2QKPA

Crystal structure of c-terminal domain of smu_1151c from streptococcus mutans
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
b'SLDRTTQQPFGNGYLSVEQANLILNHLPLEITFVNKDDIFQYYNDSVPAAEMVFKRTPSQVGRNVELCHPPKVLDKVKKVFELLRNGQRDKVNMWFQSERLGKFVYVTYAAVRDQAGDFQGVLEYVQDIKPFFELDSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structure of C-terminal domain of SMU_1151c from Streptococcus mutans.
rcsb
source organism Streptococcus mutans
molecule tags Structural genomics, unknown function
total genus 37
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13596 PAS_10 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2qkpA00
3H7WA 3ULFA 1S67L 4LPZA 1JNUA 4EXOA 3RH8B 3ZQ5A 1S1YA 3ICYA 1TS7A 4RQ9A 1OTIA 2INWA 4GHIA 3G6OA 3H82B 4WL9A 3A0SA 5HD5A 2VEAA 2W27A 1LL8A 3LIBA 4NXBA 3F1OA 2YKFA 4BBVA 3CLOA 1UWNX 5J3WA 4B9OA 2QHKA 3IS2B 3MQOA 2CMNA 1TS8A 1OJ5A 4HI4A 5TBMB 3F1PA 3BWLA 3NHQA 4I39A 1OJGA 4I3JA 4R70A 4NXGA 4M4XA 4HHDA 4PKYG 3UE6A 4JGOA 4I38A 2W0NA 1S4SA 1P97A 2I9VA 2EA9A 2QKPA 4HH3A 4HY8A 4K08A 2V0WA 3BY8A 3UB8A 5HWWA 1F98A 4WN5A 4XT2A 3D72A 3EEHA 2D01A 4JGQA 3LI8A 4GS9A 3LICA 3MQQA 3VOLA 2VV6A 1XJ4A 4LRXC 5I5LA 1Y28A 3K3DA 3F1NB 3NOPC 1ODVA 2A24B 2PDRA 4HJ3A 1X0OA 1LSXA 2PR6A 3GECA 1VB6A 3LIDA 1OT6A 1D06A 3FG8A 5HDDA 3SW1A 5IU1A 4I3IA 4MN5A 1S1ZA 5HSQA 3C2WA 3UMDA 1DP9A 5HDSA 4NXFA 3EWKA 5F6AA 5HDCA 4LRZE 4LRYC 5DKKA 1F9IA 4JGPA 2V9AA 1NWZA 4WLAA 5DJUA 3NJAA 4BBUA 2L4RA 1DRMA 1T18A 2M1CA 2R78A 3E4OA 4R38A 3CWFA 3HJIA 1D7EA 3MR0A 3MFXA 1XJ3A 2GJ3A 3P7NA 1KOUA 4I5SA 3H82A 2VV7A 2PYPA 3FC7A 5J7EA 4KQDA 4EESA 1T1BA 1OT9A 3CAXA 2PD8A 2P7JA 1DP6A 4H6JB 3LI9A 3NOTC 4EW7A 4R3AA 4KUOA 4R6LA 2PD7A 3IS2A 2WKRA 3RTYA 1P0ZA 4HH2A 5HWTA 2PHYA 1EW0A 4GW9A 2H28A 4LLOB 4F3LB 3E4PA 5TBMA 2ZBBA 3MJQA 1N9NA 4HQAA 3K3CA 1XJ2A 3LIFA 2QJ5A 3H7WB 4MN6A 2L0WA 2OWJA 1LT0A 4DJ2A 2WKQA 4GHIB 5HZHA 1S4RA 2PR5A 3NOUC 1OTBA 2ZOHA 4KUKA 3GDIA 1UWPX 3A0VA 2Z6CA 2V1AA 5HWVA 2V0UA 3UB9A 3F1OB 4HIAA 4HNBA 5HD3A 2VLGA 4JGRA 2QWSA 3HJKA 1N9LA 2K7SA 2JN7A 1N9OA 1GSXA 4PKYA 1BYWA 5AVFA 1T19A 3F1PB 3F1NA 2A24A 4HOIA 3LIEA 3PHYA 3LIAA 3BY9A 2QJ7A 2KX6A 4L9FA 1OTAA 1XFQA 4EEUA 4NXEA 2J80A 4HJ4A 3UMEA 4EERA 4XT2B 1LSWA 5EFWA 1V9YA 2OOLA 4L9EA 2PYRA 1G28A 4GS9B 2D02A 3H9WA 3PYPA 4E04A 4BBTA 1T1AA 5F69A 4WUJA 1GSVA 4YWZA 3E4QA 1OTEA 3A0RA 4L9GA 1MZUA 4EEPA 5J4EA 3IBRA 4HJ6A 5F5YA 1LSVA 1DP8A 1XJ6A 4I3AA 4EETB 3VE4A 1T1CA 3B33A 1TS0A 4HP4A 1TS6A 3OLOA 2B02A 5F68A 3LUQA 3UB7A 2BASA 3T50A 1XFNA 5IS1A 5AVEA 1GSWA 5KIZA 4EQ1A 2ZOIA 5G4YA 4DJ3A 1UGUA 2V1BA 2L1MA 3C8CA 4GCZA 5DKLA 5G4ZA 1V9ZA 3KX0X 5DJTA 2OWHA 4H6JA 2JHEA 2WKPA 1WA9A 3UB6A 2VV8A 2Z6DA 1OTDA 1S66L 4WF0A 4HP9A 2HV1A 4F3LA 3VE3A 2YKHA 5A8BA 3LYXA 2KDKA 3MXQA
chains in the Genus database with same CATH superfamily
4GD8A 3P98A 3OPHA 1MWTA 2WZZA 4II7A 3ICYA 4DMZA 3G6OA 1DJAA 2PU2A 1XPBA 3LEQA 4G3KA 5HAPA 3OCLA 3MS6A 4BBVA 1I5QA 4OOMA 2Y59A 2QHKA 3IS2B 4IUKA 4FH2A 3T1RA 4A5RA 4GD6A 2O99A 4CLCB 5CTNA 4X25A 2ZM8A 3TSGA 1Q2PA 4OQGA 2BTFP 2WKHA 4Y2FA 4I3JA 3SS4A 4R70A 4HHDA 1TEMA 3LEZA 4I38A 5E2EA 3MQ0A 4KZ9A 3GV9A 2VX8A 1ALQA 2QZ6A 1WYBA 4L0LA 3OPLA 1RCJA 4ETZA 4EBLA 5HL1A 2HGVA 3QP6A 3HL9A 5M18A 1EI5A 1PW1A 4QU3A 4Q0IA 3MZDA 4NG2A 3D72A 4BMWA 3GRJA 1FIKA 5E2GA 3UNWA 4K0XA 2EXBA 1DY6A 2WGIA 4KZAA 4WBGA 3VOLA 2ZQAA 1PFLA 1E25A 4DXBA 2C5WB 4LRXC 4MBFA 5I5LA 2VKSA 1Y28A 1XA1A 2XDMA 2OLVA 3VP1A 1CEGA 4C3QA 1MXOA 1LI9A 2HDSA 2NUPC 3D3OA 4GOGA 2PR6A 3GECA 1KGFA 1VB6A 4S2NA 3O3VA 4B4ZA 4PMAA 3S1YA 3T4QA 3SW1A 4GNUA 5HSQA 3IX8A 3UMDA 1DP9A 2GZAA 1K54C 4X6TA 1K54A 3U2AA 3AGDA 5L10A 4N1HA 2HDUA 3HVFA 2ZC6B 1BSGA 4HBUA 3EWKA 3C7VA 1E3UA 4LRYC 5FQIA 2EX6A 5DKKA 1F9IA 2WKEA 2VJWA 1F5MA 1WE4A 2V9AA 3IX4A 2J3TD 3BEBA 3QP1A 1TF1A 5CEDA 5HAIA 1KGGA 5DJUA 5E2HA 3EQVA 2L4RA 1RGYA 5IT5A 4S2PA 3HLGA 4OQHA 3E4OA 4D2OA 3C30A 1CI9A 4JF5A 4KZ6A 4N9LA 2Y55A 3IXHA 3IQAA 3N8SA 2H10A 3HJIA 5J8XA 3MR0A 5FAQA 4E6XA 4ZJ3A 5FATA 1KOUA 4I5SA 2Y2GA 2OAP1 1MKMA 4RA7A 5DF8A 1K57A 3DTEA 2NUTC 3C4OA 1VHMA 1HLUP 4EESA 4GDBA 4X69A 1OT9A 4ESPA 5L09A 5CRFA 4KZ4A 3HLDA 3PBOA 1KDSA 1SKFA 1BTLA 3IWOA 2WKRA 4JXVA 5EM0A 3S7OA 1U60A 5HWTA 2R9XA 1EW0A 4GW9A 3FYZA 4S2IA 1N9NA 4B4XA 1K0KA 4ZJ2A 3S22A 1JVJA 4N9KA 3A3EA 4MN6A 4WELA 3KYQA 2WKQA 3PBQA 1RP5A 5HZHA 1S4RA 2P08A 2PR5A 1OTBA 1YKDA 2EXAA 3RJUA 1S0WA 1Q2QA 3GDIA 4NETA 5AQ9A 3V39A 1OMEA 2FFYA 3CMZA 3F1OB 1KGEA 5HD3A 1FR6A 3HCYA 3HJKA 1JWVA 4G3WA 3VP3A 2JN7A 3PR6A 3HREA 3VMAA 4PKYA 4MMNA 2XGNA 2K31A 5AVFA 1YLZA 2Y91A 4X1LA 1ZC2A 2Y2LA 3UE0A 4HOIA 3N8RA 4YOFA 5FASA 1MBLA 2A2LA 3EOIA 2Z2LB 2KX6A 3A3FA 2Y2IA 2VGLM 1GCEA 4E3NA 1BLPA 1V9YA 2XK1A 2PYRA 1YT4A 1G28A 3DAVA 1YSQA 2H5SA 3Q7VB 2VK3A 3ZYTA 5F69A 1Y54A 1YPRA 2IA2A 1IYSA 4YWZA 2XD5A 1SKOB 2W3EA 3IBJA 2GX5A 2ZMFA 3IBRA 1H8ZA 4AFIA 3SS5A 2P04A 4I3AA 4P6BA 2E8IA 3ZG5A 3L9KA 3MXSA 3DTKA 3B33A 2UWXA 2P9VB 2K2NA 2ZMVA 1VEUB 3BECA 5GLDA 3LUQA 1JWPA 1ACFA 1NLYA 1VM1A 2HDRA 3MFDA 3LR4A 2IWDA 3PAEA 2HP6A 4X55A 1FQGA 4S2KA 2ZMAA 2ZOIA 3E2KA 1CQAA 1UGUA 4EWFA 2Y4AA 3IXDA 2XD1A 