2V8FA

Mouse profilin iia in complex with a double repeat from the fh1 domain of mdia1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
138
Chain Sequence
AGWQSYVDNLMCDGCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords PROFILIN-2
total genus 44
structure length 138
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2v8fA00
1FIKA 3DAVA 2E8JA 3LGOA 4X1MA 3T12B 1SZVA 1Y4OA 2VK3A 2ZL1A 3T1XA 4FUWA 4FTXA 4X1LA 5FDSA 2BTFP 1F2KA 1D1JA 1PFLA 2PAVP 5EVEA 1PRQA 3T1QB 1VEUA 2JKFA 5EM1A 3T1RA 1ACFA 3CPTB 2ACGA 3KYEA 3CPTA 3MS6A 3T1SA 1HLUP 1A0KA 4X25A 3L7HA 1CQAA 1FILA 2PBDP 4QWOA 1VEUB 5EM0A 2PRFA 2ZL1B 3UB5P 1SKOA 1SKOB 3NECA 1G5UA 2V8CA 3L9KA 5EV0A 4D60A 3CHWP 1J3WA 1Z09A 1K0KA 2B95A 2JKGA 5FEFA 1AWIA 1VETB 1PNEA 1VETA 5FEGA 1CJFA 3LEQA 3MSHA 3U4LP 2V8FA 4ESPA 2HZ5A 1YPRA 3NULA 1CF0A 3D9YA
chains in the Genus database with same CATH superfamily
1OPXA 1Y4OA 4O7DA 5G4YA 3Q7VB 4Q0IA 2PU4A 4ZJ3A 4Y2FA 5KMWA 1NYMA 2HF6A 4GHIA 2KDKA 1BTLA 5CXWA 4R3AA 1DJAA 2HGVA 4EEPA 4S2LA 3LFVA 3HLFA 3MSHA 2Y91A 4KQQA 1AXBA 3LGOA 5A93A 3G2YA 1ZKJA 4H6JB 3PBTA 1MPLA 1ODVA 2ZBBA 4RA7A 5GHXA 4CQHA 3UB6A 4JBFA 4KZ8A 2ZQCA 3NJAA 3N4IA 1U60A 1M6KA 2FZ0A 5IHVA 4HBUA 5FAOA 1J9MA 1FSWA 5HL6A 3T1XA 2XH9A 1ESUA 4WYYA 2HJ9C 4X1LA 3UDXA 1MKMA 3S7NA 4P87A 5G18A 3Q7ZA 3WRTA 4Y7PA 5FI7A 1HTZA 1NRJA 1W5DA 1LT0A 4MBKA 4X69A 1FR6A 4P6ZM 2XA7M 3SS5A 1T19A 1PIOA 5FQ9A 4JF5A 5F82A 2Z2MB 4Y5FA 3T1SA 4R0QA 3G4PA 4BBTA 3G30A 4HBTA 2WGVA 4QY6A 2VA0A 2Y2KA 1MBLA 1VETA 4S2NA 3H82A 1PI5A 3JPUA 4S2IA 4K08A 5EPHA 4HP9A 5AQ9A 3NIAA 1W8YA 4ZRRA 5CEDA 3QNCA 3KO6A 3WRZA 1OJ5A 3CUEA 4OPZA 4O0PA 1GSWA 3PAEA 1KGEA 2OAP1 2JN7A 5LBRA 1D7EA 4HHDA 3T1RA 5A8BA 1NWZA 4PAUA 1UWPX 2ZC5B 3PHYA 1H8ZA 2GZAA 1FOFA 3CITA 3E4PA 2JKTM 5D3OA 3OOVA 3TRCA 1STZA 3E2LA 3T1QB 4ZDXA 1HLUP 2PBYA 1YSQA 4KG5A 3SS4A 1OTEA 5GLDA 3BRMA 4R6LA 1BYWA 3ZGAB 3C4PA 3IX8A 3OC2A 4OOMA 3R4KA 2IA2A 3F1NB 3E0YA 3QP5A 3KYEA 1DJBA 4X25A 1WYCA 5F68A 3A3DA 4RVAA 3SZTA 1KDWA 2EX9A 2ZC3B 5TJJA 2WKRA 2ZOHA 5AQBA 4WELA 5HSQA 3MKEA 4C75A 4GD6A 4FTXA 3P01A 4Q0JA 1H0MA 4GB7A 2WZXA 3RTYA 3ICYA 4EESA 4JF4A 4Y0OA 1TDGA 1KE3A 2PDRA 3MJQA 4OONA 1BLSA 5EOEA 2Y55A 3IXDA 4UA9A 2XD5A 1I2SA 2Y2QA 2GJ3A 3IWQA 5F6AA 5GL9A 3B47A 4HJ6A 2BG1A 1D1JA 1IOUA 1NZUA 5C5KA 1L0DA 5M19A 3D72A 1PZOA 1ONHA 3WS2A 3BYDA 2PD8A 4KQOA 3VV4A 3B3XA 2XRNA 3VE4A 1VB6A 1PNEA 1LL5A 4JXWA 4LRXC 3T4OA 2XK1A 3BWLA 4E3IA 3HCYA 5K5BA 3MFXA 3MF0A 4A5RA 3ZG8B 3CPTA 5DKKA 4I3IA 5TR7A 2G2WA 4EQIA 3TW8A 4CLCB 4GKUA 4R23A 1C3BA 3CHWP 2PU2A 3LIDA 1K4FA 3WS0A 4DDYA 4I39A 1FCOA 3G2ZA 3UMEA 5E2GA 4M4XA 4OPYA 3UPPA 2INWA 4UQIM 3RFBA 1KGFA 1TS0A 3OZHA 1OT6A 4I3JA 4KZ9A 2QKPA 5KSHA 5L8MA 1L0FA 1ES3A 1F98A 3CLOA 4CPKA 2QJ5A 3CG5A 1ERMA 3A3IA 2H5SA 2J80A 5FASA 2ZC4B 5TBMB 4PKYG 5DF9A 2DCFA 4OQIA 2BTFP 3HLCA 2VJWA 4WMCD 2WKIA 1GA9A 3CPTB 4LGWA 2I72A 4I3AA 4IVKA 1IKGA 5GHZA 2JCHA 2V8CA 4KENB 1SKFA 5GLBA 1T18A 3PR6A 2A3UA 3GECA 1KOUA 2EX2A 1JTDA 3SOIA 4ETZA 5FQQA 5FAPA 4RQ9A 1Q2PA 3U2AA 3E2KA 3IBRA 1S4SA 3UB8A 1VEUB 4AFIA 2W1TA 2M7VA 2OV5A 2EXBA 2XQZA 1FR1A 4WM9A 1J3WA 4B88A 1PW1A 2J8YA 3O5YA 3V50A 2PYPA 1K57A 2W27A 3R7WB 4KZ3A 3LI8A 3O3VA 3T4KA 4IHQA 5IU1A 1LI9A 3T4TA 4X6TA 2BASA 3BJNA 3LEQA 3BM6A 4MMNA 2VV8A 3FC7A 3UE6A 5EVIA 1SZVA 4UAAA 4CLCA 2V0WA 2V2FF 2ZM8A 4WF0A 5HX9A 3VMAA 3LO7A 3I7JA 4QPRA 1PW8A 1K54C 2H0YA 4CLCD 4PPRA 1YM1A 1JTGA 3U4LP 4LCMA 1XPBA 5HL1A 4PM8A 5FQJA 3MBZA 4PHTA 3HLBA 1XJ6A 4GN2A 1ZHHB 1YAXA 3A0RA 1K55C 2WYXA 5HDSA 1OTAA 