2QKPA

Crystal structure of c-terminal domain of smu_1151c from streptococcus mutans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
SLDRTTQQPFGNGYLSVEQANLILNHLPLEITFVNKDDIFQYYNDSVPAAEMVFKRTPSQVGRNVELCHPPKVLDKVKKVFELLRNGQRDKVNMWFQSERLGKFVYVTYAAVRDQAGDFQGVLEYVQDIKPFFELDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal domain of SMU_1151c from Streptococcus mutans.
rcsb
source organism Streptococcus mutans
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 37
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qkpA00
1S1YA 1OTAA 3IBRA 3CLOA 4WN5A 2P7JA 3MXQA 3CAXA 3MJQA 1TS8A 4HI4A 4B9OA 4E04A 5IS1A 2WKQA 3A0RA 1OTEA 4PKYG 1UWNX 4DJ3A 3PYPA 5J3WA 1F9IA 4BBUA 4EESA 1S1ZA 4HJ6A 4BBVA 5EFWA 1BYWA 4M4XA 3F1PA 3UE6A 2V1BA 4I3IA 1F98A 3IS2B 2KX6A 4YWZA 3E4QA 3UMEA 4EEUA 2HV1A 3LUQA 4MN6A 1V9ZA 3LIAA 3CWFA 4BBTA 4KUKA 3IS2A 4I38A 2INWA 1DP8A 4WL9A 2PYPA 4GHIB 4H6JB 3FC7A 5HD5A 3F1NA 3UB7A 3C8CA 1P0ZA 5AVFA 3GDIA 4NXEA 5I5LA 2VV8A 4R38A 4GHIA 1T1CA 1NWZA 3H7WA 4H6JA 5HDCA 4EETB 2GJ3A 4R3AA 4K08A 3HJKA 2D01A 3NOTC 1LSXA 5F6AA 2K7SA 1LL8A 3B33A 1XJ3A 3LI9A 4NXBA 5HD3A 1N9NA 4HH3A 3VOLA 3E4OA 3EWKA 3LIBA 3MQOA 1LSWA 1XFNA 3OLOA 3C2WA 2QKPA 1V9YA 1N9LA 2W0NA 3GECA 4I3JA 4R70A 4LRXC 5F5YA 3EEHA 4WF0A 5F68A 3UB6A 3G6OA 3H82B 4HP4A 1T19A 4R6LA 4GW9A 3UB8A 2V0WA 1TS6A 1S67L 2H28A 3VE3A 3BWLA 2PR5A 1OT6A 3LIDA 2WKPA 3NHQA 3LI8A 3RH8B 4F3LA 1DP9A 2QJ7A 1OJ5A 1N9OA 3LIFA 1T1BA 1VB6A 3F1PB 5DJTA 4HQAA 4I3AA 4LRZE 4XT2B 3LYXA 3NOUC 1S66L 5G4ZA 5HWTA 5HWVA 5HWWA 4KQDA 2VEAA 3KX0X 5J7EA 3NOPC 3F1OA 4EERA 2I9VA 2D02A 5TBMB 1X0OA 2Z6DA 2J80A 4HNBA 2V1AA 1GSVA 2QWSA 2YKHA 1P97A 1XJ2A 2VV6A 2W27A 4WLAA 5TBMA 3ULFA 3H7WB 4EXOA 3K3CA 4I39A 4LLOB 4HIAA 2CMNA 4GS9B 1LT0A 1DRMA 4JGPA 5HZHA 2VV7A 1Y28A 1GSWA 4L9FA 1KOUA 2PYRA 4XT2A 5AVEA 5G4YA 2WKRA 3ICYA 3A0SA 3E4PA 3PHYA 3T50A 3BY8A 4EW7A 3SW1A 3MFXA 1G28A 2KDKA 4PKYA 1D06A 1TS7A 2QJ5A 1EW0A 2ZOHA 3NJAA 2V9AA 1OJGA 2VLGA 1ODVA 3LIEA 4HHDA 3F1NB 4HH2A 5J4EA 2L0WA 4RQ9A 5DKLA 1OTDA 1S4RA 4EQ1A 3BY9A 4NXFA 3A0VA 2OOLA 2OWHA 4HP9A 4LRYC 4F3LB 5HDDA 3MR0A 4LPZA 1UGUA 4JGRA 4I5SA 1XFQA 5HDSA 4HJ4A 4JGQA 5IU1A 2YKFA 4GS9A 1WA9A 4NXGA 1TS0A 5F69A 2JN7A 4L9EA 5KIZA 1T18A 3HJIA 4DJ2A 1DP6A 3UMDA 1LSVA 3RTYA 4HOIA 2ZOIA 3LICA 4WUJA 2A24B 1D7EA 4L9GA 2PHYA 2L4RA 1UWPX 2L1MA 2PDRA 2Z6CA 3F1OB 2V0UA 3K3DA 3D72A 3P7NA 4JGOA 4KUOA 1GSXA 1OTBA 3MQQA 4HY8A 5DKKA 2R78A 3H82A 4EEPA 2JHEA 2PD7A 2B02A 2PD8A 4GCZA 2PR6A 1JNUA 3ZQ5A 1XJ4A 5A8BA 1OTIA 3VE4A 4HJ3A 1XJ6A 5DJUA 3UB9A 5HSQA 1OT9A 2BASA 2ZBBA 3H9WA 3FG8A 1T1AA 2M1CA 2OWJA 4MN5A 2A24A 1MZUA 2QHKA 2EA9A 1S4SA
chains in the Genus database with same CATH superfamily
1KDWA 4DKIA 3V67A 5A92A 5FATA 1YKDA 4RYEA 4K0XA 2MJ6A 3F1NA 4NG2A 4R3AA 3HJKA 3MBZA 4NXBA 4RX2A 4R70A 4ZTKA 2Y2KA 2BG1A 3TJZC 2R9XA 3PTEA 1O7EA 1OJ5A 3UE1A 4QU3A 1N4OA 2PBDP 1VEUA 1NLZA 4R4SA 3SZTA 3BECA 2CMNA 1GHPA 2XDMA 1SKFA 4X55A 2GNXA 5KZHA 3IH8A 3LIEA 4CLCD 2ZC3B 1GA9A 2XF3A 3AGEA 3LO7A 3SS5A 1IFQA 2XGNA 2J7VA 1J9MA 1K4FA 5M19A 2A2LA 3Q1FA 4JBFA 2PHYA 5GHYA 1GSXA 4EEPA 4GDNA 2ZQ8A 4OONA 5A8BA 5A93A 3HCYA 1EWZA 3A3EA 2JBFA 1NLYA 4M4XA 3VFHA 1H3QA 5EVIB 2WGWA 4O01A 4WL9A 3NECA 5FQ9A 4KQQA 5EUAA 1ZG4A 1HTZA 4P0MA 4S2KA 5F6AA 4ME4A 1I2SA 4DE3A 3LI9A 2Y2QA 4HH3A 4WZ5C 1ERQA 4QJGA 1FILA 3PAGA 4EV4A 2FH5A 3UPNA 4FUWA 3BWLA 5D3OA 4PM8A 3LYXA 3NOUC 1QMEA 4GOGA 2J8YA 5DVAA 3T4KA 3HLWA 4JLFA 5DTKA 2RL3A 1XJ2A 3D3OA 1IYSA 4Y2FA 3TOIA 4Y0UA 1D06A 1TS7A 3IHBA 2ZOHA 2XFSA 2VLGA 2M7VA 5DKLA 5E2GA 2ZMVA 4P85A 2ZQCA 4ZJ1A 2OWHA 5HDDA 3OBFA 2ZC6B 5HDSA 3IF6B 3S7PA 2JKTI 3QNCA 4GNUA 3MFDA 4L9EA 3VFFA 5L10A 3G31A 3A3IA 2ZOIA 2A24B 3T1XA 4KZ3A 4OOLA 3ZFZA 3LGOA 3SS4A 2PD7A 3DTKA 1PZPA 4M3KA 3LR0A 3FG8A 2WGVA 2Z2LB 4AFIA 4PKYG 3BFGA 4MEZA 4YFMA 4HESA 5TJJA 4LGWA 1VEUB 4UQIS 2VJWA 3WS2A 4N1XA 1DP8A 5HD5A 3FC7A 4EWFA 3BRMA 3BW6A 1P0ZA 5EVIC 5I5LA 4H6JA 1NWZA 3H7WA 4KZ9A 4C75A 5FDHA 1CEGA 3PBOA 4Y0TA 3C2WA 1V9YA 5F1FA 5F5YA 5FAQA 4R6LA 2WYXA 2PR5A 4F3LA 1AWIA 3T4LA 3BFEA 1C3BA 5HWTA 5HL6A 3W4PA 2ZMAA 3S1YA 4GN2A 4FCFA 1P9RA 3Q81A 1PZOA 1SCWA 3A3DA 2EFUA 1KGEA 4BQMA 1VETA 4OPZA 1ZKJA 5HZHA 3NC8A 4Y7PA 5E2FA 3ICYA 1I5QA 3BLSA 5KSCA 3MFXA 1G28A 3K2NA 1SDNA 1PI5A 1YSQA 1WE4A 4H8RA 1XXMA 3A0VA 2OOLA 4JGRA 4X6TA 4MNRA 3IX3A 5EOOA 4PMAA 2NUTC 2Y2LA 4HBUA 3G2YA 2Y2MA 2R78A 4Y17A 3OC2A 4O7DA 4EBPA 2QZ6A 1JNUA 1OTIA 4B88A 4Y0OA 5EV0A 1CEFA 5AVEA 2PAVP 3CLOA 4WN5A 3TW8A 4B9OA 3TG9A 2WZXA 3EOIA 3WS0A 3DBAA 4BBUA 5HW3A 4IUHA 4EETB 1KE4A 4KQOA 1RGYA 3GECA 3QP5A 4UA9A 4N92A 4QY5A 1IEMA 3GRJA 3LIDA 4DE0A 2O0YA 2ZL1B 3IX4A 1ALQA 4RVAA 5L09A 1GHIA 3RJUA 3UB5P 3T4TA 1IYQA 5FQKA 2W3DA 3KSHA 4IBRA 2W27A 3BM6A 2VGLM 5LBRA 1NZOA 2FZ0A 2HDQA 4CLCE 1W7FA 3BY8A 2LB9A 3UNWA 3V3SA 4D60A 1OPXA 3U2AA 4LENA 1S4RA 4OQIA 3IWOA 3MR0A 3QP8A 1F2KA 1GHMA 3WS5A 2W3EA 2DCFA 1XKZA 1FSYA 5GL9A 5KIZA 4HOIA 3SH8A 4ZRRA 1D7EA 2Q9NA 3VV4A 2L4RA 4KZ8A 5EVIA 5DKKA 2VGJA 4GCZA 4DE2A 3PBQA 2PBYA 3UDXA 5L2FA 1T1AA 3EQVA 2A24A 4BMWA 1CI9A 1JTGA 1ONGA 5IS1A 1TD5A 