5A93A

293k joint x-ray neutron with cefotaxime: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a93A00
4N9KA 3C4OA 4QY5A 2Q9NA 4E3IA 1S6RA 2FFYA 4RVAA 1BUEA 4K0WA 3RXXA 1Q2PA 2Y2HA 4FH4A 3UE0A 1DJBA 4F94A 4QU3A 1MWRA 2ZMAA 4BENA 2XFTA 2Y59A 3IHBA 2A3UA 4GN2A 3W4QA 3BFGA 3O87A 1K4FA 3LO7A 2WYXA 2QZ6A 3G32A 4N1HA 4RYEA 4DE0A 2ZD8A 3C4PA 5CGWA 5CRFA 3A3DA 5FAQA 2IWCA 3NIAA 4WBGA 4IBXA 3Q1FA 3G34A 2WGWB 2Y2IA 2P9VA 3PAGA 4B88A 3GV9A 3JYIA 2WGVA 1ZC2A 4U3TA 4KQOA 1L2SA 4S2NA 4Y0TA 3HL9A 2ZQAA 1CI8A 3HUMA 4OLDA 4RX3A 4JXGA 4DF6A 3UDIA 2UWXA 1W5DA 1MWSA 2DCFA 1ES4A 5GHYA 4S2KA 1EI5A 1K6SA 3BYDA 2ZM8A 1CK3A 2ZC7A 3IQAA 3WS5A 4KENB 2EFUA 5DVAA 1PZPA 4GZBA 4JXWA 3G30A 4KQQA 1K54A 4L0LA 5E2EA 1K56D 3CG5A 2A49A 3OC2A 2EX2A 5FATA 4PPRA 1E3UD 1BLSA 1WYCA 5I94A 3NBLA 1PW8A 3A3IA 3IF6C 4ZBEA 2WADA 3GR2A 4WZ5A 4WEJA 2XGNA 3UDFA 2J9OA 4ZDXA 1GA9A 1XA1A 2Y4AA 5EPHA 4LV0A 4FH2A 2ZLYA 4OPQA 5EVIC 1M6KA 3HREA 4BD1A 2WZZA 4E3JA 3SH7A 1K57C 1KGFA 3V39A 5A91A 4X53A 1IKGA 2ZQDA 4LENA 5DTSA 4QB8A 1K38A 1NYYA 2EXBA 2OLVA 1YLJA 3IWOA 3I7JA 4KZ6A 5GHZA 3G4PA 4KG6A 4X69A 4E6WA 3DWZA 4ZAMA 2E8IA 3WWXA 3ZCZA 3G35A 4N92A 3VP2A 1K55A 2XD1A 5DTKA 5BOHA 3OCNA 1QMFA 2G2UA 5HAIA 3FKWA 3UNWA 4KZ8A 3IH8A 4DXCA 4C75A 1Q2QA 5EOOA 1L0FA 3BRMA 4WELA 5A93A 2IWDA 4WMCD 4ZJ3A 4PM6A 4R1GA 5GLDA 5J8XA 5E2GA 5F1GA 2JC7A 3VOZA 1RGYA 1LL9A 3A3EA 1H5XA 2WGWA 3GSGA 1BULA 1QMEA 3V50A 4FSFA 4N9LA 2PBYA 4QHCA 1FCNA 1FOFA 3MXSA 5CHJA 3VMAA 3EQUA 4EBNA 2HDSA 5DF8A 1XP4A 3W4PA 1XGJA 2ZQ8A 2IWBA 3PBRA 3SS3A 3IWIA 3NI9A 2HDQA 2Y91A 4PM5A 3UPPA 3P98A 4HESA 3ZG9B 4Q8IA 4QJGA 1GCEA 1WYBA 2X01A 1IYSA 3V3RA 2Y2NA 1PW1A 4Y0OA 1LHYA 4DE3A 3VP3A 5CEDA 1JWPA 1W8YA 3N4IA 1W8QA 4KG2A 4X56A 3VSLA 5FI2A 4GDNA 3Q7VB 1XA7A 3FYZA 4WZ4A 1TDGA 3VSKA 3VP4A 1PWDA 1YM1A 3V5MA 4BJPA 5EECA 3NC8A 2DRWA 2QMIA 2XR0A 1IYQA 3HLDA 3BFCA 5FQMA 5A92A 4PM9A 2H10A 3HLCA 2JCHA 4MEZA 4U0TA 4JKTA 3SS5A 2HP5A 5GLBA 3LY4A 5FAOA 5M1AA 5E2HA 1ES2A 1IYOA 4R0QA 1Y54A 5M19A 3ZGAB 5D3OA 3G2YA 5A90A 2ZC4B 4OKPA 1W79A 4U0XA 3S1YA 2WK0A 3MZFA 3C7VA 1SDEA 4S2OA 5L2FA 2JBFA 4ZTKA 1HZOA 1SKFA 3PAEA 1IEMA 4OLGA 1PWGA 1BZAA 2VGKA 4KZ9A 4OVDA 4WM9A 4XXRA 1K25A 1YLZA 3DW0A 3NY4A 1XPBA 3O86A 3VFHA 3QHYA 3IF6B 5CGSA 2Q9MA 4BQMA 4EQIA 3GRJA 4FCFA 4WYYA 1K54C 4KG5A 3MXRA 4IEDA 3ZDJA 3IXBA 4YFMA 3AGDA 1YT4A 1LI9A 1H8YA 2BG1A 4E3KA 2C6WB 3UE3A 1S0WA 3BECA 1CEFA 1ERQA 4M3KA 4UA9A 5KSCA 5AQAA 5AQBA 2XH9A 5IHVA 1YMSA 2PU4A 4X55A 1N9BA 5TR7A 1JWZA 3FWLA 4DE2A 4NETA 1YLWA 2Y2PA 2JE5A 3UPNA 3S22A 3MBZA 2Z2MB 3ZFZA 4UA6A 5CTMA 3OCLA 1K56A 4RX2A 2HPBA 4JBFA 1KGEA 3E2LA 2XEPA 1E3UA 4OPZA 4OPYA 1ES5A 4BL2A 3NCKA 3PBQA 3UO9A 1SCWA 5AQ7A 5FQQA 4UHUA 5EVLA 5KSHA 4NK3A 2G2WA 5CECA 2C5WB 3M6HA 1PI4A 2H0TA 1GHMA 3BFDA 3G31A 3PBOA 4OQHA 3C7UA 2Y2OA 4FD8A 2ZM0A 2B5RA 1ZG4A 5F83A 3WS2A 5TFQA 1XGIA 1XXMA 1E25A 4GNUA 2OLUA 3IT9A 1ESIA 4N1XA 3UN7A 1ESUA 4PMAA 4A5RA 4JXSA 3GQZA 4OQ0A 3UY6A 4Y0UA 1L0DA 1I2SA 4KQRA 4OP8A 1NXYA 3LEZA 4O7DA 4OOMA 1NJ4A 1WE4A 2J9PA 3TG9A 2XF3A 3HLGA 3CZDA 3NDGA 1G68A 3A3JA 5HX9A 3WS4A 3DWKA 4P6BA 4DXBA 3BFFA 1JWVA 3ITAA 5EOEA 5FQJA 1JTGA 2Y2LA 2ZC5B 3PBNA 4OOLA 4WMCA 1I5QA 4HBUA 4E3NA 5CERA 3O3VA 3G2ZA 3ISGA 4HEFA 4LV2A 4QD4A 4GDBA 4JF5A 3UE1A 2ZC3B 1J9MA 3HLFA 3ZVTA 2H0YA 2V1ZA 1AXBA 3IF6A 3P09A 3ZG0A 5HAQA 4UA7A 4MNRA 3HVFA 1ERMA 3ZG7B 1HD8A 4ID4A 1OMEA 2WGIA 1FSWA 5EVID 2J7VA 4XUXA 3OPRA 3ZNTA 4EBPA 5KZHA 1K57A 3IXHA 1PWCA 4Z9QA 4OP5A 3DTMA 4R3JA 2R9XA 4IVIA 2EFXA 4JF6A 1I2WA 1TDLA 1E4DA 1MBLA 1YLTA 1TVFA 2I72A 4R4RA 1ZKJA 1Z6FA 1HVBA 3HLBA 5DF7A 3M2JA 4R23A 4X6TA 3MZDA 3C5AA 1BLPA 5HAPA 1NYMA 4YINA 1XKZA 3UPOA 4HBTA 2XD5A 4IBRA 4GOGA 4UAAA 2EXAA 3OPPA 2XK1A 1KDWA 2EX8A 3PTEA 2VGJA 5CHUA 3SH9A 3LY3A 3BLSA 1GHPA 5FI7A 5CHMA 2QPNA 3GMWA 5HL1A 4BL3A 1K6RA 3WS1A 2GDNA 5TGFA 4C3QA 2WKEA 3ITBA 3W8KA 1RCJA 2CC1A 5HFOA 4S2NC 5FASA 2RCXA 4S2IA 1YMXA 4JLFA 3EQVA 4OQGA 4MBFA 1RGZA 1NZUA 3M2KA 5F1FA 1MY8A 4DRTA 1ES3A 5CXWA 1EWZA 2HP6A 5FQIA 1BLCA 1FR1A 5HARA 1YLYA 3PBSA 4GKUA 3QNCA 4LV1A 1MPLA 3LCEA 1BSGA 3AGEA 4PM7A 1O7EA 5GLCA 4XUZA 2WUQA 4QY6A 2X71A 4LV3A 2Y2QA 2OV5A 5EVIB 2Y2MA 3Q07A 1LL5A 3CMZA 1FCMA 2HDUA 1IKIA 4KZ4A 4OPRA 5G18A 1GHIA 1KE4A 5CTNA 4WZ5C 3N8SA 4B4ZA 1TEMA 1W7FA 3OPLA 1KE0A 3B3XA 1RP5A 2EX6A 1N4OA 2ZQCA 3FKVA 3S4XA 3WRTA 3BM6A 3MKEA 2WKHA 2XDMA 4WEKA 1SHVA 2FFFB 4DKIA 2ZJ9A 1IYPA 4P0MA 4R4SA 4P87A 4CJNA 3BEBA 5AQ9A 5CEBA 1NY0A 4OQIA 2Z2LB 5FDHA 1K4EA 3BFEA 3IHAA 3IWQA 3HUOA 5E2FA 3OZHA 3Q82A 1SDNA 1KVMA 4EBLA 4EWFA 3NDEA 3SOIA 1YQSA 1BT5A 2ZQ7A 1VQQA 3ZG5A 1K55C 1KGGA 3TOIA 2J8YA 4OOYA 3N6IA 3FV7A 1CEGA 3Q7VA 1FQGA 2ZM2A 1ZG6A 4RA7A 1M40A 1HTZA 1MXOA 1XX2A 5FSRA 5JYOA 1MWUA 2OSUA 3HLEA 4Y7PA 3Q81A 5FA7A 3O88A 4LCLA 4BLMA 1IELA 2P74A 3AGFA 4P85A 5DTTA 1FSYA 4H8RA 3VP1A 3IXGA 4E3OA 1CI9A 1EROA 5GLAA 3RJUA 1PI5A 3SH8A 2ZQ9A 5JYPA 5KMWA 3HUNA 2V2FF 4BD0A 5E43A 5EUAA 3ZNYA 4EUZA 4OH0A 3M6BA 1PZOA 1JVJA 2R9WA 3IH9A 2XFSA 5FQ9A 4KZ7A 3IF5A 3V3SA 2XLNA 3VFFA 5GL9A 4OONA 3WS0A 5M18A 4JPMA 2Y2KA 1JTDA 4C6YA 5EE8A 3ZG8B 1DY6A 1FR6A 3MKFA 3N8LA 5FAPA 1DJCA 3GVBA 3OPHA 5GHXA 2RL3A 1ONHA 4S2PA 1ALQA 4DE1A 3HLWA 4K0XA 3VOYA 1LLBA 3CJMA 4E3LA 2XQZA 3WRZA 5FI6A 3N7WA 2WKIA 2X02A 1YLPA 2P9VB 3ZVWA 5EVIA 1U60A 3PBTA 4X68A 1PYYA 3RXWA 3MZEA 4S2MA 4ZJ1A 1FCOA 1PIOA 1MWTA 5U47A 3D4FA 1KE3A 1VM1A 2Y2GA 1NZOA 4R3BA 1O07A 4GD6A 4EV4A 4GB7A 1BLHA 2WAEA 4JXVA 1H8ZA 2WAFA 3W4OA 3UDXA 5F82A 1BTLA 1DJAA 1GA0A 3QNBA 1C3BA 2Y55A 4JF4A 4E6XA 3A3FA 1L0GA 2Y2JA 1MKIA 5FQKA 2ZC6B 4S2LA 4KZ5A 1ONGA 3GTCA 1KDSA 3IXDA 2PU2A 3ZHHA 4IVKA 2EX9A 3TSGA 4LCMA 4E3MA 1LI0A 3E2KA 4KZBA 5DF9A 4DDYA 4K91A 4KZAA 4D2OA 3MFDA 4S2JA 4B4XA 3SS4A 3VP0A 5HW3A 4MBKA 3BLMA 2HDRA 4PM8A 1NRFA 4KZ3A 3Q7ZA 4GD8A 5CGXA 1L0EA 2HP9A 2BLSA 3HBRA 4CPKA 1G6AA 1KVLA 2DNSA 2WZXA 4MLLA 4DDSA 4ZJ2A 3FZCA 3N8RA 2H5SA 4MBHA 2V20A
chains in the Genus database with same CATH superfamily