2UV0E 3MR0A 1YLTA 1NLYA 2PT7A 3C8CA 4IUHA 4IJGA 2E8IA 2QYBA 2ZMAA 3ULFA 4BBUA 4EUZA 2ZL1A 1PFLA 3IX4A 3UPOA 1JNUA 1O07A 1GHPA 1H3QA 4S2KA 3BFFA 2Q9MA 4EERA 4Q0HA 3AGDA 3QP1A 1D06A 3G35A 2J9PA 1WYBA 3VE3A 2HPBA 2YKFA 1MWSA 1GCEA 4CLCE 2PHYA 3HVFA 4PKYA 4LV0A 2GX5A 1IEMA 3BECA 1NJ4A 1K56A 3RH8B 3DWZA 2P9VB 3IX3A 2X71A 5CTNA 2WGWB 2CC1A 3SH9A 2Y79A 4DF6A 4EBLA 2Z6CA 4WBGA 1BSGA 2C5WB 3OPRA 3IXHA 1YLWA 2ZD8A 4NEED 2ZC7A 3PXPA 5FI6A 5AVFA 3T50A 1L3LA 3ZNTA 2XA7S 3G34A 3EGXC 3ZG7B 2PR5A 5CERA 5E43A 1UGUA 1PWCA 2O9CA 1BLHA 1XGIA 4DJ3A 1IELA 4OQGA 4DJ2A 4PM9A 3MQ0A 1EW0A 2ZOIA 4S2OA 1E4DA 4E3JA 4LRZE 1GSVA 3IQAA 1XFQA 3GRJA 3DTMA 2HDSA 4P85A 1YLPA 3VP0A 2JKFA 2A49A 5EFWA 3CZDA 1OTDA 4OQHA 4E3NA 3LIBA 3KYZA 3NOPC 1SDNA 3E4OA 2P7JA 4F94A 2CMNA 3VP2A 4IBRA 4FUWA 2WAFA 2WGWA 4FOFA 2HDQA 3G31A 4EUVA 2JC7A 4JLFA 1QMEA 4KZ4A 3M2KA 1PZPA 1HD8A 3B42A 3PBOA 2IWCA 1DY6A 4WEJA 1JWZA 5FQIA 1P0ZA 2GNXA 1P9WA 4RYEA 3H82B 2ZM0A 4GD8A 1S67L 4EW7A 2JBFA 4OOYA 1IFQA 1XGJA 1YT4A 2W0NA 3OCNA 3NOTC 1BLCA 3G6OA 2V8FA 4CJNA 5GLCA 5CTMA 2D01A 2O9BA 1OTIA 2W3GA 1ACFA 3IF6B 1TDLA 2B5RA 1P9RA 2B02A 5F1FA 4GDNA 4JPMA 4WL9A 1PI4A 2XLNA 2R9XA 3K3DA 4BQMA 4WN5A 4BMWA 3HUNA 1G6AA 4BENA 3ZDJA 3FG8A 3VOZA 3BY8A 2HV1A 2QZ6A 3ZG5A 4F3LA 2VX8A 1F2KA 1Y28A 4MEZA 3WS1A 2QMIA 5CGWA 4XT2A 4IVIA 3OCLA 1CEFA 3LIEA 3JYIA 2ZQ7A 2H10A 4HNBA 2VGJA 5HD3A 2HZ5A 4FCFA 1G68A 3EQVA 3EOIA 3IF5A 2LB5A 1WE4A 4B9OA 4CLCC 1MZUA 3IF6A 2WGIA 4JXVA 5EM0A 3T4QA 3MQQA 2HJEA 3V3SA 4JXGA 3AGEA 3A0SA 4DKIA 4YOFA 1PWDA 3C7VA 1XJ3A 2VKSA 4KUKA 3OLOA 4XXRA 4DMZA 3A0VA 1DJCA 3IH9A 4BLMA 4DE2A 4PM6A 4E6XA 3HLEA 1LSVA 3VSLA 1K57C 1O7EA 4JGOA 2EWWA 1RP5A 3V39A 3W8KA 2OAQ1 2V20A 1M40A 5GLAA 1TS6A 1AWIA 1CJFA 1IYQA 4EQ1A 3VFHA 3N8LA 3C30A 1YMSA 1JVJA 3O87A 1K56D 1ALQA 1DP9A 1NXYA 2PRFA 3OPHA 3BQ8A 4B4XA 3L9KA 5DF8A 1TVFA 4Y0UA 1FQGA 1XFNA 3HLWA 3MXSA 2WKHA 2Y2MA 4HP4A 3R7WA 3GVBA 2Y2OA 5HAPA 3MS6A 4Z9QA 4E3KA 5CHUA 3L7HA 1EROA 1ES4A 4PM5A 1WA9A 3IWOA 4GHIB 2W3HA 5EV0A 1SDEA 5J4EA 2Y59A 2PR6A 3HREA 3ZG0A 3W2ZA 2P08A 3NHQA 3OPPA 2G2UA 3Q81A 1K54A 4FH2A 4H6JA 2WZZA 1NRFA 4QWOA 2KLIA 2ZQAA 4KZ5A 3WWXA 3FYZA 1G5UA 2FFYA 1VETB 1PWGA 5E2HA 3E4QA 3VOLA 1BULA 3Q7VA 3QP4A 1XP4A 1GA0A 3IHAA 2Q0OA 5DJUA 3UO9A 3D4FA 1FCMA 2WADA 5FA7A 2NUPC 1KGGA 1SKOB 4MDZA 4DXCA 3V67A 1W8QA 1Z09A 1W63M 5FQKA 2WK0A 2M1CA 3EWKA 3CMZA 3FKVA 2GDNA 3VFFA 4HH3A 1UWNX 5HDDA 2V0UA 1LSWA 3MQOA 5HD5A 3PAGA 1MC0A 2ZMVA 4ZTKA 1CQAA 2Y4AA 3UPNA 3F1PB 2EFUA 4R3JA 3ZNYA 3HLGA 4OPRA 1YLZA 2H0TA 5DVAA 1E3UA 5HAQA 1H8YA 3MKFA 1XJ4A 5F1GA 1L0GA 5F69A 1V9YA 3P98A 3VP3A 4UQIS 2OLVA 4II7A 1K4EA 2G7UA 2XEPA 3ZVWA 2W3DA 3NCKA 1ZTUA 5FEGA 3D3OA 4X55A 5DTTA 2JHEA 5BOHA 3VSKA 3GSGA 3ITAA 5JYOA 2W3EA 1T1AA 2MJ6A 4JGQA 4K0XA 3IS2B 3C7UA 1BLPA 3M6BA 1IYOA 1GHIA 2A24B 5EVIB 4IBXA 3KSIA 2JKGA 1Q2QA 1S1YA 3ISGA 2XGNA 3HL9A 3TOIA 5F83A 1Y54A 2ZC6B 4UA6A 4OPQA 1I5QA 4LRYC 1RGYA 5A92A 2W1TB 5DTKA 2VGLM 2J3WA 1XX2A 1CI9A 1N9NA 3MZFA 4O8GA 4K91A 4E6WA 5FDSA 3DBAA 4Q8IA 1YLYA 1NY0A 5HDCA 1YLJA 4QJGA 2Y2PA 3LY3A 5HWVA 1S6RA 3FKWA 3F1PA 4Y15A 4ME4A 5DF7A 1IYSA 4PM7A 5J7EA 4HQAA 3TJZC 1N9BA 3V3RA 3H7WB 2E8JA 4GCZA 5CHMA 4BJPA 2OSUA 4JGRA 2WKEA 4H8RA 5AJGA 3W4OA 1ES5A 2XF3A 1XJ2A 3IWIA 1S1ZA 1BT5A 2ZL1B 5L2FA 2VV6A 3F1OA 5CGSA 3UE1A 4F3LB 4OLGA 1YMXA 4KZ7A 4Y3IA 3SW1A 4NK3A 5DFXA 4HH2A 2L4RA 5A90A 1K6RA 4GJ4A 1ERQA 4EBNA 3LICA 1TS7A 3PBSA 2Y2GA 3FPWA 4S2MA 3S4XA 1KE4A 3GTCA 4KZAA 3IF6C 3MFDA 4ZJ1A 5TBMA 2JKRM 2P9VA 4XUZA 5DFYA 5FQMA 