2QKPA

Crystal structure of c-terminal domain of smu_1151c from streptococcus mutans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
SLDRTTQQPFGNGYLSVEQANLILNHLPLEITFVNKDDIFQYYNDSVPAAEMVFKRTPSQVGRNVELCHPPKVLDKVKKVFELLRNGQRDKVNMWFQSERLGKFVYVTYAAVRDQAGDFQGVLEYVQDIKPFFELDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of C-terminal domain of SMU_1151c from Streptococcus mutans.
rcsb
source organism Streptococcus mutans
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 37
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qkpA00
5F6AA 5J4EA 3K3CA 1JNUA 5HZHA 4PKYA 3EEHA 1T19A 5DKLA 5TBMB 3UMDA 2QWSA 1TS0A 3UB7A 1DP9A 1D7EA 1T1CA 3F1PA 3HJKA 3PYPA 1X0OA 4HH3A 3RTYA 3P7NA 4BBUA 1XFNA 3VE3A 2V0WA 4H6JA 3BY9A 1OTIA 2L1MA 2OWJA 1TS8A 2ZOIA 1DP6A 3A0VA 4WLAA 3MR0A 4EERA 3CAXA 4HY8A 1T1AA 5DKKA 5J7EA 4DJ3A 1OT9A 3SW1A 1LSVA 3C8CA 4MN5A 5F5YA 5G4YA 3LIAA 1ODVA 5IU1A 3LICA 1LL8A 1P0ZA 1P97A 2JHEA 1VB6A 3HJIA 3E4QA 2A24B 3LI8A 2ZBBA 3LYXA 1NWZA 3PHYA 2WKQA 1N9LA 5HDSA 3NHQA 3UE6A 2B02A 3VE4A 4E04A 1DP8A 2KX6A 1S67L 1GSWA 4MN6A 1GSVA 4EW7A 4EETB 2V1AA 4YWZA 1Y28A 1XJ2A 1LSXA 1V9YA 1XJ6A 2PR5A 4JGOA 2KDKA 4GW9A 1S4RA 3A0SA 2PHYA 3ULFA 5IS1A 1WA9A 2W0NA 3G6OA 3H82B 5AVFA 3EWKA 3H9WA 1F9IA 1GSXA 1OJ5A 2PYRA 2VV6A 4HJ3A 1S4SA 3H7WA 2VV7A 3A0RA 2JN7A 4HH2A 4GHIB 4K08A 4LRYC 1MZUA 3LIFA 3RH8B 3IBRA 4I5SA 3ICYA 4NXFA 1OJGA 2EA9A 5AVEA 2HV1A 1N9NA 5DJTA 5HWVA 4HI4A 2VV8A 2L0WA 4JGQA 5F69A 3IS2B 4I3JA 2P7JA 4GS9B 3GECA 4HIAA 1T18A 4LPZA 5HWWA 1UWPX 3LIDA 3GDIA 4DJ2A 4HQAA 2H28A 3NOPC 3LI9A 2PD7A 1LT0A 2YKHA 3IS2A 5HWTA 1N9OA 4B9OA 3K3DA 4WL9A 1UGUA 1G28A 4HP9A 4I3AA 4NXGA 1LSWA 1V9ZA 4EXOA 4R3AA 4NXBA 5KIZA 4L9FA 2INWA 2V9AA 1OT6A 2QHKA 5DJUA 5HSQA 5HDDA 3F1PB 4HJ4A 5EFWA 3FC7A 4R70A 1BYWA 2PD8A 3MJQA 2PR6A 5I5LA 4BBVA 2R78A 1XJ4A 2PYPA 4I39A 2D01A 2W27A 3T50A 4EEPA 4BBTA 4EESA 2WKPA 5A8BA 3H82A 2VEAA 2V0UA 2QJ5A 2VLGA 2YKFA 5HD3A 3H7WB 3F1OA 4JGRA 4L9EA 2A24A 2J80A 4GHIA 5G4ZA 5HD5A 2PDRA 3MQQA 3FG8A 4F3LA 3MFXA 2V1BA 2ZOHA 4EQ1A 3BY8A 3E4PA 4JGPA 1F98A 1OTAA 1XJ3A 3E4OA 3MQOA 3OLOA 4PKYG 1DRMA 4KQDA 2I9VA 2CMNA 4WN5A 3UMEA 4GS9A 2M1CA 1S66L 4I3IA 4LLOB 3VOLA 4F3LB 4HOIA 4WUJA 3D72A 4L9GA 3F1NB 1XFQA 4LRXC 4EEUA 4M4XA 4R6LA 2L4RA 4NXEA 3B33A 1T1BA 4HHDA 1UWNX 1TS6A 2BASA 2OOLA 3LIEA 3CWFA 1OTDA 2Z6DA 1EW0A 5F68A 3UB8A 3UB6A 2D02A 3F1OB 4XT2B 1S1ZA 4R38A 5HDCA 4KUOA 4GCZA 1S1YA 2K7SA 3BWLA 3UB9A 3MXQA 3NOTC 4HP4A 3KX0X 1TS7A 2QJ7A 4XT2A 3LIBA 4HJ6A 4KUKA 3ZQ5A 2WKRA 3C2WA 3F1NA 5J3WA 4HNBA 3CLOA 2OWHA 1D06A 4H6JB 3NJAA 3LUQA 4I38A 4LRZE 5TBMA 1KOUA 2Z6CA 1OTBA 1OTEA 3NOUC 2GJ3A 4WF0A 4RQ9A 2QKPA
chains in the Genus database with same CATH superfamily
1RCJA 3DTEA 4ID4A 1PWCA 2V8CA 3FV7A 3P7NA 1TF1A 3UO9A 4OONA 4OVDA 1YLZA 4GD6A 3SZTA 3LR4A 2X01A 3N8RA 3WWXA 1N9LA 1N4OA 5EM1A 2K2NA 3PBTA 3BRMA 1M40A 2I72A 3DWKA 3T1RA 1V9YA 2PR5A 2Q9NA 2KDKA 2PHYA 4X69A 5AJGA 2ACGA 4LRYC 4QY6A 3CPTA 3KO6A 4ARZB 4HI4A 1W7FA 5FDSA 4MN7A 5HWTA 2W3HA 1LI0A 4HP9A 4I3AA 3N6IA 3QHYA 2OV5A 1BSGA 2W1TA 4I39A 4BMWA 2Y59A 2P08A 3S4XA 5G4ZA 5E2EA 2WZZA 3BY8A 1XJ3A 3VP0A 5FQJA 1MWUA 2B5RA 3CITA 4OQ0A 2HDSA 4NXEA 4HHDA 5JYOA 3MKFA 4HBUA 1EW0A 2JE5A 3UB8A 2H10A 3QNBA 2DMWA 1F5MA 4E3JA 4KUOA 1G5UA 4WYYA 1NJ4A 4YOFA 5J3WA 1ZKJA 4X56A 3R7WB 3NOUC 2H5SA 4ZRRA 1W63Q 3CMZA 3PBRA 2HJ9C 4KZ7A 3IT9A 3EEHA 1N9BA 3HJKA 1YPRA 4H6JA 4X53A 1Q2PA 3S7NA 3V3SA 2JKTI 2ZC7A 5IU1A 3HLCA 3UE1A 3KYQA 4X1MA 3E4QA 4P6ZS 2OAQ1 4MN6A 4EW7A 4C6YA 4R3BA 1Z6FA 1IEMA 4JF5A 4GW9A 1RP5A 3WRZA 4B93A 3UB9A 1QMEA 3VOZA 3KSIA 1WYCA 5CTNA 3SH9A 3UN7A 3DAVA 4ME4A 3IS2A 4WELA 1FQGA 5C5KA 1PW1A 3EGXC 1CEGA 1FIKA 2QHKA 1YMXA 4HJ4A 3IXGA 1GA9A 3MJQA 1MKIA 3MKEA 4JXWA 3IX8A 2JC7A 1D1JA 3F1OA 4P6BA 5TGFA 2XFSA 1J9MA 4QPRA 4Y7PA 1JTGA 2V1ZA 3BYDA 1K55A 3FKWA 1PI4A 3CI6A 3BFCA 1SCWA 3TRCA 2XR0A 4CLCA 4LV0A 4OPQA 3ZFZA 5E2GA 1NYYA 4H6JB 1MPLA 2QYBA 3C4OA 4RQ9A 4ETXA 1HD8A 2V8FA 3T4KA 3JYIA 1H8YA 3OPPA 2X71A 4WMCA 4Q8IA 5TBMB 3UB7A 5M19A 4RVAA 3LEQA 4MDZA 4S2NC 1FCNA 1LSVA 3M2JA 1ODVA 2PAVP 3EEAA 3LICA 2LB5A 4PKYA 1VB6A 4FD8A 4UA9A 4KZ3A 3VSKA 4CPKA 2HZ5A 1JWVA 1BLCA 3DBAA 5FI2A 1S4RA 3A0SA 5EVID 1WA9A 3HLEA 3RXXA 1NZUA 5M1AA 3QP8A 2Y2OA 5AVEA 3HVFA 1TDGA 1G6OA 1T18A 4QD4A 3LIDA 1N9OA 4K0WA 5HAPA 4LGWA 1LSWA 4EXOA 1DJCA 4QU3A 5DJUA 5CXWA 5GLBA 5FL3A 1GCEA 3JVUA 2ZMVA 1U60A 3KSGA 4Y3IA 2OAP1 3MQQA 4EUVA 1TD5A 2XF3A 2ZQ8A 4IUKA 4WUJA 4EEUA 3N7WA 4F94A 2FH5A 3VMAA 1OTDA 5F68A 5CERA 4L0LA 4EBPA 4U0TA 3V67A 2XK1A 4HNBA 2XGNA 1L3LA 1K6RA 2Y79A 1ZHHB 4KG5A 1MWTA 3R4KA 1T19A 2QWSA 5FAQA 4EBNA 4Y0OA 1VETB 5FAOA 2XEPA 4WM9A 4P0MA 2L1MA 4EWFA 3PAEA 1T1AA 3Q7ZA 4RYEA 3S7OA 3T1QB 3G2ZA 4MBFA 2VA0A 4E3MA 2VGKA 3ZYTA 3UE6A 4DXBA 5FQKA 3A3EA 2XFTA 4B88A 4E3NA 4B4ZA 2NUTC 2AVXA 1XJ6A 2M7VA 4II7A 4BD1A 2W0NA 4HH2A 1K56D 1S4SA 2W3GA 3MZFA 1MZUA 1YM1A 4I5SA 5I94A 5CHUA 2Q9MA 5DTTA 2OLUA 4JPMA 2RCXA 1YSPA 5FEFA 4PM8A 2Y2GA 4NXBA 4NETA 2IWCA 2INWA 5A90A 4Y13A 1PYYA 2PYPA 3SH8A 2WKPA 2J80A 3Q1FA 1JWZA 3IQAA 3UB5P 4OPZA 1XA7A 2XSSA 1F98A 