4PM8A

Crystal structure of ctx-m-14 s70g:s237a beta-lactamase at 1.17 angstroms resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGAGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 91
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm8A00
4M3KA 3V3RA 2Y55A 1S0WA 1G6AA 3S1YA 2IWDA 3HL9A 4KG2A 3WS5A 2A3UA 2WAEA 4B88A 1CK3A 4OPYA 3V39A 5EOOA 1PWGA 5EE8A 1XP4A 3UPNA 4QD4A 1I5QA 5IHVA 1DJBA 3G35A 1PI4A 4DE3A 1JWVA 1XGJA 1XXMA 2XFSA 4KZ4A 4C6YA 5M18A 1K57A 5BOHA 4IVIA 1W8YA 3RXXA 3W8KA 3ZNYA 4Q8IA 5HAPA 1IEMA 1ZG4A 3LEZA 5CGXA 4EUZA 2Y2NA 2WGVA 4JXGA 5CHMA 2HDSA 3VP1A 4BL2A 5DTKA 2G2WA 3G32A 1JWPA 4JLFA 4KZ9A 4UA9A 2H0TA 4KZ3A 1L2SA 1MBLA 4UHUA 3SH9A 3SS4A 2G2UA 1RP5A 1E3UD 3PAGA 3ZGAB 1XX2A 4GD6A 4E3NA 2Y2MA 1FR1A 1GHPA 4EV4A 1GA9A 2WADA 5AQ7A 2GDNA 4JXVA 4U3TA 2WGIA 3BM6A 3MKEA 3PBSA 1MWRA 3HLGA 1H5XA 1PWCA 3E2KA 5F1GA 2V20A 3PBTA 3P98A 5GLDA 3N8LA 2XR0A 4KZ5A 5HAIA 5FDHA 3N8RA 1KVMA 4RA7A 3ZG0A 4WEJA 3P09A 5CTMA 4DRTA 2ZC6B 3DWZA 2WKIA 3Q81A 3UDXA 1O07A 1XKZA 5FSRA 4E3LA 3DWKA 1Z6FA 4RX3A 1OMEA 3IF6C 1KE3A 3EQUA 1NZUA 2OSUA 2BG1A 1BULA 2XGNA 4LV1A 2Y59A 4DE0A 1KE0A 4LV3A 4GOGA 4LCMA 1E3UA 5FQQA 3UDIA 1CEGA 4N9KA 1K25A 3V50A 4DE2A 3V3SA 4ZJ3A 2XF3A 3NCKA 4OQIA 4LCLA 5FI6A 4O7DA 4WZ5C 2OLUA 1GCEA 1FCOA 3VFFA 3C7UA 1KGGA 1TEMA 2Y4AA 3M6BA 4B4ZA 2ZQ8A 1JTGA 1WYCA 1K54A 1ALQA 1ERMA 3BLMA 4U0XA 1EROA 4GNUA 3FKWA 3G34A 5EOEA 3UE3A 1FQGA 1HD8A 2ZLYA 1EI5A 1QMFA 2HP5A 3IHAA 4U0TA 4BL3A 1ZKJA 4JF4A 3QNCA 4KQRA 4B4XA 1N4OA 5FI2A 3O87A 3IF6A 5L2FA 3LO7A 1NYMA 5CGSA 2Y2KA 2C5WB 3IXDA 5I94A 3IHBA 2A49A 4S2NC 4QJGA 1SHVA 5GHXA 4OP8A 1QMEA 2ZQ9A 4PM9A 4IVKA 4X53A 3VSLA 3LY3A 4RVAA 5E2EA 1YM1A 2ZC7A 5GLBA 2IWBA 1NXYA 3AGDA 4WMCD 5CTNA 3SH7A 1NYYA 5FAOA 4S2OA 1IYPA 4PPRA 4BLMA 1O7EA 1PW8A 1ES5A 2UWXA 4KG5A 4JKTA 4R1GA 4WZ5A 1LLBA 3GRJA 1MKIA 2ZQAA 4EBPA 1CEFA 1MY8A 3LCEA 1VM1A 4OVDA 2ZD8A 1N9BA 3MBZA 1ZC2A 3WRTA 1IYOA 3VP2A 3UPOA 3TG9A 2EFUA 1E4DA 1MPLA 5E2FA 2R9WA 4OQHA 4KG6A 4LV0A 3M2JA 1FOFA 2ZC4B 3LY4A 5TFQA 2JBFA 4S2NA 1MWTA 5DTSA 3ZFZA 3BYDA 5A92A 1FSWA 2HDRA 2E8IA 2ZC5B 5EVLA 5A90A 5FQKA 1H8ZA 3IXHA 3N6IA 5J8XA 2XDMA 3DTMA 5CHJA 4WMCA 3NI9A 2J9OA 1L0GA 4DF6A 1CI9A 3OPHA 3VOYA 5F1FA 3TOIA 2HP9A 1S6RA 3Q7ZA 1LL5A 4YFMA 2ZQ7A 5HARA 3W4QA 4JF5A 5E43A 3MXSA 3IQAA 3OCLA 3QNBA 1W79A 3PBRA 5HX9A 2Q9MA 1TDGA 4GDNA 4KQQA 4JBFA 4CPKA 1FCNA 4K0XA 3NC8A 4HBTA 4IEDA 3Q7VB 3HUNA 5TGFA 4ZAMA 5GLAA 5E2GA 2IWCA 3IH8A 2JCHA 1PYYA 1XGIA 4GB7A 4WELA 3M2KA 4XXRA 4ZDXA 4R3BA 3MZDA 1KGEA 2I72A 3DW0A 4BD1A 4Y0OA 4ZJ1A 5A93A 3UY6A 3Q7VA 2EX6A 4DXBA 3HUMA 4OQ0A 3N8SA 4Y0UA 1TDLA 5G18A 2OLVA 1JVJA 2XD5A 4QY6A 4BENA 1JTDA 4C3QA 4PM5A 1CI8A 1ES4A 3Q07A 2WKEA 3HLCA 5CRFA 5KZHA 4C75A 3BLSA 1WYBA 3CZDA 4WZ4A 3G4PA 3MFDA 4HESA 1FCMA 4OPRA 1AXBA 3W4OA 3FZCA 4X69A 3VP4A 5EPHA 2V1ZA 4JF6A 4QB8A 3S22A 1K6RA 1YLPA 3NDEA 4ZBEA 3MKFA 1DJCA 2QPNA 1LL9A 3UN7A 4H8RA 4PM7A 1K4FA 3G30A 2HDQA 3UPPA 4BD0A 1HVBA 4FCFA 3A3IA 3WS0A 1HZOA 2WZXA 3QHYA 1LI0A 2Z2MB 4X56A 4EWFA 1TVFA 2PU2A 3IXBA 3N4IA 4P85A 4GDBA 3PAEA 2FFFB 4KZAA 1BTLA 1GA0A 1Y54A 3IF6B 3Q82A 3ZG5A 1M6KA 2VGKA 1YLJA 3IWOA 4DKIA 5JYPA 4JXSA 3HVFA 5EUAA 1LI9A 4OPQA 4JPMA 2H5SA 3N7WA 4PM6A 4GKUA 3RXWA 3C7VA 1K6SA 4KZBA 5GL9A 3ZG8B 3OPPA 3WRZA 5EVID 5EVIC 1BLPA 4QU3A 5CERA 1GHMA 4OH0A 3S4XA 5HFOA 4R4SA 1M40A 2HP6A 4GN2A 4PM8A 4Z9QA 5HAQA 1YLTA 4KENB 5M19A 4JXWA 1KE4A 3GSGA 4R23A 5FATA 3ITBA 4WM9A 1ERQA 3SS5A 3VP3A 4NETA 3OZHA 2ZJ9A 3PTEA 3C5AA 5EVIB 5CEBA 2Y2QA 3MXRA 3HUOA 3O88A 4QHCA 3CJMA 3G2ZA 2RL3A 5KMWA 4KZ6A 1NZOA 5AQBA 1IYSA 1IELA 4OLGA 2X01A 4E3IA 2EX8A 3OCNA 3WWXA 1BZAA 3SOIA 4E3JA 1YMSA 3VMAA 3NIAA 3BFGA 3HLFA 2XQZA 5EVIA 4MBKA 4MNRA 4D2OA 4S2IA 3W4PA 3A3JA 1BSGA 1WE4A 3FWLA 4DDYA 4ID4A 1SDEA 3ZDJA 3HREA 3BFEA 4K91A 4OKPA 2ZMAA 3C4OA 4P0MA 5AQAA 5JYOA 1KDSA 1JWZA 1ZG6A 4GZBA 4KZ8A 4OLDA 3UDFA 1G68A 1MXOA 5EECA 5A91A 5FI7A 1YLYA 4PMAA 4RX2A 1MWSA 2C6WB 3ZVTA 1KDWA 2WYXA 3A3FA 5CHUA 4EQIA 1YLWA 1MWUA 2FFYA 5D3OA 3WS2A 4X68A 1BLSA 1PW1A 3JYIA 2WKHA 3PBQA 4R0QA 1W7FA 5FQIA 1RGYA 3BFDA 4EBNA 2WK0A 1E25A 3GQZA 1ONHA 4F94A 3V5MA 2EXAA 3NBLA 1IKIA 2JC7A 3O86A 3BEBA 1LHYA 2X71A 4IBXA 4S2PA 3MZFA 3FKVA 1EWZA 1SDNA 2Y2IA 3C4PA 4N1XA 5FQJA 3VP0A 3FYZA 1W8QA 3HLEA 1W5DA 4UA7A 1DY6A 4WYYA 2R9XA 1XPBA 1ES3A 4OQGA 1PWDA 3GR2A 2WGWA 2B5RA 3A3EA 3IWQA 5FAQA 2H10A 2EFXA 5GHYA 5E2HA 2Y2GA 4MBFA 3BFCA 5DVAA 2H0YA 4E3MA 4UA6A 4RYEA 4MEZA 2DCFA 4N9LA 1L0FA 3VSKA 3GTCA 3NY4A 1SKFA 2P9VB 1PI5A 3IT9A 4E3KA 1RGZA 4S2MA 5DF9A 3CMZA 4XUZA 4DE1A 2RCXA 3G2YA 3IF5A 4YINA 2WAFA 5CEDA 3ZNTA 2V2FF 4OONA 4OP5A 2WZZA 4GD8A 2OV5A 1RCJA 3BECA 3I7JA 4WEKA 3SH8A 3O3VA 1SCWA 2X02A 4X55A 4FH2A 5F82A 4Y0TA 4S2KA 1BLHA 2EXBA 2HDUA 4KQOA 1K4EA 2P9VA 1Q2PA 3ITAA 4HBUA 4DDSA 3B3XA 4FD8A 1K54C 1YT4A 1Q2QA 2ZM0A 5F83A 3ISGA 1XA1A 1YQSA 5CXWA 1DJAA 4MLLA 1FR6A 1NJ4A 3VFHA 4DXCA 4ZTKA 2EX2A 3D4FA 1PZPA 3HLBA 1K38A 5DF8A 2DNSA 4OPZA 5HL1A 2Y2PA 4FSFA 2EX9A 1KVLA 4P87A 2XFTA 1ESIA 5CECA 5DF7A 1XA7A 4S2LA 2ZQCA 2VGJA 2XH9A 2J7VA 1L0EA 5KSHA 2QMIA 2Y2JA 5FQ9A 3PBNA 1BT5A 4EBLA 3UO9A 4OOLA 1J9MA 1K55C 3TSGA 4LV2A 5DTTA 1U60A 2Y91A 3UE0A 2CC1A 5GHZA 5U47A 4P6BA 1YMXA 3ZG7B 4LENA 5TR7A 4A5RA 2HPBA 1BUEA 2BLSA 2Y2LA 3AGEA 5GLCA 1C3BA 3BRMA 2PBYA 2PU4A 3OPRA 5AQ9A 2Q9NA 4K0WA 4ZJ2A 1PZOA 3RJUA 3ZHHA 3IH9A 3GV9A 3GVBA 1VQQA 5CGWA 2XK1A 4IBRA 4E6XA 1BLCA 1KGFA 4E3OA 3ZG9B 3M6HA 4OOYA 3Q1FA 2QZ6A 4WBGA 2DRWA 3WS1A 1K56D 1ES2A 2J9PA 3HBRA 3PBOA 3UNWA 1I2SA 2ZC3B 4Y7PA 3ZCZA 4BQMA 4FH4A 3OC2A 2JE5A 1L0DA 2Z2LB 4CJNA 3VOZA 1ESUA 1K55A 2P74A 2ZM8A 4KZ7A 4OOMA 4MBHA 4XUXA 5HW3A 3HLDA 3BFFA 5FQMA 4N92A 2J8YA 5KSCA 3AGFA 3E2LA 3EQVA 1HTZA 1IKGA 3IXGA 5FA7A 4R4RA 2ZM2A 2ZQDA 4N1HA 2XLNA 3ZVWA 1NY0A 1YLZA 3OPLA 1K57C 3A3DA 4UAAA 3WS4A 3MZEA 5FAPA 1NRFA 2WUQA 4S2JA 3CG5A 3FV7A 4X6TA 1I2WA 2Y2HA 2WGWB 1H8YA 2Y2OA 4HEFA 2XD1A 4L0LA 3GMWA 3IWIA 3HLWA 4R3JA 1IYQA 3NDGA 4NK3A 1FSYA 1ONGA 5M1AA 4QY5A 1K56A 3UE1A 1GHIA 4BJPA 5FASA 3G31A 3SS3A 4E6WA 1PIOA 2XEPA
chains in the Genus database with same CATH superfamily
