4MN5A

Crystal structure of pas domain of s. aureus yycg
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
103
Chain Sequence
RRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLGLIARVNFSTIVQETGFVTGYIAVLHDVTEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein kinase WalK
publication title Crystal structure of PAS domain of S. aureus YycG
rcsb
source organism Staphylococcus aureus
total genus 18
structure length 103
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mn5A00
3FC7A 4JGQA 1N9NA 1DRMA 4HIAA 3LIBA 2D01A 4JGOA 2VV8A 1TS0A 1DP6A 1EW0A 1T18A 4EW7A 2V0WA 5F6AA 3LI8A 4HH3A 3ULFA 2VLGA 4E04A 3UB9A 3SW1A 2JHEA 3LIFA 5F69A 4GW9A 5F68A 1OTIA 3KX0X 1XFNA 2PHYA 3MJQA 2P7JA 5HD3A 1XJ4A 4HJ6A 2QJ5A 1LSWA 3IS2A 5HDDA 3FG8A 3LI9A 1XJ2A 3CAXA 3VE3A 5HWTA 1T1CA 1D7EA 4EXOA 4EEPA 2A24A 4GS9A 2WKPA 3GDIA 5DKLA 4GCZA 3ZQ5A 3NJAA 1GSWA 5EFWA 3MFXA 3P7NA 1WA9A 4L9GA 4HP4A 3F1NA 4HH2A 4NXGA 4YWZA 2I9VA 3LIEA 1OT6A 1LT0A 2OWJA 3NHQA 5IU1A 1NWZA 4XT2A 4MN5A 4NXBA 4PKYA 3E4QA 2PYRA 2ZOIA 3RH8B 2QWSA 5G4ZA 4I5SA 1XFQA 1XJ3A 4R6LA 1S67L 1DP8A 3PYPA 4EEUA 4LRZE 3EWKA 3LIDA 2V1AA 2OWHA 3UB6A 3LYXA 1OTEA 3D72A 5J4EA 2ZOHA 1BYWA 1V9ZA 1S66L 2EA9A 1UWPX 4HJ4A 4I3AA 3UB7A 2J80A 2JN7A 5HDSA 1OTBA 2QJ7A 3BY8A 2D02A 3K3DA 3GECA 2W27A 3C8CA 1P0ZA 3G6OA 2CMNA 5AVEA 1GSXA 5TBMB 3H7WB 1MZUA 4HHDA 3A0SA 2WKQA 3K3CA 4F3LA 4GHIA 1LSVA 2YKFA 1Y28A 1OT9A 1LL8A 1TS8A 5AVFA 5HZHA 4I3JA 3E4PA 2PR5A 2BASA 3F1OB 3BWLA 4I3IA 1UWNX 2KX6A 3C2WA 1D06A 4NXEA 5J3WA 4H6JB 4M4XA 2HV1A 3B33A 4HQAA 4HY8A 4RQ9A 3H82B 4EERA 2KDKA 2ZBBA 2L4RA 2V1BA 3T50A 4EESA 2QHKA 2R78A 3A0RA 2PDRA 5J7EA 1ODVA 5A8BA 4WF0A 3LIAA 4LLOB 4MN6A 2W0NA 2PD8A 1OJGA 3CLOA 1OJ5A 4JGPA 4LRXC 1S1YA 3HJKA 3MQQA 2H28A 1OTAA 4DJ2A 2VV7A 5F5YA 4I39A 1N9LA 2M1CA 5DJTA 3IS2B 1LSXA 1XJ6A 5G4YA 5DJUA 4WN5A 2OOLA 2V0UA 1T19A 1X0OA 3MXQA 3PHYA 4I38A 2A24B 4GS9B 4H6JA 5HWVA 1F9IA 3F1PB 2PR6A 4HP9A 5HSQA 2WKRA 3H82A 4JGRA 5I5LA 4HJ3A 2GJ3A 5KIZA 3F1NB 5HWWA 1OTDA 4R38A 1S4SA 3A0VA 4LPZA 5HDCA 1S1ZA 3LUQA 4K08A 3VE4A 4XT2B 4HOIA 4DJ3A 4HI4A 1UGUA 1S4RA 3RTYA 1DP9A 1T1AA 4BBTA 2YKHA 2VEAA 3UMEA 4HNBA 2INWA 2B02A 4KQDA 4EQ1A 2PD7A 4BBVA 1GSVA 1V9YA 3MQOA 3E4OA 3NOTC 2L1MA 3ICYA 4PKYG 4KUOA 1T1BA 3CWFA 4L9FA 4L9EA 4EETB 1KOUA 4B9OA 3UE6A 3HJIA 5IS1A 3UMDA 3F1PA 4LRYC 3NOPC 3LICA 4KUKA 2V9AA 4NXFA 4WUJA 3OLOA 5TBMA 4WL9A 3H7WA 1JNUA 3IBRA 3UB8A 1G28A 1VB6A 3MR0A 1N9OA 4R70A 2K7SA 3EEHA 3VOLA 4F3LB 4GHIB 2VV6A 1P97A 1TS7A 4BBUA 2Z6CA 3F1OA 5HD5A 4WLAA 2PYPA 1F98A 5DKKA 1TS6A 3NOUC 3BY9A 4R3AA 2Z6DA 2QKPA 3H9WA 2L0WA
chains in the Genus database with same CATH superfamily
4G3KA 4JGQA 5EUAA 3MS6A 1JWZA 4DKIA 3LIBA 3IXDA 4C6YA 4OPRA 2M7UA 4QD4A 2KOIA 1CQAA 4H8RA 1EW0A 4EW7A 3CUEC 3C5AA 1ACFA 3LI8A 4WEKA 4N1HA 3T12B 3ZVWA 3ULFA 1SDEA 4KZ3A 4E04A 1JWPA 3A3DA 3PBRA 3Q7VB 2GNXA 5F69A 3D9YA 4GW9A 1OTIA 3HCYA 3IHAA 3I7JA 1M40A 5FDSA 2V8CA 2V2FF 1LI9A 2B5RA 4KZ5A 5CTNA 3G30A 2JKTM 3DWKA 2QZ6A 5HD3A 2JKRM 3HLGA 2JKGA 1N9BA 2QJ5A 4HJ6A 4KZ7A 1TVFA 1W8QA 1L0FA 3IS2A 1H0MA 3FG8A 4LV2A 3O86A 3LI9A 4D2OA 3UDFA 3RJUA 1XJ2A 1Y4OA 4BLMA 1KE0A 1HLUP 4EEPA 4FTXA 3OPPA 2WKPA 3GDIA 1W79A 1PYYA 5GLBA 4GCZA 3IQAA 1EI5A 3MFXA 1CJFA 3LCEA 5BOHA 5DF9A 2EWVA 4L9GA 3IT9A 3F1NA 2G2WA 5DFYA 4NXGA 4WELA 3UB5P 5K5BA 3FZCA 3ZHHA 2OWJA 5IU1A 3WS4A 2B95A 5FQIA 3M6HA 1TD5A 3MBZA 2OV5A 3W4OA 4E3LA 5TR7A 4Y0UA 3MQ0A 3OPLA 3B47A 3Q7VA 2ZOIA 4GD8A 1L0EA 3RH8B 2QWSA 1E3UD 1DJCA 3T4QA 1IOUA 5G4ZA 1IKGA 2Q9MA 4GNUA 4R6LA 1KGEA 1S67L 4YFMA 5GHZA 3G2ZA 5FL3A 2W3DA 5HAIA 2ZC5B 3IHBA 2J3TD 1K57C 4L0LA 3DTIA 4KQOA 3LIDA 3N7WA 3UB6A 3LY4A 3C38A 3OPRA 5CHMA 4CLCB 1GHPA 1YMXA 2WKIA 3D72A 1FR6A 5FAOA 4ZDXA 2ZOHA 4FH4A 3QP1A 5GLCA 3AGDA 2JKRI 1S66L 5CECA 2HDRA 3LR0A 1PW1A 3BYDA 1YMSA 3UB7A 3VOZA 3FV7A 5EECA 5A93A 3SH9A 1OTBA 3BY8A 2A3UA 4KQQA 4BWIA 5L8MA 1ALQA 3OOVA 1TEMA 2ZQDA 2CMNA 1GSXA 1MZUA 2IWDA 5EM1A 3O88A 3N8RA 4KG5A 1LSVA 3NULA 4EBPA 5HZHA 3BFGA 3A3IA 1K4FA 2ZMAA 3E4PA 3HLBA 3WRTA 3VV4A 1YLPA 3O87A 5DF7A 4EQIA 4OQ0A 1S0WA 1UWNX 4R1GA 1WYBA 4E3KA 1XP4A 3BFDA 3VP1A 1GHMA 4HQAA 4HY8A 3D3OA 1OMEA 4Y17A 2HDSA 1PNEA 2WK0A 2Q0OA 1MKMA 2ZC6B 3H82B 5AQ9A 4CPKA 4PM7A 1SCWA 4JXSA 2PBYA 4PMAA 1L0GA 1YM1A 4JF5A 2V1BA 3T50A 2HPBA 2WYXA 5KZHA 3BLMA 5J7EA 4ZRRA 1P9RA 1ODVA 5CX7A 1XXMA 1Q2PA 5A90A 3ZNTA 4GZBA 1OPXA 3OBFA 1D1JA 3DBAA 3NY4A 2X01A 2H0TA 2Y2OA 2ZQ9A 3PTEA 2HP6A 4IBRA 3HLWA 3VFFA 1AWIA 1IELA 4BL2A 2VV7A 2DRWA 3ZG5A 5FA7A 2FH5A 1NYMA 1N9LA 4FUWA 3E98A 4PM9A 1Z09A 4DN0A 2OOLA 1BLPA 4CLCC 3QP2A 4ARZB 1T19A 5A92A 4RYEA 3JVUA 4X69A 4GS9B 1K6RA 5HWVA 1CF0A 5E2EA 3H82A 4HJ3A 4YINA 5KIZA 3N4IA 4R38A 1AXBA 2O99A 4S2MA 2CC1A 1HD8A 3IWOA 3IF6A 5HDCA 3GVBA 1VEUA 1IYOA 4XT2B 5F1FA 4EWFA 3IWQA 2WAEA 1KE4A 4LV1A 1S4RA 3P09A 5FQMA 3Q1FA 4R0QA 3ZFZA 4DXCA 