1UWNX 3FKWA 4ZBEA 1F9IA 4WYYA 3HUNA 1BYWA 4OKPA 3UE0A 4KG2A 2HGVA 4KUKA 3IS2A 2Z2MB 4N9KA 3PBRA 4PM6A 2IA2A 4K08A 3LEQA 2JE5A 3B33A 4ID4A 5F83A 3CG5A 3IX8A 5EPHA 4BD0A 4OPYA 3JVUA 4X25A 4LRXC 5JYPA 4WBGA 3T1SA 3GQZA 1SHVA 4PAUA 3VE3A 4RX3A 2V8CA 4EBLA 5HPIA 3FPWA 2J3TD 4KQRA 2ZQAA 1VB6A 4HQAA 2Q9MA 3KX0X 5J7EA 1MC0A 3ZHHA 2ZM8A 5FI2A 1MBLA 5CRFA 2VZWA 1LL5A 4XT2A 1YMXA 3OPLA 1L0FA 4GB7A 2KDKA 3RXXA 4KG6A 2QJ5A 2WKHA 4HH2A 2OAQ1 3FPVA 3IF6C 3P01A 4QY6A 1KE0A 2B18A 3S7QA 2XFTA 4NK3A 2EX2A 1VETB 1SDEA 3MZDA 5JYOA 1Y4OA 2PDRA 3RXWA 1YLTA 3HLEA 3E2LA 3MXRA 3D9YA 1RP5A 3GV9A 2UV0E 5EFWA 5TFQA 1MZUA 5GHZA 4JXVA 1RCJA 3DTEA 1JWZA 1OTEA 4EESA 4EUZA 4ZAMA 1XA7A 3M2KA 2KX6A 4DXBA 3Q7ZA 1PNEA 1F5MA 1K57C 3LY4A 5CGSA 2XLNA 4IEDA 1ES5A 4UA6A 4GHIA 1ES3A 5FASA 3BEBA 4K0WA 4GLQA 4X1MA 3JPUA 3VP0A 4G3KA 5GLBA 5HFOA 4FOFA 4BL2A 3R7WB 1CI8A 3GVBA 3UB8A 3N4IA 1A0KA 1M6KA 1BZAA 3N6IA 2JKRI 1ZC2A 4II7A 3NDGA 3EEAA 3VSKA 3Q82A 3PAEA 1MKMA 2LB5A 1IELA 1CF0A 5M1AA 1L2SA 3MZEA 3QP2A 2PU2A 3E4PA 3MXSA 1MWSA 1PYYA 4CLCB 4JXWA 1G6OA 4S2JA 2ZC5B 4EUVA 1K55C 3WWXA 3NJAA 4Y5FA 1DJAA 3CPTB 4JKTA 4IHQA 4LPZA 1UGUA 1BULA 2HP5A 3QNBA 4DJ2A 2HP6A 3HBRA 2WK0A 3K3DA 4CPKA 3G4PA 4KUOA 4ETXA 1OTBA 3EGXC 2B02A 1L3LA 3EQUA 3T4OA 1K54A 4ZDXA 3QP4A 1S4SA 1S1YA 1OTAA 4FD8A 3V5MA 4BBVA 4OLGA 5HARA 1BLCA 1F98A 3E4QA 1YMSA 1WYBA 3W4QA 4KZBA 4Z1WA 3IXDA 3ITBA 4NXEA 2ZQDA 1PI4A 1BLPA 1XJ3A 2WADA 3VOLA 3LIBA 3ZVWA 4JF6A 5FQQA 4HP4A 1T19A 2VX8A 4GW9A 5CGWA 2Y4AA 1LLBA 5HAIA 5FI7A 2P9VB 2WUQA 3F1PB 5CX7A 2ZLYA 4WMCD 4E3IA 1K56D 2V1AA 1AXBA 1K55A 4C3QA 1JWVA 5TBMA 4I39A 1LT0A 4XUZA 1Q2QA 3KSGA 4LFUA 3A3FA 5CEBA 4QD4A 2BLSA 3NY4A 5EM0A 1K6RA 1XFQA 1WA9A 1E3UD 1S6RA 2M7UA 3KSFA 2V0UA 4E3NA 3S22A 3Q7VB 1YLZA 1ZG6A 1LI0A 1K25A 3UB9A 2ZBBA 4QB8A 1Q2PA 2H0YA 2P7JA 4HI4A 1HZOA 2WKQA 3M6BA 3B47A 4P6ZM 1XGJA 2J9PA 4XUXA 2V1BA 2HDUA 4CLCA 1FIKA 5DTSA 4I38A 1JTDA 4IBXA 5AVFA 2QMIA 4DRTA 4GDBA 2GJ3A 2ZJ9A 1IYOA 2D01A 3ZNTA 4YINA 4JF5A 4WM9A 3W8KA 1SKOB 2X02A 2W3HA 1YT4A 4Y13A 1FQGA 1OMEA 4DDYA 3FV7A 3MF0A 1OT6A 3RH8B 3KYEA 2ZM2A 3DTMA 1N9OA 1T1BA 4ESPA 4E3KA 5TBMB 4MDZA 3H7WB 3SH7A 4S2IA 1Y28A 5FEFA 4JXGA 3WRZA 5DF8A 4EQ1A 4HP9A 4F3LB 3BFCA 4B4XA 5CTNA 3LR3A 2XA7M 3OPHA 1EROA 2W3GA 1QMFA 2WGIA 3F1OB 3PBTA 2HDRA 2JC7A 2EXBA 2VA0A 3H82A 2EX8A 5F1GA 2E8IA 4RA7A 2PR6A 2XA7S 3GR2A 3ZQ5A 4DDSA 1XP4A 4HJ3A 3BYDA 5IT5A 3IBRA 3MXQA 3MJQA 3UE3A 3PXPA 5J3WA 4KZ7A 1ESIA 3G32A 3HLDA 1W63Q 4EQIA 4S2NA 4X53A 3C8CA 1T1CA 3BQ8A 2Y2NA 2ZC7A 2K7SA 3LCEA 2P08A 2WKEA 1N9NA 1XFNA 3CI6A 5CHUA 1I2WA 3EEHA 3WS1A 1RGZA 3G6OA 3H82B 2FFYA 3MZFA 1E3UA 3PBNA 4UEYA 2XQZA 1ES4A 2HF6A 5AQ7A 2J9OA 5CGXA 5DJTA 5HWVA 2O9BA 2QPNA 2HJ9C 1FCNA 2QWSA 2YKHA 2ZD8A 3JVVA 3ULFA 2V8FA 4HIAA 4GJ4A 4CLCC 4QWOA 1IKIA 5DFYA 5AQBA 4ZJ3A 3C30A 3MSHA 3PHYA 1ODVA 2L0WA 5FAOA 3T12B 4B4ZA 4PM5A 4LRYC 4UAAA 5FI6A 3QHYA 3N8RA 5EVEA 5GLAA 4P87A 1T18A 1ONHA 1XPBA 3ZG5A 4PM7A 2JKGA 1UWPX 3G35A 4BENA 3BLMA 3VSLA 4HY8A 3P98A 2JHEA 4S2NC 3MMHA 4JXSA 3V39A 4EU0A 2M1CA 4MN5A 3AGFA 2ZMFA 2A3UA 3SS3A 2Y79A 5FQMA 1K57A 3GTCA 3DTIA 3KYZA 1S1ZA 4E3OA 3NBLA 3F1PA 3G2ZA 3HLFA 3UE6A 1TF1A 1G68A 5E2HA 2BTFP 2INWA 4ZJ2A 2JCHA 2PYPA 4EBNA 4Q0JA 1ZHHB 2X71A 1IOUA 3U4LP 4GZBA 1DY6A 3O3VA 1NXYA 3EWKA 2XR0A 3G30A 2ZL1A 1NY0A 3VP3A 1CQAA 2Y2GA 1W8YA 3LI8A 3C4OA 2H5SA 3LIFA 2VGKA 3IF6A 3F1OA 2RCXA 5GHXA 1GSVA 5EOEA 2B5RA 2WAEA 1FCOA 3ZG9B 5MC7A 2PYRA 2FFFB 2Y8HA 3NIAA 2G7UA 1VHMA 5AJGA 1BTLA 3LR4A 3Q07A 1K38A 4K91A 1MWUA 5EVLA 2XH9A 4WZ4A 4Z9QA 4Y15A 4E3JA 5FEGA 2J3WA 1XA1A 4GD8A 3ZYTA 5E43A 1PRQA 1SZVA 3E0YA 5FA7A 3LY3A 2EA9A 2GDNA 4E04A 3ZG0A 2PRFA 1HLUP 4QPRA 4N1HA 2OAP1 2G2UA 3CZDA 2HV1A 3IXBA 4MN6A 5BOHA 1D1JA 4Q0IA 4S2PA 1E25A 4OQ0A 3UB7A 3IH9A 1PFLA 3O87A 1S0WA 1VQQA 2DNSA 5A91A 1ES2A 2EX6A 4N9LA 3OCLA 1LSWA 4OLDA 3S7OA 4MBKA 4DMZA 2H28A 4LCLA 3O86A 5G4ZA 4BL3A 2V20A 4KQDA 1Z6FA 3NOPC 5CEDA 3VMAA 1P97A 3DW0A 3R7WA 3T1QB 4X69A 4L9FA 4MMNA 3QP6A 2WKRA 5F82A 1TEMA 1LI9A 2WGWB 3DWKA 3N7WA 3BJNA 3TSGA 2B95A 5DFXA 1YM1A 3BY9A 2J3TC 2OLUA 4S2OA 3MQ0A 3AGDA 3QP1A 2X01A 4JGQA 4WEJA 2V2FF 1KGFA 1NJ4A 2Y2IA 3FYZA 4BLMA 4U3TA 2JKFA 4S2MA 5TGFA 2Z6CA 4JGOA 4C6YA 2PD8A 2XRNA 4OVDA 4E6WA 2C5WB 3HL9A 1O07A 2HJEA 3O5YA 3HUOA 2JKRM 3IQAA 3T4JA 3CAXA 3R4KA 2W3FA 1ACFA 2EX9A 3W2ZA 4DJ3A 1H5XA 4HJ6A 3V50A 1PW8A 3HLGA 2ZQ7A 3LUQA 4KZAA 3CJMA 3IXHA 3LIAA 2XSSA 1K56A 4G3VA 1BLSA 4H6JB 1YLJA 3NULA 5DTTA 1FCMA 4MLLA 1LL8A 5HAPA 3ZG8B 2P04A 5HD3A 4JPMA 1IKGA 3UY6A 1K54C 1NRFA 3T4SA 3IF5A 1TVFA 4DE1A 5HPFA 1Z09A 2DRWA 1G6AA 3UO9A 3TE8A 2JKTM 3CMZA 1ZTUA 2EWWA 3L9KA 3NCKA 1NRJA 3IXGA 3JYIA 4HNBA 2VV6A 1FOFA 5E2EA 4WLAA 1J3WA 2HZ5A 1XX2A 1KGGA 2Y2JA 1BLHA 4U0TA 4Y3IA 4JGPA 4KZ4A 3FZCA 2H0TA 4OH0A 4ARZA 5FQIA 3W4OA 1EW0A 2EXAA 3ZGAB 1OTDA 2Y59A 5G18A 1NZUA 4OOYA 3B42A 2Y2HA 4MN7A 3N8SA 3CHWP 5IU1A 4P6BA 4GS9A 2HDSA 5CERA 4U0XA 3O88A 5EM1A 3UMDA 5HX9A 2UWXA 4L9GA 5L8MA 4PPRA 4OP8A 4DN0A 3MQQA 3HUMA 5DJUA 3ZDJA 2XROA 2OWJA 5F68A 2ACGA 5EE8A 2VK3A 5HAQA 1L0DA 1W5DA 2ZM0A 2ZQ9A 3CWFA 4O8GA 3GDIA 