4B9OA

The pr0 photocycle intermediate of photoactive yellow protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4b9oA00
2WKPA 2ZBBA 4K08A 4HY8A 4R38A 3VE4A 1GSVA 2QJ5A 2PYPA 2L0WA 4WN5A 1V9YA 3MQOA 3E4QA 2HV1A 4GS9A 3H82B 4H6JB 4NXGA 2A24A 2WKQA 2JN7A 2D02A 2QWSA 4MN5A 4HJ6A 1OJGA 3PHYA 2PHYA 3MR0A 1DRMA 3NOTC 4HHDA 5DJTA 3UB7A 2PR5A 3T50A 5HWVA 5DKLA 4M4XA 3B33A 4KUOA 2ZOHA 3IS2A 4WL9A 5HSQA 2V0UA 3HJIA 5KIZA 4I38A 1S1YA 2W27A 3E4PA 4HJ3A 2VEAA 2H28A 3P7NA 5IS1A 1F98A 4WLAA 4XT2B 1LL8A 1XJ3A 2PR6A 1S66L 2OWHA 5DJUA 3H7WB 4HP4A 5I5LA 4YWZA 3LIDA 2K7SA 3LIAA 3F1PA 2INWA 1OTIA 4WUJA 2PDRA 3FG8A 1GSWA 4I39A 1D06A 4MN6A 4LPZA 3A0RA 1T1CA 2I9VA 4L9FA 1P0ZA 4JGQA 1UWNX 3K3CA 3NJAA 1ODVA 2J80A 3ZQ5A 4GHIA 1TS0A 2B02A 3EWKA 4EXOA 1T18A 4I3JA 5HD5A 3A0VA 4R70A 3LIBA 1JNUA 2R78A 1VB6A 5HDCA 5A8BA 1LT0A 2L1MA 2KDKA 2V0WA 1BYWA 1OTEA 1EW0A 4GS9B 1UWPX 4DJ2A 1G28A 1KOUA 2A24B 4JGRA 1DP9A 2V1AA 4L9EA 5AVEA 2P7JA 2VV7A 2QKPA 1TS8A 2OWJA 3NOPC 5F6AA 4R3AA 4E04A 4R6LA 2OOLA 2Z6DA 3SW1A 3CWFA 3IS2B 4LRZE 3F1NA 4HQAA 4NXBA 4EERA 3LUQA 1T1BA 3LICA 4NXFA 4EW7A 1S4RA 5F68A 1OT9A 4PKYG 2V9AA 2EA9A 2L4RA 5HWTA 3ULFA 3BY9A 3CLOA 3MXQA 4EEUA 5J7EA 3LI8A 1N9OA 5HD3A 1TS7A 3UB8A 3F1PB 5HDSA 2BASA 3G6OA 2VV8A 3MFXA 4LRYC 3VE3A 4WF0A 1LSWA 3LI9A 2W0NA 2VLGA 5HZHA 1S4SA 2PD7A 3UMEA 5EFWA 4LRXC 4F3LA 1TS6A 3IBRA 3UMDA 5J3WA 1UGUA 1OTDA 2Z6CA 3LYXA 1X0OA 5AVFA 4LLOB 2VV6A 3GECA 3RTYA 4DJ3A 3F1OA 5TBMA 4GHIB 5DKKA 1OTAA 1XJ6A 1S1ZA 3UE6A 1XJ4A 2QHKA 5F69A 3MJQA 3K3DA 2CMNA 3D72A 4HH3A 4BBUA 3NHQA 4EEPA 4HH2A 4KUKA 1DP8A 1DP6A 5J4EA 3H82A 4H6JA 1P97A 2GJ3A 5F5YA 2PD8A 2KX6A 3UB6A 3E4OA 3GDIA 2ZOIA 1F9IA 3LIEA 4PKYA 4GCZA 4I5SA 1OT6A 5G4YA 2QJ7A 3ICYA 3F1NB 1T19A 1WA9A 4BBTA 2D01A 4NXEA 2PYRA 5IU1A 4HOIA 3NOUC 5HDDA 4KQDA 3HJKA 4B9OA 3FC7A 1N9NA 2JHEA 4XT2A 4HP9A 1N9LA 4I3IA 4EESA 4HJ4A 4EQ1A 1OJ5A 3CAXA 2WKRA 1OTBA 3H7WA 1LSXA 1D7EA 1V9ZA 4GW9A 2YKFA 1S67L 3PYPA 4JGPA 4HNBA 1XFNA 1T1AA 3BWLA 3UB9A 3C8CA 3OLOA 3C2WA 1MZUA 5HWWA 1LSVA 3RH8B 1NWZA 3MQQA 4HI4A 1Y28A 4EETB 4F3LB 2V1BA 2M1CA 1XJ2A 4RQ9A 4I3AA 3LIFA 2YKHA 3EEHA 5G4ZA 4JGOA 3F1OB 1GSXA 1XFQA 4BBVA 5TBMB 3H9WA 4HIAA 4L9GA 3VOLA 3A0SA 3KX0X 3BY8A
chains in the Genus database with same CATH superfamily
2XF3A 1BSGA 3W4PA 1YQSA 4R38A 1BTLA 2QJ5A 1CQAA 4DF6A 5EOEA 5DTSA 2L0WA 1ACFA 4WN5A 1K56A 3VSKA 2Y2OA 3LCEA 3UE0A 3W8KA 1YMXA 4X68A 4F94A 1BLPA 3H82B 1Y4OA 4H6JB 1IFQA 4NXGA 2WZXA 2D02A 4LV3A 1C3BA 2LB9A 4S2IA 4B93A 3S1YA 3ZNTA 2ZC4B 1PZOA 3UB7A 5D3OA 2KOIA 3IXDA 2Q0OA 4M4XA 3BM6A 1JWPA 1TF1A 4PMAA 1STZA 5HSQA 1DJBA 2ZQ7A 4GKUA 2W27A 4HJ3A 2VEAA 2NUPC 4OOMA 1MKIA 1W79A 1GA9A 4KZ4A 3HUMA 4WLAA 2P04A 2FFYA 4PM6A 3VP2A 4ZJ1A 2PR6A 2W3FA 1S66L 5L09A 3H7WB 4HP4A 2OAQ1 5EM1A 1IYSA 4YWZA 3O88A 3LIDA 2K7SA 3LIAA 3F1PA 2VZWA 3B3XA 3QP8A 3MMHA 1W8QA 2X71A 3BECA 5DTKA 4ME4A 3T4TA 2Y55A 3MF0A 2HDUA 1T1CA 2ZC5B 2PT7A 2VGLS 3HBRA 3N8LA 4DDYA 3VFHA 2R9WA 3TRCA 5FL3A 3PAEA 3DTKA 3OCLA 3VP3A 3SH9A 3V3RA 3OC2A 3IF5A 4ESPA 1TEMA 4CLCB 1ODVA 1J9MA 2XA7M 1E25A 1KVLA 3HLWA 1SCWA 4K0XA 4A5RA 5CGSA 3N4IA 3TG9A 2J9PA 4EWFA 5GLDA 5HD5A 5E2EA 2HJ9C 3A0VA 1NYMA 2HPBA 2ZMVA 4EBLA 2R78A 5GLBA 5A8BA 3N7WA 2EFUA 3IF6C 3CHWP 2QMIA 1XGJA 1OTEA 1LHYA 4MMNA 5AQBA 2E8IA 1UWPX 1KGGA 5GL9A 3ZDJA 3T4LA 2V1AA 5AVEA 4CJNA 1DJAA 1MC0A 3NOPC 5DTTA 4R3AA 2XK1A 3MKEA 3HREA 3T1RA 2Z6DA 1NRJA 2VK3A 5EE8A 3F1NA 1W7FA 2JKRM 2GZAA 3UPPA 4E3IA 5TJJA 3A3FA 1XX2A 2WYXA 3DWZA 1S4RA 2IWDA 2V2FF 4OOYA 3DTIA 4BJPA 2V9AA 1CEGA 3B42A 5IHVA 2HGVA 3ULFA 3BY9A 1D1JA 2WKEA 1E3UD 2IWCA 3ZCZA 1N9OA 2IWBA 1TS7A 1HZOA 1JVJA 1MWTA 1ZG6A 3UB8A 2HJEA 3F1PB 5CERA 1KDSA 4Y13A 1NLZA 2VV8A 2EXBA 3MXSA 3LI9A 2W0NA 2M7UA 3BLSA 5CGWA 2XR0A 2PD7A 4WZ5C 4LRXC 1YT4A 4IJGA 2Z2MB 3KSGA 5FAOA 4PAUA 4R0QA 4Y0OA 1I2SA 2VV6A 2WADA 5TFQA 2Y2JA 4C6YA 2H10A 3EQVA 4YNRA 4GJ4A 3E98A 1XJ6A 2V20A 3P98A 2W3DA 5KMWA 4FD8A 1VEUA 4N1HA 3UE6A 4LFUA 3BFDA 3FYZA 5JYOA 4Z1WA 4ETZA 1SKFA 1PZPA 4HH3A 3PBOA 4ZAMA 4UAAA 4JBFA 5E2GA 4LENA 3ZG5A 4H8RA 5AQ9A 3S7PA 5A91A 4MDZA 4N92A 5L8MA 3EGXC 4II7A 2FFFB 2EX6A 2V8CA 1U60A 3UPNA 3UB6A 3GQZA 3EQUA 1LLBA 4GCZA 4I5SA 4OPQA 2JKFA 3T1QB 3NCKA 4X25A 3ICYA 3F1NB 4Z9QA 4RX2A 3UE1A 4ZJ2A 1PI5A 3MKFA 2O99A 5IU1A 4S2PA 2AVXA 3NOUC 4ETXA 3IH9A 3FV7A 4OQ0A 4XT2A 1W63M 4HP9A 2VKSA 1Z09A 3NECA 4I3IA 1BZAA 3CAXA 1IYPA 2WKRA 4Y5FA 2V1ZA 5FQIA 3LO7A 5F83A 2LB5A 1NY0A 5HPIA 4MBKA 1IELA 3UB9A 4WM9A 3Q7ZA 3C2WA 1MZUA 5HWWA 3RH8B 4IVIA 3P01A 1Y28A 4EETB 1MKMA 1H3QA 3L9KA 2H0YA 2M1CA 4IUKA 4EUZA 3E2LA 3UNWA 5LBRA 3S7QA 4HBUA 1HLUP 2XLNA 4D2OA 2YKHA 3IX3A 3EEHA 5G4ZA 3EOIA 4KQRA 5GHZA 5HAIA 5M19A 5FATA 4X1LA 4KZAA 2EX2A 1O7EA 1KGEA 1GSXA 4KG6A 2R9XA 3DWKA 4N9KA 3H9WA 1NLYA 4WZ5A 4L9GA 1VEUB 4EU0A 3VOLA 5EV0A 3KYQA 1YKDA 3BY8A 2XFTA 2ZBBA 1TDLA 1E4DA 1VM1A 3WS2A 2Y59A 4DE0A 4BL2A 5K5BA 2A2LA 2MJ6A 1FR6A 2HV1A 4KZBA 3VV4A 3G31A 5L07A 4XXRA 2WKQA 2JN7A 4JKTA 4HJ6A 4KQQA 1OJGA 1RCJA 2PHYA 1KGFA 1NZUA 4HHDA 2ZL1A 2JKTM 3T50A 5FAPA 