2V8FA

Mouse profilin iia in complex with a double repeat from the fh1 domain of mdia1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
138
Chain Sequence
AGWQSYVDNLMCDGCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN-2
publication title High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 44
structure length 138
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2v8fA00
3T1SA 1SKOA 1VETB 3LEQA 1J3WA 2PRFA 3CHWP 4X25A 2JKGA 2HZ5A 2V8CA 2ZL1B 1HLUP 1FILA 1PFLA 1ACFA 1K0KA 1VEUB 3LGOA 1VETA 4FUWA 2VK3A 2E8JA 1A0KA 5FDSA 3MS6A 2ZL1A 3T1QB 5EV0A 3T1XA 3NECA 5EM1A 1CJFA 2PBDP 4FTXA 1FIKA 3MSHA 1PNEA 3U4LP 1Z09A 4ESPA 5EVEA 1Y4OA 2V8FA 4X1MA 1CF0A 1CQAA 3CPTB 1VEUA 1SZVA 1SKOB 3L9KA 1G5UA 3NULA 2BTFP 2ACGA 1YPRA 5FEFA 3DAVA 1AWIA 3D9YA 5EM0A 3UB5P 1D1JA 3T1RA 2PAVP 4QWOA 2B95A 1F2KA 3L7HA 2JKFA 3CPTA 5FEGA 1PRQA 4D60A 4X1LA 3KYEA 3T12B
chains in the Genus database with same CATH superfamily
1DP6A 3E2KA 1K6RA 4X53A 5JYOA 3TSGA 3OZHA 3HUNA 3HLCA 5K5BA 1JTDA 3G31A 3P09A 4NG2A 4KZ3A 3QNCA 5GLCA 3UB8A 1HD8A 4GHIA 4FSFA 2X71A 3C38A 4I3IA 4O8GA 2MJ6A 3LCEA 3PR6A 1I2SA 5HDCA 5GL9A 1YMSA 4MNRA 4OVDA 4LV1A 1W5DA 4BBTA 2Y55A 2ZL1A 4OLGA 3E98A 5F1FA 1YMXA 5E2EA 4OQGA 4K0WA 4CJNA 2ZQ9A 3IBRA 5U47A 2VV8A 1OJGA 4ARZA 1LSVA 3LY3A 4Q0IA 4L0LA 5HPFA 3MZEA 2Q0OA 2P9VA 2W3DA 4ESPA 5J3WA 4BQMA 3BFDA 4HH2A 2XA7S 2KDKA 3FV7A 2P74A 1CI8A 4B93A 3LO7A 4QY5A 5AVEA 1K56D 3EEAA 5CEBA 4JGOA 3T4KA 2A2LA 2W27A 1K55C 1KOUA 4GDBA 1XA1A 5DTSA 2EA9A 3OC2A 5EM0A 2ZM0A 3Q1FA 3ZG8B 4RVAA 3IH8A 4ZTKA 2JE5A 5C5KA 5FAQA 3CPTA 5FEGA 1S4SA 4WZ5A 4WZ5C 4FH4A 1K56A 3E0YA 1SKOA 3OPPA 3E4OA 4IVIA 4JF4A 3T50A 1J3WA 2V1AA 4PMAA 5J4EA 3NCKA 2VGJA 4JBFA 3LICA 4XT2A 5FI2A 5HPIA 3BFGA 4GD6A 1YLTA 4KQOA 3PBRA 3LR5A 3PYPA 1VB6A 5HAQA 1FILA 4QU3A 1K0KA 1VEUB 4EXOA 4UAAA 1LSWA 4S2MA 4GCZA 3VP3A 1A0KA 3HREA 4HQAA 3D72A 1K57A 3CG5A 2W1RA 2D02A 4OH0A 1IYOA 1G28A 3K3DA 1ERQA 3VE3A 2Y79A 2W3FA 1TDGA 3OOVA 1JWZA 4X55A 2Q9NA 4EU0A 3BQ8A 4UA6A 3W4QA 4Y0OA 2EX9A 4E6XA 3O86A 3GMWA 2BG1A 2L4RA 3S7QA 4EERA 5I5LA 1YAXA 3KSHA 3LR0A 2V1BA 1ZC2A 3QP8A 3DAVA 3M2KA 5GLDA 4E3OA 3BJNA 2KOIA 3CUEA 3CUEC 3DWZA 4OPQA 1MY8A 3L7HA 2EXAA 4Z9QA 3OPLA 4HEFA 1NLZA 3BY8A 1UGUA 4GDNA 2V2FF 1WE4A 3PBTA 3T4LA 5A92A 2EWWA 4X56A 3GR2A 5E2GA 2BLSA 3UMEA 5A90A 1TS8A 5DF7A 4I3JA 4BD1A 4GS9A 2ZC4B 4WLAA 3VOZA 1OTDA 2L1MA 2J7VA 3ZG7B 4GZBA 2UV0E 3LGOA 4EEPA 5E2HA 3MR0A 3QP4A 3T4JA 2JN7A 3ITAA 1TEMA 3MFDA 3G2YA 3JVUA 2JKTM 4GD8A 3SS5A 1CJFA 2UWXA 1O07A 3IX4A 3S1YA 3MJQA 4E3IA 4Y13A 2HF6A 5HSQA 5HD3A 4JLFA 1SHVA 4DN0A 4PKYA 2I72A 3O88A 4CLCE 5CTNA 3RXWA 4JXGA 2PBYA 3MQ0A 1LI9A 2WKIA 1TS6A 4M4XA 1TS7A 1YLPA 4H6JB 2HDUA 4B4XA 2YKFA 3G4PA 1H8MA 1L3LA 1K6SA 5FAPA 4QB8A 3FKVA 5TJJA 2H0TA 5TBMA 4K08A 1PRQA 2ZJ9A 4R70A 1TD5A 3KYQA 1OJ5A 4KUKA 2HGVA 3LIEA 4R6LA 3U2AA 4JGQA 1GHMA 2DMWA 3QP1A 4LV2A 4HHDA 3G30A 2JKGA 2Y2GA 2V8CA 4CPKA 1DP9A 2Y2IA 1YSQA 1V9YA 5EVIB 1H5XA 4C3QA 2EFUA 1TS0A 1K54C 4UQIM 3RJUA 4EV4A 3NJAA 3IX3A 2XK1A 1NYMA 2XEPA 2A3UA 3KX0X 5FQKA 4L9EA 5F6AA 2VGLS 2QKPA 3WS5A 2V0UA 4JXSA 4QJGA 1XFNA 2INWA 1RP5A 1SCWA 3UN7A 4JF5A 4OPRA 2WAEA 2XD5A 3IHAA 4GW9A 4X68A 4B88A 4MBKA 3VE4A 1XXMA 1DJBA 5KZHA 1ES4A 5FQJA 4BLMA 1LHYA 4NETA 2J8YA 3U4LP 1BULA 1E25A 4NEED 1L2SA 3VP0A 2ZQ7A 5M1AA 2J9OA 2OLVA 3Q81A 5CGWA 3MQOA 5AJGA 2O9CA 3V3SA 3G2ZA 1N9NA 2OV5A 1FR1A 4EQ1A 2JHEA 4Q8IA 1H3QA 1QMFA 2O9AA 3HLDA 1LLBA 3NDEA 2ZQCA 1T1BA 4LRZE 4EEUA 5G4YA 4U0XA 4XUZA 4FOFA 1IEMA 3C8CA 1U60A 3LI9A 