1I2WA 4FTXA 1E25A 4LLOB 3Q81A 5FA7A 3B33A 2BASA 1S1ZA 4PHTA 5FASA 4RX2A 1XA1A 4KUKA 4KZ5A 4OP8A 5F1GA 3DTIA 2ZL1A 2QKPA 5F6AA 4UAAA 2WKEA 4IVIA 5E2HA 4QY5A 1TS0A 4OPRA 3VE3A 3S1YA 4C3QA 3IF6C 3T12B 3BY9A 2WK0A 5HAIA 1YMSA 2VGLS 2B18A 1K57A 5CECA 5G4YA 4DMZA 1BLPA 2ZBBA 3HLGA 3FPWA 1GSVA 3FPVA 4EUZA 3O5YA 1FR1A 3ZG9B 3ULFA 3G32A 3G6OA 1FOFA 3FZCA 3PBNA 1YLTA 2PD7A 4K91A 1NLZA 4Q0IA 4XXRA 4L9FA 3F1PB 3OC2A 3E0YA 3FYZA 1JWPA 1IYQA 3CZDA 3PR6A 1NY0A 3RXWA 3MFXA 1XFQA 3EOIA 3QP5A 4XUXA 2W3FA 1UWNX 3T4TA 3CWFA 3M6BA 2ZC6B 4YNRA 1BLHA 1FSYA 4OPYA 3B42A 4BQMA 4MMNA 3ITAA 1KOUA 1W8YA 4GN2A 1A0KA 4X6TA 1DP9A 3LR5A 2Z2MB 1KE4A 3W4OA 3D9YA 4EERA 3HLFA 2BTFP 2HGVA 3GQZA 1I2SA 4IUHA 2XRNA 3V5MA 4GDNA 1RGZA 3DW0A 2KX6A 2CC1A 2V1AA 4CLCE 5GL9A 3ZGAB 4KZ6A 3GRJA 2BG1A 3G30A 3BM6A 4K08A 3VFFA 5DTKA 3ZDJA 3PBSA 4IBRA 1HZOA 1L0EA 2P7JA 2ZQ7A 3GDIA 2HP9A 3AGDA 3IF6B 3GV9A 3W2ZA 3UPNA 1PWGA 4A5RA 4NXGA 1K4EA 2ZC4B 5HDDA 5CGXA 3S22A 2GX5A 4K0XA 1VM1A 1VEUB 2WGWA 2YKFA 3NBLA 4L9EA 3NULA 1WYBA 2Y2IA 2WAFA 1PI5A 5TJJA 1JVJA 4JGPA 5IT5A 2H0YA 1E4DA 2CMNA 1S66L 5DF9A 3EGDC 3I7JA 4XT2B 2O99A 3HUOA 5HDCA 3VOYA 1EROA 2K7SA 3BWLA 3MXQA 1ALQA 5HL1A 3MZDA 3LCEA 3CUEC 4DE0A 4N9KA 1P9WA 4BLMA 4O8GA 1CK3A 2BLSA 2FFFB 3C5AA 3ISGA 5KMWA 2DCFA 1YLWA 4HH3A 4P6ZM 4LV2A 4UEYA 1RGYA 4CJNA 1DP6A 2J3TC 4HY8A 1GHMA 4ZJ3A 4B4XA 4Y2FA 1H3QA 2QMIA 1P0ZA 3M2KA 4Z9QA 2HP6A 4JXVA 5HDSA 4S2PA 4DDSA 2B02A 1FR6A 1S67L 5GHYA 4YWZA 4U0XA 1ESIA 4OLGA 3GMWA 5IS1A 5AVFA 5CRFA 4HQAA 3V39A 1CI8A 4KG6A 4QWOA 5F69A 1ES2A 3IS2B 1SDEA 1KGEA 1PRQA 3IXHA 1LT0A 4GDBA 3A3IA 2HDRA 4MLLA 4BJPA 3IX3A 3ZG0A 2J9OA 4ZDXA 4R3AA 1H8ZA 1H0MA 3LR3A 1OT6A 1PWDA 2X02A 5HPFA 2W3EA 4R70A 2ZLYA 1OPXA 1O7EA 1XJ4A 4S2IA 3KYZA 4B9OA 4JF4A 3OCNA 2A24A 3KSFA 3CJMA 3C7UA 4O0PA 2GNXA 3WS2A 3MQOA 1IYOA 3UMEA 3ZG5A 2EFUA 3F1NB 1YSQA 3C4PA 2KOIA 2VGLM 2Y2NA 3F1OB 3UPOA 5K5BA 1S1YA 2P74A 3LIBA 1VETA 3F1NA 3GR2A 3HLDA 1NLYA 3TJZC 2VX8A 4I38A 1XX2A 1OTBA 5KSCA 4IJGA 1ERQA 5J4EA 2XLNA 3OPRA 1X0OA 3VP4A 1EWZA 5U47A 3NDEA 5HARA 4WLAA 4G3VA 4HBTA 3C30A 4DE2A 3LY3A 4CLCC 4KQQA 3BLMA 3PHYA 2PRFA 2A2LA 3UDXA 2XROA 3MBZA 3WS5A 2XD5A 3T4OA 2Y2MA 4HJ3A 3O88A 3RH8B 4DRTA 2J3WA 3QNCA 3BFEA 2EWVA 2HV1A 3IH9A 5DJTA 1W63M 2H0TA 1K54C 2L0WA 3HUMA 4GS9B 4MNRA 4FSFA 2PU4A 2YKHA 3K3DA 4WL9A 4LFUA 5EE8A 1XPBA 4FUWA 5DTSA 1GHIA 1BULA 4LENA 4S2NA 3UDIA 5BOHA 4GLQA 3BJNA 4CQHA 4DDYA 3Q07A 1L0FA 3VP1A 1DRMA 1VEUA 2WGWB 4GS9A 2M1CA 3ZVWA 3PXPA 1PZOA 4ZJ1A 5G18A 4E3LA 2Z6DA 3CUEA 2ZMAA 5A91A 4OKPA 2OSUA 5L09A 1FCMA 2UWXA 4KZ4A 4HJ6A 3RFBA 4MCWA 1SHVA 1XKZA 2PT7A 4DF6A 3NJAA 4X68A 5TBMA 3IHAA 3F1PA 4IHQA 1W5DA 2ZC5B 4N92A 1ONHA 2EX2A 2ZOIA 3IWIA 5FSRA 4Q0HA 3LR0A 3Q7VA 3SW1A 4NG2A 4U3TA 4X25A 3ZNTA 1PIOA 2A49A 1DY6A 3HL9A 3HJIA 4MBHA 3ZHHA 1IKGA 5MC7A 2G2UA 3QP6A 4WZ4A 1FILA 3N4IA 2VV6A 4DJ3A 4AFIA 4NEED 5HWVA 5EOEA 3MF0A 2WGIA 2Y8HA 3LI9A 3LO7A 3MS6A 3E2KA 5EM0A 3O86A 1UGUA 1LL5A 2K31A 5HX9A 3G4PA 2WKHA 2JKTM 2KLIA 2R78A 2JBFA 3FKVA 3H7WB 5HD5A 1KGGA 5CHJA 3DWZA 3NCKA 4EQ1A 3HLWA 5JYPA 4WN5A 4DE3A 2P9VA 4HOIA 4L9GA 2WGVA 2OOLA 3HCYA 4OP5A 1AXBA 1ES3A 1K56A 1MWSA 4PMAA 4PM6A 4RX3A 5DFXA 1G6AA 5FQQA 3ZQ5A 1E3UA 2VZWA 2ZM8A 2M7UA 3AGEA 1JNUA 2ZMFA 4NK3A 5DKLA 2Y2LA 1KGFA 4ETZA 2Y2QA 1GHPA 3N8SA 1Y4OA 5AQAA 3D3OA 4S2OA 1ERMA 2GDNA 3TOIA 5CGWA 4S2LA 1LL8A 4EBLA 5HAQA 3QP4A 3BQAA 1SKOA 4O01A 4LCMA 3BLSA 3HBRA 1VHMA 4MEZA 1XP4A 4JF6A 5KZHA 1M6KA 4N9LA 3A0RA 2JN7A 3ITBA 2XD1A 1OJGA 2VV8A 3VSLA 2ZL1B 3OCLA 2XQZA 3OPHA 3ZVTA 2H28A 5FI6A 4S2JA 1PZPA 4JXGA 4P85A 1FCOA 2XA7M 4ARZA 5F83A 3FC7A 3IWOA 4BBVA 1W79A 2R9WA 5EUAA 4UQIM 4IVKA 4PAUA 5J8XA 2Y2JA 3T4QA 3VFHA 2WADA 1Y54A 3E4OA 1K55C 1ACFA 4M4XA 1ZTUA 3PTEA 4BWIA 4DN0A 4FOFA 5EVIC 2EXAA 3WS0A 1SKFA 4R1GA 3K2NA 4HEFA 3NOTC 1TS7A 2QJ7A 2ZJ9A 3PBQA 3ZG7B 1HTZA 4IBXA 2E8JA 3LUQA 2Z6CA 5J7EA 2GJ3A 1K4FA 2J9PA 4E3IA 5HZHA 3UE0A 3UMDA 3WRTA 3PYPA 3RTYA 4R4RA 2V0WA 1NXYA 2XDMA 5L2FA 4R4SA 3R7WA 3BECA 3M6HA 4KZAA 1P97A 3LYXA 5CTMA 2R9XA 3UNWA 3DTMA 3G35A 5EOOA 2J8YA 4N1HA 4KQRA 4MBKA 3IXDA 1CF0A 5DF8A 3EWKA 1GSXA 4WMCD 3H7WA 3KSHA 1ES5A 2PBDP 3IBRA 2JKRI 4UA7A 4KZ9A 4LCLA 4GNUA 3FWLA 4LPZA 2B95A 4P87A 3P09A 2W1RA 4Y15A 3V50A 3QP2A 1L0DA 4O7DA 1K0KA 3GTCA 1ZC2A 1XGIA 5DFYA 3A3FA 3VP2A 3H82A 2VEAA 4UQIS 4JGRA 1MY8A 4F3LA 2V1BA 4ZJ2A 2HF6A 4X55A 1AWIA 4LRXC 2ZC3B 1DJAA 3T1XA 4DKIA 4OLDA 3T4LA 1KVLA 4ZBEA 1J3WA 4G3KA 1NZOA 3WS4A 2WKRA 3ZNYA 3LY4A 5CEDA 2OWHA 3G31A 3OZHA 4FH2A 4CLCB 1SZVA 2VK3A 3D4FA 2VJWA 4DJ2A 4R0QA 3IF5A 1T1CA 4BBUA 2P9VB 5HFOA 5FQIA 2JKGA 1OTIA 4JKTA 2NUPC 1OT9A 1JTDA 3LIAA 5FQMA 4GZBA 1KE0A 3LI8A 1K38A 2WKQA 4S2KA 3SS4A 2VGJA 3GSGA 1WE4A 4JGOA 4ESPA 4EU0A 3H9WA 2PYRA 3OPLA 1BTLA 4GHIB 1CI9A 3ICYA 3L9KA 1N9NA 4QB8A 5CX7A 4X1LA 1UWPX 3MQ0A 2DNSA 1BUEA 1K6SA 1O07A 2C5WB 3IWQA 2V9AA 2Y91A 5F1FA 5EFWA 1BYWA 1MWRA 2LB9A 4EESA 3A3DA 4PPRA 3Q7VB 5HD3A 3Q82A 4OOLA 3FG8A 3E4PA 4OOMA 4JXSA 2EFXA 3IBJA 1TDLA 3V3RA 1TVFA 4F3LB 4GB7A 3D72A 2EX8A 4WEJA 2L4RA 1TS6A 3UB6A 4GCZA 3IH8A 1ESUA 4PM7A 2EXBA 4HP4A 4Y17A 