4FSFA 4Q0IA 5DKLA 2JKRI 3B33A 3T12B 3IS2A 3LY3A 4KENB 3IX8A 5GHXA 2P08A 3C7VA 2J3TC 3HJIA 1BLCA 1S1YA 3E4PA 3QP2A 3LEZA 3NI9A 3VP1A 1IEMA 4XT2B 1LL8A 1K4FA 2WGVA 2OWHA 5DJUA 5HX9A 3LR3A 3MZFA 2Y2IA 3SS3A 3UDIA 3SH7A 3UDFA 2PDRA 1CI8A 1GSWA 2B95A 4GDNA 4I39A 4AFIA 3HLGA 2O9CA 4P6BA 2Y2LA 3U2AA 3IWIA 3A0RA 1YLYA 4LV2A 5AJGA 2I9VA 4O01A 1LL5A 2PU4A 4DE2A 3IXBA 1CF0A 2XEPA 3EEAA 4L9FA 5F1GA 3L7HA 2ZJ9A 3G2ZA 4E3KA 2EFXA 3CG5A 4JGQA 3JPUA 2XDMA 5FI2A 4B88A 2FZ0A 3NIAA 3K3CA 3NJAA 3GVBA 5CECA 1KE3A 2JE5A 4S2NC 1YLPA 3DTMA 1BLSA 1TS0A 4OKPA 5CHJA 3T4OA 2DNSA 2X01A 2ACGA 3SZTA 1JTDA 2B02A 3EWKA 2GX5A 3RXXA 3ISGA 4O8GA 3HLCA 2Y2KA 3IHBA 4E6XA 1VB6A 5HDCA 1YMSA 4YINA 2P9VA 2ZQ9A 3NULA 2V0WA 4RYEA 1BYWA 1XGIA 1J3WA 4IBXA 4X69A 2XSSA 3OPRA 3VOZA 2XA7S 4GD8A 1Q2PA 4L9EA 4E3NA 1TD5A 2QKPA 1TS8A 2OWJA 2ZMAA 3BFFA 2ZL1B 2O0YA 4OLGA 5EM0A 5CX7A 5HAPA 4Y17A 4B4XA 3Q82A 3FKWA 1KE4A 4R6LA 2OOLA 3A3IA 3OPHA 4UQIM 3IS2B 4LRZE 5CGXA 4HQAA 3VP0A 4RA7A 4FTXA 3OCNA 4EERA 3FPVA 3CUEC 1GCEA 4NXFA 5HW3A 2VGKA 1OT9A 1YSQA 4GNUA 2JKGA 1I5QA 3PR6A 2EA9A 4IUHA 2UWXA 2I72A 3CLOA 4HBTA 1WYBA 1SDNA 1G6OA 5HD3A 5HL1A 3ZNYA 5M1AA 1SHVA 3VP4A 3MFXA 4LRYC 3G30A 1K0KA 4NG2A 5HZHA 3A3DA 1S4SA 3UMEA 3KYEA 4QY6A 4KZ3A 3UMDA 3RXWA 4GOGA 2Z6CA 3LGOA 3GSGA 3BW6A 5HPFA 5FSRA 2VJWA 4ZJ3A 3GECA 2UV0E 3MFDA 1E3UA 3BQAA 4Q0JA 4BQMA 3UO9A 4E3MA 1OTAA 4BD0A 4MLLA 1L0FA 4LV0A 4MBHA 2HF6A 4S2OA 4E3JA 4YFMA 1YLJA 3GMWA 3KSHA 5EVID 3N6IA 4DN0A 2JCHA 4BBUA 3NHQA 2P9VB 2KLIA 5EPHA 4MCWA 1FIKA 5FDSA 2Y2MA 2Y2QA 4S2NA 2C6WB 1DP6A 2XD1A 3BFGA 3C4OA 5F5YA 1YSPA 3M2JA 2X02A 3SS4A 2KX6A 4P6ZM 3R7WA 2J3TD 2JKTI 3E4OA 1KDWA 1K55C 3MZEA 2ZC6B 3QP5A 3O3VA 1OT6A 5G4YA 2QJ7A 1MY8A 1BUEA 4WBGA 4JF4A 1T19A 1GHIA 5F1FA 2W1TA 4PM7A 3S22A 4OP5A 1FILA 4P85A 4WELA 2D01A 4NXEA 1FSWA 4LCLA 2PU2A 1AWIA 4KQDA 1SZVA 3HJKA 1N9NA 1G5UA 4EQ1A 1OJ5A 1G68A 5BOHA 2J8YA 1MWRA 3D9YA 1D7EA 1RP5A 2JC7A 3T4KA 5FASA 1XFNA 5FAQA 2OSUA 1T1AA 3HLFA 3BWLA 4C3QA 3C8CA 3E0YA 4K0WA 3GRJA 3GTCA 3EGDC 1NWZA 1FOFA 4QY5A 2W3EA 5KSHA 5FEFA 5FI7A 3MQ0A 4JXGA 5EOOA 4DRTA 2GDNA 2Y79A 3JYIA 1K57C 4E3OA 4U0TA 1XFQA 3PXPA 5FQ9A 3ZHHA 4OPRA 3ZG0A 4HIAA 3LR4A 1K54C 4JXWA 3TSGA 5FQMA 4HY8A 2OV5A 2J3WA 1GSVA 3IXHA 5EVLA 4NETA 4DMZA 2PYPA 5E2FA 1QMEA 2HP9A 4ZDXA 3V50A 3E4QA 5HL6A 5A92A 1H5XA 4GS9A 1H8MA 4C75A 3R7WB 4EV4A 2RCXA 2QWSA 3ZG7B 5HFOA 3BLMA 1GA0A 1PW1A 3IF6A 4KG5A 3PHYA 1L3LA 5FDHA 3MR0A 4LGWA 1DRMA 3M2KA 3A3JA 3CJMA 4CQHA 2XQZA 5HWVA 3VFFA 4YOFA 4FH4A 4Y7PA 2ZOHA 5G18A 3KSFA 2RL3A 2W1TB 4BMWA 3PBSA 5EUAA 2V0UA 1YLZA 3W4OA 3T1SA 5KIZA 4I38A 3OZHA 1A0KA 2DRWA 3AGDA 5DF8A 3P7NA 4R4SA 4WZ4A 1F98A 3TW8A 4KG2A 3O86A 4E6WA 5DFXA 5E43A 1TVFA 1LI9A 5I5LA 2ZC3B 1ERQA 3UE3A 1KVMA 1JTGA 3O5YA 4CLCE 2EXAA 2INWA 1ERMA 4WUJA 2WK0A 4CPKA 2Y4AA 3HUNA 3OOVA 4UHUA 4S2JA 5AQAA 3N8SA 3E2KA 1IOUA 4LV1A 5A90A 2ZM2A 1N9BA 1O07A 4LPZA 4BWIA 2XRNA 5I94A 4CLCC 2QZ6A 3SH8A 3R4KA 1NXYA 3IXGA 4QU3A 1HVBA 4DE3A 3TE8A 3LR5A 3MZDA 4S2KA 1UWNX 4JXSA 4R4RA 4FCFA 4OLDA 2J80A 2W1RA 3BFEA 3NY4A 1ESUA 3ZQ5A 4GB7A 3S7OA 2W3GA 4ZRRA 5MC7A 4GDBA 5CXWA 3JVVA 3CPTA 4R70A 4R23A 1AXBA 1K57A 2M7VA 3G4PA 2J9OA 4GLQA 4DE1A 3IX4A 4IHQA 2OAP1 3IHAA 2W3HA 1FSYA 1EW0A 4GS9B 1G28A 1PI4A 1PNEA 5EVIC 2O9BA 3V3SA 1KOUA 4JGRA 5CTNA 1ZG4A 3ZYTA 5FQQA 4ZBEA 3IF6B 2Q9NA 4R1GA 2P7JA 2VV7A 5FI6A 3K2NA 2GNXA 4ID4A 2ZQCA 5DFYA 3CWFA 3T1XA 1IKGA 4EW7A 5F68A 4O7DA 2G2UA 3ITAA 2OLVA 4QPRA 1G6AA 2A3UA 2L4RA 1GHMA 1BT5A 3MXQA 3OPPA 4G3KA 3I7JA 1XA1A 5J7EA 1FR1A 2HDRA 2ZD8A 3M6BA 3NBLA 2P74A 3N8RA 3WS4A 4UQIS 3B47A 2WKHA 4R3JA 4QHCA 2BASA 3CITA 3O87A 3FWLA 4EBNA 3VE3A 4UA6A 4WF0A 5KSCA 4MEZA 2VLGA 2ZM0A 2E8JA 1ZHHB 5EFWA 4F3LA 1TS6A 3IBRA 3NDEA 1K38A 1UGUA 3IWQA 5M18A 2IA2A 2WZZA 1OTDA 3FKVA 3HVFA 3KYZA 4WMCD 3G32A 3JVUA 5AVFA 3T4QA 2O9AA 3RTYA 3RJUA 3PTEA 4LCMA 4DJ3A 2WUQA 1M6KA 4OPYA 2HDQA 3AGFA 5DKKA 1S1ZA 1XJ4A 5U47A 2QHKA 1PRQA 5F69A 3MJQA 3K3DA 5E2HA 1KE0A 1PWDA 5GLAA 3CPTB 4JF6A 4NK3A 3HL9A 4IEDA 3BFCA 4EEPA 3KSIA 1LL9A 1JWVA 1L0DA 4KZ7A 4KUKA 2EX9A 1DP8A 4UA9A 3PBQA 1XXMA 4OQHA 2PD8A 4NEED 5TR7A 3C7UA 3C38A 2ZOIA 1F9IA 3LIEA 1BULA 4PKYA 3WS0A 3ZVTA 4Y0UA 4EQIA 4GZBA 1W63Q 4P87A 3V67A 1WYCA 4OONA 4OQIA 3HUOA 5FQJA 3LEQA 3HLDA 4Y2FA 3T4JA 4DDSA 1ES5A 3Q1FA 5EVIA 3DBAA 4P0MA 4BBTA 5FEGA 4G3WA 1SKOA 2XD5A 4B4ZA 1OMEA 4HOIA 3M6HA 4OP8A 5HDDA 3FPWA 4N1XA 4B9OA 4P6ZS 2JHEA 4E3LA 1CJFA 1BLHA 4PM5A 1F5MA 2G2WA 5IT5A 1LSXA 4CLCD 1V9ZA 2YKFA 1S67L 1K6RA 3UB5P 2B18A 4JGPA 3LY4A 4HNBA 1YPRA 1H8ZA 2V8FA 2Z2LB 1PIOA 3LFVA 5FQKA 5L10A 4F3LB 2V1BA 1I2WA 1K56D 1XJ2A 2JBFA 1K4EA 4X53A 1P9RA 4MNRA 4BENA 5DF9A 2WKIA 2C5WB 1IYQA 3C30A 4DKIA 4JGOA 4ZTKA 3ZVWA 1HD8A 3V5MA 4JXVA 4MN7A 3A0SA 2ZC7A 3KX0X 4UA7A 5F82A 1IYOA 3ZFZA 1ES2A 3OPLA 2WAFA 4KZ8A 3BEBA 5FA7A 2WKPA 1RGZA 4K08A 1NJ4A 3VE4A 3PBTA 4Y15A 1V9YA 1MWUA 4IBRA 3MQOA 4KZ9A 2WGWA 3VSLA 1ZKJA 5GHYA 2XFSA 2XGNA 2BG1A 4WEKA 1XPBA 4U3TA 5EVEA 3UY6A 3BJNA 2A24A 2A49A 4MN5A 1S0WA 3UN7A 3P09A 3Q07A 5L2FA 3NOTC 