3ZCZA 3OCLA 3T12B 3T1SA 4LCMA 3HJIA 1G6AA 2E8IA 4K0XA 3OLOA 3HCYA 3A3FA 3IH9A 4RX2A 3SH9A 2HPBA 4EW7A 3AGDA 1LL5A 3A0RA 4ZJ2A 4IBXA 4GN2A 2B5RA 4L9GA 1ZG6A 1X0OA 3VP4A 4HESA 1T18A 1KGEA 2B18A 2WUQA 4FUWA 1KVLA 2ZOIA 4PAUA 5AQ9A 1HVBA 2E8JA 2JKRM 1CI9A 2JBFA 4HIAA 4KZ6A 4DJ3A 4EETB 4GB7A 3RFBA 2G2WA 2A24A 3A0SA 1H8ZA 3HLBA 4QHCA 3VOYA 4KUOA 3ZNYA 2QYBA 1LT0A 3E4QA 1PW8A 5FQMA 5IHVA 5M18A 5EE8A 3VSLA 2ZD8A 2W1TB 4C75A 1W79A 3NI9A 1L0FA 2HDSA 4YFMA 2Y2LA 3UO9A 4XXRA 2J3TD 4BBUA 4DJ2A 1PZOA 4S2NC 3ULFA 1HZOA 3H82B 3IXBA 4O01A 1GHIA 4WZ4A 4HJ3A 4KZBA 1P97A 1CEFA 1JWVA 1IOUA 4GNUA 1ES2A 3GECA 5A93A 1KE4A 3CJMA 1XJ3A 4ETXA 4KQQA 1H0MA 2XF3A 2G2UA 3DTIA 3UDIA 3N4IA 3PTEA 2XFSA 5AQAA 3T4TA 1Y54A 5L8MA 4DDSA 1LSXA 1GSVA 4Y17A 4GJ4A 4N9KA 1GSXA 3NC8A 3LUQA 2XLNA 3UB7A 1NRFA 2PT7A 1HLUP 3F1NA 3PBNA 4WEJA 4I38A 3EEHA 2XROA 4KZ9A 2H10A 3ZQ5A 3UMDA 3UY6A 4BMWA 3K3CA 4PHTA 3A0VA 4LENA 1ERMA 5DF9A 4NKPA 1MWSA 2I9VA 4O0PA 3UB6A 3VOLA 2V0WA 5CX7A 3QP6A 4O7DA 3S7PA 3Q7VB 1YKDA 3IS2B 4KG5A 4OQHA 3UNWA 3BLMA 5TGFA 4FTXA 1LL8A 2ZM8A 3NOTC 2WKRA 4UHUA 5AQ7A 2WGVA 1FSWA 3QNBA 5JYPA 3BLSA 1PWCA 1BTLA 1SDNA 1UWNX 1LL9A 2WGWA 2LB5A 1IYSA 4WF0A 5FSRA 2Y59A 3OCNA 2ACGA 4DRTA 2D01A 3RTYA 1DP8A 2Y2OA 2OSUA 2OAP1 1KGGA 3F1OA 5HDSA 4OLDA 4CLCB 5EVLA 5L10A 3IXGA 3VP2A 3UE3A 1F2KA 2OOLA 3CI6A 1GA9A 1ESUA 3KYEA 1VQQA 4R3JA 3FKWA 2Q9MA 1N4OA 1VETB 2WYXA 3CZDA 3F1PA 3ICYA 4Q0JA 1NLYA 2R9XA 3AGFA 4XUXA 3KO6A 4IUHA 3C4PA 3JYIA 3MXSA 1OPXA 3P01A 4KZ8A 4PM9A 4MEZA 2WK0A 3G6OA 3G34A 4EQIA 4N1XA 3MXRA 1V9ZA 2FZ0A 3CLOA 3BFFA 4FH2A 4DDYA 2Y2NA 4Y7PA 3UE0A 4DXCA 2VK3A 3N6IA 1C3BA 2JKRI 4MDZA 2XDMA 3LEZA 4WYYA 4EESA 1S67L 1FCMA 3NOPC 5EV0A 2IA2A 2R9WA 1K4EA 4R4RA 4BD0A 2ZC5B 2VV7A 1WYBA 4BWIA 5CTMA 5HZHA 4F3LB 1Z09A 2L0WA 4X1MA 1N9LA 2Y2HA 1TVFA 1BLSA 2J80A 5G4ZA 1K57C 4DE1A 3KYZA 5HWWA 3VSKA 2PU2A 2Z2LB 2WKQA 2XQZA 5FEFA 1WA9A 1MKMA 3IF6A 3MMHA 5BOHA 3LFVA 5DKLA 3BM6A 5FI7A 4LV0A 1D1JA 4RA7A 1YSPA 4LRXC 4UQIS 4II7A 3SW1A 5DTKA 3EQUA 3H7WB 4LRYC 2PR5A 1S4RA 4MN5A 2P08A 3UPPA 2M7UA 1BYWA 1P9WA 2XGNA 4JXVA 3UDFA 3P98A 4I5SA 3V39A 2WADA 3ZDJA 2X02A 5DJTA 1Z6FA 4IVKA 4OPZA 3LY4A 4KQDA 5IT5A 3VFHA 1YLYA 2Y2PA 5L09A 1FSYA 2XR0A 1CK3A 5HL6A 4JGRA 1S66L 1KE3A 3HLWA 3R7WA 1MXOA 3MKFA 3IF5A 1VM1A 4N92A 3SH8A 5DVAA 3IXHA 4ID4A 5KIZA 4R0QA 2WKEA 4WELA 1OT6A 1F98A 3FPVA 3E2LA 1DY6A 1FIKA 1PNEA 3EWKA 4UEYA 3G35A 1SDEA 3SOIA 3G32A 3WS0A 4YINA 5L2FA 4WL9A 1NJ4A 2LB9A 2ZC3B 1S1ZA 3WWXA 2VA0A 3V5MA 2FFYA 4QPRA 1BT5A 2WGIA 5HAPA 1T19A 4R3BA 3D4FA 1AWIA 3CMZA 2PD7A 1NXYA 3NOUC 2B95A 5HDDA 5GHZA 4HI4A 3LIBA 4R1GA 5DJUA 3MZDA 3FC7A 3HVFA 1YQSA 3LEQA 4HJ4A 4WMCA 4EUZA 3IBJA 3CITA 4G3WA 5EOEA 1XA7A 2VEAA 1T1CA 2Y2JA 3SS4A 4HBTA 5FQ9A 1ZKJA 1HTZA 2Y2QA 4EWFA 1PFLA 1ALQA 2FH5A 4P6ZM 4Y2FA 2GX5A 4K91A 1E4DA 1PYYA 4NXGA 2QMIA 4UA7A 3PHYA 1BLPA 3UPNA 1ESIA 4A5RA 2XFTA 2Z6DA 1XKZA 4S2JA 4GKUA 3PAEA 5E43A 3MBZA 4NXFA 3JVVA 4RX3A 1MWUA 1PIOA 3DBAA 4B4ZA 2VLGA 3S7NA 2P04A 2ZMFA 4RYEA 1MC0A 3ZVTA 1OTBA 3TRCA 3Q82A 5HX9A 1VEUA 2QPNA 5EECA 5DTTA 5DFYA 4LFUA 4D2OA 3HLFA 3IWQA 4OP5A 3C5AA 1YLZA 1I5QA 1RCJA 2JC7A 1IYQA 2RL3A 2QHKA 4WUJA 3LIAA 2ZOHA 5CXWA 2GDNA 3UB5P 4GHIB 4WEKA 3HLEA 2EX2A 4MBHA 2JCHA 1ODVA 4DE3A 4IHQA 4HH3A 2QJ5A 1BUEA 3PXPA 3A3IA 2K7SA 1GSWA 2HZ5A 3ZVWA 2ZL1B 4P0MA 4Y3IA 3ITBA 2VJWA 1CEGA 1K25A 3MKEA 4KZAA 5GHXA 4ARZB 2P9VB 5AVFA 2HJEA 5TR7A 4DMZA 5AQBA 2P7JA 3R4KA 2PU4A 3N7WA 1O7EA 5CHUA 1PWGA 1GHPA 3DW0A 4WBGA 5HWVA 4S2LA 5A8BA 2H28A 4PM7A 5G18A 2W3EA 3WS2A 