3MF0A 3DTKA 4FUWA 1G6AA 4EERA 3V39A 1D06A 4EESA 1PWGA 4R38A 1PI4A 1XXMA 2VV8A 1W63M 4IVIA 3W8KA 3CHWP 5HAPA 3LEZA 1ZG4A 3LEQA 3B47A 5CHMA 5HWWA 3VP1A 4BL2A 3G32A 4JLFA 3T1RA 2L4RA 1L2SA 4UHUA 3SH9A 1E3UD 2Y2MA 1GA9A 2PT7A 4JXVA 2WGIA 3HLGA 3E2KA 3PBTA 3P98A 5FDHA 3ZG0A 4HJ4A 4WEJA 3P09A 3T4SA 2WKIA 1O07A 5FSRA 4HH2A 3DWKA 1Z6FA 1P0ZA 4CLCD 3IF6C 1KE3A 3SW1A 2V8CA 3QP6A 2EWWA 3TRCA 3UDIA 3DTEA 4ZJ3A 3P01A 2HZ5A 3IBJA 4O01A 4LCLA 3OLOA 1FCOA 1ALQA 4GNUA 3FKWA 5DKKA 3KSGA 4XT2A 1FQGA 3TJZC 1HD8A 1EI5A 4BL3A 3HJKA 5FI2A 3PXPA 1BYWA 2OAP1 4PKYA 2P08A 2VEAA 1DP6A 5CGSA 2Y2KA 3IHBA 4GHIA 4OP8A 4QWOA 4PM9A 4IVKA 4GS9A 3LY3A 5E2EA 5L07A 1NYYA 4PPRA 2V1AA 4BLMA 1PW8A 2UWXA 2W3EA 2ZQAA 3LUQA 5HL6A 3K2NA 3UPOA 3TG9A 2R9WA 4LV0A 1H3QA 5TFQA 2R78A 5DTSA 2G7UA 5F1FA 2KLIA 3NI9A 3VOYA 2KX6A 3CI6A 1LL5A 3W2ZA 2ZQ7A 2KOIA 4JGPA 3W4QA 4UQIS 5E43A 3OCLA 3T4LA 4GDNA 4CPKA 4ETZA 4K0XA 3NC8A 4IEDA 3UMDA 2WKPA 2IWCA 3CITA 1PYYA 4LRXC 2I72A 3DW0A 4Y0OA 4DXBA 1MC0A 2QKPA 1TDLA 3CUEC 1JVJA 2XD5A 4BENA 4PM5A 2ZOIA 4HOIA 1ES4A 2WKEA 4IHQA 4LLOB 2JKFA 4WZ4A 1FILA 3FZCA 3BQ8A 3S22A 2O0YA 1LL9A 4IJGA 1HVBA 2CMNA 3WS0A 1LI0A 2PU2A 3N4IA 4GDBA 1BTLA 3F1PA 3Q82A 3ZG5A 1M6KA 2VGKA 4FTXA 4DKIA 5JYPA 3UE6A 3KX0X 5EUAA 1LI9A 3L7HA 4H6JA 2H5SA 3RXWA 3C7VA 4QPRA 4KZBA 5GL9A 2GZAA 5LBRA 1BLPA 4QU3A 5CERA 2PAVP 1S1YA 5HFOA 4PM8A 1LL8A 3ITBA 3KO6A 4WM9A 4BBUA 4JGQA 3PTEA 5EVIB 2Y2QA 3HUOA 3CJMA 5AQBA 1IYSA 4OLGA 2X01A 1LSWA 3OCNA 1XJ6A 4E3JA 1YMSA 4RQ9A 2J3TC 1V9ZA 4D2OA 4PHTA 3A3JA 1SKOA 1SDEA 2JHEA 3ZDJA 3BFEA 4OKPA 4P0MA 5JYOA 4OLDA 4KZ8A 5L09A 4G3KA 1MXOA 1YLYA 2PR6A 4RX2A 2YKFA 3IX4A 1KDWA 3CLOA 2OOLA 5HPFA 4Q0HA 4X68A 2J80A 3U4LP 1ODVA 4EBNA 1ONHA 4F94A 3V5MA 1FIKA 3NBLA 3O86A 1LHYA 2X71A 3A0VA 3E4OA 1EWZA 1SDNA 5FQJA 1OJGA 1W5DA 4WF0A 4YWZA 4GCZA 5TJJA 5GHYA 5E2HA 2H0YA 2P7JA 4HY8A 3H82B 1P9RA 4MEZA 1S4RA 4E04A 4DE1A 4YINA 4OP5A 4O0PA 3B42A 4P6ZM 4X55A 4FH2A 4HNBA 2P9VA 1Q2PA 3B3XA 3ULFA 5EFWA 3ISGA 5AVFA 4ZTKA 2EX2A 3D4FA 4OPZA 4EEPA 1VHMA 5CECA 2XH9A 1L0EA 5KSHA 2Y2JA 2ZMVA 1J9MA 1VEUA 2V8FA 1U60A 2M1CA 2CC1A 5FL3A 5TR7A 1KOUA 4HHDA 2OWJA 3AGEA 1XJ3A 2Q9NA 4NXBA 4E6XA 4E3OA 3Q1FA 2J9PA 4BQMA 4PKYG 4FH4A 1IFQA 2JE5A 3VOZA 4MBHA 5HW3A 1S4SA 3AGFA 3EQVA 3H7WB 3IXGA 5FA7A 2ZM2A 1NY0A 2VK3A 3MZEA 5J4EA 5FAPA 1NRFA 4S2JA 2W3GA 4X6TA 4L0LA 4HEFA 2D01A 2XD1A 3IS2A 5KIZA 4QY5A 4BJPA 3G31A 3SS3A 3C30A 1PIOA 2HV1A 2D02A 2Y55A 1N9LA 3WS5A 2A3UA 5EOOA 1I5QA 5IHVA 1JWVA 4Y13A 5BOHA 4Q8IA 1OTIA 5HDSA 3KSHA 4EUZA 5K5BA 2HDSA 2PDRA 5DTKA 1JWPA 4UA9A 4KZ9A 1WA9A 1MBLA 4GLQA 3ZGAB 1XX2A 3JVUA 1GHPA 2GDNA 4KUKA 4U3TA 3BM6A 3MKEA 2JN7A 2NUPC 5GLDA 2PR5A 3N8LA 2XR0A 3N8RA 5HWTA 4LGWA 3UB8A 4NG2A 3Q81A 3D3OA 4WN5A 3T1XA 4EETB 2BG1A 4LV1A 4DE0A 4LV3A 4CQHA 4XT2B 5FQQA 4DE2A 3V3SA 2XF3A 3NCKA 4OQIA 1OT6A 1DP9A 4WZ5C 3E4QA 2OLUA 1TEMA 2ZQ8A 3FPWA 1Y4OA 4U0XA 1TS0A 3C8CA 2GJ3A 3G34A 2KDKA 3S7PA 4KUOA 3IHAA 3KYZA 1ZKJA 4B4XA 3NHQA 3QNCA 1N4OA 3IF6A 5L2FA 1NYMA 4EQ1A 4L9EA 2A49A 4QJGA 2ZOHA 1QMEA 3VSLA 2ZC7A 1YPRA 1IYPA 4NKPA 1VETA 1LLBA 2Z6CA 1G28A 4DJ2A 1T19A 3T4JA 3E0YA 1MKIA 4LRZE 4OVDA 1T1BA 4NEED 1E4DA 1MPLA 1TS6A 3ZQ5A 3M2JA 3LY4A 5A92A 5FQKA 1H8ZA 3DBAA 3DTMA 3LYXA 4WMCA 3MS6A 4DF6A 1S6RA 3JVVA 3BY8A 5HZHA 3IQAA 3QNBA 1W79A 4KQQA 2QYBA 5IU1A 3HUNA 1T18A 4I39A 4ZAMA 5GLAA 4L9GA 4F3LA 5HD3A 3IH8A 1XGIA 3CWFA 3LI9A 3R4KA 5A93A 3Q7VA 1ZTUA 2J3WA 3HUMA 3N8SA 1F5MA 5IS1A 4LRYC 4QY6A 5KZHA 2Y79A 4HP9A 1WYBA 4HESA 4OPRA 2GX5A 3VP4A 5EPHA 1K6RA 2FH5A 3UN7A 1PFLA 1K4FA 2HDQA 3A3IA 3LFVA 4P85A 3CAXA 3KSIA 4KZAA 3LI8A 1Y54A 3CUEA 3HVFA 3DTIA 4UEYA 4JPMA 4GKUA 2W1RA 1P9WA 2JKGA 5EVID 2V0WA 1GHMA 3S4XA 2VGLM 4PAUA 4DJ3A 3D72A 1YLTA 4R23A 4B9OA 3SS5A 3PR6A 2OAQ1 3OZHA 3C5AA 3D9YA 2QHKA 4QHCA 1SKOB 4P6ZS 1YSQA 4KZ6A 1IELA 4E3IA 2ZL1A 3ICYA 3SOIA 3QP8A 3NIAA 3HLFA 2XQZA 4MBKA 4MNRA 3E98A 3W4PA 3ZYTA 1BSGA 2IA2A 3HREA 2ZMAA 3C4OA 4GZBA 2E8JA 5EECA 2C6WB 1TF1A 3GDIA 2VKSA 3A3FA 4MN7A 1MWUA 4ZRRA 3LR0A 2Z6DA 3PBQA 4R0QA 5FQIA 3BFDA 1STZA 2W0NA 2WK0A 3BY9A 1IKIA 2P04A 3FKVA 4N1XA 1NLYA 1XPBA 3F1NA 4OQGA 1PWDA 3GR2A 2WGWA 2B5RA 3BFCA 5DVAA 3T12B 5MC7A 1Z09A 1L0FA 4ME4A 3GTCA 2P9VB 1PI5A 1RGZA 4S2MA 4XUZA 3UB6A 2WAFA 2V2FF 3NOUC 4YNRA 2OV5A 3BECA 1J3WA 3O3VA 2X02A 4S2KA 2HDUA 1K4EA 3BWLA 3ITAA 4HBUA 4DDSA 1OJ5A 4FD8A 3T4TA 1Q2QA 1DJAA 2B95A 2XA7M 1VEUB 2Y2PA 1NWZA 2EX9A 1KVLA 3O5YA 4P87A 4Y2FA 1XA7A 4S2LA 3UO9A 4OOLA 1K55C 4X1MA 5GHZA 4P6BA 1YMXA 5IT5A 4WL9A 2ZMFA 2HPBA 4MN6A 5GLCA 1C3BA 3BRMA 2PU4A 3OPRA 5AQ9A 4ZJ2A 1PZOA 3ZHHA 2W3FA 4LFUA 2W3DA 1BLCA 1KGFA 1AWIA 3M6HA 3LR3A 1S67L 2DRWA 3MMHA 3WS1A 1K56D 1ES2A 3HBRA 2O9AA 1L0DA 4KZ7A 4OOMA 2I9VA 3BFFA 5KSCA 4R70A 4R4RA 1GSWA 4IUKA 4BWIA 3ZVWA 1K57C 4UAAA 4HIAA 3K3CA 3C38A 1SZVA 4EXOA 2Y2HA 5DJUA 4ARZB 2Y2OA 3IWIA 3UB5P 2HGVA 4R3JA 1IYQA 3UE1A 4E6WA 2ZM8A 2XEPA 4KG2A 2WAEA 4B88A 3EGDC 5EE8A 1XP4A 3UPNA 1DJBA 2HF6A 2HJEA 2A24A 4KZ4A 1CJFA 1W8YA 3BW6A 3RXXA 3ZNYA 1IEMA 2K7SA 1S66L 3JPUA 2WGVA 4HQAA 4ETXA 4KZ3A 3IX8A 2M7VA 3SS4A 1RP5A 3PAGA 1FR1A 4EV4A 4AFIA 2WADA 3T1SA 5HDDA 5EVEA 3PBSA 1MWRA 1PWCA 5F1GA 2V20A 3EWKA 4I38A 5G4ZA 3VOLA 1UGUA 3LIAA 5CTMA 4DRTA 3MQQA 2W1TA 2ZC6B 3UDXA 4BBTA 4E3LA 4RX3A 3K3DA 4HH3A 5F5YA 1KE0A 1TS7A 4LCMA 1E3UA 1CEGA 4N9KA 3FPVA 1K0KA 3VFFA 3M6BA 2NUTC 4B4ZA 3BLMA 1K54A 1EROA 2L1MA 4EW7A 1EW0A 5EOEA 2ZLYA 4M4XA 2HP5A 3LR5A 4JF4A 4KQRA 5HD5A 4CLCA 3O87A 4Y5FA 4G3VA 3S7OA 2B18A 3IXDA 4S2NC 1SHVA 5GHXA 2ZQ9A 4HI4A 2EA9A 2VLGA 1YM1A 5GLBA 2IWBA 1NXYA 3AGDA 2BASA 5M19A 1O7EA 1ES5A 2O9CA 4KG5A 4WZ5A 1IOUA 3GRJA 1XJ4A 1F2KA 4EBPA 3LCEA 1VM1A 2ZD8A 4I3IA 3MBZA 3WRTA 1IYOA 3VP2A 2EFUA 3LIBA 5E2FA 4KG6A 1FOFA 2ZC4B 3C2WA 1MWTA 1F9IA 5EVLA 1YAXA 4L9FA 3RFBA 5A90A 2PHYA 2XDMA 5C5KA 5CHJA 1CI9A 3MXQA 4NXEA 1MZUA 2VGLS 3MXSA 5HX9A 1TDGA 4JBFA 3T4OA 3BQAA 3Q7VB 3R7WA 2JCHA 3M2KA 4R3BA 4BMWA 3MZDA 1H8MA 2DMWA 4FOFA 3UY6A 5A8BA 4Y0UA 4C3QA 3QP1A 1CI8A 3Q07A 3UMEA 2JKTM 1FCMA 1AXBA 4X69A 1OT9A 2V1ZA 4QB8A 3A0RA 1YLPA 5L8MA 3H82A 4H8RA 4BD0A 4FCFA 2WZXA 4X56A 3NJAA 2Z2MB 1TVFA 5HSQA 3PAEA 2FFFB 1GA0A 2O99A 1YLJA 3IWOA 3BJNA 2PRFA 4GHIB 3EEAA 4JXSA 3H9WA 4GS9B 1OPXA 1DRMA 4OPQA 4GW9A 4PM6A 1K6SA 3ZG8B 1L3LA 2V9AA 5EVIC 1M40A 4GN2A 4KQDA 4HJ3A 3EOIA 3GSGA 1ERQA 2A2LA 3VP3A 4NETA 3T4QA 5DJTA 5CEBA 3MXRA 3NECA 3O88A 4D60A 2RL3A 2ZBBA 2XROA 1NZOA 3WWXA 1BZAA 3U2AA 3BFGA 3MQ0A 2XA7S 2OWHA 4K91A 5AQAA 1KDSA 1Y28A 2YKHA 5F69A 5A91A 4MN5A 5FI7A 4X25A 1MWSA 3ZVTA 2WYXA 3CPTA 5CHUA 4EQIA 4YOFA 1N9NA 1YLWA 5D3OA 1BLSA 1PW1A 3JYIA 3F1NB 1RGYA 3GQZA 5TBMA 1V9YA 5J7EA 2EXAA 3OOVA 1G6OA 1JNUA 2Q0OA 3FYZA 3HLEA 1NRJA 2VZWA 4UA7A 4WYYA 2R9XA 1D7EA 3IWQA 3VE3A 2H10A 3P7NA 3E4PA 2VV6A 4E3MA 4UA6A 2DCFA 4N9LA 3NY4A 4E3KA 5L10A 2EWVA 5DF9A 3CMZA 2RCXA 3G2YA 3IF5A 5CEDA 3DAVA 2JKTI 3F1PB 4GD8A 1RCJA 1TD5A 3I7JA 4WEKA 3SH8A 1SCWA 5F82A 2EXBA 1MKMA 4H6JB 2ZM0A 4Q0JA 5F83A 1YQSA 3LICA 2W27A 1FR6A 3T50A 1NJ4A 3VFHA 4DXCA 2DNSA 5HL1A 2PD8A 4DMZA 5HPIA 2L0WA 3B33A 3KYQA 1ESIA 5DF7A 2VGJA 1ZHHB 3PBNA 1BT5A 4EBLA 1XJ2A 3TSGA 5DTTA 3HCYA 3EEHA 5U47A 3ZG7B 5DFXA 1BUEA 2Y2LA 1LT0A 4K0WA 2INWA 3GVBA 3HJIA 1VQQA 4R6LA 4NXGA 1DP8A 1NLZA 2PYPA 4WBGA 3F1OA 1I2SA 2ZC3B 3ZCZA 4DN0A 4EEUA 2Z2LB 4CJNA 1K55A 3HLDA 5FQMA 2J8YA 3E2LA 1IKGA 1HTZA 4N1HA 1XFNA 1YLZA 1UWNX 1H0MA 2VA0A 3WS4A 2WUQA 3CG5A 1H8YA 1XFQA 3GMWA 3HLWA 4NK3A 1FSYA 1ONGA 5M1AA 2A24B 1GHIA 5FASA 3UB7A 5FEFA 4M3KA 3V3RA 1S0WA 3EGXC 3VE4A 3S1YA 2IWDA 3HL9A 2PYRA 3LGOA 1CK3A 4OPYA 4QD4A 3G35A 4DE3A 