5DJTA 2PR5A 1ESIA 5CTMA 5CEDA 1Q2QA 4KUOA 1N4OA 3CZDA 5EVIB 3MS6A 4WL9A 4DXCA 2HZ5A 3U4LP 3TOIA 1SKOB 1DY6A 3BYDA 1YLWA 3IBJA 2H28A 4EBPA 3WS1A 5DVAA 5IS1A 1P9WA 2VA0A 1XJ3A 2VGLM 3CUEA 2EX8A 2ZLYA 1SDEA 1NZOA 4OPZA 2XH9A 3A3EA 1YM1A 3QP4A 3IH8A 4JPMA 3RFBA 1OTIA 3FG8A 2PAVP 4KQOA 1CEFA 5CRFA 4EUVA 5TGFA 4D60A 3D4FA 4K91A 2Y8HA 1D06A 1FCNA 4MN6A 1GHPA 3IQAA 1EI5A 3MBZA 1FCOA 1JWZA 1EROA 3CI6A 1WE4A 1L2SA 4OOLA 4M3KA 3UPOA 2G7UA 1IKIA 4OVDA 4RVAA 1M40A 1P0ZA 4OQGA 4UEYA 1Z6FA 4GD6A 3HCYA 5CEBA 4X1MA 4PM8A 3ZG8B 1K25A 3PAGA 4GHIA 4QD4A 3DTEA 1YAXA 1MWSA 1FCMA 4EXOA 1T18A 4I3JA 1XA7A 2VGJA 4JF5A 3LIBA 1JNUA 1K6SA 1LT0A 2L1MA 2WGWB 2KDKA 4Q0HA 1ZTUA 1MXOA 3AGEA 2QPNA 4DJ2A 2PBDP 2Y2NA 3WS5A 2A24B 3DW0A 1DP9A 4BLMA 3WRZA 4WYYA 3C5AA 3BRMA 5F6AA 1ES4A 3WRTA 4E04A 1MBLA 3QNBA 4IVKA 3SW1A 2H0TA 1DJCA 1PFLA 4NXBA 3BQ8A 5HAQA 3LUQA 1T1BA 3LICA 4R3BA 1K55A 2Y91A 3UDXA 4PKYG 1ONHA 1F2KA 5EECA 4S2LA 4KZ5A 4S2MA 1XP4A 5J8XA 3GR2A 2PBYA 3IWOA 5HWTA 4WEJA 2Y2HA 4EEUA 1ALQA 3WWXA 1VHMA 2J7VA 3LI8A 3NDGA 4GN2A 2QYBA 1PWGA 2HP5A 1W8YA 4PPRA 5HDSA 3G6OA 4ARZA 2BLSA 3HLBA 2Y2GA 1LSWA 2WGIA 3QP1A 3PBNA 4DXBA 4QWOA 3SS5A 5HARA 3LR0A 5J3WA 3T4SA 1CI9A 3LYXA 1W5DA 1X0OA 4LLOB 1HTZA 1VETA 1QMFA 3F1OA 1OPXA 3IT9A 5TBMA 4XUZA 4GHIB 3QHYA 1FQGA 5KZHA 3FZCA 4X6TA 4U0XA 1EWZA 3Q7VA 3QNCA 1CK3A 4HESA 2ZQ8A 2CMNA 1S6RA 3D72A 3GV9A 5C5KA 1H0MA 2ZQAA 2OLUA 4HH2A 4PM9A 4G3VA 1LI0A 4FH2A 1K54A 2CC1A 4WMCA 4BD1A 5J4EA 3QP6A 3H82A 4H6JA 3G35A 1P97A 2GJ3A 4BL3A 4RX3A 1NYYA 2DCFA 2HDSA 2WAEA 3MSHA 3GDIA 3W2ZA 1ZC2A 2B5RA 4QB8A 1PYYA 4NKPA 3NC8A 3VMAA 3PBRA 4XUXA 3DAVA 4JLFA 1WA9A 2ZMFA 1PW8A 2FH5A 5A93A 2PYRA 3C4PA 3ITBA 2EWVA 3ZG9B 3FC7A 2HP6A 4MBFA 3ZGAB 1VQQA 1N9LA 2NUTC 1MPLA 4EESA 2PRFA 4HJ4A 4X56A 2ZM8A 3MXRA 4L0LA 3S7NA 5GLCA 5JYPA 1OTBA 3H7WA 2H5SA 5CHUA 4FOFA 4GW9A 4OH0A 3PYPA 4HEFA 1ES3A 2VX8A 4Y3IA 2ZQDA 3OBFA 3G34A 4ARZB 4Q8IA 3CMZA 1NRFA 1ONGA 3OLOA 1L0GA 1Y54A 5DF7A 1RGYA 5AQ7A 1LSVA 3MQQA 4HI4A 3TJZC 3Q81A 1H8YA 3W4QA 1XKZA 1YLTA 4RQ9A 2K31A 4I3AA 5CHMA 4QJGA 3V39A 3HLEA 4PHTA 3LIFA 4FUWA 4N9LA 2Y2PA 3S4XA 1VETB 1TDGA 2BTFP 3SOIA 2DMWA 4KZ6A 1PWCA 3F1OB 2K2NA 4CLCA 4BBVA 2Q9MA 5TBMB 1L0EA 4Y0TA 2XROA 3D3OA 3KO6A 3Q7VB 4X55A 3VOYA 3G2YA 4O0PA 2EWWA
chains in the Genus database with same CATH topology
2WKPA 2ZBBA 4K08A 4HY8A 4R38A 3VE4A 3PBTA 2J3WA 1GSVA 2QJ5A 4DMZA 2PYPA 2L0WA 4WN5A 1V9YA 5K5BA 3MQOA 2A2LA 2MJ6A 3E4QA 5HL6A 2HV1A 4GS9A 3H82B 4H6JB 1H8MA 3VV4A 4WEKA 1IFQA 3BJNA 4NXGA 2A24A 2WKQA 3R7WB 2JN7A 2D02A 2QWSA 4MN5A 4HJ6A 1OJGA 2LB9A 3PHYA 4B93A 2PHYA 3MR0A 1DRMA 3NOTC 4HHDA 5DJTA 3UB7A 4CQHA 2PR5A 2JKTM 2KOIA 3T50A 4FSFA 4Q0IA 5HWVA 5DKLA 2JKRI 4M4XA 3B33A 4YOFA 4KUOA 2ZOHA 3IS2A 1TF1A 3KSFA 2W1TB 1STZA 4BMWA 2P08A 4WL9A 5HSQA 3PBSA 2V0UA 2J3TC 3HJIA 5KIZA 4I38A 1S1YA 2W27A 3E4PA 3IBJA 4HJ3A 2VEAA 2NUPC 2H28A 4OOMA 3P7NA 5IS1A 1F98A 3TW8A 4WLAA 4XT2B 1P9WA 2P04A 2VA0A 1LL8A 1XJ3A 2PR6A 2W3FA 5DFXA 2VGLM 1S66L 2OWHA 5DJUA 3H7WB 3CUEA 4HP4A 5I5LA 2OAQ1 3LR3A 3UE3A 4YWZA 3O5YA 4CLCE 3LIDA 2K7SA 3LIAA 3F1PA 3RFBA 2INWA 2VZWA 1OTIA 4WUJA 2PDRA 3FG8A 3OOVA 1GSWA 4KQOA 4I39A 4EUVA 4AFIA 3MMHA 1IOUA 2Y8HA 1D06A 4MN6A 4LPZA 4BWIA 2O9CA 2XRNA 4ME4A 3T4TA 3U2AA 4CLCC 3MF0A 3CI6A 3A0RA 1T1CA 4OOLA 3R4KA 5AJGA 2I9VA 4O01A 2PT7A 2VGLS 2G7UA 3TE8A 3LR5A 3EEAA 4L9FA 3TRCA 5FL3A 3OCLA 1P0ZA 4UEYA 3OC2A 3HCYA 4JGQA 2FZ0A 1UWNX 3K3CA 3NJAA 4CLCB 1ODVA 2J80A 2W1RA 3ZQ5A 4GHIA 3S7OA 2XA7M 2W3GA 1TS0A 4ZRRA 3T4OA 5MC7A 1YAXA 2B02A 3EWKA 2GX5A 3JVVA 4EXOA 4O8GA 1T18A 4I3JA 5HD5A 2HJ9C 3A0VA 4R70A 3LIBA 1JNUA 2M7VA 2ZMVA 4GLQA 2R78A 1VB6A 5HDCA 5A8BA 1LT0A 2L1MA 4IHQA 2OAP1 2KDKA 2V0WA 1BYWA 2W3HA 4Q0HA 1ZTUA 1OTEA 4MMNA 1EW0A 4GS9B 1UWPX 4DJ2A 1G28A 2XSSA 2O9BA 1KOUA 2A24B 4JGRA 3T4LA 2XA7S 3ZYTA 1DP9A 2V1AA 4L9EA 5AVEA 2P7JA 2VV7A 1TD5A 1MC0A 2QKPA 3K2NA 1TS8A 2OWJA 3NOPC 2GNXA 5F6AA 2O0YA 4R3AA 5CX7A 4E04A 4R6LA 2OOLA 2Z6DA 1NRJA 5DFYA 3CWFA 4UQIM 3SW1A 3IS2B 4LRZE 3F1NA 4HQAA 4NXBA 2JKRM 3BQ8A 3OCNA 3FPVA 4EERA 3LUQA 2GZAA 1T1BA 3CUEC 5TJJA 3LICA 4NXFA 4EW7A 1S4RA 5F68A 1OT9A 4PKYG 1YSQA 4BJPA 2V9AA 4QPRA 3B42A 3PR6A 2EA9A 2L4RA 4IUHA 2HGVA 5HWTA 3ULFA 3BY9A 3CLOA 3MXQA 4WEJA 4EEUA 4G3KA 1VHMA 5J7EA 3LI8A 1N9OA 1G6OA 5HD3A 1TS7A 2QYBA 3UB8A 2HJEA 3F1PB 4UQIS 3B47A 1NLZA 5HDSA 2BASA 3G6OA 4ARZA 3CITA 2VV8A 3MFXA 4LRYC 3VE3A 4WF0A 1LSWA 3LI9A 2W0NA 2VLGA 2M7UA 3PBNA 5HZHA 1S4SA 1ZHHB 2PD7A 3UMEA 5EFWA 4LRXC 4F3LA 4IJGA 3LR0A 1TS6A 3IBRA 3KSGA 3UMDA 5J3WA 1UGUA 4PAUA 2IA2A 3T4SA 1OTDA 2Z6CA 3KYZA 3LYXA 3BW6A 1X0OA 3JVUA 5HPFA 2VJWA 5AVFA 3T4QA 4LLOB 2O9AA 2VV6A 3GECA 3RTYA 4DJ3A 3BQAA 3F1OA 4Q0JA 3EQVA 1OPXA 4YNRA 5TBMA 4GHIB 4GJ4A 1OTAA 1XJ6A 3E98A 5DKKA 2W3DA 1S1ZA 3UE6A 1XJ4A 2QHKA 2HF6A 5F69A 3MJQA 3K3DA 4Z1WA 4ETZA 2CMNA 3KSHA 3D72A 5C5KA 4DN0A 4HH3A 3PBOA 4BBUA 3NHQA 4EEPA 2KLIA 3KSIA 4MCWA 4HH2A 4G3VA 4KUKA 1DP8A 3S7PA 3PBQA 4MDZA 1DP6A 5J4EA 3H82A 5L8MA 4H6JA 3EGXC 1P97A 2GJ3A 4II7A 5F5YA 1YSPA 2PD8A 2KX6A 