1KOUA 4E3IA 4K0WA 2V0WA 3RXXA 1Q2PA 3UE0A 4QU3A 1MWRA 2ZMAA 4BENA 2W3GA 3LO7A 5HZHA 3G32A 2V1BA 2ZD8A 2IWCA 4IBXA 3IX3A 5HDSA 2J3WA 4EEPA 3OOVA 2WGVA 1S1YA 4S2NA 3O5YA 1TS7A 4JGOA 4JXGA 4QWOA 2Z6DA 2KOIA 2JHEA 1HLUP 2JN7A 2GZAA 4L9EA 1CK3A 3A0RA 2ZC7A 3IQAA 3QP6A 4RQ9A 3T1XA 1N9OA 3OC2A 4NEED 1OTBA 5FATA 4PPRA 1E3UD 5I94A 4Y5FA 3NBLA 3HCYA 3GR2A 2PR5A 3FPVA 1XA1A 3E4OA 1H3QA 3LR0A 4IJGA 1K57C 1KGFA 1S4SA 3LIEA 3V39A 3H7WB 2ZQDA 3CUEA 4LENA 5DTSA 1K38A 2OLVA 1Y28A 3IWOA 5DJUA 3BQAA 5GHZA 5IT5A 1W63M 4ZAMA 3WWXA 3G35A 4N92A 1J3WA 3BY8A 3OCNA 4B93A 4DXCA 3S7QA 5E2GA 5F1GA 1D06A 1LL9A 4R38A 2O0YA 3V50A 1FCNA 5CHJA 3MXSA 3QP4A 3VMAA 2HDSA 2OWHA 3IWIA 2HDQA 1NRJA 3UPPA 4Q8IA 4QJGA 1WYBA 3RFBA 3V3RA 1LHYA 3BY9A 3VP3A 4HNBA 2PD8A 1W8YA 1W8QA 4KG2A 5FI2A 2W1TA 3B42A 4GW9A 3VP4A 3V5MA 2V8FA 4LRZE 3BFCA 2W3HA 3H82B 2JCHA 3SS5A 4U0TA 4JKTA 2HP5A 1CF0A 1SKOA 2B02A 5M1AA 5E2HA 3VE4A 3UB6A 1T1CA 3ZGAB 2VA0A 4EW7A 1W79A 3S1YA 3C7VA 4S2OA 2WKQA 2JBFA 1SKFA 3EEHA 2V0UA 2VGKA 2A24A 3MR0A 3GRJA 3MXQA 4IEDA 3ZDJA 1H8YA 4G3WA 4UA9A 2O99A 5AQBA 5IHVA 5HSQA 2PU4A 1N9BA 1JWZA 1YLWA 2Y2PA 4QPRA 4CLCC 3UPNA 2Z2MB 1K56A 4JBFA 3G6OA 4OPYA 3PBQA 5FQQA 5EVLA 2C5WB 1MZUA 1GHMA 3PBOA 4OQHA 2Y2OA 2HGVA 4M4XA 5F83A 3WS2A 3F1OA 3NOPC 3IT9A 5TBMA 3K3DA 4PHTA 4A5RA 5K5BA 3UY6A 1I2SA 1NXYA 3KO6A 1WE4A 3TG9A 2XF3A 3CZDA 3WS4A 1G68A 3A3JA 4EERA 3LR5A 4II7A 4P6BA 2QHKA 1JWVA 5G4ZA 4OOLA 4HBUA 4E3NA 4Y17A 3UE1A 2PAVP 4FUWA 4ID4A 2WGIA 1FSWA 3V67A 3OPRA 5FL3A 5G4YA 5MC7A 4OP5A 3T1QB 2R9XA 4IVIA 2K7SA 3BWLA 2LB9A 3M2JA 4R23A 4X6TA 2D02A 1NYMA 3UPOA 4HBTA 4BMWA 1CJFA 3LUQA 2QPNA 3GMWA 4BL3A 1K6RA 5L10A 1PFLA 3ITBA 3VV4A 4DJ2A 4PAUA 1LL8A 3DTEA 3T12B 1RCJA 5HFOA 4S2NC 4CLCB 1TS6A 1XJ2A 4MBFA 1OTDA 5CXWA 1BLCA 1FR1A 1JNUA 1UGUA 1YKDA 4XUZA 1BYWA 5EVIB 3Q07A 3CMZA 1FCMA 3KYQA 5LBRA 3QP1A 2ZQCA 4LGWA 3WRTA 4IUKA 3BM6A 3ZQ5A 2WKHA 1D7EA 3IX8A 1OPXA 4P87A 3BEBA 4OQIA 2Z2LB 3C30A 5EVEA 2VV6A 3OZHA 1KVMA 1UWNX 3NDEA 4GCZA 1YQSA 1N9LA 1VQQA 2VZWA 3ZG5A 4OOYA 3N6IA 1FQGA 2ZM2A 1HTZA 5FSRA 5JYOA 1MWUA 2OSUA 3Q81A 1CQAA 4BLMA 2P74A 3H82A 3F1PA 1EROA 5JYPA 2KX6A 1P9RA 1JVJA 4Q0JA 2XFSA 5IU1A 4KZ7A 3IF5A 2XLNA 3VFFA 1S66L 2Y2KA 4C6YA 5FAPA 5HWVA 3VOYA 1XFQA 4E3LA 2XA7M 4EXOA 4ME4A 3ZYTA 4GJ4A 2VV8A 1PYYA 2Y2GA 3T1RA 3LYXA 2E8JA 1X0OA 2W1RA 5F82A 4HHDA 3QNBA 1C3BA 2Y55A 4JF4A 3A3FA 2Y2JA 2ZC6B 4S2LA 4KZ5A 1ONGA 4LFUA 3ZHHA 2PU2A 4IVKA 2O9CA 3E2KA 3MFDA 3JVVA 4O01A 3BLMA 3E0YA 4PM8A 1NRFA 5KIZA 4MN5A 1F9IA 3Q7ZA 4KZ3A 4BBVA 4I3IA 4CPKA 4WL9A 4MLLA 4ZJ2A 2H5SA 4PM5A 2V20A 3C4OA 4D60A 1STZA 4Y13A 4BBTA 4HH3A 3DBAA 3E4QA 3U4LP 2Y59A 3IHBA 3LR4A 1LSWA 5EM0A 3MMHA 3UB7A 2V1AA 4UQIS 3C4PA 3A3DA 5CX7A 3Q1FA 3NOTC 2A2LA 1XJ6A 2P9VA 3PAGA 3JYIA 4EU0A 1ZC2A 1L2SA 3HUMA 3UDIA 5L09A 2DCFA 2LB5A 1K6SA 5F68A 4GZBA 3G30A 4KQQA 2MJ6A 1LT0A 1BLSA 4ZBEA 1PW8A 3A3IA 4WZ5A 3UDFA 4JGPA 1GA9A 5EPHA 4LV0A 4CLCA 4FH2A 1SKOB 1M6KA 2ZOIA 4E3JA 2WKPA 4E04A 4X53A 1IKGA 3I7JA 2P08A 4X25A 3RTYA 4KG6A 4X69A 4E6WA 4IUHA 2A24B 3VP2A 5HDCA 1K55A 4HH2A 5HAIA 1F98A 4C75A 3CWFA 4KUOA 4GHIA 4PM6A 5J8XA 2JC7A 3A3EA 3W2ZA 1H5XA 2WGWA 1QMEA 3LIDA 3MQ0A 4QHCA 3C8CA 4EBNA 3EQUA 4FOFA 2O9AA 2Y2NA 4DE3A 5CEDA 3MS6A 4GDNA 3Q7VB 4R3AA 3VSKA 3F1OB 2DRWA 2QMIA 5TBMB 3LR3A 2H10A 4MEZA 1EW0A 1ES2A 1IYOA 4I3JA 1Y54A 3JPUA 4OKPA 4U0XA 2WK0A 3MZFA 4OVDA 1IEMA 1PWGA 3R4KA 4XXRA 1K25A 1YLZA 3NY4A 2Q9MA 4HP9A 4BQMA 4EQIA 4WUJA 4WYYA 2VK3A 2PD7A 1YSQA 3AGDA 2NUTC 1LI9A 2BG1A 5DKLA 2C6WB 1CEFA 1ERQA 3KSIA 3D3OA 2JKGA 2L0WA 3S22A 1W63Q 4UA6A 5CTMA 4RX2A 2HPBA 1OTEA 1E3UA 1ES5A 4UHUA 3TJZC 4ESPA 5KSHA 2G2WA 3M6HA 3G31A 2DMWA 1A0KA 2ZM0A 5TFQA 2ACGA 4GNUA 2HZ5A 3UN7A 1ESUA 3H9WA 3DTKA 3LEZA 5HX9A 3DWKA 3P7NA 4CQHA 5EOEA 2ZC5B 3PBNA 1I5QA 5CERA 4EESA 3G2ZA 4LRYC 4LV2A 4GDBA 1J9MA 3ZVTA 3IF6A 3EOIA 1ERMA 4EUVA 2PRFA 2L1MA 2J7VA 4XUXA 4EBPA 3IXHA 5AJGA 3QP5A 3NHQA 2B95A 2EFXA 4KUKA 2I72A 1HVBA 3KYEA 4MN6A 5DF7A 3MZDA 4P6ZS 3RH8B 2NUPC 2XD5A 4GS9B 4GOGA 4UAAA 5HPFA 2W3DA 3OPPA 5J7EA 2VGJA 3F1PB 5TGFA 3W8KA 5FASA 4EQ1A 4S2IA 4OQGA 1RGZA 5F1FA 1MY8A 4AFIA 2HP6A 2QJ5A 1YLYA 3PBSA 4GKUA 3QNCA 4LV1A 1MPLA 1BSGA 4DN0A 2X71A 3OLOA 3UMDA 3C2WA 1LL5A 1IKIA 3UE6A 4OPRA 4L9GA 3F1NA 4WZ5C 1TS8A 2FFFB 3NULA 2R78A 4P0MA 4CJNA 5AQ9A 1NY0A 2VGLM 1K4EA 3IHAA 5DFYA 5E2FA 2CMNA 4EBLA 1XJ3A 5F69A 5J3WA 3D9YA 2AVXA 1K55C 3TOIA 2J8YA 4MCWA 3Q7VA 4JGRA 1ZG6A 1MXOA 1DRMA 3HLEA 3O88A 3S7OA 1IELA 3AGFA 4H8RA 3VP1A 1CI9A 3RJUA 1PI5A 4NG2A 4ETXA 2JKRI 2QWSA 3IH9A 3WS0A 3T4QA 4DMZA 3KSHA 5FDSA 3N8LA 3OPHA 5GHXA 3ULFA 4PKYA 3EWKA 1ALQA 4K0XA 5J4EA 3CJMA 2PYRA 3N7WA 2WKIA 4NXBA 2P9VB 1U60A 3PBTA 4K08A 4S2MA 4ZJ1A 1PIOA 3D4FA 1VM1A 1NZOA 4R3BA 4GD6A 4EV4A 1BLHA 2FH5A 2WAFA 3FG8A 1ZTUA 4HQAA 4E6XA 2B18A 1MKIA 5FQKA 4XT2B 3IXDA 1F5MA 4LCMA 1LI0A 5DF9A 2PR6A 4D2OA 4YWZA 4I5SA 1NLYA 2HDRA 4YOFA 3LICA 4DDSA 2YKFA 4MBHA 4N9KA 3E98A 1S6RA 2FFYA 4RVAA 1BUEA 2Y2HA 4HI4A 4FH4A 2OAQ1 4F94A 4HJ6A 2XFTA 3O87A 1K4FA 2WYXA 4N1HA 4CLCE 4GHIB 1H8MA 5CGWA 3DTIA 5FAQA 4FTXA 4DJ3A 3NIAA 2WGWB 3EEAA 3JVUA 4U3TA 1OTAA 5DJTA 4Y0TA 3HL9A 4RX3A 1CI8A 4OLDA 4DF6A 2UWXA 4NXFA 5GHYA 2ZM8A 4G3VA 1K0KA 2EFUA 4JXWA 3T4SA 3LI9A 4GS9A 3CG5A 2A49A 2W27A 2VV7A 2EX2A 2JKTI 1L3LA 3IF6C 4JGQA 2WADA 4WEJA 1YPRA 4HJ3A 2Y4AA 2ZLYA 4OPQA 3HREA 4BD1A 3MFXA 1T1BA 1D1JA 3EGXC 1NYYA 2EXBA 1S67L 2O9BA 3G4PA 2JKTM 2XD1A 3E4PA 2G2UA 3UNWA 4KZ8A 1L0FA 1SZVA 4WMCD 4LRXC 3LI8A 4R1GA 1YSPA 5HDDA 3VOZA 1RGYA 5F5YA 4FSFA 4N9LA 5DF8A 1XP4A 3W4PA 2IWBA 2ZQ8A 3PBRA 2Y91A 1UWPX 2UV0E 1GCEA 2X01A 2ZMVA 1PW1A 1JWPA 1PNEA 3N4IA 3VSLA 1XA7A 1TDGA 1PWDA 1F2KA 4BJPA 3VOLA 4ARZB 2XR0A 4YNRA 1IYQA 5FQMA 5A92A 1VB6A 5GLBA 3LY4A 5D3OA 3G2YA 1TF1A 2ZC4B 1H0MA 1SDEA 3T1SA 5L2FA 2ZOHA 4ZTKA 1G5UA 2VKSA 1HZOA 1XJ4A 4OLGA 4KZ9A 4WM9A 3DW0A 4HIAA 1XPBA 5HWTA 3VFHA 5L8MA 1Z09A 3IF6B 4HOIA 4KQDA 1OJGA 2W3EA 1K54C 4KG5A 3MXRA 1YT4A 4HP4A 4M3KA 5KSCA 5AQAA 2XH9A 3T50A 4NETA 3SZTA 2JE5A 1WA9A 3T4LA 4G3KA 4XT2A 3E2LA 2QKPA 1OT6A 3NCKA 3UO9A 5AQ7A 1N9NA 4NK3A 3LEQA 3LIFA 3BFDA 2XROA 4X1LA 4ZRRA 1ESIA 4N1XA 4PMAA 1OTIA 4JXSA 3GQZA 4OQ0A 4Y0UA 5FEGA 4KQRA 4R6LA 3KSFA 4O7DA 4NXGA 3NDGA 5HL6A 3IS2B 3BFFA 1JTGA 3O3VA 1P0ZA 4HEFA 3ISGA 4QD4A 3NJAA 4JF5A 3CAXA 3F1NB 5HAQA 4MNRA 3HVFA 1OMEA 3MQQA 5EVID 4MMNA 3ZNTA 3S7PA 5KZHA 3L9KA 4Z9QA 1PWCA 3BQ8A 4JF6A 1S4RA 1E4DA 4R4RA 1NWZA 1T18A 3T4JA 1ZKJA 1Z6FA 3HLBA 3PHYA 3C5AA 4I3AA 2P7JA 1XKZA 1VETA 4BBUA 4IBRA 2WKRA 2EXAA 2KDKA 2XK1A 3PTEA 4Q0HA 5CHUA 3SH9A 3LY3A 3BLSA 5FI7A 5CHMA 2PDRA 3WS1A 1AWIA 2GDNA 3PR6A 5HD5A 5HWWA 3BW6A 2CC1A 2RCXA 4JLFA 3EQVA 4DRTA 3A0VA 1EWZA 2YKHA 2ZBBA 4PKYG 1DP6A 3LCEA 3AGEA 4QY6A 3OBFA 2OV5A 1GSVA 2J3TD 1VHMA 1GHIA 3N8SA 2Y79A 1TEMA 4O0PA 1KE0A 1N4OA 2VLGA 4WEKA 4DKIA 2QYBA 2ZJ9A 4HJ4A 3BFEA 1LSXA 3IWQA 3HUOA 2K2NA 2Y8HA 3SOIA 2BASA 4B9OA 1BT5A 2ZQ7A 1KGGA 2VJWA 3FV7A 4RA7A 4H6JA 1M40A 4ARZA 4Y7PA 2HJEA 3B47A 2D01A 3TRCA 3SW1A 2ZQ9A 5KMWA 2V2FF 4BD0A 5E43A 5EUAA 3ZNYA 4EUZA 4OH0A 3TW8A 3M6BA 2R9WA 4NXEA 5FQ9A 5M18A 2G7UA 4JPMA 1JTDA 5EE8A 3ZG8B 2IA2A 1DY6A 4R70A 2VX8A 2RL3A 4S2PA 3HLWA 3WRZA 5FI6A 2X02A 3ZVWA 5EFWA 3RXWA 1FCOA 5U47A 1MWTA 1KE3A 3LFVA 5A8BA 4LLOB 2M7VA 1O07A 4Z1WA 4GB7A 4JXVA 1OT9A 1DP8A 3CITA 1G6OA 3LGOA 5HD3A 3TE8A 1KDSA 3KX0X 1S1ZA 2EX9A 3TSGA 2XA7S 2W0NA 3SS4A 3VP0A 5HW3A 3NOUC 4UQIM 2BTFP 2HP9A 4MDZA 2DNSA 2WZXA 4P85A 3N8RA 4PM7A 1ODVA 4MN7A 4QY5A 2Q9NA 5AVEA 1DJBA 3IS2A 1G28A 2J80A 4GLQA 3EGDC 2A3UA 4GN2A 3W4QA 2PYPA 3BFGA 5TJJA 3QP2A 4I39A 2QZ6A 4RYEA 1FILA 3B33A 4DE0A 3T4TA 5CRFA 4WBGA 3G34A 2Y2IA 4Y3IA 4B88A 3GV9A 1VEUB 5I5LA 1GSWA 4UEYA 4KQOA 2ZQAA 2ZL1A 