1XGJA 2LB5A 2XFSA 4C6YA 5M18A 1K57A 1ACFA 4Y3IA 5CGXA 2Y2NA 4JXGA 1YSPA 2G2WA 2HJ9C 1YKDA 2H0TA 2G2UA 4GD6A 4E3NA 2W1TB 5AQ7A 1H5XA 4Q0IA 4KZ5A 5HAIA 1F98A 3TE8A 1KVMA 4RA7A 3S7NA 2WKRA 2ACGA 3DWZA 1XKZA 1OMEA 3EQUA 3MJQA 1CQAA 1NZUA 2OSUA 5DFYA 2V1BA 1BULA 2XGNA 2Y59A 3S7QA 5DKLA 4GOGA 4MMNA 1K25A 3V50A 3MR0A 2B02A 3NOPC 4CLCB 5FI6A 4O7DA 1GCEA 1OTEA 2Y8HA 1KGGA 3C7UA 2Y4AA 1JTGA 1WYCA 1ERMA 4Y17A 3KSFA 3UE3A 1X0OA 1QMFA 4U0TA 3LO7A 2C5WB 5I94A 4LPZA 5G4YA 3QP5A 4X53A 4Z1WA 1LSVA 3L9KA 1OTAA 3IX3A 4RVAA 4WMCD 3SH7A 5CTNA 5FAOA 3SZTA 4S2OA 3TW8A 4JKTA 1UWPX 4R1GA 2GNXA 3IS2B 5J3WA 5F6AA 2PBDP 1CEFA 1MY8A 4IUHA 2H28A 1N9BA 1ZC2A 5AVEA 4OQHA 2JKRM 1N9OA 4EU0A 2JBFA 4S2NA 3ZFZA 3BYDA 1FSWA 2HDRA 2E8IA 2ZC5B 3IXHA 3N6IA 5J8XA 2J9OA 1L0GA 3OPHA 3R7WB 3TOIA 2HP9A 3Q7ZA 4YFMA 5HARA 4JF5A 3PBRA 2Q9MA 1FCNA 4HBTA 5TGFA 2MJ6A 3NULA 1CF0A 5E2GA 4GB7A 4WELA 4XXRA 4ZDXA 1S1ZA 3G6OA 4CLCE 1KGEA 4BD1A 4WUJA 4ZJ1A 2EX6A 4OQ0A 5G18A 1GSVA 2OLVA 1JTDA 5EM0A 5EM1A 5CRFA 3HLCA 3GECA 4C75A 3LIDA 3BLSA 3CZDA 1VB6A 3G4PA 3MFDA 2K2NA 3W4OA 4JF6A 3KYEA 2UV0E 1G5UA 3NDEA 4ZBEA 4Y15A 3MKFA 1DJCA 2QPNA 3PHYA 1D1JA 4HJ6A 4PM7A 3G30A 3UPPA 5EV0A 1HZOA 3QHYA 4EWFA 2VV7A 3IXBA 2QJ5A 2WKQA 3FG8A 3IF6B 2XSSA 3N7WA 3OPPA 2W3HA 3WRZA 3MSHA 4OH0A 1VETB 4R4SA 2HP6A 4Z9QA 5HAQA 2AVXA 4UQIM 4KENB 4JXWA 1KE4A 5FATA 2V0UA 4NXFA 2ZJ9A 2K31A 3T1QB 4X1LA 3G2ZA 5KMWA 3RH8B 4R3AA 5F68A 2EX8A 3VMAA 2J3TD 5EVIA 3CPTB 4S2IA 1WE4A 4DDYA 3FWLA 4ID4A 1ZG6A 1JWZA 3UDFA 3LIEA 5HDCA 1G68A 3LIFA 2JKRI 2XRNA 3OBFA 5TBMB 4PMAA 2QJ7A 2VX8A 2BTFP 4F3LB 2FFYA 3WS2A 1PNEA 2WKHA 2M7UA 1W7FA 1E25A 4K08A 2JC7A 3BEBA 4IBXA 4S2PA 3MZFA 2Y2IA 3C4PA 3VP0A 3FC7A 1W8QA 1DY6A 1ES3A 4ARZA 3IBRA 1LSXA 3A3EA 5FAQA 2EFXA 2Y2GA 4MBFA 3V67A 3NOTC 5FDSA 4I5SA 4RYEA 3VSKA 1SKFA 3IT9A 3PYPA 5FEGA 3ZNTA 4OONA 2WZZA 4Y0TA 1BLHA 4KQOA 4O8GA 1K54C 1YT4A 2O9BA 1XA1A 3T4KA 2VJWA 1W63Q 5CXWA 4MLLA 2LB9A 1PZPA 4CLCC 3A0SA 3HLBA 1K38A 5DF8A 4FSFA 2XFTA 4I3JA 2ZQCA 2J7VA 1HLUP 2QMIA 5FQ9A 3MFXA 1OTDA 4JGRA 4G3WA 4LV2A 1PRQA 2Y91A 3UE0A 5CX7A 3RTYA 2ZL1B 4LENA 5I5LA 5AJGA 4A5RA 3F1OB 2BLSA 3VV4A 2PBYA 2QWSA 4I3AA 3QP4A 3MQOA 3RJUA 3IH9A 2FZ0A 3GV9A 4MCWA 5CGWA 2XK1A 4IBRA 4MDZA 4EUVA 3ZG9B 4OOYA 1T1AA 2QZ6A 1T1CA 3PBOA 4JGOA 3UNWA 4Y7PA 1GSXA 3OC2A 1ESUA 2P74A 4XUXA 4N92A 4II7A 2ZQDA 1P97A 3LR4A 4GJ4A 2XLNA 1OTBA 3OPLA 4ESPA 3A3DA 3UB9A 4BBVA 4HP4A 4B93A 4WLAA 3FV7A 1I2WA 2WGWB 3QP2A 3H7WA 3NDGA 1K56A 1TS8A 2PD7A 5HWVA 1A0KA
chains in the Genus database with same CATH topology
4M3KA 3V3RA 2Y55A 1S0WA 1G6AA 3S1YA 2IWDA 3HL9A 4KG2A 3WS5A 2A3UA 2WAEA 4B88A 1CK3A 4OPYA 3V39A 5EOOA 1PWGA 5EE8A 1XP4A 3UPNA 4QD4A 1I5QA 5IHVA 1DJBA 3G35A 1PI4A 4DE3A 1JWVA 1XGJA 1XXMA 2XFSA 4KZ4A 4C6YA 5M18A 1K57A 5BOHA 4IVIA 1W8YA 3RXXA 3W8KA 3ZNYA 4Q8IA 5HAPA 1IEMA 1ZG4A 3LEZA 5CGXA 4EUZA 2Y2NA 2WGVA 4JXGA 5CHMA 2HDSA 3VP1A 4BL2A 5DTKA 2G2WA 3G32A 1JWPA 4JLFA 4KZ9A 4UA9A 2H0TA 4KZ3A 1L2SA 1MBLA 4UHUA 3SH9A 3SS4A 2G2UA 1RP5A 1E3UD 3PAGA 3ZGAB 1XX2A 4GD6A 4E3NA 2Y2MA 1FR1A 1GHPA 4EV4A 1GA9A 2WADA 5AQ7A 2GDNA 4JXVA 4U3TA 2WGIA 3BM6A 3MKEA 3PBSA 1MWRA 3HLGA 1H5XA 1PWCA 3E2KA 5F1GA 2V20A 3PBTA 3P98A 5GLDA 3N8LA 2XR0A 4KZ5A 5HAIA 5FDHA 3N8RA 1KVMA 4RA7A 3ZG0A 4WEJA 3P09A 5CTMA 4DRTA 2ZC6B 3DWZA 2WKIA 3Q81A 3UDXA 1O07A 1XKZA 5FSRA 4E3LA 3DWKA 1Z6FA 4RX3A 1OMEA 3IF6C 1KE3A 3EQUA 1NZUA 2OSUA 2BG1A 1BULA 2XGNA 4LV1A 2Y59A 4DE0A 1KE0A 4LV3A 4GOGA 4LCMA 1E3UA 5FQQA 3UDIA 1CEGA 4N9KA 1K25A 3V50A 4DE2A 3V3SA 4ZJ3A 2XF3A 3NCKA 4OQIA 4LCLA 5FI6A 4O7DA 4WZ5C 2OLUA 1GCEA 1FCOA 3VFFA 3C7UA 1KGGA 1TEMA 2Y4AA 3M6BA 4B4ZA 2ZQ8A 1JTGA 1WYCA 1K54A 1ALQA 1ERMA 3BLMA 4U0XA 1EROA 4GNUA 3FKWA 3G34A 5EOEA 3UE3A 1FQGA 1HD8A 2ZLYA 1EI5A 1QMFA 2HP5A 3IHAA 4U0TA 4BL3A 1ZKJA 4JF4A 3QNCA 4KQRA 4B4XA 1N4OA 5FI2A 3O87A 3IF6A 5L2FA 3LO7A 1NYMA 5CGSA 2Y2KA 2C5WB 3IXDA 5I94A 3IHBA 2A49A 4S2NC 4QJGA 1SHVA 5GHXA 4OP8A 1QMEA 2ZQ9A 4PM9A 4IVKA 4X53A 3VSLA 3LY3A 4RVAA 5E2EA 1YM1A 2ZC7A 5GLBA 2IWBA 1NXYA 3AGDA 4WMCD 5CTNA 3SH7A 1NYYA 5FAOA 4S2OA 1IYPA 4PPRA 4BLMA 1O7EA 1PW8A 1ES5A 2UWXA 4KG5A 4JKTA 4R1GA 4WZ5A 1LLBA 3GRJA 1MKIA 2ZQAA 4EBPA 1CEFA 1MY8A 3LCEA 1VM1A 4OVDA 2ZD8A 1N9BA 3MBZA 1ZC2A 3WRTA 1IYOA 3VP2A 3UPOA 3TG9A 2EFUA 1E4DA 1MPLA 5E2FA 2R9WA 4OQHA 4KG6A 4LV0A 3M2JA 1FOFA 2ZC4B 3LY4A 5TFQA 2JBFA 4S2NA 1MWTA 5DTSA 3ZFZA 3BYDA 5A92A 1FSWA 2HDRA 2E8IA 2ZC5B 5EVLA 5A90A 5FQKA 1H8ZA 3IXHA 3N6IA 5J8XA 2XDMA 3DTMA 5CHJA 4WMCA 3NI9A 2J9OA 1L0GA 4DF6A 1CI9A 3OPHA 3VOYA 5F1FA 3TOIA 2HP9A 1S6RA 3Q7ZA 1LL5A 4YFMA 2ZQ7A 5HARA 3W4QA 4JF5A 5E43A 3MXSA 3IQAA 3OCLA 3QNBA 1W79A 3PBRA 5HX9A 2Q9MA 1TDGA 4GDNA 4KQQA 4JBFA 4CPKA 1FCNA 4K0XA 3NC8A 4HBTA 4IEDA 3Q7VB 3HUNA 5TGFA 4ZAMA 5GLAA 5E2GA 2IWCA 3IH8A 2JCHA 1PYYA 1XGIA 4GB7A 4WELA 3M2KA 4XXRA 4ZDXA 4R3BA 3MZDA 1KGEA 2I72A 3DW0A 4BD1A 4Y0OA 4ZJ1A 5A93A 3UY6A 3Q7VA 2EX6A 4DXBA 3HUMA 4OQ0A 3N8SA 4Y0UA 1TDLA 5G18A 2OLVA 1JVJA 2XD5A 4QY6A 4BENA 1JTDA 4C3QA 4PM5A 1CI8A 1ES4A 3Q07A 2WKEA 3HLCA 5CRFA 5KZHA 4C75A 3BLSA 1WYBA 3CZDA 4WZ4A 3G4PA 3MFDA 4HESA 1FCMA 4OPRA 1AXBA 3W4OA 3FZCA 4X69A 3VP4A 5EPHA 2V1ZA 4JF6A 4QB8A 3S22A 1K6RA 1YLPA 3NDEA 4ZBEA 3MKFA 1DJCA 2QPNA 1LL9A 3UN7A 4H8RA 4PM7A 1K4FA 3G30A 2HDQA 3UPPA 4BD0A 1HVBA 4FCFA 3A3IA 3WS0A 1HZOA 2WZXA 3QHYA 1LI0A 2Z2MB 4X56A 4EWFA 1TVFA 2PU2A 3IXBA 3N4IA 4P85A 4GDBA 3PAEA 2FFFB 4KZAA 1BTLA 1GA0A 1Y54A 3IF6B 3Q82A 3ZG5A 1M6KA 2VGKA 1YLJA 3IWOA 4DKIA 5JYPA 4JXSA 3HVFA 5EUAA 1LI9A 4OPQA 4JPMA 2H5SA 3N7WA 4PM6A 4GKUA 3RXWA 3C7VA 1K6SA 4KZBA 5GL9A 3ZG8B 3OPPA 3WRZA 5EVID 5EVIC 1BLPA 4QU3A 5CERA 1GHMA 4OH0A 3S4XA 5HFOA 4R4SA 1M40A 2HP6A 4GN2A 4PM8A 4Z9QA 5HAQA 1YLTA 4KENB 5M19A 4JXWA 1KE4A 3GSGA 4R23A 5FATA 3ITBA 4WM9A 1ERQA 3SS5A 3VP3A 4NETA 3OZHA 2ZJ9A 3PTEA 3C5AA 5EVIB 5CEBA 2Y2QA 3MXRA 3HUOA 3O88A 4QHCA 3CJMA 3G2ZA 2RL3A 5KMWA 4KZ6A 1NZOA 5AQBA 1IYSA 1IELA 4OLGA 2X01A 4E3IA 2EX8A 3OCNA 3WWXA 1BZAA 3SOIA 4E3JA 1YMSA 3VMAA 3NIAA 3BFGA 3HLFA 2XQZA 5EVIA 4MBKA 4MNRA 4D2OA 4S2IA 3W4PA 3A3JA 1BSGA 1WE4A 3FWLA 4DDYA 4ID4A 1SDEA 3ZDJA 3HREA 3BFEA 4K91A 4OKPA 2ZMAA 3C4OA 4P0MA 5AQAA 5JYOA 1KDSA 1JWZA 1ZG6A 4GZBA 4KZ8A 4OLDA 3UDFA 1G68A 1MXOA 5EECA 5A91A 5FI7A 1YLYA 4PMAA 4RX2A 1MWSA 2C6WB 3ZVTA 1KDWA 2WYXA 3A3FA 5CHUA 4EQIA 1YLWA 1MWUA 2FFYA 5D3OA 3WS2A 4X68A 1BLSA 1PW1A 3JYIA 2WKHA 3PBQA 4R0QA 1W7FA 5FQIA 1RGYA 3BFDA 4EBNA 2WK0A 1E25A 3GQZA 1ONHA 4F94A 3V5MA 2EXAA 3NBLA 1IKIA 2JC7A 3O86A 3BEBA 1LHYA 2X71A 4IBXA 4S2PA 3MZFA 3FKVA 1EWZA 1SDNA 2Y2IA 3C4PA 4N1XA 5FQJA 3VP0A 3FYZA 1W8QA 3HLEA 1W5DA 4UA7A 1DY6A 4WYYA 2R9XA 1XPBA 1ES3A 4OQGA 1PWDA 3GR2A 2WGWA 2B5RA 3A3EA 3IWQA 5FAQA 2H10A 2EFXA 5GHYA 5E2HA 2Y2GA 4MBFA 3BFCA 5DVAA 2H0YA 4E3MA 4UA6A 4RYEA 4MEZA 2DCFA 4N9LA 1L0FA 3VSKA 3GTCA 3NY4A 1SKFA 2P9VB 1PI5A 3IT9A 4E3KA 