5EV0A 3NC8A 1S0WA 2JKRM 2OLVA 1IELA 3K3CA 1EI5A 5FEGA 1OMEA 4KZBA 1D7EA 1XFNA 3BFFA 1MBLA 5DKKA 5A92A 3CHWP 1G68A 2ZQCA 4RA7A 4YFMA 1SDNA 3C8CA 5F5YA 4HESA 5HW3A 5GHXA 1LLBA 1NRJA 1C3BA 2XA7S 4GOGA 3W4QA 3VE4A 1MC0A 2Y2KA 4EV4A 1GSWA 2DRWA 4H8RA 5KSHA 5GHZA 1IOUA 2PU2A 4D60A 1Z09A 4R23A 3IHBA 4I3JA 2MJ6A 1K25A 3T4SA 5EVIA 1MKMA 1Q2QA 3AGFA 2ZQAA 3W4PA 4M3KA 1XXMA 5HSQA 2FFYA 5FATA 2D01A 1CQAA 3BEBA 3BQ8A 2QJ5A 2IWBA 2PDRA 4WEKA 2VKSA 2WYXA 3HREA 3W8KA 1TEMA 3T4JA 1FSWA 1VQQA 1T1BA 3LIEA 4E3KA 4QHCA 5DVAA 2D02A 5GLAA 3UDFA 5AQ7A 2J3TD 4XT2A 5A93A 5FDHA 1BZAA 3JVVA 3P98A 1KVMA 3N8LA 4WF0A 2HPBA 4ZAMA 1HLUP 1K57C 1YLYA 3GVBA 3O3VA 3O87A 2PBYA 4GKUA 2JCHA 4ZTKA 1TS8A 1K54A 3OOVA 4UHUA 4R3JA 4FH4A 5D3OA 2IWDA 1F2KA 3MFDA 2A24B 5FAPA 4EETB 1S6RA 2EX6A 1IYSA 1Y28A 3EQVA 4DXCA 4Y0TA 4WZ5A 1F9IA 5L07A 1ZG4A 4KZ8A 4NXFA 5AQ9A 1LI9A 2V2FF 4XUZA 3DTKA 4YINA 3G34A 4OQGA 1W8QA 4OQIA 2Q0OA 2W1TB 3HUNA 2Y2HA 3SH7A 4NKPA 3ZG8B 1E3UD 4N1XA 2PD8A 3U2AA 3JPUA 2QPNA 1STZA 4OQHA 5EPHA 5A8BA 5L10A 4FCFA 2VLGA 5CEBA 3MSHA 3L7HA 5M18A 2Y2PA 1OTAA 2O9CA 1CJFA 4E3OA 1CEFA 1PNEA 3TE8A 5IHVA 5DF7A 3IX4A 5EVIB 1IKIA 2ZM0A 1IFQA 2Y55A 1QMFA 3TW8A 1KE3A 2FZ0A 4GD8A 3C38A 3CLOA 1L0GA 5E2FA 3WS1A 1OTEA 3PAGA 4E6XA 3MMHA 2WKIA 2ZD8A 1HVBA 4KQOA 4E6WA 1ONGA 4OH0A 5EVEA 2UV0E 5TFQA 1PFLA 3E2LA 1NRFA 4LV1A 3NECA 2ZQ9A 3MR0A 3CAXA 1ES4A 3BFDA 3U4LP 2Y4AA 2P04A 4MN5A 3BW6A 2HJEA 2EWWA 1NWZA 1H8MA 3TG9A 4WZ5C 4E04A 2WAEA 3OBFA 3NIAA 1XJ2A 4KENB 3SS3A 1KDSA 1BLSA 3VV4A 1OJ5A 1YLPA 1BT5A 1SKOB 2VV7A 1L2SA 4G3WA 3MXSA 4KG2A 3S7QA 2EA9A 5CGSA 4JGQA 5E43A 5AQBA 2G2WA 2XH9A 1P9RA 3NOPC 1YT4A 3ZCZA 3CG5A 3PBOA 3UE3A 3CPTB 1I5QA 1G28A 5GLCA 4EQIA 3NI9A 5KIZA 3RJUA 3IF6A 5I5LA 2PR6A 2V20A 3T50A 2W27A 3P01A 5FQ9A 1XGJA 4EEPA 2A3UA 1NYMA 4BD0A 3B47A 3UPPA 2ZOHA 2RL3A 4PKYG 4BBTA 4KQDA 2I9VA 3VOLA 5HPIA 4OOYA 2C6WB 2W3DA 3LEZA 4R6LA 4BL3A 1YKDA 5FI7A 1MXOA 3MXRA 3SS5A 5L8MA 4CLCD 3C2WA 4JLFA 5GLDA 1D06A 3S7PA 3NY4A 1GA0A 4LV3A 2E8IA 3VP3A 4D2OA 2EX9A 4HIAA 3B3XA 1DJBA 3TSGA 2J7VA 2HDQA 2JKFA 2QZ6A 2OWJA 3A0VA 3G2YA 4Y5FA 2JHEA 2O9BA 5CHMA 1KDWA 4C75A 3NHQA 5TR7A 2O0YA 1DP8A 4Z1WA 1YAXA 3IXBA 1LSXA 2HDUA 3H82B 3KYEA 3T1SA 5HL6A 3LIFA 3SOIA 3MZEA 4DE1A 4IEDA 1H5XA 4Q0JA 5LBRA 2ZQDA 3GECA 5HWWA 3BFGA 1PW8A 2HP5A 4S2MA 5EVLA 1V9ZA 4WBGA 1ZG6A 3C7VA 3EQUA 2ZM2A 3HLBA 3LFVA 4UA6A 1LL9A 4PM9A 3A3JA 2V0UA 2GZAA 4GHIA 3UY6A 5F82A 3OLOA 3LGOA 5EECA 2WZXA 4I3IA 4BENA 3E98A 4PM5A 1LHYA 2WUQA 4QJGA 4JBFA 4R38A 4BL2A 1IYPA 2IA2A 2O9AA 3KX0X 4Y0UA 1YQSA 2G7UA 3QP1A 3NDGA 4LRZE 4GJ4A 1YLJA 2Z2LB
chains in the Genus database with same CATH topology
5F6AA 3K3CA 1TS0A 1D7EA 3F1PA 4IHQA 3P7NA 1XFNA 3VE3A 1TF1A 3BY9A 2ZOIA 4Q0HA 3LR0A 5DKKA 2VGLS 2B18A 3SW1A 3C8CA 5F5YA 5G4YA 3LR4A 4DMZA 3HJIA 2ZBBA 1N9LA 1NRJA 2XA7S 3FPWA 3VE4A 2K2NA 1MC0A 3PBTA 1GSWA 1GSVA 3FPVA 5MC7A 3O5YA 1V9YA 2PR5A 2KDKA 2PHYA 3ULFA 5KSHA 1IOUA 3G6OA 5AJGA 2VV6A 4LRYC 4DJ3A 4AFIA 3KO6A 3PBNA 4NEED 4ARZB 5HWVA 4HI4A 4I3JA 2MJ6A 4MN7A 3MF0A 3T4SA 2Y8HA 3LI9A 2PD7A 1MKMA 5HWTA 2W3HA 1UGUA 1NLZA 4HP9A 4I3AA 4Q0IA 2K31A 4L9FA 5HSQA 3F1PB 3OC2A 2JKTM 2KLIA 2W1TA 3E0YA 2R78A 4I39A 4BMWA 2D01A 3BQ8A 2P08A 2QJ5A 3H7WB 3PR6A 5HD5A 5G4ZA 2PDRA 3MFXA 4EQ1A 3BY8A 1XJ3A 4WEKA 4WN5A 2VKSA 4HOIA 4L9GA 3T4JA 1XFQA 3CITA 3EOIA 4NXEA 1T1BA 2W3FA 4HHDA 1UWNX 2OOLA 3LIEA 3HCYA 3CWFA 3T4TA 1EW0A 3UB8A 2D02A 2DMWA 1F5MA 4KUOA 4YNRA 5DFXA 2J3TD 3ZQ5A 4XT2A 4YOFA 5J3WA 3B42A 2VZWA 2M7UA 3JVVA 4MMNA 3R7WB 1KOUA 3NOUC 4WF0A 4ZRRA 1W63Q 3PBRA 1JNUA 2HJ9C 2ZMFA 5DKLA 3EEHA 1DP9A 3HJKA 3LR5A 4ETZA 4H6JA 4EERA 1TS8A 3D3OA 3S7NA 2HGVA 3OOVA 2JKTI 5IU1A 1LL8A 4IUHA 3KYQA 3E4QA 2A24B 4P6ZS 2OAQ1 2XRNA 2KX6A 4MN6A 4EW7A 3BQAA 2V1AA 4EETB 4CLCE 4O01A 1Y28A 3EQVA 4GW9A 1VHMA 4B93A 1F9IA 3UB9A 3A0RA 2JN7A 4K08A 4NXFA 1OJGA 3PBSA 2VV8A 3OCLA 2P7JA 3KSIA 3GDIA 2H28A 4ME4A 3IS2A 4WELA 3W2ZA 2W1TB 4NXGA 5C5KA 2XA7M 3EGXC 2QHKA 4NKPA 4ARZA 5HDDA 4HJ4A 3FC7A 2PD8A 3MJQA 3U2AA 4BBVA 4UQIM 1STZA 5A8BA 4PAUA 2GX5A 2VLGA 2YKFA 4L9EA 3F1OA 3T4QA 5TJJA 4JGPA 5IT5A 1OTAA 3E4OA 2O9CA 4QPRA 2CMNA 1S66L 5DF9A 3EGDC 3TE8A 4M4XA 1ZTUA 4BWIA 4DN0A 4FOFA 3CI6A 4XT2B 1IFQA 3K2NA 2O99A 3TRCA 5HDCA 2K7SA 3BWLA 4CLCA 3MXQA 3NOTC 3TW8A 1TS7A 2FZ0A 2QJ7A 3C38A 3PBQA 3CLOA 4H6JB 3LUQA 3CUEC 2QYBA 2Z6CA 1OTEA 1P9WA 5J7EA 2GJ3A 4RQ9A 4ETXA 4O8GA 3T4KA 3MMHA 5HZHA 4KQOA 3UMDA 5TBMB 3UB7A 3PYPA 3RTYA 4HH3A 4P6ZM 4UEYA 2V0WA 3R7WA 1DP6A 3MR0A 2J3TC 3CAXA 4HY8A 4MDZA 1LSVA 2P04A 4MN5A 1ODVA 3BW6A 4Y2FA 1H3QA 3EEAA 3LICA 2LB5A 1P0ZA 1P97A 4PKYA 1VB6A 2HJEA 3LYXA 2EWWA 1NWZA 1H8MA 5HDSA 2B02A 4E04A 1S67L 4YWZA 3OBFA 1XJ2A 3DBAA 1S4RA 3A0SA 5IS1A 1WA9A 5AVFA 3VV4A 3EWKA 1GSXA 1OJ5A 4HQAA 3H7WA 2VV7A 3KSHA 4G3WA 3IBRA 3S7QA 2JKRI 2EA9A 5AVEA 4JGQA 5F69A 3IS2B 1G6OA 1T18A 4LPZA 3LIDA 1P9RA 2W1RA 3NOPC 1LT0A 4BJPA 3PBOA 1N9OA 3UE3A 1G28A 1LSWA 4EXOA 4R3AA 5KIZA 3LR3A 1OT6A 5DJUA 5HPFA 2W3EA 4R70A 5I5LA 2PR6A 1OPXA 1XJ4A 3T50A 2W27A 3P01A 5FL3A 4EEPA 5DFYA 3JVUA 3H82A 2VEAA 3KYZA 4B9OA 2ZMVA 4UQIS 