Q0I A;  2VV8 A;  4Y0U A;  3OC2 A;  3NCK A;  5HWV A;  2L4R A;  4FD8 A;  2FFF B;  5EM0 A;  2K31 A;  4JGR A;  3EGD C;  4UQI S;  4WZ5 A;  2VX8 A;  4Y13 A;  1XPB A;  2W0N A;  5DJT A;  1XJ6 A;  1K38 A;  4MLL A;  3UB9 A;  4R23 A;  1W7F A;  4OVD A;  1FQG A;  2B18 A;  2ZL1 B;  3BQ8 A;  2XQZ A;  5FQ9 A;  1IFQ A;  1XGI A;  1YSQ A;  3T4J A;  2VV6 A;  4GCZ A;  3C30 A;  4BJP A;  3LID A;  4GS9 B;  4UQI M;  2ZQD A;  2P08 A;  3IWO A;  1K4E A;  4GOG A;  3UME A;  2H10 A;  4YWZ A;  4S2I A;  2WAD A;  2BTF P;  3IS2 A;  2P74 A;  1GSV A;  2ZM8 A;  5GLA A;  2ACG A;  4WMC D;  3PYP A;  3E4O A;  3PAE A;  5FQK A;  1DY6 A;  4Z1W A;  1CF0 A;  3VP4 A;  2Y91 A;  5KZH A;  5C5K A;  4BBV A;  2K2N A;  2J3T D;  1LSX A;  4IUK A;  5F1F A;  2G2W A;  2JC7 A;  3IBR A;  2KX6 A;  3M6H A;  3KSI A;  2H5S A;  1ERO A;  2JHE A;  5A90 A;  3LGO A;  3KSF A;  3VSL A;  3IHA A;  5GHX A;  2PBY A;  4MEZ A;  3UPO A;  1G6A A;  3HUN A;  3KYE A;  3V50 A;  3MQ0 A;  5HAP A;  4CLC E;  2W27 A;  4KZ4 A;  2KDK A;  4HH3 A;  4JXS A;  5FI2 A;  4EV4 A;  2ZL1 A; 
#chains in the Genus database with same CATH homology
 4YIN A;  4KG6 A;  2JCH A;  5DTK A;  4OQI A;  3IF5 A;  1NRF A;  5FAQ A;  3RXW A;  1LL9 A;  5EPH A;  3SS3 A;  2V20 A;  1SHV A;  1Y54 A;  2ZD8 A;  2HDR A;  1N9B A;  2Y2G A;  4ID4 A;  5DVA A;  1MBL A;  4BLM A;  3WS1 A;  2Y4A A;  1SCW A;  1K6R A;  4IBX A;  3WWX A;  4JLF A;  5EE8 A;  5GLC A;  1IYS A;  3VSK A;  2QZ6 A;  5CED A;  1H8Z A;  3RJU A;  4JF4 A;  3FYZ A;  4OON A;  3IXD A;  5G18 A;  5DTT A;  3O88 A;  2OLV A;  4LV3 A;  2ZC4 B;  5L2F A;  4U0X A;  3P98 A;  4DRT A;  4S2K A;  2Y2I A;  5GL9 A;  5CGW A;  3G31 A;  3V5M A;  1CI8 A;  1YM1 A;  3VP1 A;  4MBF A;  1K56 D;  3IF6 B;  1XGJ A;  3G30 A;  4L0L A;  4P0M A;  3IWI A;  1BLS A;  2G2U A;  1SDN A;  5EVI B;  1K55 C;  3ZG5 A;  2CC1 A;  1YQS A;  5M18 A;  4KZ8 A;  3GTC A;  2VGK A;  3IXG A;  2EXA A;  2WGV A;  1E4D A;  3HLE A;  1LI9 A;  2WGW A;  5IHV A;  3UDI A;  4MNR A;  1OME A;  4X68 A;  3V39 A;  3S4X A;  4GD6 A;  1O7E A;  4QHC A;  3UN7 A;  2EX2 A;  2H0T A;  2B5R A;  5TGF A;  4LCL A;  5HAQ A;  4U3T A;  4ZJ1 A;  4H8R A;  1VQQ A;  1DJA A;  3PBO A;  3HLF A;  1PWC A;  5FSR A;  3VP3 A;  3CG5 A;  3GQZ A;  2BLS A;  3N8S A;  3V3R A;  1E3U D;  1ES5 A;  2R9W A;  2X01 A;  3Q07 A;  3ZVW A;  2JBF A;  3MXS A;  4S2M A;  1MY8 A;  5F82 A;  1BUL A;  4DKI A;  2ZQ9 A;  3LY4 A;  3MKE A;  3E2L A;  3NC8 A;  3Q82 A;  3ITA A;  