1RGZA 4S2MA 5DF9A 3CMZA 4XUZA 4DE1A 2RCXA 3G2YA 3IF5A 4YINA 2WAFA 5CEDA 3ZNTA 2V2FF 4OONA 4OP5A 2WZZA 4GD8A 2OV5A 1RCJA 3BECA 3I7JA 4WEKA 3SH8A 3O3VA 1SCWA 2X02A 4X55A 4FH2A 5F82A 4Y0TA 4S2KA 1BLHA 2EXBA 2HDUA 4KQOA 1K4EA 2P9VA 1Q2PA 3ITAA 4HBUA 4DDSA 3B3XA 4FD8A 1K54C 1YT4A 1Q2QA 2ZM0A 5F83A 3ISGA 1XA1A 1YQSA 5CXWA 1DJAA 4MLLA 1FR6A 1NJ4A 3VFHA 4DXCA 4ZTKA 2EX2A 3D4FA 1PZPA 3HLBA 1K38A 5DF8A 2DNSA 4OPZA 5HL1A 2Y2PA 4FSFA 2EX9A 1KVLA 4P87A 2XFTA 1ESIA 5CECA 5DF7A 1XA7A 4S2LA 2ZQCA 2VGJA 2XH9A 2J7VA 1L0EA 5KSHA 2QMIA 2Y2JA 5FQ9A 3PBNA 1BT5A 4EBLA 3UO9A 4OOLA 1J9MA 1K55C 3TSGA 4LV2A 5DTTA 1U60A 2Y91A 3UE0A 2CC1A 5GHZA 5U47A 4P6BA 1YMXA 3ZG7B 4LENA 5TR7A 4A5RA 2HPBA 1BUEA 2BLSA 2Y2LA 3AGEA 5GLCA 1C3BA 3BRMA 2PBYA 2PU4A 3OPRA 5AQ9A 2Q9NA 4K0WA 4ZJ2A 1PZOA 3RJUA 3ZHHA 3IH9A 3GV9A 3GVBA 1VQQA 5CGWA 2XK1A 4IBRA 4E6XA 1BLCA 1KGFA 4E3OA 3ZG9B 3M6HA 4OOYA 3Q1FA 2QZ6A 4WBGA 2DRWA 3WS1A 1K56D 1ES2A 2J9PA 3HBRA 3PBOA 3UNWA 1I2SA 2ZC3B 4Y7PA 3ZCZA 4BQMA 4FH4A 3OC2A 2JE5A 1L0DA 2Z2LB 4CJNA 3VOZA 1ESUA 1K55A 2P74A 2ZM8A 4KZ7A 4OOMA 4MBHA 4XUXA 5HW3A 3HLDA 3BFFA 5FQMA 4N92A 2J8YA 5KSCA 3AGFA 3E2LA 3EQVA 1HTZA 1IKGA 3IXGA 5FA7A 4R4RA 2ZM2A 2ZQDA 4N1HA 2XLNA 3ZVWA 1NY0A 1YLZA 3OPLA 1K57C 3A3DA 4UAAA 3WS4A 3MZEA 5FAPA 1NRFA 2WUQA 4S2JA 3CG5A 3FV7A 4X6TA 1I2WA 2Y2HA 2WGWB 1H8YA 2Y2OA 4HEFA 2XD1A 4L0LA 3GMWA 3IWIA 3HLWA 4R3JA 1IYQA 3NDGA 4NK3A 1FSYA 1ONGA 5M1AA 4QY5A 1K56A 3UE1A 1GHIA 4BJPA 5FASA 3G31A 3SS3A 4E6WA 1PIOA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3K A;  3V3R A;  2Y55 A;  1S0W A;  1G6A A;  3S1Y A;  2IWD A;  3HL9 A;  4KG2 A;  3WS5 A;  2A3U A;  2WAE A;  4B88 A;  1CK3 A;  4OPY A;  3V39 A;  5EOO A;  1PWG A;  5EE8 A;  1XP4 A;  3UPN A;  4QD4 A;  1I5Q A;  5IHV A;  1DJB A;  3G35 A;  1PI4 A;  4DE3 A;  1JWV A;  1XGJ A;  1XXM A;  2XFS A;  4KZ4 A;  4C6Y A;  5M18 A;  1K57 A;  5BOH A;  4IVI A;  1W8Y A;  3RXX A;  3W8K A;  3ZNY A;  4Q8I A;  5HAP A;  1IEM A;  1ZG4 A;  3LEZ A;  5CGX A;  4EUZ A;  2Y2N A;  2WGV A;  4JXG A;  5CHM A;  2HDS A;  3VP1 A;  4BL2 A;  5DTK A;  2G2W A;  3G32 A;  1JWP A;  4JLF A;  4KZ9 A;  4UA9 A;  2H0T A;  4KZ3 A;  1L2S A;  1MBL A;  4UHU A;  3SH9 A;  3SS4 A;  2G2U A;  1RP5 A;  1E3U D;  3PAG A;  3ZGA B;  1XX2 A;  4GD6 A;  4E3N A;  2Y2M A;  1FR1 A;  1GHP A;  4EV4 A;  1GA9 A;  2WAD A;  5AQ7 A;  2GDN A;  4JXV A;  4U3T A;  2WGI A;  3BM6 A;  3MKE A;  3PBS A;  1MWR A;  3HLG A;  1H5X A;  1PWC A;  3E2K A;  5F1G A;  2V20 A;  3PBT A;  3P98 A;  5GLD A;  3N8L A;  2XR0 A;  4KZ5 A;  5HAI A;  5FDH A;  3N8R A;  1KVM A;  4RA7 A;  3ZG0 A;  4WEJ A;  3P09 A;  5CTM A;  4DRT A;  2ZC6 B;  3DWZ A;  2WKI A;  3Q81 A;  3UDX A;  1O07 A;  1XKZ A;  5FSR A;  4E3L A;  3DWK A;  1Z6F A;  4RX3 A;  1OME A;  3IF6 C;  1KE3 A;  3EQU A;  1NZU A;  2OSU A;  2BG1 A;  1BUL A;  2XGN A;  4LV1 A;  2Y59 A;  4DE0 A;  1KE0 A;  4LV3 A;  4GOG A;  4LCM A;  1E3U A;  5FQQ A;  3UDI A;  1CEG A;  4N9K A;  1K25 A;  3V50 A;  4DE2 A;  3V3S A;  4ZJ3 A;  2XF3 A;  3NCK A;  4OQI A;  4LCL A;  5FI6 A;  4O7D A;  4WZ5 C;  2OLU A;  1GCE A;  1FCO A;  3VFF A;  3C7U A;  1KGG A;  1TEM A;  2Y4A A;  3M6B A;  4B4Z A;  2ZQ8 A;  1JTG A;  1WYC A;  1K54 A;  1ALQ A;  1ERM A;  3BLM A;  4U0X A;  1ERO A;  4GNU A;  3FKW A;  3G34 A;  5EOE A;  3UE3 A;  1FQG A;  1HD8 A;  2ZLY A;  1EI5 A;  1QMF A;  2HP5 A;  3IHA A;  4U0T A;  4BL3 A;  1ZKJ A;  4JF4 A;  3QNC A;  4KQR A;  4B4X A;  1N4O A;  5FI2 A;  3O87 A;  3IF6 A;  5L2F A;  3LO7 A;  1NYM A;  5CGS A;  2Y2K A;  2C5W B;  3IXD A;  5I94 A;  3IHB A;  2A49 A;  4S2N C;  4QJG A;  1SHV A;  5GHX A;  4OP8 A;  1QME A;  2ZQ9 A;  4PM9 A;  4IVK A;  4X53 A;  3VSL A;  3LY3 A;  4RVA A;  5E2E A;  1YM1 A;  2ZC7 A;  5GLB A;  2IWB A;  1NXY A;  3AGD A;  4WMC D;  5CTN A;  3SH7 A;  1NYY A;  5FAO A;  4S2O A;  1IYP A;  4PPR A;  4BLM A;  1O7E A;  1PW8 A;  1ES5 A;  2UWX A;  4KG5 A;  4JKT A;  4R1G A;  4WZ5 A;  1LLB A;  3GRJ A;  1MKI A;  2ZQA A;  4EBP A;  1CEF A;  1MY8 A;  3LCE A;  1VM1 A;  4OVD A;  2ZD8 A;  1N9B A;  3MBZ A;  1ZC2 A;  3WRT A;  1IYO A;  3VP2 A;  3UPO A;  3TG9 A;  2EFU A;  1E4D A;  1MPL A;  5E2F A;  2R9W A;  4OQH A;  4KG6 A;  4LV0 A;  3M2J A;  1FOF A;  2ZC4 B;  3LY4 A;  5TFQ A;  2JBF A;  4S2N A;  1MWT A;  5DTS A;  3ZFZ A;  3BYD A;  5A92 A;  1FSW A;  2HDR A;  2E8I A;  2ZC5 B;  5EVL A;  5A90 A;  5FQK A;  1H8Z A;  3IXH A;  3N6I A;  5J8X A;  2XDM A;  3DTM A;  5CHJ A;  4WMC A;  3NI9 A;  2J9O A;  1L0G A;  4DF6 A;  1CI9 A;  3OPH A;  3VOY A;  5F1F A;  3TOI A;  2HP9 A;  1S6R A;  3Q7Z A;  1LL5 A;  4YFM A;  2ZQ7 A;  5HAR A;  3W4Q A;  4JF5 A;  5E43 A;  3MXS A;  3IQA A;  3OCL A;  3QNB A;  1W79 A;  3PBR A;  5HX9 A;  2Q9M A;  1TDG A;  4GDN A;  4KQQ A;  4JBF A;  4CPK A;  1FCN A;  4K0X A;  3NC8 A;  4HBT A;  4IED A;  3Q7V B;  3HUN A;  5TGF A;  4ZAM A;  5GLA A;  5E2G A;  2IWC A;  3IH8 A;  2JCH A;  1PYY A;  1XGI A;  4GB7 A;  4WEL A;  3M2K A;  4XXR A;  4ZDX A;  4R3B A;  3MZD A;  1KGE A;  2I72 A;  3DW0 A;  4BD1 A;  4Y0O A;  4ZJ1 A;  5A93 A;  3UY6 A;  3Q7V A;  2EX6 A;  4DXB A;  3HUM A;  4OQ0 A;  3N8S A;  4Y0U A;  1TDL A;  5G18 A;  2OLV A;  1JVJ A;  2XD5 A;  4QY6 A;  4BEN A;  1JTD A;  4C3Q A;  4PM5 A;  1CI8 A;  1ES4 A;  3Q07 A;  2WKE A;  3HLC A;  5CRF A;  5KZH A;  4C75 A;  3BLS A;  1WYB A;  3CZD A;  4WZ4 A;  3G4P A;  3MFD A;  4HES A;  1FCM A;  4OPR A;  1AXB A;  3W4O A;  3FZC A;  4X69 A;  3VP4 A;  5EPH A;  2V1Z A;  4JF6 A;  4QB8 A;  3S22 A;  1K6R A;  1YLP A;  3NDE A;  4ZBE A;  3MKF A;  1DJC A;  2QPN A;  1LL9 A;  3UN7 A;  4H8R A;  4PM7 A;  1K4F A;  3G30 A;  2HDQ A;  3UPP A;  4BD0 A;  1HVB A;  4FCF A;  3A3I A;  3WS0 A;  1HZO A;  2WZX A;  3QHY A;  1LI0 A;  2Z2M B;  4X56 A;  4EWF A;  1TVF A;  2PU2 A;  3IXB A;  3N4I A;  4P85 A;  4GDB A;  3PAE A;  2FFF B;  4KZA A;  1BTL A;  1GA0 A;  1Y54 A;  3IF6 B;  3Q82 A;  3ZG5 A;  1M6K A;  2VGK A;  1YLJ A;  3IWO A;  4DKI A;  5JYP A;  4JXS A;  3HVF A;  5EUA A;  1LI9 A;  4OPQ A;  4JPM A;  2H5S A;  3N7W A;  4PM6 A;  4GKU A;  3RXW A;  3C7V A;  1K6S A;  4KZB A;  5GL9 A;  3ZG8 B;  3OPP A;  3WRZ A;  5EVI D;  5EVI C;  1BLP A;  4QU3 A;  5CER A;  1GHM A;  4OH0 A;  3S4X A;  5HFO A;  4R4S A;  1M40 A;  2HP6 A;  4GN2 A;  4PM8 A;  4Z9Q A;  5HAQ A;  1YLT A;  4KEN B;  5M19 A;  4JXW A;  1KE4 A;  3GSG A;  4R23 A;  5FAT A;  3ITB A;  4WM9 A;  1ERQ A;  3SS5 A;  3VP3 A;  4NET A;  3OZH A;  2ZJ9 A;  3PTE A;  3C5A A;  5EVI B;  5CEB A;  2Y2Q A;  3MXR A;  3HUO A;  3O88 A;  4QHC A;  3CJM A;  3G2Z A;  2RL3 A;  5KMW A;  4KZ6 A;  1NZO A;  5AQB A;  1IYS A;  1IEL A;  4OLG A;  2X01 A;  4E3I A;  2EX8 A;  3OCN A;  3WWX A;  1BZA A;  3SOI A;  4E3J A;  1YMS A;  3VMA A;  3NIA A;  3BFG A;  3HLF A;  2XQZ A;  5EVI A;  4MBK A;  4MNR A;  4D2O A;  4S2I A;  3W4P A;  3A3J A;  1BSG A;  1WE4 A;  3FWL A;  4DDY A;  4ID4 A;  