4JGRA 3KSGA 2A24A 3OCNA 3KSFA 4Y3IA 2OAP1 3B47A 3MQQA 4O0PA 4EUVA 4F3LA 2V1BA 2ZOHA 1TD5A 2GNXA 3MQOA 2HF6A 4PKYG 4BBTA 3UMEA 4KQDA 2I9VA 4IUKA 3VOLA 5HPIA 4WUJA 4LRXC 3F1NB 2W3DA 4EEUA 1YSQA 4R6LA 2KOIA 2FH5A 1OTDA 5F68A 2VGLM 1YKDA 3F1OB 5K5BA 4L0LA 1S1YA 3T4LA 5L8MA 4G3KA 3LIBA 3V67A 2WKRA 3C2WA 3F1NA 4CLCD 4HNBA 2OWHA 1NLYA 1D06A 3TJZC 3S7PA 2VX8A 4I38A 4CLCB 1OTBA 4IJGA 2Y79A 4HIAA 1ZHHB 2VJWA 5J4EA 3R4KA 4DJ2A 1T19A 2QWSA 1T1CA 4BBUA 1X0OA 1OTIA 2L1MA 2OWJA 3A0VA 4WLAA 4G3VA 2NUPC 1T1AA 3C30A 3S7OA 1OT9A 4Y5FA 3LIAA 4CLCC 2JHEA 2O9BA 3LI8A 2VA0A 3PHYA 2WKQA 3ZYTA 3NHQA 3UE6A 2A2LA 2O0YA 1DP8A 4Z1WA 1YAXA 2XROA 2NUTC 1LSXA 1XJ6A 2M7VA 4JGOA 3T4OA 4II7A 4EU0A 2W0NA 3H82B 3H9WA 2PYRA 5HL6A 4HH2A 4HJ3A 1S4SA 2W3GA 4GHIB 3RH8B 1MZUA 3LIFA 4I5SA 3ICYA 2J3WA 2EWVA 1N9NA 2HV1A 5DJTA 1W63M 2L0WA 4Q0JA 4GS9B 5CX7A 5LBRA 3GECA 5HWWA 4FSFA 1UWPX 3MQ0A 2YKHA 1YSPA 3K3DA 4WL9A 1V9ZA 4NXBA 2INWA 2V9AA 3EQUA 5EFWA 1BYWA 3LFVA 2LB9A 2PYPA 4EESA 2WKPA 4GLQA 2V0UA 3BJNA 2GZAA 5HD3A 2J80A 4GHIA 4CQHA 4OOLA 3FG8A 2XSSA 3E4PA 4OOMA 1F98A 3IBJA 3OLOA 1DRMA 4GS9A 2M1CA 4I3IA 4LLOB 4F3LB 3PXPA 3E98A 3D72A 4WEJA 2L4RA 3B33A 1TS6A 2BASA 2Z6DA 3CUEA 3UB6A 1S1ZA 4R38A 4GCZA 2IA2A 2O9AA 4PHTA 4HP4A 3KX0X 4HJ6A 4KUKA 3RFBA 4MCWA 2G7UA 2PT7A 2JKRM 3NJAA 4LRZE 4GJ4A 5TBMA 2QKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6A A;  5J4E A;  3K3C A;  1JNU A;  5HZH A;  4PKY A;  3EEH A;  1T19 A;  5DKL A;  5TBM B;  3UMD A;  2QWS A;  1TS0 A;  3UB7 A;  1DP9 A;  1D7E A;  1T1C A;  3F1P A;  3HJK A;  3PYP A;  1X0O A;  4HH3 A;  3RTY A;  3P7N A;  4BBU A;  1XFN A;  3VE3 A;  2V0W A;  4H6J A;  3BY9 A;  1OTI A;  2L1M A;  2OWJ A;  1TS8 A;  2ZOI A;  1DP6 A;  3A0V A;  4WLA A;  3MR0 A;  4EER A;  3CAX A;  4HY8 A;  1T1A A;  5DKK A;  5J7E A;  4DJ3 A;  1OT9 A;  3SW1 A;  1LSV A;  3C8C A;  4MN5 A;  5F5Y A;  5G4Y A;  3LIA A;  1ODV A;  5IU1 A;  3LIC A;  1LL8 A;  1P0Z A;  1P97 A;  2JHE A;  1VB6 A;  3HJI A;  3E4Q A;  2A24 B;  3LI8 A;  2ZBB A;  3LYX A;  1NWZ A;  3PHY A;  2WKQ A;  1N9L A;  5HDS A;  3NHQ A;  3UE6 A;  2B02 A;  3VE4 A;  4E04 A;  1DP8 A;  2KX6 A;  1S67 L;  1GSW A;  4MN6 A;  1GSV A;  4EW7 A;  4EET B;  2V1A A;  4YWZ A;  1Y28 A;  1XJ2 A;  1LSX A;  1V9Y A;  1XJ6 A;  2PR5 A;  4JGO A;  2KDK A;  4GW9 A;  1S4R A;  3A0S A;  2PHY A;  3ULF A;  5IS1 A;  1WA9 A;  2W0N A;  3G6O A;  3H82 B;  5AVF A;  3EWK A;  3H9W A;  1F9I A;  1GSX A;  1OJ5 A;  2PYR A;  2VV6 A;  4HJ3 A;  1S4S A;  3H7W A;  2VV7 A;  3A0R A;  2JN7 A;  4HH2 A;  4GHI B;  4K08 A;  4LRY C;  1MZU A;  3LIF A;  3RH8 B;  3IBR A;  4I5S A;  3ICY A;  4NXF A;  1OJG A;  2EA9 A;  5AVE A;  2HV1 A;  1N9N A;  5DJT A;  5HWV A;  4HI4 A;  2VV8 A;  2L0W A;  4JGQ A;  5F69 A;  3IS2 B;  4I3J A;  2P7J A;  4GS9 B;  3GEC A;  4HIA A;  1T18 A;  4LPZ A;  5HWW A;  1UWP X;  3LID A;  3GDI A;  4DJ2 A;  4HQA A;  2H28 A;  3NOP C;  3LI9 A;  2PD7 A;  1LT0 A;  2YKH A;  3IS2 A;  5HWT A;  1N9O A;  4B9O A;  3K3D A;  4WL9 A;  1UGU A;  1G28 A;  4HP9 A;  4I3A A;  4NXG A;  1LSW A;  1V9Z A;  4EXO A;  4R3A A;  4NXB A;  5KIZ A;  4L9F A;  2INW A;  2V9A A;  1OT6 A;  2QHK A;  5DJU A;  5HSQ A;  5HDD A;  3F1P B;  4HJ4 A;  5EFW A;  3FC7 A;  4R70 A;  1BYW A;  2PD8 A;  3MJQ A;  2PR6 A;  5I5L A;  4BBV A;  2R78 A;  1XJ4 A;  2PYP A;  4I39 A;  2D01 A;  2W27 A;  3T50 A;  4EEP A;  4BBT A;  4EES A;  2WKP A;  5A8B A;  3H82 A;  2VEA A;  2V0U A;  2QJ5 A;  2VLG A;  2YKF A;  5HD3 A;  3H7W B;  3F1O A;  4JGR A;  4L9E A;  2A24 A;  2J80 A;  4GHI A;  5G4Z A;  5HD5 A;  2PDR A;  3MQQ A;  3FG8 A;  4F3L A;  3MFX A;  2V1B A;  2ZOH A;  4EQ1 A;  3BY8 A;  3E4P A;  4JGP A;  1F98 A;  1OTA A;  1XJ3 A;  3E4O A;  3MQO A;  3OLO A;  4PKY G;  1DRM A;  4KQD A;  2I9V A;  2CMN A;  4WN5 A;  3UME A;  4GS9 A;  2M1C A;  1S66 L;  4I3I A;  4LLO B;  3VOL A;  4F3L B;  4HOI A;  4WUJ A;  3D72 A;  4L9G A;  3F1N B;  1XFQ A;  4LRX C;  4EEU A;  4M4X A;  4R6L A;  2L4R A;  4NXE A;  3B33 A;  1T1B A;  4HHD A;  1UWN X;  1TS6 A;  2BAS A;  2OOL A;  3LIE A;  3CWF A;  1OTD A;  2Z6D A;  1EW0 A;  5F68 A;  3UB8 A;  3UB6 A;  2D02 A;  3F1O B;  4XT2 B;  1S1Z A;  4R38 A;  5HDC A;  4KUO A;  4GCZ A;  1S1Y A;  2K7S A;  3BWL A;  3UB9 A;  3MXQ A;  3NOT C;  4HP4 A;  3KX0 X;  1TS7 A;  2QJ7 A;  4XT2 A;  3LIB A;  4HJ6 A;  4KUK A;  3ZQ5 A;  2WKR A;  3C2W A;  3F1N A;  5J3W A;  4HNB A;  3CLO A;  2OWH A;  1D06 A;  4H6J B;  3NJA A;  3LUQ A;  4I38 A;  4LRZ E;  5TBM A;  1KOU A;  2Z6C A;  1OTB A;  1OTE A;  3NOU C;  2GJ3 A;  4WF0 A;  4RQ9 A;  2QKP A; 
#chains in the Genus database with same CATH topology