4GCZA 2H0TA 1LLBA 4KQOA 1YQSA 1NJ4A 1YLTA 5FEGA 3C4PA 2WKPA 3ISGA 3KSGA 3BLSA 4HEFA 2VGJA 1S66L 3FKVA 2HP9A 4ETXA 4WZ5C 4WZ5A 2W3DA 5CX7A 2BLSA 4E3IA 4O8GA 5AQAA 5DFYA 5CTMA 3UB5P 3MF0A 3V5MA 1BZAA 2JKFA 2KDKA 4EQ1A 4LPZA 4EQIA 4EXOA 1S1YA 3W4OA 4GHIA 4X53A 3H82B 4BL3A 3WS0A 3DWZA 2VEAA 1G5UA 3DTMA 4ZAMA 1LL8A 4R4RA 2O9CA 1UWNX 2OV5A 1SDNA 4K91A 4OP8A 1MC0A 4E3JA 2CMNA 1VETA 4BENA 5EE8A 1O07A 1TS8A 3BQ8A 1OJ5A 1YMSA 4HI4A 3R7WA 4CPKA 3BQAA 3HUNA 1ES3A 3T1XA 4NXGA 1HZOA 3PTEA 4JGOA 4P87A 4DE2A 5FDHA 4NKPA 2E8JA 1PRQA 3LR0A 4JF4A 1P97A 1H8YA 4QWOA 2QKPA 5AJGA 4HY8A 3BY8A 4KG6A 3C38A 2PU4A 2DRWA 1ZG6A 4E3MA 2LB5A 3PBNA 2VGLS 1MY8A 2D01A 3LI8A 4GS9A 3IT9A 3FZCA 2RL3A 2ZQCA 5F82A 5HPIA 3N7WA 3FWLA 5E43A 2VV6A 1XJ4A 1IOUA 3T4TA 2M7VA 5HFOA 4UA6A 3LR5A 3K3DA 3QP5A 3GMWA 3Q7ZA 2XQZA 3NOPC 2RCXA 4C6YA 4JXSA 2PDRA 4OPRA 4IVKA 2XROA 2GNXA 4Q0HA 1K56A 1LSXA 4KZ3A 3LIDA 2G2WA 1OT6A 1D06A 3S7QA 4FTXA 3HLWA 4DRTA 2PBYA 5IU1A 4KZ8A 4I3IA 1KVLA 4MN5A 5F1FA 4BD1A 2W3FA 3C2WA 4KG2A 3TE8A 2WGWB 3FPWA 3JPUA 3T12B 1BUEA 3GSGA 1K6RA 5F6AA 4F94A 1I2SA 2EX8A 3PAGA 4PM9A 2ZL1B 1MPLA 3E0YA 2EX2A 2JKGA 2PRFA 2DMWA 2DNSA 1T18A 2H0YA 4YINA 3G35A 3UE1A 2WUQA 4R38A 3IHBA 3NIAA 5HAQA 3CWFA 4QB8A 3S7PA 1XJ3A 2GJ3A 3EGDC 4ARZB 1ONGA 1H8MA 4PHTA 4DF6A 1W63M 1MWRA 2PYPA 1ES2A 3UY6A 3PBRA 4FD8A 4PM6A 4WZ4A 3CAXA 4MEZA 4LV0A 2PD8A 2P7JA 3CI6A 3OZHA 1DP6A 3NOTC 4EW7A 5JYPA 4KUOA 1NLZA 2WAFA 3RTYA 3NBLA 3JYIA 3RFBA 1PNEA 4DE1A 1G6OA 3IH9A 4OOLA 4F3LB 3E4PA 5TBMA 3CITA 4HQAA 3IF6B 1F2KA 1XJ2A 1FCNA 2X02A 3G4PA 4MCWA 3SOIA 1K38A 2L0WA 1C3BA 3S4XA 4DJ2A 4R0QA 4S2NC 1L0GA 3JVUA 3NOUC 5DVAA 4WMCA 2Q0OA 3HLBA 5FAOA 5CGSA 3BFCA 3UN7A 2OSUA 5HWVA 1PI4A 3IWIA 3A3DA 4Y0UA 4HIAA 2LB9A 3QP8A 4D60A 2VLGA 4JGRA 3OCNA 4YNRA 3C5AA 3P09A 3FV7A 5FQ9A 2J9OA 1XXMA 1I2WA 2BG1A 1FCMA 3DWKA 4JKTA 5LBRA 5CECA 4Z9QA 1T19A 3UE3A 3F1NA 4IUHA 2Y2QA 2A24A 2W3HA 5G18A 1PWGA 1GHIA 1DJBA 4L9FA 4P6ZM 1OTAA 1SHVA 2JC7A 2ZM2A 1IYQA 4EBNA 1L0FA 2Y2NA 1W63Q 2OOLA 4PAUA 4C75A 1S6RA 4L9EA 4BWIA 4R3JA 3H9WA 1PZPA 3ITAA 4E04A 1T1AA 3NCKA 1K57C 5FI2A 3FPVA 5CHMA 3E4QA 2CC1A 1OTEA 3A0RA 2V20A 4Y17A 1PI5A 4UA7A 4HJ6A 5KSHA 3IF5A 2VA0A 2EX9A 1G6AA 3U4LP 4U3TA 3VP0A 2G2UA 4EETB 3O5YA 1VQQA 4OVDA 1T1CA 1TS0A 4UHUA 1TS6A 5BOHA 5EOOA 5FSRA 1JTGA 3WWXA 1XFNA 5IS1A 3SZTA 1ES4A 2JE5A 3VOZA 1H5XA 3OC2A 1QMEA 3NI9A 3UDXA 3FKWA 1IKGA 1YMXA 4N92A 3LCEA 5EVLA 4OONA 2L1MA 3DBAA 1GA9A 2OWHA 1LL5A 2ZD8A 4FUWA 4PPRA 4H6JA 3A3IA 1WA9A 3UB6A 2Z6DA 4JXWA 1AXBA 4JLFA 1OTDA 2EFXA 3AGEA 1TD5A 5HW3A 4MBKA 3ZHHA 2I72A 3UDIA 1CI8A 3V50A 3WS5A 3ZG9B 2AVXA 2HV1A 4JPMA 1BLSA 3EEAA 2YKHA 2Q9NA 2JBFA 5EVIC 5EVIA 4LCMA 3O88A 3CJMA 5A8BA 3ZG7B 2W1TA 3TW8A 3MXQA 3H7WA 3CPTA 1S67L 5FQMA 3ZCZA 1JNUA 3ZQ5A 1ZHHB 1OTIA 4O0PA 3SH7A 1L3LA 1FOFA 4WL9A 3A0SA 4ZRRA 2PBDP 3LIBA 3M6BA 4NXBA 1TVFA 4GJ4A 2IWCA 3OBFA 3CLOA 5TFQA 5K5BA 3KSHA 1BLHA 5J3WA 4E3KA 1ERMA 5FQJA 3WRZA 1CJFA 3MQOA 5FI7A 4BL2A 1HVBA 3F1PA 2M7UA 2JKTM 3BWLA 4I39A 4B88A 1OJGA 3ZVWA 4M4XA 4EV4A 4PKYG 4IVIA 5EM1A 3GR2A 2W0NA 1S4SA 4B93A 2J3WA 3V67A 2I9VA 1H3QA 1K6SA 4M3KA 4K0WA 1E3UD 3MZEA 5I94A 1A0KA 3UB8A 4P6ZS 1F98A 5GLCA 2Y8HA 4XT2A 5TJJA 1GHPA 5EV0A 5TGFA 2A3UA 4IEDA 5A91A 1BT5A 3N8LA 3IXBA 3QNBA 4MN7A 1W5DA 4RYEA 1O7EA 5L8MA 4ME4A 2WK0A 3ZG8B 1P9WA 3M2KA 3G2YA 1ODVA 3RXWA 4KZ5A 3VSLA 2WZXA 4QJGA 2B5RA 3G30A 1ZKJA 4LGWA 4UQIM 3FG8A 5HDDA 4IBRA 3OOVA 1HTZA 4FH4A 5E2FA 4CLCE 4RVAA 1KE3A 2VGKA 4LENA 2XA7M 3ZNYA 5HX9A 2Y2KA 3O87A 4Q0JA 5CHJA 5CHUA 5DF9A 3VV4A 3PBTA 4KZBA 1FSYA 1ERQA 5HDSA 2V8CA 1FILA 4NXFA 5GHZA 1CF0A 5FAPA 3K2NA 5FL3A 1D1JA 2B95A 3NDEA 2HPBA 2KOIA 4JGPA 1KDWA 2WAEA 4S2OA 1NWZA 3CZDA 4WLAA 5F83A 2JKRM 2OAQ1 2J9PA 5FDSA 2OLUA 2XFSA 1DRMA 2QMIA 4O7DA 2M1CA 4E3LA 5EVEA 5A93A 2ZJ9A 3CHWP 3E2LA 1D7EA 4BLMA 3MFXA 4X68A 2WGVA 3Q1FA 1SDEA 3P7NA 1AWIA 4XXRA 3W8KA 4Y0TA 4WYYA 5L07A 3MKEA 1K4FA 2VV7A 4XUZA 3WS2A 3FC7A 4NK3A 5J7EA 4XUXA 1IEMA 1NYYA 1N9BA 5KZHA 4JXGA 4R6LA 3MKFA 1L2SA 3IS2A 2PHYA 4CLCC 4CLCA 2H28A 4KG5A 3CG5A 3MJQA 4G3VA 3K3CA 2XH9A 5DTSA 4GKUA 3LIFA 3SS3A 2Y2OA 3VFHA 4Q8IA 2J3TC 4UEYA 3IHAA 2JCHA 2OWJA 5L2FA 1TDGA 1LT0A 4OKPA 4LFUA 2Y2JA 4GHIB 2PT7A 2UV0E 3JVVA 2ZOHA 4GN2A 4KUKA 1L0DA 1UWPX 3C7UA 4Y5FA 3KSIA 2HJEA 2O9AA 4HNBA 3IXGA 1PWCA 2P74A 1GA0A 1XGJA 4P85A 1IYPA 3NDGA 2K7SA 3MXRA 1GSXA 1VETB 4MBHA 4R4SA 3IF6A 4FCFA 5FQQA 3R7WB 3UO9A 5CGWA 3MBZA 1LHYA 2DCFA 1EWZA 1Z6FA 4UAAA 4U0TA 1NY0A 3LIEA 4QHCA 2A49A 2J8YA 3LIAA 2ZC3B 5CERA 2XLNA 2XF3A 4GZBA 4Y15A 4NXEA 1RGZA 3D4FA 3QNCA 3HUOA 1K55C 4UQIS 4Y7PA 3UMEA 1K55A 5EFWA 1NYMA 5DFXA 4GS9B 2XA7S 2D02A 4WEJA 2Y2MA 4S2LA 4BBTA 4HESA 3NULA 4OH0A 1J9MA 1GSVA 5DF7A 1YLJA 4WEKA 1MZUA 4GLQA 3G34A 5J4EA 1Z09A 4DXCA 4R1GA 2FFFB 1LSVA 1DP8A 1XJ6A 2ZM0A 1XX2A 4HP4A 3T1SA 2EWVA 1PWDA 3SH8A 4O01A 3LY3A 3PBSA 3SH9A 2B02A 5F68A 3AGFA 5JYOA 2WKIA 4ZDXA 4DE0A 3GVBA 2BASA 3T50A 2QYBA 3HLCA 1GSWA 5KIZA 4QY5A 5EECA 3HLEA 3S7NA 5G4YA 5AQBA 3ZDJA 5DKLA 1MWSA 1DJCA 1ZG4A 1V9ZA 5DJTA 5C5KA 4WM9A 3UPOA 4KZ7A 5AQ7A 2Q9MA 2JHEA 3QP2A 3BFGA 2IWBA 3DTIA 