5M19A 2EWVA 1S0WA 1TF1A 1TDLA 3V50A 2NUPC 5EVEA 3LI8A 3CAXA 3V67A 1F9IA 4KENB 3CPTB 3MF0A 3O3VA 4ME4A 4KZ5A 1IKGA 1NY0A 1SKOB 1G5UA 3NULA 3VMAA 3C7VA 2BTFP 3WS1A 2JKTI 4JXWA 1F5MA 3ISGA 3BFEA 4XT2B 3FWLA 1STZA 1Q2QA 4G3KA 3D9YA 5KMWA 3M6BA 3KSFA 3VFFA 2VGKA 4YOFA 3FYZA 4MLLA 3UE1A 1H8YA 3HUOA 4D60A 5KSCA 2PD8A 5HARA 4HJ6A 3Q7ZA 4FCFA 4IJGA 5CGXA 5F82A 4H6JA 1G68A 1D7EA 2J9PA 3WRZA 5LBRA 1KVMA 1FQGA 2ZBBA 1FCNA 5IS1A 4S2KA 2Y91A 4E3KA 4E6WA 3D3OA 2CC1A 5EVID 3A3JA 2J3TC 3SH7A 4OPYA 4EBNA 1PW1A 4BL2A 2Z6CA 5DFXA 4BJPA 1K38A 3LR4A 4PKYG 3DWKA 1YLJA 2V20A 1XGIA 1KDWA 4B9OA 5CGSA 2EFXA 1OMEA 5EVIA 2WKPA 2PBDP 3K2NA 1L0GA 3HJKA 5EUAA 4X69A 1XJ2A 4ZBEA 1D06A 3GDIA 3JPUA 2DCFA 5FASA 2OWHA 4YNRA 1IFQA 4U0TA 1EROA 3W2ZA 5KSHA 3EOIA 3ZHHA 5I94A 3B42A 2WZZA 3FPWA 3BQAA 4NXEA 3S7OA 5FL3A 4GS9B 5DKKA 2C5WB 2W3GA 2ZMVA 3TJZC 3BWLA 4Z1WA 4GOGA 4R38A 4X1LA 1ZG4A 4BENA 4IEDA 5F83A 1BZAA 4JPMA 4I39A 5CERA 4DE2A 3A3EA 2OAQ1 2OWJA 1MKIA 2Y2KA 2ZQ8A 2PRFA 3QHYA 5CECA 5FI6A 4ZDXA 3V3RA 2ZC7A 1W8QA 4F94A 2KX6A 4E04A 1XFQA 4KZ7A 2Y2MA 5CEDA 4OKPA 4H8RA 3PAGA 4E3NA 4LCLA 2VX8A 1XGJA 3T4OA 3IWOA 1AXBA 1S1YA 1ES3A 1G6OA 4RQ9A 2PHYA 3O5YA 2XSSA 2HDQA 1W8YA 5L07A 2GNXA 3RH8B 4BBVA 4LLOB 1Y28A 4C6YA 4DXBA 1K55A 4LPZA 1BSGA 3H9WA 1DRMA 3EGXC 5GLAA 3PBOA 4DE0A 3M2JA 5TBMB 2QZ6A 4PPRA 4ZJ3A 5CRFA 1VHMA 3MFXA 1BLHA 2YKHA 3M6HA 3BYDA 2O99A 5FQQA 3ZNTA 1YPRA 4ZAMA 1W63M 1OTEA 2HP6A 3I7JA 4E3LA 1SKFA 4LV3A 2O9BA 2RCXA 3DTMA 2JKFA 2M7VA 5D3OA 1IKIA 4P6ZS 2W1TA 4BL3A 2V9AA 3GSGA 3WS4A 2H5SA 1T1AA 2K2NA 2IWCA 3CHWP 3H82A 2ZM2A 3IF6C 3ZG5A 1J9MA 4OOYA 5MC7A 3QP5A 1E3UD 2GJ3A 3KSGA 5FATA 1PZPA 1NRJA 3W8KA 1OTAA 2DRWA 2KLIA 5EFWA 4N1HA 2VV6A 4QD4A 1PI5A 4GLQA 3HBRA 2PDRA 4EBLA 1DJCA 3IX8A 1NZUA 2W0NA 1W63Q 2J3WA 3BFCA 5F68A 3T1QB 1XP4A 3T1XA 1E3UA 1MZUA 3E4PA 5EM1A 4KG6A 4FD8A 3PBSA 5EOOA 2WAFA 3QP2A 3MSHA 1JNUA 4HY8A 2K31A 3OPHA 2XD1A 5HFOA 3B47A 2IWBA 1Y4OA 2V8FA 5A91A 2PR6A 1CQAA 1BLCA 3LYXA 2QJ7A 4Y5FA 4PM8A 2PYPA 4OOLA 1XJ4A 4KQRA 3S4XA 2G7UA 4ZRRA 3T4SA 1RGYA 3B33A 4IBRA 2ZC6B 3TOIA 2A49A 1MBLA 5FQIA 5EPHA 3Q7VA 3IS2A 4Q0HA 4AFIA 3UDXA 1XJ6A 1YM1A 1LI0A 1MWRA 5J8XA 4CQHA 4CLCD 4QWOA 3W4OA 2XA7M 2CMNA 4IUKA 1L0EA 3LR3A 3N8LA 1KGFA 4R3AA 1NZOA 1P9RA 2Z2MB 4NXBA 1NYYA 5F5YA 4OONA 2HDRA 4WN5A 3IT9A 4WMCD 1MWTA 2O0YA 2Y8HA 1IELA 2A24B 5F1GA 4CLCA 4CLCC 3GVBA 1JVJA 4JGPA 3FG8A 4E3MA 4U3TA 4OP8A 1KDSA 5FAOA 4X6TA 1XX2A 4G3VA 4DF6A 3GQZA 1VETA 4ZJ1A 1GCEA 1ZTUA 4N9LA 4WM9A 3UB9A 5J7EA 4HBUA 2ZQDA 3FZCA 3ZFZA 1RGZA 3BECA 3ZG0A 4UA9A 3GV9A 3PBQA 4JF6A 3KSIA 2EXBA 3LIFA 5HL1A 1CF0A 2HP9A 3N8RA 1ONGA 1JWPA 1W7FA 4KG2A 1KE0A 1YLWA 3BW6A 3T4QA 3UE6A 4P87A 3NY4A 4LGWA 3IXDA 5FA7A 3S22A 2HP5A 2BASA 5CHJA 5HW3A 1EI5A 2H0YA 5IU1A 4MBFA 3F1NB 4F3LA 3BRMA 2PAVP 1YT4A 4HOIA 2ZMAA 4DKIA 1K54A 2B02A 4HP9A 3HUMA 3EQVA 3VP1A 5TFQA 3SS3A 4QY6A 4S2IA 4R23A 3GTCA 4X25A 1FOFA 4MN7A 3W4PA 2IWDA 2QWSA 3EGDC 3WRTA 1OTIA 2VZWA 1PWDA 1XPBA 4EUVA 3MZFA 3P7NA 4KZ4A 3H7WA 4P6BA 2EX8A 1EW0A 2WGWB 3VV4A 1GA0A 3C7UA 3CWFA 3NHQA 4YWZA 5DF8A 1PI4A 2GZAA 3HLGA 2ZQAA 1JTGA 3MQQA 3RXXA 3F1OB 3ZG9B 4E3JA 2HJ9C 3SZTA 2XRNA 3IWIA 4MMNA 2WKHA 4R4SA 1NWZA 3HL9A 3IQAA 4ETZA 3C2WA 1I2WA 3NIAA 1K4FA 5CHMA 4OOMA 3IHBA 3C30A 3F1PB 5HAIA 1M40A 2WZXA 4MCWA 3Q07A 3ZGAB 5HD5A 3UPOA 4S2PA 3T1RA 4HNBA 3TW8A 3ZYTA 2FFFB 1EWZA 4I3AA 4OQIA 4NK3A 3DTKA 3OPRA 2W3HA 2DNSA 2EX6A 3OBFA 1OT9A 4OQ0A 4JKTA 1MPLA 3TE8A 4M3KA 4S2OA 2R78A 2HV1A 2XH9A 1ACFA 1P0ZA 2ZLYA 2NUTC 2VKSA 1QMEA 4P85A 5FDSA 3BY9A 3MS6A 2Y4AA 3NECA 5F69A 4S2NA 3NBLA 4Y15A 3IF6B 1N9OA 3A3DA 5HWTA 1WYCA 2X01A 2PYRA 1ZHHB 3C4OA 4Y0UA 2C6WB 2VGLM 2OLUA 1ONHA 4HP4A 1IYPA 3N8SA 4EBPA 1SZVA 2V1ZA 5GLBA 3MXQA 4PM6A 3L9KA 2M1CA 1M6KA 3O87A 3GRJA 3B3XA 4MN6A 4L9FA 1ES5A 5EVIC 1Q2PA 3DTEA 1FR6A 4Y0TA 1S6RA 2AVXA 1FCOA 1L0DA 1DJAA 5GHYA 3BEBA 5FDHA 1UWPX 3LIDA 3NDGA 3TG9A 3AGEA 4PM5A 3R7WB 1N9BA 5E2FA