 1RCJ A;  3DTE A;  4ID4 A;  1PWC A;  2V8C A;  3FV7 A;  3P7N A;  1TF1 A;  3UO9 A;  4OON A;  4OVD A;  1YLZ A;  4GD6 A;  3SZT A;  3LR4 A;  2X01 A;  3N8R A;  3WWX A;  1N9L A;  1N4O A;  5EM1 A;  2K2N A;  3PBT A;  3BRM A;  1M40 A;  2I72 A;  3DWK A;  3T1R A;  1V9Y A;  2PR5 A;  2Q9N A;  2KDK A;  2PHY A;  4X69 A;  5AJG A;  2ACG A;  4LRY C;  4QY6 A;  3CPT A;  3KO6 A;  4ARZ B;  4HI4 A;  1W7F A;  5FDS A;  4MN7 A;  5HWT A;  2W3H A;  1LI0 A;  4HP9 A;  4I3A A;  3N6I A;  3QHY A;  2OV5 A;  1BSG A;  2W1T A;  4I39 A;  4BMW A;  2Y59 A;  2P08 A;  3S4X A;  5G4Z A;  5E2E A;  2WZZ A;  3BY8 A;  1XJ3 A;  3VP0 A;  5FQJ A;  1MWU A;  2B5R A;  3CIT A;  4OQ0 A;  2HDS A;  4NXE A;  4HHD A;  5JYO A;  3MKF A;  4HBU A;  1EW0 A;  2JE5 A;  3UB8 A;  2H10 A;  3QNB A;  2DMW A;  1F5M A;  4E3J A;  4KUO A;  1G5U A;  4WYY A;  1NJ4 A;  4YOF A;  5J3W A;  1ZKJ A;  4X56 A;  3R7W B;  3NOU C;  2H5S A;  4ZRR A;  1W63 Q;  3CMZ A;  3PBR A;  2HJ9 C;  4KZ7 A;  3IT9 A;  3EEH A;  1N9B A;  3HJK A;  1YPR A;  4H6J A;  4X53 A;  1Q2P A;  3S7N A;  3V3S A;  2JKT I;  2ZC7 A;  5IU1 A;  3HLC A;  3UE1 A;  3KYQ A;  4X1M A;  3E4Q A;  4P6Z S;  2OAQ 1;  4MN6 A;  4EW7 A;  4C6Y A;  4R3B A;  1Z6F A;  1IEM A;  4JF5 A;  4GW9 A;  1RP5 A;  3WRZ A;  4B93 A;  3UB9 A;  1QME A;  3VOZ A;  3KSI A;  1WYC A;  5CTN A;  3SH9 A;  3UN7 A;  3DAV A;  4ME4 A;  3IS2 A;  4WEL A;  1FQG A;  5C5K A;  1PW1 A;  3EGX C;  1CEG A;  1FIK A;  2QHK A;  1YMX A;  4HJ4 A;  3IXG A;  1GA9 A;  3MJQ A;  1MKI A;  3MKE A;  4JXW A;  3IX8 A;  2JC7 A;  1D1J A;  3F1O A;  4P6B A;  5TGF A;  2XFS A;  1J9M A;  4QPR A;  4Y7P A;  1JTG A;  2V1Z A;  3BYD A;  1K55 A;  3FKW A;  1PI4 A;  3CI6 A;  3BFC A;  1SCW A;  3TRC A;  2XR0 A;  4CLC A;  4LV0 A;  4OPQ A;  3ZFZ A;  5E2G A;  1NYY A;  4H6J B;  1MPL A;  2QYB A;  3C4O A;  4RQ9 A;  4ETX A;  1HD8 A;  2V8F A;  3T4K A;  3JYI A;  1H8Y A;  3OPP A;  2X71 A;  4WMC A;  4Q8I A;  5TBM B;  3UB7 A;  5M19 A;  4RVA A;  3LEQ A;  4MDZ A;  4S2N C;  1FCN A;  1LSV A;  3M2J A;  1ODV A;  2PAV P;  3EEA A;  3LIC A;  2LB5 A;  4PKY A;  1VB6 A;  4FD8 A;  4UA9 A;  4KZ3 A;  3VSK A;  4CPK A;  2HZ5 A;  1JWV A;  1BLC A;  3DBA A;  5FI2 A;  1S4R A;  3A0S A;  5EVI D;  1WA9 A;  3HLE A;  3RXX A;  1NZU A;  5M1A A;  3QP8 A;  2Y2O A;  5AVE A;  3HVF A;  1TDG A;  1G6O A;  1T18 A;  4QD4 A;  3LID A;  1N9O A;  4K0W A;  5HAP A;  4LGW A;  1LSW A;  4EXO A;  1DJC A;  4QU3 A;  5DJU A;  5CXW A;  5GLB A;  5FL3 A;  1GCE A;  3JVU A;  2ZMV A;  1U60 A;  3KSG A;  4Y3I A;  2OAP 1;  3MQQ A;  4EUV A;  1TD5 A;  2XF3 A;  2ZQ8 A;  4IUK A;  4WUJ A;  4EEU A;  3N7W A;  4F94 A;  2FH5 A;  3VMA A;  1OTD A;  5F68 A;  5CER A;  4L0L A;  4EBP A;  4U0T A;  3V67 A;  2XK1 A;  4HNB A;  2XGN A;  1L3L A;  1K6R A;  2Y79 A;  1ZHH B;  4KG5 A;  1MWT A;  3R4K A;  1T19 A;  2QWS A;  5FAQ A;  4EBN A;  4Y0O A;  1VET B;  5FAO A;  2XEP A;  4WM9 A;  4P0M A;  2L1M A;  4EWF A;  3PAE A;  1T1A A;  3Q7Z A;  4RYE A;  3S7O A;  3T1Q B;  3G2Z A;  4MBF A;  2VA0 A;  4E3M A;  2VGK A;  3ZYT A;  3UE6 A;  4DXB A;  5FQK A;  3A3E A;  2XFT A;  4B88 A;  4E3N A;  4B4Z A;  2NUT C;  2AVX A;  1XJ6 A;  2M7V A;  4II7 A;  4BD1 A;  2W0N A;  4HH2 A;  1K56 D;  1S4S A;  2W3G A;  3MZF A;  1MZU A;  1YM1 A;  4I5S A;  5I94 A;  5CHU A;  2Q9M A;  5DTT A;  2OLU A;  4JPM A;  2RCX A;  1YSP A;  5FEF A;  4PM8 A;  2Y2G A;  4NXB A;  4NET A;  2IWC A;  2INW A;  5A90 A;  4Y13 A;  1PYY A;  2PYP A;  3SH8 A;  2WKP A;  2J80 A;  3Q1F A;  1JWZ A;  3IQA A;  3UB5 P;  4OPZ A;  1XA7 A;  2XSS A;  1F98 A;  1I2W A;  4FTX A;  1E25 A;  4LLO B;  3Q81 A;  5FA7 A;  3B33 A;  2BAS A;  1S1Z A;  4PHT A;  5FAS A;  4RX2 A;  1XA1 A;  4KUK A;  4KZ5 A;  4OP8 A;  5F1G A;  3DTI A;  2ZL1 A;  2QKP A;  5F6A A;  4UAA A;  2WKE A;  4IVI A;  5E2H A;  4QY5 A;  1TS0 A;  4OPR A;  3VE3 A;  3S1Y A;  4C3Q A;  3IF6 C;  3T12 B;  3BY9 A;  2WK0 A;  5HAI A;  1YMS A;  2VGL S;  2B18 A;  1K57 A;  5CEC A;  5G4Y A;  4DMZ A;  1BLP A;  2ZBB A;  3HLG A;  3FPW A;  1GSV A;  3FPV A;  4EUZ A;  3O5Y A;  1FR1 A;  3ZG9 B;  3ULF A;  3G32 A;  3G6O A;  1FOF A;  3FZC A;  3PBN A;  1YLT A;  2PD7 A;  4K91 A;  1NLZ A;  4Q0I A;  4XXR A;  4L9F A;  3F1P B;  3OC2 A;  3E0Y A;  3FYZ A;  1JWP A;  1IYQ A;  3CZD A;  3PR6 A;  1NY0 A;  3RXW A;  3MFX A;  1XFQ A;  3EOI A;  3QP5 A;  4XUX A;  2W3F A;  1UWN X;  3T4T A;  3CWF A;  3M6B A;  2ZC6 B;  4YNR A;  1BLH A;  1FSY A;  4OPY A;  3B42 A;  4BQM A;  4MMN A;  3ITA A;  1KOU A;  1W8Y A;  4GN2 A;  1A0K A;  4X6T A;  1DP9 A;  3LR5 A;  2Z2M B;  1KE4 A;  3W4O A;  3D9Y A;  4EER A;  3HLF A;  2BTF P;  2HGV A;  3GQZ A;  1I2S A;  4IUH A;  2XRN A;  3V5M A;  4GDN A;  1RGZ A;  3DW0 A;  2KX6 A;  2CC1 A;  2V1A A;  4CLC E;  5GL9 A;  3ZGA B;  4KZ6 A;  3GRJ A;  2BG1 A;  3G30 A;  3BM6 A;  4K08 A;  3VFF A;  5DTK A;  3ZDJ A;  3PBS A;  4IBR A;  1HZO A;  1L0E A;  2P7J A;  2ZQ7 A;  3GDI A;  2HP9 A;  3AGD A;  3IF6 B;  3GV9 A;  3W2Z A;  3UPN A;  1PWG A;  4A5R A;  4NXG A;  1K4E A;  2ZC4 B;  5HDD A;  5CGX A;  3S22 A;  2GX5 A;  4K0X A;  1VM1 A;  1VEU B;  2WGW A;  2YKF A;  3NBL A;  4L9E A;  3NUL A;  1WYB A;  2Y2I A;  2WAF A;  1PI5 A;  5TJJ A;  1JVJ A;  4JGP A;  5IT5 A;  2H0Y A;  1E4D A;  2CMN A;  1S66 L;  5DF9 A;  3EGD C;  3I7J A;  4XT2 B;  2O99 A;  3HUO A;  5HDC A;  3VOY A;  1ERO A;  2K7S A;  3BWL A;  3MXQ A;  1ALQ A;  5HL1 A;  3MZD A;  3LCE A;  3CUE C;  4DE0 A;  4N9K A;  1P9W A;  4BLM A;  4O8G A;  1CK3 A;  2BLS A;  2FFF B;  3C5A A;  3ISG A;  5KMW A;  2DCF A;  1YLW A;  4HH3 A;  4P6Z M;  4LV2 A;  4UEY A;  1RGY A;  4CJN A;  1DP6 A;  2J3T C;  4HY8 A;  1GHM