3VP2A 2VV8A 5TR7A 4N1XA 2G7UA 4WF0A 4OPYA 4X1MA 2Z2MB 3W4PA 4E6WA 4PM5A 4QY6A 3IX3A 3TJZC 4OQIA 3UPPA 1YAXA 2XFTA 3ULFA 4GDNA 2JKTI 4Y3IA 3RH8B 3WRTA 2B18A 4DDSA 1TS7A 4RQ9A 1JWZA 2INWA 4LV2A 1YLPA 4CLCD 1CEFA 2HZ5A 3LO7A 5HD5A 4CJNA 5U47A 2GDNA 5FA7A 2HJ9C 1BULA 2W27A 2O9BA 2MJ6A 3F1OA 2YKFA 4HBTA 4OQ0A 4B9OA 1K56D 2Y2HA 3TOIA 4GB7A 1PW8A 2XRNA 2XR0A 5TBMB 4UA9A 4MLLA 4RX3A 3NHQA 1NZOA 5KMWA 3UE6A 1IELA 5GLAA 2PAVP 3N6IA 4LV1A 3BRMA 1YM1A 4PM7A 5M1AA 3WS4A 1LI0A 4ZBEA 3UDFA 2EA9A 1TDLA 4HH3A 1H0MA 4K08A 2V0WA 1PYYA 2WYXA 2HDQA 3QHYA 5HWWA 1ONHA 2HP5A 4WN5A 5KSCA 2W3GA 3EGXC 3EEHA 4PM8A 2X71A 1LL9A 3I7JA 2XSSA 2ZC4B 4JGQA 3OPRA 5EUAA 1ES5A 5CGXA 1FCOA 3Q7VA 2V8FA 1YLYA 1ESIA 4DDYA 3M2JA 3LICA 3TRCA 4LV3A 3MQQA 5EPHA 2J7VA 4S2JA 3ZVTA 1SKOA 3F1NB 3Q81A 3BLMA 3VFFA 2A24B 4OLGA 3GTCA 3A3JA 5HPFA 5DTKA 4HJ3A 3E98A 1X0OA 3N4IA 5HARA 3V3RA 3V3SA 1MWUA 3W2ZA 1M6KA 2P9VA 2JKRI 1K4EA 1VEUA 3LGOA 2ACGA 4Z1WA 4BQMA 5FI6A 1S1ZA 3BJNA 1NXYA 4EBPA 4DKIA 1XGIA 1L0EA 3BW6A 1IKIA 3R4KA 1KVMA 3Q07A 4DE3A 4KQQA 1STZA 5HDCA 3TG9A 4LRZE 1GHMA 3ZFZA 3NY4A 2WADA 1W8YA 1NRFA 3CUEC 3CUEA 1EROA 4R23A 3KYZA 3PXPA 4FOFA 1Y4OA 4JBFA 3NJAA 4BBUA 2ZC5B 3MSHA 1PIOA 4DN0A 5EOEA 5DTTA 2R78A 1W8QA 4WMCD 5CXWA 1N4OA 1ZTUA 1QMFA 3ZGAB 2O0YA 1NRJA 3HBRA 3T4KA 3H82A 3T4JA 4Y0OA 4P0MA 1HD8A 1J3WA 3B42A 1WYCA 4KQDA 1T1BA 3KO6A 3LR3A 2ZQDA 3KYEA 3LI9A 4H6JB 5MC7A 4R3AA 4KQRA 4OPQA 2ZQ7A 3NECA 2XEPA 2V1ZA 3T4OA 2PD7A 1IYOA 3BFFA 4ZTKA 4MDZA 1P0ZA 4HH2A 4LLOB 3VP4A 3VOYA 4IBXA 3ZG0A 3WS1A 2ZBBA 4IHQA 4S2MA 5A92A 5EVIB 5FEFA 5A90A 2W1RA 2W1TB 1W7FA 2Y79A 2QJ5A 3H7WB 2VZWA 3UPNA 3CPTB 2EWWA 3T1QB 2FH5A 1XKZA 4FSFA 1W79A 3G2ZA 5F1GA 2ZLYA 5CEBA 3A0VA 4CQHA 2Z6CA 3Q82A 2V1AA 2V0UA 5GHXA 3UB9A 2V2FF 3DW0A 2ZQ8A 3NC8A 4E3OA 2QWSA 2Y2PA 3W4QA 4RX2A 1N9LA 4H8RA 5D3OA 1N9OA 5FQKA 1BYWA 4EU0A 3F1PB 3LY4A 4OPZA 3VSKA 4BJPA 1BLCA 3T4SA 5GL9A 1FSWA 1YLWA 3D9YA 3L7HA 3PHYA 4OOYA 1G68A 4EUVA 1XA7A 3BY9A 2QJ7A 3MZFA 3BYDA 3MMHA 3BM6A 3IWQA 5GHYA 1XFQA 4EEUA 3O86A 1P9RA 2J80A 3QP4A 1M40A 4HJ4A 4QPRA 4MNRA 4EERA 4XT2B 1LSWA 2WGWA 2EFUA 3PYPA 1E4DA 1KE4A 4WUJA 5EVID 2ZL1A 1XP4A 4R3BA 4L9GA 1FR1A 3T4LA 4EEPA 4ID4A 2ZC7A 3GQZA 5F5YA 4KENB 3RXXA 2R9WA 1YSPA 3BFDA 4U0XA 3ZNTA 3VE4A 2ZQ9A 5IHVA 1NZUA 1OPXA 1PZOA 3OLOA 4IJGA 3HUMA 3P01A 3IH8A 4EUZA 4NEED 3G32A 3UB7A 4OLDA 3HLFA 3EQUA 2C6WB 4ARZA 5AVEA 1MKIA 4QD4A 1K25A 3BFEA 1KE0A 2HF6A 3B47A 2KLIA 4X56A 1SCWA 4DJ3A 2X01A 2V1BA 3C8CA 5G4ZA 3B3XA 3KX0X 3KSFA 1IFQA 4YFMA 1JTDA 3G31A 4JF6A 5HL6A 2QPNA 4HP9A 4Y13A 1CK3A 1SZVA 4OP5A 4F3LA 3VE3A 3OPPA 3LFVA 5M19A 4LCLA 4ZJ1A 3ITBA 3IF6C 4BD0A 3M6HA 3LYXA 5GLBA 2FZ0A 1ESUA
chains in the Genus database with same CATH topology
3H7WA 3ULFA 2JKTI 4Y3IA 1S67L 4LPZA 1JNUA 4EXOA 3RH8B 3ZQ5A 1S1YA 4II7A 3ICYA 1ZHHB 2B18A 1TS7A 4RQ9A 1OTIA 4DMZA 2INWA 4O0PA 4GHIA 4CLCD 3G6OA 3H82B 4WL9A 3A0SA 4ZRRA 5HD5A 2VEAA 2HJ9C 4G3KA 2W27A 1LL8A 3LIBA 2O9BA 2MJ6A 3F1OA 4NXBA 2YKFA 3OCLA 2O9CA 4GJ4A 4BBVA 3OBFA 3CLOA 5K5BA 3KSHA 1UWNX 4OOMA 5J3WA 4B9OA 1MC0A 2QHKA 3IS2B 4IUKA 3MQOA 2CMNA 2O99A 4CLCB 1TS8A 2XRNA 3BQ8A 1OJ5A 4HI4A 3R7WA 5TBMB 3F1PA 4Y2FA 2JKTM 3BQAA 3BWLA 3NHQA 4I39A 2M7UA 1OJGA 4I3JA 4R70A 4NXGA 4M4XA 4HHDA 4PKYG 3UE6A 4JGOA 4I38A 3MQ0A 2VX8A 4NKPA 2W0NA 1S4SA 4B93A 2J3WA 3V67A 3LR0A 4L0LA 1P97A 2I9VA 2EA9A 1H3QA 4ETZA 2QKPA 4HH3A 5AJGA 4HY8A 4K08A 2V0WA 2HGVA 3BY8A 3C38A 3UB8A 4P6ZS 5HWWA 1F98A 2LB5A 2Y8HA 4WN5A 4XT2A 5TJJA 2W3GA 4Q0IA 3EGXC 3PBNA 2VGLS 3D72A 3EEHA 2XSSA 4BMWA 2D01A 4JGQA 3LI8A 4GS9A 5HPIA 3LICA 3TRCA 3MQQA 3VOLA 2VV6A 1XJ4A 1IOUA 4MN7A 3T4TA 2M7VA 4LRXC 5L8MA 5I5LA 2VKSA 4ME4A 3LR5A 1Y28A 3K3DA 3F1NB 3NOPC 1P9WA 1ODVA 2A24B 5HPFA 2PDRA 4HJ3A 2XROA 2GNXA 2NUPC 3D3OA 3E98A 1X0OA 4Q0HA 1LSXA 2PR6A 3GECA 3W2ZA 1VB6A 3LIDA 1OT6A 2JKRI 1D06A 3S7QA 4UQIM 3FG8A 5HDDA 3OOVA 3T4QA 3SW1A 4Z1WA 5IU1A 4CLCE 4I3IA 4MN5A 1S1ZA 5HSQA 2XA7M 3BJNA 2W3FA 3C2WA 1DP9A 3UMDA 2GZAA 3TE8A 3FPWA 3U2AA 4Q0JA 5DF9A 3VV4A 3BW6A 3PBTA 5HDSA 4NXFA 3EWKA 3R4KA 5F6AA 1STZA 5HDCA 4LRZE 4LRYC 3K2NA 5DKKA 5FL3A 1F9IA 3E0YA 2KOIA 4JGPA 2VJWA 3CUEC 1F5MA 2V9AA 3CUEA 2J3TD 1NWZA 3KYZA 1TF1A 4WLAA 3PXPA 5DJUA 2DMWA 2JKRM 4FOFA 2OAQ1 3NJAA 3EQVA 4BBUA 2L4RA 1DRMA 1T18A 4DN0A 5IT5A 2M1CA 2R78A 3E4OA 4R38A 3C30A 1ZTUA 3CWFA 3HJIA 1D7EA 3S7PA 3MR0A 3MFXA 2O0YA 1NRJA 1XJ3A 2GJ3A 3EGDC 4ARZB 3T4KA 3P7NA 1H8MA 4PHTA 1KOUA 4I5SA 3H82A 2VV7A 3T4JA 1W63M 2PYPA 3FC7A 2OAP1 3PBRA 1MKMA 5J7EA 2NUTC 3B42A 4KQDA 1VHMA 4EESA 1T1BA 1OT9A 3CAXA 3KO6A 3LR3A 2PD8A 2P7JA 3CI6A 1DP6A 3LI9A 4H6JB 3NOTC 4EW7A 5MC7A 4R3AA 3PBOA 4KUOA 4R6LA 1NLZA 3T4OA 2PD7A 3IS2A 2WKRA 3RTYA 3S7OA 4MDZA 1P0ZA 4HH2A 5HWTA 2PHYA 3RFBA 4CLCC 1EW0A 4CLCA 1G6OA 4GW9A 2H28A 4LLOB 4OOLA 4F3LB 3E4PA 5TBMA 2ZBBA 3CITA 3MJQA 1N9NA 4IHQA 4HQAA 4G3VA 3K3CA 1XJ2A 2W1RA 3LIFA 2W1TB 4MCWA 2Y79A 2J3TC 4UEYA 2QJ5A 3H7WB 2VZWA 4MN6A 4WELA 2L0WA 2EWWA 2FH5A 2OWJA 1LT0A 3KYQA 4DJ2A 2WKQA 4FSFA 3PBQA 4GHIB 5HZHA 1S4RA 3JVUA 2PT7A 2P08A 2PR5A 3NOUC 1OTBA 1YKDA 3JVVA 2ZOHA 4KUKA 3GDIA 1UWPX 3A0VA 