chains in the Genus database with same CATH topology
3T1SA 1SKOA 1VETB 3LEQA 1J3WA 2PRFA 3CHWP 4X25A 2JKGA 2HZ5A 2V8CA 2ZL1B 1HLUP 1FILA 1PFLA 1ACFA 1K0KA 1VEUB 3LGOA 1VETA 4FUWA 2VK3A 2E8JA 1A0KA 5FDSA 3MS6A 2ZL1A 3T1QB 5EV0A 3T1XA 3NECA 5EM1A 1CJFA 2PBDP 4FTXA 1FIKA 3MSHA 1PNEA 3U4LP 1Z09A 4ESPA 5EVEA 1Y4OA 2V8FA 4X1MA 1CF0A 1CQAA 3CPTB 1VEUA 1SZVA 1SKOB 3L9KA 1G5UA 3NULA 2BTFP 2ACGA 1YPRA 5FEFA 3DAVA 1AWIA 3D9YA 5EM0A 3UB5P 1D1JA 3T1RA 2PAVP 4QWOA 2B95A 1F2KA 3L7HA 2JKFA 3CPTA 5FEGA 1PRQA 4D60A 4X1LA 3KYEA 3T12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1S A;  1SKO A;  1VET B;  3LEQ A;  1J3W A;  2PRF A;  3CHW P;  4X25 A;  2JKG A;  2HZ5 A;  2V8C A;  2ZL1 B;  1HLU P;  1FIL A;  1PFL A;  1ACF A;  1K0K A;  1VEU B;  3LGO A;  1VET A;  4FUW A;  2VK3 A;  2E8J A;  1A0K A;  5FDS A;  3MS6 A;  2ZL1 A;  3T1Q B;  5EV0 A;  3T1X A;  3NEC A;  5EM1 A;  1CJF A;  2PBD P;  4FTX A;  1FIK A;  3MSH A;  1PNE A;  3U4L P;  1Z09 A;  4ESP A;  5EVE A;  1Y4O A;  2V8F A;  4X1M A;  1CF0 A;  1CQA A;  3CPT B;  1VEU A;  1SZV A;  1SKO B;  3L9K A;  1G5U A;  3NUL A;  2BTF P;  2ACG A;  1YPR A;  5FEF A;  3DAV A;  1AWI A;  3D9Y A;  5EM0 A;  3UB5 P;  1D1J A;  3T1R A;  2PAV P;  4QWO A;  2B95 A;  1F2K A;  3L7H A;  2JKF A;  3CPT A;  5FEG A;  1PRQ A;  4D60 A;  4X1L A;  3KYE A;  3T12 B; 
#chains in the Genus database with same CATH topology
 1DP6 A;  3E2K A;  1K6R A;  4X53 A;  5JYO A;  3TSG A;  3OZH A;  3HUN A;  3HLC A;  5K5B A;  1JTD A;  3G31 A;  3P09 A;  4NG2 A;  4KZ3 A;  3QNC A;  5GLC A;  3UB8 A;  1HD8 A;  4GHI A;  4FSF A;  2X71 A;  3C38 A;  4I3I A;  4O8G A;  2MJ6 A;  3LCE A;  3PR6 A;  1I2S A;  5HDC A;  5GL9 A;  1YMS A;  4MNR A;  4OVD A;  4LV1 A;  1W5D A;  4BBT A;  2Y55 A;  2ZL1 A;  4OLG A;  3E98 A;  5F1F A;  1YMX A;  5E2E A;  4OQG A;  4K0W A;  4CJN A;  2ZQ9 A;  3IBR A;  5U47 A;  2VV8 A;  1OJG A;  4ARZ A;  1LSV A;  3LY3 A;  4Q0I A;  4L0L A;  5HPF A;  3MZE A;  2Q0O A;  2P9V A;  2W3D A;  4ESP A;  5J3W A;  4BQM A;  3BFD A;  4HH2 A;  2XA7 S;  2KDK A;  3FV7 A;  2P74 A;  1CI8 A;  4B93 A;  3LO7 A;  4QY5 A;  5AVE A;  1K56 D;  3EEA A;  5CEB A;  4JGO A;  3T4K A;  2A2L A;  2W27 A;  1K55 C;  1KOU A;  4GDB A;  1XA1 A;  5DTS A;  2EA9 A;  3OC2 A;  5EM0 A;  2ZM0 A;  3Q1F A;  3ZG8 B;  4RVA A;  3IH8 A;  4ZTK A;  2JE5 A;  5C5K A;  5FAQ A;  3CPT A;  5FEG A;  1S4S A;  4WZ5 A;  4WZ5 C;  4FH4 A;  1K56 A;  3E0Y A;  1SKO A;  3OPP A;  3E4O A;  4IVI A;  4JF4 A;  3T50 A;  1J3W A;  2V1A A;  4PMA A;  5J4E A;  3NCK A;  2VGJ A;  4JBF A;  3LIC A;  4XT2 A;  5FI2 A;  5HPI A;  3BFG A;  4GD6 A;  1YLT A;  4KQO A;  3PBR A;  3LR5 A;  3PYP A;  1VB6 A;  5HAQ A;  1FIL A;  4QU3 A;  1K0K A;  1VEU B;  4EXO A;  4UAA A;  1LSW A;  4S2M A;  4GCZ A;  3VP3 A;  1A0K A;  3HRE A;  4HQA A;  3D72 A;  1K57 A;  3CG5 A;  2W1R A;  2D02 A;  4OH0 A;  1IYO A;  1G28 A;  3K3D A;  1ERQ A;  3VE3 A;  2Y79 A;  2W3F A;  1TDG A;  3OOV A;  1JWZ A;  4X55 A;  2Q9N A;  4EU0 A;  3BQ8 A;  4UA6 A;  3W4Q A;  4Y0O A;  2EX9 A;  4E6X A;  3O86 A;  3GMW A;  2BG1 A;  2L4R A;  3S7Q A;  4EER A;  5I5L A;  1YAX A;  3KSH A;  3LR0 A;  2V1B A;  1ZC2 A;  3QP8 