4P6ZM 3R7WA 2J3TD 4NEED 3UB6A 2JKTI 3C38A 3E4OA 3GDIA 2ZOIA 3EQUA 1F9IA 3W2ZA 3LIEA 4PKYA 1W63Q 4GCZA 3V67A 4I5SA 1OT6A 4NKPA 5G4YA 2QJ7A 3PBRA 3ICYA 4Y2FA 3T4JA 3F1NB 1T19A 2W1TA 1WA9A 3DBAA 4BBTA 2ZMFA 4WELA 2D01A 4NXEA 4G3WA 2FH5A 2O99A 2PYRA 5IU1A 4HOIA 2EWVA 3NOUC 5HDDA 4ETXA 4KQDA 3FPWA 3HJKA 4B9OA 3FC7A 4P6ZS 1N9NA 2JHEA 4XT2A 1W63M 2VKSA 4HP9A 1N9LA 2NUTC 4I3IA 4EESA 4HJ4A 4EQ1A 1OJ5A 3CAXA 4L0LA 1F5MA 2WKRA 4Y5FA 3S7NA 5IT5A 1OTBA 3H7WA 1LSXA 1D7EA 4CLCD 4FOFA 1V9ZA 4GW9A 2YKFA 1S67L 3PYPA 3T4KA 2B18A 4JGPA 2VX8A 4HNBA 4Y3IA 2LB5A 1XFNA 3OBFA 1T1AA 3BWLA 4ARZB 5HPIA 3UB9A 3LFVA 3C8CA 3OLOA 3C2WA 1MZUA 3E0YA 5HWWA 3EGDC 1LSVA 3RH8B 1NWZA 3MQQA 3P01A 4HI4A 3TJZC 1Y28A 4EETB 1MKMA 1H3QA 4F3LB 2V1BA 4IUKA 2M1CA 5LBRA 1XJ2A 2W3EA 5KSHA 4RQ9A 2K31A 4I3AA 3S7QA 4PHTA 1P9RA 3MQ0A 3LIFA 5DF9A 2YKHA 3EEHA 5G4ZA 2Y79A 3EOIA 3C30A 4JGOA 2DMWA 3F1OB 2K2NA 1GSXA 1XFQA 3PXPA 4CLCA 4BBVA 5TBMB 3H9WA 2XROA 3D3OA 1NLYA 3KO6A 4HIAA 4L9GA 4EU0A 3LR4A 3VOLA 4MN7A 3A0SA 3KX0X 3KYQA 4O0PA 1YKDA 2EWWA 3BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKP A;  2ZBB A;  4K08 A;  4HY8 A;  4R38 A;  3VE4 A;  1GSV A;  2QJ5 A;  2PYP A;  2L0W A;  4WN5 A;  1V9Y A;  3MQO A;  3E4Q A;  2HV1 A;  4GS9 A;  3H82 B;  4H6J B;  4NXG A;  2A24 A;  2WKQ A;  2JN7 A;  2D02 A;  2QWS A;  4MN5 A;  4HJ6 A;  1OJG A;  3PHY A;  2PHY A;  3MR0 A;  1DRM A;  3NOT C;  4HHD A;  5DJT A;  3UB7 A;  2PR5 A;  3T50 A;  5HWV A;  5DKL A;  4M4X A;  3B33 A;  4KUO A;  2ZOH A;  3IS2 A;  4WL9 A;  5HSQ A;  2V0U A;  3HJI A;  5KIZ A;  4I38 A;  1S1Y A;  2W27 A;  3E4P A;  4HJ3 A;  2VEA A;  2H28 A;  3P7N A;  5IS1 A;  1F98 A;  4WLA A;  4XT2 B;  1LL8 A;  1XJ3 A;  2PR6 A;  1S66 L;  2OWH A;  5DJU A;  3H7W B;  4HP4 A;  5I5L A;  4YWZ A;  3LID A;  2K7S A;  3LIA A;  3F1P A;  2INW A;  1OTI A;  4WUJ A;  2PDR A;  3FG8 A;  1GSW A;  4I39 A;  1D06 A;  4MN6 A;  4LPZ A;  3A0R A;  1T1C A;  2I9V A;  4L9F A;  1P0Z A;  4JGQ A;  1UWN X;  3K3C A;  3NJA A;  1ODV A;  2J80 A;  3ZQ5 A;  4GHI A;  1TS0 A;  2B02 A;  3EWK A;  4EXO A;  1T18 A;  4I3J A;  5HD5 A;  3A0V A;  4R70 A;  3LIB A;  1JNU A;  2R78 A;  1VB6 A;  5HDC A;  5A8B A;  1LT0 A;  2L1M A;  2KDK A;  2V0W A;  1BYW A;  1OTE A;  1EW0 A;  4GS9 B;  1UWP X;  4DJ2 A;  1G28 A;  1KOU A;  2A24 B;  4JGR A;  1DP9 A;  2V1A A;  4L9E A;  5AVE A;  2P7J A;  2VV7 A;  2QKP A;  1TS8 A;  2OWJ A;  3NOP C;  5F6A A;  4R3A A;  4E04 A;  4R6L A;  2OOL A;  2Z6D A;  3SW1 A;  3CWF A;  3IS2 B;  4LRZ E;  3F1N A;  4HQA A;  4NXB A;  4EER A;  3LUQ A;  1T1B A;  3LIC A;  4NXF A;  4EW7 A;  1S4R A;  5F68 A;  1OT9 A;  4PKY G;  2V9A A;  2EA9 A;  2L4R A;  5HWT A;  3ULF A;  3BY9 A;  3CLO A;  3MXQ A;  4EEU A;  5J7E A;  3LI8 A;  1N9O A;  5HD3 A;  1TS7 A;  3UB8 A;  3F1P B;  5HDS A;  2BAS A;  3G6O A;  2VV8 A;  3MFX A;  4LRY C;  3VE3 A;  4WF0 A;  1LSW A;  3LI9 A;  2W0N A;  2VLG A;  5HZH A;  1S4S A;  2PD7 A;  3UME A;  5EFW A;  4LRX C;  4F3L A;  1TS6 A;  3IBR A;  3UMD A;  5J3W A;  1UGU A;  1OTD A;  2Z6C A;  3LYX A;  1X0O A;  5AVF A;  4LLO B;  2VV6 A;  3GEC A;  3RTY A;  4DJ3 A;  3F1O A;  5TBM A;  4GHI B;  5DKK A;  1OTA A;  1XJ6 A;  1S1Z A;  3UE6 A;  1XJ4 A;  2QHK A;  5F69 A;  3MJQ A;  3K3D A;  2CMN A;  3D72 A;  4HH3 A;  4BBU A;  3NHQ A;  4EEP A;  4HH2 A;  4KUK A;  1DP8 A;  1DP6 A;  5J4E A;  3H82 A;  4H6J A;  1P97 A;  2GJ3 A;  5F5Y A;  2PD8 A;  2KX6 A;  3UB6 A;  3E4O A;  3GDI A;  2ZOI A;  1F9I A;  3LIE A;  4PKY A;  4GCZ A;  4I5S A;  1OT6 A;  5G4Y A;  2QJ7 A;  3ICY A;  3F1N B;  1T19 A;  1WA9 A;  4BBT A;  2D01 A;  4NXE A;  2PYR A;  5IU1 A;  4HOI A;  3NOU C;  5HDD A;  4KQD A;  3HJK A;  4B9O A;  3FC7 A;  1N9N A;  2JHE A;  4XT2 A;  4HP9 A;  1N9L A;  4I3I A;  4EES A;  4HJ4 A;  4EQ1 A;  1OJ5 A;  3CAX A;  2WKR A;  1OTB A;  3H7W A;  1LSX A;  1D7E A;  1V9Z A;  4GW9 A;  2YKF A;  1S67 L;  3PYP A;  4JGP A;  4HNB A;  1XFN A;  1T1A A;  3BWL A;  3UB9 A;  3C8C A;  3OLO A;  3C2W A;  1MZU A;  5HWW A;  1LSV A;  3RH8 B;  1NWZ A;  3MQQ A;  4HI4 A;  1Y28 A;  4EET B;  4F3L B;  2V1B A;  2M1C A;  1XJ2 A;  4RQ9 A;  4I3A A;  3LIF A;  2YKH A;  3EEH A;  5G4Z A;  4JGO A;  3F1O B;  1GSX A;  1XFQ A;  4BBV A;  5TBM B;  3H9W A;  4HIA A;  4L9G A;  3VOL A;  3A0S A;  3KX0 X;  3BY8 A; 
#chains in the Genus database with same CATH topology