1L0D A;  2J7V A;  4E3K A;  1BLC A;  3G2Y A;  3VP0 A;  2Y2N A;  4Y0T A;  4R3B A;  4DE0 A;  3FKW A;  2WKI A;  1LHY A;  3VFF A;  4RX2 A;  5HL1 A;  5GHY A;  3WS4 A;  4DF6 A;  1NYM A;  2ZQA A;  5F83 A;  1Q2P A;  4N1H A;  1CEF A;  1KVM A;  1MWU A;  3TOI A;  1GHM A;  1G68 A;  4R3J A;  1IEM A;  3EQV A;  4OOM A;  1IYO A;  4JKT A;  1FR1 A;  3MZD A;  1HD8 A;  1PW8 A;  3UNW A;  4NK3 A;  5JYO A;  2Y2J A;  4GB7 A;  3A3J A;  3WRT A;  2XR0 A;  1BUE A;  4LCM A;  5CGX A;  1L0F A;  3N4I A;  4O7D A;  3S1Y A;  4D2O A;  1NY0 A;  1WE4 A;  2IWC A;  4OQG A;  5M1A A;  4HEF A;  1IYP A;  4ZJ2 A;  4DDS A;  1S6R A;  4GN2 A;  1YLT A;  1HZO A;  4E3J A;  1AXB A;  3C4O A;  4M3K A;  5HAR A;  2XLN A;  4S2N A;  1XA7 A;  5FDH A;  1Z6F A;  3HLB A;  3DW0 A;  3PBR A;  4RA7 A;  3GMW A;  1L0G A;  5DF9 A;  4EUZ A;  5FAT A;  1RP5 A;  4FH2 A;  3D4F A;  4UA7 A;  4PM9 A;  4KG2 A;  2EX6 A;  2WZZ A;  3C7U A;  1NJ4 A;  4OOL A;  4ZAM A;  1YT4 A;  2Y2P A;  4DE2 A;  3FWL A;  3ZG7 B;  2R9X A;  1KVL A;  4WEJ A;  4QD4 A;  3N8R A;  4C75 A;  1BSG A;  1HVB A;  1ZKJ A;  4WEL A;  4BL2 A;  4C3Q A;  4PPR A;  4QB8 A;  2XD5 A;  3AGF A;  3IF6 A;  4K0X A;  3NDE A;  3O3V A;  1DJB A;  1H8Y A;  1WYB A;  5EVL A;  1TEM A;  4PMA A;  3BFE A;  3MFD A;  1W8Q A;  4FCF A;  4S2P A;  1FSY A;  4JXG A;  4OPQ A;  4UHU A;  5HW3 A;  1E25 A;  1K57 A;  1MXO A;  3BYD A;  3BFC A;  3ZCZ A;  1K6S A;  2Z2M B;  3BLS A;  4Q8I A;  2VGJ A;  4E3I A;  1J9M A;  2WAE A;  1BZA A;  2WK0 A;  1M6K A;  3SS5 A;  2XF3 A;  3DWK A;  2WGI A;  1XA1 A;  2ZLY A;  5U47 A;  1SKF A;  3SH7 A;  1XP4 A;  3I7J A;  2XDM A;  1YMS A;  3MXR A;  4ZDX A;  4E6X A;  3HLD A;  2P9V B;  1PWD A;  4Y0O A;  1MPL A;  1S0W A;  3ZFZ A;  5CHM A;  3A3D A;  3UO9 A;  4WYY A;  4JF5 A;  5A92 A;  2ZC5 B;  5J8X A;  1DJC A;  3G4P A;  3OPH A;  4GDB A;  4HBT A;  4N1X A;  2EFX A;  1GCE A;  2X02 A;  3ZNT A;  4EBN A;  5F1G A;  4S2O A;  3OPR A;  2ZJ9 A;  4OP5 A;  1KGG A;  2GDN A;  5D3O A;  5DF8 A;  1XKZ A;  1I5Q A;  5EOO A;  4UAA A;  1KE0 A;  3IXH A;  4X6T A;  4KQQ A;  3N6I A;  3OPL A;  3O86 A;  3C7V A;  2ZQ8 A;  2BG1 A;  4GDN A;  4YFM A;  3QNB A;  2Y59 A;  2FFY A;  3UPN A;  2ZQ7 A;  1N4O A;  4XUX A;  4LV2 A;  1ZC2 A;  4QJG A;  3BFD A;  2Y2L A;  3OCL A;  5E2E A;  4KG5 A;  2QMI A;  4IED A;  1M40 A;  5AQA A;  4E3M A;  3LY3 A;  2HDQ A;  5CXW A;  3N7W A;  1CEG A;  3SS4 A;  4A5R A;  5EVI C;  4DE3 A;  3VOY A;  3A3E A;  3M2J A;  3BLM A;  