1IYPA 4XUXA 2RCXA 3S7OA 2HP6A 3O86A 3H7WA 1CI8A 4P6ZS 2DNSA 5HWTA 4OH0A 3EQUA 2V1ZA 4NG2A 2EX6A 4ESPA 4GS9A 3UB9A 3WS5A 1CEGA 5EECA 4L0LA 4KQDA 3AGFA 2V1BA 2ZMFA 4HEFA 5EOOA 4E3LA 1QMFA 3GR2A 1OMEA 3CI6A 3MXQA 2EWVA 5JYPA 1G6OA 5CECA 3IHBA 2PD7A 5HW3A 2IWDA 2J7VA 2WKPA 5L07A 4MBHA 1TD5A 3N8SA 4P0MA 4QB8A 1VM1A 3IT9A 4IEDA 1GSXA 1SKOA 3NDEA 1NLZA 3NDGA 4OP8A 3V5MA 2HDRA 2ZJ9A 5TGFA 4D60A 3LR0A 5CX7A 1E3UD 3E98A 4BWIA 4X1MA 1L0EA 1ZG6A 3PYPA 5FATA 5HPIA 1VEUA 5EUAA 3IBJA 3NC8A 2Y2IA 2KX6A 2EFXA 5CHJA 1RGZA 5HZHA 1P97A 1H5XA 3M2JA 4GS9B 3MMHA 3FV7A 2QJ7A 3T4LA 3Q1FA 4E04A 2IWBA 2K31A 4DN0A 3UE0A 1GHMA 2FH5A 4WLAA 4WMCA 5E2EA 1HVBA 3DTKA 4EU0A 3FZCA 4EV4A 3KSHA 3C38A 1F5MA 4JKTA 4MN6A 1PYYA 1YKDA 1TS8A 3WS4A 2QWSA 4MN5A 5AQAA 3LIFA 2Y2JA 1W79A 1YPRA 3UE3A 1EWZA 3IH8A 4GZBA 4EBPA 1BZAA 5I94A 2P74A 2O99A 1A0KA 2Y2HA 3JVVA 3NI9A 5EVLA 4NXEA 3VOYA 4ZBEA 4OLDA 3JVUA 2JKTI 4S2JA 3O88A 2VK3A 4MBFA 2EXAA 2XD1A 3LUQA 3QHYA 4BL2A 1YQSA 4DDSA 2RL3A 2BLSA 1BUEA 4RX2A 4U0TA 3A3FA 2O0YA 4I5SA 3P7NA 2J9OA 1XKZA 1MXOA 1OT9A 1V9ZA 5U47A 4B93A 4LV2A 2KOIA 4B4ZA 2QHKA 3PBNA 3T4JA 2Q9NA 4Y13A 4Y17A 4GOGA 3TSGA 2W3FA 1XXMA 1N9LA 3A3JA 4YNRA 1N4OA 2HP9A 4GW9A 3LCEA 3BFGA 3LR5A 4QY5A 1SCWA 4YWZA 4EWFA 3S7QA 4UEYA 2X02A 2DMWA 1MY8A 4E3OA 4Y0TA 4N9LA 1I2WA 4WEKA 3RXXA 2B18A 1MKIA 1JWPA 4YINA 5HFOA 3PBRA 2Y2LA 1K55A 4P6BA 2ZQ9A 3TE8A 2P04A 1KVMA 4QU3A 4S2NC 4MCWA 4GNUA 3MXRA 3CAXA 2V9AA 5G4ZA 4R38A 4QD4A 3S22A 4BD0A 3Q07A 4KG2A 4JF6A 3FPVA 4GDBA 2JE5A 3EGDC 3FWLA 1ZG4A 2XSSA 3H9WA 4L9GA 4NETA 3RXWA 3K3CA 5FAQA 1W7FA 4KG6A 4HOIA 5EM1A 2ZQ8A 5EVIC 1DP8A 4LPZA 3S7PA 5M18A 3LIAA 2VGLS 4HESA 3HLDA 3BLMA 4UHUA 3ZG9B 2WAEA 3NY4A 3N7WA 4K0WA 5EVID 4WUJA 4I38A 2OOLA 2FFFB 5CEBA 4M3KA 2ZQDA 5I5LA 3W4PA 4N1HA 5GHYA 4HJ4A 4LLOB 3UMDA 5IT5A 1CK3A 4NXBA 4ZAMA 3DTIA 3F1NA 3ZCZA 3DWKA 2EX8A 4HJ3A 1F9IA 1FSYA 3UDFA 4C3QA 2WKQA 3UB7A 1KE0A 3C4OA 5KZHA 3N8RA 1NYYA 3P09A 4Z1WA 4PMAA 2ACGA 4OKPA 5E2FA 1RCJA 3GV9A 2XFTA 2L1MA 3NECA 3C5AA 4BL3A 5FL3A 3KYQA 3LEZA 2Z6DA 1L2SA 1LL8A 4MN7A 4MLLA 4LFUA 3QP2A 5L10A 4ETXA 2HDUA 3OBFA 4E3MA 3KX0X 3PTEA 1JWVA 4FSFA 1S0WA 2V1AA 1HZOA 2UWXA 3QNBA 4G3KA 4ZJ2A 3Q82A 4N9KA 2X01A 3BFCA 4WZ4A 3GDIA 5F5YA 4L9EA 3LR4A 4R4RA 4EEUA 3G32A 3IS2A 4X68A 2W1RA 1K6SA 2PBDP 4DE0A 2AVXA 4WZ5A 1S4RA 3VP4A 2NUTC 5HWWA 4HI4A 3ZVTA 3OPLA 3ZQ5A 1TEMA 1CF0A 1KVLA 3BY9A 3T12B 3IXBA 4LENA 4EXOA 2XDMA 4OVDA 2VZWA 1LSXA 1FILA 3BEBA 4X56A 4KQRA 2Y2NA 2PYRA 3BFDA 2HP5A 3BW6A 4ID4A 5FI2A 4BD1A 5J8XA 2A24A 2ZLYA 3DAVA 3PBQA 3MZDA 5KIZA 4DXBA 3UY6A 4HY8A 2XR0A 4U0XA 1LI0A 2OWJA 1X0OA 4OP5A 3HJKA 4DRTA 4WZ5C 4X53A 3DTEA 1MWRA 3RJUA 1ZC2A 2VEAA 4EETB 3EEAA 4UA7A 1K25A 1MWUA 4RX3A 2XROA 4QHCA 2J3TC 4IUKA 3CJMA 5M1AA 4S2PA 4DE1A 2O9AA 5EVEA 5MC7A 4R1GA 4MNRA 1ES2A 3QP8A 5TFQA 1YSPA 3LY4A 1KDSA 2A2LA 3BFEA 4OQ0A 1N9OA 1G28A 2EA9A 5DJTA 1Z6FA 5L09A 2K7SA 4G3VA 3T4SA 3KSFA 5EE8A 3IXGA 2OLUA 2L0WA 4BBVA 5HPFA 3A3EA 4JGPA 3K2NA 1IKIA 4D2OA 2QPNA 1T1BA 2VLGA 3LR3A 5CGXA 4HIAA 3ZHHA 3C2WA 5A91A 2C6WB 4FD8A 5HARA 3CUEC 1XA7A 3HUMA 1EI5A 2J3TD 2K2NA 4DE3A 3BQAA 3UDIA 1T1CA 1H8MA 1LHYA 1FIKA 5AQ7A 3GQZA 2VV7A 3SH7A 2PAVP 3CWFA 3HJIA 3W4QA 2Y8HA 2WUQA 1W63Q 1OTBA 5KSCA 3NOUC 2XFSA 3HUOA 1K0KA 1XA1A 1DP6A 3LYXA 5HAIA 3UN7A 4GLQA 2R78A 4LCLA 4KZ6A 1LLBA 2VGKA 4R4SA 3TG9A 3KSGA 4JXSA 4C6YA 3VP1A 2M7UA 4XT2B 1S66L 1ESIA 3ITBA 4ARZB 1LL9A 3MZEA 1OJGA 1K38A 2Z2LB 1VHMA 5IS1A 4N92A 3S1YA 1MWTA 3UB5P 4N1XA 5DTSA 5AVEA 2H28A 2JKRI 1VQQA 5FEFA 4YFMA 4KUOA 5DKLA 1ONGA 3D9YA 4OOLA 1FCNA 3EEHA 3LI9A 4U3TA 1PRQA 3N6IA 4KZBA 2ZM2A 4LV3A 3ZFZA 2I9VA 3NBLA 5FSRA 2D02A 1NZOA 4LV1A 3ZYTA 3F1OB 4FH4A 3B33A 2YKHA 3HBRA 3GMWA 2R9WA 4R70A 5CRFA 2LB9A 3BLSA 4NXGA 3NULA 5FDHA 1TF1A 5J3WA 4R3BA 1DRMA 4L9FA 3QP6A 3DW0A 3M6HA 2OWHA 4O01A 4NKPA 3UNWA 3SH8A 1E25A 4G3WA 4ARZA 1SHVA 3SS3A 2B95A 4NXFA 2DRWA