3ZDJA 4MNRA 4UAAA 3W8KA 2B02A 2KLIA 2ZJ9A 5FAPA 4EQ1A 3UPOA 4UQIS 2DNSA 3V39A 4S2IA 5GLDA 1GCEA 2L1MA 4LCLA 2OLUA 1SKOA 2BG1A 3PAEA 3IBJA 4L9FA 4Y0OA 5KSCA 3M2JA 3HJIA 5CGXA 4S2JA 4Y2FA 4JF6A 2Y2QA 3NOPC 3LICA 4WZ4A 5EPHA 4IUHA 1MWSA 3HVFA 3BRMA 3N6IA 4WUJA 3VOYA 3OLOA 3SS4A 5EOOA 3IF5A 5CERA 1G28A 2WADA 1BSGA 4LCMA 5DVAA 3ZG0A 4EUVA 1N9OA 4ETXA 2EFXA 3VOLA 4F3LB 4GHIB 1YLJA 2ZM8A 2XLNA 4R4RA 3R7WB 1P97A 3SS3A 5CGSA 3WS5A 5IT5A 1H8ZA 2Z6CA 1EWZA 1VM1A 3IX8A 3CG5A 4ZBEA 1TS6A 3NOUC 3T1XA 3QP8A 3GMWA 5C5KA 4P85A 4NEED 1QMEA 2J9PA 1NXYA 1NJ4A 5JYPA 4HIAA 4MLLA 3S22A 3VSKA 1MWRA 4CQHA 2QYBA 4G3WA 3G2YA 3BEBA 3ZG9B 2VGLS 4X53A 3WRZA 5HAPA 1FQGA 2JHEA 3LIFA 3L9KA 1W5DA 3HLCA 3G34A 5FQJA 3KSGA 1O7EA 1P9WA 3E2KA 3KX0X 1RGYA 3ZG8B 3UDXA 3HLFA 5I94A 3TSGA 4WMCD 2G2UA 2PBDP 4GDNA 5HDDA 5HARA 5FQ9A 2G7UA 3CAXA 5TFQA 1JWVA 1NZOA 2P9VA 1H3QA 1D7EA 2VK3A 2XQZA 3C30A 2X71A 3ZQ5A 3NJAA 4BD1A 5CEBA 4II7A 1G6OA 5EVIB 4A5RA 3CJMA 3MXSA 3MF0A 4GB7A 5IHVA 3CUEA 1K54C 2VJWA 3CPTA 4DDSA 3S7PA 1XX2A 5L09A 2Y59A 5CHUA 4JXGA 2J7VA 4OOMA 5GL9A 1NY0A 1G6AA 4P87A 3E4QA 2PYRA 1FIKA 3MZFA 1MBLA 4N1XA 2FZ0A 4JBFA 4FCFA 2LB9A 2Y2JA 1I2WA 4P6ZS 1XJ3A 2EX6A 3CHWP 3LGOA 4X68A 4F94A 3MMHA 5HPIA 4O8GA 3VFHA 2C5WB 3UY6A 2XSSA 4JPMA 3LO7A 3VP4A 1G5UA 4M3KA 2ZQAA 1UWPX 3RXWA 4HJ4A 3IX3A 5EM0A 1GHIA 2J80A 2ZM2A 5M19A 2JN7A 1FR1A 1MKIA 5HDSA 3OZHA 2D02A 3K3DA 3OPHA 4Q0HA 1P0ZA 3W4PA 5AVEA 5TBMB 5EVLA 1SKFA 5E2HA 1BTLA 4YNRA 5U47A 3FYZA 3GV9A 1YQSA 2XFTA 2WKQA 4OP8A 4D60A 1Y28A 5AVFA 1YKDA 4MBHA 2Z2LB 1Y54A 1K57A 2V1ZA 3G31A 2XF3A 2Y55A 5CGWA 3JPUA 3F1OB 3BWLA 4I3IA 2XEPA 3BFCA 5HL1A 2XA7M 3A3EA 4JLFA 3NIAA 3FPWA 1H8MA 4H6JB 2GZAA 1GA0A 4K0XA 4EERA 2ZMFA 2ZL1B 2ZBBA 5EVIC 5FASA 2L4RA 4NK3A 2WAFA 5DTKA 1JTGA 2QHKA 3BQ8A 2R78A 3A0RA 4ZJ3A 1Q2QA 1W63M 3IH8A 3G32A 3QNCA 5A8BA 4EU0A 1F5MA 4LLOB 1STZA 1PWGA 4X56A 3NECA 4MBFA 4JGPA 2Y2HA 4LRXC 5CXWA 5FDHA 4OQIA 2H28A 3DWZA 4E3NA 5HFOA 1FSWA 4BL3A 3HUOA 1NLYA 2W1RA 2Y4AA 5DJTA 3T4JA 4B88A 4KG6A 4RX2A 2PU4A 2XD5A 4WN5A 4E6WA 2JKTI 4X55A 3ITAA 3O5YA 3G35A 3E0YA 3PHYA 1ERQA 4I38A 2A24B 4H6JA 4OLDA 4DE1A 1MXOA 1YSPA 2WKRA 4JGRA 5E43A 2ZL1A 3NDGA 5HWWA 3T1QB 3JYIA 4LPZA 3UE0A 2XA7S 3V3RA 5FI2A 5A91A 4UA9A 5E2FA 5F82A 4HI4A 1YLTA 4JF4A 3NCKA 4Y15A 3RTYA 2IWCA 4X1MA 4IVKA 2GX5A 4DE0A 1WE4A 1T1AA 3LR4A 4BBTA 1ZG6A 5CEDA 3E2LA 4IUKA 4WZ5C 3S7NA 4HNBA 3T1SA 2INWA 3N8SA 4KQDA 2W3EA 4LENA 1GSVA 1V9YA 2ZD8A 4CLCA 1C3BA 5AQ7A 1KDSA 2K2NA 4X25A 3V50A 3ICYA 3PR6A 1PI5A 1PFLA 2JCHA 3L7HA 1MY8A 3WS2A 4B9OA 3UE6A 5IS1A 4CJNA 4KZ9A 3IXHA 4KUKA 1K56A 3CI6A 4O7DA 4UQIM 4DF6A 3Q7ZA 2C6WB 2JBFA 4NXFA 3QP4A 5CRFA 2OLVA 3GSGA 1VETB 4MCWA 3IBRA 4B4ZA 1K56D 1CEGA 2ZQ8A 1H8YA 1L0DA 4R4SA 1XGJA 1KVMA 1ESUA 3EEHA 1IKIA 1ZTUA 2BLSA 2X02A 4OVDA 4DDYA 1DJBA 4BENA 4JXWA 3FWLA 4BBUA 4WLAA 2PYPA 4IHQA 4OOYA 4NG2A 4IJGA 1F98A 3CITA 4HBTA 3HLEA 3RXXA 3MSHA 4E3IA 2K31A 2WUQA 3FC7A 2VA0A 4PM6A 1YPRA 1L3LA 4KG2A 4KQRA 1K25A 2Y2PA 3IXBA 2R9XA 3TG9A 2Y2KA 5FQQA 2D01A 3IWIA 4OH0A 4QY6A 4JGOA 1TS0A 4GOGA 3LR3A 2HDQA 1YLZA 5F6AA 4HH3A 2JE5A 2W3FA 4PM5A 1E25A 3SW1A 3QNBA 1VETA 4KZ6A 1YLYA 3AGEA 4GN2A 2ZMVA 2XGNA 3ITBA 3DTEA 4WM9A 3SH7A 3GRJA 4UEYA 3UPNA 2PHYA 3MJQA 2P7JA 5GHYA 3Q07A 1XJ4A 2HJ9C 1LSWA 3LY3A 3UNWA 1MWUA 2VGLM 1ES5A 2HDUA 5FQKA 1PW8A 2Y79A 3WS0A 3HUMA 4Z1WA 5HWTA 4Y0TA 4PPRA 4ARZA 2QMIA 3BM6A 4GS9A 5EFWA 3O3VA 1CI9A 1WYCA 4ETZA 1WA9A 2DMWA 3HBRA 2Y2GA 2Y91A 4HP4A 3OC2A 1NLZA 3M2KA 3KSHA 2P08A 3UDIA 5EV0A 3EOIA 1NWZA 4HESA 5E2GA 2O9CA 4XT2A 3VP3A 4NXBA 1F2KA 1ES3A 1ES2A 2H5SA 3EEAA 1IYQA 2XR0A 4ZAMA 1MPLA 4BQMA 3C7UA 4I5SA 1XFQA 1BULA 4X6TA 1S6RA 1DP8A 3TJZC 2UV0E 3PYPA 1MC0A 4FD8A 4EEUA 4ME4A 4LRZE 1I2SA 2V1AA 2OWHA 3MXRA 5JYOA 3LYXA 2BTFP 4O01A 4N9LA 4OKPA 2W3GA 4ZTKA 5J4EA 1TDGA 1V9ZA 4WYYA 3PBOA 4P6ZM 1VQQA 4XUZA 3S7OA 2J8YA 1BLHA 1K54A 3BJNA 3LFVA 2UWXA 2PT7A 4KZBA 1W7FA 3C8CA 4UA6A 3G6OA 2W1TB 1PWCA 4FSFA 5HW3A 3H7WB 4BJPA 4HHDA 3EQUA 2WGWB 3K3CA 4F3LA 4GHIA 3ZVTA 4E3JA 2I72A 1FCNA 3BW6A 3R7WA 3OCNA 1OT9A 4K91A 1LL8A 4OQHA 4I3JA 5G18A 2HP5A 1YT4A 1XA7A 3D4FA 2KX6A 1D06A 4NXEA 3N8LA 1XA1A 4QU3A 1XPBA 2Y2MA 1YLWA 4QB8A 4GD6A 2EX2A 3HL9A 4OOLA 4FH2A 1TF1A 4EESA 2O9BA 5AQBA 4X1LA 3A3FA 5AQAA 4GKUA 2PDRA 1ERMA 1ONGA 1J9MA 1SHVA 4FOFA 3C4PA 3S1YA 1W8YA 3LIAA 5EE8A 2W1TA 4ID4A 4MN6A 2W0NA 2PD8A 3CLOA 1OJ5A 4YOFA 3CMZA 3T4TA 2PAVP 3PBTA 3BFEA 3HJKA 3MQQA 4N92A 1PI4A 4IVIA 1VHMA 1OTAA 4DJ2A 4UA7A 1YAXA 2EWWA 5F5YA 2WZZA 5J8XA 3EQVA 3QHYA 1U60A 4IEDA 3FKVA 3IS2B 3MZDA 1LSXA 4RX3A 2ZM0A 1J3WA 1XJ6A 5G4YA 2V0UA 1X0OA 3MXQA 1Z6FA 2A2LA 4OPQA 3W2ZA 5EVIA 3TE8A 4OP5A 2HZ5A 1F9IA 2EX9A 1PZPA 3F1PB 4HP9A 2XH9A 1L2SA 5HSQA 2Y2IA 5I5LA 2GJ3A 4N9KA 4S2NC 4R3JA 3F1NB 3ZCZA 4ZJ2A 1S4SA 5EVID 3QP5A 4S2OA 2RL3A 4MDZA 2PRFA 3LUQA 4K08A 3NC8A 1KGFA 4MMNA 4HOIA 