2QKPA

Crystal structure of c-terminal domain of smu_1151c from streptococcus mutans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
SLDRTTQQPFGNGYLSVEQANLILNHLPLEITFVNKDDIFQYYNDSVPAAEMVFKRTPSQVGRNVELCHPPKVLDKVKKVFELLRNGQRDKVNMWFQSERLGKFVYVTYAAVRDQAGDFQGVLEYVQDIKPFFELDSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Structure of C-terminal domain of SMU_1151c from Streptococcus mutans.
rcsb
source organism Streptococcus mutans
total genus 37
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qkpA00
2KDKA 4I3JA 1DP9A 3HJKA 4HOIA 1TS7A 1BYWA 2A24A 3VOLA 2BASA 1V9YA 2V1BA 3LUQA 3MFXA 5DJTA 3A0RA 1G28A 1TS0A 3LYXA 1D7EA 3UB8A 2PYPA 2V9AA 1F9IA 3FG8A 4R3AA 4GCZA 1XJ2A 3UB9A 5F69A 1T1BA 4HP4A 4LRXC 3B33A 3MQOA 1XJ3A 4I39A 2JHEA 1N9NA 1N9OA 1ODVA 4R6LA 4B9OA 1F98A 1EW0A 4HHDA 4I3IA 4R38A 4EEUA 5HD5A 3KX0X 3K3DA 4JGPA 4HNBA 2Z6DA 1GSXA 5DKKA 4BBVA 3ULFA 4NXEA 1OTIA 4HY8A 3H82B 4HJ6A 1LSWA 2OWJA 4EETB 2W0NA 5G4YA 1T18A 2CMNA 3H9WA 2PR5A 4I3AA 3NJAA 2VEAA 1S1YA 4PKYA 1UGUA 3F1PA 4HI4A 1D06A 4LPZA 3A0SA 4WLAA 3CWFA 1LL8A 1XFQA 2INWA 3UE6A 2VV7A 4KQDA 3MR0A 4XT2A 3IS2B 1WA9A 2V0UA 3E4OA 5G4ZA 4K08A 5I5LA 5F5YA 2PYRA 3FC7A 5AVFA 2QJ7A 3VE3A 2ZBBA 1LSXA 5J3WA 1T1AA 3OLOA 3ICYA 1S4RA 1N9LA 5HDSA 4HQAA 1X0OA 3LIFA 2WKRA 3NHQA 1LT0A 2ZOIA 3LIAA 2KX6A 4KUOA 2OWHA 2YKHA 3MJQA 1S4SA 3VE4A 2VV8A 1OTBA 2B02A 2PHYA 3A0VA 2PD8A 4NXBA 4L9EA 3NOTC 3MXQA 1S66L 4I5SA 5IS1A 2QHKA 4H6JB 1T1CA 5AVEA 5HWTA 3F1NB 3P7NA 1OT6A 2A24B 2QWSA 1DP8A 3C8CA 2M1CA 5J7EA 4F3LB 4PKYG 4JGQA 4WL9A 5HDDA 1GSWA 3E4PA 1OT9A 3E4QA 5DKLA 4EESA 4LLOB 1S67L 3HJIA 3BY9A 3RH8B 4HH2A 3UB6A 5F6AA 3D72A 2QKPA 3IS2A 3H7WB 1NWZA 4EW7A 3T50A 5HWVA 5HDCA 4GHIB 1P97A 2V0WA 1MZUA 2VLGA 5TBMB 2WKQA 4MN5A 1XFNA 1OTDA 4DJ2A 2QJ5A 4I38A 1UWNX 4WN5A 2K7SA 4JGOA 4NXGA 3GDIA 3RTYA 3SW1A 2W27A 3NOPC 4WF0A 1T19A 1UWPX 5F68A 3F1OB 4E04A 4LRYC 4H6JA 3UMEA 2H28A 3PYPA 5HSQA 4BBUA 5KIZA 3MQQA 1OJGA 2PD7A 4M4XA 4GS9B 2D01A 3F1NA 5IU1A 4L9GA 2L4RA 3NOUC 4EEPA 3PHYA 4DJ3A 5HZHA 3LIEA 3F1PB 1XJ4A 4F3LA 2PDRA 4EQ1A 4EXOA 2YKFA 3LI9A 2OOLA 2L0WA 4WUJA 3LI8A 2I9VA 3H82A 4XT2B 1VB6A 2WKPA 1LSVA 2HV1A 4HH3A 4HJ4A 2D02A 2R78A 4JGRA 4GW9A 3H7WA 4HP9A 4GHIA 4HJ3A 2V1AA 2JN7A 5TBMA 2GJ3A 3BY8A 5DJUA 1OTEA 1JNUA 1TS6A 5HD3A 3G6OA 1TS8A 1OTAA 4HIAA 3UMDA 1DP6A 2Z6CA 3C2WA 5J4EA 4EERA 3LIDA 2ZOHA 5A8BA 5HWWA 1DRMA 4BBTA 2PR6A 4KUKA 3F1OA 2L1MA 2P7JA 4LRZE 4R70A 3IBRA 3BWLA 4YWZA 2VV6A 4GS9A 3GECA 3CAXA 1Y28A 4L9FA 3K3CA 3UB7A 1S1ZA 4MN6A 4RQ9A 3LICA 3EEHA 1OJ5A 1XJ6A 1KOUA 3ZQ5A 3EWKA 2EA9A 4NXFA 1GSVA 3LIBA 1V9ZA 2J80A 1P0ZA 3CLOA 5EFWA
chains in the Genus database with same CATH superfamily
1K55A 4P6ZS 1BLSA 4I3JA 2V8FA 4P85A 4O01A 1DP9A 1XGIA 1BYWA 2O9CA 5HL1A 4BWIA 5DJTA 5TJJA 3ZYTA 3FKWA 3T4QA 1K4EA 1TS0A 4CJNA 3UB8A 4P6ZM 4K91A 3FG8A 3UO9A 3OBFA 4CQHA 3BYDA 5DTTA 3TE8A 2HDSA 3BFDA 3UB9A 5F69A 1T1BA 5K5BA 3MQOA 1XJ3A 4FH4A 1FILA 1N9NA 2XD1A 5BOHA 4C6YA 1CI8A 4E3OA 3T4JA 4LV3A 2AVXA 3GQZA 3MXRA 4EEUA 2ZM8A 3GSGA 3LGOA 3Q07A 4HNBA 3RJUA 2Z6DA 1GSXA 3PAEA 4GDBA 3ULFA 1IYSA 2P08A 1OTIA 3JYIA 2FZ0A 2XEPA 3SZTA 4HY8A 3H82B 4K0WA 5GLAA 1DJCA 1P9WA 4GB7A 1IKIA 3FWLA 5DFYA 2JKTI 2Z2LB 4IUHA 5D3OA 2W0NA 4ME4A 2CMNA 3G2ZA 4MDZA 4GDNA 4I3AA 1ZC2A 3MKFA 3EEAA 1BLHA 3PBTA 3ZVTA 3BRMA 3T4SA 2J3TC 1PNEA 5KZHA 2INWA 2VV7A 4Q8IA 2XH9A 4JPMA 1XXMA 2W1TB 2WYXA 4S2PA 3HLWA 1SKFA 5G4ZA 5AQ7A 5I5LA 4OPYA 4B4XA 2PYRA 1E3UD 2JKTM 2IWBA 1LSXA 1ALQA 3HL9A 3PR6A 5CECA 2ZQ8A 1N9LA 3ZGAB 4KZ3A 5LBRA 4KZ8A 3UDFA 2WKRA 3O3VA 3HUOA 3NHQA 5KSCA 1O7EA 1FIKA 3T4OA 2Y2GA 2OWHA 4X1MA 4X56A 1IELA 1S4SA 2B95A 3AGEA 2B02A 3A0VA 1EWZA 2K2NA 3IHAA 1S66L 2XR0A 2ZLYA 4XUXA 2J8YA 3IXBA 5AVEA 4EBPA 1E3UA 4O7DA 2EX9A 1G5UA 1OT6A 2QWSA 3N7WA 3O86A 5FDSA 4XXRA 3UE1A 5HARA 1K6SA 3UE0A 1CQAA 3OOVA 5HPFA 1SZVA 3UPOA 3S7NA 4DRTA 4FTXA 3HREA 4QWOA 4LV2A 5F6AA 2XGNA 2O0YA 1NWZA 2EX8A 4WZ4A 3UY6A 5HDCA 2OAP1 5GLCA 4OOYA 1H3QA 5CGWA 3MQ0A 2VLGA 5TGFA 1WYCA 1NRFA 2WUQA 1XFNA 5DF9A 1L3LA 1FCOA 2QPNA 2Y2JA 5EVEA 3U4LP 4OLDA 2ZM0A 1BT5A 4MNRA 3CMZA 4CLCC 5HL6A 3VP3A 3S22A 2GNXA 2W27A 3PBNA 3SS3A 4WF0A 2W3GA 3M6HA 5F68A 1YMXA 4E04A 4S2JA 2ZL1A 3L7HA 4S2KA 5EVIC 1BZAA 5HSQA 4BBUA 3MQQA 3MF0A 4WM9A 2PD7A 3F1NA 1C3BA 4IBXA 1K0KA 5C5KA 4GOGA 2L4RA 3NOUC 4EEPA 5EE8A 1FCNA 4BL3A 3SS4A 3LIEA 1NYYA 2JC7A 3Q1FA 5FI2A 3S1YA 1TD5A 4E3KA 4EXOA 5AQAA 2YKFA 4L0LA 4A5RA 5EUAA 1SHVA 1M6KA 1MPLA 1JTGA 4WUJA 2LB5A 4WZ5A 4GD8A 4OKPA 2HP6A 3HUMA 1PWDA 4BENA 4HJ4A 2R78A 2Y2HA 5FAOA 3H7WA 3L9KA 4Z1WA 2H0YA 2EFXA 1PFLA 1L0EA 5TBMA 3LFVA 3KYEA 1PZOA 3BY8A 3SH8A 4JF5A 4DKIA 4FCFA 1MWRA 3BQAA 3HCYA 5L8MA 1GCEA 1SKOB 3MFDA 3O88A 1FQGA 4DDSA 3UMDA 3VFFA 4UAAA 2G2UA 1TVFA 1TDLA 2XF3A 3UPNA 3C2WA 2ZOHA 4KZAA 3NDEA 4Y5FA 3PBSA 4ZAMA 4ARZA 3F1OA 1YKDA 2JKRM 4LCLA 3C7UA 1MWUA 2P7JA 5G18A 4R70A 3LR0A 2Y79A 5A92A 1BLPA 4JLFA 4OQHA 2WAFA 2IWCA 1YSQA 3GECA 3G30A 3BFEA 4E6XA 4HBTA 3CAXA 3A3IA 4PPRA 1SCWA 4ZDXA 4L9FA 5E2EA 4AFIA 1M40A 4GJ4A 3UB5P 4S2OA 1K57A 4KZ6A 1XJ6A 1K55C 3UDXA 4OPQA 5FA7A 