chains in the Genus database with same CATH topology
1FIKA 3DAVA 2E8JA 3LGOA 4X1MA 3T12B 1SZVA 1Y4OA 2VK3A 2ZL1A 3T1XA 4FUWA 4FTXA 4X1LA 5FDSA 2BTFP 1F2KA 1D1JA 1PFLA 2PAVP 5EVEA 1PRQA 3T1QB 1VEUA 2JKFA 5EM1A 3T1RA 1ACFA 3CPTB 2ACGA 3KYEA 3CPTA 3MS6A 3T1SA 1HLUP 1A0KA 4X25A 3L7HA 1CQAA 1FILA 2PBDP 4QWOA 1VEUB 5EM0A 2PRFA 2ZL1B 3UB5P 1SKOA 1SKOB 3NECA 1G5UA 2V8CA 3L9KA 5EV0A 4D60A 3CHWP 1J3WA 1Z09A 1K0KA 2B95A 2JKGA 5FEFA 1AWIA 1VETB 1PNEA 1VETA 5FEGA 1CJFA 3LEQA 3MSHA 3U4LP 2V8FA 4ESPA 2HZ5A 1YPRA 3NULA 1CF0A 3D9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIK A;  3DAV A;  2E8J A;  3LGO A;  4X1M A;  3T12 B;  1SZV A;  1Y4O A;  2VK3 A;  2ZL1 A;  3T1X A;  4FUW A;  4FTX A;  4X1L A;  5FDS A;  2BTF P;  1F2K A;  1D1J A;  1PFL A;  2PAV P;  5EVE A;  1PRQ A;  3T1Q B;  1VEU A;  2JKF A;  5EM1 A;  3T1R A;  1ACF A;  3CPT B;  2ACG A;  3KYE A;  3CPT A;  3MS6 A;  3T1S A;  1HLU P;  1A0K A;  4X25 A;  3L7H A;  1CQA A;  1FIL A;  2PBD P;  4QWO A;  1VEU B;  5EM0 A;  2PRF A;  2ZL1 B;  3UB5 P;  1SKO A;  1SKO B;  3NEC A;  1G5U A;  2V8C A;  3L9K A;  5EV0 A;  4D60 A;  3CHW P;  1J3W A;  1Z09 A;  1K0K A;  2B95 A;  2JKG A;  5FEF A;  1AWI A;  1VET B;  1PNE A;  1VET A;  5FEG A;  1CJF A;  3LEQ A;  3MSH A;  3U4L P;  2V8F A;  4ESP A;  2HZ5 A;  1YPR A;  3NUL A;  1CF0 A;  3D9Y A; 
#chains in the Genus database with same CATH topology
 1OPX A;  1Y4O A;  4O7D A;  5G4Y A;  3Q7V B;  4Q0I A;  2PU4 A;  4ZJ3 A;  4Y2F A;  5KMW A;  1NYM A;  2HF6 A;  4GHI A;  2KDK A;  1BTL A;  5CXW A;  4R3A A;  1DJA A;  2HGV A;  4EEP A;  4S2L A;  3LFV A;  3HLF A;  3MSH A;  2Y91 A;  4KQQ A;  1AXB A;  3LGO A;  5A93 A;  3G2Y A;  1ZKJ A;  4H6J B;  3PBT A;  1MPL A;  1ODV A;  2ZBB A;  4RA7 A;  5GHX A;  4CQH A;  3UB6 A;  4JBF A;  4KZ8 A;  2ZQC A;  3NJA A;  3N4I A;  1U60 A;  1M6K A;  2FZ0 A;  5IHV A;  4HBU A;  5FAO A;  1J9M A;  1FSW A;  5HL6 A;  3T1X A;  2XH9 A;  1ESU A;  4WYY A;  2HJ9 C;  4X1L A;  3UDX A;  1MKM A;  3S7N A;  4P87 A;  5G18 A;  3Q7Z A;  3WRT A;  4Y7P A;  5FI7 A;  1HTZ A;  1NRJ A;  1W5D A;  1LT0 A;  4MBK A;  4X69 A;  1FR6 A;  4P6Z M;  2XA7 M;  3SS5 A;  1T19 A;  1PIO A;  5FQ9 A;  4JF5 A;  5F82 A;  2Z2M B;  4Y5F A;  3T1S A;  4R0Q A;  3G4P A;  4BBT A;  3G30 A;  4HBT A;  2WGV A;  4QY6 A;  2VA0 A;  2Y2K A;  1MBL A;  1VET A;  4S2N A;  3H82 A;  1PI5 A;  3JPU A;  4S2I A;  4K08 A;  5EPH A;  4HP9 A;  5AQ9 A;  3NIA A;  1W8Y A;  4ZRR A;  5CED A;  3QNC A;  3KO6 A;  3WRZ A;  1OJ5 A;  3CUE A;  4OPZ A;  4O0P A;  1GSW A;  3PAE A;  1KGE A;  2OAP 1;  2JN7 A;  5LBR A;  1D7E A;  4HHD A;  3T1R A;  5A8B A;  1NWZ A;  4PAU A;  1UWP X;  2ZC5 B;  3PHY A;  1H8Z A;  2GZA A;  1FOF A;  3CIT A;  3E4P A;  2JKT M;  5D3O A;  3OOV A;  3TRC A;  1STZ A;  3E2L A;  3T1Q B;  4ZDX A;  1HLU P;  2PBY A;  1YSQ A;  4KG5 A;  3SS4 A;  1OTE A;  5GLD A;  3BRM A;  4R6L A;  1BYW A;  3ZGA B;  3C4P A;  3IX8 A;  3OC2 A;  4OOM A;  3R4K A;  2IA2 A;  3F1N B;  3E0Y A;  3QP5 A;  3KYE A;  1DJB A;  4X25 A;  1WYC A;  5F68 A;  3A3D A;  4RVA A;  3SZT A;  1KDW A;  2EX9 A;  2ZC3 B;  5TJJ A;  2WKR A;  2ZOH A;  5AQB A;  4WEL A;  5HSQ A;  3MKE A;  4C75 A;  4GD6 A;  4FTX A;  3P01 