4DJ3A 1RP5A 2V8FA 1PIOA 3ISGA 5M1AA 2Y2NA 3T4KA 2JKFA 4EV4A 4BMWA 5HL6A 2YKHA 1FOFA 1KGGA 2PU2A 4IBXA 1BZAA 5EOEA 4E6XA 3SOIA 2FFYA 5L2FA 2WKEA 2JC7A 2Z2MB 1MWTA 4RA7A 3MQOA 2ZC4B 5D3OA 3NOTC 5DF8A 4PKYG 4KUOA 2HF6A 4L9EA 4EETB 3F1PA 2J9OA 4BD0A 4LRYC 4U0XA 1FSYA 3DTKA 5TGFA 2ZQ7A 3V67A 5TBMA 1DJAA 3TOIA 2NUTC 2VGKA 3KSFA 3UB8A 3LR5A 5KSHA 4XUXA 4NETA 1ZG4A 1E3UA 2Y2LA 2ZC7A 3MR0A 5L10A 4LFUA 2O9AA 3V3SA 2K7SA 1FCOA 2XROA 3MKEA 4DRTA 1ZC2A 4WZ5A 2VV6A 3QP6A 2WKHA 4KZ4A 3F1OA 5HD5A 3BLSA 1FILA 1FCMA 2E8IA 2ZQCA 2FFFB 3OCLA 3BY9A 4R3AA 1KDWA 2Z6DA 2V20A 3H9WA 2XK1A 4Y5FA 2L0WA 1N9NA 2VX8A 4R23A 5CHJA 2B18A 1LL5A 1DRMA 3SZTA 1SDNA 5HAQA 3A3JA 3U4LP 4S2LA 3EGXC 1ESIA 1O07A 4GDBA 5HX9A 4Y13A 2VV8A 1DP6A 1BLCA 3AGFA 1T18A 2OAP1 4EBNA 2V0WA 1ZHHB 1LHYA 4RVAA 2VGJA 4OQGA 2VLGA 3HREA 1EROA 1CI8A 4Q0IA 3UB9A 4Z9QA 4LV3A 1BLSA 5TJJA 2M7VA 4QPRA 5F68A 5L07A 3RFBA 5LBRA 1XFNA 4DE2A 5EVEA 1KVLA 3PBNA 2J3TC 5DTTA 4HEFA 3GTCA 4XXRA 1ES4A 5GHXA 1A0KA 4ESPA 2XDMA 3VE3A 1IFQA 1T1CA 2P04A 3LEZA 4NKPA 1NRFA 4CLCD 1JTDA 4EXOA 5HPFA 2A24A 4PHTA 3UPPA 4HBUA 2EFUA 4OPZA 5DKLA 1GSWA 3P7NA 3UO9A 1QMFA 3MZEA 4KZAA 3V5MA 1I5QA 4HH2A 2ZLYA 4YWZA 2I9VA 1K6SA 3LIEA 3K2NA 1OT6A 4PM8A 2GDNA 3DAVA 1LT0A 3NHQA 5FAQA 3IF6B 2LB5A 1VEUB 4MN5A 4PKYA 4U3TA 3ZYTA 2XD1A 3KO6A 4E3OA 1NRJA 2NUPC 1HTZA 1PZOA 5F83A 4OLGA 3BQAA 2R9WA 3MFDA 3CZDA 3WWXA 4Q8IA 3VSLA 1IYSA 5FI6A 3BFFA 4QY5A 4G3VA 2VKSA 3IH9A 3EWKA 3M6BA 2XRNA 3T4OA 1OTEA 3Q81A 2IA2A 1XKZA 4QWOA 2H10A 2XFSA 3TW8A 3DTMA 4GJ4A 1HZOA 1N4OA 1SKOB 1BYWA 5AJGA 3ZG7B 1IEMA 2EA9A 3PAGA 4DXBA 3PBQA 4I3AA 2J3WA 3UE3A 5FI7A 3FPVA 2QJ7A 5DTSA 4O0PA 3GECA 2W27A 5FEFA 2WZXA 3WS1A 3VMAA 1XGIA 3P01A 1G68A 1K55A 3A0SA 3LEQA 1GA9A 1RGZA 4MBKA 5GLAA 2YKFA 2MJ6A 4EUZA 1DY6A 1TS8A 3B3XA 3Q82A 2PR5A 2BASA 1ZKJA 1CEFA 4R3BA 3C2WA 5J3WA 3KYEA 2OAQ1 2HV1A 3IXGA 4M4XA 3B33A 2ACGA 5F1GA 4ZJ1A 4P0MA 4S2KA 4RQ9A 3MKFA 4JXVA 2KDKA 1CK3A 1HVBA 3KYQA 3FKWA 3SH8A 4OONA 3UN7A 1W63Q 4WEJA 4DMZA 4K0WA 1M6KA 3P98A 3HLDA 2AVXA 1BT5A 1RCJA 1K55C 4Q0JA 4WF0A 3IF6C 3TRCA 2EX8A 5KMWA 1OJGA 1S1YA 4Y7PA 4CLCE 3GR2A 4KZ8A 4MN7A 2Y8HA 1JVJA 5FSRA 4I39A 1ONHA 2ZC3B 2M1CA 4U0TA 2WGIA 3G4PA 2HJEA 3T4LA 3SS5A 4JKTA 1K38A 5DJUA 5CTMA 2P9VB 2IWBA 3R4KA 1K0KA 3DW0A 2PR6A 3JVVA 4B93A 3C7VA 1NZUA 3NI9A 2W3HA 3UE1A 3ZGAB 3W4QA 1YSQA 1OTDA 1H5XA 3A0VA 3CPTB 2HGVA 2QPNA 1S1ZA 3U2AA 3VE4A 1TDLA 4KENB 4WBGA 4C3QA 5DFXA 3T4SA 5MC7A 5FATA 1UGUA 3S7QA 1LI0A 4QHCA 1BUEA 3S4XA 2VZWA 4MEZA 4WMCA 1DP9A 5FEGA 3VP0A 4DE3A 1LL9A 2VEAA 3EGDC 3UMEA 4B4XA 1PWDA 4OPYA 4AFIA 2PD7A 3VP2A 4BBVA 1SZVA 4C75A 4E3MA 2WGVA 3E4OA 4UHUA 3IX4A 3NBLA 2EXBA 1T1BA 2HP9A 1LLBA 4P6BA 3CWFA 3GQZA 1KOUA 3BECA 4S2NA 3UMDA 3KSIA 2EXAA 2RCXA 1NYYA 1E4DA 2O0YA 2V9AA 4PAUA 4Y3IA 1K4EA 5M18A 3HUNA 1PRQA 3B42A 1KE3A 4WL9A 3H7WA 3PXPA 1JNUA 3T1RA 3KYZA 2WGWA 1VB6A 2Q9NA 2E8JA 3PBSA 4R70A 4LV0A 4GLQA 1TS7A 4S2PA 1IYPA 2H0YA 3ZNYA 4EBLA 3C4OA 5DKKA 2OSUA 4QJGA 2DCFA 2QKPA 2A49A 4LGWA 2P74A 3NDEA
chains in the Genus database with same CATH topology
2K31A 3FC7A 4G3KA 4JGQA 2VA0A 1N9NA 2VX8A 2B18A 1DRMA 4HIAA 3LIBA 3EGXC 2D01A 4JGOA 2VV8A 2M7UA 1TS0A 3LR3A 1DP6A 2KOIA 1EW0A 1T18A 2OAP1 2QYBA 3CUEC 4G3WA 4CQHA 2V0WA 1ZHHB 4EW7A 5F6AA 3LI8A 4WEKA 4HH3A 3ULFA 2VGLS 2VLGA 2W3FA 4E04A 4Q0IA 3UB9A 3PBRA 3SW1A 2JHEA 3LIFA 5TJJA 2M7VA 2GNXA 5F69A 4GW9A 4QPRA 1OTIA 3HCYA 5F68A 3KSGA 1P9WA 2ZMVA 3KX0X 3RFBA 4UEYA 5LBRA 1XFNA 2PHYA 3MJQA 2P7JA 2JKTM 3PBNA 2J3TC 5HD3A 1XJ4A 2HJ9C 2JKRM 4HJ6A 2QJ5A 1LSWA 2VGLM 3IS2A 5HDDA 3FG8A 3LI9A 2G7UA 1XJ2A 3CAXA 2Y79A 3VE3A 4Z1WA 5HWTA 1IFQA 4ARZA 1H3QA 1T1CA 2P04A 4NKPA 1D7EA 4CLCD 4EXOA 4EEPA 2A24A 4PHTA 4GS9A 5HPFA 2WKPA 3GDIA 5DKLA 3C30A 4GCZA 3ZQ5A 3NJAA 1GSWA 5EFWA 3MFXA 3P7NA 4II7A 1G6OA 4ETZA 1WA9A 2DMWA 5DF9A 2EWVA 4L9GA 3MF0A 4HP4A 3F1NA 3CUEA 3OC2A 4HH2A 4NXGA 1NLZA 4WELA 5DFYA 4YWZA 2I9VA 3LIEA 5K5BA 3K2NA 1OT6A 3KSHA 2P08A 2VJWA 1LT0A 2OWJA 3NHQA 3EOIA 5IU1A 1NWZA 3S7PA 2O9CA 1TD5A 2LB5A 4XT2A 4MN5A 4NXBA 4OOMA 4PKYA 3ZYTA 3KO6A 1NRJA 3MQ0A 3E4QA 2NUPC 2PYRA 3B47A 2ZOIA 3EEAA 3RH8B 3BQAA 2QWSA 3T4QA 2FZ0A 1IOUA 5G4ZA 2LB9A 4I5SA 1XFQA 4P6ZS 1XJ3A 4R6LA 3MMHA 1S67L 5HPIA 5FL3A 1DP8A 2W3DA 3TJZC 4G3VA 4O8GA 2VKSA 3PYPA 1MC0A 2J3TD 4EEUA 4ME4A 4L0LA 4LRZE 3EWKA 2XSSA 4KQOA 3LIDA 2XRNA 2V1AA 2OWHA 3UB6A 3C38A 3LYXA 3T4OA 1OTEA 4O01A 2IA2A 4CLCB 2W3GA 3D72A 3TW8A 4GJ4A 5J4EA 2ZOHA 1BYWA 5AJGA 1V9ZA 2JKRI 3PBOA 1S66L 4P6ZM 2EA9A 3LR0A 1UWPX 4HJ4A 3PBQA 3S7OA 4I3AA 3UB7A 2J3WA 3UE3A 2J80A 2JN7A 3FPVA 3BJNA 5HDSA 3LFVA 1OTBA 2PT7A 2QJ7A 3BY8A 2D02A 3K3DA 4O0PA 4BWIA 3GECA 4Q0HA 5L8MA 2W27A 3C8CA 3OOVA 1P0ZA 3G6OA 2W1TB 2CMNA 5AVEA 1GSXA 3P01A 4FSFA 5TBMB 3H7WB 4BJPA 1MZUA 4YNRA 4HHDA 3A0SA 3EQUA 2WKQA 3K3CA 4F3LA 4GHIA 1LSVA 2YKFA 3BW6A 3R7WA 3OCNA 1Y28A 1OT9A 