4D2OA 4LV2A 5HDCA 3RFBA 4PM9A 3FKVA 3HREA 3NOTC 1LSXA 2CC1A 3KYQA 2Q0OA 4R4RA 3ZNYA 4GKUA 3MKEA 3V3RA 1N9LA 3HLBA 5HL1A 2WAFA 4KENB 5J8XA 3NHQA 3VOYA 2Y2PA 1XGIA 4FH4A 4UHUA 4I3AA 5CHMA 4JF4A 3DWZA 1BSGA 2J80A 2XEPA 1DJCA 1DJBA 5AQ9A 4LLOB 1DRMA 2ZC4B 2VV7A 1P9WA 1KOUA 5G4YA 1H8ZA 3C7VA 2PU4A 1NYYA 4QHCA 3C38A 2HP9A 1PWGA 2WZZA 4PHTA 2K31A 2K2NA 4NEED 4HJ4A 5CHJA 4NXGA 3OPRA 3UDIA 1L0EA 5C5KA 1K6SA 3D4FA 3CPTA 3ZCZA 2NUPC 3G34A 1GA0A 4DXCA 2O99A 4YNRA 3RTYA 5FDSA 3IWQA 3HVFA 2P9VA 3C5AA 1BT5A 4YOFA 2IWCA 5CECA 4OPRA 3UB6A 2QHKA 3VP2A 3OCNA 2W1TA 1TDLA 1TDGA 5DF7A 2IWDA 3NI9A 4Q8IA 3LEZA 3HLCA 1GCEA 1YLWA 3IS2B 3ZVTA 4BJPA 5L07A 2V1ZA 3TRCA 3CUEC 1K4EA 3N8LA 4HBTA 3OOVA 3VOZA 3MQOA 2QKPA 2GZAA 2WKIA 3BFDA 3GSGA 4E3MA 2DMWA 5FAPA 4XT2B 1G5UA 1S66L 1HVBA 3LR5A 2KOIA 2PT7A 2I9VA 3UN7A 1H8MA 1MXOA 4CJNA 4EXOA 3K3CA 1E4DA 1GSWA 1MWTA 1Y54A 3A0SA 1YQSA 1YAXA 3SW1A 1CJFA 4UQIM 3E2KA 3WRTA 4BD1A 3DAVA 2IWBA 1SKOA 3OZHA 1JVJA 4NXFA 2Y55A 4R3JA 4IUKA 3M2JA 3S7NA 5U47A 5KSHA 1TS0A 1FSWA 3BFFA 2JN7A 3UPPA 3ZG7B 4XXRA 2O9AA 3LICA 4MCWA 5F69A 4ARZB 3P7NA 2R9WA 4Q0HA 4WELA 4OQGA 3I7JA 4BWIA 1OT9A 3H9WA 3EGDC 3L7HA 1YPRA 4S2LA 3C7UA 4NKPA 2VGLS 4L0LA 1YLPA 3FWLA 4I3IA 4YWZA 2XD1A 1ESUA 4BBTA 2Y91A 4GHIB 4LV0A 3PBSA 5A90A 5CTMA 4R1GA 1H0MA 3E4OA 3OLOA 1L0GA 2W0NA 5FL3A 3SOIA 1YLYA 5CXWA 5EVID 4R3BA 4WF0A 4NETA 2OSUA 1IYPA 1TS6A 3KSIA 4DF6A 3IBJA 4X68A 1WYCA 4WZ5A 2QJ7A 4LRZE 4WEKA 2W1RA 4LV3A 2VEAA 4E3LA 4EERA 2I72A 2AVXA 1X0OA 1M40A 4OOMA 1W79A 4R0QA 2O9CA 3M6HA 4GS9B 5GLCA 1KVMA 4FTXA 2GX5A 4EW7A 2W1TB 3CUEA 3WS4A 5KMWA 4B93A 1BUEA 1OJGA 4IVKA 2C6WB 1N9BA 3F1NB 5J4EA 3NDEA 4P6ZS 3Q7VA 5I94A 1FR6A 3UPOA 2KLIA 3B3XA 5DF9A 2YKFA 4GD6A 3T4QA 1PIOA 1FR1A 1DP6A 1KE3A 1LSVA 4WUJA 3MS6A 2L1MA 3BQAA 3E98A 3S4XA 3A3JA 3C4PA 1VM1A 1XJ6A 4X56A 5HSQA 2BASA 2WKPA 1U60A 1TS8A 4E6XA 3A0RA 1LL9A 1MPLA 3PYPA 1JWPA 4OPQA 3LFVA 5HWWA 4EEUA 3UMEA 5K5BA 1V9ZA 4OQHA 4WMCA 1STZA 2XK1A 4LV1A 4IJGA 4A5RA 5TR7A 2VV8A 4R38A 3ISGA 1W8QA 2Y2OA 3UDFA 4I3JA 1W63M 2P74A 2V0WA 1S67L 1K0KA 2EFXA 3IHAA 5FSRA 2EWVA 4MBHA 1DP9A 4HEFA 4KZ6A 3T50A 5M18A 4OP5A 1EI5A 1MY8A 4R23A 5EECA 1H8YA 3GMWA 2D02A 2Z6DA 1MWRA 1NYMA 3VP4A 4CQHA 3CITA 1LHYA 4LCMA 4ETZA 5GLDA 2OV5A 2QYBA 2E8JA 1PW1A 3VP1A 1YSPA 3MKFA 2H10A 4PKYA 5IHVA 1PWDA 2A49A 2VKSA 2V9AA 4HHDA 3OPPA 4RQ9A 4KG5A 3T1RA 4FH2A 4O0PA 4I5SA 5AQAA 4F94A 3ITAA 3IT9A 3IWIA 4UA7A 4X1LA 1KVLA 1HD8A 1ERMA 3HJIA 4KZ5A 1PWCA 4FSFA 3D72A 4MBFA 1MKIA 3KO6A 2HPBA 1XJ4A 4IVIA 2XD5A 3VE4A 2G2WA 1CK3A 4G3WA 5FQJA 2OLVA 3PR6A 3SH9A 3P09A 1KDSA
chains in the Genus database with same CATH topology
4BMWA 3IBRA 3MXQA 3MJQA 3UE3A 3PXPA 5IS1A 1TD5A 1UWNX 3V67A 5J3WA 1F9IA 1BYWA 1YKDA 2HGVA 3CWFA 4O8GA 4KUKA 3IS2A 1W63Q 2MJ6A 3F1NA 3C8CA 3PBRA 3GDIA 5HDCA 1T1CA 2IA2A 3BQ8A 3RFBA 4R3AA 4K08A 3HJKA 3NOTC 1LSXA 3KYQA 2K7SA 3B33A 2P08A 4NXBA 1N9NA 1XFNA 3JVUA 3CI6A 1N9LA 4R70A 4LRXC 3EEHA 3G6OA 3H82B 3TJZC 4PAUA 3VE3A 3PBNA 4UEYA 5HPIA 3FPWA 3NHQA 2J3TD 2HF6A 1OJ5A 1VB6A 5DJTA 4HQAA 4I3AA 5HWVA 2O9BA 3KX0X 5J7EA 1MC0A 2HJ9C 2J80A 2QWSA 2YKHA 3JVVA 3ULFA 1NLZA 4LLOB 4HIAA 4GJ4A 4CLCC 2CMNA 2VZWA 1DRMA 2VV7A 1P9WA 5DFYA 4XT2A 1KOUA 3C30A 5G4YA 2GNXA 3PHYA 2KDKA 2QJ5A 4HH2A 1ODVA 3LIEA 2OAQ1 2L0WA 4CLCD 3C38A 3FPVA 3P01A 4PHTA 2K31A 4LRYC 2K2NA 2B18A 3S7QA 4NEED 4HJ4A 4NXGA 1IFQA 5C5KA 1T18A 2A2LA 2NUPC 2PHYA 1UWPX 2PDRA 2O99A 4YNRA 3RTYA 1GSXA 4HY8A 4EEPA 2JHEA 3MMHA 5A8BA 4YOFA 4EU0A 2M1CA 5EFWA 4MN5A 3HCYA 1MZUA 2QHKA 3UB6A 3OCNA 2W1TA 2ZMFA 2Y79A 1OTEA 3KYZA 4EESA 1S1ZA 1NLYA 4M4XA 3F1PA 3UE6A 1TF1A 3IS2B 2KX6A 1H3QA 4BJPA 4O01A 2INWA 1F5MA 4WL9A 2PYPA 3TRCA 4Q0JA 3CUEC 1ZHHB 4GHIA 3OOVA 1IOUA 5F6AA 4ME4A 4GLQA 3LI9A 4HH3A 3EWKA 3MQOA 4G3KA 2QKPA 4FOFA 2GZAA 3R7WB 2FH5A 3UB8A 3BWLA 3LI8A 2DMWA 3LIFA 4XT2B 3LYXA 3NOUC 1S66L 2JKRI 3LR5A 2KOIA 4II7A 3T4KA 3F1OA 2PT7A 3EEAA 2I9VA 1MKMA 2LB5A 1GSVA 1H8MA 1XJ2A 3D3OA 4EXOA 3K3CA 5MC7A 1GSWA 2PYRA 3A0SA 3E4PA 1YAXA 3SW1A 4Y2FA 2Y8HA 4CLCB 4UQIM 2G7UA 1G6OA 4EUVA 1D06A 1TS7A 3NJAA 2ZOHA 1VHMA 4Y5FA 5AJGA 2VLGA 3LR4A 2M7VA 5DKLA 4NXFA 2ZMVA 4IHQA 2OWHA 5HDDA 4LPZA 1UGUA 3OBFA 5HDSA 4IUKA 3S7NA 3S7PA 5KSHA 2JKTI 1TS0A 2JN7A 4L9EA 4DJ2A 2ZOIA 2O9AA 3LICA 2A24B 2J3WA 3K3DA 4MCWA 5F69A 4ARZB 3P7NA 3ZYTA 4KUOA 4OOLA 1OTBA 4ETXA 3EGXC 4Q0HA 2PD7A 2B02A 4WELA 3E0YA 3EQUA 3T4OA 4BWIA 1OT9A 3H9WA 3EGDC 3LR0A 3FG8A 2EA9A 1S4SA 1S1YA 1OTAA 4AFIA 4E04A 4NKPA 4PKYG 2VGLS 4L0LA 4QPRA 4BBVA 5TJJA 2OAP1 4I3IA 1F98A 4YWZA 3E4QA 2HV1A 4MN6A 4UQIS 2VJWA 4BBTA 1DP8A 4Q0IA 5HD5A 4GHIB 3FC7A 4Z1WA 3PBSA 3UB7A 3BW6A 1P0ZA 4NXEA 5I5LA 4H6JA 1NWZA 3H7WA 1XJ3A 3VOLA 3PBOA 3E4OA 3LIBA 3OCLA 1LSWA 3OLOA 3C2WA 1V9YA 2W0NA 5FL3A 5F5YA 4WF0A 4HP4A 3S7OA 1T19A 2VX8A 4GW9A 4R6LA 1TS6A 4DMZA 2H28A 3KSIA 3IBJA 2PR5A 4F3LA 2QJ7A 3F1PB 5G4ZA 3T4LA 4LRZE 4WEKA 2W1RA 5CX7A 5HWTA 4KQDA 5HL6A 2VEAA 3NOPC 4EERA 1X0OA 2V1AA 1P97A 4OOMA 1P9RA 5TBMA 3R7WA 2O9CA 4I39A 4GS9B 1LT0A 5HZHA 4L9FA 4MMNA 2WKRA 3ICYA 2GX5A 4EW7A 2W1TB 3CUEA 3MFXA 1G28A 3K2NA 3KSGA 