A;  4Q0J A;  1H0M A;  4GB7 A;  2WZX A;  3RTY A;  3ICY A;  4EES A;  4JF4 A;  4Y0O A;  1TDG A;  1KE3 A;  2PDR A;  3MJQ A;  4OON A;  1BLS A;  5EOE A;  2Y55 A;  3IXD A;  4UA9 A;  2XD5 A;  1I2S A;  2Y2Q A;  2GJ3 A;  3IWQ A;  5F6A A;  5GL9 A;  3B47 A;  4HJ6 A;  2BG1 A;  1D1J A;  1IOU A;  1NZU A;  5C5K A;  1L0D A;  5M19 A;  3D72 A;  1PZO A;  1ONH A;  3WS2 A;  3BYD A;  2PD8 A;  4KQO A;  3VV4 A;  3B3X A;  2XRN A;  3VE4 A;  1VB6 A;  1PNE A;  1LL5 A;  4JXW A;  4LRX C;  3T4O A;  2XK1 A;  3BWL A;  4E3I A;  3HCY A;  5K5B A;  3MFX A;  3MF0 A;  4A5R A;  3ZG8 B;  3CPT A;  5DKK A;  4I3I A;  5TR7 A;  2G2W A;  4EQI A;  3TW8 A;  4CLC B;  4GKU A;  4R23 A;  1C3B A;  3CHW P;  2PU2 A;  3LID A;  1K4F A;  3WS0 A;  4DDY A;  4I39 A;  1FCO A;  3G2Z A;  3UME A;  5E2G A;  4M4X A;  4OPY A;  3UPP A;  2INW A;  4UQI M;  3RFB A;  1KGF A;  1TS0 A;  3OZH A;  1OT6 A;  4I3J A;  4KZ9 A;  2QKP A;  5KSH A;  5L8M A;  1L0F A;  1ES3 A;  1F98 A;  3CLO A;  4CPK A;  2QJ5 A;  3CG5 A;  1ERM A;  3A3I A;  2H5S A;  2J80 A;  5FAS A;  2ZC4 B;  5TBM B;  4PKY G;  5DF9 A;  2DCF A;  4OQI A;  2BTF P;  3HLC A;  2VJW A;  4WMC D;  2WKI A;  1GA9 A;  3CPT B;  4LGW A;  2I72 A;  4I3A A;  4IVK A;  1IKG A;  5GHZ A;  2JCH A;  2V8C A;  4KEN B;  1SKF A;  5GLB A;  1T18 A;  3PR6 A;  2A3U A;  3GEC A;  1KOU A;  2EX2 A;  1JTD A;  3SOI A;  4ETZ A;  5FQQ A;  5FAP A;  4RQ9 A;  1Q2P A;  3U2A A;  3E2K A;  3IBR A;  1S4S A;  3UB8 A;  1VEU B;  4AFI A;  2W1T A;  2M7V A;  2OV5 A;  2EXB A;  2XQZ A;  1FR1 A;  4WM9 A;  1J3W A;  4B88 A;  1PW1 A;  2J8Y A;  3O5Y A;  3V50 A;  2PYP A;  1K57 A;  2W27 A;  3R7W B;  4KZ3 A;  3LI8 A;  3O3V A;  3T4K A;  4IHQ A;  5IU1 A;  1LI9 A;  3T4T A;  4X6T A;  2BAS A;  3BJN A;  3LEQ A;  3BM6 A;  4MMN A;  2VV8 A;  3FC7 A;  3UE6 A;  5EVI A;  1SZV A;  4UAA A;  4CLC A;  2V0W A;  2V2F F;  2ZM8 A;  4WF0 A;  5HX9 A;  3VMA A;  3LO7 A;  3I7J A;  4QPR A;  1PW8 A;  1K54 C;  2H0Y A;  4CLC D;  4PPR A;  1YM1 A;  1JTG A;  3U4L P;  4LCM A;  1XPB A;  5HL1 A;  4PM8 A;  5FQJ A;  3MBZ A;  4PHT A;  3HLB A;  1XJ6 A;  4GN2 A;  1ZHH B;  1YAX A;  3A0R A;  1K55 C;  2WYX A;  5HDS A;  1OTA A;  2UV0 E;  3MR0 A;  1YLT A;  1NLY A;  2PT7 A;  3C8C A;  4IUH A;  4IJG A;  2E8I A;  2QYB A;  2ZMA A;  3ULF A;  4BBU A;  4EUZ A;  2ZL1 A;  1PFL A;  3IX4 A;  3UPO A;  1JNU A;  1O07 A;  1GHP A;  1H3Q A;  4S2K A;  3BFF A;  2Q9M A;  4EER A;  4Q0H A;  3AGD A;  3QP1 A;  1D06 A;  3G35 A;  2J9P A;  1WYB A;  3VE3 A;  2HPB A;  2YKF A;  1MWS A;  1GCE A;  4CLC E;  2PHY A;  3HVF A;  4PKY A;  4LV0 A;  2GX5 A;  1IEM A;  3BEC A;  1NJ4 A;  1K56 A;  3RH8 B;  3DWZ A;  2P9V B;  3IX3 A;  2X71 A;  5CTN A;  2WGW B;  2CC1 A;  3SH9 A;  2Y79 A;  4DF6 A;  4EBL A;  2Z6C A;  4WBG A;  1BSG A;  2C5W B;  3OPR A;  3IXH A;  1YLW A;  2ZD8 A;  4NEE D;  2ZC7 A;  3PXP A;  5FI6 A;  5AVF A;  3T50 A;  1L3L A;  3ZNT A;  2XA7 S;  3G34 A;  3EGX C;  3ZG7 B;  2PR5 A;  5CER A;  5E43 A;  1UGU A;  1PWC A;  2O9C A;  1BLH A;  1XGI A;  4DJ3 A;  1IEL A;  4OQG A;  4DJ2 A;  4PM9 A;  3MQ0 A;  1EW0 A;  2ZOI A;  4S2O A;  1E4D A;  4E3J A;  4LRZ E;  1GSV A;  3IQA A;  1XFQ A;  3GRJ A;  3DTM A;  2HDS A;  4P85 A;  1YLP A;  3VP0 A;  2JKF A;  2A49 A;  5EFW A;  3CZD A;  1OTD A;  4OQH A;  4E3N A;  3LIB A;  3KYZ A;  3NOP C;  1SDN A;  3E4O A;  2P7J A;  4F94 A;  2CMN A;  3VP2 A;  4IBR A;  4FUW A;  2WAF A;  2WGW A;  4FOF A;  2HDQ A;  3G31 A;  4EUV A;  2JC7 A;  4JLF A;  1QME A;  4KZ4 A;  3M2K A;  1PZP A;  1HD8 A;  3B42 A;  3PBO A;  2IWC A;  1DY6 A;  4WEJ A;  