1SDE A;  3ZDJ A;  3HRE A;  3BFE A;  4K91 A;  4OKP A;  2ZMA A;  3C4O A;  4P0M A;  5AQA A;  5JYO A;  1KDS A;  1JWZ A;  1ZG6 A;  4GZB A;  4KZ8 A;  4OLD A;  3UDF A;  1G68 A;  1MXO A;  5EEC A;  5A91 A;  5FI7 A;  1YLY A;  4PMA A;  4RX2 A;  1MWS A;  2C6W B;  3ZVT A;  1KDW A;  2WYX A;  3A3F A;  5CHU A;  4EQI A;  1YLW A;  1MWU A;  2FFY A;  5D3O A;  3WS2 A;  4X68 A;  1BLS A;  1PW1 A;  3JYI A;  2WKH A;  3PBQ A;  4R0Q A;  1W7F A;  5FQI A;  1RGY A;  3BFD A;  4EBN A;  2WK0 A;  1E25 A;  3GQZ A;  1ONH A;  4F94 A;  3V5M A;  2EXA A;  3NBL A;  1IKI A;  2JC7 A;  3O86 A;  3BEB A;  1LHY A;  2X71 A;  4IBX A;  4S2P A;  3MZF A;  3FKV A;  1EWZ A;  1SDN A;  2Y2I A;  3C4P A;  4N1X A;  5FQJ A;  3VP0 A;  3FYZ A;  1W8Q A;  3HLE A;  1W5D A;  4UA7 A;  1DY6 A;  4WYY A;  2R9X A;  1XPB A;  1ES3 A;  4OQG A;  1PWD A;  3GR2 A;  2WGW A;  2B5R A;  3A3E A;  3IWQ A;  5FAQ A;  2H10 A;  2EFX A;  5GHY A;  5E2H A;  2Y2G A;  4MBF A;  3BFC A;  5DVA A;  2H0Y A;  4E3M A;  4UA6 A;  4RYE A;  4MEZ A;  2DCF A;  4N9L A;  1L0F A;  3VSK A;  3GTC A;  3NY4 A;  1SKF A;  2P9V B;  1PI5 A;  3IT9 A;  4E3K A;  1RGZ A;  4S2M A;  5DF9 A;  3CMZ A;  4XUZ A;  4DE1 A;  2RCX A;  3G2Y A;  3IF5 A;  4YIN A;  2WAF A;  5CED A;  3ZNT A;  2V2F F;  4OON A;  4OP5 A;  2WZZ A;  4GD8 A;  2OV5 A;  1RCJ A;  3BEC A;  3I7J A;  4WEK A;  3SH8 A;  3O3V A;  1SCW A;  2X02 A;  4X55 A;  4FH2 A;  5F82 A;  4Y0T A;  4S2K A;  1BLH A;  2EXB A;  2HDU A;  4KQO A;  1K4E A;  2P9V A;  1Q2P A;  3ITA A;  4HBU A;  4DDS A;  3B3X A;  4FD8 A;  1K54 C;  1YT4 A;  1Q2Q A;  2ZM0 A;  5F83 A;  3ISG A;  1XA1 A;  1YQS A;  5CXW A;  1DJA A;  4MLL A;  1FR6 A;  1NJ4 A;  3VFH A;  4DXC A;  4ZTK A;  2EX2 A;  3D4F A;  1PZP A;  3HLB A;  1K38 A;  5DF8 A;  2DNS A;  4OPZ A;  5HL1 A;  2Y2P A;  4FSF A;  2EX9 A;  1KVL A;  4P87 A;  2XFT A;  1ESI A;  5CEC A;  5DF7 A;  1XA7 A;  4S2L A;  2ZQC A;  2VGJ A;  2XH9 A;  2J7V A;  1L0E A;  5KSH A;  2QMI A;  2Y2J A;  5FQ9 A;  3PBN A;  1BT5 A;  4EBL A;  3UO9 A;  4OOL A;  1J9M A;  1K55 C;  3TSG A;  4LV2 A;  5DTT A;  1U60 A;  2Y91 A;  3UE0 A;  2CC1 A;  5GHZ A;  5U47 A;  4P6B A;  1YMX A;  3ZG7 B;  4LEN A;  5TR7 A;  4A5R A;  2HPB A;  1BUE A;  2BLS A;  2Y2L A;  3AGE A;  5GLC A;  1C3B A;  3BRM A;  2PBY A;  2PU4 A;  3OPR A;  5AQ9 A;  2Q9N A;  4K0W A;  4ZJ2 A;  1PZO A;  3RJU A;  3ZHH A;  3IH9 A;  3GV9 A;  3GVB A;  1VQQ A;  5CGW A;  2XK1 A;  4IBR A;  4E6X A;  1BLC A;  1KGF A;  4E3O A;  3ZG9 B;  3M6H A;  4OOY A;  3Q1F A;  2QZ6 A;  4WBG A;  2DRW A;  3WS1 A;  1K56 D;  1ES2 A;  2J9P A;  3HBR A;  3PBO A;  3UNW A;  1I2S A;  2ZC3 B;  4Y7P A;  3ZCZ A;  4BQM A;  4FH4 A;  3OC2 A;  2JE5 A;  1L0D A;  2Z2L B;  4CJN A;  3VOZ A;  1ESU A;  1K55 A;  2P74 A;  2ZM8 A;  4KZ7 A;  4OOM A;  4MBH A;  4XUX A;  5HW3 A;  3HLD A;  3BFF A;  5FQM A;  4N92 A;  2J8Y A;  5KSC A;  3AGF A;  3E2L A;  3EQV A;  1HTZ A;  1IKG A;  3IXG A;  5FA7 A;  4R4R A;  2ZM2 A;  2ZQD A;  4N1H A;  2XLN A;  3ZVW A;  1NY0 A;  1YLZ A;  3OPL A;  1K57 C;  3A3D A;  4UAA A;  3WS4 A;  3MZE A;  5FAP A;  1NRF A;  2WUQ A;  4S2J A;  3CG5 A;  3FV7 A;  4X6T A;  1I2W A;  2Y2H A;  2WGW B;  1H8Y A;  2Y2O A;  4HEF A;  2XD1 A;  4L0L A;  3GMW A;  3IWI A;  3HLW A;  4R3J A;  1IYQ A;  3NDG A;  4NK3 A;  1FSY A;  1ONG A;  5M1A A;  4QY5 A;  1K56 A;  3UE1 A;  1GHI A;  4BJP A;  5FAS A;  3G31 A;  3SS3 A;  4E6W A;  1PIO A;  2XEP A; 
#chains in the Genus database with same CATH topology
 3MF0 A;  3DTK A;  4FUW A;  1G6A A;  4EER A;  3V39 A;  1D06 A;  4EES A;  1PWG A;  4R38 A;  1PI4 A;  1XXM A;  2VV8 A;  1W63 M;  4IVI A;  3W8K A;  3CHW P;  5HAP A;  3LEZ A;  1ZG4 A;  3LEQ A;  3B47 A;  5CHM A;  5HWW A;  3VP1 A;  4BL2 A;  3G32 A;  4JLF A;  3T1R A;  2L4R A;  1L2S A;  4UHU A;  3SH9 A;  1E3U D;  2Y2M A;  1GA9 A;  2PT7 A;  4JXV A;  2WGI A;  3HLG A;  3E2K A;  3PBT A;  3P98 A;  5FDH A;  3ZG0 A;  4HJ4 A;  4WEJ A;  3P09 A;  3T4S A;  2WKI A;  1O07 A;  5FSR A;  4HH2 A;  3DWK A;  1Z6F A;  1P0Z A;  4CLC D;  3IF6 C;  1KE3 A;  3SW1 A;  2V8C A;  3QP6 A;  2EWW A;  3TRC A;  3UDI A;  3DTE A;  4ZJ3 A;  3P01 A;  2HZ5 A;  3IBJ A;  4O01 A;  4LCL A;  3OLO A;  1FCO A;  1ALQ A;  4GNU A;  3FKW A;  5DKK A;  3KSG A;  4XT2 A;  1FQG A;  3TJZ C;  1HD8 A;  1EI5 A;  4BL3 A;  3HJK A;  5FI2 A;  3PXP A;  1BYW A;  2OAP 1;  4PKY A;  2P08 A;  2VEA A;  1DP6 A;  5CGS A;  2Y2K A;  3IHB A;  4GHI A;  4OP8 A;  4QWO A;  4PM9 A;  4IVK A;  4GS9 A;  3LY3 A;  5E2E A;  5L07 A;  1NYY A;  4PPR A;  2V1A A;  4BLM A;  1PW8 A;  2UWX A;  2W3E A;  2ZQA A;  3LUQ A;  5HL6 A;  3K2N A;  3UPO A;  3TG9 A;  2R9W A;  4LV0 A;  1H3Q A;  5TFQ A;  2R78 A;  5DTS A;  2G7U A;  5F1F A;  2KLI A;  3NI9 A;  3VOY A;  2KX6 A;  3CI6 A;  1LL5 A;  3W2Z A;  2ZQ7 A;  2KOI A;  4JGP A;  3W4Q A;  4UQI S;  5E43 A;  3OCL A;  3T4L A;  4GDN A;  4CPK A;  4ETZ A;  4K0X A;  3NC8 A;  4IED A;  3UMD A;  2WKP A;  2IWC A;  3CIT A;  1PYY A;  4LRX C;  2I72 A;  3DW0 A;  4Y0O A;  4DXB A;  1MC0 A;  2QKP A;  1TDL A;  3CUE C;  1JVJ A;  2XD5 A;  4BEN A;  4PM5 A;  2ZOI A;  4HOI A;  1ES4 A;  2WKE A;  4IHQ A;  4LLO B;  2JKF A;  4WZ4 A;  1FIL A;  3FZC A;  3BQ8 A;  3S22 A;  2O0Y A;  1LL9 A;  4IJG A;  1HVB A;  2CMN A;  3WS0 A;  1LI0 A;  2PU2 A;  3N4I A;  4GDB A;  1BTL A;  3F1P A;  3Q82 A;  3ZG5 A;  1M6K A;  2VGK A;  4FTX A;  4DKI A;  5JYP A;  3UE6 A;  3KX0 X;  5EUA A;  1LI9 A;  3L7H A;  4H6J A;  2H5S A;  3RXW A;  3C7V A;  4QPR A;  4KZB A;  5GL9 A;  2GZA A;  5LBR A;  1BLP A;  4QU3 A;  5CER A;  2PAV P;  1S1Y A;  5HFO A;  4PM8 A;  1LL8 A;  3ITB A;  3KO6 A;  4WM9 A;  4BBU A;  4JGQ A;  3PTE A;  5EVI B;  2Y2Q A;  3HUO A;  3CJM A;  5AQB A;  1IYS A;  4OLG A;  2X01 A;  1LSW A;  3OCN A;  1XJ6 A;  4E3J A;  1YMS A;  4RQ9 A;  2J3T C;  1V9Z A;  4D2O A;  4PHT A;  3A3J A;  1SKO A;  1SDE A;  2JHE A;  3ZDJ A;  3BFE A;  4OKP A;  4P0M A;  5JYO A;  4OLD A;  4KZ8 A;  5L09 A;  4G3K A;  1MXO A;  1YLY A;  2PR6 A;  4RX2 A;  2YKF A;  3IX4 A;  1KDW A;  3CLO A;  2OOL A;  5HPF A;  4Q0H A;  4X68 A;  2J80 A;  3U4L P;  1ODV A;  4EBN A;  1ONH A;  4F94 A;  3V5M A;  1FIK A;  3NBL A;  3O86 A;  1LHY A;  2X71 A;  3A0V A;  3E4O A;  1EWZ A;  1SDN A;  5FQJ A;  1OJG A;  1W5D A;  4WF0 A;  4YWZ A;  4GCZ A;  5TJJ A;  5GHY A;  5E2H A;  2H0Y A;  2P7J A;  4HY8 A;  3H82 B;  1P9R A;  4MEZ A;  1S4R A;  4E04 A;  4DE1 A;  4YIN A;  4OP5 A;  4O0P A;  3B42 A;  4P6Z M;  4X55 A;  4FH2 A;  4HNB A;  2P9V A;  1Q2P A;  3B3X A;  3ULF A;  5EFW A;  3ISG A;  5AVF A;  4ZTK A;  2EX2 A;  3D4F A;  4OPZ A;  4EEP A;  1VHM A;  5CEC A;  2XH9 A;  1L0E A;  5KSH A;  2Y2J A;  2ZMV A;  1J9M A;  1VEU A;  2V8F A;  1U60 A;  2M1C A;  2CC1 A;  5FL3 A;  5TR7 A;  1KOU A;  4HHD A;  2OWJ A;  3AGE A;  1XJ3 A;  2Q9N A;  4NXB A;  4E6X A;  4E3O A;  3Q1F A;  2J9P A;  4BQM A;  4PKY G;  4FH4 A;  1IFQ A;  2JE5 A;  3VOZ A;  4MBH