4CQHA 2Z6CA 2V1AA 5HWVA 2V0UA 3UB9A 4Y5FA 3KSIA 3F1OB 2HJEA 2O9AA 4HIAA 2LB9A 4HNBA 5HD3A 2VLGA 4JGRA 3OCNA 4YNRA 2QWSA 3HCYA 3HJKA 4G3WA 1N9LA 2K7SA 2JN7A 3PR6A 1N9OA 1GSXA 4PKYA 1BYWA 4MMNA 2K31A 5LBRA 5AVFA 4EU0A 1T19A 3R7WB 3F1PB 3UE3A 3F1NA 4IUHA 4BJPA 2A24A 2W3HA 3T4SA 4HOIA 4YOFA 3LIEA 2A2LA 3EOIA 3LIAA 3PHYA 4EUVA 3BY9A 2QJ7A 2KX6A 4L9FA 4P6ZM 3MMHA 1OTAA 1XFQA 4EEUA 4NXEA 2VGLM 1P9RA 2J80A 4HJ4A 4QPRA 3UMEA 4UQIS 4EERA 4XT2B 1LSWA 5EFWA 1W63Q 1V9YA 2OOLA 4PAUA 5DFXA 4L9EA 2PYRA 1G28A 4GS9B 2XA7S 4BWIA 2D02A 4WEJA 3H9WA 3PYPA 1YSQA 4E04A 4BBTA 3ZYTA 1T1AA 5F69A 4WUJA 2IA2A 1GSVA 3FPVA 4YWZA 3E4QA 2W3EA 1OTEA 3A0RA 3IBJA 4WEKA 4L9GA 2GX5A 3T4LA 1MZUA 4GLQA 4EEPA 2ZMFA 5J4EA 3IBRA 4HJ6A 5F5YA 4AFIA 2VA0A 1LSVA 5KSHA 1DP8A 2P04A 1XJ6A 4I3AA 1YSPA 4EETB 3O5YA 3VE4A 1T1CA 3B33A 1TS0A 1OPXA 4HP4A 1TS6A 2K2NA 2EWVA 2ZMVA 3OLOA 4IJGA 4O01A 3PBSA 3P01A 2B02A 5F68A 3LUQA 4NEED 1NLYA 3UB7A 2BASA 3EQUA 3T50A 4ARZA 3LR4A 2QYBA 1XFNA 5IS1A 5AVEA 1GSWA 5KIZA 3OC2A 4EQ1A 2HF6A 3B47A 2KLIA 2ZOIA 3S7NA 5G4YA 4DJ3A 1UGUA 2V1BA 2L1MA 3C8CA 4GCZA 5DKLA 5G4ZA 1V9ZA 3DBAA 3KX0X 3KSFA 4KQOA 5DJTA 5C5KA 2OWHA 1IFQA 4H6JA 2JHEA 2WKPA 1WA9A 3UB6A 2VV8A 3KSGA 2Z6DA 1OTDA 1TD5A 1S66L 5HL6A 2G7UA 4WF0A 4HP9A 4ETXA 2W3DA 2HV1A 5CX7A 4F3LA 3VE3A 4O8GA 3EEAA 2YKHA 3LFVA 3TJZC 5DFYA 3MF0A 5A8BA 3LYXA 2FZ0A 2W1TA 3TW8A 1YAXA 2KDKA 3MXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W A;  3ULF A;  1S67 L;  4LPZ A;  1JNU A;  4EXO A;  3RH8 B;  3ZQ5 A;  1S1Y A;  3ICY A;  1TS7 A;  4RQ9 A;  1OTI A;  2INW A;  4GHI A;  3G6O A;  3H82 B;  4WL9 A;  3A0S A;  5HD5 A;  2VEA A;  2W27 A;  1LL8 A;  3LIB A;  4NXB A;  3F1O A;  2YKF A;  4BBV A;  3CLO A;  1UWN X;  5J3W A;  4B9O A;  2QHK A;  3IS2 B;  3MQO A;  2CMN A;  1TS8 A;  1OJ5 A;  4HI4 A;  5TBM B;  3F1P A;  3BWL A;  3NHQ A;  4I39 A;  1OJG A;  4I3J A;  4R70 A;  4NXG A;  4M4X A;  4HHD A;  4PKY G;  3UE6 A;  4JGO A;  4I38 A;  2W0N A;  1S4S A;  1P97 A;  2I9V A;  2EA9 A;  2QKP A;  4HH3 A;  4HY8 A;  4K08 A;  2V0W A;  3BY8 A;  3UB8 A;  5HWW A;  1F98 A;  4WN5 A;  4XT2 A;  3D72 A;  3EEH A;  2D01 A;  4JGQ A;  3LI8 A;  4GS9 A;  3LIC A;  3MQQ A;  3VOL A;  2VV6 A;  1XJ4 A;  4LRX C;  5I5L A;  1Y28 A;  3K3D A;  3F1N B;  3NOP C;  1ODV A;  2A24 B;  2PDR A;  4HJ3 A;  1X0O A;  1LSX A;  2PR6 A;  3GEC A;  1VB6 A;  3LID A;  1OT6 A;  1D06 A;  3FG8 A;  5HDD A;  3SW1 A;  5IU1 A;  4I3I A;  4MN5 A;  1S1Z A;  5HSQ A;  3C2W A;  3UMD A;  1DP9 A;  5HDS A;  4NXF A;  3EWK A;  5F6A A;  5HDC A;  4LRZ E;  4LRY C;  5DKK A;  1F9I A;  4JGP A;  2V9A A;  1NWZ A;  4WLA A;  5DJU A;  3NJA A;  4BBU A;  2L4R A;  1DRM A;  1T18 A;  2M1C A;  2R78 A;  3E4O A;  4R38 A;  3CWF A;  3HJI A;  1D7E A;  3MR0 A;  3MFX A;  1XJ3 A;  2GJ3 A;  3P7N A;  1KOU A;  4I5S A;  3H82 A;  2VV7 A;  2PYP A;  3FC7 A;  5J7E A;  4KQD A;  4EES A;  1T1B A;  1OT9 A;  3CAX A;  2PD8 A;  2P7J A;  1DP6 A;  4H6J B;  3LI9 A;  3NOT C;  4EW7 A;  4R3A A;  4KUO A;  4R6L A;  2PD7 A;  3IS2 A;  2WKR A;  3RTY A;  1P0Z A;  4HH2 A;  5HWT A;  2PHY A;  1EW0 A;  4GW9 A;  2H28 A;  4LLO B;  4F3L B;  3E4P A;  5TBM A;  2ZBB A;  3MJQ A;  1N9N A;  4HQA A;  3K3C A;  1XJ2 A;  3LIF A;  2QJ5 A;  3H7W B;  4MN6 A;  2L0W A;  2OWJ A;  1LT0 A;  4DJ2 A;  2WKQ A;  4GHI B;  5HZH A;  1S4R A;  2PR5 A;  3NOU C;  1OTB A;  2ZOH A;  4KUK A;  3GDI A;  1UWP X;  3A0V A;  2Z6C A;  2V1A A;  5HWV A;  2V0U A;  3UB9 A;  3F1O B;  4HIA A;  4HNB A;  5HD3 A;  2VLG A;  4JGR A;  2QWS A;  3HJK A;  1N9L A;  2K7S A;  2JN7 A;  1N9O A;  1GSX A;  4PKY A;  1BYW A;  5AVF A;  1T19 A;  3F1P B;  3F1N A;  2A24 A;  4HOI A;  3LIE A;  3PHY A;  3LIA A;  3BY9 A;  2QJ7 A;  2KX6 A;  4L9F A;  1OTA A;  1XFQ A;  4EEU A;  4NXE A;  2J80 A;  4HJ4 A;  3UME A;  4EER A;  4XT2 B;  1LSW A;  5EFW A;  1V9Y A;  2OOL A;  4L9E A;  2PYR A;  1G28 A;  4GS9 B;  2D02 A;  3H9W A;  3PYP A;  4E04 A;  4BBT A;  1T1A A;  5F69 A;  4WUJ A;  1GSV A;  4YWZ A;  3E4Q A;  1OTE A;  3A0R A;  4L9G A;  1MZU A;  4EEP A;  5J4E A;  3IBR A;  4HJ6 A;  5F5Y A;  1LSV A;  1DP8 A;  1XJ6 A;  4I3A A;  4EET B;  3VE4 A;  1T1C A;  3B33 A;  1TS0 A;  4HP4 A;  1TS6 A;  3OLO A;  2B02 A;  5F68 A;  3LUQ A;  3UB7 A;  2BAS A;  3T50 A;  1XFN A;  5IS1 A;  5AVE A;  1GSW A;  5KIZ A;  4EQ1 A;  2ZOI A;  5G4Y A;  4DJ3 A;  1UGU A;  2V1B A;  2L1M A;  3C8C A;  4GCZ A;  5DKL A;  5G4Z A;  1V9Z A;  3KX0 X;  5DJT A;  2OWH A;  4H6J A;  2JHE A;  2WKP A;  1WA9 A;  3UB6 A;  2VV8 A;  2Z6D A;  1OTD A;  1S66 L;  4WF0 A;  4HP9 A;  2HV1 A;  4F3L A;  3VE3 A;  2YKH A;  5A8B A;  3LYX A;  2KDK A;  3MXQ A; 
#chains in the Genus database with same CATH topology