1JWZ A;  5FQI A;  1P0Z A;  2GNX A;  1P9W A;  4RYE A;  3H82 B;  2ZM0 A;  4GD8 A;  1S67 L;  4EW7 A;  2JBF A;  4OOY A;  1IFQ A;  1XGJ A;  1YT4 A;  2W0N A;  3OCN A;  3NOT C;  1BLC A;  3G6O A;  2V8F A;  4CJN A;  5GLC A;  5CTM A;  2D01 A;  2O9B A;  1OTI A;  2W3G A;  1ACF A;  3IF6 B;  1TDL A;  2B5R A;  1P9R A;  2B02 A;  5F1F A;  4GDN A;  4JPM A;  4WL9 A;  1PI4 A;  2XLN A;  2R9X A;  3K3D A;  4BQM A;  4WN5 A;  4BMW A;  3HUN A;  1G6A A;  4BEN A;  3ZDJ A;  3FG8 A;  3VOZ A;  3BY8 A;  2HV1 A;  2QZ6 A;  3ZG5 A;  4F3L A;  2VX8 A;  1F2K A;  1Y28 A;  4MEZ A;  3WS1 A;  2QMI A;  5CGW A;  4XT2 A;  4IVI A;  3OCL A;  1CEF A;  3LIE A;  3JYI A;  2ZQ7 A;  2H10 A;  4HNB A;  2VGJ A;  5HD3 A;  2HZ5 A;  4FCF A;  1G68 A;  3EQV A;  3EOI A;  3IF5 A;  2LB5 A;  1WE4 A;  4B9O A;  4CLC C;  1MZU A;  3IF6 A;  2WGI A;  4JXV A;  5EM0 A;  3T4Q A;  3MQQ A;  2HJE A;  3V3S A;  4JXG A;  3AGE A;  3A0S A;  4DKI A;  4YOF A;  1PWD A;  3C7V A;  1XJ3 A;  2VKS A;  4KUK A;  3OLO A;  4XXR A;  4DMZ A;  3A0V A;  1DJC A;  3IH9 A;  4BLM A;  4DE2 A;  4PM6 A;  4E6X A;  3HLE A;  1LSV A;  3VSL A;  1K57 C;  1O7E A;  4JGO A;  2EWW A;  1RP5 A;  3V39 A;  3W8K A;  2OAQ 1;  2V20 A;  1M40 A;  5GLA A;  1TS6 A;  1AWI A;  1CJF A;  1IYQ A;  4EQ1 A;  3VFH A;  3N8L A;  3C30 A;  1YMS A;  1JVJ A;  3O87 A;  1K56 D;  1ALQ A;  1DP9 A;  1NXY A;  2PRF A;  3OPH A;  3BQ8 A;  4B4X A;  3L9K A;  5DF8 A;  1TVF A;  4Y0U A;  1FQG A;  1XFN A;  3HLW A;  3MXS A;  2WKH A;  2Y2M A;  4HP4 A;  3R7W A;  3GVB A;  2Y2O A;  5HAP A;  3MS6 A;  4Z9Q A;  4E3K A;  5CHU A;  3L7H A;  1ERO A;  1ES4 A;  4PM5 A;  1WA9 A;  3IWO A;  4GHI B;  2W3H A;  5EV0 A;  1SDE A;  5J4E A;  2Y59 A;  2PR6 A;  3HRE A;  3ZG0 A;  3W2Z A;  2P08 A;  3NHQ A;  3OPP A;  2G2U A;  3Q81 A;  1K54 A;  4FH2 A;  4H6J A;  2WZZ A;  1NRF A;  4QWO A;  2KLI A;  2ZQA A;  4KZ5 A;  3WWX A;  3FYZ A;  1G5U A;  2FFY A;  1VET B;  1PWG A;  5E2H A;  3E4Q A;  3VOL A;  1BUL A;  3Q7V A;  3QP4 A;  1XP4 A;  1GA0 A;  3IHA A;  2Q0O A;  5DJU A;  3UO9 A;  3D4F A;  1FCM A;  2WAD A;  5FA7 A;  2NUP C;  1KGG A;  1SKO B;  4MDZ A;  4DXC A;  3V67 A;  1W8Q A;  1Z09 A;  1W63 M;  5FQK A;  2WK0 A;  2M1C A;  3EWK A;  3CMZ A;  3FKV A;  2GDN A;  3VFF A;  4HH3 A;  1UWN X;  5HDD A;  2V0U A;  1LSW A;  3MQO A;  5HD5 A;  3PAG A;  1MC0 A;  2ZMV A;  4ZTK A;  1CQA A;  2Y4A A;  3UPN A;  3F1P B;  2EFU A;  4R3J A;  3ZNY A;  3HLG A;  4OPR A;  1YLZ A;  2H0T A;  5DVA A;  1E3U A;  5HAQ A;  1H8Y A;  3MKF A;  1XJ4 A;  5F1G A;  1L0G A;  5F69 A;  1V9Y A;  3P98 A;  3VP3 A;  4UQI S;  2OLV A;  4II7 A;  1K4E A;  2G7U A;  2XEP A;  3ZVW A;  2W3D A;  3NCK A;  1ZTU A;  5FEG A;  3D3O A;  4X55 A;  5DTT A;  2JHE A;  5BOH A;  3VSK A;  3GSG A;  3ITA A;  5JYO A;  2W3E A;  1T1A A;  2MJ6 A;  4JGQ A;  4K0X A;  3IS2 B;  3C7U A;  1BLP A;  3M6B A;  1IYO A;  1GHI A;  2A24 B;  5EVI B;  4IBX A;  3KSI A;  2JKG A;  1Q2Q A;  1S1Y A;  3ISG A;  2XGN A;  3HL9 A;  3TOI A;  5F83 A;  1Y54 A;  2ZC6 B;  4UA6 A;  4OPQ A;  1I5Q A;  4LRY C;  1RGY A;  5A92 A;  2W1T B;  5DTK A;  2VGL M;  2J3W A;  1XX2 A;  1CI9 A;  1N9N A;  3MZF A;  4O8G A;  4K91 A;  4E6W A;  5FDS A;  3DBA A;  4Q8I A;  1YLY A;  1NY0 A;  5HDC A;  1YLJ A;  4QJG A;  2Y2P A;  3LY3 A;  5HWV A;  1S6R A;  3FKW A;  3F1P A;  4Y15 A;  4ME4 A;  5DF7 A;  1IYS A;  4PM7 A;  5J7E A;  4HQA A;  3TJZ C;  1N9B A;  3V3R A;  3H7W B;  2E8J A;  4GCZ A;  5CHM A;  4BJP A;  2OSU A;  4JGR A;  2WKE A;  4H8R A;  5AJG A;  3W4O A;  1ES5 A;  2XF3 A;  1XJ2 A;  3IWI A;  1S1Z A;  1BT5 A;  