2MJ6A 1LL8A 1TS8A 5AVFA 5HZHA 4I3JA 1YKDA 3E4PA 2PR5A 3VV4A 2BASA 3F1OB 3BWLA 4I3IA 1UWNX 2KX6A 3C2WA 1D06A 4NXEA 5J3WA 2XA7M 3FPWA 1H8MA 4H6JB 2OAQ1 2GZAA 2HV1A 4M4XA 3B33A 4HQAA 4HY8A 3D3OA 4OOLA 4RQ9A 3H82B 4EERA 1MKMA 2ZMFA 2KDKA 1TF1A 3KYQA 2ZBBA 2L4RA 1W63Q 2V1BA 3T50A 4EESA 2O9BA 2QHKA 3BQ8A 4WEJA 4DMZA 2R78A 3A0RA 1W63M 2PDRA 5J7EA 4ZRRA 4FOFA 1P9RA 1ODVA 5A8BA 5CX7A 4Q0JA 4WF0A 3LIAA 3TRCA 4EU0A 1F5MA 4LLOB 2W1TA 4MN6A 1STZA 2W0NA 2PD8A 1OJGA 1OPXA 3OBFA 3CLOA 1OJ5A 4YOFA 3DBAA 4Y5FA 4JGPA 4LRXC 3T4TA 3PBTA 1S1YA 3HJKA 3MQQA 2H28A 1VHMA 1OTAA 4DJ2A 1YAXA 2EWWA 4CLCE 2VV7A 5F5YA 4MN7A 3EQVA 2Y8HA 2FH5A 4I39A 1NLYA 2W1RA 1N9LA 2M1CA 5DJTA 3IS2B 3T4JA 3E98A 1LSXA 2HJEA 3T4LA 1XJ6A 5G4YA 5DJUA 4WN5A 2JKTI 4DN0A 2OOLA 3O5YA 4ARZB 4CLCC 2V0UA 1T19A 1X0OA 3E0YA 3MXQA 3PHYA 3R4KA 4I38A 3JVUA 2A24B 4GS9B 4H6JA 2A2LA 3W2ZA 5HWVA 3TE8A 1F9IA 3F1PB 2PR6A 4HP9A 3JVVA 4B93A 5HSQA 1YSPA 2WKRA 3H82A 4JGRA 5I5LA 2W3HA 4HJ3A 2GJ3A 5KIZA 3F1NB 1YSQA 5HWWA 1OTDA 4R38A 1S4SA 2O99A 3A0VA 4LPZA 4MDZA 2HGVA 5HDCA 1S1ZA 3U2AA 3LUQA 2XA7S 4K08A 3VE4A 4XT2B 5DFXA 3T4SA 5MC7A 4MMNA 4HOIA 4DJ3A 4HI4A 1UGUA 3S7QA 1S4RA 3RTYA 2GX5A 2VZWA 3T4KA 3LR4A 1DP9A 1T1AA 4BMWA 5HL6A 4BBTA 2YKHA 4IUKA 2VEAA 3EGDC 3UMEA 3S7NA 4HNBA 4AFIA 2INWA 2B02A 2KLIA 2W3EA 4KQDA 4EQ1A 2PD7A 4UQIS 4BBVA 1GSVA 1V9YA 3MQOA 4CLCA 3E4OA 3NOTC 2K2NA 2L1MA 3ICYA 4PKYG 4KUOA 3PR6A 1T1BA 2HF6A 3IBJA 3CWFA 4L9FA 4L9EA 4EETB 1KOUA 4B9OA 3UE6A 3HJIA 5IS1A 4Y2FA 3UMDA 3F1PA 3KSIA 4LRYC 3NOPC 3LICA 4KUKA 4IUHA 3CI6A 2O0YA 4UQIM 2V9AA 4PAUA 4Y3IA 4NXFA 4WUJA 3V67A 3B42A 3OLOA 5TBMA 4MCWA 4WL9A 3H7WA 3PXPA 1JNUA 2NUTC 3IBRA 3KSFA 3UB8A 1G28A 3LR5A 5KSHA 3KYZA 1VB6A 3MR0A 4EUVA 1N9OA 3PBSA 4R70A 2O9AA 2K7SA 3EEHA 4ETXA 3VOLA 4F3LB 1ZTUA 4GLQA 2XROA 4GHIB 3R7WB 2VV6A 1P97A 1TS7A 4BBUA 5IT5A 2Z6CA 3F1OA 5HD5A 4WLAA 2PYPA 4IHQA 4IJGA 1F98A 5DKKA 1TS6A 3CITA 3NOUC 3OCLA 3BY9A 4R3AA 2Z6DA 2QKPA 5C5KA 4NEED 3H9WA 2L0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC7 A;  4JGQ A;  1N9N A;  1DRM A;  4HIA A;  3LIB A;  2D01 A;  4JGO A;  2VV8 A;  1TS0 A;  1DP6 A;  1EW0 A;  1T18 A;  4EW7 A;  2V0W A;  5F6A A;  3LI8 A;  4HH3 A;  3ULF A;  2VLG A;  4E04 A;  3UB9 A;  3SW1 A;  2JHE A;  3LIF A;  5F69 A;  4GW9 A;  5F68 A;  1OTI A;  3KX0 X;  1XFN A;  2PHY A;  3MJQ A;  2P7J A;  5HD3 A;  1XJ4 A;  4HJ6 A;  2QJ5 A;  1LSW A;  3IS2 A;  5HDD A;  3FG8 A;  3LI9 A;  1XJ2 A;  3CAX A;  3VE3 A;  5HWT A;  1T1C A;  1D7E A;  4EXO A;  4EEP A;  2A24 A;  4GS9 A;  2WKP A;  3GDI A;  5DKL A;  4GCZ A;  3ZQ5 A;  3NJA A;  1GSW A;  5EFW A;  3MFX A;  3P7N A;  1WA9 A;  4L9G A;  4HP4 A;  3F1N A;  4HH2 A;  4NXG A;  4YWZ A;  2I9V A;  3LIE A;  1OT6 A;  1LT0 A;  2OWJ A;  3NHQ A;  5IU1 A;  1NWZ A;  4XT2 A;  4MN5 A;  4NXB A;  4PKY A;  3E4Q A;  2PYR A;  2ZOI A;  3RH8 B;  2QWS A;  5G4Z A;  4I5S A;  1XFQ A;  1XJ3 A;  4R6L A;  1S67 L;  1DP8 A;  3PYP A;  4EEU A;  4LRZ E;  3EWK A;  3LID A;  2V1A A;  2OWH A;  3UB6 A;  3LYX A;  1OTE A;  3D72 A;  5J4E A;  2ZOH A;  1BYW A;  1V9Z A;  1S66 L;  2EA9 A;  1UWP X;  4HJ4 A;  4I3A A;  3UB7 A;  2J80 A;  2JN7 A;  5HDS A;  1OTB A;  2QJ7 A;  3BY8 A;  2D02 A;  3K3D A;  3GEC A;  2W27 A;  3C8C A;  1P0Z A;  3G6O A;  2CMN A;  5AVE A;  1GSX A;  5TBM B;  3H7W B;  1MZU A;  4HHD A;  3A0S A;  2WKQ A;  3K3C A;  4F3L A;  4GHI A;  1LSV A;  2YKF A;  1Y28 A;  1OT9 A;  1LL8 A;  1TS8 A;  5AVF A;  5HZH A;  4I3J A;  3E4P A;  2PR5 A;  2BAS A;  3F1O B;  3BWL A;  4I3I A;  1UWN X;  2KX6 A;  3C2W A;  1D06 A;  4NXE A;  5J3W A;  4H6J B;  4M4X A;  2HV1 A;  3B33 A;  4HQA A;  4HY8 A;  4RQ9 A;  3H82 B;  4EER A;  2KDK A;  2ZBB A;  2L4R A;  2V1B A;  3T50 A;  4EES A;  2QHK A;  2R78 A;  3A0R A;  2PDR A;  5J7E A;  1ODV A;  5A8B A;  4WF0 A;  3LIA A;  4LLO B;  4MN6 A;  2W0N A;  2PD8 A;  1OJG A;  3CLO A;  1OJ5 A;  4JGP A;  4LRX C;  1S1Y A;  3HJK A;  3MQQ A;  2H28 A;  1OTA A;  4DJ2 A;  2VV7 A;  5F5Y A;  4I39 A;  1N9L A;  2M1C A;  5DJT A;  3IS2 B;  1LSX A;  1XJ6 A;  5G4Y A;  5DJU A;  4WN5 A;  2OOL A;  2V0U A;  1T19 A;  1X0O A;  3MXQ A;  3PHY A;  4I38 A;  2A24 B;  4GS9 B;  4H6J A;  5HWV A;  1F9I A;  3F1P B;  2PR6 A;  4HP9 A;  5HSQ A;  2WKR A;  3H82 A;  4JGR A;  5I5L A;  4HJ3 A;  2GJ3 A;  5KIZ A;  3F1N B;  5HWW A;  1OTD A;  4R38 A;  1S4S A;  3A0V A;  4LPZ A;  5HDC A;  1S1Z A;  3LUQ A;  4K08 A;  3VE4 A;  4XT2 B;  4HOI A;  4DJ3 A;  4HI4 A;  1UGU A;  1S4R A;  3RTY A;  1DP9 A;  1T1A A;  4BBT A;  2YKH A;  2VEA A;  3UME A;  4HNB A;  2INW A;  2B02 A;  4KQD A;  4EQ1 A;  2PD7 A;  4BBV A;  1GSV A;  1V9Y A;  3MQO A;  3E4O A;  3NOT C;  2L1M A;  3ICY A;  4PKY G;  4KUO A;  1T1B A;  3CWF A;  4L9F A;  4L9E A;  4EET B;  1KOU A;  4B9O A;  3UE6 A;  3HJI A;  5IS1 A;  3UMD A;  3F1P A;  4LRY C;  3NOP C;  3LIC A;  4KUK A;  2V9A A;  4NXF A;  4WUJ A;  3OLO A;  5TBM A;  4WL9 A;  3H7W A;  1JNU A;  3IBR A;  3UB8 A;  1G28 A;  1VB6 A;  3MR0 A;  1N9O A;  4R70 A;  2K7S A;  3EEH A;  3VOL A;  4F3L B;  4GHI B;  2VV6 A;  1P97 A;  1TS7 A;  4BBU A;  2Z6C A;  3F1O A;  5HD5 A;  4WLA A;  2PYP A;  1F98 A;  5DKK A;  1TS6 A;  3NOU C;  3BY9 A;  4R3A A;  2Z6D A;  2QKP A;  3H9W A;  2L0W A; 