3PBS A;  4R1G A;  1FOF A;  1W79 A;  4BD0 A;  3Q7Z A;  4OKP A;  4WZ4 A;  4OPZ A;  2WZX A;  2ZC3 B;  2Y2O A;  1QMF A;  3ITB A;  3HRE A;  3ZG9 B;  5AQ9 A;  1MWT A;  4BEN A;  4JPM A;  1I2S A;  2JE5 A;  3ZGA B;  3G35 A;  1JVJ A;  5A93 A;  1ES3 A;  1EWZ A;  1HTZ A;  4QY5 A;  1MWR A;  2Z2L B;  3W4P A;  4E3L A;  3CZD A;  5EVI D;  4OPR A;  3ZG8 B;  3BEB A;  4R0Q A;  1K4F A;  4RX3 A;  1JWP A;  3WS5 A;  4ZJ3 A;  3O87 A;  2XFT A;  1L0E A;  1CK3 A;  2DNS A;  3TG9 A;  3MBZ A;  3IXB A;  1PIO A;  1ERM A;  2HP9 A;  4EBL A;  1YLW A;  3QHY A;  4KEN B;  3UE0 A;  4OLG A;  4ZBE A;  4PM8 A;  2UWX A;  5FI6 A;  3CMZ A;  4B88 A;  4F94 A;  2C6W B;  3UE3 A;  1JTG A;  3IHB A;  1GA0 A;  1KGF A;  1NXY A;  3DTM A;  3GRJ A;  4P87 A;  1YMX A;  2EFU A;  2RCX A;  2WKE A;  5CER A;  3HBR A;  5JYP A;  2E8I A;  3PBN A;  3BFF A;  4IBR A;  2A49 A;  4R4S A;  2WYX A;  5GLD A;  1PW1 A;  2X71 A;  5FQJ A;  4BL3 A;  3HUO A;  4JXW A;  1IEL A;  5CGS A;  1VM1 A;  3HVF A;  4BQM A;  4JXV A;  1GA9 A;  1IYQ A;  3ZNY A;  4JF6 A;  1PYY A;  2P9V A;  1O07 A;  1FCO A;  1K54 A;  1RGY A;  1NZU A;  2OLU A;  4KZ9 A;  4OPY A;  4ZTK A;  1FCM A;  5TFQ A;  4X55 A;  3ZG0 A;  4OQH A;  4XUZ A;  5CEC A;  2DCF A;  3PBT A;  1PZO A;  5GHZ A;  4EWF A;  1WYC A;  3QNC A;  3GR2 A;  4OP8 A;  1PI5 A;  4X69 A;  1SDE A;  3BM6 A;  5CHJ A;  2HP5 A;  4KZ6 A;  1ONH A;  2WUQ A;  2XD1 A;  1NZO A;  2J9O A;  2Y55 A;  3AGE A;  2ZC7 A;  3M2K A;  4OH0 A;  4MBH A;  1ALQ A;  3FKV A;  3ZDJ A;  1I2W A;  3E2K A;  2HDS A;  4KQR A;  3UE1 A;  4K0W A;  3BFG A;  3EQU A;  2ZM0 A;  1E3U A;  1ES2 A;  4GNU A;  3C5A A;  4P6B A;  1W8Y A;  2ZQC A;  3TSG A;  2Y2H A;  3IT9 A;  5DF7 A;  2J8Y A;  4Y7P A;  2EX8 A;  1Q2Q A;  4B4X A;  4HBU A;  4GZB A;  1LI0 A;  3HL9 A;  4DXB A;  1KE3 A;  4C6Y A;  2HP6 A;  5M19 A;  3IH9 A;  1FSW A;  5CHU A;  1L2S A;  4E3O A;  3VP2 A;  5FAS A;  3P09 A;  4UA6 A;  1TDG A;  4EQI A;  1XXM A;  1YLJ A;  4PM6 A;  3IQA A;  5GLB A;  1LLB A;  1U60 A;  3HLC A;  4WMC A;  5E2G A;  2EX9 A;  4FSF A;  1ZG6 A;  1KGE A;  3UDF A;  2WAF A;  3A3I A;  2J9P A;  5CRF A;  2QPN A;  1YLP A;  3MZF A;  3DWZ A;  3Q7V B;  4LEN A;  3N8L A;  4WM9 A;  5E2H A;  5EOE A;  3GV9 A;  1GHP A;  3GSG A;  1ESI A;  4S2N C;  3Q1F A;  4OOY A;  3S22 A;  2Q9N A;  5DTS A;  1JWZ A;  2EXB A;  5AQB A;  5TR7 A;  1BT5 A;  4KZ3 A;  5E43 A;  3W4Q A;  1JTD A;  2OSU A;  4RVA A;  4WEK A;  4R4R A;  4N9K A;  1K54 C;  2ZM2 A;  5CTN