3ZQ5A 4NXFA 3MSHA 1PWGA 2VGJA 3KYQA 3CLOA 5EFWA 5HAQA 4GD6A 4Z9QA 4OP8A 4R0QA 3JVVA 4KZ5A 4HOIA 1TS7A 2A24A 4GLQA 3VOLA 2ZD8A 3G4PA 1V9YA 3LUQA 1TF1A 3MFXA 4PHTA 3UN7A 1G28A 1I5QA 4X25A 1YLZA 3EGDC 3B3XA 3LYXA 4PM5A 3FPWA 4Y2FA 2PYPA 5CGSA 1F9IA 1OPXA 4QB8A 4JXGA 2VX8A 2WAEA 3BQ8A 2EWVA 1TDGA 3IH8A 2QYBA 4R4RA 4Y15A 2J3WA 2I72A 2C5WB 4ETZA 4UQIS 4MLLA 1FOFA 4LRXC 1Y4OA 3E2LA 4I39A 3CITA 1N9OA 2WGWA 1YLYA 4B9OA 1BSGA 3P98A 5HAIA 4R1GA 5EVIB 1EW0A 2HDUA 4I3IA 4R38A 4P87A 1IKGA 4UQIM 3C7VA 4CPKA 4JGPA 3GRJA 3IX3A 5DKKA 5CHJA 4BBVA 1KDWA 3R7WA 2QZ6A 2Y2NA 1RCJA 1L0DA 4NXEA 3DW0A 1ES4A 2KOIA 3BFCA 3U2AA 3LR4A 4M3KA 1CI9A 2BG1A 4ZRRA 4E3MA 4PMAA 5FEGA 4HJ6A 3DTMA 3MMHA 3N4IA 4HESA 2ZQ7A 2ZC3B 3H9WA 2PR5A 1CF0A 3HBRA 4R23A 1RP5A 3NJAA 4S2NC 2HP9A 2OLUA 2V1ZA 4DE0A 4YFMA 3TRCA 3CUEA 3C38A 5CGXA 4KQDA 1NRJA 3QP2A 3ZG5A 5HAPA 4XT2A 3E4OA 4DF6A 1DY6A 5F5YA 3BEBA 1NXYA 3GVBA 1ACFA 3VSLA 5J3WA 3OLOA 3HLDA 5GHZA 2V20A 3FZCA 4HQAA 1X0OA 3LIFA 4Y7PA 3VOYA 2Y2QA 4OP5A 3RXWA 3WRZA 4KUOA 4UA7A 3TOIA 2JKGA 1ZG6A 1QMEA 5L09A 3IF6A 2VV8A 1FCMA 1OTBA 3VP4A 2PD8A 2EFUA 4BL2A 5IS1A 5JYPA 2W3FA 3G35A 3LR3A 3ZNTA 4ZTKA 4BJPA 5FAQA 4DE1A 1MXOA 2X01A 2RL3A 3BLMA 3NBLA 3T4LA 3MZDA 3GR2A 2J9OA 1PW8A 1YLTA 2W1RA 4PKYG 3NC8A 3E4PA 1MWTA 5DKLA 5FQ9A 4R3BA 1AWIA 3GMWA 1S67L 2FFFB 3HJIA 3ISGA 3ZDJA 4B93A 2Q9MA 4ETXA 2JE5A 4EBNA 3D72A 2QKPA 5CX7A 3WWXA 2P9VB 4GHIB 2VGLS 1K56D 1MZUA 3WS4A 1W79A 4KZ9A 2WKQA 5FQKA 5CRFA 2A49A 4MN5A 3IWOA 4DXBA 1ERMA 1XKZA 2HJEA 1K25A 4KQOA 4U0XA 2Y2LA 4MMNA 4QJGA 1NZOA 3G34A 4I38A 3V39A 4WEKA 1UWNX 2VGLM 4FOFA 3OZHA 4WN5A 2UWXA 2A3UA 5EM0A 3BFGA 3QP1A 4PM8A 4JGOA 4D60A 1W8YA 3IT9A 3N8SA 4IVIA 3ZG0A 1BULA 3TG9A 1KE3A 4IUKA 3AGFA 3A3JA 4QU3A 2WKEA 3NULA 1OJGA 1K56A 4R4SA 4GS9B 2D01A 4RVAA 3Q7VB 5IU1A 1P9RA 2VK3A 3G32A 3KSGA 4N1HA 1WE4A 1VM1A 5AQBA 4DJ3A 2Z2MB 5FQIA 4EQ1A 2O9AA 4WZ5C 2OOLA 4EU0A 4DE2A 1ZKJA 3QNBA 3NY4A 1ESIA 5GHXA 3MS6A 4S2LA 1PIOA 4X69A 1VB6A 4Q0HA 1LSVA 5M19A 4FH2A 4HH3A 5DVAA 3IXHA 1Z6FA 1I2WA 4HP9A 3NCKA 2H0TA 2HZ5A 1LL9A 1STZA 1PI4A 2B18A 4KZBA 1CJFA 4IBRA 5E2GA 2GJ3A 5DJUA 1OTEA 1RGYA 1JVJA 3CHWP 3PAGA 2DMWA 2P74A 2Q9NA 3V5MA 4MEZA 1IEMA 1DP6A 2WADA 2P04A 5J4EA 3BFFA 3LIDA 5A93A 1NY0A 2J3TD 5A8BA 5HWWA 4KZ7A 3EOIA 2WZXA 1G6OA 4KUKA 5FI7A 3N6IA 3BWLA 4UEYA 2EX2A 3BM6A 5FQMA 1F2KA 1K57C 1EI5A 3ZG8B 1VHMA 4JXWA 4Y0OA 1GHIA 4RQ9A 3LICA 3IXDA 3VP2A 3Q81A 1KOUA 3EWKA 5EECA 5KMWA 3KSIA 2Y8HA 3G2YA 3W8KA 1LLBA 1EROA 3OPRA 2J80A 3OPPA 3DTEA 3MKEA 1JWVA 3W4QA 1KGEA 4QD4A 4IVKA 1A0KA 4CLCE 3HJKA 1W7FA 1XA1A 2BASA 2V1BA 1YT4A 1KVMA 3A0RA 4E3JA 1MKIA 4D2OA 1ZG4A 1Q2QA 2WK0A 3HLBA 1D7EA 4S2IA 2EXAA 1JWPA 4EUVA 4R3AA 1XJ2A 3IX4A 3DTKA 5FI6A 1K6RA 4HP4A 3T1SA 3QP5A 2X71A 2JHEA 3D3OA 4N1XA 3WS5A 1ODVA 4BD1A 1CEGA 3P01A 5DF8A 3SH9A 2PRFA 3D4FA 5CXWA 4HHDA 4KENB 3N8LA 5HD5A 3LEZA 1MBLA 2DNSA 4PM7A 3QP4A 4O0PA 5CTNA 1KGFA 3CI6A 2HGVA 2OAQ1 2PU2A 1GA9A 1K54A 2A2LA 4B88A 4BD0A 1JWZA 2XQZA 3JPUA 3HLGA 2JBFA 4JF6A 4E3LA 1LSWA 2OWJA 4G3WA 5G4YA 4FUWA 4Y3IA 5L2FA 4DMZA 1U60A 3PBOA 4IHQA 3FKVA 1VEUB 4NK3A 2EWWA 3ZCZA 5FAPA 4EQIA 5DTKA 2XK1A 2VEAA 1S1YA 4PKYA 3IH9A 1UGUA 3F1PA 1ERQA 2ZQ9A 4QY5A 2G7UA 1J3WA 3NI9A 1D06A 5DFXA 3MZEA 1H5XA 3A0SA 4KG5A 3CWFA 1LL8A 3MBZA 1W5DA 1FR6A 3R4KA 2Y2OA 3MR0A 3ZG9B 4BQMA 4C3QA 3IS2B 3PTEA 1WA9A 4NKPA 4KZ4A 3NDGA 4WMCD 4LCMA 3B47A 3KSFA 2VZWA 4K08A 2W3HA 4ARZB 5AVFA 5FQJA 3GTCA 1YQSA 3VE3A 4HEFA 1T1AA 4N9KA 3ICYA 4E6WA 1NZUA 2FFYA 5HDSA 1OMEA 5CEBA 1RGZA 1LT0A 3HLEA 3IF6C 2QMIA 2K31A 1S0WA 1YAXA 4G3VA 2YKHA 1H8YA 2XDMA 5CEDA 2WKIA 4CLCB 2XA7S 5FEFA 2LB9A 1E25A 4NXBA 4L9EA 4II7A 1MWSA 3MXQA 4WELA 5F1FA 2E8JA 2QHKA 4H6JB 1T1CA 4WMCA 5GHYA 1FSWA 1N9BA 4Q0JA 1XA7A 4OOLA 2XA7M 1K38A 1YLWA 4G3KA 2A24B 3UE3A 1DP8A 3O87A 5J7EA 4OOMA 4F3LB 1SDNA 4EUZA 2VJWA 3IWQA 1L0GA 1GSWA 3SH7A 1OT9A 3E4QA 4B4ZA 3LEQA 3KSHA 3CPTA 1VETA 3ZHHA 2ZMFA 3EGXC 1YSPA 4OLGA 2H5SA 4RA7A 4WEJA 3UB6A 4EW7A 5HWVA 1LHYA 5EOOA 5TFQA 3LY4A 4LV0A 1P97A 2V0WA 3IHBA 3LY3A 3IQAA 2WGIA 3DBAA 1K4FA 2XD5A 2Y2IA 2WGWB 2UV0E 4DJ2A 4BLMA 2XSSA 2QJ5A 3ZFZA 2Y2KA 1TEMA 4P0MA 3E98A 4MBHA 3VV4A 2K7SA 1BUEA 2O9BA 3PBQA 4NXGA 4YNRA 3RTYA 3SW1A 3R7WB 2OLVA 2R9WA 1UWPX 5MC7A 4LRYC 4BMWA 1MC0A 1ZTUA 3AGDA 3UMEA 3WRTA 1ONGA 3ITAA 1KE4A 3BW6A 4M4XA 2XLNA 4DXCA 4LENA 1GHPA 2VA0A 4L9GA 3WS1A 3ZNYA 5HFOA 2HP5A 4ZBEA 2ZQDA 3OPLA 2PDRA 3CG5A 4X1LA 4ESPA 5CERA 2HJ9C 4Y0UA 2L0WA 1ES5A 5FDHA 3LI8A 1XGJA 4DDYA 5KSHA 3UNWA 3H82A 4XT2B 5F82A 2WKPA 3IBJA 5DF7A 4RX2A 2VGKA 2HV1A 2MJ6A 3PXPA 4UHUA 4JGRA 4GW9A 2P9VA 4GHIA 4OH0A 4HJ3A 2NUTC 2C6WB 2BTFP 1NLZA 2Y2PA 4GKUA 5E2FA 3GV9A 2PBDP 1JNUA 5CHUA 5HD3A 3W2ZA 3LCEA 1TS8A 1OTAA 2J7VA 3N8RA 4WYYA 4JKTA 4FSFA 4MN7A 3IF6B 2W1TA 3T1RA 5FQQA 3OC2A 1W8QA 1YLJA 4UA9A 5EPHA 5JYOA 2PR6A 2JKFA 5EM1A 2DRWA 3IF5A 3DAVA 3M6BA 4Y13A 3KYZA 4LRZE 4PM9A 3EQVA 3FPVA 5F1GA 2Y55A 4NETA 3S7PA 1ONHA 1JTDA 1BLCA 4GS9A 4OPZA 4LGWA 4QHCA 3Q7VA 3SOIA 1Y28A 1H0MA 3VP0A 1S1ZA 4FD8A 4ZJ2A 3UPPA 4MN6A 3A3EA 3S7OA 3PBRA 4H8RA 2EA9A 4S2NA 1Y54A 3LIBA 