2ZL1 B;  5L2F A;  2VV6 A;  3F1O A;  5CGS A;  3UE1 A;  4F3L B;  4OLG A;  1YMX A;  4KZ7 A;  4Y3I A;  3SW1 A;  4NK3 A;  5DFX A;  4HH2 A;  2L4R A;  5A90 A;  1K6R A;  4GJ4 A;  1ERQ A;  4EBN A;  3LIC A;  1TS7 A;  3PBS A;  2Y2G A;  3FPW A;  4S2M A;  3S4X A;  1KE4 A;  3GTC A;  4KZA A;  3IF6 C;  3MFD A;  4ZJ1 A;  5TBM A;  2JKR M;  2P9V A;  4XUZ A;  5DFY A;  5FQM A;  1IYP A;  4XUX A;  2RCX A;  3S7O A;  2HP6 A;  3O86 A;  3H7W A;  1CI8 A;  4P6Z S;  2DNS A;  5HWT A;  4OH0 A;  3EQU A;  2V1Z A;  4NG2 A;  2EX6 A;  4ESP A;  4GS9 A;  3UB9 A;  3WS5 A;  1CEG A;  5EEC A;  4L0L A;  4KQD A;  3AGF A;  2V1B A;  2ZMF A;  4HEF A;  5EOO A;  4E3L A;  1QMF A;  3GR2 A;  1OME A;  3CI6 A;  3MXQ A;  2EWV A;  5JYP A;  1G6O A;  5CEC A;  3IHB A;  2PD7 A;  5HW3 A;  2IWD A;  2J7V A;  2WKP A;  5L07 A;  4MBH A;  1TD5 A;  3N8S A;  4P0M A;  4QB8 A;  1VM1 A;  3IT9 A;  4IED A;  1GSX A;  1SKO A;  3NDE A;  1NLZ A;  3NDG A;  4OP8 A;  3V5M A;  2HDR A;  2ZJ9 A;  5TGF A;  4D60 A;  3LR0 A;  5CX7 A;  1E3U D;  3E98 A;  4BWI A;  4X1M A;  1L0E A;  1ZG6 A;  3PYP A;  5FAT A;  5HPI A;  1VEU A;  5EUA A;  3IBJ A;  3NC8 A;  2Y2I A;  2KX6 A;  2EFX A;  5CHJ A;  1RGZ A;  5HZH A;  1P97 A;  1H5X A;  3M2J A;  4GS9 B;  3MMH A;  3FV7 A;  2QJ7 A;  3T4L A;  3Q1F A;  4E04 A;  2IWB A;  2K31 A;  4DN0 A;  3UE0 A;  1GHM A;  2FH5 A;  4WLA A;  4WMC A;  5E2E A;  1HVB A;  3DTK A;  4EU0 A;  3FZC A;  4EV4 A;  3KSH A;  3C38 A;  1F5M A;  4JKT A;  4MN6 A;  1PYY A;  1YKD A;  1TS8 A;  3WS4 A;  2QWS A;  4MN5 A;  5AQA A;  3LIF A;  2Y2J A;  1W79 A;  1YPR A;  3UE3 A;  1EWZ A;  3IH8 A;  4GZB A;  4EBP A;  1BZA A;  5I94 A;  2P74 A;  2O99 A;  1A0K A;  2Y2H A;  3JVV A;  3NI9 A;  5EVL A;  4NXE A;  3VOY A;  4ZBE A;  4OLD A;  3JVU A;  2JKT I;  4S2J A;  3O88 A;  2VK3 A;  4MBF A;  2EXA A;  2XD1 A;  3LUQ A;  3QHY A;  4BL2 A;  1YQS A;  4DDS A;  2RL3 A;  2BLS A;  1BUE A;  4RX2 A;  4U0T A;  3A3F A;  2O0Y A;  4I5S A;  3P7N A;  2J9O A;  1XKZ A;  1MXO A;  1OT9 A;  1V9Z A;  5U47 A;  4B93 A;  4LV2 A;  2KOI A;  4B4Z A;  2QHK A;  3PBN A;  3T4J A;  2Q9N A;  4Y13 A;  4Y17 A;  4GOG A;  3TSG A;  2W3F A;  1XXM A;  1N9L A;  3A3J A;  4YNR A;  1N4O A;  2HP9 A;  4GW9 A;  3LCE A;  3BFG A;  3LR5 A;  4QY5 A;  1SCW A;  4YWZ A;  4EWF A;  3S7Q A;  4UEY A;  2X02 A;  2DMW A;  1MY8 A;  4E3O A;  4Y0T A;  4N9L A;  1I2W A;  4WEK A;  3RXX A;  2B18 A;  1MKI A;  1JWP A;  4YIN A;  5HFO A;  3PBR A;  2Y2L A;  1K55 A;  4P6B A;  2ZQ9 A;  3TE8 A;  2P04 A;  1KVM A;  4QU3 A;  4S2N C;  4MCW A;  4GNU A;  3MXR A;  3CAX A;  2V9A A;  5G4Z A;  4R38 A;  4QD4 A;  3S22 A;  4BD0 A;  3Q07 A;  4KG2 A;  4JF6 A;  3FPV A;  4GDB A;  2JE5 A;  3EGD C;  3FWL A;  1ZG4 A;  2XSS A;  3H9W A;  4L9G A;  4NET A;  3RXW A;  3K3C A;  5FAQ A;  1W7F A;  4KG6 A;  4HOI A;  5EM1 A;  2ZQ8 A;  5EVI C;  1DP8 A;  4LPZ A;  3S7P A;  5M18 A;  3LIA A;  2VGL S;  4HES A;  3HLD A;  3BLM A;  4UHU A;  3ZG9 B;  2WAE A;  3NY4 A;  3N7W A;  4K0W A;  5EVI D;  4WUJ A;  4I38 A;  2OOL A;  2FFF B;  5CEB A;  4M3K A;  2ZQD A;  5I5L A;  3W4P A;  4N1H A;  5GHY A;  4HJ4 A;  4LLO B;  3UMD A;  5IT5 A;  1CK3 A;  4NXB A;  4ZAM A;  3DTI A;  3F1N A;  3ZCZ A;  3DWK A;  2EX8 A;  4HJ3 A;  1F9I A;  1FSY A;  3UDF A;  4C3Q A;  2WKQ A;  3UB7 A;  1KE0 A;  3C4O A;  5KZH A;  3N8R A;  1NYY A;  3P09 A;  4Z1W A;  4PMA A;  2ACG A;  4OKP A;  5E2F A;  1RCJ A;  3GV9 A;  2XFT A;  2L1M A;  3NEC A;  3C5A A;  4BL3 A;  5FL3 A;  3KYQ A;  3LEZ A;  2Z6D A;  1L2S A;  1LL8 A;  4MN7 A;  4MLL A;  4LFU A;  3QP2 A;  5L10 A;  