A;  3Q81 A;  1TVF A;  4KQO A;  5FA7 A;  3VMA A;  4Y0U A;  2Y2K A;  1QME A;  3OC2 A;  4IVK A;  3NCK A;  1RGZ A;  5KSH A;  5KSC A;  3HUM A;  3OCN A;  4FD8 A;  2FFF B;  3W8K A;  1CI9 A;  4GD8 A;  4RYE A;  5FAP A;  4X53 A;  1PI4 A;  4E3N A;  4WZ5 A;  3IF6 C;  1ES4 A;  1KE4 A;  3WS2 A;  3ISG A;  1XPB A;  1GHI A;  4S2J A;  1YLZ A;  1IKI A;  1K38 A;  1NYY A;  2Q9M A;  4MLL A;  4R23 A;  4B4Z A;  5HFO A;  4EBP A;  1W7F A;  4S2L A;  4OVD A;  1K57 C;  5A91 A;  4JBF A;  1FQG A;  4DXC A;  2I72 A;  3W4O A;  1PZP A;  4IVI A;  1YLY A;  3SH8 A;  5CTM A;  1BLH A;  2XQZ A;  2WKH A;  2V2F F;  3LO7 A;  5FQ9 A;  4QY6 A;  1XGI A;  3HLW A;  4KZ7 A;  3GVB A;  5HX9 A;  4CPK A;  4PM7 A;  3SOI A;  1W5D A;  3WRZ A;  4BJP A;  3PTE A;  5EUA A;  3JYI A;  4XXR A;  4DE1 A;  4U0T A;  2ZQD A;  3G2Z A;  5E2F A;  5CEB A;  3IWO A;  3UY6 A;  1K4E A;  4GOG A;  3IH8 A;  3SH9 A;  1C3B A;  2XEP A;  2H10 A;  2ZC6 B;  4S2I A;  2WAD A;  5KMW A;  1EI5 A;  1BTL A;  2H0Y A;  4KZA A;  3MZE A;  2XGN A;  1FR6 A;  2ZMA A;  3LEZ A;  4CJN A;  3A3F A;  2P74 A;  3G32 A;  3UPP A;  3BEC A;  4LV1 A;  3NI9 A;  4MBK A;  1KDS A;  4LV0 A;  2Y2Q A;  4BD1 A;  4KZB A;  2ZM8 A;  1K25 A;  4N92 A;  5GLA A;  1ERQ A;  4GKU A;  4QU3 A;  5FQM A;  2IWD A;  3OZH A;  1ZG4 A;  4WMC D;  2XH9 A;  1K56 A;  2WGW B;  3M6B A;  1MKI A;  1TDL A;  4K91 A;  5FI7 A;  3PAE A;  3AGD A;  3IWQ A;  5FQK A;  1DY6 A;  3LCE A;  3VP4 A;  3C4P A;  3PAG A;  4WZ5 C;  3G34 A;  2Y91 A;  1XX2 A;  2A3U A;  1ONG A;  3HLG A;  3RXX A;  2OV5 A;  3VFH A;  4DDY A;  5BOH A;  5KZH A;  3Q7V A;  1IKG A;  4KZ5 A;  5F1F A;  3NY4 A;  3UDX A;  4FH4 A;  3FV7 A;  4X56 A;  4WBG A;  1MWS A;  2G2W A;  3ZVT A;  2JC7 A;  3NBL A;  4Z9Q A;  2RL3 A;  4P85 A;  3M6H A;  3PBQ A;  2XFS A;  3CJM A;  2H5S A;  1K55 A;  5EEC A;  1RCJ A;  3VOZ A;  1ERO A;  4PM5 A;  3WS0 A;  1FCN A;  2HPB A;  2PU2 A;  5A90 A;  4N9L A;  4OQ0 A;  3VSL A;  1BLP A;  1H5X A;  3IHA A;  5GHX A;  2PBY A;  4MEZ A;  2V1Z A;  3V3S A;  4UA9 A;  3UPO A;  1G6A A;  3HUN A;  4OLD A;  2C5W B;  1KDW A;  5FAO A;  2DRW A;  5FQI A;  1ESU A;  3B3X A;  3BRM A;  3MKF A;  3OPP A;  1LL5 A;  3V50 A;  4NET A;  3ZHH A;  5HAP A;  4HES A;  5EVI A;  5HAI A;  4KZ4 A;  1JWV A;  1PWG A;  2XK1 A;  5I94 A;  4JXS A;  2Y2M A;  5FI2 A;  5AQ7 A;  4E6W A;  5FQQ A;  4EV4 A;  3NIA A;  3NDG A;  3FZC A;  2IWB A;  2PU4 A;  2HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...