 4GD8 A;  3P98 A;  3OPH A;  1MWT A;  2WZZ A;  4II7 A;  3ICY A;  4DMZ A;  3G6O A;  1DJA A;  2PU2 A;  1XPB A;  3LEQ A;  4G3K A;  5HAP A;  3OCL A;  3MS6 A;  4BBV A;  1I5Q A;  4OOM A;  2Y59 A;  2QHK A;  3IS2 B;  4IUK A;  4FH2 A;  3T1R A;  4A5R A;  4GD6 A;  2O99 A;  4CLC B;  5CTN A;  4X25 A;  2ZM8 A;  3TSG A;  1Q2P A;  4OQG A;  2BTF P;  2WKH A;  4Y2F A;  4I3J A;  3SS4 A;  4R70 A;  4HHD A;  1TEM A;  3LEZ A;  4I38 A;  5E2E A;  3MQ0 A;  4KZ9 A;  3GV9 A;  2VX8 A;  1ALQ A;  2QZ6 A;  1WYB A;  4L0L A;  3OPL A;  1RCJ A;  4ETZ A;  4EBL A;  5HL1 A;  2HGV A;  3QP6 A;  3HL9 A;  5M18 A;  1EI5 A;  1PW1 A;  4QU3 A;  4Q0I A;  3MZD A;  4NG2 A;  3D72 A;  4BMW A;  3GRJ A;  1FIK A;  5E2G A;  3UNW A;  4K0X A;  2EXB A;  1DY6 A;  2WGI A;  4KZA A;  4WBG A;  3VOL A;  2ZQA A;  1PFL A;  1E25 A;  4DXB A;  2C5W B;  4LRX C;  4MBF A;  5I5L A;  2VKS A;  1Y28 A;  1XA1 A;  2XDM A;  2OLV A;  3VP1 A;  1CEG A;  4C3Q A;  1MXO A;  1LI9 A;  2HDS A;  2NUP C;  3D3O A;  4GOG A;  2PR6 A;  3GEC A;  1KGF A;  1VB6 A;  4S2N A;  3O3V A;  4B4Z A;  4PMA A;  3S1Y A;  3T4Q A;  3SW1 A;  4GNU A;  5HSQ A;  3IX8 A;  3UMD A;  1DP9 A;  2GZA A;  1K54 C;  4X6T A;  1K54 A;  3U2A A;  3AGD A;  5L10 A;  4N1H A;  2HDU A;  3HVF A;  2ZC6 B;  1BSG A;  4HBU A;  3EWK A;  3C7V A;  1E3U A;  4LRY C;  5FQI A;  2EX6 A;  5DKK A;  1F9I A;  2WKE A;  2VJW A;  1F5M A;  1WE4 A;  2V9A A;  3IX4 A;  2J3T D;  3BEB A;  3QP1 A;  1TF1 A;  5CED A;  5HAI A;  1KGG A;  5DJU A;  5E2H A;  3EQV A;  2L4R A;  1RGY A;  5IT5 A;  4S2P A;  3HLG A;  4OQH A;  3E4O A;  4D2O A;  3C30 A;  1CI9 A;  4JF5 A;  4KZ6 A;  4N9L A;  2Y55 A;  3IXH A;  3IQA A;  3N8S A;  2H10 A;  3HJI A;  5J8X A;  3MR0 A;  5FAQ A;  4E6X A;  4ZJ3 A;  5FAT A;  1KOU A;  4I5S A;  2Y2G A;  2OAP 1;  1MKM A;  4RA7 A;  5DF8 A;  1K57 A;  3DTE A;  2NUT C;  3C4O A;  1VHM A;  1HLU P;  4EES A;  4GDB A;  4X69 A;  1OT9 A;  4ESP A;  5L09 A;  5CRF A;  4KZ4 A;  3HLD A;  3PBO A;  1KDS A;  1SKF A;  1BTL A;  3IWO A;  2WKR A;  4JXV A;  5EM0 A;  3S7O A;  1U60 A;  5HWT A;  2R9X A;  1EW0 A;  4GW9 A;  3FYZ A;  4S2I A;  1N9N A;  4B4X A;  1K0K A;  4ZJ2 A;  3S22 A;  1JVJ A;  4N9K A;  3A3E A;  4MN6 A;  4WEL A;  3KYQ A;  2WKQ A;  3PBQ A;  1RP5 A;  5HZH A;  1S4R A;  2P08 A;  2PR5 A;  1OTB A;  1YKD A;  2EXA A;  3RJU A;  1S0W A;  1Q2Q A;  3GDI A;  4NET A;  5AQ9 A;  3V39 A;  1OME A;  2FFY A;  3CMZ A;  3F1O B;  1KGE A;  5HD3 A;  1FR6 A;  3HCY A;  3HJK A;  1JWV A;  4G3W A;  3VP3 A;  2JN7 A;  3PR6 A;  3HRE A;  3VMA A;  4PKY A;  4MMN A;  2XGN A;  2K31 A;  5AVF A;  1YLZ A;  2Y91 A;  4X1L A;  1ZC2 A;  2Y2L A;  3UE0 A;  4HOI A;  3N8R A;  4YOF A;  5FAS A;  1MBL A;  2A2L A;  3EOI A;  2Z2L B;  2KX6 A;  3A3F A;  2Y2I A;  2VGL M;  1GCE A;  4E3N A;  1BLP A;  1V9Y A;  2XK1 A;  2PYR A;  1YT4 A;  1G28 A;  3DAV A;  1YSQ A;  2H5S A;  3Q7V B;  2VK3 A;  3ZYT A;  5F69 A;  1Y54 A;  1YPR A;  2IA2 A;  1IYS A;  4YWZ A;  2XD5 A;  1SKO B;  2W3E A;  3IBJ A;  2GX5 A;  2ZMF A;  3IBR A;  1H8Z A;  4AFI A;  3SS5 A;  2P04 A;  4I3A A;  4P6B A;  2E8I A;  3ZG5 A;  3L9K A;  3MXS A;  3DTK A;  3B33 A;  2UWX A;  2P9V B;  2K2N A;  2ZMV A;  1VEU B;  3BEC A;  5GLD A;  3LUQ A;  1JWP A;  1ACF A;  1NLY A;  1VM1 A;  2HDR A;  3MFD A;  3LR4 A;  2IWD A;  3PAE A;  2HP6 A;  4X55 A;  1FQG A;  4S2K A;  2ZMA A;  2ZOI A;  3E2K A;  1CQA A;  1UGU A;  4EWF A;  2Y4A A;  3IXD A;  2XD1 A;  4GCZ A;  2H0T A;  1LLB A;  4KQO A;  1YQS A;  1NJ4 A;  1YLT A;  5FEG A;  3C4P A;  2WKP A;  3ISG A;  3KSG A;  3BLS A;  4HEF A;  2VGJ A;  1S66 L;  3FKV A;  2HP9 A;  4ETX A;  4WZ5 C;  4WZ5 A;  2W3D A;  5CX7 A;  2BLS A;  4E3I A;  4O8G A;  5AQA A;  5DFY A;  5CTM A;  3UB5 P;  3MF0 A;  3V5M A;  1BZA A;  2JKF A;  2KDK A;  4EQ1 A;  4LPZ A;  4EQI A;  4EXO A;  1S1Y A;  3W4O A;  4GHI A;  4X53 A;  3H82 B;  4BL3 A;  3WS0 A;  3DWZ A;  2VEA A;  1G5U A;  3DTM A;  4ZAM A;  1LL8 A;  4R4R A;  2O9C A;  1UWN X;  2OV5 A;  1SDN A;  4K91 A;  4OP8 A;  1MC0 A;  4E3J A;  2CMN A;  1VET A;  4BEN A;  5EE8 A;  1O07 A;  1TS8 A;  3BQ8 A;  1OJ5 A;  1YMS A;  4HI4 A;  3R7W A;  4CPK A;  3BQA A;  3HUN A;  1ES3 A;  3T1X A;  4NXG A;  1HZO A;  3PTE A;  4JGO A;  4P87 A;  4DE2 A;  5FDH A;  4NKP A;  2E8J A;  1PRQ A;  3LR0 A;  4JF4 A;  1P97 A;  1H8Y A;  4QWO A;  2QKP A;  5AJG A;  4HY8 A;  3BY8 A;  4KG6 A;  3C38 A;  2PU4 A;  2DRW A;  1ZG6 A;  4E3M A;  2LB5 A;  3PBN A;  2VGL S;  1MY8 A;  2D01 A;  3LI8 A;  4GS9 A;  3IT9 A;  3FZC A;  2RL3 A;  2ZQC A;  5F82 A;  5HPI A;  3N7W A;  3FWL A;  5E43 A;  2VV6 A;  1XJ4 A;  1IOU A;  3T4T A;  2M7V A;  5HFO A;  4UA6 A;  3LR5 A;  3K3D A;  3QP5 A;  3GMW A;  3Q7Z A;  2XQZ A;  3NOP C;  2RCX A;  4C6Y A;  4JXS A;  2PDR A;  4OPR A;  4IVK A;  2XRO A;  2GNX A;  4Q0H A;  1K56 A;  1LSX A;  4KZ3 A;  3LID A;  2G2W A;  1OT6 A;  1D06 A;  3S7Q A;  4FTX A;  3HLW A;  4DRT A;  2PBY A;  5IU1 A;  4KZ8 A;  4I3I A;  1KVL A;  4MN5 A;  5F1F A;  4BD1 A;  2W3F A;  3C2W A;  4KG2 A;  3TE8 A;  2WGW B;  3FPW A;  3JPU A;  3T12 B;  1BUE A;  3GSG A;  1K6R A;  5F6A A;  4F94 A;  1I2S A;  2EX8 A;  3PAG A;  4PM9 A;  2ZL1 B;  1MPL A;  3E0Y A;  2EX2 A;  2JKG A;  2PRF A;  2DMW A;  2DNS A;  1T18 A;  2H0Y A;  4YIN A;  3G35 A;  3UE1 A;  2WUQ A;  4R38 A;  3IHB A;  3NIA A;  5HAQ A;  3CWF A;  4QB8 A;  3S7P A;  1XJ3 A;  2GJ3 A;  3EGD C;  4ARZ B;  1ONG A;  1H8M A;  4PHT A;  4DF6 A;  1W63 M;  1MWR A;  2PYP A;  1ES2 A;  3UY6 A;  3PBR A;  4FD8 A;  4PM6 A;  4WZ4 A;  3CAX A;  4MEZ A;  4LV0 A;  2PD8 A;  2P7J A;  3CI6 A;  3OZH A;  1DP6 A;  3NOT C;  4EW7 A;  