1V9ZA 4IJGA 3O5YA 5GL9A 2KDKA 3FYZA 4R3JA 1IOUA 4U0TA 2PBYA 1NLYA 4K0XA 5F83A 5CTMA 3C4OA 3V50A 2HF6A 1ZHHB 3HLCA 2Q0OA 4KQRA 4RYEA 1XPBA 1J9MA 3DTIA 2V9AA 1YLPA 5GLBA 2WZZA 2RCXA 4GCZA 2M7UA 2PU4A 4C75A 2B5RA 1GA0A 5CHMA 2X02A 2XFSA 1O07A 4O8GA 5J8XA 4S2MA 4EBLA 2VKSA 3B33A 4MBFA 4KG2A 5M1AA 2XFTA 3LO7A 4R6LA 1YPRA 1F98A 4WBGA 1F5MA 1PW1A 3KX0X 3K3DA 2ZC5B 1K54C 2HPBA 5HX9A 2Y2MA 4Y17A 3BLSA 2O99A 3FV7A 4NG2A 3K2NA 2IA2A 1W63Q 2Y59A 3MZFA 2M7VA 4OQIA 3IWIA 4MBKA 4RX3A 5IT5A 3G31A 2GDNA 1SDEA 5HPIA 4EETB 1S6RA 3C4PA 3I7JA 1T18A 1G6AA 2EX6A 3V67A 3T1QB 1IFQA 3Q82A 2FH5A 3NECA 1NYMA 1H8ZA 2ZC6B 3B42A 5A90A 4HI4A 4LPZA 1Q2PA 5M18A 4ID4A 4WLAA 5I94A 1XFQA 1VQQA 3UE6A 4GNUA 2ZM2A 3BJNA 4OQGA 1L0FA 2DCFA 2V0UA 3OCLA 3WS0A 4NEED 3BECA 3FC7A 1HLUP 2WGVA 3C5AA 2NUPC 1PRQA 2QJ7A 3P09A 4YOFA 2ZBBA 4E3IA 1KGGA 2V2FF 4N92A 1S4RA 5HW3A 3VFHA 3UDIA 2PT7A 5AJGA 1PZPA 2R9XA 2ZOIA 4PM6A 3LIAA 3VOZA 1W63M 2EXBA 2KX6A 3QHYA 1LI9A 1SKOA 2BLSA 2ZC4B 3HUNA 4P6BA 1HVBA 3MJQA 2J9PA 2JCHA 3VE4A 1CEFA 3VP1A 3C30A 3TJZC 3W4OA 5AQ9A 2PHYA 3M2KA 2G2WA 3NOTC 2ZL1B 4I5SA 4GZBA 1ESUA 4YINA 2H10A 2Y4AA 1BTLA 5HWTA 3F1NB 2JKRI 4LV1A 3P7NA 3QNCA 4OPRA 4ZJ1A 4IEDA 3C8CA 1D1JA 2M1CA 1VEUA 4JGQA 4WL9A 5HDDA 5E43A 4KQQA 1PWCA 1DJAA 1LL5A 4EESA 2HDRA 3E2KA 4LLOB 4CLCD 2ZJ9A 5E2HA 3BY9A 1IYPA 3RH8B 1GHMA 4HH2A 3OPHA 4KG6A 2ACGA 3IS2A 3H7WB 3ITBA 3T50A 3NIAA 4QPRA 1AXBA 3W4PA 3E0YA 5TBMB 5EVID 2ZC7A 1OTDA 3CUEC 3IX8A 3S4XA 3DWKA 3V3RA 3ZVWA 1L2SA 3S7QA 3KO6A 5U47A 3ZG7B 3Q7ZA 1LI0A 2GZAA 3RFBA 3DWZA 1ES3A 4HBUA 3TW8A 3GDIA 1DJBA 4JXVA 4X68A 3NOPC 4CLCA 1T19A 1FSYA 5FATA 3F1OB 5FSRA 2XRNA 3CZDA 5IHVA 4GN2A 4H6JA 2H28A 5FASA 4JXSA 3PYPA 5KIZA 4ZJ3A 4N9LA 1I2SA 5EVIA 3JVUA 1IYQA 4QY6A 3PHYA 5HZHA 2GX5A 2ZMVA 1XJ4A 3F1PB 4F3LA 4EV4A 5A91A 4F94A 4MCWA 1MY8A 4E3NA 3T1XA 2V8CA 3LI9A 1ES2A 1XP4A 3A3FA 3OCNA 2Y91A 2OSUA 3VSKA 4X53A 3A3DA 1PI5A 2I9VA 1NJ4A 3HLFA 3MXSA 5FL3A 4U3TA 5GLDA 1Z09A 1YM1A 2D02A 1HZOA 2PAVP 5L10A 1KE0A 3T4TA 1HD8A 2V1AA 2JN7A 1CK3A 5TR7A 3D9YA 3WS2A 2W3EA 4UA6A 1IYOA 2HDQA 1KVLA 2OV5A 3T12B 1N4OA 3SS5A 1TS6A 3G6OA 3CJMA 2W3DA 4X6TA 4HIAA 3M2JA 4OQ0A 2KLIA 4Q0IA 1XX2A 4Y0TA 2Z6CA 2CC1A 4EERA 3QP8A 4DN0A 3V3SA 3HVFA 3TSGA 1DRMA 4BBTA 1G68A 4EWFA 3IXGA 2L1MA 1KDSA 2XROA 5EOEA 2ZQAA 3IBRA 2IWDA 4YWZA 1QMFA 2VV6A 3LR5A 1YMSA 5EV0A 1WYBA 2WKHA 4JBFA 4OONA 3EQUA 4LFUA 1E4DA 2ZQCA 3K3CA 4JF4A 3UB7A 2ZMAA 4X55A 5L07A 1HTZA 4OVDA 3T4KA 3CPTB 1VETB 3EEHA 1PYYA 1H8MA 1FR1A 1MKMA 1OJ5A 5DTSA 3RXXA 3VMAA 3QP6A 4XUZA 5EVLA 1GSVA 2E8IA 4DE3A 1P0ZA 4PAUA
chains in the Genus database with same CATH topology
2KDKA 1IOUA 4P6ZS 4I3JA 3JVVA 4O01A 1DP9A 1NLYA 3HJKA 4HOIA 4CLCE 1TS7A 1BYWA 2O9CA 2A24A 4GLQA 3VOLA 2BASA 1V9YA 2HF6A 1ZHHB 1TF1A 2V1BA 3LUQA 3MFXA 4PHTA 4BWIA 5DJTA 3A0RA 1G28A 5TJJA 3ZYTA 3EGDC 3T4QA 1TS0A 3LYXA 1D7EA 3UB8A 4P6ZM 3FPWA 4Y2FA 2PYPA 2V9AA 1F9IA 3FG8A 1OPXA 4EUVA 2VX8A 3OBFA 4CQHA 3BQ8A 2EWVA 4R3AA 4GCZA 2M7UA 2QYBA 1XJ2A 3TE8A 2J3WA 5F69A 3UB9A 4O8GA 1T1BA 5K5BA 2VKSA 4ETZA 4UQIS 4HP4A 4LRXC 3B33A 3MQOA 1XJ3A 4I39A 2JHEA 1N9NA 3D3OA 3CITA 1N9OA 1ODVA 4R6LA 4B9OA 3T4JA 1F98A 3P01A 1F5MA 1EW0A 4HHDA 4I3IA 4R38A 4EEUA 5HD5A 3KX0X 3K3DA 4UQIM 4O0PA 4JGPA 4HNBA 2Z6DA 1GSXA 5DKKA 4BBVA 3R7WA 3CI6A 3ULFA 2HGVA 2OAQ1 2P08A 4NXEA 2O99A 1OTIA 3K2NA 2IA2A 2FZ0A 1W63Q 2KOIA 2A2LA 2M7VA 3U2AA 4HY8A 3LR4A 3H82B 4ZRRA 1P9WA 5DFYA 2JKTI 5IT5A 4IUHA 5HPIA 4HJ6A 1LSWA 2OWJA 4EETB 2W0NA 4ME4A 4G3WA 5G4YA 4Y3IA 3MMHA 1T18A 4DMZA 2CMNA 3PBOA 4IHQA 3V67A 1IFQA 3H9WA 4MDZA 2FH5A 2EWWA 2PR5A 4I3AA 3EEAA 3NJAA 2VEAA 1S1YA 4PKYA 1UGUA 3B42A 3F1PA 3PBTA 4HI4A 2G7UA 1D06A 3T4SA 2J3TC 5DFXA 4LPZA 3A0SA 4WLAA 3CWFA 1LL8A 3TRCA 1XFQA 2INWA 3UE6A 3CUEA 2VV7A 3C38A 3R4KA 4KQDA 3BJNA 1NRJA 3MR0A 2W1TB 4XT2A 3IS2B 1WA9A 2V0UA 3E4OA 3OCLA 4NKPA 3B47A 3KSFA 5G4ZA 2VZWA 4NEED 4K08A 5I5LA 2W3HA 5F5YA 2PYRA 3FC7A 2JKTM 4ARZB 5AVFA 2NUPC 2QJ7A 3VE3A 4YOFA 2ZBBA 1LSXA 5J3WA 1T1AA 3OLOA 3ICYA 3PR6A 1S4RA 1N9LA 5HDSA 4HQAA 5LBRA 1X0OA 3LIFA 2WKRA 2PT7A 3NHQA 5AJGA 1LT0A 2ZOIA 3LIAA 1W63M 3T4OA 2KX6A 4KUOA 2K31A 2OWHA 1YAXA 4G3VA 2YKHA 3MJQA 1S4SA 3VE4A 2VV8A 1OTBA 3C30A 2XA7S 4CLCB 3TJZC 2B02A 2PHYA 3A0VA 2LB9A 2PD8A 4NXBA 4L9EA 4II7A 2K2NA 3NOTC 3MXQA 4WELA 1S66L 4I5SA 5IS1A 2QHKA 4H6JB 1T1CA 2W3FA 3LR3A 5AVEA 4BJPA 4Q0JA 4OOLA 5HWTA 3F1NB 2JKRI 2XA7M 3P7NA 4G3KA 1OT6A 2A24B 2QWSA 3T4LA 3UE3A 1DP8A 3C8CA 2M1CA 5J7EA 4OOMA 4F3LB 2W1RA 2VJWA 4PKYG 4JGQA 4WL9A 5HDDA 1GSWA 3E4PA 1OT9A 3E4QA 3OOVA 5HPFA 5DKLA 3KSHA 4EESA 3S7NA 2ZMFA 3EGXC 4LLOB 1YSPA 4CLCD 1S67L 3HJIA 3BY9A 4B93A 4WEJA 3RH8B 4HH2A 3UB6A 4ETXA 5F6AA 3D72A 2QKPA 3IS2A 5CX7A 3H7WB 2O0YA 1NWZA 4EW7A 3T50A 5HWVA 5HDCA 4GHIB 2VGLS 2OAP1 4QPRA 1H3QA 1P97A 2V0WA 1MZUA 3MQ0A 2VLGA 3E0YA 5TBMB 3DBAA 2WKQA 4MN5A 1XFNA 1OTDA 3CUEC 5DF9A 4DJ2A 2HJEA 4KQOA 2XSSA 3KO6A 3S7QA 2QJ5A 4MMNA 4I38A 4WEKA 1UWNX 2VGLM 3E98A 4FOFA 3VV4A 4WN5A 4CLCC 2GZAA 2K7SA 2O9BA 3PBQA 5HL6A 3RFBA 4JGOA 3TW8A 4NXGA 3GDIA 4YNRA 3RTYA 3SW1A 3R7WB 2GNXA 2W27A 3PBNA 