3BJNA 4B93A 5DFXA 1YSQA 1OJGA 3F1NB 5J4EA 4P6ZS 3BY9A 3A0VA 2J3TC 2OOLA 2KLIA 4JGRA 3MQ0A 1XFQA 5DF9A 4JGQA 4WEJA 2YKFA 3T4QA 1WA9A 2M7UA 1DP6A 1LSVA 3KSFA 2NUTC 4WUJA 2L1MA 2Z6CA 2V0UA 4JGOA 3BQAA 3E98A 2R78A 3OC2A 2PD8A 2XRNA 1JNUA 1OTIA 3UB9A 1XJ6A 5HSQA 2BASA 2ZBBA 2HJEA 2WKPA 3O5YA 5AVEA 2JKRM 3CLOA 4WN5A 2P7JA 3T4JA 3CAXA 4HI4A 1TS8A 3TW8A 3R4KA 2W3FA 4B9OA 2WKQA 3A0RA 3EOIA 3B47A 4P6ZM 3W2ZA 4DJ3A 3PYPA 3DBAA 4BBUA 3LFVA 4HJ6A 2V1BA 5HWWA 4EEUA 3UMEA 5K5BA 3LUQA 4CLCA 1V9ZA 4IUHA 3LIAA 2XSSA 4I38A 1STZA 4G3VA 4H6JB 4IJGA 5AVFA 2VV8A 4R38A 4EETB 2GJ3A 4KQOA 2D01A 1LL8A 2P04A 5HD3A 4I3JA 3GECA 1W63M 3T4SA 2W3HA 2V0WA 1S67L 3LIDA 1OT6A 3MF0A 3RH8B 5HPFA 2EWVA 1DP9A 2O0YA 1N9OA 1T1BA 3TE8A 3T50A 2JKTM 1ZTUA 2EWWA 1NRJA 2D02A 5TBMB 3T4TA 2Z6DA 2W3DA 4HNBA 4MDZA 4CQHA 3KSHA 2VV6A 2W27A 4WLAA 3CITA 3H7WB 4ETZA 2VGLM 5LBRA 2FZ0A 4Y3IA 4JGPA 2QYBA 1Y28A 4CLCE 3BY8A 2LB9A 1YSPA 4ARZA 4PKYA 1EW0A 2VKSA 2V9AA 4HHDA 1OPXA 3U2AA 4RQ9A 1OTDA 1S4RA 4EQ1A 4HP9A 3B42A 4F3LB 3MR0A 4O0PA 4I5SA 4MN7A 2W3EA 3LR3A 5IU1A 4GS9A 5KIZA 2XA7M 3HJIA 3UMDA 4HOIA 4ZRRA 2W3GA 4L9GA 1D7EA 5L8MA 3VV4A 2L4RA 3PBTA 3F1OB 4FSFA 3D72A 5DKKA 2VA0A 3MQQA 4DN0A 3H82A 3KO6A 4GCZA 2PR6A 2XA7S 3ZQ5A 1XJ4A 3VE4A 4HJ3A 3PBQA 5DJUA 2XROA 4G3WA 5IT5A 3PR6A 1T1AA 3EQVA 2OWJA 2A24A 5F68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Y A;  1OTA A;  3IBR A;  3CLO A;  4WN5 A;  2P7J A;  3MXQ A;  3CAX A;  3MJQ A;  1TS8 A;  4HI4 A;  4B9O A;  4E04 A;  5IS1 A;  2WKQ A;  3A0R A;  1OTE A;  4PKY G;  1UWN X;  4DJ3 A;  3PYP A;  5J3W A;  1F9I A;  4BBU A;  4EES A;  1S1Z A;  4HJ6 A;  4BBV A;  5EFW A;  1BYW A;  4M4X A;  3F1P A;  3UE6 A;  2V1B A;  4I3I A;  1F98 A;  3IS2 B;  2KX6 A;  4YWZ A;  3E4Q A;  3UME A;  4EEU A;  2HV1 A;  3LUQ A;  4MN6 A;  1V9Z A;  3LIA A;  3CWF A;  4BBT A;  4KUK A;  3IS2 A;  4I38 A;  2INW A;  1DP8 A;  4WL9 A;  2PYP A;  4GHI B;  4H6J B;  3FC7 A;  5HD5 A;  3F1N A;  3UB7 A;  3C8C A;  1P0Z A;  5AVF A;  3GDI A;  4NXE A;  5I5L A;  2VV8 A;  4R38 A;  4GHI A;  1T1C A;  1NWZ A;  3H7W A;  4H6J A;  5HDC A;  4EET B;  2GJ3 A;  4R3A A;  4K08 A;  3HJK A;  2D01 A;  3NOT C;  1LSX A;  5F6A A;  2K7S A;  1LL8 A;  3B33 A;  1XJ3 A;  3LI9 A;  4NXB A;  5HD3 A;  1N9N A;  4HH3 A;  3VOL A;  3E4O A;  3EWK A;  3LIB A;  3MQO A;  1LSW A;  1XFN A;  3OLO A;  3C2W A;  2QKP A;  1V9Y A;  1N9L A;  2W0N A;  3GEC A;  4I3J A;  4R70 A;  4LRX C;  5F5Y A;  3EEH A;  4WF0 A;  5F68 A;  3UB6 A;  3G6O A;  3H82 B;  4HP4 A;  1T19 A;  4R6L A;  4GW9 A;  3UB8 A;  2V0W A;  1TS6 A;  1S67 L;  2H28 A;  3VE3 A;  3BWL A;  2PR5 A;  1OT6 A;  3LID A;  2WKP A;  3NHQ A;  3LI8 A;  3RH8 B;  4F3L A;  1DP9 A;  2QJ7 A;  1OJ5 A;  1N9O A;  3LIF A;  1T1B A;  1VB6 A;  3F1P B;  5DJT A;  4HQA A;  4I3A A;  4LRZ E;  4XT2 B;  3LYX A;  3NOU C;  1S66 L;  5G4Z A;  5HWT A;  5HWV A;  5HWW A;  4KQD A;  2VEA A;  3KX0 X;  5J7E A;  3NOP C;  3F1O A;  4EER A;  2I9V A;  2D02 A;  5TBM B;  1X0O A;  2Z6D A;  2J80 A;  4HNB A;  2V1A A;  1GSV A;  2QWS A;  2YKH A;  1P97 A;  1XJ2 A;  2VV6 A;  2W27 A;  4WLA A;  5TBM A;  3ULF A;  3H7W B;  4EXO A;  3K3C A;  4I39 A;  4LLO B;  4HIA A;  2CMN A;  4GS9 B;  1LT0 A;  1DRM A;  4JGP A;  5HZH A;  2VV7 A;  1Y28 A;  1GSW A;  4L9F A;  1KOU A;  2PYR A;  4XT2 A;  5AVE A;  5G4Y A;  2WKR A;  3ICY A;  3A0S A;  3E4P A;  3PHY A;  3T50 A;  3BY8 A;  4EW7 A;  3SW1 A;  3MFX A;  1G28 A;  2KDK A;  4PKY A;  1D06 A;  1TS7 A;  2QJ5 A;  1EW0 A;  2ZOH A;  3NJA A;  2V9A A;  1OJG A;  2VLG A;  1ODV A;  3LIE A;  4HHD A;  3F1N B;  4HH2 A;  5J4E A;  2L0W A;  4RQ9 A;  5DKL A;  1OTD A;  1S4R A;  4EQ1 A;  3BY9 A;  4NXF A;  3A0V A;  2OOL A;  2OWH A;  4HP9 A;  4LRY C;  4F3L B;  5HDD A;  3MR0 A;  4LPZ A;  1UGU A;  4JGR A;  4I5S A;  1XFQ A;  5HDS A;  4HJ4 A;  4JGQ A;  5IU1 A;  2YKF A;  4GS9 A;  1WA9 A;  4NXG A;  1TS0 A;  5F69 A;  2JN7 A;  4L9E A;  5KIZ A;  1T18 A;  3HJI A;  4DJ2 A;  1DP6 A;  3UMD A;  1LSV A;  3RTY A;  4HOI A;  2ZOI A;  3LIC A;  4WUJ A;  2A24 B;  1D7E A;  4L9G A;  2PHY A;  2L4R A;  1UWP X;  2L1M A;  2PDR A;  2Z6C A;  3F1O B;  2V0U A;  3K3D A;  3D72 A;  3P7N A;  4JGO A;  4KUO A;  1GSX A;  1OTB A;  3MQQ A;  4HY8 A;  5DKK A;  2R78 A;  3H82 A;  4EEP A;  2JHE A;  2PD7 A;  2B02 A;  2PD8 A;  4GCZ A;  2PR6 A;  1JNU A;  3ZQ5 A;  1XJ4 A;  5A8B A;  1OTI A;  3VE4 A;  4HJ3 A;  1XJ6 A;  5DJU A;  3UB9 A;  5HSQ A;  1OT9 A;  2BAS A;  2ZBB A;  3H9W A;  3FG8 A;  1T1A A;  2M1C A;  2OWJ A;  4MN5 A;  2A24 A;  1MZU A;  2QHK A;  2EA9 A;  1S4S A; 
#chains in the Genus database with same CATH topology