A;  4ZJ3 A;  4B4X A;  4Y2F A;  1H3Q A;  2QMI A;  1P0Z A;  3M2K A;  4Z9Q A;  2HP6 A;  4JXV A;  5HDS A;  4S2P A;  4DDS A;  2B02 A;  1FR6 A;  1S67 L;  5GHY A;  4YWZ A;  4U0X A;  1ESI A;  4OLG A;  3GMW A;  5IS1 A;  5AVF A;  5CRF A;  4HQA A;  3V39 A;  1CI8 A;  4KG6 A;  4QWO A;  5F69 A;  1ES2 A;  3IS2 B;  1SDE A;  1KGE A;  1PRQ A;  3IXH A;  1LT0 A;  4GDB A;  3A3I A;  2HDR A;  4MLL A;  4BJP A;  3IX3 A;  3ZG0 A;  2J9O A;  4ZDX A;  4R3A A;  1H8Z A;  1H0M A;  3LR3 A;  1OT6 A;  1PWD A;  2X02 A;  5HPF A;  2W3E A;  4R70 A;  2ZLY A;  1OPX A;  1O7E A;  1XJ4 A;  4S2I A;  3KYZ A;  4B9O A;  4JF4 A;  3OCN A;  2A24 A;  3KSF A;  3CJM A;  3C7U A;  4O0P A;  2GNX A;  3WS2 A;  3MQO A;  1IYO A;  3UME A;  3ZG5 A;  2EFU A;  3F1N B;  1YSQ A;  3C4P A;  2KOI A;  2VGL M;  2Y2N A;  3F1O B;  3UPO A;  5K5B A;  1S1Y A;  2P74 A;  3LIB A;  1VET A;  3F1N A;  3GR2 A;  3HLD A;  1NLY A;  3TJZ C;  2VX8 A;  4I38 A;  1XX2 A;  1OTB A;  5KSC A;  4IJG A;  1ERQ A;  5J4E A;  2XLN A;  3OPR A;  1X0O A;  3VP4 A;  1EWZ A;  5U47 A;  3NDE A;  5HAR A;  4WLA A;  4G3V A;  4HBT A;  3C30 A;  4DE2 A;  3LY3 A;  4CLC C;  4KQQ A;  3BLM A;  3PHY A;  2PRF A;  2A2L A;  3UDX A;  2XRO A;  3MBZ A;  3WS5 A;  2XD5 A;  3T4O A;  2Y2M A;  4HJ3 A;  3O88 A;  3RH8 B;  4DRT A;  2J3W A;  3QNC A;  3BFE A;  2EWV A;  2HV1 A;  3IH9 A;  5DJT A;  1W63 M;  2H0T A;  1K54 C;  2L0W A;  3HUM A;  4GS9 B;  4MNR A;  4FSF A;  2PU4 A;  2YKH A;  3K3D A;  4WL9 A;  4LFU A;  5EE8 A;  1XPB A;  4FUW A;  5DTS A;  1GHI A;  1BUL A;  4LEN A;  4S2N A;  3UDI A;  5BOH A;  4GLQ A;  3BJN A;  4CQH A;  4DDY A;  3Q07 A;  1L0F A;  3VP1 A;  1DRM A;  1VEU A;  2WGW B;  4GS9 A;  2M1C A;  3ZVW A;  3PXP A;  1PZO A;  4ZJ1 A;  5G18 A;  4E3L A;  2Z6D A;  3CUE A;  2ZMA A;  5A91 A;  4OKP A;  2OSU A;  5L09 A;  1FCM A;  2UWX A;  4KZ4 A;  4HJ6 A;  3RFB A;  4MCW A;  1SHV A;  1XKZ A;  2PT7 A;  4DF6 A;  3NJA A;  4X68 A;  5TBM A;  3IHA A;  3F1P A;  4IHQ A;  1W5D A;  2ZC5 B;  4N92 A;  1ONH A;  2EX2 A;  2ZOI A;  3IWI A;  5FSR A;  4Q0H A;  3LR0 A;  3Q7V A;  3SW1 A;  4NG2 A;  4U3T A;  4X25 A;  3ZNT A;  1PIO A;  2A49 A;  1DY6 A;  3HL9 A;  3HJI A;  4MBH A;  3ZHH A;  1IKG A;  5MC7 A;  2G2U A;  3QP6 A;  4WZ4 A;  1FIL A;  3N4I A;  2VV6 A;  4DJ3 A;  4AFI A;  4NEE D;  5HWV A;  5EOE A;  3MF0 A;  2WGI A;  2Y8H A;  3LI9 A;  3LO7 A;  3MS6 A;  3E2K A;  5EM0 A;  3O86 A;  1UGU A;  1LL5 A;  2K31 A;  5HX9 A;  3G4P A;  2WKH A;  2JKT M;  2KLI A;  2R78 A;  2JBF A;  3FKV A;  3H7W B;  5HD5 A;  1KGG A;  5CHJ A;  3DWZ A;  3NCK A;  4EQ1 A;  3HLW A;  5JYP A;  4WN5 A;  4DE3 A;  2P9V A;  4HOI A;  4L9G A;  2WGV A;  2OOL A;  3HCY A;  4OP5 A;  1AXB A;  1ES3 A;  1K56 A;  1MWS A;  4PMA A;  4PM6 A;  4RX3 A;  5DFX A;  1G6A A;  5FQQ A;  3ZQ5 A;  1E3U A;  2VZW A;  2ZM8 A;  2M7U A;  3AGE A;  1JNU A;  2ZMF A;  4NK3 A;  5DKL A;  2Y2L A;  1KGF A;  4ETZ A;  2Y2Q A;  1GHP A;  3N8S A;  1Y4O A;  5AQA A;  3D3O A;  4S2O A;  1ERM A;  2GDN A;  3TOI A;  5CGW A;  4S2L A;  1LL8 A;  4EBL A;  5HAQ A;  3QP4 A;  3BQA A;  1SKO A;  4O01 A;  4LCM A;  3BLS A;  3HBR A;  1VHM A;  4MEZ A;  1XP4 A;  4JF6 A;  5KZH A;  1M6K A;  4N9L A;  3A0R A;  2JN7 A;  3ITB A;  2XD1 A;  1OJG A;  2VV8 A;  3VSL A;  2ZL1 B;  3OCL A;  2XQZ A;  3OPH A;  3ZVT A;  2H28 A;  5FI6 A;  4S2J A;  1PZP A;  4JXG A;  4P85 A;  1FCO A;  2XA7 M;  4ARZ A;  5F83 A;  3FC7 A;  3IWO A;  4BBV A;  1W79 A;  2R9W A;  5EUA A;  4UQI M;  4IVK A;  4PAU A;  5J8X A;  2Y2J A;  3T4Q A;  3VFH A;  2WAD A;  1Y54 A;  3E4O A;  1K55 C;  1ACF A;  4M4X A;  1ZTU A;  3PTE A;  4BWI A;  4DN0 A;  4FOF A;  5EVI C;  2EXA A;  3WS0 A;  1SKF A;  4R1G A;  3K2N A;  4HEF A;  3NOT C;  1TS7 A;  2QJ7 A;  2ZJ9 A;  3PBQ A;  3ZG7 B;  1HTZ A;  4IBX A;  2E8J A;  3LUQ A;  2Z6C A;  5J7E A;  2GJ3 A;  1K4F A;  2J9P A;  4E3I A;  5HZH A;  3UE0 A;  3UMD A;  3WRT A;  3PYP A;  3RTY A;  4R4R A;  2V0W A;  1NXY A;  2XDM A;  5L2F A;  4R4S A;  3R7W A;  3BEC A;  3M6H A;  4KZA A;  1P97 A;  3LYX A;  5CTM A;  2R9X A;  3UNW A;  3DTM A;  3G35 A;  5EOO A;  2J8Y A;  4N1H A;  4KQR A;  4MBK A;  3IXD A;  1CF0 A;  5DF8 A;  3EWK A;  1GSX A;  4WMC D;  3H7W A;  3KSH A;  1ES5 A;  2PBD P;  3IBR A;  2JKR I;  4UA7 A;  4KZ9 A;  4LCL A;  4GNU A;  3FWL A;  4LPZ A;  2B95 A;  4P87 A;  3P09 A;  2W1R A;  4Y15 A;  3V50 A;  3QP2 A;  1L0D A;  4O7D A;  1K0K A;  3GTC A;  1ZC2 A;  1XGI A;  5DFY A;  3A3F A;  3VP2 A;  3H82 A;  2VEA A;  4UQI S;  4JGR A;  1MY8 A;  4F3L A;  2V1B A;  4ZJ2 A;  2HF6 A;  4X55 A;  1AWI A;  4LRX C;  2ZC3 B;  1DJA A;  3T1X A;  4DKI A;  4OLD A;  3T4L A;  1KVL A;  4ZBE A;  1J3W A;  4G3K A;  1NZO A;  3WS4 A;  2WKR A;  3ZNY A;  3LY4 A;  5CED A;  2OWH A;  3G31 A;  3OZH A;  4FH2 A;  4CLC B;  1SZV A;  2VK3 A;  3D4F A;  2VJW A;  4DJ2 A;  4R0Q A;  3IF5 A;  1T1C A;  4BBU A;  2P9V B;  5HFO A;  5FQI A;  2JKG A;  1OTI A;  4JKT A;  2NUP C;  1OT9 A;  1JTD A;  3LIA A;  5FQM A;  4GZB A;  1KE0 A;  3LI8 A;  1K38 A;  2WKQ A;  4S2K A;  3SS4 A;  2VGJ A;  3GSG A;  1WE4 A;  4JGO A;  4ESP A;  4EU0 A;  3H9W A;  2PYR A;  3OPL A;  1BTL A;  4GHI B;  