3NOPC 4WF0A 4CLCA 2W3GA 1T19A 1UWPX 5F68A 3F1OB 5MC7A 4E04A 4LRYC 4BMWA 2XRNA 1MC0A 1ZTUA 4IUKA 4H6JA 3UMEA 2H28A 3PYPA 5HSQA 4BBUA 5KIZA 3MQQA 3MF0A 1OJGA 2PD7A 3BW6A 4M4XA 4GS9B 2D01A 3F1NA 3JVUA 5C5KA 2VA0A 1P9RA 4L9GA 5IU1A 3KSGA 2L4RA 3NOUC 4EEPA 3PHYA 4DJ3A 5HZHA 3LIEA 2GX5A 2ZMVA 1XJ4A 3F1PB 4F3LA 2PDRA 4EQ1A 1TD5A 4EXOA 2O9AA 4MCWA 2YKFA 4L0LA 2HJ9C 3LI9A 2OOLA 3OCNA 4EU0A 2L0WA 4WUJA 3LI8A 2LB5A 5KSHA 2I9VA 3H82A 4XT2B 1VB6A 2WKPA 3IBJA 4Q0HA 1LSVA 5FL3A 2HV1A 2MJ6A 3PXPA 4HH3A 4HJ4A 2D02A 2R78A 4JGRA 4GW9A 3H7WA 4Z1WA 4HP9A 3T4TA 4GHIA 4HJ3A 2V1AA 2NUTC 1STZA 2JN7A 2B18A 1NLZA 5TBMA 2GJ3A 3LFVA 2W3EA 3BY8A 5DJUA 1OTEA 3BQAA 3HCYA 1JNUA 1TS6A 5HD3A 3G6OA 5L8MA 2W3DA 3W2ZA 1TS8A 2DMWA 1OTAA 4HIAA 3UMDA 2KLIA 4Q0IA 4FSFA 4MN7A 1DP6A 2Z6CA 2W1TA 2P04A 3C2WA 5J4EA 4EERA 3LIDA 2ZOHA 3OC2A 4DN0A 2J3TD 5A8BA 5HWWA 1DRMA 4Y5FA 3EOIA 3PBSA 4BBTA 2PR6A 1G6OA 4ARZA 4KUKA 3F1OA 1YKDA 2JKRM 3KYZA 2L1MA 2P7JA 4LRZE 2XROA 4R70A 3LR0A 3EQVA 3IBRA 2Y79A 3BWLA 3FPVA 4UEYA 4YWZA 3S7PA 2VV6A 3LR5A 4GS9A 1YSQA 3GECA 3EQUA 3CAXA 1Y28A 4L9FA 3K3CA 4AFIA 3UB7A 1S1ZA 4GJ4A 1VHMA 4MN6A 4RQ9A 3LICA 3T4KA 3EEHA 1H8MA 1OJ5A 1MKMA 1XJ6A 3S7OA 3PBRA 1KOUA 3ZQ5A 3EWKA 2EA9A 3KSIA 2Y8HA 4NXFA 1GSVA 3LIBA 1V9ZA 4IJGA 3O5YA 3KYQA 2J80A 1P0ZA 3CLOA 4PAUA 5EFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  4I3J A;  1DP9 A;  3HJK A;  4HOI A;  1TS7 A;  1BYW A;  2A24 A;  3VOL A;  2BAS A;  1V9Y A;  2V1B A;  3LUQ A;  3MFX A;  5DJT A;  3A0R A;  1G28 A;  1TS0 A;  3LYX A;  1D7E A;  3UB8 A;  2PYP A;  2V9A A;  1F9I A;  3FG8 A;  4R3A A;  4GCZ A;  1XJ2 A;  3UB9 A;  5F69 A;  1T1B A;  4HP4 A;  4LRX C;  3B33 A;  3MQO A;  1XJ3 A;  4I39 A;  2JHE A;  1N9N A;  1N9O A;  1ODV A;  4R6L A;  4B9O A;  1F98 A;  1EW0 A;  4HHD A;  4I3I A;  4R38 A;  4EEU A;  5HD5 A;  3KX0 X;  3K3D A;  4JGP A;  4HNB A;  2Z6D A;  1GSX A;  5DKK A;  4BBV A;  3ULF A;  4NXE A;  1OTI A;  4HY8 A;  3H82 B;  4HJ6 A;  1LSW A;  2OWJ A;  4EET B;  2W0N A;  5G4Y A;  1T18 A;  2CMN A;  3H9W A;  2PR5 A;  4I3A A;  3NJA A;  2VEA A;  1S1Y A;  4PKY A;  1UGU A;  3F1P A;  4HI4 A;  1D06 A;  4LPZ A;  3A0S A;  4WLA A;  3CWF A;  1LL8 A;  1XFQ A;  2INW A;  3UE6 A;  2VV7 A;  4KQD A;  3MR0 A;  4XT2 A;  3IS2 B;  1WA9 A;  2V0U A;  3E4O A;  5G4Z A;  4K08 A;  5I5L A;  5F5Y A;  2PYR A;  3FC7 A;  5AVF A;  2QJ7 A;  3VE3 A;  2ZBB A;  1LSX A;  5J3W A;  1T1A A;  3OLO A;  3ICY A;  1S4R A;  1N9L A;  5HDS A;  4HQA A;  1X0O A;  3LIF A;  2WKR A;  3NHQ A;  1LT0 A;  2ZOI A;  3LIA A;  2KX6 A;  4KUO A;  2OWH A;  2YKH A;  3MJQ A;  1S4S A;  3VE4 A;  2VV8 A;  1OTB A;  2B02 A;  2PHY A;  3A0V A;  2PD8 A;  4NXB A;  4L9E A;  3NOT C;  3MXQ A;  1S66 L;  4I5S A;  5IS1 A;  2QHK A;  4H6J B;  1T1C A;  5AVE A;  5HWT A;  3F1N B;  3P7N A;  1OT6 A;  2A24 B;  2QWS A;  1DP8 A;  3C8C A;  2M1C A;  5J7E A;  4F3L B;  4PKY G;  4JGQ A;  4WL9 A;  5HDD A;  1GSW A;  3E4P A;  1OT9 A;  3E4Q A;  5DKL A;  4EES A;  4LLO B;  1S67 L;  3HJI A;  3BY9 A;  3RH8 B;  4HH2 A;  3UB6 A;  5F6A A;  3D72 A;  2QKP A;  3IS2 A;  3H7W B;  1NWZ A;  4EW7 A;  3T50 A;  5HWV A;  5HDC A;  4GHI B;  1P97 A;  2V0W A;  1MZU A;  2VLG A;  5TBM B;  2WKQ A;  4MN5 A;  1XFN A;  1OTD A;  4DJ2 A;  2QJ5 A;  4I38 A;  1UWN X;  4WN5 A;  2K7S A;  4JGO A;  4NXG A;  3GDI A;  3RTY A;  3SW1 A;  2W27 A;  3NOP C;  4WF0 A;  1T19 A;  1UWP X;  5F68 A;  3F1O B;  4E04 A;  4LRY C;  4H6J A;  3UME A;  2H28 A;  3PYP A;  5HSQ A;  4BBU A;  5KIZ A;  3MQQ A;  1OJG A;  2PD7 A;  4M4X A;  4GS9 B;  2D01 A;  3F1N A;  5IU1 A;  4L9G A;  2L4R A;  3NOU C;  4EEP A;  3PHY A;  4DJ3 A;  5HZH A;  3LIE A;  3F1P B;  1XJ4 A;  4F3L A;  2PDR A;  4EQ1 A;  4EXO A;  2YKF A;  3LI9 A;  2OOL A;  2L0W A;  4WUJ A;  3LI8 A;  2I9V A;  3H82 A;  4XT2 B;  1VB6 A;  2WKP A;  1LSV A;  2HV1 A;  4HH3 A;  4HJ4 A;  2D02 A;  2R78 A;  4JGR A;  4GW9 A;  3H7W A;  4HP9 A;  4GHI A;  4HJ3 A;  2V1A A;  2JN7 A;  5TBM A;  2GJ3 A;  3BY8 A;  5DJU A;  1OTE A;  1JNU A;  1TS6 A;  5HD3 A;  3G6O A;  1TS8 A;  1OTA A;  4HIA A;  3UMD A;  1DP6 A;  2Z6C A;  3C2W A;  5J4E A;  4EER A;  3LID A;  2ZOH A;  5A8B A;  5HWW A;  1DRM A;  4BBT A;  2PR6 A;  4KUK A;  3F1O A;  2L1M A;  2P7J A;  4LRZ E;  4R70 A;  3IBR A;  3BWL A;  4YWZ A;  2VV6 A;  4GS9 A;  3GEC A;  3CAX A;  1Y28 A;  4L9F A;  3K3C A;  3UB7 A;  1S1Z A;  4MN6 A;  4RQ9 A;  3LIC A;  3EEH A;  1OJ5 A;  1XJ6 A;  1KOU A;  3ZQ5 A;  3EWK A;  2EA9 A;  4NXF A;  1GSV A;  3LIB A;  1V9Z A;  2J80 A;  1P0Z A;  3CLO A;  5EFW A; 
#chains in the Genus database with same CATH topology