 1KDW A;  4DKI A;  3V67 A;  5A92 A;  5FAT A;  1YKD A;  4RYE A;  4K0X A;  2MJ6 A;  3F1N A;  4NG2 A;  4R3A A;  3HJK A;  3MBZ A;  4NXB A;  4RX2 A;  4R70 A;  4ZTK A;  2Y2K A;  2BG1 A;  3TJZ C;  2R9X A;  3PTE A;  1O7E A;  1OJ5 A;  3UE1 A;  4QU3 A;  1N4O A;  2PBD P;  1VEU A;  1NLZ A;  4R4S A;  3SZT A;  3BEC A;  2CMN A;  1GHP A;  2XDM A;  1SKF A;  4X55 A;  2GNX A;  5KZH A;  3IH8 A;  3LIE A;  4CLC D;  2ZC3 B;  1GA9 A;  2XF3 A;  3AGE A;  3LO7 A;  3SS5 A;  1IFQ A;  2XGN A;  2J7V A;  1J9M A;  1K4F A;  5M19 A;  2A2L A;  3Q1F A;  4JBF A;  2PHY A;  5GHY A;  1GSX A;  4EEP A;  4GDN A;  2ZQ8 A;  4OON A;  5A8B A;  5A93 A;  3HCY A;  1EWZ A;  3A3E A;  2JBF A;  1NLY A;  4M4X A;  3VFH A;  1H3Q A;  5EVI B;  2WGW A;  4O01 A;  4WL9 A;  3NEC A;  5FQ9 A;  4KQQ A;  5EUA A;  1ZG4 A;  1HTZ A;  4P0M A;  4S2K A;  5F6A A;  4ME4 A;  1I2S A;  4DE3 A;  3LI9 A;  2Y2Q A;  4HH3 A;  4WZ5 C;  1ERQ A;  4QJG A;  1FIL A;  3PAG A;  4EV4 A;  2FH5 A;  3UPN A;  4FUW A;  3BWL A;  5D3O A;  4PM8 A;  3LYX A;  3NOU C;  1QME A;  4GOG A;  2J8Y A;  5DVA A;  3T4K A;  3HLW A;  4JLF A;  5DTK A;  2RL3 A;  1XJ2 A;  3D3O A;  1IYS A;  4Y2F A;  3TOI A;  4Y0U A;  1D06 A;  1TS7 A;  3IHB A;  2ZOH A;  2XFS A;  2VLG A;  2M7V A;  5DKL A;  5E2G A;  2ZMV A;  4P85 A;  2ZQC A;  4ZJ1 A;  2OWH A;  5HDD A;  3OBF A;  2ZC6 B;  5HDS A;  3IF6 B;  3S7P A;  2JKT I;  3QNC A;  4GNU A;  3MFD A;  4L9E A;  3VFF A;  5L10 A;  3G31 A;  3A3I A;  2ZOI A;  2A24 B;  3T1X A;  4KZ3 A;  4OOL A;  3ZFZ A;  3LGO A;  3SS4 A;  2PD7 A;  3DTK A;  1PZP A;  4M3K A;  3LR0 A;  3FG8 A;  2WGV A;  2Z2L B;  4AFI A;  4PKY G;  3BFG A;  4MEZ A;  4YFM A;  4HES A;  5TJJ A;  4LGW A;  1VEU B;  4UQI S;  2VJW A;  3WS2 A;  4N1X A;  1DP8 A;  5HD5 A;  3FC7 A;  4EWF A;  3BRM A;  3BW6 A;  1P0Z A;  5EVI C;  5I5L A;  4H6J A;  1NWZ A;  3H7W A;  4KZ9 A;  4C75 A;  5FDH A;  1CEG A;  3PBO A;  4Y0T A;  3C2W A;  1V9Y A;  5F1F A;  5F5Y A;  5FAQ A;  4R6L A;  2WYX A;  2PR5 A;  4F3L A;  1AWI A;  3T4L A;  3BFE A;  1C3B A;  5HWT A;  5HL6 A;  3W4P A;  2ZMA A;  3S1Y A;  4GN2 A;  4FCF A;  1P9R A;  3Q81 A;  1PZO A;  1SCW A;  3A3D A;  2EFU A;  1KGE A;  4BQM A;  1VET A;  4OPZ A;  1ZKJ A;  5HZH A;  3NC8 A;  4Y7P A;  5E2F A;  3ICY A;  1I5Q A;  3BLS A;  5KSC A;  3MFX A;  1G28 A;  3K2N A;  1SDN A;  1PI5 A;  1YSQ A;  1WE4 A;  4H8R A;  1XXM A;  3A0V A;  2OOL A;  4JGR A;  4X6T A;  4MNR A;  3IX3 A;  5EOO A;  4PMA A;  2NUT C;  2Y2L A;  4HBU A;  3G2Y A;  2Y2M A;  2R78 A;  4Y17 A;  3OC2 A;  4O7D A;  4EBP A;  2QZ6 A;  1JNU A;  1OTI A;  4B88 A;  4Y0O A;  5EV0 A;  1CEF A;  5AVE A;  2PAV P;  3CLO A;  4WN5 A;  3TW8 A;  4B9O A;  3TG9 A;  2WZX A;  3EOI A;  3WS0 A;  3DBA A;  4BBU A;  5HW3 A;  4IUH A;  4EET B;  1KE4 A;  4KQO A;  1RGY A;  3GEC A;  3QP5 A;  4UA9 A;  4N92 A;  4QY5 A;  1IEM A;  3GRJ A;  3LID A;  4DE0 A;  2O0Y A;  2ZL1 B;  3IX4 A;  1ALQ A;  4RVA A;  5L09 A;  1GHI A;  3RJU A;  3UB5 P;  3T4T A;  1IYQ A;  5FQK A;  2W3D A;  3KSH A;  4IBR A;  2W27 A;  3BM6 A;  2VGL M;  5LBR A;  1NZO A;  2FZ0 A;  2HDQ A;  4CLC E;  1W7F A;  3BY8 A;  2LB9 A;  3UNW A;  3V3S A;  4D60 A;  1OPX A;  3U2A A;  4LEN A;  1S4R A;  4OQI A;  3IWO A;  3MR0 A;  3QP8 A;  1F2K A;  1GHM A;  3WS5 A;  2W3E A;  2DCF A;  1XKZ A;  1FSY A;  5GL9 A;  5KIZ A;  4HOI A;  3SH8 A;  4ZRR A;  1D7E A;  2Q9N A;  3VV4 A;  2L4R A;  4KZ8 A;  5EVI A;  5DKK A;  2VGJ A;  4GCZ A;  4DE2 A;  3PBQ A;  2PBY A;  3UDX A;  5L2F A;  1T1A A;  3EQV A;  2A24 A;  4BMW A;  1CI9 A;  1JTG A;  1ONG A;  5IS1 A;  1TD5 A;  1UWN X;  3FKW A;  4ZBE A;  1F9I A;  4WYY A;  3HUN A;  1BYW A;  4OKP A;  3UE0 A;  4KG2 A;  2HGV A;  4KUK A;  3IS2 A;  2Z2M B;  4N9K A;  3PBR A;  4PM6 A;  2IA2 A;  4K08 A;  3LEQ A;  2JE5 A;  3B33 A;  4ID4 A;  5F83 A;  3CG5 A;  3IX8 A;  5EPH A;  4BD0 A;  4OPY A;  3JVU A;  4X25 A;  4LRX C;  5JYP A;  4WBG A;  3T1S A;  3GQZ A;  1SHV A;  4PAU A;  3VE3 A;  4RX3 A;  2V8C A;  4EBL A;  5HPI A;  3FPW A;  2J3T D;  4KQR A;  2ZQA A;  1VB6 A;  4HQA A;  2Q9M A;  3KX0 X;  5J7E A;  1MC0 A;  3ZHH A;  2ZM8 A;  5FI2 A;  1MBL A;  5CRF A;  2VZW A;  1LL5 A;  4XT2 A;  1YMX A;  3OPL A;  1L0F A;  4GB7 A;  2KDK A;  3RXX A;  4KG6 A;  2QJ5 A;  2WKH A;  4HH2 A;  2OAQ 1;  3FPV A;  3IF6 C;  3P01 A;  4QY6 A;  1KE0 A;  2B18 A;  3S7Q A;  2XFT A;  4NK3 A;  2EX2 A;  1VET B;  1SDE A;  3MZD A;  5JYO A;  1Y4O A;  2PDR A;  3RXW A;  1YLT A;  3HLE A;  3E2L A;  3MXR A;  3D9Y A;  1RP5 A;  3GV9 A;  2UV0 E;  5EFW A;  5TFQ A;  1MZU A;  5GHZ A;  4JXV A;  1RCJ A;  3DTE A;  1JWZ A;  1OTE A;  4EES A;  4EUZ A;  4ZAM A;  1XA7 A;  3M2K A;  2KX6 A;  4DXB A;  3Q7Z A;  1PNE A;  1F5M A;  1K57 C;  3LY4 A;  5CGS A;  2XLN A;  4IED A;  1ES5 A;  4UA6 A;  4GHI A;  1ES3 A;  5FAS A;  3BEB A;  4K0W A;  4GLQ A;  4X1M A;  3JPU A;  3VP0 A;  4G3K A;  5GLB A;  5HFO A;  4FOF A;  4BL2 A;  3R7W B;  1CI8 A;  3GVB A;  3UB8 A;  3N4I A;  1A0K A;  1M6K A;  1BZA A;  3N6I A;  2JKR I;  1ZC2 A;  4II7 A;  3NDG A;  3EEA A;  3VSK A;  3Q82 A;  3PAE A;  1MKM A;  2LB5 A;  1IEL A;  1CF0 A;  5M1A A;  1L2S A;  3MZE A;  3QP2 A;  2PU2 A;  3E4P A;  3MXS A;  1MWS A;  1PYY A;  4CLC B;  4JXW A;  1G6O A;  4S2J A;  2ZC5 B;  4EUV A;  1K55 C;  3WWX A;  3NJA A;  4Y5F A;  1DJA A;  3CPT B;  4JKT A;  4IHQ A;  4LPZ A;  1UGU A;  1BUL A;  2HP5 A;  3QNB A;  4DJ2 A;  2HP6 A;  3HBR A;  2WK0 A;  3K3D A;  4CPK A;  3G4P A;  4KUO A;  4ETX A;  1OTB A;  3EGX C;  2B02 A;  1L3L A;  3EQU A;  3T4O A;  1K54 A;  4ZDX A;  3QP4 A;  1S4S A;  1S1Y A;  1OTA A;  4FD8 A;  3V5M A;  4BBV A;  4OLG A;  5HAR A;  1BLC A;  1F98 A;  