A;  3DAV A;  3M2K A;  5GLD A;  4E3O A;  3BJN A;  2KOI A;  3CUE A;  3CUE C;  3DWZ A;  4OPQ A;  1MY8 A;  3L7H A;  2EXA A;  4Z9Q A;  3OPL A;  4HEF A;  1NLZ A;  3BY8 A;  1UGU A;  4GDN A;  2V2F F;  1WE4 A;  3PBT A;  3T4L A;  5A92 A;  2EWW A;  4X56 A;  3GR2 A;  5E2G A;  2BLS A;  3UME A;  5A90 A;  1TS8 A;  5DF7 A;  4I3J A;  4BD1 A;  4GS9 A;  2ZC4 B;  4WLA A;  3VOZ A;  1OTD A;  2L1M A;  2J7V A;  3ZG7 B;  4GZB A;  2UV0 E;  3LGO A;  4EEP A;  5E2H A;  3MR0 A;  3QP4 A;  3T4J A;  2JN7 A;  3ITA A;  1TEM A;  3MFD A;  3G2Y A;  3JVU A;  2JKT M;  4GD8 A;  3SS5 A;  1CJF A;  2UWX A;  1O07 A;  3IX4 A;  3S1Y A;  3MJQ A;  4E3I A;  4Y13 A;  2HF6 A;  5HSQ A;  5HD3 A;  4JLF A;  1SHV A;  4DN0 A;  4PKY A;  2I72 A;  3O88 A;  4CLC E;  5CTN A;  3RXW A;  4JXG A;  2PBY A;  3MQ0 A;  1LI9 A;  2WKI A;  1TS6 A;  4M4X A;  1TS7 A;  1YLP A;  4H6J B;  2HDU A;  4B4X A;  2YKF A;  3G4P A;  1H8M A;  1L3L A;  1K6S A;  5FAP A;  4QB8 A;  3FKV A;  5TJJ A;  2H0T A;  5TBM A;  4K08 A;  1PRQ A;  2ZJ9 A;  4R70 A;  1TD5 A;  3KYQ A;  1OJ5 A;  4KUK A;  2HGV A;  3LIE A;  4R6L A;  3U2A A;  4JGQ A;  1GHM A;  2DMW A;  3QP1 A;  4LV2 A;  4HHD A;  3G30 A;  2JKG A;  2Y2G A;  2V8C A;  4CPK A;  1DP9 A;  2Y2I A;  1YSQ A;  1V9Y A;  5EVI B;  1H5X A;  4C3Q A;  2EFU A;  1TS0 A;  1K54 C;  4UQI M;  3RJU A;  4EV4 A;  3NJA A;  3IX3 A;  2XK1 A;  1NYM A;  2XEP A;  2A3U A;  3KX0 X;  5FQK A;  4L9E A;  5F6A A;  2VGL S;  2QKP A;  3WS5 A;  2V0U A;  4JXS A;  4QJG A;  1XFN A;  2INW A;  1RP5 A;  1SCW A;  3UN7 A;  4JF5 A;  4OPR A;  2WAE A;  2XD5 A;  3IHA A;  4GW9 A;  4X68 A;  4B88 A;  4MBK A;  3VE4 A;  1XXM A;  1DJB A;  5KZH A;  1ES4 A;  5FQJ A;  4BLM A;  1LHY A;  4NET A;  2J8Y A;  3U4L P;  1BUL A;  1E25 A;  4NEE D;  1L2S A;  3VP0 A;  2ZQ7 A;  5M1A A;  2J9O A;  2OLV A;  3Q81 A;  5CGW A;  3MQO A;  5AJG A;  2O9C A;  3V3S A;  3G2Z A;  1N9N A;  2OV5 A;  1FR1 A;  4EQ1 A;  2JHE A;  4Q8I A;  1H3Q A;  1QMF A;  2O9A A;  3HLD A;  1LLB A;  3NDE A;  2ZQC A;  1T1B A;  4LRZ E;  4EEU A;  5G4Y A;  4U0X A;  4XUZ A;  4FOF A;  1IEM A;  3C8C A;  1U60 A;  3LI9 A;  3ZCZ A;  3OCL A;  3T12 B;  3T1S A;  4LCM A;  3HJI A;  1G6A A;  2E8I A;  4K0X A;  3OLO A;  3HCY A;  3A3F A;  3IH9 A;  4RX2 A;  3SH9 A;  2HPB A;  4EW7 A;  3AGD A;  1LL5 A;  3A0R A;  4ZJ2 A;  4IBX A;  4GN2 A;  2B5R A;  4L9G A;  1ZG6 A;  1X0O A;  3VP4 A;  4HES A;  1T18 A;  1KGE A;  2B18 A;  2WUQ A;  4FUW A;  1KVL A;  2ZOI A;  4PAU A;  5AQ9 A;  1HVB A;  2E8J A;  2JKR M;  1CI9 A;  2JBF A;  4HIA A;  4KZ6 A;  4DJ3 A;  4EET B;  4GB7 A;  3RFB A;  2G2W A;  2A24 A;  3A0S A;  1H8Z A;  3HLB A;  4QHC A;  3VOY A;  4KUO A;  3ZNY A;  2QYB A;  1LT0 A;  3E4Q A;  1PW8 A;  5FQM A;  5IHV A;  5M18 A;  5EE8 A;  3VSL A;  2ZD8 A;  2W1T B;  4C75 A;  1W79 A;  3NI9 A;  1L0F A;  2HDS A;  4YFM A;  2Y2L A;  3UO9 A;  4XXR A;  2J3T D;  4BBU A;  4DJ2 A;  1PZO A;  4S2N C;  3ULF A;  1HZO A;  3H82 B;  3IXB A;  4O01 A;  1GHI A;  4WZ4 A;  4HJ3 A;  4KZB A;  1P97 A;  1CEF A;  1JWV A;  1IOU A;  4GNU A;  1ES2 A;  3GEC A;  5A93 A;  1KE4 A;  3CJM A;  1XJ3 A;  4ETX A;  4KQQ A;  1H0M A;  2XF3 A;  2G2U A;  3DTI A;  3UDI A;  3N4I A;  3PTE A;  2XFS A;  5AQA A;  3T4T A;  1Y54 A;  5L8M A;  4DDS A;  1LSX A;  1GSV A;  4Y17 A;  4GJ4 A;  4N9K A;  1GSX A;  3NC8 A;  3LUQ A;  2XLN A;  3UB7 A;  1NRF A;  2PT7 A;  1HLU P;  3F1N A;  3PBN A;  4WEJ A;  4I38 A;  3EEH A;  2XRO A;  4KZ9 A;  2H10 A;  3ZQ5 A;  3UMD A;  3UY6 A;  4BMW A;  3K3C A;  4PHT A;  3A0V A;  4LEN A;  1ERM A;  5DF9 A;  4NKP A;  1MWS A;  