 1K55 A;  4P6Z S;  1BLS A;  4I3J A;  2V8F A;  4P85 A;  4O01 A;  1DP9 A;  1XGI A;  1BYW A;  2O9C A;  5HL1 A;  4BWI A;  5DJT A;  5TJJ A;  3ZYT A;  3FKW A;  3T4Q A;  1K4E A;  1TS0 A;  4CJN A;  3UB8 A;  4P6Z M;  4K91 A;  3FG8 A;  3UO9 A;  3OBF A;  4CQH A;  3BYD A;  5DTT A;  3TE8 A;  2HDS A;  3BFD A;  3UB9 A;  5F69 A;  1T1B A;  5K5B A;  3MQO A;  1XJ3 A;  4FH4 A;  1FIL A;  1N9N A;  2XD1 A;  5BOH A;  4C6Y A;  1CI8 A;  4E3O A;  3T4J A;  4LV3 A;  2AVX A;  3GQZ A;  3MXR A;  4EEU A;  2ZM8 A;  3GSG A;  3LGO A;  3Q07 A;  4HNB A;  3RJU A;  2Z6D A;  1GSX A;  3PAE A;  4GDB A;  3ULF A;  1IYS A;  2P08 A;  1OTI A;  3JYI A;  2FZ0 A;  2XEP A;  3SZT A;  4HY8 A;  3H82 B;  4K0W A;  5GLA A;  1DJC A;  1P9W A;  4GB7 A;  1IKI A;  3FWL A;  5DFY A;  2JKT I;  2Z2L B;  4IUH A;  5D3O A;  2W0N A;  4ME4 A;  2CMN A;  3G2Z A;  4MDZ A;  4GDN A;  4I3A A;  1ZC2 A;  3MKF A;  3EEA A;  1BLH A;  3PBT A;  3ZVT A;  3BRM A;  3T4S A;  2J3T C;  1PNE A;  5KZH A;  2INW A;  2VV7 A;  4Q8I A;  2XH9 A;  4JPM A;  1XXM A;  2W1T B;  2WYX A;  4S2P A;  3HLW A;  1SKF A;  5G4Z A;  5AQ7 A;  5I5L A;  4OPY A;  4B4X A;  2PYR A;  1E3U D;  2JKT M;  2IWB A;  1LSX A;  1ALQ A;  3HL9 A;  3PR6 A;  5CEC A;  2ZQ8 A;  1N9L A;  3ZGA B;  4KZ3 A;  5LBR A;  4KZ8 A;  3UDF A;  2WKR A;  3O3V A;  3HUO A;  3NHQ A;  5KSC A;  1O7E A;  1FIK A;  3T4O A;  2Y2G A;  2OWH A;  4X1M A;  4X56 A;  1IEL A;  1S4S A;  2B95 A;  3AGE A;  2B02 A;  3A0V A;  1EWZ A;  2K2N A;  3IHA A;  1S66 L;  2XR0 A;  2ZLY A;  4XUX A;  2J8Y A;  3IXB A;  5AVE A;  4EBP A;  1E3U A;  4O7D A;  2EX9 A;  1G5U A;  1OT6 A;  2QWS A;  3N7W A;  3O86 A;  5FDS A;  4XXR A;  3UE1 A;  5HAR A;  1K6S A;  3UE0 A;  1CQA A;  3OOV A;  5HPF A;  1SZV A;  3UPO A;  3S7N A;  4DRT A;  4FTX A;  3HRE A;  4QWO A;  4LV2 A;  5F6A A;  2XGN A;  2O0Y A;  1NWZ A;  2EX8 A;  4WZ4 A;  3UY6 A;  5HDC A;  2OAP 1;  5GLC A;  4OOY A;  1H3Q A;  5CGW A;  3MQ0 A;  2VLG A;  5TGF A;  1WYC A;  1NRF A;  2WUQ A;  1XFN A;  5DF9 A;  1L3L A;  1FCO A;  2QPN A;  2Y2J A;  5EVE A;  3U4L P;  4OLD A;  2ZM0 A;  1BT5 A;  4MNR A;  3CMZ A;  4CLC C;  5HL6 A;  3VP3 A;  3S22 A;  2GNX A;  2W27 A;  3PBN A;  3SS3 A;  4WF0 A;  2W3G A;  3M6H A;  5F68 A;  1YMX A;  4E04 A;  4S2J A;  2ZL1 A;  3L7H A;  4S2K A;  5EVI C;  1BZA A;  5HSQ A;  4BBU A;  3MQQ A;  3MF0 A;  4WM9 A;  2PD7 A;  3F1N A;  1C3B A;  4IBX A;  1K0K A;  5C5K A;  4GOG A;  2L4R A;  3NOU C;  4EEP A;  5EE8 A;  1FCN A;  4BL3 A;  3SS4 A;  3LIE A;  1NYY A;  2JC7 A;  3Q1F A;  5FI2 A;  3S1Y A;  1TD5 A;  4E3K A;  4EXO A;  5AQA A;  2YKF A;  4L0L A;  4A5R A;  5EUA A;  1SHV A;  1M6K A;  1MPL A;  1JTG A;  4WUJ A;  2LB5 A;  4WZ5 A;  4GD8 A;  4OKP A;  2HP6 A;  3HUM A;  1PWD A;  4BEN A;  4HJ4 A;  2R78 A;  2Y2H A;  5FAO A;  3H7W A;  3L9K A;  4Z1W A;  2H0Y A;  2EFX A;  1PFL A;  1L0E A;  5TBM A;  3LFV A;  3KYE A;  1PZO A;  3BY8 A;  3SH8 A;  4JF5 A;  4DKI A;  4FCF A;  1MWR A;  3BQA A;  3HCY A;  5L8M A;  1GCE A;  1SKO B;  3MFD A;  3O88 A;  1FQG A;  4DDS A;  3UMD A;  3VFF A;  4UAA A;  2G2U A;  1TVF A;  1TDL A;  2XF3 A;  3UPN A;  3C2W A;  2ZOH A;  4KZA A;  3NDE A;  4Y5F A;  3PBS A;  4ZAM A;  4ARZ A;  3F1O A;  1YKD A;  2JKR M;  4LCL A;  3C7U A;  1MWU A;  2P7J A;  5G18 A;  4R70 A;  3LR0 A;  2Y79 A;  5A92 A;  1BLP A;  4JLF A;  4OQH A;  2WAF A;  2IWC A;  1YSQ A;  3GEC A;  3G30 A;  3BFE A;  4E6X A;  4HBT A;  3CAX A;  3A3I A;  4PPR A;  1SCW A;  4ZDX A;  4L9F A;  5E2E A;  4AFI A;  1M40 A;  4GJ4 A;  3UB5 P;  4S2O A;  1K57 A;  4KZ6 A;  1XJ6 A;  1K55 C;  3UDX A;  4OPQ A;  5FA7 A;  3ZQ5 A;  4NXF A;  3MSH A;  1PWG A;  2VGJ A;  3KYQ A;  3CLO A;  5EFW A;  5HAQ A;  4GD6 A;  4Z9Q A;  4OP8 A;  4R0Q A;  3JVV A;  4KZ5 A;  4HOI A;  1TS7 A;  2A24 A;  4GLQ A;  3VOL A;  2ZD8 A;  3G4P A;  1V9Y A;  3LUQ A;  1TF1 A;  3MFX A;  4PHT A;  3UN7 A;  1G28 A;  1I5Q A;  4X25 A;  1YLZ A;  3EGD C;  3B3X A;  3LYX A;  4PM5 A;  3FPW A;  4Y2F A;  2PYP A;  5CGS A;  1F9I A;  1OPX A;  4QB8 A;  4JXG A;  2VX8 A;  2WAE A;  3BQ8 A;  2EWV A;  1TDG A;  3IH8 A;  2QYB A;  4R4R A;  4Y15 A;  2J3W A;  2I72 A;  2C5W B;  4ETZ A;  4UQI S;  4MLL A;  1FOF A;  4LRX C;  1Y4O A;  3E2L A;  4I39 A;  3CIT A;  1N9O A;  2WGW A;  1YLY A;  4B9O A;  1BSG A;  3P98 A;  5HAI A;  4R1G A;  5EVI B;  1EW0 A;  2HDU A;  4I3I A;  4R38 A;  4P87 A;  1IKG A;  4UQI M;  3C7V A;  4CPK A;  4JGP A;  3GRJ A;  3IX3 A;  5DKK A;  5CHJ A;  4BBV A;  1KDW A;  3R7W A;  2QZ6 A;  2Y2N A;  1RCJ A;  1L0D A;  4NXE A;  3DW0 A;  1ES4 A;  2KOI A;  3BFC A;  3U2A A;  3LR4 A;  4M3K A;  1CI9 A;  2BG1 A;  4ZRR A;  4E3M A;  4PMA A;  5FEG A;  4HJ6 A;  3DTM A;  3MMH A;  3N4I A;  4HES A;  2ZQ7 A;  2ZC3 B;  3H9W A;  2PR5 A;  1CF0 A;  3HBR A;  4R23 A;  1RP5 A;  3NJA A;  4S2N C;  2HP9 A;  2OLU A;  2V1Z A;  4DE0 A;  4YFM A;  3TRC A;  3CUE A;  3C38 A;  5CGX A;  4KQD A;  1NRJ A;  3QP2 A;  3ZG5 A;  5HAP A;  4XT2 A;  3E4O A;  4DF6 A;  1DY6 A;  5F5Y A;  3BEB A;  1NXY A;  3GVB A;  1ACF A;  3VSL A;  5J3W A;  3OLO A;  3HLD A;  5GHZ A;  2V20 A;  3FZC A;  4HQA A;  1X0O A;  3LIF A;  4Y7P A;  3VOY A;  2Y2Q A;  4OP5 A;  3RXW A;  3WRZ A;  4KUO A;  4UA7 A;  3TOI A;  2JKG A;  1ZG6 A;  1QME A;  5L09 A;  3IF6 A;  2VV8 A;  1FCM A;  1OTB A;  3VP4 A;  2PD8 A;  2EFU A;  4BL2 A;  5IS1 A;  5JYP A;  2W3F A;  3G35 A;  3LR3 A;  3ZNT A;  4ZTK A;  4BJP A;  5FAQ A;  4DE1 A;  1MXO A;  2X01 A;  2RL3 A;  3BLM A;  3NBL A;  3T4L A;  3MZD A;  3GR2 A;  2J9O A;  1PW8 A;  1YLT A;  2W1R A;  4PKY G;  3NC8 A;  3E4P A;  1MWT A;  5DKL A;  5FQ9 A;  4R3B A;  1AWI A;  3GMW A;  1S67 L;  2FFF B;  3HJI A;  