3E4Q A;  1YMS A;  1WYB A;  3W4Q A;  4KZB A;  4Z1W A;  3IXD A;  3ITB A;  4NXE A;  2ZQD A;  1PI4 A;  1BLP A;  1XJ3 A;  2WAD A;  3VOL A;  3LIB A;  3ZVW A;  4JF6 A;  5FQQ A;  4HP4 A;  1T19 A;  2VX8 A;  4GW9 A;  5CGW A;  2Y4A A;  1LLB A;  5HAI A;  5FI7 A;  2P9V B;  2WUQ A;  3F1P B;  5CX7 A;  2ZLY A;  4WMC D;  4E3I A;  1K56 D;  2V1A A;  1AXB A;  1K55 A;  4C3Q A;  1JWV A;  5TBM A;  4I39 A;  1LT0 A;  4XUZ A;  1Q2Q A;  3KSG A;  4LFU A;  3A3F A;  5CEB A;  4QD4 A;  2BLS A;  3NY4 A;  5EM0 A;  1K6R A;  1XFQ A;  1WA9 A;  1E3U D;  1S6R A;  2M7U A;  3KSF A;  2V0U A;  4E3N A;  3S22 A;  3Q7V B;  1YLZ A;  1ZG6 A;  1LI0 A;  1K25 A;  3UB9 A;  2ZBB A;  4QB8 A;  1Q2P A;  2H0Y A;  2P7J A;  4HI4 A;  1HZO A;  2WKQ A;  3M6B A;  3B47 A;  4P6Z M;  1XGJ A;  2J9P A;  4XUX A;  2V1B A;  2HDU A;  4CLC A;  1FIK A;  5DTS A;  4I38 A;  1JTD A;  4IBX A;  5AVF A;  2QMI A;  4DRT A;  4GDB A;  2GJ3 A;  2ZJ9 A;  1IYO A;  2D01 A;  3ZNT A;  4YIN A;  4JF5 A;  4WM9 A;  3W8K A;  1SKO B;  2X02 A;  2W3H A;  1YT4 A;  4Y13 A;  1FQG A;  1OME A;  4DDY A;  3FV7 A;  3MF0 A;  1OT6 A;  3RH8 B;  3KYE A;  2ZM2 A;  3DTM A;  1N9O A;  1T1B A;  4ESP A;  4E3K A;  5TBM B;  4MDZ A;  3H7W B;  3SH7 A;  4S2I A;  1Y28 A;  5FEF A;  4JXG A;  3WRZ A;  5DF8 A;  4EQ1 A;  4HP9 A;  4F3L B;  3BFC A;  4B4X A;  5CTN A;  3LR3 A;  2XA7 M;  3OPH A;  1ERO A;  2W3G A;  1QMF A;  2WGI A;  3F1O B;  3PBT A;  2HDR A;  2JC7 A;  2EXB A;  2VA0 A;  3H82 A;  2EX8 A;  5F1G A;  2E8I A;  4RA7 A;  2PR6 A;  2XA7 S;  3GR2 A;  3ZQ5 A;  4DDS A;  1XP4 A;  4HJ3 A;  3BYD A;  5IT5 A;  3IBR A;  3MXQ A;  3MJQ A;  3UE3 A;  3PXP A;  5J3W A;  4KZ7 A;  1ESI A;  3G32 A;  3HLD A;  1W63 Q;  4EQI A;  4S2N A;  4X53 A;  3C8C A;  1T1C A;  3BQ8 A;  2Y2N A;  2ZC7 A;  2K7S A;  3LCE A;  2P08 A;  2WKE A;  1N9N A;  1XFN A;  3CI6 A;  5CHU A;  1I2W A;  3EEH A;  3WS1 A;  1RGZ A;  3G6O A;  3H82 B;  2FFY A;  3MZF A;  1E3U A;  3PBN A;  4UEY A;  2XQZ A;  1ES4 A;  2HF6 A;  5AQ7 A;  2J9O A;  5CGX A;  5DJT A;  5HWV A;  2O9B A;  2QPN A;  2HJ9 C;  1FCN A;  2QWS A;  2YKH A;  2ZD8 A;  3JVV A;  3ULF A;  2V8F A;  4HIA A;  4GJ4 A;  4CLC C;  4QWO A;  1IKI A;  5DFY A;  5AQB A;  4ZJ3 A;  3C30 A;  3MSH A;  3PHY A;  1ODV A;  2L0W A;  5FAO A;  3T12 B;  4B4Z A;  4PM5 A;  4LRY C;  4UAA A;  5FI6 A;  3QHY A;  3N8R A;  5EVE A;  5GLA A;  4P87 A;  1T18 A;  1ONH A;  1XPB A;  3ZG5 A;  4PM7 A;  2JKG A;  1UWP X;  3G35 A;  4BEN A;  3BLM A;  3VSL A;  4HY8 A;  3P98 A;  2JHE A;  4S2N C;  3MMH A;  4JXS A;  3V39 A;  4EU0 A;  2M1C A;  4MN5 A;  3AGF A;  2ZMF A;  2A3U A;  3SS3 A;  2Y79 A;  5FQM A;  1K57 A;  3GTC A;  3DTI A;  3KYZ A;  1S1Z A;  4E3O A;  3NBL A;  3F1P A;  3G2Z A;  3HLF A;  3UE6 A;  1TF1 A;  1G68 A;  5E2H A;  2BTF P;  2INW A;  4ZJ2 A;  2JCH A;  2PYP A;  4EBN A;  4Q0J A;  1ZHH B;  2X71 A;  1IOU A;  3U4L P;  4GZB A;  1DY6 A;  3O3V A;  1NXY A;  3EWK A;  2XR0 A;  3G30 A;  2ZL1 A;  1NY0 A;  3VP3 A;  1CQA A;  2Y2G A;  1W8Y A;  3LI8 A;  3C4O A;  2H5S A;  3LIF A;  2VGK A;  3IF6 A;  3F1O A;  2RCX A;  5GHX A;  1GSV A;  5EOE A;  2B5R A;  2WAE A;  1FCO A;  3ZG9 B;  5MC7 A;  2PYR A;  2FFF B;  2Y8H A;  3NIA A;  2G7U A;  1VHM A;  5AJG A;  1BTL A;  3LR4 A;  3Q07 A;  1K38 A;  4K91 A;  1MWU A;  5EVL A;  2XH9 A;  4WZ4 A;  4Z9Q A;  4Y15 A;  4E3J A;  5FEG A;  2J3W A;  1XA1 A;  4GD8 A;  3ZYT A;  5E43 A;  1PRQ A;  1SZV A;  3E0Y A;  5FA7 A;  3LY3 A;  2EA9 A;  2GDN A;  4E04 A;  3ZG0 A;  2PRF A;  1HLU P;  4QPR A;  4N1H A;  2OAP 1;  2G2U A;  3CZD A;  2HV1 A;  3IXB A;  4MN6 A;  5BOH A;  1D1J A;  4Q0I A;  4S2P A;  1E25 A;  4OQ0 A;  3UB7 A;  3IH9 A;  1PFL A;  3O87 A;  1S0W A;  1VQQ A;  2DNS A;  5A91 A;  1ES2 A;  2EX6 A;  4N9L A;  3OCL A;  1LSW A;  4OLD A;  3S7O A;  4MBK A;  4DMZ A;  2H28 A;  4LCL A;  3O86 A;  5G4Z A;  4BL3 A;  2V20 A;  4KQD A;  1Z6F A;  3NOP C;  5CED A;  3VMA A;  1P97 A;  3DW0 A;  3R7W A;  3T1Q B;  4X69 A;  4L9F A;  4MMN A;  3QP6 A;  2WKR A;  5F82 A;  1TEM A;  1LI9 A;  2WGW B;  3DWK A;  3N7W A;  3BJN A;  3TSG A;  2B95 A;  5DFX A;  1YM1 A;  3BY9 A;  2J3T C;  2OLU A;  4S2O A;  3MQ0 A;  3AGD A;  3QP1 A;  2X01 A;  4JGQ A;  4WEJ A;  2V2F F;  1KGF A;  1NJ4 A;  2Y2I A;  3FYZ A;  4BLM A;  4U3T A;  2JKF A;  4S2M A;  5TGF A;  2Z6C A;  4JGO A;  4C6Y A;  2PD8 A;  2XRN A;  4OVD A;  4E6W A;  2C5W B;  3HL9 A;  1O07 A;  2HJE A;  3O5Y A;  3HUO A;  2JKR M;  3IQA A;  3T4J A;  3CAX A;  3R4K A;  2W3F A;  1ACF A;  2EX9 A;  3W2Z A;  4DJ3 A;  1H5X A;  4HJ6 A;  3V50 A;  1PW8 A;  3HLG A;  2ZQ7 A;  3LUQ A;  4KZA A;  3CJM A;  3IXH A;  3LIA A;  2XSS A;  1K56 A;  4G3V A;  1BLS A;  4H6J B;  1YLJ A;  3NUL A;  5DTT A;  1FCM A;  4MLL A;  1LL8 A;  5HAP A;  3ZG8 B;  2P04 A;  5HD3 A;  4JPM A;  1IKG A;  3UY6 A;  1K54 C;  1NRF A;  3T4S A;  3IF5 A;  1TVF A;  4DE1 A;  5HPF A;  1Z09 A;  2DRW A;  1G6A A;  3UO9 A;  3TE8 A;  2JKT M;  3CMZ A;  1ZTU A;  2EWW A;  3L9K A;  3NCK A;  1NRJ A;  3IXG A;  3JYI A;  4HNB A;  2VV6 A;  1FOF A;  5E2E A;  4WLA A;  1J3W A;  2HZ5 A;  1XX2 A;  1KGG A;  2Y2J A;  1BLH A;  4U0T A;  4Y3I A;  4JGP A;  4KZ4 