#chains in the Genus database with same CATH topology
 4G3K A;  4JGQ A;  5EUA A;  3MS6 A;  1JWZ A;  4DKI A;  3LIB A;  3IXD A;  4C6Y A;  4OPR A;  2M7U A;  4QD4 A;  2KOI A;  1CQA A;  4H8R A;  1EW0 A;  4EW7 A;  3CUE C;  3C5A A;  1ACF A;  3LI8 A;  4WEK A;  4N1H A;  3T12 B;  3ZVW A;  3ULF A;  1SDE A;  4KZ3 A;  4E04 A;  1JWP A;  3A3D A;  3PBR A;  3Q7V B;  2GNX A;  5F69 A;  3D9Y A;  4GW9 A;  1OTI A;  3HCY A;  3IHA A;  3I7J A;  1M40 A;  5FDS A;  2V8C A;  2V2F F;  1LI9 A;  2B5R A;  4KZ5 A;  5CTN A;  3G30 A;  2JKT M;  3DWK A;  2QZ6 A;  5HD3 A;  2JKR M;  3HLG A;  2JKG A;  1N9B A;  2QJ5 A;  4HJ6 A;  4KZ7 A;  1TVF A;  1W8Q A;  1L0F A;  3IS2 A;  1H0M A;  3FG8 A;  4LV2 A;  3O86 A;  3LI9 A;  4D2O A;  3UDF A;  3RJU A;  1XJ2 A;  1Y4O A;  4BLM A;  1KE0 A;  1HLU P;  4EEP A;  4FTX A;  3OPP A;  2WKP A;  3GDI A;  1W79 A;  1PYY A;  5GLB A;  4GCZ A;  3IQA A;  1EI5 A;  3MFX A;  1CJF A;  3LCE A;  5BOH A;  5DF9 A;  2EWV A;  4L9G A;  3IT9 A;  3F1N A;  2G2W A;  5DFY A;  4NXG A;  4WEL A;  3UB5 P;  5K5B A;  3FZC A;  3ZHH A;  2OWJ A;  5IU1 A;  3WS4 A;  2B95 A;  5FQI A;  3M6H A;  1TD5 A;  3MBZ A;  2OV5 A;  3W4O A;  4E3L A;  5TR7 A;  4Y0U A;  3MQ0 A;  3OPL A;  3B47 A;  3Q7V A;  2ZOI A;  4GD8 A;  1L0E A;  3RH8 B;  2QWS A;  1E3U D;  1DJC A;  3T4Q A;  1IOU A;  5G4Z A;  1IKG A;  2Q9M A;  4GNU A;  4R6L A;  1KGE A;  1S67 L;  4YFM A;  5GHZ A;  3G2Z A;  5FL3 A;  2W3D A;  5HAI A;  2ZC5 B;  3IHB A;  2J3T D;  1K57 C;  4L0L A;  3DTI A;  4KQO A;  3LID A;  3N7W A;  3UB6 A;  3LY4 A;  3C38 A;  3OPR A;  5CHM A;  4CLC B;  1GHP A;  1YMX A;  2WKI A;  3D72 A;  1FR6 A;  5FAO A;  4ZDX A;  2ZOH A;  4FH4 A;  3QP1 A;  5GLC A;  3AGD A;  2JKR I;  1S66 L;  5CEC A;  2HDR A;  3LR0 A;  1PW1 A;  3BYD A;  1YMS A;  3UB7 A;  3VOZ A;  3FV7 A;  5EEC A;  5A93 A;  3SH9 A;  1OTB A;  3BY8 A;  2A3U A;  4KQQ A;  4BWI A;  5L8M A;  1ALQ A;  3OOV A;  1TEM A;  2ZQD A;  2CMN A;  1GSX A;  1MZU A;  2IWD A;  5EM1 A;  3O88 A;  3N8R A;  4KG5 A;  1LSV A;  3NUL A;  4EBP A;  5HZH A;  3BFG A;  3A3I A;  1K4F A;  2ZMA A;  3E4P A;  3HLB A;  3WRT A;  3VV4 A;  1YLP A;  3O87 A;  5DF7 A;  4EQI A;  4OQ0 A;  1S0W A;  1UWN X;  4R1G A;  1WYB A;  4E3K A;  1XP4 A;  3BFD A;  3VP1 A;  1GHM A;  4HQA A;  4HY8 A;  3D3O A;  1OME A;  4Y17 A;  2HDS A;  1PNE A;  2WK0 A;  2Q0O A;  1MKM A;  2ZC6 B;  3H82 B;  5AQ9 A;  4CPK A;  4PM7 A;  1SCW A;  4JXS A;  2PBY A;  4PMA A;  1L0G A;  1YM1 A;  4JF5 A;  2V1B A;  3T50 A;  2HPB A;  2WYX A;  5KZH A;  3BLM A;  5J7E A;  4ZRR A;  1P9R A;  1ODV A;  5CX7 A;  1XXM A;  1Q2P A;  5A90 A;  3ZNT A;  4GZB A;  1OPX A;  3OBF A;  1D1J A;  3DBA A;  3NY4 A;  2X01 A;  2H0T A;  2Y2O A;  2ZQ9 A;  3PTE A;  2HP6 A;  4IBR A;  3HLW A;  3VFF A;  1AWI A;  1IEL A;  4BL2 A;  2VV7 A;  2DRW A;  3ZG5 A;  5FA7 A;  2FH5 A;  1NYM A;  1N9L A;  4FUW A;  3E98 A;  4PM9 A;  1Z09 A;  4DN0 A;  2OOL A;  1BLP A;  4CLC C;  3QP2 A;  4ARZ B;  1T19 A;  5A92 A;  4RYE A;  3JVU A;  4X69 A;  4GS9 B;  1K6R A;  5HWV A;  1CF0 A;  5E2E A;  3H82 A;  4HJ3 A;  4YIN A;  5KIZ A;  3N4I A;  4R38 A;  1AXB A;  2O99 A;  4S2M A;  2CC1 A;  1HD8 A;  3IWO A;  3IF6 A;  5HDC A;  3GVB A;  1VEU A;  1IYO A;  4XT2 B;  5F1F A;  4EWF A;  3IWQ A;  2WAE A;  1KE4 A;  4LV1 A;  1S4R A;  3P09 A;  5FQM A;  3Q1F A;  4R0Q A;  3ZFZ A;  4DXC A;  3ZDJ A;  4MNR A;  4UAA A;  3W8K A;  2B02 A;  2KLI A;  2ZJ9 A;  5FAP A;  4EQ1 A;  3UPO A;  4UQI S;  2DNS A;  3V39 A;  4S2I A;  5GLD A;  1GCE A;  2L1M A;  4LCL A;  2OLU A;  1SKO A;  2BG1 A;  3PAE A;  3IBJ A;  4L9F A;  4Y0O A;  5KSC A;  3M2J A;  3HJI A;  5CGX A;  4S2J A;  4Y2F A;  4JF6 A;  2Y2Q A;  3NOP C;  3LIC A;  4WZ4 A;  5EPH A;  4IUH A;  1MWS A;  3HVF A;  3BRM A;  3N6I A;  4WUJ A;  3VOY A;  3OLO A;  3SS4 A;  5EOO A;  3IF5 A;  5CER A;  1G28 A;  2WAD A;  1BSG A;  4LCM A;  5DVA A;  3ZG0 A;  4EUV A;  1N9O A;  4ETX A;  2EFX A;  3VOL A;  4F3L B;  4GHI B;  1YLJ A;  2ZM8 A;  2XLN A;  4R4R A;  3R7W B;  1P97 A;  3SS3 A;  5CGS A;  3WS5 A;  5IT5 A;  1H8Z A;  2Z6C A;  1EWZ A;  1VM1 A;  3IX8 A;  3CG5 A;  4ZBE A;  1TS6 A;  3NOU C;  3T1X A;  3QP8 A;  3GMW A;  5C5K A;  4P85 A;  4NEE D;  1QME A;  2J9P A;  1NXY A;  1NJ4 A;  5JYP A;  4HIA A;  4MLL A;  3S22 A;  3VSK A;  1MWR A;  4CQH A;  2QYB A;  4G3W A;  3G2Y A;  3BEB A;  3ZG9 B;  2VGL S;  4X53 A;  3WRZ A;  5HAP A;  1FQG A;  2JHE A;  3LIF A;  3L9K A;  1W5D A;  3HLC A;  3G34 A;  5FQJ A;  3KSG A;  1O7E A;  1P9W A;  3E2K A;  3KX0 X;  1RGY A;  3ZG8 B;  3UDX A;  3HLF A;  5I94 A;  3TSG