1CI9 A;  3ICY A;  3L9K A;  1N9N A;  4QB8 A;  5CX7 A;  4X1L A;  1UWP X;  3MQ0 A;  2DNS A;  1BUE A;  1K6S A;  1O07 A;  2C5W B;  3IWQ A;  2V9A A;  2Y91 A;  5F1F A;  5EFW A;  1BYW A;  1MWR A;  2LB9 A;  4EES A;  3A3D A;  4PPR A;  3Q7V B;  5HD3 A;  3Q82 A;  4OOL A;  3FG8 A;  3E4P A;  4OOM A;  4JXS A;  2EFX A;  3IBJ A;  1TDL A;  3V3R A;  1TVF A;  4F3L B;  4GB7 A;  3D72 A;  2EX8 A;  4WEJ A;  2L4R A;  1TS6 A;  3UB6 A;  4GCZ A;  3IH8 A;  1ESU A;  4PM7 A;  2EXB A;  4HP4 A;  4Y17 A;  5EV0 A;  3NC8 A;  1S0W A;  2JKR M;  2OLV A;  1IEL A;  3K3C A;  1EI5 A;  5FEG A;  1OME A;  4KZB A;  1D7E A;  1XFN A;  3BFF A;  1MBL A;  5DKK A;  5A92 A;  3CHW P;  1G68 A;  2ZQC A;  4RA7 A;  4YFM A;  1SDN A;  3C8C A;  5F5Y A;  4HES A;  5HW3 A;  5GHX A;  1LLB A;  1NRJ A;  1C3B A;  2XA7 S;  4GOG A;  3W4Q A;  3VE4 A;  1MC0 A;  2Y2K A;  4EV4 A;  1GSW A;  2DRW A;  4H8R A;  5KSH A;  5GHZ A;  1IOU A;  2PU2 A;  4D60 A;  1Z09 A;  4R23 A;  3IHB A;  4I3J A;  2MJ6 A;  1K25 A;  3T4S A;  5EVI A;  1MKM A;  1Q2Q A;  3AGF A;  2ZQA A;  3W4P A;  4M3K A;  1XXM A;  5HSQ A;  2FFY A;  5FAT A;  2D01 A;  1CQA A;  3BEB A;  3BQ8 A;  2QJ5 A;  2IWB A;  2PDR A;  4WEK A;  2VKS A;  2WYX A;  3HRE A;  3W8K A;  1TEM A;  3T4J A;  1FSW A;  1VQQ A;  1T1B A;  3LIE A;  4E3K A;  4QHC A;  5DVA A;  2D02 A;  5GLA A;  3UDF A;  5AQ7 A;  2J3T D;  4XT2 A;  5A93 A;  5FDH A;  1BZA A;  3JVV A;  3P98 A;  1KVM A;  3N8L A;  4WF0 A;  2HPB A;  4ZAM A;  1HLU P;  1K57 C;  1YLY A;  3GVB A;  3O3V A;  3O87 A;  2PBY A;  4GKU A;  2JCH A;  4ZTK A;  1TS8 A;  1K54 A;  3OOV A;  4UHU A;  4R3J A;  4FH4 A;  5D3O A;  2IWD A;  1F2K A;  3MFD A;  2A24 B;  5FAP A;  4EET B;  1S6R A;  2EX6 A;  1IYS A;  1Y28 A;  3EQV A;  4DXC A;  4Y0T A;  4WZ5 A;  1F9I A;  5L07 A;  1ZG4 A;  4KZ8 A;  4NXF A;  5AQ9 A;  1LI9 A;  2V2F F;  4XUZ A;  3DTK A;  4YIN A;  3G34 A;  4OQG A;  1W8Q A;  4OQI A;  2Q0O A;  2W1T B;  3HUN A;  2Y2H A;  3SH7 A;  4NKP A;  3ZG8 B;  1E3U D;  4N1X A;  2PD8 A;  3U2A A;  3JPU A;  2QPN A;  1STZ A;  4OQH A;  5EPH A;  5A8B A;  5L10 A;  4FCF A;  2VLG A;  5CEB A;  3MSH A;  3L7H A;  5M18 A;  2Y2P A;  1OTA A;  2O9C A;  1CJF A;  4E3O A;  1CEF A;  1PNE A;  3TE8 A;  5IHV A;  5DF7 A;  3IX4 A;  5EVI B;  1IKI A;  2ZM0 A;  1IFQ A;  2Y55 A;  1QMF A;  3TW8 A;  1KE3 A;  2FZ0 A;  4GD8 A;  3C38 A;  3CLO A;  1L0G A;  5E2F A;  3WS1 A;  1OTE A;  3PAG A;  4E6X A;  3MMH A;  2WKI A;  2ZD8 A;  1HVB A;  4KQO A;  4E6W A;  1ONG A;  4OH0 A;  5EVE A;  2UV0 E;  5TFQ A;  1PFL A;  3E2L A;  1NRF A;  4LV1 A;  3NEC A;  2ZQ9 A;  3MR0 A;  3CAX A;  1ES4 A;  3BFD A;  3U4L P;  2Y4A A;  2P04 A;  4MN5 A;  3BW6 A;  2HJE A;  2EWW A;  1NWZ A;  1H8M A;  3TG9 A;  4WZ5 C;  4E04 A;  2WAE A;  3OBF A;  3NIA A;  1XJ2 A;  4KEN B;  3SS3 A;  1KDS A;  1BLS A;  3VV4 A;  1OJ5 A;  1YLP A;  1BT5 A;  1SKO B;  2VV7 A;  1L2S A;  4G3W A;  3MXS A;  4KG2 A;  3S7Q A;  2EA9 A;  5CGS A;  4JGQ A;  5E43 A;  5AQB A;  2G2W A;  2XH9 A;  1P9R A;  3NOP C;  1YT4 A;  3ZCZ A;  3CG5 A;  3PBO A;  3UE3 A;  3CPT B;  1I5Q A;  1G28 A;  5GLC A;  4EQI A;  3NI9 A;  5KIZ A;  3RJU A;  3IF6 A;  5I5L A;  2PR6 A;  2V20 A;  3T50 A;  2W27 A;  3P01 A;  5FQ9 A;  1XGJ A;  4EEP A;  2A3U A;  1NYM A;  4BD0 A;  3B47 A;  3UPP A;  2ZOH A;  2RL3 A;  4PKY G;  4BBT A;  4KQD A;  2I9V A;  3VOL A;  5HPI A;  4OOY A;  2C6W B;  2W3D A;  3LEZ A;  4R6L A;  4BL3 A;  1YKD A;  5FI7 A;  1MXO A;  3MXR A;  3SS5 A;  5L8M A;  4CLC D;  3C2W A;  4JLF A;  5GLD A;  1D06 A;  3S7P A;  3NY4 A;  1GA0 A;  4LV3 A;  2E8I A;  3VP3 A;  4D2O A;  2EX9 A;  4HIA A;  3B3X A;  1DJB A;  3TSG A;  2J7V A;  2HDQ A;  2JKF A;  2QZ6 A;  2OWJ A;  3A0V A;  3G2Y A;  4Y5F A;  2JHE A;  2O9B A;  5CHM A;  1KDW A;  4C75 A;  3NHQ A;  5TR7 A;  2O0Y A;  1DP8 A;  4Z1W A;  1YAX A;  3IXB A;  1LSX A;  2HDU A;  3H82 B;  3KYE A;  3T1S A;  5HL6 A;  3LIF A;  3SOI A;  3MZE A;  4DE1 A;  4IED A;  1H5X A;  4Q0J A;  5LBR A;  2ZQD A;  3GEC A;  5HWW A;  3BFG A;  1PW8 A;  2HP5 A;  4S2M A;  5EVL A;  1V9Z A;  4WBG A;  1ZG6 A;  3C7V A;  3EQU A;  2ZM2 A;  3HLB A;  3LFV A;  4UA6 A;  1LL9 A;  4PM9 A;  3A3J A;  2V0U A;  2GZA A;  4GHI A;  3UY6 A;  5F82 A;  3OLO A;  3LGO A;  5EEC A;  2WZX A;  4I3I A;  4BEN A;  3E98 A;  4PM5 A;  1LHY A;  2WUQ A;  4QJG A;  4JBF A;  4R38 A;  4BL2 A;  1IYP A;  2IA2 A;  2O9A A;  3KX0 X;  4Y0U A;  1YQS A;  2G7U A;  3QP1 A;  3NDG A;  4LRZ E;  4GJ4 A;  1YLJ A;  2Z2L B; 
#chains in the Genus database with same CATH homology