 2XF3 A;  1BSG A;  3W4P A;  1YQS A;  4R38 A;  1BTL A;  2QJ5 A;  1CQA A;  4DF6 A;  5EOE A;  5DTS A;  2L0W A;  1ACF A;  4WN5 A;  1K56 A;  3VSK A;  2Y2O A;  3LCE A;  3UE0 A;  3W8K A;  1YMX A;  4X68 A;  4F94 A;  1BLP A;  3H82 B;  1Y4O A;  4H6J B;  1IFQ A;  4NXG A;  2WZX A;  2D02 A;  4LV3 A;  1C3B A;  2LB9 A;  4S2I A;  4B93 A;  3S1Y A;  3ZNT A;  2ZC4 B;  1PZO A;  3UB7 A;  5D3O A;  2KOI A;  3IXD A;  2Q0O A;  4M4X A;  3BM6 A;  1JWP A;  1TF1 A;  4PMA A;  1STZ A;  5HSQ A;  1DJB A;  2ZQ7 A;  4GKU A;  2W27 A;  4HJ3 A;  2VEA A;  2NUP C;  4OOM A;  1MKI A;  1W79 A;  1GA9 A;  4KZ4 A;  3HUM A;  4WLA A;  2P04 A;  2FFY A;  4PM6 A;  3VP2 A;  4ZJ1 A;  2PR6 A;  2W3F A;  1S66 L;  5L09 A;  3H7W B;  4HP4 A;  2OAQ 1;  5EM1 A;  1IYS A;  4YWZ A;  3O88 A;  3LID A;  2K7S A;  3LIA A;  3F1P A;  2VZW A;  3B3X A;  3QP8 A;  3MMH A;  1W8Q A;  2X71 A;  3BEC A;  5DTK A;  4ME4 A;  3T4T A;  2Y55 A;  3MF0 A;  2HDU A;  1T1C A;  2ZC5 B;  2PT7 A;  2VGL S;  3HBR A;  3N8L A;  4DDY A;  3VFH A;  2R9W A;  3TRC A;  5FL3 A;  3PAE A;  3DTK A;  3OCL A;  3VP3 A;  3SH9 A;  3V3R A;  3OC2 A;  3IF5 A;  4ESP A;  1TEM A;  4CLC B;  1ODV A;  1J9M A;  2XA7 M;  1E25 A;  1KVL A;  3HLW A;  1SCW A;  4K0X A;  4A5R A;  5CGS A;  3N4I A;  3TG9 A;  2J9P A;  4EWF A;  5GLD A;  5HD5 A;  5E2E A;  2HJ9 C;  3A0V A;  1NYM A;  2HPB A;  2ZMV A;  4EBL A;  2R78 A;  5GLB A;  5A8B A;  3N7W A;  2EFU A;  3IF6 C;  3CHW P;  2QMI A;  1XGJ A;  1OTE A;  1LHY A;  4MMN A;  5AQB A;  2E8I A;  1UWP X;  1KGG A;  5GL9 A;  3ZDJ A;  3T4L A;  2V1A A;  5AVE A;  4CJN A;  1DJA A;  1MC0 A;  3NOP C;  5DTT A;  4R3A A;  2XK1 A;  3MKE A;  3HRE A;  3T1R A;  2Z6D A;  1NRJ A;  2VK3 A;  5EE8 A;  3F1N A;  1W7F A;  2JKR M;  2GZA A;  3UPP A;  4E3I A;  5TJJ A;  3A3F A;  1XX2 A;  2WYX A;  3DWZ A;  1S4R A;  2IWD A;  2V2F F;  4OOY A;  3DTI A;  4BJP A;  2V9A A;  1CEG A;  3B42 A;  5IHV A;  2HGV A;  3ULF A;  3BY9 A;  1D1J A;  2WKE A;  1E3U D;  2IWC A;  3ZCZ A;  1N9O A;  2IWB A;  1TS7 A;  1HZO A;  1JVJ A;  1MWT A;  1ZG6 A;  3UB8 A;  2HJE A;  3F1P B;  5CER A;  1KDS A;  4Y13 A;  1NLZ A;  2VV8 A;  2EXB A;  3MXS A;  3LI9 A;  2W0N A;  2M7U A;  3BLS A;  5CGW A;  2XR0 A;  2PD7 A;  4WZ5 C;  4LRX C;  1YT4 A;  4IJG A;  2Z2M B;  3KSG A;  5FAO A;  4PAU A;  4R0Q A;  4Y0O A;  1I2S A;  2VV6 A;  2WAD A;  5TFQ A;  2Y2J A;  4C6Y A;  2H10 A;  3EQV A;  4YNR A;  4GJ4 A;  3E98 A;  1XJ6 A;  2V20 A;  3P98 A;  2W3D A;  5KMW A;  4FD8 A;  1VEU A;  4N1H A;  3UE6 A;  4LFU A;  3BFD A;  3FYZ A;  5JYO A;  4Z1W A;  4ETZ A;  1SKF A;  1PZP A;  4HH3 A;  3PBO A;  4ZAM A;  4UAA A;  4JBF A;  5E2G A;  4LEN A;  3ZG5 A;  4H8R A;  5AQ9 A;  3S7P A;  5A91 A;  4MDZ A;  4N92 A;  5L8M A;  3EGX C;  4II7 A;  2FFF B;  2EX6 A;  2V8C A;  1U60 A;  3UPN A;  3UB6 A;  3GQZ A;  3EQU A;  1LLB A;  4GCZ A;  4I5S A;  4OPQ A;  2JKF A;  3T1Q B;  3NCK A;  4X25 A;  3ICY A;  3F1N B;  4Z9Q A;  4RX2 A;  3UE1 A;  4ZJ2 A;  1PI5 A;  3MKF A;  2O99 A;  5IU1 A;  4S2P A;  2AVX A;  3NOU C;  4ETX A;  3IH9 A;  3FV7 A;  4OQ0 A;  4XT2 A;  1W63 M;  4HP9 A;  2VKS A;  1Z09 A;  3NEC A;  4I3I A;  1BZA A;  3CAX A;  1IYP A;  2WKR A;  4Y5F A;  2V1Z A;  5FQI A;  3LO7 A;  5F83 A;  2LB5 A;  1NY0 A;  5HPI A;  4MBK A;  1IEL A;  3UB9 A;  4WM9 A;  3Q7Z A;  3C2W A;  1MZU A;  5HWW A;  3RH8 B;  4IVI A;  3P01 A;  1Y28 A;  4EET B;  1MKM A;  1H3Q A;  3L9K A;  2H0Y A;  2M1C A;  4IUK A;  4EUZ A;  3E2L A;  3UNW A;  5LBR A;  3S7Q A;  4HBU A;  1HLU P;  2XLN A;  4D2O A;  2YKH A;  3IX3 A;  3EEH A;  5G4Z A;  3EOI A;  4KQR A;  5GHZ A;  5HAI A;  5M19 A;  5FAT A;  4X1L A;  4KZA A;  2EX2 A;  1O7E A;  1KGE A;  1GSX A;  4KG6 A;  2R9X A;  3DWK A;  4N9K A;  3H9W A;  1NLY A;  4WZ5 A;  4L9G A;  1VEU B;  4EU0 A;  3VOL A;  5EV0 A;  3KYQ A;  1YKD A;  3BY8 A;  2XFT A;  2ZBB A;  1TDL A;  1E4D A;  1VM1 A;  3WS2 A;  2Y59 A;  4DE0 A;  4BL2 A;  5K5B A;  2A2L A;  2MJ6 A;  1FR6 A;  2HV1 A;  4KZB A;  3VV4 A;  3G31 A;  5L07 A;  4XXR A;  2WKQ A;  2JN7 A;  4JKT A;  4HJ6 A;  4KQQ A;  1OJG A;  1RCJ A;  2PHY A;  1KGF A;  1NZU A;  4HHD A;  2ZL1 A;  2JKT M;  3T50 A;  5FAP A;  4FSF A;  4Q0I A;  5DKL A;  2JKR I;  3B33 A;  3T12 B;  3IS2 A;  3LY3 A;  4KEN B;  3IX8 A;  5GHX A;  2P08 A;  3C7V A;  2J3T C;  3HJI A;  1BLC A;  1S1Y A;  3E4P A;  3QP2 A;  3LEZ A;  3NI9 A;  3VP1 A;  1IEM A;  4XT2 B;  1LL8 A;  1K4F A;  2WGV A;  2OWH A;  5DJU A;  5HX9 A;  3LR3 A;  3MZF A;  2Y2I A;  3SS3 A;  3UDI A;  3SH7 A;  3UDF A;  2PDR A;  1CI8 A;  1GSW A;  2B95 A;  4GDN A;  4I39 A;  4AFI A;  3HLG A;  2O9C A;  4P6B A;  2Y2L A;  3U2A A;  3IWI A;  3A0R A;  1YLY A;  4LV2 A;  5AJG A;  2I9V A;  4O01 A;  1LL5 A;  2PU4 A;  4DE2 A;  3IXB A;  1CF0 A;  2XEP A;  3EEA A;  4L9F A;  5F1G A;  3L7H A;  2ZJ9 A;  3G2Z A;  4E3K A;  2EFX A;  3CG5 A;  4JGQ A;  3JPU A;  2XDM A;  5FI2 A;  4B88 A;  2FZ0 A;  3NIA A;  3K3C A;  3NJA A;  3GVB A;  5CEC A;  1KE3 A;  2JE5 A;  4S2N C;  1YLP A;  3DTM A;  1BLS A;  1TS0 A;  4OKP A;  5CHJ A;  3T4O A;  2DNS A;  2X01 A;  2ACG A;  3SZT A;  1JTD A;  2B02 A;  3EWK A;  2GX5 A;  3RXX A;  3ISG A;  4O8G A;  3HLC A;  2Y2K A;  3IHB A;  4E6X A;  1VB6 A;  5HDC A;  1YMS A;  4YIN A;  2P9V A;  2ZQ9 A;  3NUL A;  2V0W A;  4RYE A;  1BYW A;  1XGI A;  1J3W A;  4IBX A;  4X69 A;  2XSS A;  3OPR A;  3VOZ A;  2XA7 S;  4GD8 A;  1Q2P A;  4L9E A;  4E3N A;  1TD5 A;  2QKP A;  1TS8 A;  2OWJ A;  2ZMA A;  3BFF A;  2ZL1 B;  2O0Y A;  4OLG A;  5EM0 A;  5CX7 A;  5HAP A;  4Y17 A;  4B4X A;  3Q82 A;  3FKW A;  1KE4 A;  4R6L A;  2OOL A;  3A3I A;  3OPH A;  4UQI M;  3IS2 B;  4LRZ E;  5CGX A;  4HQA A;  3VP0 A;  4RA7 A;  4FTX A;  3OCN A;  4EER A;  3FPV A;  3CUE C;  1GCE A;  4NXF A;  5HW3 A;  2VGK A;  1OT9 A;  1YSQ A;  4GNU A;  2JKG A;  1I5Q A;  