4ETX A;  2HDU A;  3OBF A;  4E3M A;  3KX0 X;  3PTE A;  1JWV A;  4FSF A;  1S0W A;  2V1A A;  1HZO A;  2UWX A;  3QNB A;  4G3K A;  4ZJ2 A;  3Q82 A;  4N9K A;  2X01 A;  3BFC A;  4WZ4 A;  3GDI A;  5F5Y A;  4L9E A;  3LR4 A;  4R4R A;  4EEU A;  3G32 A;  3IS2 A;  4X68 A;  2W1R A;  1K6S A;  2PBD P;  4DE0 A;  2AVX A;  4WZ5 A;  1S4R A;  3VP4 A;  2NUT C;  5HWW A;  4HI4 A;  3ZVT A;  3OPL A;  3ZQ5 A;  1TEM A;  1CF0 A;  1KVL A;  3BY9 A;  3T12 B;  3IXB A;  4LEN A;  4EXO A;  2XDM A;  4OVD A;  2VZW A;  1LSX A;  1FIL A;  3BEB A;  4X56 A;  4KQR A;  2Y2N A;  2PYR A;  3BFD A;  2HP5 A;  3BW6 A;  4ID4 A;  5FI2 A;  4BD1 A;  5J8X A;  2A24 A;  2ZLY A;  3DAV A;  3PBQ A;  3MZD A;  5KIZ A;  4DXB A;  3UY6 A;  4HY8 A;  2XR0 A;  4U0X A;  1LI0 A;  2OWJ A;  1X0O A;  4OP5 A;  3HJK A;  4DRT A;  4WZ5 C;  4X53 A;  3DTE A;  1MWR A;  3RJU A;  1ZC2 A;  2VEA A;  4EET B;  3EEA A;  4UA7 A;  1K25 A;  1MWU A;  4RX3 A;  2XRO A;  4QHC A;  2J3T C;  4IUK A;  3CJM A;  5M1A A;  4S2P A;  4DE1 A;  2O9A A;  5EVE A;  5MC7 A;  4R1G A;  4MNR A;  1ES2 A;  3QP8 A;  5TFQ A;  1YSP A;  3LY4 A;  1KDS A;  2A2L A;  3BFE A;  4OQ0 A;  1N9O A;  1G28 A;  2EA9 A;  5DJT A;  1Z6F A;  5L09 A;  2K7S A;  4G3V A;  3T4S A;  3KSF A;  5EE8 A;  3IXG A;  2OLU A;  2L0W A;  4BBV A;  5HPF A;  3A3E A;  4JGP A;  3K2N A;  1IKI A;  4D2O A;  2QPN A;  1T1B A;  2VLG A;  3LR3 A;  5CGX A;  4HIA A;  3ZHH A;  3C2W A;  5A91 A;  2C6W B;  4FD8 A;  5HAR A;  3CUE C;  1XA7 A;  3HUM A;  1EI5 A;  2J3T D;  2K2N A;  4DE3 A;  3BQA A;  3UDI A;  1T1C A;  1H8M A;  1LHY A;  1FIK A;  5AQ7 A;  3GQZ A;  2VV7 A;  3SH7 A;  2PAV P;  3CWF A;  3HJI A;  3W4Q A;  2Y8H A;  2WUQ A;  1W63 Q;  1OTB A;  5KSC A;  3NOU C;  2XFS A;  3HUO A;  1K0K A;  1XA1 A;  1DP6 A;  3LYX A;  5HAI A;  3UN7 A;  4GLQ A;  2R78 A;  4LCL A;  4KZ6 A;  1LLB A;  2VGK A;  4R4S A;  3TG9 A;  3KSG A;  4JXS A;  4C6Y A;  3VP1 A;  2M7U A;  4XT2 B;  1S66 L;  1ESI A;  3ITB A;  4ARZ B;  1LL9 A;  3MZE A;  1OJG A;  1K38 A;  2Z2L B;  1VHM A;  5IS1 A;  4N92 A;  3S1Y A;  1MWT A;  3UB5 P;  4N1X A;  5DTS A;  5AVE A;  2H28 A;  2JKR I;  1VQQ A;  5FEF A;  4YFM A;  4KUO A;  5DKL A;  1ONG A;  3D9Y A;  4OOL A;  1FCN A;  3EEH A;  3LI9 A;  4U3T A;  1PRQ A;  3N6I A;  4KZB A;  2ZM2 A;  4LV3 A;  3ZFZ A;  2I9V A;  3NBL A;  5FSR A;  2D02 A;  1NZO A;  4LV1 A;  3ZYT A;  3F1O B;  4FH4 A;  3B33 A;  2YKH A;  3HBR A;  3GMW A;  2R9W A;  4R70 A;  5CRF A;  2LB9 A;  3BLS A;  4NXG A;  3NUL A;  5FDH A;  1TF1 A;  5J3W A;  4R3B A;  1DRM A;  4L9F A;  3QP6 A;  3DW0 A;  3M6H A;  2OWH A;  4O01 A;  4NKP A;  3UNW A;  3SH8 A;  1E25 A;  4G3W A;  4ARZ A;  1SHV A;  3SS3 A;  2B95 A;  4NXF A;  2DRW A; 
#chains in the Genus database with same CATH homology
 1FIK A;  3DAV A;  2E8J A;  3LGO A;  4X1M A;  3T12 B;  1SZV A;  1Y4O A;  2VK3 A;  2ZL1 A;  3T1X A;  4FUW A;  4FTX A;  4X1L A;  5FDS A;  2BTF P;  1F2K A;  1D1J A;  1PFL A;  2PAV P;  5EVE A;  1PRQ A;  3T1Q B;  1VEU A;  2JKF A;  5EM1 A;  3T1R A;  1ACF A;  3CPT B;  2ACG A;  3KYE A;  3CPT A;  3MS6 A;  3T1S A;  1HLU P;  1A0K A;  4X25 A;  3L7H A;  1CQA A;  1FIL A;  2PBD P;  4QWO A;  1VEU B;  5EM0 A;  2PRF A;  2ZL1 B;  3UB5 P;  1SKO A;  1SKO B;  3NEC A;  1G5U A;  2V8C A;  3L9K A;  5EV0 A;  4D60 A;  3CHW P;  1J3W A;  1Z09 A;  1K0K A;  2B95 A;  2JKG A;  5FEF A;  1AWI A;  1VET B;  1PNE A;  1VET A;  5FEG A;  1CJF A;  3LEQ A;  3MSH A;  3U4L P;  2V8F A;  4ESP A;  2HZ5 A;  1YPR A;  3NUL A;  1CF0 A;  3D9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...