A;  5HW3 A;  1S4S A;  3AGF A;  3EQV A;  3H7W B;  3IXG A;  5FA7 A;  2ZM2 A;  1NY0 A;  2VK3 A;  3MZE A;  5J4E A;  5FAP A;  1NRF A;  4S2J A;  2W3G A;  4X6T A;  4L0L A;  4HEF A;  2D01 A;  2XD1 A;  3IS2 A;  5KIZ A;  4QY5 A;  4BJP A;  3G31 A;  3SS3 A;  3C30 A;  1PIO A;  2HV1 A;  2D02 A;  2Y55 A;  1N9L A;  3WS5 A;  2A3U A;  5EOO A;  1I5Q A;  5IHV A;  1JWV A;  4Y13 A;  5BOH A;  4Q8I A;  1OTI A;  5HDS A;  3KSH A;  4EUZ A;  5K5B A;  2HDS A;  2PDR A;  5DTK A;  1JWP A;  4UA9 A;  4KZ9 A;  1WA9 A;  1MBL A;  4GLQ A;  3ZGA B;  1XX2 A;  3JVU A;  1GHP A;  2GDN A;  4KUK A;  4U3T A;  3BM6 A;  3MKE A;  2JN7 A;  2NUP C;  5GLD A;  2PR5 A;  3N8L A;  2XR0 A;  3N8R A;  5HWT A;  4LGW A;  3UB8 A;  4NG2 A;  3Q81 A;  3D3O A;  4WN5 A;  3T1X A;  4EET B;  2BG1 A;  4LV1 A;  4DE0 A;  4LV3 A;  4CQH A;  4XT2 B;  5FQQ A;  4DE2 A;  3V3S A;  2XF3 A;  3NCK A;  4OQI A;  1OT6 A;  1DP9 A;  4WZ5 C;  3E4Q A;  2OLU A;  1TEM A;  2ZQ8 A;  3FPW A;  1Y4O A;  4U0X A;  1TS0 A;  3C8C A;  2GJ3 A;  3G34 A;  2KDK A;  3S7P A;  4KUO A;  3IHA A;  3KYZ A;  1ZKJ A;  4B4X A;  3NHQ A;  3QNC A;  1N4O A;  3IF6 A;  5L2F A;  1NYM A;  4EQ1 A;  4L9E A;  2A49 A;  4QJG A;  2ZOH A;  1QME A;  3VSL A;  2ZC7 A;  1YPR A;  1IYP A;  4NKP A;  1VET A;  1LLB A;  2Z6C A;  1G28 A;  4DJ2 A;  1T19 A;  3T4J A;  3E0Y A;  1MKI A;  4LRZ E;  4OVD A;  1T1B A;  4NEE D;  1E4D A;  1MPL A;  1TS6 A;  3ZQ5 A;  3M2J A;  3LY4 A;  5A92 A;  5FQK A;  1H8Z A;  3DBA A;  3DTM A;  3LYX A;  4WMC A;  3MS6 A;  4DF6 A;  1S6R A;  3JVV A;  3BY8 A;  5HZH A;  3IQA A;  3QNB A;  1W79 A;  4KQQ A;  2QYB A;  5IU1 A;  3HUN A;  1T18 A;  4I39 A;  4ZAM A;  5GLA A;  4L9G A;  4F3L A;  5HD3 A;  3IH8 A;  1XGI A;  3CWF A;  3LI9 A;  3R4K A;  5A93 A;  3Q7V A;  1ZTU A;  2J3W A;  3HUM A;  3N8S A;  1F5M A;  5IS1 A;  4LRY C;  4QY6 A;  5KZH A;  2Y79 A;  4HP9 A;  1WYB A;  4HES A;  4OPR A;  2GX5 A;  3VP4 A;  5EPH A;  1K6R A;  2FH5 A;  3UN7 A;  1PFL A;  1K4F A;  2HDQ A;  3A3I A;  3LFV A;  4P85 A;  3CAX A;  3KSI A;  4KZA A;  3LI8 A;  1Y54 A;  3CUE A;  3HVF A;  3DTI A;  4UEY A;  4JPM A;  4GKU A;  2W1R A;  1P9W A;  2JKG A;  5EVI D;  2V0W A;  1GHM A;  3S4X A;  2VGL M;  4PAU A;  4DJ3 A;  3D72 A;  1YLT A;  4R23 A;  4B9O A;  3SS5 A;  3PR6 A;  2OAQ 1;  3OZH A;  3C5A A;  3D9Y A;  2QHK A;  4QHC A;  1SKO B;  4P6Z S;  1YSQ A;  4KZ6 A;  1IEL A;  4E3I A;  2ZL1 A;  3ICY A;  3SOI A;  3QP8 A;  3NIA A;  3HLF A;  2XQZ A;  4MBK A;  4MNR A;  3E98 A;  3W4P A;  3ZYT A;  1BSG A;  2IA2 A;  3HRE A;  2ZMA A;  3C4O A;  4GZB A;  2E8J A;  5EEC A;  2C6W B;  1TF1 A;  3GDI A;  2VKS A;  3A3F A;  4MN7 A;  1MWU A;  4ZRR A;  3LR0 A;  2Z6D A;  3PBQ A;  4R0Q A;  5FQI A;  3BFD A;  1STZ A;  2W0N A;  2WK0 A;  3BY9 A;  1IKI A;  2P04 A;  3FKV A;  4N1X A;  1NLY A;  1XPB A;  3F1N A;  4OQG A;  1PWD A;  3GR2 A;  2WGW A;  2B5R A;  3BFC A;  5DVA A;  3T12 B;  5MC7 A;  1Z09 A;  1L0F A;  4ME4 A;  3GTC A;  2P9V B;  1PI5 A;  1RGZ A;  4S2M A;  4XUZ A;  3UB6 A;  2WAF A;  2V2F F;  3NOU C;  4YNR A;  2OV5 A;  3BEC A;  1J3W A;  3O3V A;  2X02 A;  4S2K A;  2HDU A;  1K4E A;  3BWL A;  3ITA A;  4HBU A;  4DDS A;  1OJ5 A;  4FD8 A;  3T4T A;  1Q2Q A;  1DJA A;  2B95 A;  2XA7 M;  1VEU B;  2Y2P A;  1NWZ A;  2EX9 A;  1KVL A;  3O5Y A;  4P87 A;  4Y2F A;  1XA7 A;  4S2L A;  3UO9 A;  4OOL A;  1K55 C;  4X1M A;  5GHZ A;  4P6B A;  1YMX A;  5IT5 A;  4WL9 A;  2ZMF A;  2HPB A;  4MN6 A;  5GLC A;  1C3B A;  3BRM A;  2PU4 A;  3OPR A;  5AQ9 A;  4ZJ2 A;  1PZO A;  3ZHH A;  2W3F A;  4LFU A;  2W3D A;  1BLC A;  1KGF A;  1AWI A;  3M6H A;  3LR3 A;  1S67 L;  2DRW A;  3MMH A;  3WS1 A;  1K56 D;  1ES2 A;  3HBR A;  2O9A A;  1L0D A;  4KZ7 A;  4OOM A;  2I9V A;  3BFF A;  5KSC A;  4R70 A;  4R4R A;  1GSW A;  4IUK A;  4BWI A;  3ZVW A;  1K57 C;  4UAA A;  4HIA A;  3K3C A;  3C38 A;  1SZV A;  4EXO A;  2Y2H A;  5DJU A;  4ARZ B;  2Y2O A;  3IWI A;  3UB5 P;  2HGV A;  4R3J A;  1IYQ A;  3UE1 A;  4E6W A;  2ZM8 A;  2XEP A;  4KG2 A;  2WAE A;  4B88 A;  3EGD C;  5EE8 A;  1XP4 A;  3UPN A;  1DJB A;  2HF6 A;  2HJE A;  2A24 A;  4KZ4 A;  1CJF A;  1W8Y A;  3BW6 A;  3RXX A;  3ZNY A;  1IEM A;  2K7S A;  1S66 L;  3JPU A;  2WGV A;  4HQA A;  4ETX A;  4KZ3 A;  3IX8 A;  2M7V A;  3SS4 A;  1RP5 A;  3PAG A;  1FR1 A;  4EV4 A;  4AFI A;  2WAD A;  3T1S A;  5HDD A;  5EVE A;  3PBS A;  1MWR A;  1PWC A;  5F1G A;  2V20 A;  3EWK A;  4I38 A;  5G4Z A;  3VOL A;  1UGU A;  3LIA A;  5CTM A;  4DRT A;  3MQQ A;  2W1T A;  2ZC6 B;  3UDX A;  4BBT A;  4E3L A;  4RX3 A;  3K3D A;  4HH3 A;  5F5Y A;  1KE0 A;  1TS7 A;  4LCM A;  1E3U A;  1CEG A;  4N9K A;  3FPV A;  1K0K A;  3VFF A;  3M6B A;  2NUT C;  4B4Z A;  3BLM A;  1K54 A;  1ERO A;  2L1M A;  4EW7 A;  1EW0 A;  5EOE A;  2ZLY A;  4M4X A;  2HP5 A;  3LR5 A;  4JF4 A;  4KQR A;  5HD5 A;  4CLC A;  3O87 A;  4Y5F A;  4G3V A;  3S7O A;  2B18 A;  3IXD A;  4S2N C;  1SHV A;  5GHX A;  2ZQ9 A;  4HI4 A;  2EA9 A;  2VLG A;  1YM1 A;  5GLB A;  2IWB A;  1NXY A;  3AGD A;  2BAS A;  5M19 A;  1O7E A;  1ES5 A;  2O9C A;  4KG5 A;  4WZ5 A;  1IOU A;  3GRJ A;  1XJ4 A;  1F2K A;  4EBP A;  3LCE A;  1VM1 A;  2ZD8 A;  4I3I A;  3MBZ A;  3WRT A;  1IYO A;  3VP2 A;  2EFU A;  3LIB A;  5E2F A;  4KG6 A;  1FOF A;  2ZC4 B;  3C2W A;  1MWT A;  1F9I A;  5EVL A;  1YAX A;  4L9F A;  3RFB A;  5A90 A;  2PHY A;  2XDM A;  5C5K A;  5CHJ A;  1CI9 A;  3MXQ A;  4NXE A;  1MZU A;  2VGL S;  3MXS A;  5HX9 A;  1TDG A;  4JBF A;  3T4O A;  3BQA A;  3Q7V B;  3R7W A;  2JCH A;  3M2K A;  4R3B A;  4BMW A;  3MZD A;  1H8M A;  2DMW A;  4FOF A;  3UY6 A;  5A8B A;  4Y0U A;  4C3Q A;  3QP1 A;  1CI8 A;  3Q07 A;  3UME A;  2JKT M;  1FCM A;  1AXB A;  4X69 A;  1OT9 A;  2V1Z A;  4QB8 A;  3A0R A;  1YLP A;  5L8M A;  3H82 A;  4H8R A;  4BD0 A;  4FCF A;  2WZX A;  4X56 A;  3NJA A;  2Z2M B;  1TVF A;  5HSQ A;  3PAE A;  2FFF B;  1GA0 A;  2O99 A;  1YLJ A;  3IWO A;  3BJN A;  2PRF A;  4GHI B;  3EEA A;  4JXS A;  3H9W A;  4GS9 B;  1OPX A;  1DRM A;  4OPQ A;  4GW9 A;  4PM6 A;  1K6S A;  3ZG8 B;  1L3L A;  2V9A A;  5EVI C;  1M40 A;  4GN2 A;  4KQD A;  4HJ3 A;  3EOI A;  3GSG A;  1ERQ A;  2A2L A;  3VP3 A;  4NET A;  3T4Q A;  5DJT A;  5CEB A;  3MXR A;  3NEC A;  3O88 A;  4D60 A;  2RL3 A;  2ZBB A;  2XRO A;  1NZO A;  3WWX A;  1BZA A;  3U2A A;  3BFG A;  3MQ0 A;  2XA7 S;  2OWH A;  4K91 A;  5AQA A;  1KDS A;  1Y28 A;  2YKH A;  5F69 A;  5A91 A;  4MN5 A;  5FI7 A;  4X25 A;  1MWS A;  3ZVT A;  2WYX A;  3CPT A;  5CHU A;  4EQI A;  4YOF A;  1N9N A;  1YLW A;  5D3O A;  1BLS A;  1PW1 A;  3JYI A;  3F1N B;  1RGY A;  3GQZ A;  5TBM A;  1V9Y A;  5J7E A;  2EXA A;  3OOV A;  1G6O A;  1JNU A;  2Q0O A;  3FYZ A;  3HLE A;  1NRJ A;  2VZW A;  4UA7 A;  4WYY A;  2R9X A;  1D7E A;  3IWQ A;  3VE3 A;  2H10 A;  3P7N A;  3E4P A;  2VV6 A;  4E3M A;  4UA6 A;  2DCF A;  4N9L A;  3NY4 A;  4E3K A;  5L10 A;  2EWV A;  5DF9 A;  3CMZ A;  2RCX