3PR6 A;  2EA9 A;  4IUH A;  2UWX A;  2I72 A;  3CLO A;  4HBT A;  1WYB A;  1SDN A;  1G6O A;  5HD3 A;  5HL1 A;  3ZNY A;  5M1A A;  1SHV A;  3VP4 A;  3MFX A;  4LRY C;  3G30 A;  1K0K A;  4NG2 A;  5HZH A;  3A3D A;  1S4S A;  3UME A;  3KYE A;  4QY6 A;  4KZ3 A;  3UMD A;  3RXW A;  4GOG A;  2Z6C A;  3LGO A;  3GSG A;  3BW6 A;  5HPF A;  5FSR A;  2VJW A;  4ZJ3 A;  3GEC A;  2UV0 E;  3MFD A;  1E3U A;  3BQA A;  4Q0J A;  4BQM A;  3UO9 A;  4E3M A;  1OTA A;  4BD0 A;  4MLL A;  1L0F A;  4LV0 A;  4MBH A;  2HF6 A;  4S2O A;  4E3J A;  4YFM A;  1YLJ A;  3GMW A;  3KSH A;  5EVI D;  3N6I A;  4DN0 A;  2JCH A;  4BBU A;  3NHQ A;  2P9V B;  2KLI A;  5EPH A;  4MCW A;  1FIK A;  5FDS A;  2Y2M A;  2Y2Q A;  4S2N A;  2C6W B;  1DP6 A;  2XD1 A;  3BFG A;  3C4O A;  5F5Y A;  1YSP A;  3M2J A;  2X02 A;  3SS4 A;  2KX6 A;  4P6Z M;  3R7W A;  2J3T D;  2JKT I;  3E4O A;  1KDW A;  1K55 C;  3MZE A;  2ZC6 B;  3QP5 A;  3O3V A;  1OT6 A;  5G4Y A;  2QJ7 A;  1MY8 A;  1BUE A;  4WBG A;  4JF4 A;  1T19 A;  1GHI A;  5F1F A;  2W1T A;  4PM7 A;  3S22 A;  4OP5 A;  1FIL A;  4P85 A;  4WEL A;  2D01 A;  4NXE A;  1FSW A;  4LCL A;  2PU2 A;  1AWI A;  4KQD A;  1SZV A;  3HJK A;  1N9N A;  1G5U A;  4EQ1 A;  1OJ5 A;  1G68 A;  5BOH A;  2J8Y A;  1MWR A;  3D9Y A;  1D7E A;  1RP5 A;  2JC7 A;  3T4K A;  5FAS A;  1XFN A;  5FAQ A;  2OSU A;  1T1A A;  3HLF A;  3BWL A;  4C3Q A;  3C8C A;  3E0Y A;  4K0W A;  3GRJ A;  3GTC A;  3EGD C;  1NWZ A;  1FOF A;  4QY5 A;  2W3E A;  5KSH A;  5FEF A;  5FI7 A;  3MQ0 A;  4JXG A;  5EOO A;  4DRT A;  2GDN A;  2Y79 A;  3JYI A;  1K57 C;  4E3O A;  4U0T A;  1XFQ A;  3PXP A;  5FQ9 A;  3ZHH A;  4OPR A;  3ZG0 A;  4HIA A;  3LR4 A;  1K54 C;  4JXW A;  3TSG A;  5FQM A;  4HY8 A;  2OV5 A;  2J3W A;  1GSV A;  3IXH A;  5EVL A;  4NET A;  4DMZ A;  2PYP A;  5E2F A;  1QME A;  2HP9 A;  4ZDX A;  3V50 A;  3E4Q A;  5HL6 A;  5A92 A;  1H5X A;  4GS9 A;  1H8M A;  4C75 A;  3R7W B;  4EV4 A;  2RCX A;  2QWS A;  3ZG7 B;  5HFO A;  3BLM A;  1GA0 A;  1PW1 A;  3IF6 A;  4KG5 A;  3PHY A;  1L3L A;  5FDH A;  3MR0 A;  4LGW A;  1DRM A;  3M2K A;  3A3J A;  3CJM A;  4CQH A;  2XQZ A;  5HWV A;  3VFF A;  4YOF A;  4FH4 A;  4Y7P A;  2ZOH A;  5G18 A;  3KSF A;  2RL3 A;  2W1T B;  4BMW A;  3PBS A;  5EUA A;  2V0U A;  1YLZ A;  3W4O A;  3T1S A;  5KIZ A;  4I38 A;  3OZH A;  1A0K A;  2DRW A;  3AGD A;  5DF8 A;  3P7N A;  4R4S A;  4WZ4 A;  1F98 A;  3TW8 A;  4KG2 A;  3O86 A;  4E6W A;  5DFX A;  5E43 A;  1TVF A;  1LI9 A;  5I5L A;  2ZC3 B;  1ERQ A;  3UE3 A;  1KVM A;  1JTG A;  3O5Y A;  4CLC E;  2EXA A;  2INW A;  1ERM A;  4WUJ A;  2WK0 A;  4CPK A;  2Y4A A;  3HUN A;  3OOV A;  4UHU A;  4S2J A;  5AQA A;  3N8S A;  3E2K A;  1IOU A;  4LV1 A;  5A90 A;  2ZM2 A;  1N9B A;  1O07 A;  4LPZ A;  4BWI A;  2XRN A;  5I94 A;  4CLC C;  2QZ6 A;  3SH8 A;  3R4K A;  1NXY A;  3IXG A;  4QU3 A;  1HVB A;  4DE3 A;  3TE8 A;  3LR5 A;  3MZD A;  4S2K A;  1UWN X;  4JXS A;  4R4R A;  4FCF A;  4OLD A;  2J80 A;  2W1R A;  3BFE A;  3NY4 A;  1ESU A;  3ZQ5 A;  4GB7 A;  3S7O A;  2W3G A;  4ZRR A;  5MC7 A;  4GDB A;  5CXW A;  3JVV A;  3CPT A;  4R70 A;  4R23 A;  1AXB A;  1K57 A;  2M7V A;  3G4P A;  2J9O A;  4GLQ A;  4DE1 A;  3IX4 A;  4IHQ A;  2OAP 1;  3IHA A;  2W3H A;  1FSY A;  1EW0 A;  4GS9 B;  1G28 A;  1PI4 A;  1PNE A;  5EVI C;  2O9B A;  3V3S A;  1KOU A;  4JGR A;  5CTN A;  1ZG4 A;  3ZYT A;  5FQQ A;  4ZBE A;  3IF6 B;  2Q9N A;  4R1G A;  2P7J A;  2VV7 A;  5FI6 A;  3K2N A;  2GNX A;  4ID4 A;  2ZQC A;  5DFY A;  3CWF A;  3T1X A;  1IKG A;  4EW7 A;  5F68 A;  4O7D A;  2G2U A;  3ITA A;  2OLV A;  4QPR A;  1G6A A;  2A3U A;  2L4R A;  1GHM A;  1BT5 A;  3MXQ A;  3OPP A;  4G3K A;  3I7J A;  1XA1 A;  5J7E A;  1FR1 A;  2HDR A;  2ZD8 A;  3M6B A;  3NBL A;  2P74 A;  3N8R A;  3WS4 A;  4UQI S;  3B47 A;  2WKH A;  4R3J A;  4QHC A;  2BAS A;  3CIT A;  3O87 A;  3FWL A;  4EBN A;  3VE3 A;  4UA6 A;  4WF0 A;  5KSC A;  4MEZ A;  2VLG A;  2ZM0 A;  2E8J A;  1ZHH B;  5EFW A;  4F3L A;  1TS6 A;  3IBR A;  3NDE A;  1K38 A;  1UGU A;  3IWQ A;  5M18 A;  2IA2 A;  2WZZ A;  1OTD A;  3FKV A;  3HVF A;  3KYZ A;  4WMC D;  3G32 A;  3JVU A;  5AVF A;  3T4Q A;  2O9A A;  3RTY A;  3RJU A;  3PTE A;  4LCM A;  4DJ3 A;  2WUQ A;  1M6K A;  4OPY A;  2HDQ A;  3AGF A;  5DKK A;  1S1Z A;  1XJ4 A;  5U47 A;  2QHK A;  1PRQ A;  5F69 A;  3MJQ A;  3K3D A;  5E2H A;  1KE0 A;  1PWD A;  5GLA A;  3CPT B;  4JF6 A;  4NK3 A;  3HL9 A;  4IED A;  3BFC A;  4EEP A;  3KSI A;  1LL9 A;  1JWV A;  1L0D A;  4KZ7 A;  4KUK A;  2EX9 A;  1DP8 A;  4UA9 A;  3PBQ A;  1XXM A;  4OQH A;  2PD8 A;  4NEE D;  5TR7 A;  3C7U A;  3C38 A;  2ZOI A;  1F9I A;  3LIE A;  1BUL A;  4PKY A;  3WS0 A;  3ZVT A;  4Y0U A;  4EQI A;  4GZB A;  1W63 Q;  4P87 A;  3V67 A;  1WYC A;  4OON A;  4OQI A;  3HUO A;  5FQJ A;  3LEQ A;  3HLD A;  4Y2F A;  3T4J A;  4DDS A;  1ES5 A;  3Q1F A;  5EVI A;  3DBA A;  4P0M A;  4BBT A;  5FEG A;  4G3W A;  1SKO A;  2XD5 A;  4B4Z A;  1OME A;  4HOI A;  3M6H A;  4OP8 A;  5HDD A;  3FPW A;  4N1X A;  4B9O A;  4P6Z S;  2JHE A;  4E3L A;  1CJF A;  1BLH A;  4PM5 A;  