A;  3FZC A;  2H0T A;  4OH0 A;  4ARZ A;  5FQI A;  3W4O A;  1EW0 A;  2EXA A;  3ZGA B;  1OTD A;  2Y59 A;  5G18 A;  1NZU A;  4OOY A;  3B42 A;  2Y2H A;  4MN7 A;  3N8S A;  3CHW P;  5IU1 A;  4P6B A;  4GS9 A;  2HDS A;  5CER A;  4U0X A;  3O88 A;  5EM1 A;  3UMD A;  5HX9 A;  2UWX A;  4L9G A;  5L8M A;  4PPR A;  4OP8 A;  4DN0 A;  3MQQ A;  3HUM A;  5DJU A;  3ZDJ A;  2XRO A;  2OWJ A;  5F68 A;  2ACG A;  5EE8 A;  2VK3 A;  5HAQ A;  1L0D A;  1W5D A;  2ZM0 A;  2ZQ9 A;  3CWF A;  4O8G A;  3GDI A;  4D2O A;  4LV2 A;  5HDC A;  3RFB A;  4PM9 A;  3FKV A;  3HRE A;  3NOT C;  1LSX A;  2CC1 A;  3KYQ A;  2Q0O A;  4R4R A;  3ZNY A;  4GKU A;  3MKE A;  3V3R A;  1N9L A;  3HLB A;  5HL1 A;  2WAF A;  4KEN B;  5J8X A;  3NHQ A;  3VOY A;  2Y2P A;  1XGI A;  4FH4 A;  4UHU A;  4I3A A;  5CHM A;  4JF4 A;  3DWZ A;  1BSG A;  2J80 A;  2XEP A;  1DJC A;  1DJB A;  5AQ9 A;  4LLO B;  1DRM A;  2ZC4 B;  2VV7 A;  1P9W A;  1KOU A;  5G4Y A;  1H8Z A;  3C7V A;  2PU4 A;  1NYY A;  4QHC A;  3C38 A;  2HP9 A;  1PWG A;  2WZZ A;  4PHT A;  2K31 A;  2K2N A;  4NEE D;  4HJ4 A;  5CHJ A;  4NXG A;  3OPR A;  3UDI A;  1L0E A;  5C5K A;  1K6S A;  3D4F A;  3CPT A;  3ZCZ A;  2NUP C;  3G34 A;  1GA0 A;  4DXC A;  2O99 A;  4YNR A;  3RTY A;  5FDS A;  3IWQ A;  3HVF A;  2P9V A;  3C5A A;  1BT5 A;  4YOF A;  2IWC A;  5CEC A;  4OPR A;  3UB6 A;  2QHK A;  3VP2 A;  3OCN A;  2W1T A;  1TDL A;  1TDG A;  5DF7 A;  2IWD A;  3NI9 A;  4Q8I A;  3LEZ A;  3HLC A;  1GCE A;  1YLW A;  3IS2 B;  3ZVT A;  4BJP A;  5L07 A;  2V1Z A;  3TRC A;  3CUE C;  1K4E A;  3N8L A;  4HBT A;  3OOV A;  3VOZ A;  3MQO A;  2QKP A;  2GZA A;  2WKI A;  3BFD A;  3GSG A;  4E3M A;  2DMW A;  5FAP A;  4XT2 B;  1G5U A;  1S66 L;  1HVB A;  3LR5 A;  2KOI A;  2PT7 A;  2I9V A;  3UN7 A;  1H8M A;  1MXO A;  4CJN A;  4EXO A;  3K3C A;  1E4D A;  1GSW A;  1MWT A;  1Y54 A;  3A0S A;  1YQS A;  1YAX A;  3SW1 A;  1CJF A;  4UQI M;  3E2K A;  3WRT A;  4BD1 A;  3DAV A;  2IWB A;  1SKO A;  3OZH A;  1JVJ A;  4NXF A;  2Y55 A;  4R3J A;  4IUK A;  3M2J A;  3S7N A;  5U47 A;  5KSH A;  1TS0 A;  1FSW A;  3BFF A;  2JN7 A;  3UPP A;  3ZG7 B;  4XXR A;  2O9A A;  3LIC A;  4MCW A;  5F69 A;  4ARZ B;  3P7N A;  2R9W A;  4Q0H A;  4WEL A;  4OQG A;  3I7J A;  4BWI A;  1OT9 A;  3H9W A;  3EGD C;  3L7H A;  1YPR A;  4S2L A;  3C7U A;  4NKP A;  2VGL S;  4L0L A;  1YLP A;  3FWL A;  4I3I A;  4YWZ A;  2XD1 A;  1ESU A;  4BBT A;  2Y91 A;  4GHI B;  4LV0 A;  3PBS A;  5A90 A;  5CTM A;  4R1G A;  1H0M A;  3E4O A;  3OLO A;  1L0G A;  2W0N A;  5FL3 A;  3SOI A;  1YLY A;  5CXW A;  5EVI D;  4R3B A;  4WF0 A;  4NET A;  2OSU A;  1IYP A;  1TS6 A;  3KSI A;  4DF6 A;  3IBJ A;  4X68 A;  1WYC A;  4WZ5 A;  2QJ7 A;  4LRZ E;  4WEK A;  2W1R A;  4LV3 A;  2VEA A;  4E3L A;  4EER A;  2I72 A;  2AVX A;  1X0O A;  1M40 A;  4OOM A;  1W79 A;  4R0Q A;  2O9C A;  3M6H A;  4GS9 B;  5GLC A;  1KVM A;  4FTX A;  2GX5 A;  4EW7 A;  2W1T B;  3CUE A;  3WS4 A;  5KMW A;  4B93 A;  1BUE A;  1OJG A;  4IVK A;  2C6W B;  1N9B A;  3F1N B;  5J4E A;  3NDE A;  4P6Z S;  3Q7V A;  5I94 A;  1FR6 A;  3UPO A;  2KLI A;  3B3X A;  5DF9 A;  2YKF A;  4GD6 A;  3T4Q A;  1PIO A;  1FR1 A;  1DP6 A;  1KE3 A;  1LSV A;  4WUJ A;  3MS6 A;  2L1M A;  3BQA A;  3E98 A;  3S4X A;  3A3J A;  3C4P A;  1VM1 A;  1XJ6 A;  4X56 A;  5HSQ A;  2BAS A;  2WKP A;  1U60 A;  1TS8 A;  4E6X A;  3A0R A;  1LL9 A;  1MPL A;  3PYP A;  1JWP A;  4OPQ A;  3LFV A;  5HWW A;  4EEU A;  3UME A;  5K5B A;  1V9Z A;  4OQH A;  4WMC A;  1STZ A;  2XK1 A;  4LV1 A;  4IJG A;  4A5R A;  5TR7 A;  2VV8 A;  4R38 A;  3ISG A;  1W8Q A;  2Y2O A;  3UDF A;  4I3J A;  1W63 M;  2P74 A;  2V0W A;  1S67 L;  1K0K A;  2EFX A;  3IHA A;  5FSR A;  2EWV A;  4MBH A;  1DP9 A;  4HEF A;  4KZ6 A;  3T50 A;  5M18 A;  4OP5 A;  1EI5 A;  1MY8 A;  4R23 A;  5EEC A;  1H8Y A;  3GMW A;  2D02 A;  2Z6D A;  1MWR A;  1NYM A;  3VP4 A;  4CQH A;  3CIT A;  1LHY A;  4LCM A;  4ETZ A;  5GLD A;  2OV5 A;  2QYB A;  2E8J A;  1PW1 A;  3VP1 A;  1YSP A;  3MKF A;  2H10 A;  4PKY A;  5IHV A;  1PWD A;  2A49 A;  2VKS A;  2V9A A;  4HHD A;  3OPP A;  4RQ9 A;  4KG5 A;  3T1R A;  4FH2 A;  4O0P A;  4I5S A;  5AQA A;  4F94 A;  3ITA A;  3IT9 A;  3IWI A;  4UA7 A;  4X1L A;  1KVL A;  1HD8 A;  1ERM A;  3HJI A;  4KZ5 A;  1PWC A;  4FSF A;  3D72 A;  4MBF A;  1MKI A;  3KO6 A;  2HPB A;  1XJ4 A;  4IVI A;  2XD5 A;  3VE4 A;  2G2W A;  1CK3 A;  4G3W A;  5FQJ A;  2OLV A;  3PR6 A;  3SH9 A;  3P09 A;  1KDS A; 
#chains in the Genus database with same CATH homology