3ISG A;  3ZDJ A;  4B93 A;  2Q9M A;  4ETX A;  2JE5 A;  4EBN A;  3D72 A;  2QKP A;  5CX7 A;  3WWX A;  2P9V B;  4GHI B;  2VGL S;  1K56 D;  1MZU A;  3WS4 A;  1W79 A;  4KZ9 A;  2WKQ A;  5FQK A;  5CRF A;  2A49 A;  4MN5 A;  3IWO A;  4DXB A;  1ERM A;  1XKZ A;  2HJE A;  1K25 A;  4KQO A;  4U0X A;  2Y2L A;  4MMN A;  4QJG A;  1NZO A;  3G34 A;  4I38 A;  3V39 A;  4WEK A;  1UWN X;  2VGL M;  4FOF A;  3OZH A;  4WN5 A;  2UWX A;  2A3U A;  5EM0 A;  3BFG A;  3QP1 A;  4PM8 A;  4JGO A;  4D60 A;  1W8Y A;  3IT9 A;  3N8S A;  4IVI A;  3ZG0 A;  1BUL A;  3TG9 A;  1KE3 A;  4IUK A;  3AGF A;  3A3J A;  4QU3 A;  2WKE A;  3NUL A;  1OJG A;  1K56 A;  4R4S A;  4GS9 B;  2D01 A;  4RVA A;  3Q7V B;  5IU1 A;  1P9R A;  2VK3 A;  3G32 A;  3KSG A;  4N1H A;  1WE4 A;  1VM1 A;  5AQB A;  4DJ3 A;  2Z2M B;  5FQI A;  4EQ1 A;  2O9A A;  4WZ5 C;  2OOL A;  4EU0 A;  4DE2 A;  1ZKJ A;  3QNB A;  3NY4 A;  1ESI A;  5GHX A;  3MS6 A;  4S2L A;  1PIO A;  4X69 A;  1VB6 A;  4Q0H A;  1LSV A;  5M19 A;  4FH2 A;  4HH3 A;  5DVA A;  3IXH A;  1Z6F A;  1I2W A;  4HP9 A;  3NCK A;  2H0T A;  2HZ5 A;  1LL9 A;  1STZ A;  1PI4 A;  2B18 A;  4KZB A;  1CJF A;  4IBR A;  5E2G A;  2GJ3 A;  5DJU A;  1OTE A;  1RGY A;  1JVJ A;  3CHW P;  3PAG A;  2DMW A;  2P74 A;  2Q9N A;  3V5M A;  4MEZ A;  1IEM A;  1DP6 A;  2WAD A;  2P04 A;  5J4E A;  3BFF A;  3LID A;  5A93 A;  1NY0 A;  2J3T D;  5A8B A;  5HWW A;  4KZ7 A;  3EOI A;  2WZX A;  1G6O A;  4KUK A;  5FI7 A;  3N6I A;  3BWL A;  4UEY A;  2EX2 A;  3BM6 A;  5FQM A;  1F2K A;  1K57 C;  1EI5 A;  3ZG8 B;  1VHM A;  4JXW A;  4Y0O A;  1GHI A;  4RQ9 A;  3LIC A;  3IXD A;  3VP2 A;  3Q81 A;  1KOU A;  3EWK A;  5EEC A;  5KMW A;  3KSI A;  2Y8H A;  3G2Y A;  3W8K A;  1LLB A;  1ERO A;  3OPR A;  2J80 A;  3OPP A;  3DTE A;  3MKE A;  1JWV A;  3W4Q A;  1KGE A;  4QD4 A;  4IVK A;  1A0K A;  4CLC E;  3HJK A;  1W7F A;  1XA1 A;  2BAS A;  2V1B A;  1YT4 A;  1KVM A;  3A0R A;  4E3J A;  1MKI A;  4D2O A;  1ZG4 A;  1Q2Q A;  2WK0 A;  3HLB A;  1D7E A;  4S2I A;  2EXA A;  1JWP A;  4EUV A;  4R3A A;  1XJ2 A;  3IX4 A;  3DTK A;  5FI6 A;  1K6R A;  4HP4 A;  3T1S A;  3QP5 A;  2X71 A;  2JHE A;  3D3O A;  4N1X A;  3WS5 A;  1ODV A;  4BD1 A;  1CEG A;  3P01 A;  5DF8 A;  3SH9 A;  2PRF A;  3D4F A;  5CXW A;  4HHD A;  4KEN B;  3N8L A;  5HD5 A;  3LEZ A;  1MBL A;  2DNS A;  4PM7 A;  3QP4 A;  4O0P A;  5CTN A;  1KGF A;  3CI6 A;  2HGV A;  2OAQ 1;  2PU2 A;  1GA9 A;  1K54 A;  2A2L A;  4B88 A;  4BD0 A;  1JWZ A;  2XQZ A;  3JPU A;  3HLG A;  2JBF A;  4JF6 A;  4E3L A;  1LSW A;  2OWJ A;  4G3W A;  5G4Y A;  4FUW A;  4Y3I A;  5L2F A;  4DMZ A;  1U60 A;  3PBO A;  4IHQ A;  3FKV A;  1VEU B;  4NK3 A;  2EWW A;  3ZCZ A;  5FAP A;  4EQI A;  5DTK A;  2XK1 A;  2VEA A;  1S1Y A;  4PKY A;  3IH9 A;  1UGU A;  3F1P A;  1ERQ A;  2ZQ9 A;  4QY5 A;  2G7U A;  1J3W A;  3NI9 A;  1D06 A;  5DFX A;  3MZE A;  1H5X A;  3A0S A;  4KG5 A;  3CWF A;  1LL8 A;  3MBZ A;  1W5D A;  1FR6 A;  3R4K A;  2Y2O A;  3MR0 A;  3ZG9 B;  4BQM A;  4C3Q A;  3IS2 B;  3PTE A;  1WA9 A;  4NKP A;  4KZ4 A;  3NDG A;  4WMC D;  4LCM A;  3B47 A;  3KSF A;  2VZW A;  4K08 A;  2W3H A;  4ARZ B;  5AVF A;  5FQJ A;  3GTC A;  1YQS A;  3VE3 A;  4HEF A;  1T1A A;  4N9K A;  3ICY A;  4E6W A;  1NZU A;  2FFY A;  5HDS A;  1OME A;  5CEB A;  1RGZ A;  1LT0 A;  3HLE A;  3IF6 C;  2QMI A;  2K31 A;  1S0W A;  1YAX A;  4G3V A;  2YKH A;  1H8Y A;  2XDM A;  5CED A;  2WKI A;  4CLC B;  2XA7 S;  5FEF A;  2LB9 A;  1E25 A;  4NXB A;  4L9E A;  4II7 A;  1MWS A;  3MXQ A;  4WEL A;  5F1F A;  2E8J A;  2QHK A;  4H6J B;  1T1C A;  4WMC A;  5GHY A;  1FSW A;  1N9B A;  4Q0J A;  1XA7 A;  4OOL A;  2XA7 M;  1K38 A;  1YLW A;  4G3K A;  2A24 B;  3UE3 A;  1DP8 A;  3O87 A;  5J7E A;  4OOM A;  4F3L B;  1SDN A;  4EUZ A;  2VJW A;  3IWQ A;  1L0G A;  1GSW A;  3SH7 A;  1OT9 A;  3E4Q A;  4B4Z A;  3LEQ A;  3KSH A;  3CPT A;  1VET A;  3ZHH A;  2ZMF A;  3EGX C;  1YSP A;  4OLG A;  2H5S A;  4RA7 A;  4WEJ A;  3UB6 A;  4EW7 A;  5HWV A;  1LHY A;  5EOO A;  5TFQ A;  3LY4 A;  4LV0 A;  1P97 A;  2V0W A;  3IHB A;  3LY3 A;  3IQA A;  2WGI A;  3DBA A;  1K4F A;  2XD5 A;  2Y2I A;  2WGW B;  2UV0 E;  4DJ2 A;  4BLM A;  2XSS A;  2QJ5 A;  3ZFZ A;  2Y2K A;  1TEM A;  4P0M A;  3E98 A;  4MBH A;  3VV4 A;  2K7S A;  1BUE A;  2O9B A;  3PBQ A;  4NXG A;  4YNR A;  3RTY A;  3SW1 A;  3R7W B;  2OLV A;  2R9W A;  1UWP X;  5MC7 A;  4LRY C;  4BMW A;  1MC0 A;  1ZTU A;  3AGD A;  3UME A;  3WRT A;  1ONG A;  3ITA A;  1KE4 A;  3BW6 A;  4M4X A;  2XLN A;  4DXC A;  4LEN A;  1GHP A;  2VA0 A;  4L9G A;  3WS1 A;  3ZNY A;  5HFO A;  2HP5 A;  4ZBE A;  2ZQD A;  3OPL A;  2PDR A;  3CG5 A;  4X1L A;  4ESP A;  5CER A;  2HJ9 C;  4Y0U A;  2L0W A;  1ES5 A;  5FDH A;  3LI8 A;  1XGJ A;  4DDY A;  5KSH A;  3UNW A;  3H82 A;  4XT2 B;  5F82 A;  2WKP A;  3IBJ A;  5DF7 A;  4RX2 A;  2VGK A;  2HV1 A;  2MJ6 A;  3PXP A;  4UHU A;  4JGR A;  4GW9 A;  2P9V A;  4GHI A;  4OH0 A;  4HJ3 A;  2NUT C;  2C6W B;  2BTF P;  1NLZ A;  2Y2P A;  4GKU A;  5E2F A;  3GV9 A;  2PBD P;  1JNU A;  5CHU A;  5HD3 A;  3W2Z A;  3LCE A;  1TS8 A;  1OTA A;  2J7V A;  3N8R A;  4WYY A;  