1F5M A;  2G2W A;  5IT5 A;  1LSX A;  4CLC D;  1V9Z A;  2YKF A;  1S67 L;  1K6R A;  3UB5 P;  2B18 A;  4JGP A;  3LY4 A;  4HNB A;  1YPR A;  1H8Z A;  2V8F A;  2Z2L B;  1PIO A;  3LFV A;  5FQK A;  5L10 A;  4F3L B;  2V1B A;  1I2W A;  1K56 D;  1XJ2 A;  2JBF A;  1K4E A;  4X53 A;  1P9R A;  4MNR A;  4BEN A;  5DF9 A;  2WKI A;  2C5W B;  1IYQ A;  3C30 A;  4DKI A;  4JGO A;  4ZTK A;  3ZVW A;  1HD8 A;  3V5M A;  4JXV A;  4MN7 A;  3A0S A;  2ZC7 A;  3KX0 X;  4UA7 A;  5F82 A;  1IYO A;  3ZFZ A;  1ES2 A;  3OPL A;  2WAF A;  4KZ8 A;  3BEB A;  5FA7 A;  2WKP A;  1RGZ A;  4K08 A;  1NJ4 A;  3VE4 A;  3PBT A;  4Y15 A;  1V9Y A;  1MWU A;  4IBR A;  3MQO A;  4KZ9 A;  2WGW A;  3VSL A;  1ZKJ A;  5GHY A;  2XFS A;  2XGN A;  2BG1 A;  4WEK A;  1XPB A;  4U3T A;  5EVE A;  3UY6 A;  3BJN A;  2A24 A;  2A49 A;  4MN5 A;  1S0W A;  3UN7 A;  3P09 A;  3Q07 A;  5L2F A;  3NOT C;  5DJT A;  2PR5 A;  1ESI A;  5CTM A;  5CED A;  1Q2Q A;  4KUO A;  1N4O A;  3CZD A;  5EVI B;  3MS6 A;  4WL9 A;  4DXC A;  2HZ5 A;  3U4L P;  3TOI A;  1SKO B;  1DY6 A;  3BYD A;  1YLW A;  3IBJ A;  2H28 A;  4EBP A;  3WS1 A;  5DVA A;  5IS1 A;  1P9W A;  2VA0 A;  1XJ3 A;  2VGL M;  3CUE A;  2EX8 A;  2ZLY A;  1SDE A;  1NZO A;  4OPZ A;  2XH9 A;  3A3E A;  1YM1 A;  3QP4 A;  3IH8 A;  4JPM A;  3RFB A;  1OTI A;  3FG8 A;  2PAV P;  4KQO A;  1CEF A;  5CRF A;  4EUV A;  5TGF A;  4D60 A;  3D4F A;  4K91 A;  2Y8H A;  1D06 A;  1FCN A;  4MN6 A;  1GHP A;  3IQA A;  1EI5 A;  3MBZ A;  1FCO A;  1JWZ A;  1ERO A;  3CI6 A;  1WE4 A;  1L2S A;  4OOL A;  4M3K A;  3UPO A;  2G7U A;  1IKI A;  4OVD A;  4RVA A;  1M40 A;  1P0Z A;  4OQG A;  4UEY A;  1Z6F A;  4GD6 A;  3HCY A;  5CEB A;  4X1M A;  4PM8 A;  3ZG8 B;  1K25 A;  3PAG A;  4GHI A;  4QD4 A;  3DTE A;  1YAX A;  1MWS A;  1FCM A;  4EXO A;  1T18 A;  4I3J A;  1XA7 A;  2VGJ A;  4JF5 A;  3LIB A;  1JNU A;  1K6S A;  1LT0 A;  2L1M A;  2WGW B;  2KDK A;  4Q0H A;  1ZTU A;  1MXO A;  3AGE A;  2QPN A;  4DJ2 A;  2PBD P;  2Y2N A;  3WS5 A;  2A24 B;  3DW0 A;  1DP9 A;  4BLM A;  3WRZ A;  4WYY A;  3C5A A;  3BRM A;  5F6A A;  1ES4 A;  3WRT A;  4E04 A;  1MBL A;  3QNB A;  4IVK A;  3SW1 A;  2H0T A;  1DJC A;  1PFL A;  4NXB A;  3BQ8 A;  5HAQ A;  3LUQ A;  1T1B A;  3LIC A;  4R3B A;  1K55 A;  2Y91 A;  3UDX A;  4PKY G;  1ONH A;  1F2K A;  5EEC A;  4S2L A;  4KZ5 A;  4S2M A;  1XP4 A;  5J8X A;  3GR2 A;  2PBY A;  3IWO A;  5HWT A;  4WEJ A;  2Y2H A;  4EEU A;  1ALQ A;  3WWX A;  1VHM A;  2J7V A;  3LI8 A;  3NDG A;  4GN2 A;  2QYB A;  1PWG A;  2HP5 A;  1W8Y A;  4PPR A;  5HDS A;  3G6O A;  4ARZ A;  2BLS A;  3HLB A;  2Y2G A;  1LSW A;  2WGI A;  3QP1 A;  3PBN A;  4DXB A;  4QWO A;  3SS5 A;  5HAR A;  3LR0 A;  5J3W A;  3T4S A;  1CI9 A;  3LYX A;  1W5D A;  1X0O A;  4LLO B;  1HTZ A;  1VET A;  1QMF A;  3F1O A;  1OPX A;  3IT9 A;  5TBM A;  4XUZ A;  4GHI B;  3QHY A;  1FQG A;  5KZH A;  3FZC A;  4X6T A;  4U0X A;  1EWZ A;  3Q7V A;  3QNC A;  1CK3 A;  4HES A;  2ZQ8 A;  2CMN A;  1S6R A;  3D72 A;  3GV9 A;  5C5K A;  1H0M A;  2ZQA A;  2OLU A;  4HH2 A;  4PM9 A;  4G3V A;  1LI0 A;  4FH2 A;  1K54 A;  2CC1 A;  4WMC A;  4BD1 A;  5J4E A;  3QP6 A;  3H82 A;  4H6J A;  3G35 A;  1P97 A;  2GJ3 A;  4BL3 A;  4RX3 A;  1NYY A;  2DCF A;  2HDS A;  2WAE A;  3MSH A;  3GDI A;  3W2Z A;  1ZC2 A;  2B5R A;  4QB8 A;  1PYY A;  4NKP A;  3NC8 A;  3VMA A;  3PBR A;  4XUX A;  3DAV A;  4JLF A;  1WA9 A;  2ZMF A;  1PW8 A;  2FH5 A;  5A93 A;  2PYR A;  3C4P A;  3ITB A;  2EWV A;  3ZG9 B;  3FC7 A;  2HP6 A;  4MBF A;  3ZGA B;  1VQQ A;  1N9L A;  2NUT C;  1MPL A;  4EES A;  2PRF A;  4HJ4 A;  4X56 A;  2ZM8 A;  3MXR A;  4L0L A;  3S7N A;  5GLC A;  5JYP A;  1OTB A;  3H7W A;  2H5S A;  5CHU A;  4FOF A;  4GW9 A;  4OH0 A;  3PYP A;  4HEF A;  1ES3 A;  2VX8 A;  4Y3I A;  2ZQD A;  3OBF A;  3G34 A;  4ARZ B;  4Q8I A;  3CMZ A;  1NRF A;  1ONG A;  3OLO A;  1L0G A;  1Y54 A;  5DF7 A;  1RGY A;  5AQ7 A;  1LSV A;  3MQQ A;  4HI4 A;  3TJZ C;  3Q81 A;  1H8Y A;  3W4Q A;  1XKZ A;  1YLT A;  4RQ9 A;  2K31 A;  4I3A A;  5CHM A;  4QJG A;  3V39 A;  3HLE A;  4PHT A;  3LIF A;  4FUW A;  4N9L A;  2Y2P A;  3S4X A;  1VET B;  1TDG A;  2BTF P;  3SOI A;  2DMW A;  4KZ6 A;  1PWC A;  3F1O B;  2K2N A;  4CLC A;  4BBV A;  2Q9M A;  5TBM B;  1L0E A;  4Y0T A;  2XRO A;  3D3O A;  3KO6 A;  3Q7V B;  4X55 A;  3VOY A;  3G2Y A;  4O0P A;  2EWW A; 
#chains in the Genus database with same CATH homology