2INWA 4LPZA 1W5DA 1MWSA 4Y15A 1ES4A 4S2KA 1EI5A 3BYDA 3KSGA 3WS5A 4KENB 2HF6A 4WN5A 5DVAA 1PZPA 4L9FA 1K54A 4L0LA 5E2EA 1K56D 3GECA 1WYCA 3CPTA 2XGNA 2J9OA 4ZDXA 3HJIA 2H28A 5EVIC 3UB9A 2WZZA 3SH7A 5A91A 1GSXA 2Q0OA 3S7NA 4QB8A 1YLJA 4KZ6A 2HV1A 3DWZA 2E8IA 3ZCZA 5DTKA 5BOHA 1QMFA 3FKWA 2HJ9C 2JKRM 3IH8A 1Q2QA 5EOOA 3BRMA 4WELA 3K3CA 5A93A 2IWDA 4ZJ3A 1Y4OA 5GLDA 1YAXA 1XFNA 3GSGA 1BULA 2PBYA 1FOFA 3U2AA 1MKMA 1P97A 1XGJA 3SS3A 3HJKA 3NI9A 3R7WB 1TD5A 3P98A 4HESA 3ZG9B 1LSVA 4F3LB 1IYSA 3MF0A 4Y0OA 3MJQA 4Y2FA 4X56A 2J3TC 4WZ4A 3FYZA 5C5KA 4ETZA 1YM1A 5EECA 3NC8A 3HLDA 4PM9A 3HLCA 3NECA 5F6AA 5FAOA 4R0QA 5M19A 5A90A 4Q0IA 3H7WA 5HPIA 3GDIA 3CHWP 3PAEA 1BZAA 3O86A 3QHYA 5CGSA 2GJ3A 4FCFA 2EA9A 2EWWA 2XSSA 3IXBA 4YFMA 4E3KA 2OAP1 3UE3A 1S0WA 3BECA 2W3FA 1YMSA 2L4RA 4X55A 5TR7A 3FWLA 4DE2A 1DP9A 2PT7A 3MBZA 3ZFZA 3OCLA 3KYZA 3CUEC 3IX4A 1KGEA 1VETB 2XEPA 4OPZA 4NKPA 3P01A 4BL2A 4BWIA 1SCWA 5CECA 2Z6CA 3BJNA 3ICYA 1PI4A 2H0TA 3C7UA 3K2NA 1T19A 2PBDP 4FD8A 1FIKA 2B5RA 1ZG4A 5IS1A 1V9YA 1XGIA 5DFXA 1XXMA 1E25A 3VE3A 2OLUA 2OOLA 4WLAA 1L0DA 4OP8A 4OOMA 1NJ4A 2GX5A 2J9PA 3HLGA 3IBJA 2QJ7A 4DXBA 1IOUA 1NLZA 3ITAA 5FQJA 2Y2LA 3CI6A 4WMCA 2GNXA 4P6ZM 2ZC3B 3HLFA 2H0YA 2V1ZA 1AXBA 3D72A 3P09A 4I38A 3C38A 3ZG0A 4UA7A 2OWJA 3T4OA 1VEUA 3ZG7B 1HD8A 1IFQA 3L7HA 3IBRA 1K57A 3DTMA 4R3JA 1I2WA 1TDLA 1MBLA 1YLTA 1TVFA 2V9AA 5EV0A 2PHYA 1MC0A 3LIAA 1BLPA 5HAPA 4YINA 1T1AA 2V8CA 4H6JB 4HY8A 1KDWA 2EX8A 2I9VA 1GHPA 3PXPA 5HL1A 4C3QA 2WKEA 3T4KA 2M1CA 1YMXA 1P9WA 1NZUA 3M2KA 1ES3A 5FQIA 2VEAA 1TS0A 5HARA 1ACFA 3A0SA 5L07A 1O7EA 5GLCA 2WUQA 4LV3A 2Y2QA 2Y2MA 2HDUA 4KZ4A 5G18A 2FZ0A 1KE4A 5CTNA 4B4ZA 1W7FA 3OPLA 3B3XA 1RP5A 2EX6A 4O8GA 3S4XA 3FKVA 3MQOA 3MKEA 2XDMA 1SHVA 1OJ5A 1IYPA 4R4SA 5CEBA 3R7WA 5FDHA 4X1MA 1V9ZA 2ZMFA 4F3LA 3Q82A 1SDNA 4EWFA 2KLIA 2K31A 3QP8A 1CEGA 1XX2A 2W1TB 3PYPA 5FA7A 3UB5P 4LCLA 5DTTA 1FSYA 3IXGA 3UMEA 4E3OA 5GLAA 3SH8A 3HUNA 2VGLS 1PRQA 4CLCD 1PZOA 3V3SA 5GL9A 4OONA 3DAVA 4EEUA 1FR6A 3MKFA 1DJCA 3GVBA 3CLOA 3FC7A 1ONHA 4DE1A 3UB8A 1LLBA 2XQZA 3MSHA 1YLPA 5EVIA 4X68A 3MZEA 5FEFA 2ZL1B 5EM1A 1ZHHB 2WAEA 1H8ZA 3W4OA 4IHQA 3UDXA 2EWVA 5DKKA 1BTLA 1DJAA 1GA0A 2JKFA 3FPWA 1L0GA 5AVFA 3GTCA 4E3MA 4KZBA 2P04A 4DDYA 4K91A 4KZAA 2M7UA 4S2JA 3CPTB 4B4XA 4EETB 4MBKA 2XRNA 4GD8A 5CGXA 1L0EA 2BLSA 3HBRA 4WF0A 1G6AA 1KVLA 3LIBA 3FZCA
chains in the Genus database with same CATH topology
4N9KA 3C4OA 4QY5A 2Q9NA 4E3IA 1S6RA 2FFYA 4RVAA 1BUEA 4K0WA 3RXXA 1Q2PA 2Y2HA 4FH4A 3UE0A 1DJBA 4F94A 4QU3A 1MWRA 2ZMAA 4BENA 2XFTA 2Y59A 3IHBA 2A3UA 4GN2A 3W4QA 3BFGA 3O87A 1K4FA 3LO7A 2WYXA 2QZ6A 3G32A 4N1HA 4RYEA 4DE0A 2ZD8A 3C4PA 5CGWA 5CRFA 3A3DA 5FAQA 2IWCA 3NIAA 4WBGA 4IBXA 3Q1FA 3G34A 2WGWB 2Y2IA 2P9VA 3PAGA 4B88A 3GV9A 3JYIA 2WGVA 1ZC2A 4U3TA 4KQOA 1L2SA 4S2NA 4Y0TA 3HL9A 2ZQAA 1CI8A 3HUMA 4OLDA 4RX3A 4JXGA 4DF6A 3UDIA 2UWXA 1W5DA 1MWSA 2DCFA 1ES4A 5GHYA 4S2KA 1EI5A 1K6SA 3BYDA 2ZM8A 1CK3A 2ZC7A 3IQAA 3WS5A 4KENB 2EFUA 5DVAA 1PZPA 4GZBA 4JXWA 3G30A 4KQQA 1K54A 4L0LA 5E2EA 1K56D 3CG5A 2A49A 3OC2A 2EX2A 5FATA 4PPRA 1E3UD 1BLSA 1WYCA 5I94A 3NBLA 1PW8A 3A3IA 3IF6C 4ZBEA 2WADA 3GR2A 4WZ5A 4WEJA 2XGNA 3UDFA 2J9OA 4ZDXA 1GA9A 1XA1A 2Y4AA 5EPHA 4LV0A 4FH2A 2ZLYA 4OPQA 5EVIC 1M6KA 3HREA 4BD1A 2WZZA 4E3JA 3SH7A 1K57C 1KGFA 3V39A 5A91A 4X53A 1IKGA 2ZQDA 4LENA 5DTSA 4QB8A 1K38A 1NYYA 2EXBA 2OLVA 1YLJA 3IWOA 3I7JA 4KZ6A 5GHZA 3G4PA 4KG6A 4X69A 4E6WA 3DWZA 4ZAMA 2E8IA 3WWXA 3ZCZA 3G35A 4N92A 3VP2A 1K55A 2XD1A 5DTKA 5BOHA 3OCNA 1QMFA 2G2UA 5HAIA 3FKWA 3UNWA 4KZ8A 3IH8A 4DXCA 4C75A 1Q2QA 5EOOA 1L0FA 3BRMA 4WELA 5A93A 2IWDA 4WMCD 4ZJ3A 4PM6A 4R1GA 5GLDA 5J8XA 5E2GA 5F1GA 2JC7A 3VOZA 1RGYA 1LL9A 3A3EA 1H5XA 2WGWA 3GSGA 1BULA 1QMEA 3V50A 4FSFA 4N9LA 2PBYA 4QHCA 1FCNA 1FOFA 3MXSA 5CHJA 3VMAA 3EQUA 4EBNA 2HDSA 5DF8A 1XP4A 3W4PA 1XGJA 2ZQ8A 2IWBA 3PBRA 3SS3A 3IWIA 3NI9A 2HDQA 2Y91A 4PM5A 3UPPA 3P98A 4HESA 3ZG9B 4Q8IA 4QJGA 1GCEA 1WYBA 2X01A 1IYSA 3V3RA 2Y2NA 1PW1A 4Y0OA 1LHYA 4DE3A 3VP3A 5CEDA 1JWPA 1W8YA 3N4IA 1W8QA 4KG2A 4X56A 3VSLA 5FI2A 4GDNA 3Q7VB 1XA7A 3FYZA 4WZ4A 1TDGA 3VSKA 3VP4A 1PWDA 1YM1A 3V5MA 4BJPA 5EECA 3NC8A 2DRWA 2QMIA 2XR0A 1IYQA 3HLDA 3BFCA 5FQMA 5A92A 4PM9A 2H10A 3HLCA 2JCHA 4MEZA 4U0TA 4JKTA 3SS5A 2HP5A 5GLBA 3LY4A 5FAOA 5M1AA 5E2HA 1ES2A 1IYOA 4R0QA 1Y54A 5M19A 3ZGAB 5D3OA 3G2YA 5A90A 2ZC4B 4OKPA 1W79A 4U0XA 3S1YA 2WK0A 3MZFA 3C7VA 1SDEA 4S2OA 5L2FA 2JBFA 4ZTKA 1HZOA 1SKFA 3PAEA 1IEMA 4OLGA 1PWGA 1BZAA 2VGKA 4KZ9A 4OVDA 4WM9A 4XXRA 1K25A 1YLZA 3DW0A 3NY4A 1XPBA 3O86A 3VFHA 3QHYA 3IF6B 5CGSA 2Q9MA 4BQMA 4EQIA 3GRJA 4FCFA 4WYYA 1K54C 4KG5A 3MXRA 4IEDA 3ZDJA 3IXBA 4YFMA 3AGDA 1YT4A 1LI9A 1H8YA 2BG1A 4E3KA 2C6WB 3UE3A 1S0WA 3BECA 1CEFA 1ERQA 4M3KA 4UA9A 5KSCA 5AQAA 5AQBA 2XH9A 5IHVA 1YMSA 2PU4A 4X55A 1N9BA 5TR7A 1JWZA 3FWLA 4DE2A 4NETA 1YLWA 2Y2PA 2JE5A 3UPNA 3S22A 3MBZA 2Z2MB 3ZFZA 4UA6A 5CTMA 3OCLA 1K56A 4RX2A 2HPBA 4JBFA 1KGEA 3E2LA 2XEPA 1E3UA 4OPZA 4OPYA 1ES5A 4BL2A 3NCKA 3PBQA 3UO9A 1SCWA 5AQ7A 5FQQA 4UHUA 5EVLA 5KSHA 4NK3A 2G2WA 5CECA 2C5WB 3M6HA 1PI4A 2H0TA 1GHMA 3BFDA 3G31A 3PBOA 4OQHA 3C7UA 2Y2OA 4FD8A 2ZM0A 2B5RA 1ZG4A 5F83A 3WS2A 5TFQA 1XGIA 1XXMA 1E25A 4GNUA 2OLUA 3IT9A 1ESIA 4N1XA 3UN7A 1ESUA 4PMAA 4A5RA 4JXSA 3GQZA 4OQ0A 3UY6A 4Y0UA 1L0DA 1I2SA 4KQRA 4OP8A 1NXYA 3LEZA 4O7DA 4OOMA 1NJ4A 1WE4A 2J9PA 3TG9A 2XF3A 3HLGA 3CZDA 3NDGA 1G68A 3A3JA 5HX9A 3WS4A 3DWKA 4P6BA 4DXBA 3BFFA 1JWVA 3ITAA 5EOEA 5FQJA 1JTGA 2Y2LA 2ZC5B 3PBNA 4OOLA 4WMCA 1I5QA 4HBUA 4E3NA 5CERA 3O3VA 3G2ZA 3ISGA 4HEFA 4LV2A 4QD4A 4GDBA 4JF5A 3UE1A 2ZC3B 1J9MA 3HLFA 3ZVTA 2H0YA 2V1ZA 1AXBA 3IF6A 3P09A 3ZG0A 5HAQA 4UA7A 4MNRA 3HVFA 1ERMA 3ZG7B 1HD8A 4ID4A 1OMEA 2WGIA 1FSWA 5EVID 2J7VA 4XUXA 3OPRA 3ZNTA 4EBPA 5KZHA 1K57A 3IXHA 1PWCA 4Z9QA 4OP5A 3DTMA 4R3JA 2R9XA 4IVIA 2EFXA 4JF6A 1I2WA 1TDLA 1E4DA 1MBLA 1YLTA 1TVFA 2I72A 4R4RA 1ZKJA 1Z6FA 1HVBA 3HLBA 5DF7A 3M2JA 4R23A 4X6TA 3MZDA 3C5AA 1BLPA 5HAPA 1NYMA 4YINA 1XKZA 3UPOA 4HBTA 2XD5A 4IBRA 4GOGA 4UAAA 2EXAA 3OPPA 2XK1A 1KDWA 2EX8A 3PTEA 2VGJA 5CHUA 3SH9A 3LY3A 3BLSA 1GHPA 5FI7A 5CHMA 2QPNA 3GMWA 5HL1A 4BL3A 1K6RA 3WS1A 2GDNA 5TGFA 4C3QA 2WKEA 3ITBA 3W8KA 1RCJA 2CC1A 5HFOA 4S2NC 5FASA 2RCXA 4S2IA 1YMXA 4JLFA 3EQVA 4OQGA 4MBFA 1RGZA 1NZUA 3M2KA 5F1FA 1MY8A 4DRTA 1ES3A 5CXWA 1EWZA 2HP6A 5FQIA 1BLCA 1FR1A 5HARA 1YLYA 3PBSA 4GKUA 3QNCA 4LV1A 1MPLA 3LCEA 1BSGA 3AGEA 4PM7A 1O7EA 5GLCA 4XUZA 2WUQA 4QY6A 2X71A 4LV3A 2Y2QA 2OV5A 5EVIB 2Y2MA 3Q07A 1LL5A 3CMZA 1FCMA 2HDUA 1IKIA 4KZ4A 4OPRA 5G18A 1GHIA 1KE4A 5CTNA 4WZ5C 3N8SA 4B4ZA 1TEMA 1W7FA 3OPLA 1KE0A 3B3XA 1RP5A 2EX6A 1N4OA 2ZQCA 3FKVA 3S4XA 3WRTA 3BM6A 3MKEA 2WKHA 2XDMA 4WEKA 1SHVA 2FFFB 4DKIA 2ZJ9A 1IYPA 4P0MA 4R4SA 4P87A 4CJNA 3BEBA 5AQ9A 5CEBA 1NY0A 4OQIA 2Z2LB 5FDHA 1K4EA 