4JKT A;  4FSF A;  4MN7 A;  3IF6 B;  2W1T A;  3T1R A;  5FQQ A;  3OC2 A;  1W8Q A;  1YLJ A;  4UA9 A;  5EPH A;  5JYO A;  2PR6 A;  2JKF A;  5EM1 A;  2DRW A;  3IF5 A;  3DAV A;  3M6B A;  4Y13 A;  3KYZ A;  4LRZ E;  4PM9 A;  3EQV A;  3FPV A;  5F1G A;  2Y55 A;  4NET A;  3S7P A;  1ONH A;  1JTD A;  1BLC A;  4GS9 A;  4OPZ A;  4LGW A;  4QHC A;  3Q7V A;  3SOI A;  1Y28 A;  1H0M A;  3VP0 A;  1S1Z A;  4FD8 A;  4ZJ2 A;  3UPP A;  4MN6 A;  3A3E A;  3S7O A;  3PBR A;  4H8R A;  2EA9 A;  4S2N A;  1Y54 A;  3LIB A;  1V9Z A;  4IJG A;  3O5Y A;  5GL9 A;  2KDK A;  3FYZ A;  4R3J A;  1IOU A;  4U0T A;  2PBY A;  1NLY A;  4K0X A;  5F83 A;  5CTM A;  3C4O A;  3V50 A;  2HF6 A;  1ZHH B;  3HLC A;  2Q0O A;  4KQR A;  4RYE A;  1XPB A;  1J9M A;  3DTI A;  2V9A A;  1YLP A;  5GLB A;  2WZZ A;  2RCX A;  4GCZ A;  2M7U A;  2PU4 A;  4C75 A;  2B5R A;  1GA0 A;  5CHM A;  2X02 A;  2XFS A;  1O07 A;  4O8G A;  5J8X A;  4S2M A;  4EBL A;  2VKS A;  3B33 A;  4MBF A;  4KG2 A;  5M1A A;  2XFT A;  3LO7 A;  4R6L A;  1YPR A;  1F98 A;  4WBG A;  1F5M A;  1PW1 A;  3KX0 X;  3K3D A;  2ZC5 B;  1K54 C;  2HPB A;  5HX9 A;  2Y2M A;  4Y17 A;  3BLS A;  2O99 A;  3FV7 A;  4NG2 A;  3K2N A;  2IA2 A;  1W63 Q;  2Y59 A;  3MZF A;  2M7V A;  4OQI A;  3IWI A;  4MBK A;  4RX3 A;  5IT5 A;  3G31 A;  2GDN A;  1SDE A;  5HPI A;  4EET B;  1S6R A;  3C4P A;  3I7J A;  1T18 A;  1G6A A;  2EX6 A;  3V67 A;  3T1Q B;  1IFQ A;  3Q82 A;  2FH5 A;  3NEC A;  1NYM A;  1H8Z A;  2ZC6 B;  3B42 A;  5A90 A;  4HI4 A;  4LPZ A;  1Q2P A;  5M18 A;  4ID4 A;  4WLA A;  5I94 A;  1XFQ A;  1VQQ A;  3UE6 A;  4GNU A;  2ZM2 A;  3BJN A;  4OQG A;  1L0F A;  2DCF A;  2V0U A;  3OCL A;  3WS0 A;  4NEE D;  3BEC A;  3FC7 A;  1HLU P;  2WGV A;  3C5A A;  2NUP C;  1PRQ A;  2QJ7 A;  3P09 A;  4YOF A;  2ZBB A;  4E3I A;  1KGG A;  2V2F F;  4N92 A;  1S4R A;  5HW3 A;  3VFH A;  3UDI A;  2PT7 A;  5AJG A;  1PZP A;  2R9X A;  2ZOI A;  4PM6 A;  3LIA A;  3VOZ A;  1W63 M;  2EXB A;  2KX6 A;  3QHY A;  1LI9 A;  1SKO A;  2BLS A;  2ZC4 B;  3HUN A;  4P6B A;  1HVB A;  3MJQ A;  2J9P A;  2JCH A;  3VE4 A;  1CEF A;  3VP1 A;  3C30 A;  3TJZ C;  3W4O A;  5AQ9 A;  2PHY A;  3M2K A;  2G2W A;  3NOT C;  2ZL1 B;  4I5S A;  4GZB A;  1ESU A;  4YIN A;  2H10 A;  2Y4A A;  1BTL A;  5HWT A;  3F1N B;  2JKR I;  4LV1 A;  3P7N A;  3QNC A;  4OPR A;  4ZJ1 A;  4IED A;  3C8C A;  1D1J A;  2M1C A;  1VEU A;  4JGQ A;  4WL9 A;  5HDD A;  5E43 A;  4KQQ A;  1PWC A;  1DJA A;  1LL5 A;  4EES A;  2HDR A;  3E2K A;  4LLO B;  4CLC D;  2ZJ9 A;  5E2H A;  3BY9 A;  1IYP A;  3RH8 B;  1GHM A;  4HH2 A;  3OPH A;  4KG6 A;  2ACG A;  3IS2 A;  3H7W B;  3ITB A;  3T50 A;  3NIA A;  4QPR A;  1AXB A;  3W4P A;  3E0Y A;  5TBM B;  5EVI D;  2ZC7 A;  1OTD A;  3CUE C;  3IX8 A;  3S4X A;  3DWK A;  3V3R A;  3ZVW A;  1L2S A;  3S7Q A;  3KO6 A;  5U47 A;  3ZG7 B;  3Q7Z A;  1LI0 A;  2GZA A;  3RFB A;  3DWZ A;  1ES3 A;  4HBU A;  3TW8 A;  3GDI A;  1DJB A;  4JXV A;  4X68 A;  3NOP C;  4CLC A;  1T19 A;  1FSY A;  5FAT A;  3F1O B;  5FSR A;  2XRN A;  3CZD A;  5IHV A;  4GN2 A;  4H6J A;  2H28 A;  5FAS A;  4JXS A;  3PYP A;  5KIZ A;  4ZJ3 A;  4N9L A;  1I2S A;  5EVI A;  3JVU A;  1IYQ A;  4QY6 A;  3PHY A;  5HZH A;  2GX5 A;  2ZMV A;  1XJ4 A;  3F1P B;  4F3L A;  4EV4 A;  5A91 A;  4F94 A;  4MCW A;  1MY8 A;  4E3N A;  3T1X A;  2V8C A;  3LI9 A;  1ES2 A;  1XP4 A;  3A3F A;  3OCN A;  2Y91 A;  2OSU A;  3VSK A;  4X53 A;  3A3D A;  1PI5 A;  2I9V A;  1NJ4 A;  3HLF A;  3MXS A;  5FL3 A;  4U3T A;  5GLD A;  1Z09 A;  1YM1 A;  2D02 A;  1HZO A;  2PAV P;  5L10 A;  1KE0 A;  3T4T A;  1HD8 A;  2V1A A;  2JN7 A;  1CK3 A;  5TR7 A;  3D9Y A;  3WS2 A;  2W3E A;  4UA6 A;  1IYO A;  2HDQ A;  1KVL A;  2OV5 A;  3T12 B;  1N4O A;  3SS5 A;  1TS6 A;  3G6O A;  3CJM A;  2W3D A;  4X6T A;  4HIA A;  3M2J A;  4OQ0 A;  2KLI A;  4Q0I A;  1XX2 A;  4Y0T A;  2Z6C A;  2CC1 A;  4EER A;  3QP8 A;  4DN0 A;  3V3S A;  3HVF A;  3TSG A;  1DRM A;  4BBT A;  1G68 A;  4EWF A;  3IXG A;  2L1M A;  1KDS A;  2XRO A;  5EOE A;  2ZQA A;  3IBR A;  2IWD A;  4YWZ A;  1QMF A;  2VV6 A;  3LR5 A;  1YMS A;  5EV0 A;  1WYB A;  2WKH A;  4JBF A;  4OON A;  3EQU A;  4LFU A;  1E4D A;  2ZQC A;  3K3C A;  4JF4 A;  3UB7 A;  2ZMA A;  4X55 A;  5L07 A;  1HTZ A;  4OVD A;  3T4K A;  3CPT B;  1VET B;  3EEH A;  1PYY A;  1H8M A;  1FR1 A;  1MKM A;  1OJ5 A;  5DTS A;  3RXX A;  3VMA A;  3QP6 A;  4XUZ A;  5EVL A;  1GSV A;  2E8I A;  4DE3 A;  1P0Z A;  4PAU A; 
#chains in the Genus database with same CATH homology