 2WKP A;  2ZBB A;  4K08 A;  4HY8 A;  4R38 A;  3VE4 A;  3PBT A;  2J3W A;  1GSV A;  2QJ5 A;  4DMZ A;  2PYP A;  2L0W A;  4WN5 A;  1V9Y A;  5K5B A;  3MQO A;  2A2L A;  2MJ6 A;  3E4Q A;  5HL6 A;  2HV1 A;  4GS9 A;  3H82 B;  4H6J B;  1H8M A;  3VV4 A;  4WEK A;  1IFQ A;  3BJN A;  4NXG A;  2A24 A;  2WKQ A;  3R7W B;  2JN7 A;  2D02 A;  2QWS A;  4MN5 A;  4HJ6 A;  1OJG A;  2LB9 A;  3PHY A;  4B93 A;  2PHY A;  3MR0 A;  1DRM A;  3NOT C;  4HHD A;  5DJT A;  3UB7 A;  4CQH A;  2PR5 A;  2JKT M;  2KOI A;  3T50 A;  4FSF A;  4Q0I A;  5HWV A;  5DKL A;  2JKR I;  4M4X A;  3B33 A;  4YOF A;  4KUO A;  2ZOH A;  3IS2 A;  1TF1 A;  3KSF A;  2W1T B;  1STZ A;  4BMW A;  2P08 A;  4WL9 A;  5HSQ A;  3PBS A;  2V0U A;  2J3T C;  3HJI A;  5KIZ A;  4I38 A;  1S1Y A;  2W27 A;  3E4P A;  3IBJ A;  4HJ3 A;  2VEA A;  2NUP C;  2H28 A;  4OOM A;  3P7N A;  5IS1 A;  1F98 A;  3TW8 A;  4WLA A;  4XT2 B;  1P9W A;  2P04 A;  2VA0 A;  1LL8 A;  1XJ3 A;  2PR6 A;  2W3F A;  5DFX A;  2VGL M;  1S66 L;  2OWH A;  5DJU A;  3H7W B;  3CUE A;  4HP4 A;  5I5L A;  2OAQ 1;  3LR3 A;  3UE3 A;  4YWZ A;  3O5Y A;  4CLC E;  3LID A;  2K7S A;  3LIA A;  3F1P A;  3RFB A;  2INW A;  2VZW A;  1OTI A;  4WUJ A;  2PDR A;  3FG8 A;  3OOV A;  1GSW A;  4KQO A;  4I39 A;  4EUV A;  4AFI A;  3MMH A;  1IOU A;  2Y8H A;  1D06 A;  4MN6 A;  4LPZ A;  4BWI A;  2O9C A;  2XRN A;  4ME4 A;  3T4T A;  3U2A A;  4CLC C;  3MF0 A;  3CI6 A;  3A0R A;  1T1C A;  4OOL A;  3R4K A;  5AJG A;  2I9V A;  4O01 A;  2PT7 A;  2VGL S;  2G7U A;  3TE8 A;  3LR5 A;  3EEA A;  4L9F A;  3TRC A;  5FL3 A;  3OCL A;  1P0Z A;  4UEY A;  3OC2 A;  3HCY A;  4JGQ A;  2FZ0 A;  1UWN X;  3K3C A;  3NJA A;  4CLC B;  1ODV A;  2J80 A;  2W1R A;  3ZQ5 A;  4GHI A;  3S7O A;  2XA7 M;  2W3G A;  1TS0 A;  4ZRR A;  3T4O A;  5MC7 A;  1YAX A;  2B02 A;  3EWK A;  2GX5 A;  3JVV A;  4EXO A;  4O8G A;  1T18 A;  4I3J A;  5HD5 A;  2HJ9 C;  3A0V A;  4R70 A;  3LIB A;  1JNU A;  2M7V A;  2ZMV A;  4GLQ A;  2R78 A;  1VB6 A;  5HDC A;  5A8B A;  1LT0 A;  2L1M A;  4IHQ A;  2OAP 1;  2KDK A;  2V0W A;  1BYW A;  2W3H A;  4Q0H A;  1ZTU A;  1OTE A;  4MMN A;  1EW0 A;  4GS9 B;  1UWP X;  4DJ2 A;  1G28 A;  2XSS A;  2O9B A;  1KOU A;  2A24 B;  4JGR A;  3T4L A;  2XA7 S;  3ZYT A;  1DP9 A;  2V1A A;  4L9E A;  5AVE A;  2P7J A;  2VV7 A;  1TD5 A;  1MC0 A;  2QKP A;  3K2N A;  1TS8 A;  2OWJ A;  3NOP C;  2GNX A;  5F6A A;  2O0Y A;  4R3A A;  5CX7 A;  4E04 A;  4R6L A;  2OOL A;  2Z6D A;  1NRJ A;  5DFY A;  3CWF A;  4UQI M;  3SW1 A;  3IS2 B;  4LRZ E;  3F1N A;  4HQA A;  4NXB A;  2JKR M;  3BQ8 A;  3OCN A;  3FPV A;  4EER A;  3LUQ A;  2GZA A;  1T1B A;  3CUE C;  5TJJ A;  3LIC A;  4NXF A;  4EW7 A;  1S4R A;  5F68 A;  1OT9 A;  4PKY G;  1YSQ A;  4BJP A;  2V9A A;  4QPR A;  3B42 A;  3PR6 A;  2EA9 A;  2L4R A;  4IUH A;  2HGV A;  5HWT A;  3ULF A;  3BY9 A;  3CLO A;  3MXQ A;  4WEJ A;  4EEU A;  4G3K A;  1VHM A;  5J7E A;  3LI8 A;  1N9O A;  1G6O A;  5HD3 A;  1TS7 A;  2QYB A;  3UB8 A;  2HJE A;  3F1P B;  4UQI S;  3B47 A;  1NLZ A;  5HDS A;  2BAS A;  3G6O A;  4ARZ A;  3CIT A;  2VV8 A;  3MFX A;  4LRY C;  3VE3 A;  4WF0 A;  1LSW A;  3LI9 A;  2W0N A;  2VLG A;  2M7U A;  3PBN A;  5HZH A;  1S4S A;  1ZHH B;  2PD7 A;  3UME A;  5EFW A;  4LRX C;  4F3L A;  4IJG A;  3LR0 A;  1TS6 A;  3IBR A;  3KSG A;  3UMD A;  5J3W A;  1UGU A;  4PAU A;  2IA2 A;  3T4S A;  1OTD A;  2Z6C A;  3KYZ A;  3LYX A;  3BW6 A;  1X0O A;  3JVU A;  5HPF A;  2VJW A;  5AVF A;  3T4Q A;  4LLO B;  2O9A A;  2VV6 A;  3GEC A;  3RTY A;  4DJ3 A;  3BQA A;  3F1O A;  4Q0J A;  3EQV A;  1OPX A;  4YNR A;  5TBM A;  4GHI B;  4GJ4 A;  1OTA A;  1XJ6 A;  3E98 A;  5DKK A;  2W3D A;  1S1Z A;  3UE6 A;  1XJ4 A;  2QHK A;  2HF6 A;  5F69 A;  3MJQ A;  3K3D A;  4Z1W A;  4ETZ A;  2CMN A;  3KSH A;  3D72 A;  5C5K A;  4DN0 A;  4HH3 A;  3PBO A;  4BBU A;  3NHQ A;  4EEP A;  2KLI A;  3KSI A;  4MCW A;  4HH2 A;  4G3V A;  4KUK A;  1DP8 A;  3S7P A;  3PBQ A;  4MDZ A;  1DP6 A;  5J4E A;  3H82 A;  5L8M A;  4H6J A;  3EGX C;  1P97 A;  2GJ3 A;  4II7 A;  5F5Y A;  1YSP A;  2PD8 A;  2KX6 A;  4P6Z M;  3R7W A;  2J3T D;  4NEE D;  3UB6 A;  2JKT I;  3C38 A;  3E4O A;  3GDI A;  2ZOI A;  3EQU A;  1F9I A;  3W2Z A;  3LIE A;  4PKY A;  1W63 Q;  4GCZ A;  3V67 A;  4I5S A;  1OT6 A;  4NKP A;  5G4Y A;  2QJ7 A;  3PBR A;  3ICY A;  4Y2F A;  3T4J A;  3F1N B;  1T19 A;  2W1T A;  1WA9 A;  3DBA A;  4BBT A;  2ZMF A;  4WEL A;  2D01 A;  4NXE A;  4G3W A;  2FH5 A;  2O99 A;  2PYR A;  5IU1 A;  4HOI A;  2EWV A;  3NOU C;  5HDD A;  4ETX A;  4KQD A;  3FPW A;  3HJK A;  4B9O A;  3FC7 A;  4P6Z S;  1N9N A;  2JHE A;  4XT2 A;  1W63 M;  2VKS A;  4HP9 A;  1N9L A;  2NUT C;  4I3I A;  4EES A;  4HJ4 A;  4EQ1 A;  1OJ5 A;  3CAX A;  4L0L A;  1F5M A;  2WKR A;  4Y5F A;  3S7N A;  5IT5 A;  1OTB A;  3H7W A;  1LSX A;  1D7E A;  4CLC D;  4FOF A;  1V9Z A;  4GW9 A;  2YKF A;  1S67 L;  3PYP A;  3T4K A;  2B18 A;  4JGP A;  2VX8 A;  4HNB A;  4Y3I A;  2LB5 A;  1XFN A;  3OBF A;  1T1A A;  3BWL A;  4ARZ B;  5HPI A;  3UB9 A;  3LFV A;  3C8C A;  3OLO A;  3C2W A;  1MZU A;  3E0Y A;  5HWW A;  3EGD C;  1LSV A;  3RH8 B;  1NWZ A;  3MQQ A;  3P01 A;  4HI4 A;  3TJZ C;  1Y28 A;  4EET B;  1MKM A;  1H3Q A;  4F3L B;  2V1B A;  4IUK A;  2M1C A;  5LBR A;  1XJ2 A;  2W3E A;  5KSH A;  4RQ9 A;  2K31 A;  4I3A A;  3S7Q A;  4PHT A;  1P9R A;  3MQ0 A;  3LIF A;  5DF9 A;  2YKH A;  3EEH A;  5G4Z A;  2Y79 A;  3EOI A;  3C30 A;  4JGO A;  2DMW A;  3F1O B;  2K2N A;  1GSX A;  1XFQ A;  3PXP A;  4CLC A;  4BBV A;  5TBM B;  3H9W A;  2XRO A;  3D3O A;  1NLY A;  3KO6 A;  4HIA A;  4L9G A;  4EU0 A;  3LR4 A;  3VOL A;  4MN7 A;  3A0S A;  3KX0 X;  3KYQ A;  4O0P A;  1YKD A;  2EWW A;  3BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...