3BFEA 3IHAA 3IWQA 3HUOA 5E2FA 3OZHA 3Q82A 1SDNA 1KVMA 4EBLA 4EWFA 3NDEA 3SOIA 1YQSA 1BT5A 2ZQ7A 1VQQA 3ZG5A 1K55C 1KGGA 3TOIA 2J8YA 4OOYA 3N6IA 3FV7A 1CEGA 3Q7VA 1FQGA 2ZM2A 1ZG6A 4RA7A 1M40A 1HTZA 1MXOA 1XX2A 5FSRA 5JYOA 1MWUA 2OSUA 3HLEA 4Y7PA 3Q81A 5FA7A 3O88A 4LCLA 4BLMA 1IELA 2P74A 3AGFA 4P85A 5DTTA 1FSYA 4H8RA 3VP1A 3IXGA 4E3OA 1CI9A 1EROA 5GLAA 3RJUA 1PI5A 3SH8A 2ZQ9A 5JYPA 5KMWA 3HUNA 2V2FF 4BD0A 5E43A 5EUAA 3ZNYA 4EUZA 4OH0A 3M6BA 1PZOA 1JVJA 2R9WA 3IH9A 2XFSA 5FQ9A 4KZ7A 3IF5A 3V3SA 2XLNA 3VFFA 5GL9A 4OONA 3WS0A 5M18A 4JPMA 2Y2KA 1JTDA 4C6YA 5EE8A 3ZG8B 1DY6A 1FR6A 3MKFA 3N8LA 5FAPA 1DJCA 3GVBA 3OPHA 5GHXA 2RL3A 1ONHA 4S2PA 1ALQA 4DE1A 3HLWA 4K0XA 3VOYA 1LLBA 3CJMA 4E3LA 2XQZA 3WRZA 5FI6A 3N7WA 2WKIA 2X02A 1YLPA 2P9VB 3ZVWA 5EVIA 1U60A 3PBTA 4X68A 1PYYA 3RXWA 3MZEA 4S2MA 4ZJ1A 1FCOA 1PIOA 1MWTA 5U47A 3D4FA 1KE3A 1VM1A 2Y2GA 1NZOA 4R3BA 1O07A 4GD6A 4EV4A 4GB7A 1BLHA 2WAEA 4JXVA 1H8ZA 2WAFA 3W4OA 3UDXA 5F82A 1BTLA 1DJAA 1GA0A 3QNBA 1C3BA 2Y55A 4JF4A 4E6XA 3A3FA 1L0GA 2Y2JA 1MKIA 5FQKA 2ZC6B 4S2LA 4KZ5A 1ONGA 3GTCA 1KDSA 3IXDA 2PU2A 3ZHHA 4IVKA 2EX9A 3TSGA 4LCMA 4E3MA 1LI0A 3E2KA 4KZBA 5DF9A 4DDYA 4K91A 4KZAA 4D2OA 3MFDA 4S2JA 4B4XA 3SS4A 3VP0A 5HW3A 4MBKA 3BLMA 2HDRA 4PM8A 1NRFA 4KZ3A 3Q7ZA 4GD8A 5CGXA 1L0EA 2HP9A 2BLSA 3HBRA 4CPKA 1G6AA 1KVLA 2DNSA 2WZXA 4MLLA 4DDSA 4ZJ2A 3FZCA 3N8RA 2H5SA 4MBHA 2V20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N9K A;  3C4O A;  4QY5 A;  2Q9N A;  4E3I A;  1S6R A;  2FFY A;  4RVA A;  1BUE A;  4K0W A;  3RXX A;  1Q2P A;  2Y2H A;  4FH4 A;  3UE0 A;  1DJB A;  4F94 A;  4QU3 A;  1MWR A;  2ZMA A;  4BEN A;  2XFT A;  2Y59 A;  3IHB A;  2A3U A;  4GN2 A;  3W4Q A;  3BFG A;  3O87 A;  1K4F A;  3LO7 A;  2WYX A;  2QZ6 A;  3G32 A;  4N1H A;  4RYE A;  4DE0 A;  2ZD8 A;  3C4P A;  5CGW A;  5CRF A;  3A3D A;  5FAQ A;  2IWC A;  3NIA A;  4WBG A;  4IBX A;  3Q1F A;  3G34 A;  2WGW B;  2Y2I A;  2P9V A;  3PAG A;  4B88 A;  3GV9 A;  3JYI A;  2WGV A;  1ZC2 A;  4U3T A;  4KQO A;  1L2S A;  4S2N A;  4Y0T A;  3HL9 A;  2ZQA A;  1CI8 A;  3HUM A;  4OLD A;  4RX3 A;  4JXG A;  4DF6 A;  3UDI A;  2UWX A;  1W5D A;  1MWS A;  2DCF A;  1ES4 A;  5GHY A;  4S2K A;  1EI5 A;  1K6S A;  3BYD A;  2ZM8 A;  1CK3 A;  2ZC7 A;  3IQA A;  3WS5 A;  4KEN B;  2EFU A;  5DVA A;  1PZP A;  4GZB A;  4JXW A;  3G30 A;  4KQQ A;  1K54 A;  4L0L A;  5E2E A;  1K56 D;  3CG5 A;  2A49 A;  3OC2 A;  2EX2 A;  5FAT A;  4PPR A;  1E3U D;  1BLS A;  1WYC A;  5I94 A;  3NBL A;  1PW8 A;  3A3I A;  3IF6 C;  4ZBE A;  2WAD A;  3GR2 A;  4WZ5 A;  4WEJ A;  2XGN A;  3UDF A;  2J9O A;  4ZDX A;  1GA9 A;  1XA1 A;  2Y4A A;  5EPH A;  4LV0 A;  4FH2 A;  2ZLY A;  4OPQ A;  5EVI C;  1M6K A;  3HRE A;  4BD1 A;  2WZZ A;  4E3J A;  3SH7 A;  1K57 C;  1KGF A;  3V39 A;  5A91 A;  4X53 A;  1IKG A;  2ZQD A;  4LEN A;  5DTS A;  4QB8 A;  1K38 A;  1NYY A;  2EXB A;  2OLV A;  1YLJ A;  3IWO A;  3I7J A;  4KZ6 A;  5GHZ A;  3G4P A;  4KG6 A;  4X69 A;  4E6W A;  3DWZ A;  4ZAM A;  2E8I A;  3WWX A;  3ZCZ A;  3G35 A;  4N92 A;  3VP2 A;  1K55 A;  2XD1 A;  5DTK A;  5BOH A;  3OCN A;  1QMF A;  2G2U A;  5HAI A;  3FKW A;  3UNW A;  4KZ8 A;  3IH8 A;  4DXC A;  4C75 A;  1Q2Q A;  5EOO A;  1L0F A;  3BRM A;  4WEL A;  5A93 A;  2IWD A;  4WMC D;  4ZJ3 A;  4PM6 A;  4R1G A;  5GLD A;  5J8X A;  5E2G A;  5F1G A;  2JC7 A;  3VOZ A;  1RGY A;  1LL9 A;  3A3E A;  1H5X A;  2WGW A;  3GSG A;  1BUL A;  1QME A;  3V50 A;  4FSF A;  4N9L A;  2PBY A;  4QHC A;  1FCN A;  1FOF A;  3MXS A;  5CHJ A;  3VMA A;  3EQU A;  4EBN A;  2HDS A;  5DF8 A;  1XP4 A;  3W4P A;  1XGJ A;  2ZQ8 A;  2IWB A;  3PBR A;  3SS3 A;  3IWI A;  3NI9 A;  2HDQ A;  2Y91 A;  4PM5 A;  3UPP A;  3P98 A;  4HES A;  3ZG9 B;  4Q8I A;  4QJG A;  1GCE A;  1WYB A;  2X01 A;  1IYS A;  3V3R A;  2Y2N A;  1PW1 A;  4Y0O A;  1LHY A;  4DE3 A;  3VP3 A;  5CED A;  1JWP A;  1W8Y A;  3N4I A;  1W8Q A;  4KG2 A;  4X56 A;  3VSL A;  5FI2 A;  4GDN A;  3Q7V B;  1XA7 A;  3FYZ A;  4WZ4 A;  1TDG A;  3VSK A;  3VP4 A;  1PWD A;  1YM1 A;  3V5M A;  4BJP A;  5EEC A;  3NC8 A;  2DRW A;  2QMI A;  2XR0 A;  1IYQ A;  3HLD A;  3BFC A;  5FQM A;  5A92 A;  4PM9 A;  2H10 A;  3HLC A;  2JCH A;  4MEZ A;  4U0T A;  4JKT A;  3SS5 A;  2HP5 A;  5GLB A;  3LY4 A;  5FAO A;  5M1A A;  5E2H A;  1ES2 A;  1IYO A;  4R0Q A;  1Y54 A;  5M19 A;  3ZGA B;  5D3O A;  3G2Y A;  5A90 A;  2ZC4 B;  4OKP A;  1W79 A;  4U0X A;  3S1Y A;  2WK0 A;  3MZF A;  3C7V A;  1SDE A;  4S2O A;  5L2F A;  2JBF A;  4ZTK A;  1HZO A;  1SKF A;  3PAE A;  1IEM A;  4OLG A;  1PWG A;  1BZA A;  2VGK A;  4KZ9 A;  4OVD A;  4WM9 A;  4XXR A;  1K25 A;  1YLZ A;  3DW0 A;  3NY4 A;  1XPB A;  3O86 A;  3VFH A;  3QHY A;  3IF6 B;  5CGS A;  2Q9M A;  4BQM A;  4EQI A;  3GRJ A;  4FCF A;  4WYY A;  1K54 C;  4KG5 A;  3MXR A;  4IED A;  3ZDJ A;  3IXB A;  4YFM A;  3AGD A;  1YT4 A;  1LI9 A;  1H8Y A;  2BG1 A;  4E3K A;  2C6W B;  3UE3 A;  1S0W A;  3BEC A;  1CEF A;  1ERQ A;  4M3K A;  4UA9 A;  5KSC A;  5AQA A;  5AQB A;  2XH9 A;  5IHV A;  1YMS A;  2PU4 A;  4X55 A;  1N9B A;  5TR7 A;  1JWZ A;  3FWL A;  4DE2 A;  4NET A;  1YLW A;  2Y2P A;  2JE5 A;  3UPN A;  3S22 A;  3MBZ A;  2Z2M B;  3ZFZ A;  4UA6 A;  5CTM A;  3OCL A;  1K56 A;  4RX2 A;  2HPB A;  4JBF A;  1KGE A;  3E2L A;  2XEP A;  1E3U A;  4OPZ A;  4OPY A;  1ES5 A;  4BL2 A;  3NCK A;  3PBQ A;  3UO9 A;  1SCW A;  5AQ7 A;  5FQQ A;  4UHU A;  5EVL A;  5KSH A;  4NK3 A;  2G2W A;  5CEC A;  2C5W B;  3M6H A;  1PI4 A;  2H0T A;  1GHM A;  3BFD A;  3G31 A;  3PBO A;  4OQH A;  3C7U A;  2Y2O A;  4FD8 A;  2ZM0 A;  2B5R A;  1ZG4 A;  5F83 A;  3WS2 A;  5TFQ A;  1XGI A;  1XXM A;  1E25 A;  4GNU A;  2OLU A;  3IT9 A;  1ESI A;  4N1X A;  3UN7 A;  1ESU A;  4PMA A;  4A5R A;  4JXS A;  3GQZ A;  4OQ0 A;  3UY6 A;  4Y0U A;  1L0D A;  1I2S A;  4KQR A;  4OP8 A;  1NXY A;  3LEZ A;  4O7D A;  4OOM A;  1NJ4 A;  1WE4 A;  2J9P A;  3TG9 A;  2XF3 A;  3HLG A;  3CZD A;  3NDG A;  1G68 A;  3A3J A;  5HX9 A;  3WS4 A;  3DWK A;  4P6B A;  4DXB A;  3BFF A;  1JWV A;  3ITA A;  5EOE A;  5FQJ A;  1JTG A;  2Y2L A;  2ZC5 B;  3PBN A;  4OOL A;  4WMC A;  1I5Q A;  4HBU A;  4E3N A;  5CER A;  3O3V A;  3G2Z A;  3ISG A;  4HEF A;  4LV2 A;  4QD4 A;  4GDB A;  4JF5 A;  3UE1 A;  2ZC3 B;  1J9M A;  3HLF A;  3ZVT A;  2H0Y A;  2V1Z A;  1AXB A;  3IF6 A;  3P09 A;  3ZG0 A;  5HAQ A;  4UA7 A;  4MNR A;  3HVF A;  1ERM A;  3ZG7 B;  1HD8 A;  4ID4 A;  1OME A;  2WGI A;  1FSW A;  5EVI D;  2J7V A;  4XUX A;  3OPR A;  3ZNT A;  4EBP A;  5KZH A;  1K57 A;  3IXH A;  1PWC A;  4Z9Q A;  4OP5 A;  3DTM A;  4R3J A;  2R9X A;  4IVI A;  2EFX A;  4JF6 A;  1I2W A;  1TDL A;  1E4D A;  1MBL A;  1YLT A;  1TVF A;  2I72 A;  4R4R A;  1ZKJ A;  1Z6F A;  1HVB A;  3HLB A;  5DF7 A;  3M2J A;  4R23 A;  4X6T A;  3MZD A;  3C5A A;  1BLP A;  5HAP A;  1NYM A;  4YIN A;  1XKZ A;  3UPO A;  4HBT A;  