2I9V A;  4O0P A;  3UB6 A;  3VOL A;  2V0W A;  5CX7 A;  3QP6 A;  4O7D A;  3S7P A;  3Q7V B;  1YKD A;  3IS2 B;  4KG5 A;  4OQH A;  3UNW A;  3BLM A;  5TGF A;  4FTX A;  1LL8 A;  2ZM8 A;  3NOT C;  2WKR A;  4UHU A;  5AQ7 A;  2WGV A;  1FSW A;  3QNB A;  5JYP A;  3BLS A;  1PWC A;  1BTL A;  1SDN A;  1UWN X;  1LL9 A;  2WGW A;  2LB5 A;  1IYS A;  4WF0 A;  5FSR A;  2Y59 A;  3OCN A;  2ACG A;  4DRT A;  2D01 A;  3RTY A;  1DP8 A;  2Y2O A;  2OSU A;  2OAP 1;  1KGG A;  3F1O A;  5HDS A;  4OLD A;  4CLC B;  5EVL A;  5L10 A;  3IXG A;  3VP2 A;  3UE3 A;  1F2K A;  2OOL A;  3CI6 A;  1GA9 A;  1ESU A;  3KYE A;  1VQQ A;  4R3J A;  3FKW A;  2Q9M A;  1N4O A;  1VET B;  2WYX A;  3CZD A;  3F1P A;  3ICY A;  4Q0J A;  1NLY A;  2R9X A;  3AGF A;  4XUX A;  3KO6 A;  4IUH A;  3C4P A;  3JYI A;  3MXS A;  1OPX A;  3P01 A;  4KZ8 A;  4PM9 A;  4MEZ A;  2WK0 A;  3G6O A;  3G34 A;  4EQI A;  4N1X A;  3MXR A;  1V9Z A;  2FZ0 A;  3CLO A;  3BFF A;  4FH2 A;  4DDY A;  2Y2N A;  4Y7P A;  3UE0 A;  4DXC A;  2VK3 A;  3N6I A;  1C3B A;  2JKR I;  4MDZ A;  2XDM A;  3LEZ A;  4WYY A;  4EES A;  1S67 L;  1FCM A;  3NOP C;  5EV0 A;  2IA2 A;  2R9W A;  1K4E A;  4R4R A;  4BD0 A;  2ZC5 B;  2VV7 A;  1WYB A;  4BWI A;  5CTM A;  5HZH A;  4F3L B;  1Z09 A;  2L0W A;  4X1M A;  1N9L A;  2Y2H A;  1TVF A;  1BLS A;  2J80 A;  5G4Z A;  1K57 C;  4DE1 A;  3KYZ A;  5HWW A;  3VSK A;  2PU2 A;  2Z2L B;  2WKQ A;  2XQZ A;  5FEF A;  1WA9 A;  1MKM A;  3IF6 A;  3MMH A;  5BOH A;  3LFV A;  5DKL A;  3BM6 A;  5FI7 A;  4LV0 A;  1D1J A;  4RA7 A;  1YSP A;  4LRX C;  4UQI S;  4II7 A;  3SW1 A;  5DTK A;  3EQU A;  3H7W B;  4LRY C;  2PR5 A;  1S4R A;  4MN5 A;  2P08 A;  3UPP A;  2M7U A;  1BYW A;  1P9W A;  2XGN A;  4JXV A;  3UDF A;  3P98 A;  4I5S A;  3V39 A;  2WAD A;  3ZDJ A;  2X02 A;  5DJT A;  1Z6F A;  4IVK A;  4OPZ A;  3LY4 A;  4KQD A;  5IT5 A;  3VFH A;  1YLY A;  2Y2P A;  5L09 A;  1FSY A;  2XR0 A;  1CK3 A;  5HL6 A;  4JGR A;  1S66 L;  1KE3 A;  3HLW A;  3R7W A;  1MXO A;  3MKF A;  3IF5 A;  1VM1 A;  4N92 A;  3SH8 A;  5DVA A;  3IXH A;  4ID4 A;  5KIZ A;  4R0Q A;  2WKE A;  4WEL A;  1OT6 A;  1F98 A;  3FPV A;  3E2L A;  1DY6 A;  1FIK A;  1PNE A;  3EWK A;  4UEY A;  3G35 A;  1SDE A;  3SOI A;  3G32 A;  3WS0 A;  4YIN A;  5L2F A;  4WL9 A;  1NJ4 A;  2LB9 A;  2ZC3 B;  1S1Z A;  3WWX A;  2VA0 A;  3V5M A;  2FFY A;  4QPR A;  1BT5 A;  2WGI A;  5HAP A;  1T19 A;  4R3B A;  3D4F A;  1AWI A;  3CMZ A;  2PD7 A;  1NXY A;  3NOU C;  2B95 A;  5HDD A;  5GHZ A;  4HI4 A;  3LIB A;  4R1G A;  5DJU A;  3MZD A;  3FC7 A;  3HVF A;  1YQS A;  3LEQ A;  4HJ4 A;  4WMC A;  4EUZ A;  3IBJ A;  3CIT A;  4G3W A;  5EOE A;  1XA7 A;  2VEA A;  1T1C A;  2Y2J A;  3SS4 A;  4HBT A;  5FQ9 A;  1ZKJ A;  1HTZ A;  2Y2Q A;  4EWF A;  1PFL A;  1ALQ A;  2FH5 A;  4P6Z M;  4Y2F A;  2GX5 A;  4K91 A;  1E4D A;  1PYY A;  4NXG A;  2QMI A;  4UA7 A;  3PHY A;  1BLP A;  3UPN A;  1ESI A;  4A5R A;  2XFT A;  2Z6D A;  1XKZ A;  4S2J A;  4GKU A;  3PAE A;  5E43 A;  3MBZ A;  4NXF A;  3JVV A;  4RX3 A;  1MWU A;  1PIO A;  3DBA A;  4B4Z A;  2VLG A;  3S7N A;  2P04 A;  2ZMF A;  4RYE A;  1MC0 A;  3ZVT A;  1OTB A;  3TRC A;  3Q82 A;  5HX9 A;  1VEU A;  2QPN A;  5EEC A;  5DTT A;  5DFY A;  4LFU A;  4D2O A;  3HLF A;  3IWQ A;  4OP5 A;  3C5A A;  1YLZ A;  1I5Q A;  1RCJ A;  2JC7 A;  1IYQ A;  2RL3 A;  2QHK A;  4WUJ A;  3LIA A;  2ZOH A;  5CXW A;  2GDN A;  3UB5 P;  4GHI B;  4WEK A;  3HLE A;  2EX2 A;  4MBH A;  2JCH A;  1ODV A;  4DE3 A;  4IHQ A;  4HH3 A;  2QJ5 A;  1BUE A;  3PXP A;  3A3I A;  2K7S A;  1GSW A;  2HZ5 A;  3ZVW