 5F6A A;  3K3C A;  1TS0 A;  1D7E A;  3F1P A;  4IHQ A;  3P7N A;  1XFN A;  3VE3 A;  1TF1 A;  3BY9 A;  2ZOI A;  4Q0H A;  3LR0 A;  5DKK A;  2VGL S;  2B18 A;  3SW1 A;  3C8C A;  5F5Y A;  5G4Y A;  3LR4 A;  4DMZ A;  3HJI A;  2ZBB A;  1N9L A;  1NRJ A;  2XA7 S;  3FPW A;  3VE4 A;  2K2N A;  1MC0 A;  3PBT A;  1GSW A;  1GSV A;  3FPV A;  5MC7 A;  3O5Y A;  1V9Y A;  2PR5 A;  2KDK A;  2PHY A;  3ULF A;  5KSH A;  1IOU A;  3G6O A;  5AJG A;  2VV6 A;  4LRY C;  4DJ3 A;  4AFI A;  3KO6 A;  3PBN A;  4NEE D;  4ARZ B;  5HWV A;  4HI4 A;  4I3J A;  2MJ6 A;  4MN7 A;  3MF0 A;  3T4S A;  2Y8H A;  3LI9 A;  2PD7 A;  1MKM A;  5HWT A;  2W3H A;  1UGU A;  1NLZ A;  4HP9 A;  4I3A A;  4Q0I A;  2K31 A;  4L9F A;  5HSQ A;  3F1P B;  3OC2 A;  2JKT M;  2KLI A;  2W1T A;  3E0Y A;  2R78 A;  4I39 A;  4BMW A;  2D01 A;  3BQ8 A;  2P08 A;  2QJ5 A;  3H7W B;  3PR6 A;  5HD5 A;  5G4Z A;  2PDR A;  3MFX A;  4EQ1 A;  3BY8 A;  1XJ3 A;  4WEK A;  4WN5 A;  2VKS A;  4HOI A;  4L9G A;  3T4J A;  1XFQ A;  3CIT A;  3EOI A;  4NXE A;  1T1B A;  2W3F A;  4HHD A;  1UWN X;  2OOL A;  3LIE A;  3HCY A;  3CWF A;  3T4T A;  1EW0 A;  3UB8 A;  2D02 A;  2DMW A;  1F5M A;  4KUO A;  4YNR A;  5DFX A;  2J3T D;  3ZQ5 A;  4XT2 A;  4YOF A;  5J3W A;  3B42 A;  2VZW A;  2M7U A;  3JVV A;  4MMN A;  3R7W B;  1KOU A;  3NOU C;  4WF0 A;  4ZRR A;  1W63 Q;  3PBR A;  1JNU A;  2HJ9 C;  2ZMF A;  5DKL A;  3EEH A;  1DP9 A;  3HJK A;  3LR5 A;  4ETZ A;  4H6J A;  4EER A;  1TS8 A;  3D3O A;  3S7N A;  2HGV A;  3OOV A;  2JKT I;  5IU1 A;  1LL8 A;  4IUH A;  3KYQ A;  3E4Q A;  2A24 B;  4P6Z S;  2OAQ 1;  2XRN A;  2KX6 A;  4MN6 A;  4EW7 A;  3BQA A;  2V1A A;  4EET B;  4CLC E;  4O01 A;  1Y28 A;  3EQV A;  4GW9 A;  1VHM A;  4B93 A;  1F9I A;  3UB9 A;  3A0R A;  2JN7 A;  4K08 A;  4NXF A;  1OJG A;  3PBS A;  2VV8 A;  3OCL A;  2P7J A;  3KSI A;  3GDI A;  2H28 A;  4ME4 A;  3IS2 A;  4WEL A;  3W2Z A;  2W1T B;  4NXG A;  5C5K A;  2XA7 M;  3EGX C;  2QHK A;  4NKP A;  4ARZ A;  5HDD A;  4HJ4 A;  3FC7 A;  2PD8 A;  3MJQ A;  3U2A A;  4BBV A;  4UQI M;  1STZ A;  5A8B A;  4PAU A;  2GX5 A;  2VLG A;  2YKF A;  4L9E A;  3F1O A;  3T4Q A;  5TJJ A;  4JGP A;  5IT5 A;  1OTA A;  3E4O A;  2O9C A;  4QPR A;  2CMN A;  1S66 L;  5DF9 A;  3EGD C;  3TE8 A;  4M4X A;  1ZTU A;  4BWI A;  4DN0 A;  4FOF A;  3CI6 A;  4XT2 B;  1IFQ A;  3K2N A;  2O99 A;  3TRC A;  5HDC A;  2K7S A;  3BWL A;  4CLC A;  3MXQ A;  3NOT C;  3TW8 A;  1TS7 A;  2FZ0 A;  2QJ7 A;  3C38 A;  3PBQ A;  3CLO A;  4H6J B;  3LUQ A;  3CUE C;  2QYB A;  2Z6C A;  1OTE A;  1P9W A;  5J7E A;  2GJ3 A;  4RQ9 A;  4ETX A;  4O8G A;  3T4K A;  3MMH A;  5HZH A;  4KQO A;  3UMD A;  5TBM B;  3UB7 A;  3PYP A;  3RTY A;  4HH3 A;  4P6Z M;  4UEY A;  2V0W A;  3R7W A;  1DP6 A;  3MR0 A;  2J3T C;  3CAX A;  4HY8 A;  4MDZ A;  1LSV A;  2P04 A;  4MN5 A;  1ODV A;  3BW6 A;  4Y2F A;  1H3Q A;  3EEA A;  3LIC A;  2LB5 A;  1P0Z A;  1P97 A;  4PKY A;  1VB6 A;  2HJE A;  3LYX A;  2EWW A;  1NWZ A;  1H8M A;  5HDS A;  2B02 A;  4E04 A;  1S67 L;  4YWZ A;  3OBF A;  1XJ2 A;  3DBA A;  1S4R A;  3A0S A;  5IS1 A;  1WA9 A;  5AVF A;  3VV4 A;  3EWK A;  1GSX A;  1OJ5 A;  4HQA A;  3H7W A;  2VV7 A;  3KSH A;  4G3W A;  3IBR A;  3S7Q A;  2JKR I;  2EA9 A;  5AVE A;  4JGQ A;  5F69 A;  3IS2 B;  1G6O A;  1T18 A;  4LPZ A;  3LID A;  1P9R A;  2W1R A;  3NOP C;  1LT0 A;  4BJP A;  3PBO A;  1N9O A;  3UE3 A;  1G28 A;  1LSW A;  4EXO A;  4R3A A;  5KIZ A;  3LR3 A;  1OT6 A;  5DJU A;  5HPF A;  2W3E A;  4R70 A;  5I5L A;  2PR6 A;  1OPX A;  1XJ4 A;  3T50 A;  2W27 A;  3P01 A;  5FL3 A;  4EEP A;  5DFY A;  3JVU A;  3H82 A;  2VEA A;  3KYZ A;  4B9O A;  2ZMV A;  4UQI S;  4JGR A;  3KSG A;  2A24 A;  3OCN A;  3KSF A;  4Y3I A;  2OAP 1;  3B47 A;  3MQQ A;  4O0P A;  4EUV A;  4F3L A;  2V1B A;  2ZOH A;  1TD5 A;  2GNX A;  3MQO A;  2HF6 A;  4PKY G;  4BBT A;  3UME A;  4KQD A;  2I9V A;  4IUK A;  3VOL A;  5HPI A;  4WUJ A;  4LRX C;  3F1N B;  2W3D A;  4EEU A;  1YSQ A;  4R6L A;  2KOI A;  2FH5 A;  1OTD A;  5F68 A;  2VGL M;  1YKD A;  3F1O B;  5K5B A;  4L0L A;  1S1Y A;  3T4L A;  5L8M A;  4G3K A;  3LIB A;  3V67 A;  2WKR A;  3C2W A;  3F1N A;  4CLC D;  4HNB A;  2OWH A;  1NLY A;  1D06 A;  3TJZ C;  3S7P A;  2VX8 A;  4I38 A;  4CLC B;  1OTB A;  4IJG A;  2Y79 A;  4HIA A;  1ZHH B;  2VJW A;  5J4E A;  3R4K A;  4DJ2 A;  1T19 A;  2QWS A;  1T1C A;  4BBU A;  1X0O A;  1OTI A;  2L1M A;  2OWJ A;  3A0V A;  4WLA A;  4G3V A;  2NUP C;  1T1A A;  3C30 A;  3S7O A;  1OT9 A;  4Y5F A;  3LIA A;  4CLC C;  2JHE A;  2O9B A;  3LI8 A;  2VA0 A;  3PHY A;  2WKQ A;  3ZYT A;  3NHQ A;  3UE6 A;  2A2L A;  2O0Y A;  1DP8 A;  4Z1W A;  1YAX A;  2XRO A;  2NUT C;  1LSX A;  1XJ6 A;  2M7V A;  4JGO A;  3T4O A;  4II7 A;  4EU0 A;  2W0N A;  3H82 B;  3H9W A;  2PYR A;  5HL6 A;  4HH2 A;  4HJ3 A;  1S4S A;  2W3G A;  4GHI B;  3RH8 B;  1MZU A;  3LIF A;  4I5S A;  3ICY A;  2J3W A;  2EWV A;  1N9N A;  2HV1 A;  5DJT A;  1W63 M;  2L0W A;  4Q0J A;  4GS9 B;  5CX7 A;  5LBR A;  3GEC A;  5HWW A;  4FSF A;  1UWP X;  3MQ0 A;  2YKH A;  1YSP A;  3K3D A;  4WL9 A;  1V9Z A;  4NXB A;  2INW A;  2V9A A;  3EQU A;  5EFW A;  1BYW A;  3LFV A;  2LB9 A;  2PYP A;  4EES A;  2WKP A;  4GLQ A;  2V0U A;  3BJN A;  2GZA A;  5HD3 A;  2J80 A;  4GHI A;  4CQH A;  4OOL A;  3FG8 A;  2XSS A;  3E4P A;  4OOM A;  1F98 A;  3IBJ A;  3OLO A;  1DRM A;  4GS9 A;  2M1C A;  4I3I A;  4LLO B;  4F3L B;  3PXP A;  3E98 A;  3D72 A;  4WEJ A;  2L4R A;  3B33 A;  1TS6 A;  2BAS A;  2Z6D A;  3CUE A;  3UB6 A;  1S1Z A;  4R38 A;  4GCZ A;  2IA2 A;  2O9A A;  4PHT A;  4HP4 A;  3KX0 X;  4HJ6 A;  4KUK A;  3RFB A;  4MCW A;  2G7U A;  2PT7 A;  2JKR M;  3NJA A;  4LRZ E;  4GJ4 A;  5TBM A;  2QKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...