2XD5 A;  4IBR A;  4GOG A;  4UAA A;  2EXA A;  3OPP A;  2XK1 A;  1KDW A;  2EX8 A;  3PTE A;  2VGJ A;  5CHU A;  3SH9 A;  3LY3 A;  3BLS A;  1GHP A;  5FI7 A;  5CHM A;  2QPN A;  3GMW A;  5HL1 A;  4BL3 A;  1K6R A;  3WS1 A;  2GDN A;  5TGF A;  4C3Q A;  2WKE A;  3ITB A;  3W8K A;  1RCJ A;  2CC1 A;  5HFO A;  4S2N C;  5FAS A;  2RCX A;  4S2I A;  1YMX A;  4JLF A;  3EQV A;  4OQG A;  4MBF A;  1RGZ A;  1NZU A;  3M2K A;  5F1F A;  1MY8 A;  4DRT A;  1ES3 A;  5CXW A;  1EWZ A;  2HP6 A;  5FQI A;  1BLC A;  1FR1 A;  5HAR A;  1YLY A;  3PBS A;  4GKU A;  3QNC A;  4LV1 A;  1MPL A;  3LCE A;  1BSG A;  3AGE A;  4PM7 A;  1O7E A;  5GLC A;  4XUZ A;  2WUQ A;  4QY6 A;  2X71 A;  4LV3 A;  2Y2Q A;  2OV5 A;  5EVI B;  2Y2M A;  3Q07 A;  1LL5 A;  3CMZ A;  1FCM A;  2HDU A;  1IKI A;  4KZ4 A;  4OPR A;  5G18 A;  1GHI A;  1KE4 A;  5CTN A;  4WZ5 C;  3N8S A;  4B4Z A;  1TEM A;  1W7F A;  3OPL A;  1KE0 A;  3B3X A;  1RP5 A;  2EX6 A;  1N4O A;  2ZQC A;  3FKV A;  3S4X A;  3WRT A;  3BM6 A;  3MKE A;  2WKH A;  2XDM A;  4WEK A;  1SHV A;  2FFF B;  4DKI A;  2ZJ9 A;  1IYP A;  4P0M A;  4R4S A;  4P87 A;  4CJN A;  3BEB A;  5AQ9 A;  5CEB A;  1NY0 A;  4OQI A;  2Z2L B;  5FDH A;  1K4E A;  3BFE A;  3IHA A;  3IWQ A;  3HUO A;  5E2F A;  3OZH A;  3Q82 A;  1SDN A;  1KVM A;  4EBL A;  4EWF A;  3NDE A;  3SOI A;  1YQS A;  1BT5 A;  2ZQ7 A;  1VQQ A;  3ZG5 A;  1K55 C;  1KGG A;  3TOI A;  2J8Y A;  4OOY A;  3N6I A;  3FV7 A;  1CEG A;  3Q7V A;  1FQG A;  2ZM2 A;  1ZG6 A;  4RA7 A;  1M40 A;  1HTZ A;  1MXO A;  1XX2 A;  5FSR A;  5JYO A;  1MWU A;  2OSU A;  3HLE A;  4Y7P A;  3Q81 A;  5FA7 A;  3O88 A;  4LCL A;  4BLM A;  1IEL A;  2P74 A;  3AGF A;  4P85 A;  5DTT A;  1FSY A;  4H8R A;  3VP1 A;  3IXG A;  4E3O A;  1CI9 A;  1ERO A;  5GLA A;  3RJU A;  1PI5 A;  3SH8 A;  2ZQ9 A;  5JYP A;  5KMW A;  3HUN A;  2V2F F;  4BD0 A;  5E43 A;  5EUA A;  3ZNY A;  4EUZ A;  4OH0 A;  3M6B A;  1PZO A;  1JVJ A;  2R9W A;  3IH9 A;  2XFS A;  5FQ9 A;  4KZ7 A;  3IF5 A;  3V3S A;  2XLN A;  3VFF A;  5GL9 A;  4OON A;  3WS0 A;  5M18 A;  4JPM A;  2Y2K A;  1JTD A;  4C6Y A;  5EE8 A;  3ZG8 B;  1DY6 A;  1FR6 A;  3MKF A;  3N8L A;  5FAP A;  1DJC A;  3GVB A;  3OPH A;  5GHX A;  2RL3 A;  1ONH A;  4S2P A;  1ALQ A;  4DE1 A;  3HLW A;  4K0X A;  3VOY A;  1LLB A;  3CJM A;  4E3L A;  2XQZ A;  3WRZ A;  5FI6 A;  3N7W A;  2WKI A;  2X02 A;  1YLP A;  2P9V B;  3ZVW A;  5EVI A;  1U60 A;  3PBT A;  4X68 A;  1PYY A;  3RXW A;  3MZE A;  4S2M A;  4ZJ1 A;  1FCO A;  1PIO A;  1MWT A;  5U47 A;  3D4F A;  1KE3 A;  1VM1 A;  2Y2G A;  1NZO A;  4R3B A;  1O07 A;  4GD6 A;  4EV4 A;  4GB7 A;  1BLH A;  2WAE A;  4JXV A;  1H8Z A;  2WAF A;  3W4O A;  3UDX A;  5F82 A;  1BTL A;  1DJA A;  1GA0 A;  3QNB A;  1C3B A;  2Y55 A;  4JF4 A;  4E6X A;  3A3F A;  1L0G A;  2Y2J A;  1MKI A;  5FQK A;  2ZC6 B;  4S2L A;  4KZ5 A;  1ONG A;  3GTC A;  1KDS A;  3IXD A;  2PU2 A;  3ZHH A;  4IVK A;  2EX9 A;  3TSG A;  4LCM A;  4E3M A;  1LI0 A;  3E2K A;  4KZB A;  5DF9 A;  4DDY A;  4K91 A;  4KZA A;  4D2O A;  3MFD A;  4S2J A;  4B4X A;  3SS4 A;  3VP0 A;  5HW3 A;  4MBK A;  3BLM A;  2HDR A;  4PM8 A;  1NRF A;  4KZ3 A;  3Q7Z A;  4GD8 A;  5CGX A;  1L0E A;  2HP9 A;  2BLS A;  3HBR A;  4CPK A;  1G6A A;  1KVL A;  2DNS A;  2WZX A;  4MLL A;  4DDS A;  4ZJ2 A;  3FZC A;  3N8R A;  2H5S A;  4MBH A;  2V20 A; 
#chains in the Genus database with same CATH topology
 1KOU A;  4E3I A;  4K0W A;  2V0W A;  3RXX A;  1Q2P A;  3UE0 A;  4QU3 A;  1MWR A;  2ZMA A;  4BEN A;  2W3G A;  3LO7 A;  5HZH A;  3G32 A;  2V1B A;  2ZD8 A;  2IWC A;  4IBX A;  3IX3 A;  5HDS A;  2J3W A;  4EEP A;  3OOV A;  2WGV A;  1S1Y A;  4S2N A;  3O5Y A;  1TS7 A;  4JGO A;  4JXG A;  4QWO A;  2Z6D A;  2KOI A;  2JHE A;  1HLU P;  2JN7 A;  2GZA A;  4L9E A;  1CK3 A;  3A0R A;  2ZC7 A;  3IQA A;  3QP6 A;  4RQ9 A;  3T1X A;  1N9O A;  3OC2 A;  4NEE D;  1OTB A;  5FAT A;  4PPR A;  1E3U D;  5I94 A;  4Y5F A;  3NBL A;  3HCY A;  3GR2 A;  2PR5 A;  3FPV A;  1XA1 A;  3E4O A;  1H3Q A;  3LR0 A;  4IJG A;  1K57 C;  1KGF A;  1S4S A;  3LIE A;  3V39 A;  3H7W B;  2ZQD A;  3CUE A;  4LEN A;  5DTS A;  1K38 A;  2OLV A;  1Y28 A;  3IWO A;  5DJU A;  3BQA A;  5GHZ A;  5IT5 A;  1W63 M;  4ZAM A;  3WWX A;  3G35 A;  4N92 A;  1J3W A;  3BY8 A;  3OCN A;  4B93 A;  4DXC A;  3S7Q A;  5E2G A;  5F1G A;  1D06 A;  1LL9 A;  4R38 A;  2O0Y A;  3V50 A;  1FCN A;  5CHJ A;  3MXS A;  3QP4 A;  3VMA A;  2HDS A;  2OWH A;  3IWI A;  2HDQ A;  1NRJ A;  3UPP A;  4Q8I A;  4QJG A;  1WYB A;  3RFB A;  3V3R A;  1LHY A;  3BY9 A;  3VP3 A;  4HNB A;  2PD8 A;  1W8Y A;  1W8Q A;  4KG2 A;  5FI2 A;  2W1T A;  3B42 A;  4GW9 A;  3VP4 A;  3V5M A;  2V8F A;  4LRZ E;  3BFC A;  2W3H A;  3H82 B;  2JCH A;  3SS5 A;  4U0T A;  4JKT A;  2HP5 A;  1CF0 A;  1SKO A;  2B02 A;  5M1A A;  5E2H A;  3VE4 A;  3UB6 A;  1T1C A;  3ZGA B;  2VA0 A;  4EW7 A;  1W79 A;  3S1Y A;  3C7V A;  4S2O A;  2WKQ A;  2JBF A;  1SKF A;  3EEH A;  2V0U A;  2VGK A;  2A24 A;  3MR0 A;  3GRJ A;  3MXQ A;  4IED A;  3ZDJ A;  1H8Y A;  4G3W A;  4UA9 A;  2O99 A;  5AQB A;  5IHV A;  5HSQ A;  2PU4 A;  1N9B A;  1JWZ A;  1YLW A;  2Y2P A;  4QPR A;  4CLC C;  3UPN A;  2Z2M B;  1K56 A;  4JBF A;  3G6O A;  4OPY A;  3PBQ A;  5FQQ A;  5EVL A;  2C5W B;  1MZU A;  1GHM A;  3PBO A;  4OQH A;  2Y2O A;  2HGV A;  4M4X A;  5F83 A;  3WS2 A;  3F1O A;  3NOP C;  3IT9 A;  5TBM A;  3K3D A;  4PHT A;  4A5R A;  5K5B A;  3UY6 A;  1I2S A;  1NXY A;  3KO6 A;  1WE4 A;  3TG9 A;  2XF3 A;  3CZD A;  3WS4 A;  1G68 A;  3A3J A;  4EER A;  3LR5 A;  4II7 A;  4P6B A;  2QHK A;  1JWV A;  5G4Z A;  4OOL A;  4HBU A;  4E3N A;  4Y17 A;  3UE1 A;  2PAV P;  4FUW A;  4ID4 A;  2WGI A;  1FSW A;  3V67 A;  3OPR A;  5FL3 A;  5G4Y A;  5MC7 A;  4OP5 A;  3T1Q B;  2R9X A;  4IVI A;  2K7S A;  3BWL A;  2LB9 A;  3M2J A;  4R23 A;  4X6T A;  2D02 A;  1NYM A;  3UPO A;  4HBT A;  4BMW A;  1CJF A;  3LUQ A;  2QPN A;  3GMW A;  4BL3 A;  1K6R A;  5L10 A;  1PFL A;  3ITB A;  3VV4 A;  4DJ2 A;  4PAU A;  1LL8 A;  3DTE A;  3T12 B;  1RCJ A;  5HFO A;  4S2N C;  4CLC B;  1TS6 A;  1XJ2 A;  4MBF A;  1OTD A;  5CXW A;  1BLC A;  1FR1 A;  1JNU A;  1UGU A;  1YKD A;  4XUZ A;  1BYW A;  5EVI B;  3Q07 A;  3CMZ A;  1FCM A;  3KYQ A;  5LBR A;  3QP1 A;  2ZQC A;  4LGW A;  3WRT A;  4IUK A;  3BM6 A;  3ZQ5 A;  2WKH A;  1D7E A;  3IX8 A;  1OPX A;  4P87 A;  3BEB A;  4OQI A;  2Z2L B;  3C30 A;  5EVE A;  2VV6 A;  3OZH A;  1KVM A;  1UWN X;  3NDE A;  4GCZ A;  1YQS A;  1N9L A;  1VQQ A;  2VZW A;  3ZG5 A;  4OOY A;  3N6I A;  1FQG A;  2ZM2 A;  1HTZ A;  5FSR A;  5JYO A;  1MWU A;  2OSU A;  3Q81 A;  1CQA A;  4BLM A;  2P74 A;  3H82 A;  3F1P A;  1ERO A;  5JYP A;  2KX6 A;  1P9R A;  1JVJ A;  4Q0J A;  2XFS A;  5IU1 A;  4KZ7 A;  3IF5 A;  2XLN A;  3VFF A;  1S66 L;  2Y2K A;  4C6Y A;  5FAP A;  5HWV A;  3VOY A;  1XFQ A;  4E3L A;  2XA7 M;  4EXO A;  4ME4 A;  3ZYT A;  