A;  4WMC D;  2G2U A;  2PBD P;  4GDN A;  5HDD A;  5HAR A;  5FQ9 A;  2G7U A;  3CAX A;  5TFQ A;  1JWV A;  1NZO A;  2P9V A;  1H3Q A;  1D7E A;  2VK3 A;  2XQZ A;  3C30 A;  2X71 A;  3ZQ5 A;  3NJA A;  4BD1 A;  5CEB A;  4II7 A;  1G6O A;  5EVI B;  4A5R A;  3CJM A;  3MXS A;  3MF0 A;  4GB7 A;  5IHV A;  3CUE A;  1K54 C;  2VJW A;  3CPT A;  4DDS A;  3S7P A;  1XX2 A;  5L09 A;  2Y59 A;  5CHU A;  4JXG A;  2J7V A;  4OOM A;  5GL9 A;  1NY0 A;  1G6A A;  4P87 A;  3E4Q A;  2PYR A;  1FIK A;  3MZF A;  1MBL A;  4N1X A;  2FZ0 A;  4JBF A;  4FCF A;  2LB9 A;  2Y2J A;  1I2W A;  4P6Z S;  1XJ3 A;  2EX6 A;  3CHW P;  3LGO A;  4X68 A;  4F94 A;  3MMH A;  5HPI A;  4O8G A;  3VFH A;  2C5W B;  3UY6 A;  2XSS A;  4JPM A;  3LO7 A;  3VP4 A;  1G5U A;  4M3K A;  2ZQA A;  1UWP X;  3RXW A;  4HJ4 A;  3IX3 A;  5EM0 A;  1GHI A;  2J80 A;  2ZM2 A;  5M19 A;  2JN7 A;  1FR1 A;  1MKI A;  5HDS A;  3OZH A;  2D02 A;  3K3D A;  3OPH A;  4Q0H A;  1P0Z A;  3W4P A;  5AVE A;  5TBM B;  5EVL A;  1SKF A;  5E2H A;  1BTL A;  4YNR A;  5U47 A;  3FYZ A;  3GV9 A;  1YQS A;  2XFT A;  2WKQ A;  4OP8 A;  4D60 A;  1Y28 A;  5AVF A;  1YKD A;  4MBH A;  2Z2L B;  1Y54 A;  1K57 A;  2V1Z A;  3G31 A;  2XF3 A;  2Y55 A;  5CGW A;  3JPU A;  3F1O B;  3BWL A;  4I3I A;  2XEP A;  3BFC A;  5HL1 A;  2XA7 M;  3A3E A;  4JLF A;  3NIA A;  3FPW A;  1H8M A;  4H6J B;  2GZA A;  1GA0 A;  4K0X A;  4EER A;  2ZMF A;  2ZL1 B;  2ZBB A;  5EVI C;  5FAS A;  2L4R A;  4NK3 A;  2WAF A;  5DTK A;  1JTG A;  2QHK A;  3BQ8 A;  2R78 A;  3A0R A;  4ZJ3 A;  1Q2Q A;  1W63 M;  3IH8 A;  3G32 A;  3QNC A;  5A8B A;  4EU0 A;  1F5M A;  4LLO B;  1STZ A;  1PWG A;  4X56 A;  3NEC A;  4MBF A;  4JGP A;  2Y2H A;  4LRX C;  5CXW A;  5FDH A;  4OQI A;  2H28 A;  3DWZ A;  4E3N A;  5HFO A;  1FSW A;  4BL3 A;  3HUO A;  1NLY A;  2W1R A;  2Y4A A;  5DJT A;  3T4J A;  4B88 A;  4KG6 A;  4RX2 A;  2PU4 A;  2XD5 A;  4WN5 A;  4E6W A;  2JKT I;  4X55 A;  3ITA A;  3O5Y A;  3G35 A;  3E0Y A;  3PHY A;  1ERQ A;  4I38 A;  2A24 B;  4H6J A;  4OLD A;  4DE1 A;  1MXO A;  1YSP A;  2WKR A;  4JGR A;  5E43 A;  2ZL1 A;  3NDG A;  5HWW A;  3T1Q B;  3JYI A;  4LPZ A;  3UE0 A;  2XA7 S;  3V3R A;  5FI2 A;  5A91 A;  4UA9 A;  5E2F A;  5F82 A;  4HI4 A;  1YLT A;  4JF4 A;  3NCK A;  4Y15 A;  3RTY A;  2IWC A;  4X1M A;  4IVK A;  2GX5 A;  4DE0 A;  1WE4 A;  1T1A A;  3LR4 A;  4BBT A;  1ZG6 A;  5CED A;  3E2L A;  4IUK A;  4WZ5 C;  3S7N A;  4HNB A;  3T1S A;  2INW A;  3N8S A;  4KQD A;  2W3E A;  4LEN A;  1GSV A;  1V9Y A;  2ZD8 A;  4CLC A;  1C3B A;  5AQ7 A;  1KDS A;  2K2N A;  4X25 A;  3V50 A;  3ICY A;  3PR6 A;  1PI5 A;  1PFL A;  2JCH A;  3L7H A;  1MY8 A;  3WS2 A;  4B9O A;  3UE6 A;  5IS1 A;  4CJN A;  4KZ9 A;  3IXH A;  4KUK A;  1K56 A;  3CI6 A;  4O7D A;  4UQI M;  4DF6 A;  3Q7Z A;  2C6W B;  2JBF A;  4NXF A;  3QP4 A;  5CRF A;  2OLV A;  3GSG A;  1VET B;  4MCW A;  3IBR A;  4B4Z A;  1K56 D;  1CEG A;  2ZQ8 A;  1H8Y A;  1L0D A;  4R4S A;  1XGJ A;  1KVM A;  1ESU A;  3EEH A;  1IKI A;  1ZTU A;  2BLS A;  2X02 A;  4OVD A;  4DDY A;  1DJB A;  4BEN A;  4JXW A;  3FWL A;  4BBU A;  4WLA A;  2PYP A;  4IHQ A;  4OOY A;  4NG2 A;  4IJG A;  1F98 A;  3CIT A;  4HBT A;  3HLE A;  3RXX A;  3MSH A;  4E3I A;  2K31 A;  2WUQ A;  3FC7 A;  2VA0 A;  4PM6 A;  1YPR A;  1L3L A;  4KG2 A;  4KQR A;  1K25 A;  2Y2P A;  3IXB A;  2R9X A;  3TG9 A;  2Y2K A;  5FQQ A;  2D01 A;  3IWI A;  4OH0 A;  4QY6 A;  4JGO A;  1TS0 A;  4GOG A;  3LR3 A;  2HDQ A;  1YLZ A;  5F6A A;  4HH3 A;  2JE5 A;  2W3F A;  4PM5 A;  1E25 A;  3SW1 A;  3QNB A;  1VET A;  4KZ6 A;  1YLY A;  3AGE A;  4GN2 A;  2ZMV A;  2XGN A;  3ITB A;  3DTE A;  4WM9 A;  3SH7 A;  3GRJ A;  4UEY A;  3UPN A;  2PHY A;  3MJQ A;  2P7J A;  5GHY A;  3Q07 A;  1XJ4 A;  2HJ9 C;  1LSW A;  3LY3 A;  3UNW A;  1MWU A;  2VGL M;  1ES5 A;  2HDU A;  5FQK A;  1PW8 A;  2Y79 A;  3WS0 A;  3HUM A;  4Z1W A;  5HWT A;  4Y0T A;  4PPR A;  4ARZ A;  2QMI A;  3BM6 A;  4GS9 A;  5EFW A;  3O3V A;  1CI9 A;  1WYC A;  4ETZ A;  1WA9 A;  2DMW A;  3HBR A;  2Y2G A;  2Y91 A;  4HP4 A;  3OC2 A;  1NLZ A;  3M2K A;  3KSH A;  2P08 A;  3UDI A;  5EV0 A;  3EOI A;  1NWZ A;  4HES A;  5E2G A;  2O9C A;  4XT2 A;  3VP3 A;  4NXB A;  1F2K A;  1ES3 A;  1ES2 A;  2H5S A;  3EEA A;  1IYQ A;  2XR0 A;  4ZAM A;  1MPL A;  4BQM A;  3C7U A;  4I5S A;  1XFQ A;  1BUL A;  4X6T A;  1S6R A;  1DP8 A;  3TJZ C;  2UV0 E;  3PYP A;  1MC0 A;  4FD8 A;  4EEU A;  4ME4 A;  4LRZ E;  1I2S A;  2V1A A;  2OWH A;  3MXR A;  5JYO A;  3LYX A;  2BTF P;  4O01 A;  4N9L A;  4OKP A;  2W3G A;  4ZTK A;  5J4E A;  1TDG A;  1V9Z A;  4WYY A;  3PBO A;  4P6Z M;  1VQQ A;  4XUZ A;  3S7O A;  2J8Y A;  1BLH A;  1K54 A;  3BJN A;  3LFV A;  2UWX A;  2PT7 A;  4KZB A;  1W7F A;  3C8C A;  4UA6 A;  3G6O A;  2W1T B;  1PWC A;  4FSF A;  5HW3 A;  3H7W B;  4BJP A;  4HHD A;  3EQU A;  2WGW B;  3K3C A;  4F3L A;  4GHI A;  3ZVT A;  4E3J A;  2I72 