A;  3G2Y A;  3IF5 A;  5CED A;  3DAV A;  2JKT I;  3F1P B;  4GD8 A;  1RCJ A;  1TD5 A;  3I7J A;  4WEK A;  3SH8 A;  1SCW A;  5F82 A;  2EXB A;  1MKM A;  4H6J B;  2ZM0 A;  4Q0J A;  5F83 A;  1YQS A;  3LIC A;  2W27 A;  1FR6 A;  3T50 A;  1NJ4 A;  3VFH A;  4DXC A;  2DNS A;  5HL1 A;  2PD8 A;  4DMZ A;  5HPI A;  2L0W A;  3B33 A;  3KYQ A;  1ESI A;  5DF7 A;  2VGJ A;  1ZHH B;  3PBN A;  1BT5 A;  4EBL A;  1XJ2 A;  3TSG A;  5DTT A;  3HCY A;  3EEH A;  5U47 A;  3ZG7 B;  5DFX A;  1BUE A;  2Y2L A;  1LT0 A;  4K0W A;  2INW A;  3GVB A;  3HJI A;  1VQQ A;  4R6L A;  4NXG A;  1DP8 A;  1NLZ A;  2PYP A;  4WBG A;  3F1O A;  1I2S A;  2ZC3 B;  3ZCZ A;  4DN0 A;  4EEU A;  2Z2L B;  4CJN A;  1K55 A;  3HLD A;  5FQM A;  2J8Y A;  3E2L A;  1IKG A;  1HTZ A;  4N1H A;  1XFN A;  1YLZ A;  1UWN X;  1H0M A;  2VA0 A;  3WS4 A;  2WUQ A;  3CG5 A;  1H8Y A;  1XFQ A;  3GMW A;  3HLW A;  4NK3 A;  1FSY A;  1ONG A;  5M1A A;  2A24 B;  1GHI A;  5FAS A;  3UB7 A;  5FEF A;  4M3K A;  3V3R A;  1S0W A;  3EGX C;  3VE4 A;  3S1Y A;  2IWD A;  3HL9 A;  2PYR A;  3LGO A;  1CK3 A;  4OPY A;  4QD4 A;  3G35 A;  4DE3 A;  1XGJ A;  2LB5 A;  2XFS A;  4C6Y A;  5M18 A;  1K57 A;  1ACF A;  4Y3I A;  5CGX A;  2Y2N A;  4JXG A;  1YSP A;  2G2W A;  2HJ9 C;  1YKD A;  2H0T A;  2G2U A;  4GD6 A;  4E3N A;  2W1T B;  5AQ7 A;  1H5X A;  4Q0I A;  4KZ5 A;  5HAI A;  1F98 A;  3TE8 A;  1KVM A;  4RA7 A;  3S7N A;  2WKR A;  2ACG A;  3DWZ A;  1XKZ A;  1OME A;  3EQU A;  3MJQ A;  1CQA A;  1NZU A;  2OSU A;  5DFY A;  2V1B A;  1BUL A;  2XGN A;  2Y59 A;  3S7Q A;  5DKL A;  4GOG A;  4MMN A;  1K25 A;  3V50 A;  3MR0 A;  2B02 A;  3NOP C;  4CLC B;  5FI6 A;  4O7D A;  1GCE A;  1OTE A;  2Y8H A;  1KGG A;  3C7U A;  2Y4A A;  1JTG A;  1WYC A;  1ERM A;  4Y17 A;  3KSF A;  3UE3 A;  1X0O A;  1QMF A;  4U0T A;  3LO7 A;  2C5W B;  5I94 A;  4LPZ A;  5G4Y A;  3QP5 A;  4X53 A;  4Z1W A;  1LSV A;  3L9K A;  1OTA A;  3IX3 A;  4RVA A;  4WMC D;  3SH7 A;  5CTN A;  5FAO A;  3SZT A;  4S2O A;  3TW8 A;  4JKT A;  1UWP X;  4R1G A;  2GNX A;  3IS2 B;  5J3W A;  5F6A A;  2PBD P;  1CEF A;  1MY8 A;  4IUH A;  2H28 A;  1N9B A;  1ZC2 A;  5AVE A;  4OQH A;  2JKR M;  1N9O A;  4EU0 A;  2JBF A;  4S2N A;  3ZFZ A;  3BYD A;  1FSW A;  2HDR A;  2E8I A;  2ZC5 B;  3IXH A;  3N6I A;  5J8X A;  2J9O A;  1L0G A;  3OPH A;  3R7W B;  3TOI A;  2HP9 A;  3Q7Z A;  4YFM A;  5HAR A;  4JF5 A;  3PBR A;  2Q9M A;  1FCN A;  4HBT A;  5TGF A;  2MJ6 A;  3NUL A;  1CF0 A;  5E2G A;  4GB7 A;  4WEL A;  4XXR A;  4ZDX A;  1S1Z A;  3G6O A;  4CLC E;  1KGE A;  4BD1 A;  4WUJ A;  4ZJ1 A;  2EX6 A;  4OQ0 A;  5G18 A;  1GSV A;  2OLV A;  1JTD A;  5EM0 A;  5EM1 A;  5CRF A;  3HLC A;  3GEC A;  4C75 A;  3LID A;  3BLS A;  3CZD A;  1VB6 A;  3G4P A;  3MFD A;  2K2N A;  3W4O A;  4JF6 A;  3KYE A;  2UV0 E;  1G5U A;  3NDE A;  4ZBE A;  4Y15 A;  3MKF A;  1DJC A;  2QPN A;  3PHY A;  1D1J A;  4HJ6 A;  4PM7 A;  3G30 A;  3UPP A;  5EV0 A;  1HZO A;  3QHY A;  4EWF A;  2VV7 A;  3IXB A;  2QJ5 A;  2WKQ A;  3FG8 A;  3IF6 B;  2XSS A;  3N7W A;  3OPP A;  2W3H A;  3WRZ A;  3MSH A;  4OH0 A;  1VET B;  4R4S A;  2HP6 A;  4Z9Q A;  5HAQ A;  2AVX A;  4UQI M;  4KEN B;  4JXW A;  1KE4 A;  5FAT A;  2V0U A;  4NXF A;  2ZJ9 A;  2K31 A;  3T1Q B;  4X1L A;  3G2Z A;  5KMW A;  3RH8 B;  4R3A A;  5F68 A;  2EX8 A;  3VMA A;  2J3T D;  5EVI A;  3CPT B;  4S2I A;  1WE4 A;  4DDY A;  3FWL A;  4ID4 A;  1ZG6 A;  1JWZ A;  3UDF A;  3LIE A;  5HDC A;  1G68 A;  3LIF A;  2JKR I;  2XRN A;  3OBF A;  5TBM B;  4PMA A;  2QJ7 A;  2VX8 A;  2BTF P;  4F3L B;  2FFY A;  3WS2 A;  1PNE A;  2WKH A;  2M7U A;  1W7F A;  1E25 A;  4K08 A;  2JC7 A;  3BEB A;  4IBX A;  4S2P A;  3MZF A;  2Y2I A;  3C4P A;  3VP0 A;  3FC7 A;  1W8Q A;  1DY6 A;  1ES3 A;  4ARZ A;  3IBR A;  1LSX A;  3A3E A;  5FAQ A;  2EFX A;  2Y2G A;  4MBF A;  3V67 A;  3NOT C;  5FDS A;  4I5S A;  4RYE A;  3VSK A;  1SKF A;  3IT9 A;  3PYP A;  5FEG A;  3ZNT A;  4OON A;  2WZZ A;  4Y0T A;  1BLH A;  4KQO A;  4O8G A;  1K54 C;  1YT4 A;  2O9B A;  1XA1 A;  3T4K A;  2VJW A;  1W63 Q;  5CXW A;  4MLL A;  2LB9 A;  1PZP A;  4CLC C;  3A0S A;  3HLB A;  1K38 A;  5DF8 A;  4FSF A;  2XFT A;  4I3J A;  2ZQC A;  2J7V A;  1HLU P;  2QMI A;  5FQ9 A;  3MFX A;  1OTD A;  4JGR A;  4G3W A;  4LV2 A;  1PRQ A;  2Y91 A;  3UE0 A;  5CX7 A;  3RTY A;  2ZL1 B;  4LEN A;  5I5L A;  5AJG A;  4A5R A;  3F1O B;  2BLS A;  3VV4 A;  2PBY A;  2QWS A;  4I3A A;  3QP4 A;  3MQO A;  3RJU A;  3IH9 A;  2FZ0 A;  3GV9 A;  4MCW A;  5CGW A;  2XK1 A;  4IBR A;  4MDZ A;  4EUV A;  3ZG9 B;  4OOY A;  1T1A A;  2QZ6 A;  1T1C A;  3PBO A;  4JGO A;  3UNW A;  4Y7P A;  1GSX A;  3OC2 A;  1ESU A;  2P74 A;  4XUX A;  4N92 A;  4II7 A;  2ZQD A;  1P97 A;  3LR4 A;  4GJ4 A;  2XLN A;  1OTB A;  3OPL A;  4ESP A;  3A3D A;  3UB9 A;  4BBV A;  4HP4 A;  4B93 A;  4WLA A;  3FV7 A;  1I2W A;  2WGW B;  3QP2 A;  3H7W A;  3NDG A;  1K56 A;  1TS8 A;  2PD7 A;  5HWV A;  1A0K A; 
#chains in the Genus database with same CATH homology
 4M3K A;  3V3R A;  2Y55 A;  1S0W A;  1G6A A;  3S1Y A;  2IWD A;  3HL9 A;  4KG2 A;  3WS5 A;  2A3U A;  2WAE A;  4B88 A;  1CK3 A;  4OPY A;  3V39 A;  5EOO A;  1PWG A;  5EE8 A;  1XP4 A;  3UPN A;  4QD4 A;  1I5Q A;  5IHV A;  1DJB A;  3G35 A;  1PI4 A;  4DE3 A;  1JWV A;  1XGJ A;  1XXM A;  2XFS A;  4KZ4 A;  4C6Y A;  5M18 A;  1K57 A;  5BOH A;  4IVI A;  1W8Y A;  3RXX A;  3W8K A;  3ZNY A;  4Q8I A;  5HAP A;  1IEM A;  1ZG4 A;  3LEZ A;  5CGX A;  4EUZ A;  2Y2N A;  2WGV A;  4JXG A;  5CHM A;  2HDS A;  3VP1 A;  4BL2 A;  5DTK A;  2G2W A;  3G32 A;  1JWP A;  4JLF A;  4KZ9 A;  4UA9 A;  2H0T A;  4KZ3 A;  1L2S A;  1MBL A;  4UHU A;  3SH9 A;  3SS4 A;  2G2U A;  1RP5 A;  1E3U D;  3PAG A;  3ZGA B;  1XX2 A;  4GD6 A;  4E3N A;  2Y2M A;  1FR1 A;  1GHP A;  4EV4 A;  1GA9 A;  2WAD A;  5AQ7 A;  2GDN A;  4JXV A;  4U3T A;  2WGI A;  3BM6 A;  3MKE A;  3PBS A;  1MWR A;  3HLG A;  1H5X A;  1PWC A;  3E2K A;  5F1G A;  2V20 A;  3PBT A;  3P98 A;  5GLD A;  3N8L A;  2XR0 A;  4KZ5 A;  5HAI A;  5FDH A;  3N8R A;  1KVM A;  4RA7 A;  3ZG0 A;  4WEJ A;  3P09 A;  5CTM A;  4DRT A;  2ZC6 B;  3DWZ A;  2WKI A;  3Q81 A;  3UDX A;  1O07 A;  1XKZ A;  5FSR A;  4E3L A;  3DWK A;  1Z6F A;  4RX3 A;  1OME A;  3IF6 C;  1KE3 A;  3EQU A;  1NZU A;  2OSU A;  2BG1 A;  1BUL A;  2XGN A;  4LV1 A;  2Y59 A;  4DE0 A;  1KE0 A;  4LV3 A;  4GOG A;  4LCM A;  1E3U A;  5FQQ A;  3UDI A;  1CEG A;  4N9K A;  1K25 A;  3V50 A;  4DE2 A;  3V3S A;  4ZJ3 A;  2XF3 A;  3NCK A;  4OQI A;  4LCL A;  5FI6 A;  4O7D A;  4WZ5 C;  2OLU A;  1GCE A;  1FCO A;  3VFF A;  3C7U A;  1KGG A;  1TEM A;  2Y4A A;  3M6B A;  4B4Z A;  2ZQ8 A;  1JTG A;  1WYC A;  1K54 A;  1ALQ A;  1ERM A;  3BLM A;  4U0X A;  1ERO A;  4GNU A;  3FKW A;  3G34 A;  5EOE A;  3UE3 A;  1FQG A;  1HD8 A;  2ZLY A;  1EI5 A;  1QMF A;  2HP5 A;  3IHA A;  4U0T A;  4BL3 A;  1ZKJ A;  4JF4 A;  3QNC A;  4KQR A;  