4GJ4 A;  2VV8 A;  1PYY A;  2Y2G A;  3T1R A;  3LYX A;  2E8J A;  1X0O A;  2W1R A;  5F82 A;  4HHD A;  3QNB A;  1C3B A;  2Y55 A;  4JF4 A;  3A3F A;  2Y2J A;  2ZC6 B;  4S2L A;  4KZ5 A;  1ONG A;  4LFU A;  3ZHH A;  2PU2 A;  4IVK A;  2O9C A;  3E2K A;  3MFD A;  3JVV A;  4O01 A;  3BLM A;  3E0Y A;  4PM8 A;  1NRF A;  5KIZ A;  4MN5 A;  1F9I A;  3Q7Z A;  4KZ3 A;  4BBV A;  4I3I A;  4CPK A;  4WL9 A;  4MLL A;  4ZJ2 A;  2H5S A;  4PM5 A;  2V20 A;  3C4O A;  4D60 A;  1STZ A;  4Y13 A;  4BBT A;  4HH3 A;  3DBA A;  3E4Q A;  3U4L P;  2Y59 A;  3IHB A;  3LR4 A;  1LSW A;  5EM0 A;  3MMH A;  3UB7 A;  2V1A A;  4UQI S;  3C4P A;  3A3D A;  5CX7 A;  3Q1F A;  3NOT C;  2A2L A;  1XJ6 A;  2P9V A;  3PAG A;  3JYI A;  4EU0 A;  1ZC2 A;  1L2S A;  3HUM A;  3UDI A;  5L09 A;  2DCF A;  2LB5 A;  1K6S A;  5F68 A;  4GZB A;  3G30 A;  4KQQ A;  2MJ6 A;  1LT0 A;  1BLS A;  4ZBE A;  1PW8 A;  3A3I A;  4WZ5 A;  3UDF A;  4JGP A;  1GA9 A;  5EPH A;  4LV0 A;  4CLC A;  4FH2 A;  1SKO B;  1M6K A;  2ZOI A;  4E3J A;  2WKP A;  4E04 A;  4X53 A;  1IKG A;  3I7J A;  2P08 A;  4X25 A;  3RTY A;  4KG6 A;  4X69 A;  4E6W A;  4IUH A;  2A24 B;  3VP2 A;  5HDC A;  1K55 A;  4HH2 A;  5HAI A;  1F98 A;  4C75 A;  3CWF A;  4KUO A;  4GHI A;  4PM6 A;  5J8X A;  2JC7 A;  3A3E A;  3W2Z A;  1H5X A;  2WGW A;  1QME A;  3LID A;  3MQ0 A;  4QHC A;  3C8C A;  4EBN A;  3EQU A;  4FOF A;  2O9A A;  2Y2N A;  4DE3 A;  5CED A;  3MS6 A;  4GDN A;  3Q7V B;  4R3A A;  3VSK A;  3F1O B;  2DRW A;  2QMI A;  5TBM B;  3LR3 A;  2H10 A;  4MEZ A;  1EW0 A;  1ES2 A;  1IYO A;  4I3J A;  1Y54 A;  3JPU A;  4OKP A;  4U0X A;  2WK0 A;  3MZF A;  4OVD A;  1IEM A;  1PWG A;  3R4K A;  4XXR A;  1K25 A;  1YLZ A;  3NY4 A;  2Q9M A;  4HP9 A;  4BQM A;  4EQI A;  4WUJ A;  4WYY A;  2VK3 A;  2PD7 A;  1YSQ A;  3AGD A;  2NUT C;  1LI9 A;  2BG1 A;  5DKL A;  2C6W B;  1CEF A;  1ERQ A;  3KSI A;  3D3O A;  2JKG A;  2L0W A;  3S22 A;  1W63 Q;  4UA6 A;  5CTM A;  4RX2 A;  2HPB A;  1OTE A;  1E3U A;  1ES5 A;  4UHU A;  3TJZ C;  4ESP A;  5KSH A;  2G2W A;  3M6H A;  3G31 A;  2DMW A;  1A0K A;  2ZM0 A;  5TFQ A;  2ACG A;  4GNU A;  2HZ5 A;  3UN7 A;  1ESU A;  3H9W A;  3DTK A;  3LEZ A;  5HX9 A;  3DWK A;  3P7N A;  4CQH A;  5EOE A;  2ZC5 B;  3PBN A;  1I5Q A;  5CER A;  4EES A;  3G2Z A;  4LRY C;  4LV2 A;  4GDB A;  1J9M A;  3ZVT A;  3IF6 A;  3EOI A;  1ERM A;  4EUV A;  2PRF A;  2L1M A;  2J7V A;  4XUX A;  4EBP A;  3IXH A;  5AJG A;  3QP5 A;  3NHQ A;  2B95 A;  2EFX A;  4KUK A;  2I72 A;  1HVB A;  3KYE A;  4MN6 A;  5DF7 A;  3MZD A;  4P6Z S;  3RH8 B;  2NUP C;  2XD5 A;  4GS9 B;  4GOG A;  4UAA A;  5HPF A;  2W3D A;  3OPP A;  5J7E A;  2VGJ A;  3F1P B;  5TGF A;  3W8K A;  5FAS A;  4EQ1 A;  4S2I A;  4OQG A;  1RGZ A;  5F1F A;  1MY8 A;  4AFI A;  2HP6 A;  2QJ5 A;  1YLY A;  3PBS A;  4GKU A;  3QNC A;  4LV1 A;  1MPL A;  1BSG A;  4DN0 A;  2X71 A;  3OLO A;  3UMD A;  3C2W A;  1LL5 A;  1IKI A;  3UE6 A;  4OPR A;  4L9G A;  3F1N A;  4WZ5 C;  1TS8 A;  2FFF B;  3NUL A;  2R78 A;  4P0M A;  4CJN A;  5AQ9 A;  1NY0 A;  2VGL M;  1K4E A;  3IHA A;  5DFY A;  5E2F A;  2CMN A;  4EBL A;  1XJ3 A;  5F69 A;  5J3W A;  3D9Y A;  2AVX A;  1K55 C;  3TOI A;  2J8Y A;  4MCW A;  3Q7V A;  4JGR A;  1ZG6 A;  1MXO A;  1DRM A;  3HLE A;  3O88 A;  3S7O A;  1IEL A;  3AGF A;  4H8R A;  3VP1 A;  1CI9 A;  3RJU A;  1PI5 A;  4NG2 A;  4ETX A;  2JKR I;  2QWS A;  3IH9 A;  3WS0 A;  3T4Q A;  4DMZ A;  3KSH A;  5FDS A;  3N8L A;  3OPH A;  5GHX A;  3ULF A;  4PKY A;  3EWK A;  1ALQ A;  4K0X A;  5J4E A;  3CJM A;  2PYR A;  3N7W A;  2WKI A;  4NXB A;  2P9V B;  1U60 A;  3PBT A;  4K08 A;  4S2M A;  4ZJ1 A;  1PIO A;  3D4F A;  1VM1 A;  1NZO A;  4R3B A;  4GD6 A;  4EV4 A;  1BLH A;  2FH5 A;  2WAF A;  3FG8 A;  1ZTU A;  4HQA A;  4E6X A;  2B18 A;  1MKI A;  5FQK A;  4XT2 B;  3IXD A;  1F5M A;  4LCM A;  1LI0 A;  5DF9 A;  2PR6 A;  4D2O A;  4YWZ A;  4I5S A;  1NLY A;  2HDR A;  4YOF A;  3LIC A;  4DDS A;  2YKF A;  4MBH A;  4N9K A;  3E98 A;  1S6R A;  2FFY A;  4RVA A;  1BUE A;  2Y2H A;  4HI4 A;  4FH4 A;  2OAQ 1;  4F94 A;  4HJ6 A;  2XFT A;  3O87 A;  1K4F A;  2WYX A;  4N1H A;  4CLC E;  4GHI B;  1H8M A;  5CGW A;  3DTI A;  5FAQ A;  4FTX A;  4DJ3 A;  3NIA A;  2WGW B;  3EEA A;  3JVU A;  4U3T A;  1OTA A;  5DJT A;  4Y0T A;  3HL9 A;  4RX3 A;  1CI8 A;  4OLD A;  4DF6 A;  2UWX A;  4NXF A;  5GHY A;  2ZM8 A;  4G3V A;  1K0K A;  2EFU A;  4JXW A;  3T4S A;  3LI9 A;  4GS9 A;  3CG5 A;  2A49 A;  2W27 A;  2VV7 A;  2EX2 A;  2JKT I;  1L3L A;  3IF6 C;  4JGQ A;  2WAD A;  4WEJ A;  1YPR A;  4HJ3 A;  2Y4A A;  2ZLY A;  4OPQ A;  3HRE A;  4BD1 A;  3MFX A;  1T1B A;  1D1J A;  3EGX C;  1NYY A;  2EXB A;  1S67 L;  2O9B A;  3G4P A;  2JKT M;  2XD1 A;  3E4P A;  2G2U A;  3UNW A;  4KZ8 A;  1L0F A;  1SZV A;  4WMC D;  4LRX C;  3LI8 A;  4R1G A;  1YSP A;  5HDD A;  3VOZ A;  1RGY A;  5F5Y A;  4FSF A;  4N9L A;  5DF8 A;  1XP4 A;  3W4P A;  2IWB A;  2ZQ8 A;  3PBR A;  2Y91 A;  1UWP X;  2UV0 E;  1GCE A;  2X01 A;  2ZMV A;  1PW1 A;  1JWP A;  1PNE A;  3N4I A;  3VSL A;  1XA7 A;  1TDG A;  1PWD A;  1F2K A;  4BJP A;  3VOL A;  4ARZ B;  2XR0 A;  4YNR A;  1IYQ A;  5FQM A;  5A92 A;  1VB6 A;  5GLB A;  3LY4 A;  5D3O A;  3G2Y A;  1TF1 A;  2ZC4 B;  1H0M A;  1SDE A;  3T1S A;  5L2F A;  2ZOH A;  4ZTK A;  1G5U A;  2VKS A;  1HZO A;  1XJ4 A;  4OLG A;  4KZ9 A;  4WM9 A;  3DW0 A;  4HIA A;  1XPB A;  5HWT A;  3VFH A;  5L8M A;  1Z09 A;  3IF6 B;  4HOI A;  4KQD A;  1OJG A;  2W3E A;  1K54 C;  4KG5 A;  3MXR A;  1YT4 A;  4HP4 A;  4M3K A;  5KSC A;  5AQA A;  2XH9 A;  3T50 A;  4NET A;  3SZT A;  2JE5 A;  1WA9 A;  3T4L A;  4G3K A;  4XT2 A;  3E2L A;  2QKP A;  1OT6 A;  3NCK A;  3UO9 A;  5AQ7 A;  1N9N A;  4NK3 A;  3LEQ A;  3LIF A;  3BFD A;  2XRO A;  4X1L A;  4ZRR A;  1ESI A;  4N1X A;  4PMA A;  1OTI A;  4JXS A;  3GQZ A;  4OQ0 A;  4Y0U A;  5FEG A;  4KQR A;  4R6L A;  3KSF A;  4O7D A;  4NXG A;  3NDG A;  5HL6 A;  3IS2 B;  3BFF A;  1JTG A;  3O3V A;  1P0Z A;  4HEF A;  3ISG A;  4QD4 A;  3NJA A;  4JF5 A;  3CAX A;  3F1N B;  5HAQ A;  4MNR A;  3HVF A;  1OME A;  3MQQ A;  5EVI D;  4MMN A;  3ZNT A;  3S7P A;  5KZH A;  3L9K A;  4Z9Q A;  1PWC A;  3BQ8 A;  4JF6 A;  1S4R A;  1E4D A;  4R4R A;  1NWZ A;  1T18 A;  3T4J A;  1ZKJ A;  1Z6F A;  3HLB A;  3PHY A;  3C5A A;  4I3A A;  2P7J A;  1XKZ A;  1VET A;  4BBU A;  4IBR A;  2WKR A;  2EXA A;  2KDK A;  2XK1 A;  3PTE A;  4Q0H A;  5CHU A;  3SH9 A;  3LY3 A;  3BLS A;  5FI7 A;  5CHM A;  2PDR A;  3WS1 A;  1AWI A;  2GDN A;  3PR6 A;  5HD5 A;  5HWW A;  3BW6 A;  2CC1 A;  2RCX A;  4JLF A;  3EQV A;  4DRT A;  3A0V A;  1EWZ A;  2YKH A;  2ZBB A;  4PKY G;  1DP6 A;  3LCE A;  3AGE A;  4QY6 A;  3OBF A;  2OV5 A;  1GSV A;  2J3T D;  1VHM A;  1GHI A;  3N8S A;  2Y79 A;  1TEM A;  4O0P A;  1KE0 A;  1N4O A;  2VLG A;  4WEK A;  4DKI A;  2QYB A;  2ZJ9 A;  4HJ4 A;  3BFE A;  1LSX A;  3IWQ A;  