A;  1FCN A;  3BW6 A;  3R7W A;  3OCN A;  1OT9 A;  4K91 A;  1LL8 A;  4OQH A;  4I3J A;  5G18 A;  2HP5 A;  1YT4 A;  1XA7 A;  3D4F A;  2KX6 A;  1D06 A;  4NXE A;  3N8L A;  1XA1 A;  4QU3 A;  1XPB A;  2Y2M A;  1YLW A;  4QB8 A;  4GD6 A;  2EX2 A;  3HL9 A;  4OOL A;  4FH2 A;  1TF1 A;  4EES A;  2O9B A;  5AQB A;  4X1L A;  3A3F A;  5AQA A;  4GKU A;  2PDR A;  1ERM A;  1ONG A;  1J9M A;  1SHV A;  4FOF A;  3C4P A;  3S1Y A;  1W8Y A;  3LIA A;  5EE8 A;  2W1T A;  4ID4 A;  4MN6 A;  2W0N A;  2PD8 A;  3CLO A;  1OJ5 A;  4YOF A;  3CMZ A;  3T4T A;  2PAV P;  3PBT A;  3BFE A;  3HJK A;  3MQQ A;  4N92 A;  1PI4 A;  4IVI A;  1VHM A;  1OTA A;  4DJ2 A;  4UA7 A;  1YAX A;  2EWW A;  5F5Y A;  2WZZ A;  5J8X A;  3EQV A;  3QHY A;  1U60 A;  4IED A;  3FKV A;  3IS2 B;  3MZD A;  1LSX A;  4RX3 A;  2ZM0 A;  1J3W A;  1XJ6 A;  5G4Y A;  2V0U A;  1X0O A;  3MXQ A;  1Z6F A;  2A2L A;  4OPQ A;  3W2Z A;  5EVI A;  3TE8 A;  4OP5 A;  2HZ5 A;  1F9I A;  2EX9 A;  1PZP A;  3F1P B;  4HP9 A;  2XH9 A;  1L2S A;  5HSQ A;  2Y2I A;  5I5L A;  2GJ3 A;  4N9K A;  4S2N C;  4R3J A;  3F1N B;  3ZCZ A;  4ZJ2 A;  1S4S A;  5EVI D;  3QP5 A;  4S2O A;  2RL3 A;  4MDZ A;  2PRF A;  3LUQ A;  4K08 A;  3NC8 A;  1KGF A;  4MMN A;  4HOI A;  4DJ3 A;  1RP5 A;  2V8F A;  1PIO A;  3ISG A;  5M1A A;  2Y2N A;  3T4K A;  2JKF A;  4EV4 A;  4BMW A;  5HL6 A;  2YKH A;  1FOF A;  1KGG A;  2PU2 A;  4IBX A;  1BZA A;  5EOE A;  4E6X A;  3SOI A;  2FFY A;  5L2F A;  2WKE A;  2JC7 A;  2Z2M B;  1MWT A;  4RA7 A;  3MQO A;  2ZC4 B;  5D3O A;  3NOT C;  5DF8 A;  4PKY G;  4KUO A;  2HF6 A;  4L9E A;  4EET B;  3F1P A;  2J9O A;  4BD0 A;  4LRY C;  4U0X A;  1FSY A;  3DTK A;  5TGF A;  2ZQ7 A;  3V67 A;  5TBM A;  1DJA A;  3TOI A;  2NUT C;  2VGK A;  3KSF A;  3UB8 A;  3LR5 A;  5KSH A;  4XUX A;  4NET A;  1ZG4 A;  1E3U A;  2Y2L A;  2ZC7 A;  3MR0 A;  5L10 A;  4LFU A;  2O9A A;  3V3S A;  2K7S A;  1FCO A;  2XRO A;  3MKE A;  4DRT A;  1ZC2 A;  4WZ5 A;  2VV6 A;  3QP6 A;  2WKH A;  4KZ4 A;  3F1O A;  5HD5 A;  3BLS A;  1FIL A;  1FCM A;  2E8I A;  2ZQC A;  2FFF B;  3OCL A;  3BY9 A;  4R3A A;  1KDW A;  2Z6D A;  2V20 A;  3H9W A;  2XK1 A;  4Y5F A;  2L0W A;  1N9N A;  2VX8 A;  4R23 A;  5CHJ A;  2B18 A;  1LL5 A;  1DRM A;  3SZT A;  1SDN A;  5HAQ A;  3A3J A;  3U4L P;  4S2L A;  3EGX C;  1ESI A;  1O07 A;  4GDB A;  5HX9 A;  4Y13 A;  2VV8 A;  1DP6 A;  1BLC A;  3AGF A;  1T18 A;  2OAP 1;  4EBN A;  2V0W A;  1ZHH B;  1LHY A;  4RVA A;  2VGJ A;  4OQG A;  2VLG A;  3HRE A;  1ERO A;  1CI8 A;  4Q0I A;  3UB9 A;  4Z9Q A;  4LV3 A;  1BLS A;  5TJJ A;  2M7V A;  4QPR A;  5F68 A;  5L07 A;  3RFB A;  5LBR A;  1XFN A;  4DE2 A;  5EVE A;  1KVL A;  3PBN A;  2J3T C;  5DTT A;  4HEF A;  3GTC A;  4XXR A;  1ES4 A;  5GHX A;  1A0K A;  4ESP A;  2XDM A;  3VE3 A;  1IFQ A;  1T1C A;  2P04 A;  3LEZ A;  4NKP A;  1NRF A;  4CLC D;  1JTD A;  4EXO A;  5HPF A;  2A24 A;  4PHT A;  3UPP A;  4HBU A;  2EFU A;  4OPZ A;  5DKL A;  1GSW A;  3P7N A;  3UO9 A;  1QMF A;  3MZE A;  4KZA A;  3V5M A;  1I5Q A;  4HH2 A;  2ZLY A;  4YWZ A;  2I9V A;  1K6S A;  3LIE A;  3K2N A;  1OT6 A;  4PM8 A;  2GDN A;  3DAV A;  1LT0 A;  3NHQ A;  5FAQ A;  3IF6 B;  2LB5 A;  1VEU B;  4MN5 A;  4PKY A;  4U3T A;  3ZYT A;  2XD1 A;  3KO6 A;  4E3O A;  1NRJ A;  2NUP C;  1HTZ A;  1PZO A;  5F83 A;  4OLG A;  3BQA A;  2R9W A;  3MFD A;  3CZD A;  3WWX A;  4Q8I A;  3VSL A;  1IYS A;  5FI6 A;  3BFF A;  4QY5 A;  4G3V A;  2VKS A;  3IH9 A;  3EWK A;  3M6B A;  2XRN A;  3T4O A;  1OTE A;  3Q81 A;  2IA2 A;  1XKZ A;  4QWO A;  2H10 A;  2XFS A;  3TW8 A;  3DTM A;  4GJ4 A;  1HZO A;  1N4O A;  1SKO B;  1BYW A;  5AJG A;  3ZG7 B;  1IEM A;  2EA9 A;  3PAG A;  4DXB A;  3PBQ A;  4I3A A;  2J3W A;  3UE3 A;  5FI7 A;  3FPV A;  2QJ7 A;  5DTS A;  4O0P A;  3GEC A;  2W27 A;  5FEF A;  2WZX A;  3WS1 A;  3VMA A;  1XGI A;  3P01 A;  1G68 A;  1K55 A;  3A0S A;  3LEQ A;  1GA9 A;  1RGZ A;  4MBK A;  5GLA A;  2YKF A;  2MJ6 A;  4EUZ A;  1DY6 A;  1TS8 A;  3B3X A;  3Q82 A;  2PR5 A;  2BAS A;  1ZKJ A;  1CEF A;  4R3B A;  3C2W A;  5J3W A;  3KYE A;  2OAQ 1;  2HV1 A;  3IXG A;  4M4X A;  3B33 A;  2ACG A;  5F1G A;  4ZJ1 A;  4P0M A;  4S2K A;  4RQ9 A;  3MKF A;  4JXV A;  2KDK A;  1CK3 A;  1HVB A;  3KYQ A;  3FKW A;  3SH8 A;  4OON A;  3UN7 A;  1W63 Q;  4WEJ A;  4DMZ A;  4K0W A;  1M6K A;  3P98 A;  3HLD A;  2AVX A;  1BT5 A;  1RCJ A;  1K55 C;  4Q0J A;  4WF0 A;  3IF6 C;  3TRC A;  2EX8 A;  5KMW A;  1OJG A;  1S1Y A;  4Y7P A;  4CLC E;  3GR2 A;  4KZ8 A;  4MN7 A;  2Y8H A;  1JVJ A;  5FSR A;  4I39 A;  1ONH A;  2ZC3 B;  2M1C A;  4U0T A;  2WGI A;  3G4P A;  2HJE A;  3T4L A;  3SS5 A;  4JKT A;  1K38 A;  5DJU A;  5CTM A;  2P9V B;  2IWB A;  3R4K A;  1K0K A;  3DW0 A;  2PR6 A;  3JVV A;  4B93 A;  3C7V A;  1NZU A;  3NI9 A;  2W3H A;  3UE1 A;  3ZGA B;  3W4Q A;  1YSQ A;  1OTD A;  1H5X A;  3A0V A;  3CPT B;  2HGV A;  2QPN A;  1S1Z A;  3U2A A;  3VE4 