 2KDK A;  1IOU A;  4P6Z S;  4I3J A;  3JVV A;  4O01 A;  1DP9 A;  1NLY A;  3HJK A;  4HOI A;  4CLC E;  1TS7 A;  1BYW A;  2O9C A;  2A24 A;  4GLQ A;  3VOL A;  2BAS A;  1V9Y A;  2HF6 A;  1ZHH B;  1TF1 A;  2V1B A;  3LUQ A;  3MFX A;  4PHT A;  4BWI A;  5DJT A;  3A0R A;  1G28 A;  5TJJ A;  3ZYT A;  3EGD C;  3T4Q A;  1TS0 A;  3LYX A;  1D7E A;  3UB8 A;  4P6Z M;  3FPW A;  4Y2F A;  2PYP A;  2V9A A;  1F9I A;  3FG8 A;  1OPX A;  4EUV A;  2VX8 A;  3OBF A;  4CQH A;  3BQ8 A;  2EWV A;  4R3A A;  4GCZ A;  2M7U A;  2QYB A;  1XJ2 A;  3TE8 A;  2J3W A;  5F69 A;  3UB9 A;  4O8G A;  1T1B A;  5K5B A;  2VKS A;  4ETZ A;  4UQI S;  4HP4 A;  4LRX C;  3B33 A;  3MQO A;  1XJ3 A;  4I39 A;  2JHE A;  1N9N A;  3D3O A;  3CIT A;  1N9O A;  1ODV A;  4R6L A;  4B9O A;  3T4J A;  1F98 A;  3P01 A;  1F5M A;  1EW0 A;  4HHD A;  4I3I A;  4R38 A;  4EEU A;  5HD5 A;  3KX0 X;  3K3D A;  4UQI M;  4O0P A;  4JGP A;  4HNB A;  2Z6D A;  1GSX A;  5DKK A;  4BBV A;  3R7W A;  3CI6 A;  3ULF A;  2HGV A;  2OAQ 1;  2P08 A;  4NXE A;  2O99 A;  1OTI A;  3K2N A;  2IA2 A;  2FZ0 A;  1W63 Q;  2KOI A;  2A2L A;  2M7V A;  3U2A A;  4HY8 A;  3LR4 A;  3H82 B;  4ZRR A;  1P9W A;  5DFY A;  2JKT I;  5IT5 A;  4IUH A;  5HPI A;  4HJ6 A;  1LSW A;  2OWJ A;  4EET B;  2W0N A;  4ME4 A;  4G3W A;  5G4Y A;  4Y3I A;  3MMH A;  1T18 A;  4DMZ A;  2CMN A;  3PBO A;  4IHQ A;  3V67 A;  1IFQ A;  3H9W A;  4MDZ A;  2FH5 A;  2EWW A;  2PR5 A;  4I3A A;  3EEA A;  3NJA A;  2VEA A;  1S1Y A;  4PKY A;  1UGU A;  3B42 A;  3F1P A;  3PBT A;  4HI4 A;  2G7U A;  1D06 A;  3T4S A;  2J3T C;  5DFX A;  4LPZ A;  3A0S A;  4WLA A;  3CWF A;  1LL8 A;  3TRC A;  1XFQ A;  2INW A;  3UE6 A;  3CUE A;  2VV7 A;  3C38 A;  3R4K A;  4KQD A;  3BJN A;  1NRJ A;  3MR0 A;  2W1T B;  4XT2 A;  3IS2 B;  1WA9 A;  2V0U A;  3E4O A;  3OCL A;  4NKP A;  3B47 A;  3KSF A;  5G4Z A;  2VZW A;  4NEE D;  4K08 A;  5I5L A;  2W3H A;  5F5Y A;  2PYR A;  3FC7 A;  2JKT M;  4ARZ B;  5AVF A;  2NUP C;  2QJ7 A;  3VE3 A;  4YOF A;  2ZBB A;  1LSX A;  5J3W A;  1T1A A;  3OLO A;  3ICY A;  3PR6 A;  1S4R A;  1N9L A;  5HDS A;  4HQA A;  5LBR A;  1X0O A;  3LIF A;  2WKR A;  2PT7 A;  3NHQ A;  5AJG A;  1LT0 A;  2ZOI A;  3LIA A;  1W63 M;  3T4O A;  2KX6 A;  4KUO A;  2K31 A;  2OWH A;  1YAX A;  4G3V A;  2YKH A;  3MJQ A;  1S4S A;  3VE4 A;  2VV8 A;  1OTB A;  3C30 A;  2XA7 S;  4CLC B;  3TJZ C;  2B02 A;  2PHY A;  3A0V A;  2LB9 A;  2PD8 A;  4NXB A;  4L9E A;  4II7 A;  2K2N A;  3NOT C;  3MXQ A;  4WEL A;  1S66 L;  4I5S A;  5IS1 A;  2QHK A;  4H6J B;  1T1C A;  2W3F A;  3LR3 A;  5AVE A;  4BJP A;  4Q0J A;  4OOL A;  5HWT A;  3F1N B;  2JKR I;  2XA7 M;  3P7N A;  4G3K A;  1OT6 A;  2A24 B;  2QWS A;  3T4L A;  3UE3 A;  1DP8 A;  3C8C A;  2M1C A;  5J7E A;  4OOM A;  4F3L B;  2W1R A;  2VJW A;  4PKY G;  4JGQ A;  4WL9 A;  5HDD A;  1GSW A;  3E4P A;  1OT9 A;  3E4Q A;  3OOV A;  5HPF A;  5DKL A;  3KSH A;  4EES A;  3S7N A;  2ZMF A;  3EGX C;  4LLO B;  1YSP A;  4CLC D;  1S67 L;  3HJI A;  3BY9 A;  4B93 A;  4WEJ A;  3RH8 B;  4HH2 A;  3UB6 A;  4ETX A;  5F6A A;  3D72 A;  2QKP A;  3IS2 A;  5CX7 A;  3H7W B;  2O0Y A;  1NWZ A;  4EW7 A;  3T50 A;  5HWV A;  5HDC A;  4GHI B;  2VGL S;  2OAP 1;  4QPR A;  1H3Q A;  1P97 A;  2V0W A;  1MZU A;  3MQ0 A;  2VLG A;  3E0Y A;  5TBM B;  3DBA A;  2WKQ A;  4MN5 A;  1XFN A;  1OTD A;  3CUE C;  5DF9 A;  4DJ2 A;  2HJE A;  4KQO A;  2XSS A;  3KO6 A;  3S7Q A;  2QJ5 A;  4MMN A;  4I38 A;  4WEK A;  1UWN X;  2VGL M;  3E98 A;  4FOF A;  3VV4 A;  4WN5 A;  4CLC C;  2GZA A;  2K7S A;  2O9B A;  3PBQ A;  5HL6 A;  3RFB A;  4JGO A;  3TW8 A;  4NXG A;  3GDI A;  4YNR A;  3RTY A;  3SW1 A;  3R7W B;  2GNX A;  2W27 A;  3PBN A;  3NOP C;  4WF0 A;  4CLC A;  2W3G A;  1T19 A;  1UWP X;  5F68 A;  3F1O B;  5MC7 A;  4E04 A;  4LRY C;  4BMW A;  2XRN A;  1MC0 A;  1ZTU A;  4IUK A;  4H6J A;  3UME A;  2H28 A;  3PYP A;  5HSQ A;  4BBU A;  5KIZ A;  3MQQ A;  3MF0 A;  1OJG A;  2PD7 A;  3BW6 A;  4M4X A;  4GS9 B;  2D01 A;  3F1N A;  3JVU A;  5C5K A;  2VA0 A;  1P9R A;  4L9G A;  5IU1 A;  3KSG A;  2L4R A;  3NOU C;  4EEP A;  3PHY A;  4DJ3 A;  5HZH A;  3LIE A;  2GX5 A;  2ZMV A;  1XJ4 A;  3F1P B;  4F3L A;  2PDR A;  4EQ1 A;  1TD5 A;  4EXO A;  2O9A A;  4MCW A;  2YKF A;  4L0L A;  2HJ9 C;  3LI9 A;  2OOL A;  3OCN A;  4EU0 A;  2L0W A;  4WUJ A;  3LI8 A;  2LB5 A;  5KSH A;  2I9V A;  3H82 A;  4XT2 B;  1VB6 A;  2WKP A;  3IBJ A;  4Q0H A;  1LSV A;  5FL3 A;  2HV1 A;  2MJ6 A;  3PXP A;  4HH3 A;  4HJ4 A;  2D02 A;  2R78 A;  4JGR A;  4GW9 A;  3H7W A;  4Z1W A;  4HP9 A;  3T4T A;  4GHI A;  4HJ3 A;  2V1A A;  2NUT C;  1STZ A;  2JN7 A;  2B18 A;  1NLZ A;  5TBM A;  2GJ3 A;  3LFV A;  2W3E A;  3BY8 A;  5DJU A;  1OTE A;  3BQA A;  3HCY A;  1JNU A;  1TS6 A;  5HD3 A;  3G6O A;  5L8M A;  2W3D A;  3W2Z A;  1TS8 A;  2DMW A;  1OTA A;  4HIA A;  3UMD A;  2KLI A;  4Q0I A;  4FSF A;  4MN7 A;  1DP6 A;  2Z6C A;  2W1T A;  2P04 A;  3C2W A;  5J4E A;  4EER A;  3LID A;  2ZOH A;  3OC2 A;  4DN0 A;  2J3T D;  5A8B A;  5HWW A;  1DRM A;  4Y5F A;  3EOI A;  3PBS A;  4BBT A;  2PR6 A;  1G6O A;  4ARZ A;  4KUK A;  3F1O A;  1YKD A;  2JKR M;  3KYZ A;  2L1M A;  2P7J A;  4LRZ E;  2XRO A;  4R70 A;  3LR0 A;  3EQV A;  3IBR A;  2Y79 A;  3BWL A;  3FPV A;  4UEY A;  4YWZ A;  3S7P A;  2VV6 A;  3LR5 A;  4GS9 A;  1YSQ A;  3GEC A;  3EQU A;  3CAX A;  1Y28 A;  4L9F A;  3K3C A;  4AFI A;  3UB7 A;  1S1Z A;  4GJ4 A;  1VHM A;  4MN6 A;  4RQ9 A;  3LIC A;  3T4K A;  3EEH A;  1H8M A;  1OJ5 A;  1MKM A;  1XJ6 A;  3S7O A;  3PBR A;  1KOU A;  3ZQ5 A;  3EWK A;  2EA9 A;  3KSI A;  2Y8H A;  4NXF A;  1GSV A;  3LIB A;  1V9Z A;  4IJG A;  3O5Y A;  3KYQ A;  2J80 A;  1P0Z A;  3CLO A;  4PAU A;  5EFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...