A;  2ZL1 B;  4P0M A;  4Y3I A;  3ITB A;  2VJW A;  1CEG A;  1K25 A;  3MKE A;  4KZA A;  5GHX A;  4ARZ B;  2P9V B;  5AVF A;  2HJE A;  5TR7 A;  4DMZ A;  5AQB A;  2P7J A;  3R4K A;  2PU4 A;  3N7W A;  1O7E A;  5CHU A;  1PWG A;  1GHP A;  3DW0 A;  4WBG A;  5HWV A;  4S2L A;  5A8B A;  2H28 A;  4PM7 A;  5G18 A;  2W3E A;  3WS2 A;  5M19 A;  2EWV A;  1S0W A;  1TF1 A;  1TDL A;  3V50 A;  2NUP C;  5EVE A;  3LI8 A;  3CAX A;  3V67 A;  1F9I A;  4KEN B;  3CPT B;  3MF0 A;  3O3V A;  4ME4 A;  4KZ5 A;  1IKG A;  1NY0 A;  1SKO B;  1G5U A;  3NUL A;  3VMA A;  3C7V A;  2BTF P;  3WS1 A;  2JKT I;  4JXW A;  1F5M A;  3ISG A;  3BFE A;  4XT2 B;  3FWL A;  1STZ A;  1Q2Q A;  4G3K A;  3D9Y A;  5KMW A;  3M6B A;  3KSF A;  3VFF A;  2VGK A;  4YOF A;  3FYZ A;  4MLL A;  3UE1 A;  1H8Y A;  3HUO A;  4D60 A;  5KSC A;  2PD8 A;  5HAR A;  4HJ6 A;  3Q7Z A;  4FCF A;  4IJG A;  5CGX A;  5F82 A;  4H6J A;  1G68 A;  1D7E A;  2J9P A;  3WRZ A;  5LBR A;  1KVM A;  1FQG A;  2ZBB A;  1FCN A;  5IS1 A;  4S2K A;  2Y91 A;  4E3K A;  4E6W A;  3D3O A;  2CC1 A;  5EVI D;  3A3J A;  2J3T C;  3SH7 A;  4OPY A;  4EBN A;  1PW1 A;  4BL2 A;  2Z6C A;  5DFX A;  4BJP A;  1K38 A;  3LR4 A;  4PKY G;  3DWK A;  1YLJ A;  2V20 A;  1XGI A;  1KDW A;  4B9O A;  5CGS A;  2EFX A;  1OME A;  5EVI A;  2WKP A;  2PBD P;  3K2N A;  1L0G A;  3HJK A;  5EUA A;  4X69 A;  1XJ2 A;  4ZBE A;  1D06 A;  3GDI A;  3JPU A;  2DCF A;  5FAS A;  2OWH A;  4YNR A;  1IFQ A;  4U0T A;  1ERO A;  3W2Z A;  5KSH A;  3EOI A;  3ZHH A;  5I94 A;  3B42 A;  2WZZ A;  3FPW A;  3BQA A;  4NXE A;  3S7O A;  5FL3 A;  4GS9 B;  5DKK A;  2C5W B;  2W3G A;  2ZMV A;  3TJZ C;  3BWL A;  4Z1W A;  4GOG A;  4R38 A;  4X1L A;  1ZG4 A;  4BEN A;  4IED A;  5F83 A;  1BZA A;  4JPM A;  4I39 A;  5CER A;  4DE2 A;  3A3E A;  2OAQ 1;  2OWJ A;  1MKI A;  2Y2K A;  2ZQ8 A;  2PRF A;  3QHY A;  5CEC A;  5FI6 A;  4ZDX A;  3V3R A;  2ZC7 A;  1W8Q A;  4F94 A;  2KX6 A;  4E04 A;  1XFQ A;  4KZ7 A;  2Y2M A;  5CED A;  4OKP A;  4H8R A;  3PAG A;  4E3N A;  4LCL A;  2VX8 A;  1XGJ A;  3T4O A;  3IWO A;  1AXB A;  1S1Y A;  1ES3 A;  1G6O A;  4RQ9 A;  2PHY A;  3O5Y A;  2XSS A;  2HDQ A;  1W8Y A;  5L07 A;  2GNX A;  3RH8 B;  4BBV A;  4LLO B;  1Y28 A;  4C6Y A;  4DXB A;  1K55 A;  4LPZ A;  1BSG A;  3H9W A;  1DRM A;  3EGX C;  5GLA A;  3PBO A;  4DE0 A;  3M2J A;  5TBM B;  2QZ6 A;  4PPR A;  4ZJ3 A;  5CRF A;  1VHM A;  3MFX A;  1BLH A;  2YKH A;  3M6H A;  3BYD A;  2O99 A;  5FQQ A;  3ZNT A;  1YPR A;  4ZAM A;  1W63 M;  1OTE A;  2HP6 A;  3I7J A;  4E3L A;  1SKF A;  4LV3 A;  2O9B A;  2RCX A;  3DTM A;  2JKF A;  2M7V A;  5D3O A;  1IKI A;  4P6Z S;  2W1T A;  4BL3 A;  2V9A A;  3GSG A;  3WS4 A;  2H5S A;  1T1A A;  2K2N A;  2IWC A;  3CHW P;  3H82 A;  2ZM2 A;  3IF6 C;  3ZG5 A;  1J9M A;  4OOY A;  5MC7 A;  3QP5 A;  1E3U D;  2GJ3 A;  3KSG A;  5FAT A;  1PZP A;  1NRJ A;  3W8K A;  1OTA A;  2DRW A;  2KLI A;  5EFW A;  4N1H A;  2VV6 A;  4QD4 A;  1PI5 A;  4GLQ A;  3HBR A;  2PDR A;  4EBL A;  1DJC A;  3IX8 A;  1NZU A;  2W0N A;  1W63 Q;  2J3W A;  3BFC A;  5F68 A;  3T1Q B;  1XP4 A;  3T1X A;  1E3U A;  1MZU A;  3E4P A;  5EM1 A;  4KG6 A;  4FD8 A;  3PBS A;  5EOO A;  2WAF A;  3QP2 A;  3MSH A;  1JNU A;  4HY8 A;  2K31 A;  3OPH A;  2XD1 A;  5HFO A;  3B47 A;  2IWB A;  1Y4O A;  2V8F A;  5A91 A;  2PR6 A;  1CQA A;  1BLC A;  3LYX A;  2QJ7 A;  4Y5F A;  4PM8 A;  2PYP A;  4OOL A;  1XJ4 A;  4KQR A;  3S4X A;  2G7U A;  4ZRR A;  3T4S A;  1RGY A;  3B33 A;  4IBR A;  2ZC6 B;  3TOI A;  2A49 A;  1MBL A;  5FQI A;  5EPH A;  3Q7V A;  3IS2 A;  4Q0H A;  