4B4X A;  1N4O A;  5FI2 A;  3O87 A;  3IF6 A;  5L2F A;  3LO7 A;  1NYM A;  5CGS A;  2Y2K A;  2C5W B;  3IXD A;  5I94 A;  3IHB A;  2A49 A;  4S2N C;  4QJG A;  1SHV A;  5GHX A;  4OP8 A;  1QME A;  2ZQ9 A;  4PM9 A;  4IVK A;  4X53 A;  3VSL A;  3LY3 A;  4RVA A;  5E2E A;  1YM1 A;  2ZC7 A;  5GLB A;  2IWB A;  1NXY A;  3AGD A;  4WMC D;  5CTN A;  3SH7 A;  1NYY A;  5FAO A;  4S2O A;  1IYP A;  4PPR A;  4BLM A;  1O7E A;  1PW8 A;  1ES5 A;  2UWX A;  4KG5 A;  4JKT A;  4R1G A;  4WZ5 A;  1LLB A;  3GRJ A;  1MKI A;  2ZQA A;  4EBP A;  1CEF A;  1MY8 A;  3LCE A;  1VM1 A;  4OVD A;  2ZD8 A;  1N9B A;  3MBZ A;  1ZC2 A;  3WRT A;  1IYO A;  3VP2 A;  3UPO A;  3TG9 A;  2EFU A;  1E4D A;  1MPL A;  5E2F A;  2R9W A;  4OQH A;  4KG6 A;  4LV0 A;  3M2J A;  1FOF A;  2ZC4 B;  3LY4 A;  5TFQ A;  2JBF A;  4S2N A;  1MWT A;  5DTS A;  3ZFZ A;  3BYD A;  5A92 A;  1FSW A;  2HDR A;  2E8I A;  2ZC5 B;  5EVL A;  5A90 A;  5FQK A;  1H8Z A;  3IXH A;  3N6I A;  5J8X A;  2XDM A;  3DTM A;  5CHJ A;  4WMC A;  3NI9 A;  2J9O A;  1L0G A;  4DF6 A;  1CI9 A;  3OPH A;  3VOY A;  5F1F A;  3TOI A;  2HP9 A;  1S6R A;  3Q7Z A;  1LL5 A;  4YFM A;  2ZQ7 A;  5HAR A;  3W4Q A;  4JF5 A;  5E43 A;  3MXS A;  3IQA A;  3OCL A;  3QNB A;  1W79 A;  3PBR A;  5HX9 A;  2Q9M A;  1TDG A;  4GDN A;  4KQQ A;  4JBF A;  4CPK A;  1FCN A;  4K0X A;  3NC8 A;  4HBT A;  4IED A;  3Q7V B;  3HUN A;  5TGF A;  4ZAM A;  5GLA A;  5E2G A;  2IWC A;  3IH8 A;  2JCH A;  1PYY A;  1XGI A;  4GB7 A;  4WEL A;  3M2K A;  4XXR A;  4ZDX A;  4R3B A;  3MZD A;  1KGE A;  2I72 A;  3DW0 A;  4BD1 A;  4Y0O A;  4ZJ1 A;  5A93 A;  3UY6 A;  3Q7V A;  2EX6 A;  4DXB A;  3HUM A;  4OQ0 A;  3N8S A;  4Y0U A;  1TDL A;  5G18 A;  2OLV A;  1JVJ A;  2XD5 A;  4QY6 A;  4BEN A;  1JTD A;  4C3Q A;  4PM5 A;  1CI8 A;  1ES4 A;  3Q07 A;  2WKE A;  3HLC A;  5CRF A;  5KZH A;  4C75 A;  3BLS A;  1WYB A;  3CZD A;  4WZ4 A;  3G4P A;  3MFD A;  4HES A;  1FCM A;  4OPR A;  1AXB A;  3W4O A;  3FZC A;  4X69 A;  3VP4 A;  5EPH A;  2V1Z A;  4JF6 A;  4QB8 A;  3S22 A;  1K6R A;  1YLP A;  3NDE A;  4ZBE A;  3MKF A;  1DJC A;  2QPN A;  1LL9 A;  3UN7 A;  4H8R A;  4PM7 A;  1K4F A;  3G30 A;  2HDQ A;  3UPP A;  4BD0 A;  1HVB A;  4FCF A;  3A3I A;  3WS0 A;  1HZO A;  2WZX A;  3QHY A;  1LI0 A;  2Z2M B;  4X56 A;  4EWF A;  1TVF A;  2PU2 A;  3IXB A;  3N4I A;  4P85 A;  4GDB A;  3PAE A;  2FFF B;  4KZA A;  1BTL A;  1GA0 A;  1Y54 A;  3IF6 B;  3Q82 A;  3ZG5 A;  1M6K A;  2VGK A;  1YLJ A;  3IWO A;  4DKI A;  5JYP A;  4JXS A;  3HVF A;  5EUA A;  1LI9 A;  4OPQ A;  4JPM A;  2H5S A;  3N7W A;  4PM6 A;  4GKU A;  3RXW A;  3C7V A;  1K6S A;  4KZB A;  5GL9 A;  3ZG8 B;  3OPP A;  3WRZ A;  5EVI D;  5EVI C;  1BLP A;  4QU3 A;  5CER A;  1GHM A;  4OH0 A;  3S4X A;  5HFO A;  4R4S A;  1M40 A;  2HP6 A;  4GN2 A;  4PM8 A;  4Z9Q A;  5HAQ A;  1YLT A;  4KEN B;  5M19 A;  4JXW A;  1KE4 A;  3GSG A;  4R23 A;  5FAT A;  3ITB A;  4WM9 A;  1ERQ A;  3SS5 A;  3VP3 A;  4NET A;  3OZH A;  2ZJ9 A;  3PTE A;  3C5A A;  5EVI B;  5CEB A;  2Y2Q A;  3MXR A;  3HUO A;  3O88 A;  4QHC A;  3CJM A;  3G2Z A;  2RL3 A;  5KMW A;  4KZ6 A;  1NZO A;  5AQB A;  1IYS A;  1IEL A;  4OLG A;  2X01 A;  4E3I A;  2EX8 A;  3OCN A;  3WWX A;  1BZA A;  3SOI A;  4E3J A;  1YMS A;  3VMA A;  3NIA A;  3BFG A;  3HLF A;  2XQZ A;  5EVI A;  4MBK A;  4MNR A;  4D2O A;  4S2I A;  3W4P A;  3A3J A;  1BSG A;  1WE4 A;  3FWL A;  4DDY A;  4ID4 A;  1SDE A;  3ZDJ A;  3HRE A;  3BFE A;  4K91 A;  4OKP A;  2ZMA A;  3C4O A;  4P0M A;  5AQA A;  5JYO A;  1KDS A;  1JWZ A;  1ZG6 A;  4GZB A;  4KZ8 A;  4OLD A;  3UDF A;  1G68 A;  1MXO A;  5EEC A;  5A91 A;  5FI7 A;  1YLY A;  4PMA A;  4RX2 A;  1MWS A;  2C6W B;  3ZVT A;  1KDW A;  2WYX A;  3A3F A;  5CHU A;  4EQI A;  1YLW A;  1MWU A;  2FFY A;  5D3O A;  3WS2 A;  4X68 A;  1BLS A;  1PW1 A;  3JYI A;  2WKH A;  3PBQ A;  4R0Q A;  1W7F A;  5FQI A;  1RGY A;  3BFD A;  4EBN A;  2WK0 A;  1E25 A;  3GQZ A;  1ONH A;  4F94 A;  3V5M A;  2EXA A;  3NBL A;  1IKI A;  2JC7 A;  3O86 A;  3BEB A;  1LHY A;  2X71 A;  4IBX A;  4S2P A;  3MZF A;  3FKV A;  1EWZ A;  1SDN A;  2Y2I A;  3C4P A;  4N1X A;  5FQJ A;  3VP0 A;  3FYZ A;  1W8Q A;  3HLE A;  1W5D A;  4UA7 A;  1DY6 A;  4WYY A;  2R9X A;  1XPB A;  1ES3 A;  4OQG A;  1PWD A;  3GR2 A;  2WGW A;  2B5R A;  3A3E A;  3IWQ A;  5FAQ A;  2H10 A;  2EFX A;  5GHY A;  5E2H A;  2Y2G A;  4MBF A;  3BFC A;  5DVA A;  2H0Y A;  4E3M A;  4UA6 A;  4RYE A;  4MEZ A;  2DCF A;  4N9L A;  1L0F A;  3VSK A;  3GTC A;  3NY4 A;  1SKF A;  2P9V B;  1PI5 A;  3IT9 A;  4E3K A;  1RGZ A;  4S2M A;  5DF9 A;  3CMZ A;  4XUZ A;  4DE1 A;  2RCX A;  3G2Y A;  3IF5 A;  4YIN A;  2WAF A;  5CED A;  3ZNT A;  2V2F F;  4OON A;  4OP5 A;  2WZZ A;  4GD8 A;  2OV5 A;  1RCJ A;  3BEC A;  3I7J A;  4WEK A;  3SH8 A;  3O3V A;  1SCW A;  2X02 A;  4X55 A;  4FH2 A;  5F82 A;  4Y0T A;  4S2K A;  1BLH A;  2EXB A;  2HDU A;  4KQO A;  1K4E A;  2P9V A;  1Q2P A;  3ITA A;  4HBU A;  4DDS A;  3B3X A;  4FD8 A;  1K54 C;  1YT4 A;  1Q2Q A;  2ZM0 A;  5F83 A;  3ISG A;  1XA1 A;  1YQS A;  5CXW A;  1DJA A;  4MLL A;  1FR6 A;  1NJ4 A;  3VFH A;  4DXC A;  4ZTK A;  2EX2 A;  3D4F A;  1PZP A;  3HLB A;  1K38 A;  5DF8 A;  2DNS A;  4OPZ A;  5HL1 A;  2Y2P A;  4FSF A;  2EX9 A;  1KVL A;  4P87 A;  2XFT A;  1ESI A;  5CEC A;  5DF7 A;  1XA7 A;  4S2L A;  2ZQC A;  2VGJ A;  2XH9 A;  2J7V A;  1L0E A;  5KSH A;  2QMI A;  2Y2J A;  5FQ9 A;  3PBN A;  1BT5 A;  4EBL A;  3UO9 A;  4OOL A;  1J9M A;  1K55 C;  3TSG A;  4LV2 A;  5DTT A;  1U60 A;  2Y91 A;  3UE0 A;  2CC1 A;  5GHZ A;  5U47 A;  4P6B A;  1YMX A;  3ZG7 B;  4LEN A;  5TR7 A;  4A5R A;  2HPB A;  1BUE A;  2BLS A;  2Y2L A;  3AGE A;  5GLC A;  1C3B A;  3BRM A;  2PBY A;  2PU4 A;  3OPR A;  5AQ9 A;  2Q9N A;  4K0W A;  4ZJ2 A;  1PZO A;  3RJU A;  3ZHH A;  3IH9 A;  3GV9 A;  3GVB A;  1VQQ A;  5CGW A;  2XK1 A;  4IBR A;  4E6X A;  1BLC A;  1KGF A;  4E3O A;  3ZG9 B;  3M6H A;  4OOY A;  3Q1F A;  2QZ6 A;  4WBG A;  2DRW A;  3WS1 A;  1K56 D;  1ES2 A;  2J9P A;  3HBR A;  3PBO A;  3UNW A;  1I2S A;  2ZC3 B;  4Y7P A;  3ZCZ A;  4BQM A;  4FH4 A;  3OC2 A;  2JE5 A;  1L0D A;  2Z2L B;  4CJN A;  3VOZ A;  1ESU A;  1K55 A;  2P74 A;  2ZM8 A;  4KZ7 A;  4OOM A;  4MBH A;  4XUX A;  5HW3 A;  3HLD A;  3BFF A;  5FQM A;  4N92 A;  2J8Y A;  5KSC A;  3AGF A;  3E2L A;  3EQV A;  1HTZ A;  1IKG A;  3IXG A;  5FA7 A;  4R4R A;  2ZM2 A;  2ZQD A;  4N1H A;  2XLN A;  3ZVW A;  1NY0 A;  1YLZ A;  3OPL A;  1K57 C;  3A3D A;  4UAA A;  3WS4 A;  3MZE A;  5FAP A;  1NRF A;  2WUQ A;  4S2J A;  3CG5 A;  3FV7 A;  4X6T A;  1I2W A;  2Y2H A;  2WGW B;  1H8Y A;  2Y2O A;  4HEF A;  2XD1 A;  4L0L A;  3GMW A;  3IWI A;  3HLW A;  4R3J A;  1IYQ A;  3NDG A;  4NK3 A;  1FSY A;  1ONG A;  5M1A A;  4QY5 A;  1K56 A;  3UE1 A;  1GHI A;  4BJP A;  5FAS A;  3G31 A;  3SS3 A;  4E6W A;  1PIO A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...