3HUO A;  2K2N A;  2Y8H A;  3SOI A;  2BAS A;  4B9O A;  1BT5 A;  2ZQ7 A;  1KGG A;  2VJW A;  3FV7 A;  4RA7 A;  4H6J A;  1M40 A;  4ARZ A;  4Y7P A;  2HJE A;  3B47 A;  2D01 A;  3TRC A;  3SW1 A;  2ZQ9 A;  5KMW A;  2V2F F;  4BD0 A;  5E43 A;  5EUA A;  3ZNY A;  4EUZ A;  4OH0 A;  3TW8 A;  3M6B A;  2R9W A;  4NXE A;  5FQ9 A;  5M18 A;  2G7U A;  4JPM A;  1JTD A;  5EE8 A;  3ZG8 B;  2IA2 A;  1DY6 A;  4R70 A;  2VX8 A;  2RL3 A;  4S2P A;  3HLW A;  3WRZ A;  5FI6 A;  2X02 A;  3ZVW A;  5EFW A;  3RXW A;  1FCO A;  5U47 A;  1MWT A;  1KE3 A;  3LFV A;  5A8B A;  4LLO B;  2M7V A;  1O07 A;  4Z1W A;  4GB7 A;  4JXV A;  1OT9 A;  1DP8 A;  3CIT A;  1G6O A;  3LGO A;  5HD3 A;  3TE8 A;  1KDS A;  3KX0 X;  1S1Z A;  2EX9 A;  3TSG A;  2XA7 S;  2W0N A;  3SS4 A;  3VP0 A;  5HW3 A;  3NOU C;  4UQI M;  2BTF P;  2HP9 A;  4MDZ A;  2DNS A;  2WZX A;  4P85 A;  3N8R A;  4PM7 A;  1ODV A;  4MN7 A;  4QY5 A;  2Q9N A;  5AVE A;  1DJB A;  3IS2 A;  1G28 A;  2J80 A;  4GLQ A;  3EGD C;  2A3U A;  4GN2 A;  3W4Q A;  2PYP A;  3BFG A;  5TJJ A;  3QP2 A;  4I39 A;  2QZ6 A;  4RYE A;  1FIL A;  3B33 A;  4DE0 A;  3T4T A;  5CRF A;  4WBG A;  3G34 A;  2Y2I A;  4Y3I A;  4B88 A;  3GV9 A;  1VEU B;  5I5L A;  1GSW A;  4UEY A;  4KQO A;  2ZQA A;  2ZL1 A;  2INW A;  4LPZ A;  1W5D A;  1MWS A;  4Y15 A;  1ES4 A;  4S2K A;  1EI5 A;  3BYD A;  3KSG A;  3WS5 A;  4KEN B;  2HF6 A;  4WN5 A;  5DVA A;  1PZP A;  4L9F A;  1K54 A;  4L0L A;  5E2E A;  1K56 D;  3GEC A;  1WYC A;  3CPT A;  2XGN A;  2J9O A;  4ZDX A;  3HJI A;  2H28 A;  5EVI C;  3UB9 A;  2WZZ A;  3SH7 A;  5A91 A;  1GSX A;  2Q0O A;  3S7N A;  4QB8 A;  1YLJ A;  4KZ6 A;  2HV1 A;  3DWZ A;  2E8I A;  3ZCZ A;  5DTK A;  5BOH A;  1QMF A;  3FKW A;  2HJ9 C;  2JKR M;  3IH8 A;  1Q2Q A;  5EOO A;  3BRM A;  4WEL A;  3K3C A;  5A93 A;  2IWD A;  4ZJ3 A;  1Y4O A;  5GLD A;  1YAX A;  1XFN A;  3GSG A;  1BUL A;  2PBY A;  1FOF A;  3U2A A;  1MKM A;  1P97 A;  1XGJ A;  3SS3 A;  3HJK A;  3NI9 A;  3R7W B;  1TD5 A;  3P98 A;  4HES A;  3ZG9 B;  1LSV A;  4F3L B;  1IYS A;  3MF0 A;  4Y0O A;  3MJQ A;  4Y2F A;  4X56 A;  2J3T C;  4WZ4 A;  3FYZ A;  5C5K A;  4ETZ A;  1YM1 A;  5EEC A;  3NC8 A;  3HLD A;  4PM9 A;  3HLC A;  3NEC A;  5F6A A;  5FAO A;  4R0Q A;  5M19 A;  5A90 A;  4Q0I A;  3H7W A;  5HPI A;  3GDI A;  3CHW P;  3PAE A;  1BZA A;  3O86 A;  3QHY A;  5CGS A;  2GJ3 A;  4FCF A;  2EA9 A;  2EWW A;  2XSS A;  3IXB A;  4YFM A;  4E3K A;  2OAP 1;  3UE3 A;  1S0W A;  3BEC A;  2W3F A;  1YMS A;  2L4R A;  4X55 A;  5TR7 A;  3FWL A;  4DE2 A;  1DP9 A;  2PT7 A;  3MBZ A;  3ZFZ A;  3OCL A;  3KYZ A;  3CUE C;  3IX4 A;  1KGE A;  1VET B;  2XEP A;  4OPZ A;  4NKP A;  3P01 A;  4BL2 A;  4BWI A;  1SCW A;  5CEC A;  2Z6C A;  3BJN A;  3ICY A;  1PI4 A;  2H0T A;  3C7U A;  3K2N A;  1T19 A;  2PBD P;  4FD8 A;  1FIK A;  2B5R A;  1ZG4 A;  5IS1 A;  1V9Y A;  1XGI A;  5DFX A;  1XXM A;  1E25 A;  3VE3 A;  2OLU A;  2OOL A;  4WLA A;  1L0D A;  4OP8 A;  4OOM A;  1NJ4 A;  2GX5 A;  2J9P A;  3HLG A;  3IBJ A;  2QJ7 A;  4DXB A;  1IOU A;  1NLZ A;  3ITA A;  5FQJ A;  2Y2L A;  3CI6 A;  4WMC A;  2GNX A;  4P6Z M;  2ZC3 B;  3HLF A;  2H0Y A;  2V1Z A;  1AXB A;  3D72 A;  3P09 A;  4I38 A;  3C38 A;  3ZG0 A;  4UA7 A;  2OWJ A;  3T4O A;  1VEU A;  3ZG7 B;  1HD8 A;  1IFQ A;  3L7H A;  3IBR A;  1K57 A;  3DTM A;  4R3J A;  1I2W A;  1TDL A;  1MBL A;  1YLT A;  1TVF A;  2V9A A;  5EV0 A;  2PHY A;  1MC0 A;  3LIA A;  1BLP A;  5HAP A;  4YIN A;  1T1A A;  2V8C A;  4H6J B;  4HY8 A;  1KDW A;  2EX8 A;  2I9V A;  1GHP A;  3PXP A;  5HL1 A;  4C3Q A;  2WKE A;  3T4K A;  2M1C A;  1YMX A;  1P9W A;  1NZU A;  3M2K A;  1ES3 A;  5FQI A;  2VEA A;  1TS0 A;  5HAR A;  1ACF A;  3A0S A;  5L07 A;  1O7E A;  5GLC A;  2WUQ A;  4LV3 A;  2Y2Q A;  2Y2M A;  2HDU A;  4KZ4 A;  5G18 A;  2FZ0 A;  1KE4 A;  5CTN A;  4B4Z A;  1W7F A;  3OPL A;  3B3X A;  1RP5 A;  2EX6 A;  4O8G A;  3S4X A;  3FKV A;  3MQO A;  3MKE A;  2XDM A;  1SHV A;  1OJ5 A;  1IYP A;  4R4S A;  5CEB A;  3R7W A;  5FDH A;  4X1M A;  1V9Z A;  2ZMF A;  4F3L A;  3Q82 A;  1SDN A;  4EWF A;  2KLI A;  2K31 A;  3QP8 A;  1CEG A;  1XX2 A;  2W1T B;  3PYP A;  5FA7 A;  3UB5 P;  4LCL A;  5DTT A;  1FSY A;  3IXG A;  3UME A;  4E3O A;  5GLA A;  3SH8 A;  3HUN A;  2VGL S;  1PRQ A;  4CLC D;  1PZO A;  3V3S A;  5GL9 A;  4OON A;  3DAV A;  4EEU A;  1FR6 A;  3MKF A;  1DJC A;  3GVB A;  3CLO A;  3FC7 A;  1ONH A;  4DE1 A;  3UB8 A;  1LLB A;  2XQZ A;  3MSH A;  1YLP A;  5EVI A;  4X68 A;  3MZE A;  5FEF A;  2ZL1 B;  5EM1 A;  1ZHH B;  2WAE A;  1H8Z A;  3W4O A;  4IHQ A;  3UDX A;  2EWV A;  5DKK A;  1BTL A;  1DJA A;  1GA0 A;  2JKF A;  3FPW A;  1L0G A;  5AVF A;  3GTC A;  4E3M A;  4KZB A;  2P04 A;  4DDY A;  4K91 A;  4KZA A;  2M7U A;  4S2J A;  3CPT B;  4B4X A;  4EET B;  4MBK A;  2XRN A;  4GD8 A;  5CGX A;  1L0E A;  2BLS A;  3HBR A;  4WF0 A;  1G6A A;  1KVL A;  3LIB A;  3FZC A; 
#chains in the Genus database with same CATH homology
 4N9K A;  3C4O A;  4QY5 A;  2Q9N A;  4E3I A;  1S6R A;  2FFY A;  4RVA A;  1BUE A;  4K0W A;  3RXX A;  1Q2P A;  2Y2H A;  4FH4 A;  3UE0 A;  1DJB A;  4F94 A;  4QU3 A;  1MWR A;  2ZMA A;  4BEN A;  2XFT A;  2Y59 A;  3IHB A;  2A3U A;  4GN2 A;  3W4Q A;  3BFG A;  3O87 A;  1K4F A;  3LO7 A;  2WYX A;  2QZ6 A;  3G32 A;  4N1H A;  4RYE A;  4DE0 A;  2ZD8 A;  3C4P A;  5CGW A;  5CRF A;  3A3D A;  5FAQ A;  2IWC A;  3NIA A;  4WBG A;  4IBX A;  3Q1F A;  3G34 A;  2WGW B;  2Y2I A;  2P9V A;  3PAG A;  4B88 A;  3GV9 A;  3JYI A;  2WGV A;  1ZC2 A;  4U3T A;  4KQO A;  1L2S A;  4S2N A;  4Y0T A;  3HL9 A;  2ZQA A;  1CI8 A;  3HUM A;  4OLD A;  4RX3 A;  4JXG A;  4DF6 A;  3UDI A;  2UWX A;  1W5D A;  1MWS A;  2DCF A;  1ES4 A;  5GHY A;  4S2K A;  1EI5 A;  1K6S A;  3BYD A;  2ZM8 A;  1CK3 A;  2ZC7 A;  3IQA A;  3WS5 A;  4KEN B;  2EFU A;  5DVA A;  1PZP A;  4GZB A;  4JXW A;  3G30 A;  4KQQ A;  1K54 A;  4L0L A;  5E2E A;  1K56 D;  3CG5 A;  2A49 A;  3OC2 A;  2EX2 A;  5FAT A;  4PPR A;  1E3U D;  1BLS A;  1WYC A;  5I94 A;  3NBL A;  1PW8 A;  3A3I A;  3IF6 C;  4ZBE A;  2WAD A;  3GR2 A;  4WZ5 A;  4WEJ A;  2XGN A;  3UDF A;  2J9O A;  4ZDX A;  1GA9 A;  1XA1 A;  2Y4A A;  5EPH A;  4LV0 A;  4FH2 A;  2ZLY A;  4OPQ A;  5EVI C;  1M6K A;  3HRE A;  4BD1 A;  2WZZ A;  4E3J A;  3SH7 A;  1K57 C;  1KGF A;  3V39 A;  5A91 A;  4X53 A;  1IKG A;  2ZQD A;  4LEN A;  5DTS A;  4QB8 A;  1K38 A;  1NYY A;  2EXB A;  2OLV A;  1YLJ A;  3IWO A;  3I7J A;  4KZ6 A;  5GHZ A;  3G4P A;  4KG6 A;  4X69 A;  4E6W A;  3DWZ A;  4ZAM A;  2E8I A;  3WWX A;  3ZCZ A;  3G35 A;  4N92 A;  3VP2 A;  1K55 A;  2XD1 A;  5DTK A;  5BOH A;  3OCN A;  1QMF A;  2G2U A;  5HAI A;  3FKW A;  3UNW A;  4KZ8 A;  3IH8 A;  4DXC A;  4C75 A;  1Q2Q A;  5EOO A;  1L0F A;  3BRM A;  4WEL A;  5A93 A;  2IWD A;  4WMC D;  4ZJ3 A;  4PM6 A;  4R1G A;  5GLD A;  5J8X A;  5E2G A;  5F1G A;  2JC7 A;  3VOZ A;  1RGY