5JYP A;  4KUO A;  1NLZ A;  2WAF A;  3RTY A;  3NBL A;  3JYI A;  3RFB A;  1PNE A;  4DE1 A;  1G6O A;  3IH9 A;  4OOL A;  4F3L B;  3E4P A;  5TBM A;  3CIT A;  4HQA A;  3IF6 B;  1F2K A;  1XJ2 A;  1FCN A;  2X02 A;  3G4P A;  4MCW A;  3SOI A;  1K38 A;  2L0W A;  1C3B A;  3S4X A;  4DJ2 A;  4R0Q A;  4S2N C;  1L0G A;  3JVU A;  3NOU C;  5DVA A;  4WMC A;  2Q0O A;  3HLB A;  5FAO A;  5CGS A;  3BFC A;  3UN7 A;  2OSU A;  5HWV A;  1PI4 A;  3IWI A;  3A3D A;  4Y0U A;  4HIA A;  2LB9 A;  3QP8 A;  4D60 A;  2VLG A;  4JGR A;  3OCN A;  4YNR A;  3C5A A;  3P09 A;  3FV7 A;  5FQ9 A;  2J9O A;  1XXM A;  1I2W A;  2BG1 A;  1FCM A;  3DWK A;  4JKT A;  5LBR A;  5CEC A;  4Z9Q A;  1T19 A;  3UE3 A;  3F1N A;  4IUH A;  2Y2Q A;  2A24 A;  2W3H A;  5G18 A;  1PWG A;  1GHI A;  1DJB A;  4L9F A;  4P6Z M;  1OTA A;  1SHV A;  2JC7 A;  2ZM2 A;  1IYQ A;  4EBN A;  1L0F A;  2Y2N A;  1W63 Q;  2OOL A;  4PAU A;  4C75 A;  1S6R A;  4L9E A;  4BWI A;  4R3J A;  3H9W A;  1PZP A;  3ITA A;  4E04 A;  1T1A A;  3NCK A;  1K57 C;  5FI2 A;  3FPV A;  5CHM A;  3E4Q A;  2CC1 A;  1OTE A;  3A0R A;  2V20 A;  4Y17 A;  1PI5 A;  4UA7 A;  4HJ6 A;  5KSH A;  3IF5 A;  2VA0 A;  2EX9 A;  1G6A A;  3U4L P;  4U3T A;  3VP0 A;  2G2U A;  4EET B;  3O5Y A;  1VQQ A;  4OVD A;  1T1C A;  1TS0 A;  4UHU A;  1TS6 A;  5BOH A;  5EOO A;  5FSR A;  1JTG A;  3WWX A;  1XFN A;  5IS1 A;  3SZT A;  1ES4 A;  2JE5 A;  3VOZ A;  1H5X A;  3OC2 A;  1QME A;  3NI9 A;  3UDX A;  3FKW A;  1IKG A;  1YMX A;  4N92 A;  3LCE A;  5EVL A;  4OON A;  2L1M A;  3DBA A;  1GA9 A;  2OWH A;  1LL5 A;  2ZD8 A;  4FUW A;  4PPR A;  4H6J A;  3A3I A;  1WA9 A;  3UB6 A;  2Z6D A;  4JXW A;  1AXB A;  4JLF A;  1OTD A;  2EFX A;  3AGE A;  1TD5 A;  5HW3 A;  4MBK A;  3ZHH A;  2I72 A;  3UDI A;  1CI8 A;  3V50 A;  3WS5 A;  3ZG9 B;  2AVX A;  2HV1 A;  4JPM A;  1BLS A;  3EEA A;  2YKH A;  2Q9N A;  2JBF A;  5EVI C;  5EVI A;  4LCM A;  3O88 A;  3CJM A;  5A8B A;  3ZG7 B;  2W1T A;  3TW8 A;  3MXQ A;  3H7W A;  3CPT A;  1S67 L;  5FQM A;  3ZCZ A;  1JNU A;  3ZQ5 A;  1ZHH B;  1OTI A;  4O0P A;  3SH7 A;  1L3L A;  1FOF A;  4WL9 A;  3A0S A;  4ZRR A;  2PBD P;  3LIB A;  3M6B A;  4NXB A;  1TVF A;  4GJ4 A;  2IWC A;  3OBF A;  3CLO A;  5TFQ A;  5K5B A;  3KSH A;  1BLH A;  5J3W A;  4E3K A;  1ERM A;  5FQJ A;  3WRZ A;  1CJF A;  3MQO A;  5FI7 A;  4BL2 A;  1HVB A;  3F1P A;  2M7U A;  2JKT M;  3BWL A;  4I39 A;  4B88 A;  1OJG A;  3ZVW A;  4M4X A;  4EV4 A;  4PKY G;  4IVI A;  5EM1 A;  3GR2 A;  2W0N A;  1S4S A;  4B93 A;  2J3W A;  3V67 A;  2I9V A;  1H3Q A;  1K6S A;  4M3K A;  4K0W A;  1E3U D;  3MZE A;  5I94 A;  1A0K A;  3UB8 A;  4P6Z S;  1F98 A;  5GLC A;  2Y8H A;  4XT2 A;  5TJJ A;  1GHP A;  5EV0 A;  5TGF A;  2A3U A;  4IED A;  5A91 A;  1BT5 A;  3N8L A;  3IXB A;  3QNB A;  4MN7 A;  1W5D A;  4RYE A;  1O7E A;  5L8M A;  4ME4 A;  2WK0 A;  3ZG8 B;  1P9W A;  3M2K A;  3G2Y A;  1ODV A;  3RXW A;  4KZ5 A;  3VSL A;  2WZX A;  4QJG A;  2B5R A;  3G30 A;  1ZKJ A;  4LGW A;  4UQI M;  3FG8 A;  5HDD A;  4IBR A;  3OOV A;  1HTZ A;  4FH4 A;  5E2F A;  4CLC E;  4RVA A;  1KE3 A;  2VGK A;  4LEN A;  2XA7 M;  3ZNY A;  5HX9 A;  2Y2K A;  3O87 A;  4Q0J A;  5CHJ A;  5CHU A;  5DF9 A;  3VV4 A;  3PBT A;  4KZB A;  1FSY A;  1ERQ A;  5HDS A;  2V8C A;  1FIL A;  4NXF A;  5GHZ A;  1CF0 A;  5FAP A;  3K2N A;  5FL3 A;  1D1J A;  2B95 A;  3NDE A;  2HPB A;  2KOI A;  4JGP A;  1KDW A;  2WAE A;  4S2O A;  1NWZ A;  3CZD A;  4WLA A;  5F83 A;  2JKR M;  2OAQ 1;  2J9P A;  5FDS A;  2OLU A;  2XFS A;  1DRM A;  2QMI A;  4O7D A;  2M1C A;  4E3L A;  5EVE A;  5A93 A;  2ZJ9 A;  3CHW P;  3E2L A;  1D7E A;  4BLM A;  3MFX A;  4X68 A;  2WGV A;  3Q1F A;  1SDE A;  3P7N A;  1AWI A;  4XXR A;  3W8K A;  4Y0T A;  4WYY A;  5L07 A;  3MKE A;  1K4F A;  2VV7 A;  4XUZ A;  3WS2 A;  3FC7 A;  4NK3 A;  5J7E A;  4XUX A;  1IEM A;  1NYY A;  1N9B A;  5KZH A;  4JXG A;  4R6L A;  3MKF A;  1L2S A;  3IS2 A;  2PHY A;  4CLC C;  4CLC A;  2H28 A;  4KG5 A;  3CG5 A;  3MJQ A;  4G3V A;  3K3C A;  2XH9 A;  5DTS A;  4GKU A;  3LIF A;  3SS3 A;  2Y2O A;  3VFH A;  4Q8I A;  2J3T C;  4UEY A;  3IHA A;  2JCH A;  2OWJ A;  5L2F A;  1TDG A;  1LT0 A;  4OKP A;  4LFU A;  2Y2J A;  4GHI B;  2PT7 A;  2UV0 E;  3JVV A;  2ZOH A;  4GN2 A;  4KUK A;  1L0D A;  1UWP X;  3C7U A;  4Y5F A;  3KSI A;  2HJE A;  2O9A A;  4HNB A;  3IXG A;  1PWC A;  2P74 A;  1GA0 A;  1XGJ A;  4P85 A;  1IYP A;  3NDG A;  2K7S A;  3MXR A;  1GSX A;  1VET B;  4MBH A;  4R4S A;  3IF6 A;  4FCF A;  5FQQ A;  3R7W B;  3UO9 A;  5CGW A;  3MBZ A;  1LHY A;  2DCF A;  1EWZ A;  1Z6F A;  4UAA A;  4U0T A;  1NY0 A;  3LIE A;  4QHC A;  2A49 A;  2J8Y A;  3LIA A;  2ZC3 B;  5CER A;  2XLN A;  2XF3 A;  4GZB A;  4Y15 A;  4NXE A;  1RGZ A;  3D4F A;  3QNC A;  3HUO A;  1K55 C;  4UQI S;  4Y7P A;  3UME A;  1K55 A;  5EFW A;  1NYM A;  5DFX A;  4GS9 B;  2XA7 S;  2D02 A;  4WEJ A;  2Y2M A;  4S2L A;  4BBT A;  4HES A;  3NUL A;  4OH0 A;  1J9M A;  1GSV A;  5DF7 A;  1YLJ A;  4WEK A;  1MZU A;  4GLQ A;  3G34 A;  5J4E A;  1Z09 A;  4DXC A;  4R1G A;  2FFF B;  1LSV A;  1DP8 A;  1XJ6 A;  2ZM0 A;  1XX2 A;  4HP4 A;  3T1S A;  2EWV A;  1PWD