4AFI A;  3UDX A;  1XJ6 A;  1YM1 A;  1LI0 A;  1MWR A;  5J8X A;  4CQH A;  4CLC D;  4QWO A;  3W4O A;  2XA7 M;  2CMN A;  4IUK A;  1L0E A;  3LR3 A;  3N8L A;  1KGF A;  4R3A A;  1NZO A;  1P9R A;  2Z2M B;  4NXB A;  1NYY A;  5F5Y A;  4OON A;  2HDR A;  4WN5 A;  3IT9 A;  4WMC D;  1MWT A;  2O0Y A;  2Y8H A;  1IEL A;  2A24 B;  5F1G A;  4CLC A;  4CLC C;  3GVB A;  1JVJ A;  4JGP A;  3FG8 A;  4E3M A;  4U3T A;  4OP8 A;  1KDS A;  5FAO A;  4X6T A;  1XX2 A;  4G3V A;  4DF6 A;  3GQZ A;  1VET A;  4ZJ1 A;  1GCE A;  1ZTU A;  4N9L A;  4WM9 A;  3UB9 A;  5J7E A;  4HBU A;  2ZQD A;  3FZC A;  3ZFZ A;  1RGZ A;  3BEC A;  3ZG0 A;  4UA9 A;  3GV9 A;  3PBQ A;  4JF6 A;  3KSI A;  2EXB A;  3LIF A;  5HL1 A;  1CF0 A;  2HP9 A;  3N8R A;  1ONG A;  1JWP A;  1W7F A;  4KG2 A;  1KE0 A;  1YLW A;  3BW6 A;  3T4Q A;  3UE6 A;  4P87 A;  3NY4 A;  4LGW A;  3IXD A;  5FA7 A;  3S22 A;  2HP5 A;  2BAS A;  5CHJ A;  5HW3 A;  1EI5 A;  2H0Y A;  5IU1 A;  4MBF A;  3F1N B;  4F3L A;  3BRM A;  2PAV P;  1YT4 A;  4HOI A;  2ZMA A;  4DKI A;  1K54 A;  2B02 A;  4HP9 A;  3HUM A;  3EQV A;  3VP1 A;  5TFQ A;  3SS3 A;  4QY6 A;  4S2I A;  4R23 A;  3GTC A;  4X25 A;  1FOF A;  4MN7 A;  3W4P A;  2IWD A;  2QWS A;  3EGD C;  3WRT A;  1OTI A;  2VZW A;  1PWD A;  1XPB A;  4EUV A;  3MZF A;  3P7N A;  4KZ4 A;  3H7W A;  4P6B A;  2EX8 A;  1EW0 A;  2WGW B;  3VV4 A;  1GA0 A;  3C7U A;  3CWF A;  3NHQ A;  4YWZ A;  5DF8 A;  1PI4 A;  2GZA A;  3HLG A;  2ZQA A;  1JTG A;  3MQQ A;  3RXX A;  3F1O B;  3ZG9 B;  4E3J A;  2HJ9 C;  3SZT A;  2XRN A;  3IWI A;  4MMN A;  2WKH A;  4R4S A;  1NWZ A;  3HL9 A;  3IQA A;  4ETZ A;  3C2W A;  1I2W A;  3NIA A;  1K4F A;  5CHM A;  4OOM A;  3IHB A;  3C30 A;  3F1P B;  5HAI A;  1M40 A;  2WZX A;  4MCW A;  3Q07 A;  3ZGA B;  5HD5 A;  3UPO A;  4S2P A;  3T1R A;  4HNB A;  3TW8 A;  3ZYT A;  2FFF B;  1EWZ A;  4I3A A;  4OQI A;  4NK3 A;  3DTK A;  3OPR A;  2W3H A;  2DNS A;  2EX6 A;  3OBF A;  1OT9 A;  4OQ0 A;  4JKT A;  1MPL A;  3TE8 A;  4M3K A;  4S2O A;  2R78 A;  2HV1 A;  2XH9 A;  1ACF A;  1P0Z A;  2ZLY A;  2NUT C;  2VKS A;  1QME A;  4P85 A;  5FDS A;  3BY9 A;  3MS6 A;  2Y4A A;  3NEC A;  5F69 A;  4S2N A;  3NBL A;  4Y15 A;  3IF6 B;  1N9O A;  3A3D A;  5HWT A;  1WYC A;  2X01 A;  2PYR A;  1ZHH B;  3C4O A;  4Y0U A;  2C6W B;  2VGL M;  2OLU A;  1ONH A;  4HP4 A;  1IYP A;  3N8S A;  4EBP A;  1SZV A;  2V1Z A;  5GLB A;  3MXQ A;  4PM6 A;  3L9K A;  2M1C A;  1M6K A;  3O87 A;  3GRJ A;  3B3X A;  4MN6 A;  4L9F A;  1ES5 A;  5EVI C;  1Q2P A;  3DTE A;  1FR6 A;  4Y0T A;  1S6R A;  2AVX A;  1FCO A;  1L0D A;  1DJA A;  5GHY A;  3BEB A;  5FDH A;  1UWP X;  3LID A;  3NDG A;  3TG9 A;  3AGE A;  4PM5 A;  3R7W B;  1N9B A;  5E2F A; 
#chains in the Genus database with same CATH homology
 3T1S A;  1SKO A;  1VET B;  3LEQ A;  1J3W A;  2PRF A;  3CHW P;  4X25 A;  2JKG A;  2HZ5 A;  2V8C A;  2ZL1 B;  1HLU P;  1FIL A;  1PFL A;  1ACF A;  1K0K A;  1VEU B;  3LGO A;  1VET A;  4FUW A;  2VK3 A;  2E8J A;  1A0K A;  5FDS A;  3MS6 A;  2ZL1 A;  3T1Q B;  5EV0 A;  3T1X A;  3NEC A;  5EM1 A;  1CJF A;  2PBD P;  4FTX A;  1FIK A;  3MSH A;  1PNE A;  3U4L P;  1Z09 A;  4ESP A;  5EVE A;  1Y4O A;  2V8F A;  4X1M A;  1CF0 A;  1CQA A;  3CPT B;  1VEU A;  1SZV A;  1SKO B;  3L9K A;  1G5U A;  3NUL A;  2BTF P;  2ACG A;  1YPR A;  5FEF A;  3DAV A;  1AWI A;  3D9Y A;  5EM0 A;  3UB5 P;  1D1J A;  3T1R A;  2PAV P;  4QWO A;  2B95 A;  1F2K A;  3L7H A;  2JKF A;  3CPT A;  5FEG A;  1PRQ A;  4D60 A;  4X1L A;  3KYE A;  3T12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...