 4BMW A;  3IBR A;  3MXQ A;  3MJQ A;  3UE3 A;  3PXP A;  5IS1 A;  1TD5 A;  1UWN X;  3V67 A;  5J3W A;  1F9I A;  1BYW A;  1YKD A;  2HGV A;  3CWF A;  4O8G A;  4KUK A;  3IS2 A;  1W63 Q;  2MJ6 A;  3F1N A;  3C8C A;  3PBR A;  3GDI A;  5HDC A;  1T1C A;  2IA2 A;  3BQ8 A;  3RFB A;  4R3A A;  4K08 A;  3HJK A;  3NOT C;  1LSX A;  3KYQ A;  2K7S A;  3B33 A;  2P08 A;  4NXB A;  1N9N A;  1XFN A;  3JVU A;  3CI6 A;  1N9L A;  4R70 A;  4LRX C;  3EEH A;  3G6O A;  3H82 B;  3TJZ C;  4PAU A;  3VE3 A;  3PBN A;  4UEY A;  5HPI A;  3FPW A;  3NHQ A;  2J3T D;  2HF6 A;  1OJ5 A;  1VB6 A;  5DJT A;  4HQA A;  4I3A A;  5HWV A;  2O9B A;  3KX0 X;  5J7E A;  1MC0 A;  2HJ9 C;  2J80 A;  2QWS A;  2YKH A;  3JVV A;  3ULF A;  1NLZ A;  4LLO B;  4HIA A;  4GJ4 A;  4CLC C;  2CMN A;  2VZW A;  1DRM A;  2VV7 A;  1P9W A;  5DFY A;  4XT2 A;  1KOU A;  3C30 A;  5G4Y A;  2GNX A;  3PHY A;  2KDK A;  2QJ5 A;  4HH2 A;  1ODV A;  3LIE A;  2OAQ 1;  2L0W A;  4CLC D;  3C38 A;  3FPV A;  3P01 A;  4PHT A;  2K31 A;  4LRY C;  2K2N A;  2B18 A;  3S7Q A;  4NEE D;  4HJ4 A;  4NXG A;  1IFQ A;  5C5K A;  1T18 A;  2A2L A;  2NUP C;  2PHY A;  1UWP X;  2PDR A;  2O99 A;  4YNR A;  3RTY A;  1GSX A;  4HY8 A;  4EEP A;  2JHE A;  3MMH A;  5A8B A;  4YOF A;  4EU0 A;  2M1C A;  5EFW A;  4MN5 A;  3HCY A;  1MZU A;  2QHK A;  3UB6 A;  3OCN A;  2W1T A;  2ZMF A;  2Y79 A;  1OTE A;  3KYZ A;  4EES A;  1S1Z A;  1NLY A;  4M4X A;  3F1P A;  3UE6 A;  1TF1 A;  3IS2 B;  2KX6 A;  1H3Q A;  4BJP A;  4O01 A;  2INW A;  1F5M A;  4WL9 A;  2PYP A;  3TRC A;  4Q0J A;  3CUE C;  1ZHH B;  4GHI A;  3OOV A;  1IOU A;  5F6A A;  4ME4 A;  4GLQ A;  3LI9 A;  4HH3 A;  3EWK A;  3MQO A;  4G3K A;  2QKP A;  4FOF A;  2GZA A;  3R7W B;  2FH5 A;  3UB8 A;  3BWL A;  3LI8 A;  2DMW A;  3LIF A;  4XT2 B;  3LYX A;  3NOU C;  1S66 L;  2JKR I;  3LR5 A;  2KOI A;  4II7 A;  3T4K A;  3F1O A;  2PT7 A;  3EEA A;  2I9V A;  1MKM A;  2LB5 A;  1GSV A;  1H8M A;  1XJ2 A;  3D3O A;  4EXO A;  3K3C A;  5MC7 A;  1GSW A;  2PYR A;  3A0S A;  3E4P A;  1YAX A;  3SW1 A;  4Y2F A;  2Y8H A;  4CLC B;  4UQI M;  2G7U A;  1G6O A;  4EUV A;  1D06 A;  1TS7 A;  3NJA A;  2ZOH A;  1VHM A;  4Y5F A;  5AJG A;  2VLG A;  3LR4 A;  2M7V A;  5DKL A;  4NXF A;  2ZMV A;  4IHQ A;  2OWH A;  5HDD A;  4LPZ A;  1UGU A;  3OBF A;  5HDS A;  4IUK A;  3S7N A;  3S7P A;  5KSH A;  2JKT I;  1TS0 A;  2JN7 A;  4L9E A;  4DJ2 A;  2ZOI A;  2O9A A;  3LIC A;  2A24 B;  2J3W A;  3K3D A;  4MCW A;  5F69 A;  4ARZ B;  3P7N A;  3ZYT A;  4KUO A;  4OOL A;  1OTB A;  4ETX A;  3EGX C;  4Q0H A;  2PD7 A;  2B02 A;  4WEL A;  3E0Y A;  3EQU A;  3T4O A;  4BWI A;  1OT9 A;  3H9W A;  3EGD C;  3LR0 A;  3FG8 A;  2EA9 A;  1S4S A;  1S1Y A;  1OTA A;  4AFI A;  4E04 A;  4NKP A;  4PKY G;  2VGL S;  4L0L A;  4QPR A;  4BBV A;  5TJJ A;  2OAP 1;  4I3I A;  1F98 A;  4YWZ A;  3E4Q A;  2HV1 A;  4MN6 A;  4UQI S;  2VJW A;  4BBT A;  1DP8 A;  4Q0I A;  5HD5 A;  4GHI B;  3FC7 A;  4Z1W A;  3PBS A;  3UB7 A;  3BW6 A;  1P0Z A;  4NXE A;  5I5L A;  4H6J A;  1NWZ A;  3H7W A;  1XJ3 A;  3VOL A;  3PBO A;  3E4O A;  3LIB A;  3OCL A;  1LSW A;  3OLO A;  3C2W A;  1V9Y A;  2W0N A;  5FL3 A;  5F5Y A;  4WF0 A;  4HP4 A;  3S7O A;  1T19 A;  2VX8 A;  4GW9 A;  4R6L A;  1TS6 A;  4DMZ A;  2H28 A;  3KSI A;  3IBJ A;  2PR5 A;  4F3L A;  2QJ7 A;  3F1P B;  5G4Z A;  3T4L A;  4LRZ E;  4WEK A;  2W1R A;  5CX7 A;  5HWT A;  4KQD A;  5HL6 A;  2VEA A;  3NOP C;  4EER A;  1X0O A;  2V1A A;  1P97 A;  4OOM A;  1P9R A;  5TBM A;  3R7W A;  2O9C A;  4I39 A;  4GS9 B;  1LT0 A;  5HZH A;  4L9F A;  4MMN A;  2WKR A;  3ICY A;  2GX5 A;  4EW7 A;  2W1T B;  3CUE A;  3MFX A;  1G28 A;  3K2N A;  3KSG A;  3BJN A;  4B93 A;  5DFX A;  1YSQ A;  1OJG A;  3F1N B;  5J4E A;  4P6Z S;  3BY9 A;  3A0V A;  2J3T C;  2OOL A;  2KLI A;  4JGR A;  3MQ0 A;  1XFQ A;  5DF9 A;  4JGQ A;  4WEJ A;  2YKF A;  3T4Q A;  1WA9 A;  2M7U A;  1DP6 A;  1LSV A;  3KSF A;  2NUT C;  4WUJ A;  2L1M A;  2Z6C A;  2V0U A;  4JGO A;  3BQA A;  3E98 A;  2R78 A;  3OC2 A;  2PD8 A;  2XRN A;  1JNU A;  1OTI A;  3UB9 A;  1XJ6 A;  5HSQ A;  2BAS A;  2ZBB A;  2HJE A;  2WKP A;  3O5Y A;  5AVE A;  2JKR M;  3CLO A;  4WN5 A;  2P7J A;  3T4J A;  3CAX A;  4HI4 A;  1TS8 A;  3TW8 A;  3R4K A;  2W3F A;  4B9O A;  2WKQ A;  3A0R A;  3EOI A;  3B47 A;  4P6Z M;  3W2Z A;  4DJ3 A;  3PYP A;  3DBA A;  4BBU A;  3LFV A;  4HJ6 A;  2V1B A;  5HWW A;  4EEU A;  3UME A;  5K5B A;  3LUQ A;  4CLC A;  1V9Z A;  4IUH A;  3LIA A;  2XSS A;  4I38 A;  1STZ A;  4G3V A;  4H6J B;  4IJG A;  5AVF A;  2VV8 A;  4R38 A;  4EET B;  2GJ3 A;  4KQO A;  2D01 A;  1LL8 A;  2P04 A;  5HD3 A;  4I3J A;  3GEC A;  1W63 M;  3T4S A;  2W3H A;  2V0W A;  1S67 L;  3LID A;  1OT6 A;  3MF0 A;  3RH8 B;  5HPF A;  2EWV A;  1DP9 A;  2O0Y A;  1N9O A;  1T1B A;  3TE8 A;  3T50 A;  2JKT M;  1ZTU A;  2EWW A;  1NRJ A;  2D02 A;  5TBM B;  3T4T A;  2Z6D A;  2W3D A;  4HNB A;  4MDZ A;  4CQH A;  3KSH A;  2VV6 A;  2W27 A;  4WLA A;  3CIT A;  3H7W B;  4ETZ A;  2VGL M;  5LBR A;  2FZ0 A;  4Y3I A;  4JGP A;  2QYB A;  1Y28 A;  4CLC E;  3BY8 A;  2LB9 A;  1YSP A;  4ARZ A;  4PKY A;  1EW0 A;  2VKS A;  2V9A A;  4HHD A;  1OPX A;  3U2A A;  4RQ9 A;  1OTD A;  1S4R A;  4EQ1 A;  4HP9 A;  3B42 A;  4F3L B;  3MR0 A;  4O0P A;  4I5S A;  4MN7 A;  2W3E A;  3LR3 A;  5IU1 A;  4GS9 A;  5KIZ A;  2XA7 M;  3HJI A;  3UMD A;  4HOI A;  4ZRR A;  2W3G A;  4L9G A;  1D7E A;  5L8M A;  3VV4 A;  2L4R A;  3PBT A;  3F1O B;  4FSF A;  3D72 A;  5DKK A;  2VA0 A;  3MQQ A;  4DN0 A;  3H82 A;  3KO6 A;  4GCZ A;  2PR6 A;  2XA7 S;  3ZQ5 A;  1XJ4 A;  3VE4 A;  4HJ3 A;  3PBQ A;  5DJU A;  2XRO A;  4G3W A;  5IT5 A;  3PR6 A;  1T1A A;  3EQV A;  2OWJ A;  2A24 A;  5F68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...