A;  1LL9 A;  3A3E A;  1H5X A;  2WGW A;  3GSG A;  1BUL A;  1QME A;  3V50 A;  4FSF A;  4N9L A;  2PBY A;  4QHC A;  1FCN A;  1FOF A;  3MXS A;  5CHJ A;  3VMA A;  3EQU A;  4EBN A;  2HDS A;  5DF8 A;  1XP4 A;  3W4P A;  1XGJ A;  2ZQ8 A;  2IWB A;  3PBR A;  3SS3 A;  3IWI A;  3NI9 A;  2HDQ A;  2Y91 A;  4PM5 A;  3UPP A;  3P98 A;  4HES A;  3ZG9 B;  4Q8I A;  4QJG A;  1GCE A;  1WYB A;  2X01 A;  1IYS A;  3V3R A;  2Y2N A;  1PW1 A;  4Y0O A;  1LHY A;  4DE3 A;  3VP3 A;  5CED A;  1JWP A;  1W8Y A;  3N4I A;  1W8Q A;  4KG2 A;  4X56 A;  3VSL A;  5FI2 A;  4GDN A;  3Q7V B;  1XA7 A;  3FYZ A;  4WZ4 A;  1TDG A;  3VSK A;  3VP4 A;  1PWD A;  1YM1 A;  3V5M A;  4BJP A;  5EEC A;  3NC8 A;  2DRW A;  2QMI A;  2XR0 A;  1IYQ A;  3HLD A;  3BFC A;  5FQM A;  5A92 A;  4PM9 A;  2H10 A;  3HLC A;  2JCH A;  4MEZ A;  4U0T A;  4JKT A;  3SS5 A;  2HP5 A;  5GLB A;  3LY4 A;  5FAO A;  5M1A A;  5E2H A;  1ES2 A;  1IYO A;  4R0Q A;  1Y54 A;  5M19 A;  3ZGA B;  5D3O A;  3G2Y A;  5A90 A;  2ZC4 B;  4OKP A;  1W79 A;  4U0X A;  3S1Y A;  2WK0 A;  3MZF A;  3C7V A;  1SDE A;  4S2O A;  5L2F A;  2JBF A;  4ZTK A;  1HZO A;  1SKF A;  3PAE A;  1IEM A;  4OLG A;  1PWG A;  1BZA A;  2VGK A;  4KZ9 A;  4OVD A;  4WM9 A;  4XXR A;  1K25 A;  1YLZ A;  3DW0 A;  3NY4 A;  1XPB A;  3O86 A;  3VFH A;  3QHY A;  3IF6 B;  5CGS A;  2Q9M A;  4BQM A;  4EQI A;  3GRJ A;  4FCF A;  4WYY A;  1K54 C;  4KG5 A;  3MXR A;  4IED A;  3ZDJ A;  3IXB A;  4YFM A;  3AGD A;  1YT4 A;  1LI9 A;  1H8Y A;  2BG1 A;  4E3K A;  2C6W B;  3UE3 A;  1S0W A;  3BEC A;  1CEF A;  1ERQ A;  4M3K A;  4UA9 A;  5KSC A;  5AQA A;  5AQB A;  2XH9 A;  5IHV A;  1YMS A;  2PU4 A;  4X55 A;  1N9B A;  5TR7 A;  1JWZ A;  3FWL A;  4DE2 A;  4NET A;  1YLW A;  2Y2P A;  2JE5 A;  3UPN A;  3S22 A;  3MBZ A;  2Z2M B;  3ZFZ A;  4UA6 A;  5CTM A;  3OCL A;  1K56 A;  4RX2 A;  2HPB A;  4JBF A;  1KGE A;  3E2L A;  2XEP A;  1E3U A;  4OPZ A;  4OPY A;  1ES5 A;  4BL2 A;  3NCK A;  3PBQ A;  3UO9 A;  1SCW A;  5AQ7 A;  5FQQ A;  4UHU A;  5EVL A;  5KSH A;  4NK3 A;  2G2W A;  5CEC A;  2C5W B;  3M6H A;  1PI4 A;  2H0T A;  1GHM A;  3BFD A;  3G31 A;  3PBO A;  4OQH A;  3C7U A;  2Y2O A;  4FD8 A;  2ZM0 A;  2B5R A;  1ZG4 A;  5F83 A;  3WS2 A;  5TFQ A;  1XGI A;  1XXM A;  1E25 A;  4GNU A;  2OLU A;  3IT9 A;  1ESI A;  4N1X A;  3UN7 A;  1ESU A;  4PMA A;  4A5R A;  4JXS A;  3GQZ A;  4OQ0 A;  3UY6 A;  4Y0U A;  1L0D A;  1I2S A;  4KQR A;  4OP8 A;  1NXY A;  3LEZ A;  4O7D A;  4OOM A;  1NJ4 A;  1WE4 A;  2J9P A;  3TG9 A;  2XF3 A;  3HLG A;  3CZD A;  3NDG A;  1G68 A;  3A3J A;  5HX9 A;  3WS4 A;  3DWK A;  4P6B A;  4DXB A;  3BFF A;  1JWV A;  3ITA A;  5EOE A;  5FQJ A;  1JTG A;  2Y2L A;  2ZC5 B;  3PBN A;  4OOL A;  4WMC A;  1I5Q A;  4HBU A;  4E3N A;  5CER A;  3O3V A;  3G2Z A;  3ISG A;  4HEF A;  4LV2 A;  4QD4 A;  4GDB A;  4JF5 A;  3UE1 A;  2ZC3 B;  1J9M A;  3HLF A;  3ZVT A;  2H0Y A;  2V1Z A;  1AXB A;  3IF6 A;  3P09 A;  3ZG0 A;  5HAQ A;  4UA7 A;  4MNR A;  3HVF A;  1ERM A;  3ZG7 B;  1HD8 A;  4ID4 A;  1OME A;  2WGI A;  1FSW A;  5EVI D;  2J7V A;  4XUX A;  3OPR A;  3ZNT A;  4EBP A;  5KZH A;  1K57 A;  3IXH A;  1PWC A;  4Z9Q A;  4OP5 A;  3DTM A;  4R3J A;  2R9X A;  4IVI A;  2EFX A;  4JF6 A;  1I2W A;  1TDL A;  1E4D A;  1MBL A;  1YLT A;  1TVF A;  2I72 A;  4R4R A;  1ZKJ A;  1Z6F A;  1HVB A;  3HLB A;  5DF7 A;  3M2J A;  4R23 A;  4X6T A;  3MZD A;  3C5A A;  1BLP A;  5HAP A;  1NYM A;  4YIN A;  1XKZ A;  3UPO A;  4HBT A;  2XD5 A;  4IBR A;  4GOG A;  4UAA A;  2EXA A;  3OPP A;  2XK1 A;  1KDW A;  2EX8 A;  3PTE A;  2VGJ A;  5CHU A;  3SH9 A;  3LY3 A;  3BLS A;  1GHP A;  5FI7 A;  5CHM A;  2QPN A;  3GMW A;  5HL1 A;  4BL3 A;  1K6R A;  3WS1 A;  2GDN A;  5TGF A;  4C3Q A;  2WKE A;  3ITB A;  3W8K A;  1RCJ A;  2CC1 A;  5HFO A;  4S2N C;  5FAS A;  2RCX A;  4S2I A;  1YMX A;  4JLF A;  3EQV A;  4OQG A;  4MBF A;  1RGZ A;  1NZU A;  3M2K A;  5F1F A;  1MY8 A;  4DRT A;  1ES3 A;  5CXW A;  1EWZ A;  2HP6 A;  5FQI A;  1BLC A;  1FR1 A;  5HAR A;  1YLY A;  3PBS A;  4GKU A;  3QNC A;  4LV1 A;  1MPL A;  3LCE A;  1BSG A;  3AGE A;  4PM7 A;  1O7E A;  5GLC A;  4XUZ A;  2WUQ A;  4QY6 A;  2X71 A;  4LV3 A;  2Y2Q A;  2OV5 A;  5EVI B;  2Y2M A;  3Q07 A;  1LL5 A;  3CMZ A;  1FCM A;  2HDU A;  1IKI A;  4KZ4 A;  4OPR A;  5G18 A;  1GHI A;  1KE4 A;  5CTN A;  4WZ5 C;  3N8S A;  4B4Z A;  1TEM A;  1W7F A;  3OPL A;  1KE0 A;  3B3X A;  1RP5 A;  2EX6 A;  1N4O A;  2ZQC A;  3FKV A;  3S4X A;  3WRT A;  3BM6 A;  3MKE A;  2WKH A;  2XDM A;  4WEK A;  1SHV A;  2FFF B;  4DKI A;  2ZJ9 A;  1IYP A;  4P0M A;  4R4S A;  4P87 A;  4CJN A;  3BEB A;  5AQ9 A;  5CEB A;  1NY0 A;  4OQI A;  2Z2L B;  5FDH A;  1K4E A;  3BFE A;  3IHA A;  3IWQ A;  3HUO A;  5E2F A;  3OZH A;  3Q82 A;  1SDN A;  1KVM A;  4EBL A;  4EWF A;  3NDE A;  3SOI A;  1YQS A;  1BT5 A;  2ZQ7 A;  1VQQ A;  3ZG5 A;  1K55 C;  1KGG A;  3TOI A;  2J8Y A;  4OOY A;  3N6I A;  3FV7 A;  1CEG A;  3Q7V A;  1FQG A;  2ZM2 A;  1ZG6 A;  4RA7 A;  1M40 A;  1HTZ A;  1MXO A;  1XX2 A;  5FSR A;  5JYO A;  1MWU A;  2OSU A;  3HLE A;  4Y7P A;  3Q81 A;  5FA7 A;  3O88 A;  4LCL A;  4BLM A;  1IEL A;  2P74 A;  3AGF A;  4P85 A;  5DTT A;  1FSY A;  4H8R A;  3VP1 A;  3IXG A;  4E3O A;  1CI9 A;  1ERO A;  5GLA A;  3RJU A;  1PI5 A;  3SH8 A;  2ZQ9 A;  5JYP A;  5KMW A;  3HUN A;  2V2F F;  4BD0 A;  5E43 A;  5EUA A;  3ZNY A;  4EUZ A;  4OH0 A;  3M6B A;  1PZO A;  1JVJ A;  2R9W A;  3IH9 A;  2XFS A;  5FQ9 A;  4KZ7 A;  3IF5 A;  3V3S A;  2XLN A;  3VFF A;  5GL9 A;  4OON A;  3WS0 A;  5M18 A;  4JPM A;  2Y2K A;  1JTD A;  4C6Y A;  5EE8 A;  3ZG8 B;  1DY6 A;  1FR6 A;  3MKF A;  3N8L A;  5FAP A;  1DJC A;  3GVB A;  3OPH A;  5GHX A;  2RL3 A;  1ONH A;  4S2P A;  1ALQ A;  4DE1 A;  3HLW A;  4K0X A;  3VOY A;  1LLB A;  3CJM A;  4E3L A;  2XQZ A;  3WRZ A;  5FI6 A;  3N7W A;  2WKI A;  2X02 A;  1YLP A;  2P9V B;  3ZVW A;  5EVI A;  1U60 A;  3PBT A;  4X68 A;  1PYY A;  3RXW A;  3MZE A;  4S2M A;  4ZJ1 A;  1FCO A;  1PIO A;  1MWT A;  5U47 A;  3D4F A;  1KE3 A;  1VM1 A;  2Y2G A;  1NZO A;  4R3B A;  1O07 A;  4GD6 A;  4EV4 A;  4GB7 A;  1BLH A;  2WAE A;  4JXV A;  1H8Z A;  2WAF A;  3W4O A;  3UDX A;  5F82 A;  1BTL A;  1DJA A;  1GA0 A;  3QNB A;  1C3B A;  2Y55 A;  4JF4 A;  4E6X A;  3A3F A;  1L0G A;  2Y2J A;  1MKI A;  5FQK A;  2ZC6 B;  4S2L A;  4KZ5 A;  1ONG A;  3GTC A;  1KDS A;  3IXD A;  2PU2 A;  3ZHH A;  4IVK A;  2EX9 A;  3TSG A;  4LCM A;  4E3M A;  1LI0 A;  3E2K A;  4KZB A;  5DF9 A;  4DDY A;  4K91 A;  4KZA A;  4D2O A;  3MFD A;  4S2J A;  4B4X A;  3SS4 A;  3VP0 A;  5HW3 A;  4MBK A;  3BLM A;  2HDR A;  4PM8 A;  1NRF A;  4KZ3 A;  3Q7Z A;  4GD8 A;  5CGX A;  1L0E A;  2HP9 A;  2BLS A;  3HBR A;  4CPK A;  1G6A A;  1KVL A;  2DNS A;  2WZX A;  4MLL A;  4DDS A;  4ZJ2 A;  3FZC A;  3N8R A;  2H5S A;  4MBH A;  2V20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...