A;  3SH8 A;  4O01 A;  3LY3 A;  3PBS A;  3SH9 A;  2B02 A;  5F68 A;  3AGF A;  5JYO A;  2WKI A;  4ZDX A;  4DE0 A;  3GVB A;  2BAS A;  3T50 A;  2QYB A;  3HLC A;  1GSW A;  5KIZ A;  4QY5 A;  5EEC A;  3HLE A;  3S7N A;  5G4Y A;  5AQB A;  3ZDJ A;  5DKL A;  1MWS A;  1DJC A;  1ZG4 A;  1V9Z A;  5DJT A;  5C5K A;  4WM9 A;  3UPO A;  4KZ7 A;  5AQ7 A;  2Q9M A;  2JHE A;  3QP2 A;  3BFG A;  2IWB A;  3DTI A;  3VP2 A;  2VV8 A;  5TR7 A;  4N1X A;  2G7U A;  4WF0 A;  4OPY A;  4X1M A;  2Z2M B;  3W4P A;  4E6W A;  4PM5 A;  4QY6 A;  3IX3 A;  3TJZ C;  4OQI A;  3UPP A;  1YAX A;  2XFT A;  3ULF A;  4GDN A;  2JKT I;  4Y3I A;  3RH8 B;  3WRT A;  2B18 A;  4DDS A;  1TS7 A;  4RQ9 A;  1JWZ A;  2INW A;  4LV2 A;  1YLP A;  4CLC D;  1CEF A;  2HZ5 A;  3LO7 A;  5HD5 A;  4CJN A;  5U47 A;  2GDN A;  5FA7 A;  2HJ9 C;  1BUL A;  2W27 A;  2O9B A;  2MJ6 A;  3F1O A;  2YKF A;  4HBT A;  4OQ0 A;  4B9O A;  1K56 D;  2Y2H A;  3TOI A;  4GB7 A;  1PW8 A;  2XRN A;  2XR0 A;  5TBM B;  4UA9 A;  4MLL A;  4RX3 A;  3NHQ A;  1NZO A;  5KMW A;  3UE6 A;  1IEL A;  5GLA A;  2PAV P;  3N6I A;  4LV1 A;  3BRM A;  1YM1 A;  4PM7 A;  5M1A A;  3WS4 A;  1LI0 A;  4ZBE A;  3UDF A;  2EA9 A;  1TDL A;  4HH3 A;  1H0M A;  4K08 A;  2V0W A;  1PYY A;  2WYX A;  2HDQ A;  3QHY A;  5HWW A;  1ONH A;  2HP5 A;  4WN5 A;  5KSC A;  2W3G A;  3EGX C;  3EEH A;  4PM8 A;  2X71 A;  1LL9 A;  3I7J A;  2XSS A;  2ZC4 B;  4JGQ A;  3OPR A;  5EUA A;  1ES5 A;  5CGX A;  1FCO A;  3Q7V A;  2V8F A;  1YLY A;  1ESI A;  4DDY A;  3M2J A;  3LIC A;  3TRC A;  4LV3 A;  3MQQ A;  5EPH A;  2J7V A;  4S2J A;  3ZVT A;  1SKO A;  3F1N B;  3Q81 A;  3BLM A;  3VFF A;  2A24 B;  4OLG A;  3GTC A;  3A3J A;  5HPF A;  5DTK A;  4HJ3 A;  3E98 A;  1X0O A;  3N4I A;  5HAR A;  3V3R A;  3V3S A;  1MWU A;  3W2Z A;  1M6K A;  2P9V A;  2JKR I;  1K4E A;  1VEU A;  3LGO A;  2ACG A;  4Z1W A;  4BQM A;  5FI6 A;  1S1Z A;  3BJN A;  1NXY A;  4EBP A;  4DKI A;  1XGI A;  1L0E A;  3BW6 A;  1IKI A;  3R4K A;  1KVM A;  3Q07 A;  4DE3 A;  4KQQ A;  1STZ A;  5HDC A;  3TG9 A;  4LRZ E;  1GHM A;  3ZFZ A;  3NY4 A;  2WAD A;  1W8Y A;  1NRF A;  3CUE C;  3CUE A;  1ERO A;  4R23 A;  3KYZ A;  3PXP A;  4FOF A;  1Y4O A;  4JBF A;  3NJA A;  4BBU A;  2ZC5 B;  3MSH A;  1PIO A;  4DN0 A;  5EOE A;  5DTT A;  2R78 A;  1W8Q A;  4WMC D;  5CXW A;  1N4O A;  1ZTU A;  1QMF A;  3ZGA B;  2O0Y A;  1NRJ A;  3HBR A;  3T4K A;  3H82 A;  3T4J A;  4Y0O A;  4P0M A;  1HD8 A;  1J3W A;  3B42 A;  1WYC A;  4KQD A;  1T1B A;  3KO6 A;  3LR3 A;  2ZQD A;  3KYE A;  3LI9 A;  4H6J B;  5MC7 A;  4R3A A;  4KQR A;  4OPQ A;  2ZQ7 A;  3NEC A;  2XEP A;  2V1Z A;  3T4O A;  2PD7 A;  1IYO A;  3BFF A;  4ZTK A;  4MDZ A;  1P0Z A;  4HH2 A;  4LLO B;  3VP4 A;  3VOY A;  4IBX A;  3ZG0 A;  3WS1 A;  2ZBB A;  4IHQ A;  4S2M A;  5A92 A;  5EVI B;  5FEF A;  5A90 A;  2W1R A;  2W1T B;  1W7F A;  2Y79 A;  2QJ5 A;  3H7W B;  2VZW A;  3UPN A;  3CPT B;  2EWW A;  3T1Q B;  2FH5 A;  1XKZ A;  4FSF A;  1W79 A;  3G2Z A;  5F1G A;  2ZLY A;  5CEB A;  3A0V A;  4CQH A;  2Z6C A;  3Q82 A;  2V1A A;  2V0U A;  5GHX A;  3UB9 A;  2V2F F;  3DW0 A;  2ZQ8 A;  3NC8 A;  4E3O A;  2QWS A;  2Y2P A;  3W4Q A;  4RX2 A;  1N9L A;  4H8R A;  5D3O A;  1N9O A;  5FQK A;  1BYW A;  4EU0 A;  3F1P B;  3LY4 A;  4OPZ A;  3VSK A;  4BJP A;  1BLC A;  3T4S A;  5GL9 A;  1FSW A;  1YLW A;  3D9Y A;  3L7H A;  3PHY A;  4OOY A;  1G68 A;  4EUV A;  1XA7 A;  3BY9 A;  2QJ7 A;  3MZF A;  3BYD A;  3MMH A;  3BM6 A;  3IWQ A;  5GHY A;  1XFQ A;  4EEU A;  3O86 A;  1P9R A;  2J80 A;  3QP4 A;  1M40 A;  4HJ4 A;  4QPR A;  4MNR A;  4EER A;  4XT2 B;  1LSW A;  2WGW A;  2EFU A;  3PYP A;  1E4D A;  1KE4 A;  4WUJ A;  5EVI D;  2ZL1 A;  1XP4 A;  4R3B A;  4L9G A;  1FR1 A;  3T4L A;  4EEP A;  4ID4 A;  2ZC7 A;  3GQZ A;  5F5Y A;  4KEN B;  3RXX A;  2R9W A;  1YSP A;  3BFD A;  4U0X A;  3ZNT A;  3VE4 A;  2ZQ9 A;  5IHV A;  1NZU A;  1OPX A;  1PZO A;  3OLO A;  4IJG A;  3HUM A;  3P01 A;  3IH8 A;  4EUZ A;  4NEE D;  3G32 A;  3UB7 A;  4OLD A;  3HLF A;  3EQU A;  2C6W B;  4ARZ A;  5AVE A;  1MKI A;  4QD4 A;  1K25 A;  3BFE A;  1KE0 A;  2HF6 A;  3B47 A;  2KLI A;  4X56 A;  1SCW A;  4DJ3 A;  2X01 A;  2V1B A;  3C8C A;  5G4Z A;  3B3X A;  3KX0 X;  3KSF A;  1IFQ A;  4YFM A;  1JTD A;  3G31 A;  4JF6 A;  5HL6 A;  2QPN A;  4HP9 A;  4Y13 A;  1CK3 A;  1SZV A;  4OP5 A;  4F3L A;  3VE3 A;  3OPP A;  3LFV A;  5M19 A;  4LCL A;  4ZJ1 A;  3ITB A;  3IF6 C;  4BD0 A;  3M6H A;  3LYX A;  5GLB A;  2FZ0 A;  1ESU A; 
#chains in the Genus database with same CATH homology
 3H7W A;  3ULF A;  2JKT I;  4Y3I A;  1S67 L;  4LPZ A;  1JNU A;  4EXO A;  3RH8 B;  3ZQ5 A;  1S1Y A;  4II7 A;  3ICY A;  1ZHH B;  2B18 A;  1TS7 A;  4RQ9 A;  1OTI A;  4DMZ A;  2INW A;  4O0P A;  4GHI A;  4CLC D;  3G6O A;  3H82 B;  4WL9 A;  3A0S A;  4ZRR A;  5HD5 A;  2VEA A;  2HJ9 C;  4G3K A;  2W27 A;  1LL8 A;  3LIB A;  2O9B A;  2MJ6 A;  3F1O A;  4NXB A;  2YKF A;  3OCL A;  2O9C A;  4GJ4 A;  4BBV A;  3OBF A;  3CLO A;  5K5B A;  3KSH A;  1UWN X;  4OOM A;  5J3W A;  4B9O A;  1MC0 A;  2QHK A;  3IS2 B;  4IUK A;  3MQO A;  2CMN A;  2O99 A;  4CLC B;  1TS8 A;  2XRN A;  3BQ8 A;  1OJ5 A;  4HI4 A;  3R7W A;  5TBM B;  3F1P A;  4Y2F A;  2JKT M;  3BQA A;  3BWL A;  3NHQ A;  4I39 A;  2M7U A;  1OJG A;  4I3J A;  4R70 A;  4NXG A;  4M4X A;  4HHD A;  4PKY G;  3UE6 A;  4JGO A;  4I38 A;  3MQ0 A;  2VX8 A;  4NKP A;  2W0N A;  1S4S A;  4B93 A;  2J3W A;  3V67 A;  3LR0 A;  4L0L A;  1P97 A;  2I9V A;  2EA9 A;  1H3Q A;  4ETZ A;  2QKP A;  4HH3 A;  5AJG A;  4HY8 A;  4K08 A;  2V0W A;  2HGV A;  3BY8 A;  3C38 A;  3UB8 A;  4P6Z S;  5HWW A;  1F98 A;  2LB5 A;  2Y8H A;  4WN5 A;  4XT2 A;  5TJJ A;  2W3G A;  4Q0I A;  3EGX C;  3PBN A;  2VGL S;  3D72 A;  3EEH A;  2XSS A;  4BMW A;  2D01 A;  4JGQ A;  3LI8 A;  4GS9 A;  5HPI A;  3LIC A;  3TRC A;  3MQQ A;  3VOL A;  2VV6 A;  1XJ4 A;  1IOU A;  4MN7 A;  3T4T A;  2M7V A;  4LRX C;  5L8M A;  5I5L A;  2VKS A;  4ME4 A;  3LR5 A;  1Y28 A;  3K3D A;  3F1N B;  3NOP C;  1P9W A;  1ODV A;  2A24 B;  5HPF A;  2PDR A;  4HJ3 A;  2XRO A;  2GNX A;  2NUP C;  3D3O A;  3E98 A;  1X0O A;  4Q0H A;  1LSX A;  2PR6 A;  3GEC A;  3W2Z A;  1VB6 A;  3LID A;  1OT6 A;  2JKR I;  1D06 A;  3S7Q A;  4UQI M;  3FG8 A;  5HDD A;  3OOV A;  3T4Q A;  3SW1 A;  4Z1W A;  5IU1 A;  4CLC E;  4I3I A;  4MN5 A;  1S1Z A;  5HSQ A;  2XA7 M;  3BJN A;  2W3F A;  3C2W A;  1DP9 A;  3UMD A;  2GZA A;  3TE8 A;  3FPW A;  3U2A A;  4Q0J A;  5DF9 A;  3VV4 A;  3BW6 A;  3PBT A;  5HDS A;  4NXF A;  3EWK A;  3R4K A;  5F6A A;  1STZ A;  5HDC A;  4LRZ E;  4LRY C;  3K2N A;  5DKK A;  5FL3 A;  1F9I A;  3E0Y A;  2KOI A;  4JGP A;  2VJW A;  3CUE C;  1F5M A;  2V9A A;  3CUE A;  2J3T D;  1NWZ A;  3KYZ A;  1TF1 A;  4WLA A;  3PXP A;  5DJU A;  2DMW A;  2JKR M;  4FOF A;  2OAQ 1;  3NJA A;  3EQV A;  4BBU A;  2L4R A;  1DRM A;  1T18 A;  4DN0 A;  5IT5 A;  2M1C A;  2R78 A;  3E4O A;  4R38 A;  3C30 A;  1ZTU A;  3CWF A;  3HJI A;  1D7E A;  3S7P A;  3MR0 A;  3MFX A;  2O0Y A;  1NRJ A;  1XJ3 A;  2GJ3 A;  3EGD C;  4ARZ B;  3T4K A;  3P7N A;  1H8M A;  4PHT A;  1KOU A;  4I5S A;  3H82 A;  2VV7 A;  3T4J A;  1W63 M;  2PYP A;  3FC7 A;  2OAP 1;  3PBR A;  1MKM A;  5J7E A;  2NUT C;  3B42 A;  4KQD A;  1VHM A;  4EES A;  1T1B A;  1OT9 A;  3CAX A;  3KO6 A;  3LR3 A;  2PD8 A;  2P7J A;  3CI6 A;  1DP6 A;  3LI9 A;  4H6J B;  3NOT C;  4EW7 A;  5MC7 A;  4R3A A;  3PBO A;  4KUO A;  4R6L A;  1NLZ A;  3T4O A;  2PD7 A;  3IS2 A;  2WKR A;  3RTY A;  3S7O A;  4MDZ A;  1P0Z A;  4HH2 A;  5HWT A;  2PHY A;  3RFB A;  4CLC C;  1EW0 A;  4CLC A;  1G6O A;  4GW9 A;  2H28 A;  4LLO B;  4OOL A;  4F3L B;  3E4P A;  5TBM A;  2ZBB A;  3CIT A;  3MJQ A;  1N9N A;  4IHQ A;  4HQA A;  4G3V A;  3K3C A;  1XJ2 A;  2W1R A;  3LIF A;  2W1T B;  4MCW A;  2Y79 A;  2J3T C;  4UEY A;  2QJ5 A;  3H7W B;  2VZW A;  4MN6 A;  4WEL A;  2L0W A;  2EWW A;  2FH5 A;  2OWJ A;  1LT0 A;  3KYQ A;  4DJ2 A;  2WKQ A;  4FSF A;  3PBQ A;  4GHI B;  5HZH A;  1S4R A;  3JVU A;  2PT7 A;  2P08 A;  2PR5 A;  3NOU C;  1OTB A;  1YKD A;  3JVV A;  2ZOH A;  4KUK A;  3GDI A;  1UWP X;  3A0V A;  4CQH A;  2Z6C A;  2V1A A;  5HWV A;  2V0U A;  3UB9 A;  4Y5F A;  3KSI A;  3F1O B;  2HJE A;  2O9A A;  4HIA A;  2LB9 A;  4HNB A;  5HD3 A;  2VLG A;  4JGR A;  3OCN A;  4YNR A;  2QWS A;  3HCY A;  3HJK A;  4G3W A;  1N9L A;  2K7S A;  2JN7 A;  3PR6 A;  1N9O A;  1GSX A;  4PKY A;  1BYW A;  4MMN A;  2K31 A;  5LBR A;  5AVF A;  4EU0 A;  1T19 A;  3R7W B;  3F1P B;  3UE3 A;  3F1N A;  4IUH A;  4BJP A;  2A24 A;  2W3H A;  3T4S A;  4HOI A;  4YOF A;  3LIE A;  2A2L A;  3EOI A;  3LIA A;  3PHY A;  4EUV A;  3BY9 A;  2QJ7 A;  2KX6 A;  4L9F A;  4P6Z M;  3MMH A;  1OTA A;  1XFQ A;  4EEU A;  4NXE A;  2VGL M;  1P9R A;  2J80 A;  4HJ4 A;  4QPR A;  3UME A;  4UQI S;  4EER A;  4XT2 B;  1LSW A;  5EFW A;  1W63 Q;  1V9Y A;  2OOL A;  4PAU A;  5DFX A;  4L9E A;  2PYR A;  1G28 A;  4GS9 B;  2XA7 S;  4BWI A;  2D02 A;  4WEJ A;  3H9W A;  3PYP A;  1YSQ A;  4E04 A;  4BBT A;  3ZYT A;  1T1A A;  5F69 A;  4WUJ A;  2IA2 A;  1GSV A;  3FPV A;  4YWZ A;  3E4Q A;  2W3E A;  1OTE A;  3A0R A;  3IBJ A;  4WEK A;  4L9G A;  2GX5 A;  3T4L A;  1MZU A;  4GLQ A;  4EEP A;  2ZMF A;  5J4E A;  3IBR A;  4HJ6 A;  5F5Y A;  4AFI A;  2VA0 A;  1LSV A;  5KSH A;  1DP8 A;  2P04 A;  1XJ6 A;  4I3A A;  1YSP A;  4EET B;  3O5Y A;  3VE4 A;  1T1C A;  3B33 A;  1TS0 A;  1OPX A;  4HP4 A;  1TS6 A;  2K2N A;  2EWV A;  2ZMV A;  3OLO A;  4IJG A;  4O01 A;  3PBS A;  3P01 A;  2B02 A;  5F68 A;  3LUQ A;  4NEE D;  1NLY A;  3UB7 A;  2BAS A;  3EQU A;  3T50 A;  4ARZ A;  3LR4 A;  2QYB A;  1XFN A;  5IS1 A;  5AVE A;  1GSW A;  5KIZ A;  3OC2 A;  4EQ1 A;  2HF6 A;  3B47 A;  2KLI A;  2ZOI A;  3S7N A;  5G4Y A;  4DJ3 A;  1UGU A;  2V1B A;  2L1M A;  3C8C A;  4GCZ A;  5DKL A;  5G4Z A;  1V9Z A;  3DBA A;  3KX0 X;  3KSF A;  4KQO A;  5DJT A;  5C5K A;  2OWH A;  1IFQ A;  4H6J A;  2JHE A;  2WKP A;  1WA9 A;  3UB6 A;  2VV8 A;  3KSG A;  2Z6D A;  1OTD A;  1TD5 A;  1S66 L;  5HL6 A;  2G7U A;  4WF0 A;  4HP9 A;  4ETX A;  2W3D A;  2HV1 A;  5CX7 A;  4F3L A;  3VE3 A;  4O8G A;  3EEA A;  2YKH A;  3LFV A;  3TJZ C;  5DFY A;  3MF0 A;  5A8B A;  3LYX A;  2FZ0 A;  2W1T A;  3TW8 A;  1YAX A;  2KDK A;  3MXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...