A;  1TDL A;  4KEN B;  4WBG A;  4C3Q A;  5DFX A;  3T4S A;  5MC7 A;  5FAT A;  1UGU A;  3S7Q A;  1LI0 A;  4QHC A;  1BUE A;  3S4X A;  2VZW A;  4MEZ A;  4WMC A;  1DP9 A;  5FEG A;  3VP0 A;  4DE3 A;  1LL9 A;  2VEA A;  3EGD C;  3UME A;  4B4X A;  1PWD A;  4OPY A;  4AFI A;  2PD7 A;  3VP2 A;  4BBV A;  1SZV A;  4C75 A;  4E3M A;  2WGV A;  3E4O A;  4UHU A;  3IX4 A;  3NBL A;  2EXB A;  1T1B A;  2HP9 A;  1LLB A;  4P6B A;  3CWF A;  3GQZ A;  1KOU A;  3BEC A;  4S2N A;  3UMD A;  3KSI A;  2EXA A;  2RCX A;  1NYY A;  1E4D A;  2O0Y A;  2V9A A;  4PAU A;  4Y3I A;  1K4E A;  5M18 A;  3HUN A;  1PRQ A;  3B42 A;  1KE3 A;  4WL9 A;  3H7W A;  3PXP A;  1JNU A;  3T1R A;  3KYZ A;  2WGW A;  1VB6 A;  2Q9N A;  2E8J A;  3PBS A;  4R70 A;  4LV0 A;  4GLQ A;  1TS7 A;  4S2P A;  1IYP A;  2H0Y A;  3ZNY A;  4EBL A;  3C4O A;  5DKK A;  2OSU A;  4QJG A;  2DCF A;  2QKP A;  2A49 A;  4LGW A;  2P74 A;  3NDE A; 
#chains in the Genus database with same CATH homology
 2K31 A;  3FC7 A;  4G3K A;  4JGQ A;  2VA0 A;  1N9N A;  2VX8 A;  2B18 A;  1DRM A;  4HIA A;  3LIB A;  3EGX C;  2D01 A;  4JGO A;  2VV8 A;  2M7U A;  1TS0 A;  3LR3 A;  1DP6 A;  2KOI A;  1EW0 A;  1T18 A;  2OAP 1;  2QYB A;  3CUE C;  4G3W A;  4CQH A;  2V0W A;  1ZHH B;  4EW7 A;  5F6A A;  3LI8 A;  4WEK A;  4HH3 A;  3ULF A;  2VGL S;  2VLG A;  2W3F A;  4E04 A;  4Q0I A;  3UB9 A;  3PBR A;  3SW1 A;  2JHE A;  3LIF A;  5TJJ A;  2M7V A;  2GNX A;  5F69 A;  4GW9 A;  4QPR A;  1OTI A;  3HCY A;  5F68 A;  3KSG A;  1P9W A;  2ZMV A;  3KX0 X;  3RFB A;  4UEY A;  5LBR A;  1XFN A;  2PHY A;  3MJQ A;  2P7J A;  2JKT M;  3PBN A;  2J3T C;  5HD3 A;  1XJ4 A;  2HJ9 C;  2JKR M;  4HJ6 A;  2QJ5 A;  1LSW A;  2VGL M;  3IS2 A;  5HDD A;  3FG8 A;  3LI9 A;  2G7U A;  1XJ2 A;  3CAX A;  2Y79 A;  3VE3 A;  4Z1W A;  5HWT A;  1IFQ A;  4ARZ A;  1H3Q A;  1T1C A;  2P04 A;  4NKP A;  1D7E A;  4CLC D;  4EXO A;  4EEP A;  2A24 A;  4PHT A;  4GS9 A;  5HPF A;  2WKP A;  3GDI A;  5DKL A;  3C30 A;  4GCZ A;  3ZQ5 A;  3NJA A;  1GSW A;  5EFW A;  3MFX A;  3P7N A;  4II7 A;  1G6O A;  4ETZ A;  1WA9 A;  2DMW A;  5DF9 A;  2EWV A;  4L9G A;  3MF0 A;  4HP4 A;  3F1N A;  3CUE A;  3OC2 A;  4HH2 A;  4NXG A;  1NLZ A;  4WEL A;  5DFY A;  4YWZ A;  2I9V A;  3LIE A;  5K5B A;  3K2N A;  1OT6 A;  3KSH A;  2P08 A;  2VJW A;  1LT0 A;  2OWJ A;  3NHQ A;  3EOI A;  5IU1 A;  1NWZ A;  3S7P A;  2O9C A;  1TD5 A;  2LB5 A;  4XT2 A;  4MN5 A;  4NXB A;  4OOM A;  4PKY A;  3ZYT A;  3KO6 A;  1NRJ A;  3MQ0 A;  3E4Q A;  2NUP C;  2PYR A;  3B47 A;  2ZOI A;  3EEA A;  3RH8 B;  3BQA A;  2QWS A;  3T4Q A;  2FZ0 A;  1IOU A;  5G4Z A;  2LB9 A;  4I5S A;  1XFQ A;  4P6Z S;  1XJ3 A;  4R6L A;  3MMH A;  1S67 L;  5HPI A;  5FL3 A;  1DP8 A;  2W3D A;  3TJZ C;  4G3V A;  4O8G A;  2VKS A;  3PYP A;  1MC0 A;  2J3T D;  4EEU A;  4ME4 A;  4L0L A;  4LRZ E;  3EWK A;  2XSS A;  4KQO A;  3LID A;  2XRN A;  2V1A A;  2OWH A;  3UB6 A;  3C38 A;  3LYX A;  3T4O A;  1OTE A;  4O01 A;  2IA2 A;  4CLC B;  2W3G A;  3D72 A;  3TW8 A;  4GJ4 A;  5J4E A;  2ZOH A;  1BYW A;  5AJG A;  1V9Z A;  2JKR I;  3PBO A;  1S66 L;  4P6Z M;  2EA9 A;  3LR0 A;  1UWP X;  4HJ4 A;  3PBQ A;  3S7O A;  4I3A A;  3UB7 A;  2J3W A;  3UE3 A;  2J80 A;  2JN7 A;  3FPV A;  3BJN A;  5HDS A;  3LFV A;  1OTB A;  2PT7 A;  2QJ7 A;  3BY8 A;  2D02 A;  3K3D A;  4O0P A;  4BWI A;  3GEC A;  4Q0H A;  5L8M A;  2W27 A;  3C8C A;  3OOV A;  1P0Z A;  3G6O A;  2W1T B;  2CMN A;  5AVE A;  1GSX A;  3P01 A;  4FSF A;  5TBM B;  3H7W B;  4BJP A;  1MZU A;  4YNR A;  4HHD A;  3A0S A;  3EQU A;  2WKQ A;  3K3C A;  4F3L A;  4GHI A;  1LSV A;  2YKF A;  3BW6 A;  3R7W A;  3OCN A;  1Y28 A;  1OT9 A;  2MJ6 A;  1LL8 A;  1TS8 A;  5AVF A;  5HZH A;  4I3J A;  1YKD A;  3E4P A;  2PR5 A;  3VV4 A;  2BAS A;  3F1O B;  3BWL A;  4I3I A;  1UWN X;  2KX6 A;  3C2W A;  1D06 A;  4NXE A;  5J3W A;  2XA7 M;  3FPW A;  1H8M A;  4H6J B;  2OAQ 1;  2GZA A;  2HV1 A;  4M4X A;  3B33 A;  4HQA A;  4HY8 A;  3D3O A;  4OOL A;  4RQ9 A;  3H82 B;  4EER A;  1MKM A;  2ZMF A;  2KDK A;  1TF1 A;  3KYQ A;  2ZBB A;  2L4R A;  1W63 Q;  2V1B A;  3T50 A;  4EES A;  2O9B A;  2QHK A;  3BQ8 A;  4WEJ A;  4DMZ A;  2R78 A;  3A0R A;  1W63 M;  2PDR A;  5J7E A;  4ZRR A;  4FOF A;  1P9R A;  1ODV A;  5A8B A;  5CX7 A;  4Q0J A;  4WF0 A;  3LIA A;  3TRC A;  4EU0 A;  1F5M A;  4LLO B;  2W1T A;  4MN6 A;  1STZ A;  2W0N A;  2PD8 A;  1OJG A;  1OPX A;  3OBF A;  3CLO A;  1OJ5 A;  4YOF A;  3DBA A;  4Y5F A;  4JGP A;  4LRX C;  3T4T A;  3PBT A;  1S1Y A;  3HJK A;  3MQQ A;  2H28 A;  1VHM A;  1OTA A;  4DJ2 A;  1YAX A;  2EWW A;  4CLC E;  2VV7 A;  5F5Y A;  4MN7 A;  3EQV A;  2Y8H A;  2FH5 A;  4I39 A;  1NLY A;  2W1R A;  1N9L A;  2M1C A;  5DJT A;  3IS2 B;  3T4J A;  3E98 A;  1LSX A;  2HJE A;  3T4L A;  1XJ6 A;  5G4Y A;  5DJU A;  4WN5 A;  2JKT I;  4DN0 A;  2OOL A;  3O5Y A;  4ARZ B;  4CLC C;  2V0U A;  1T19 A;  1X0O A;  3E0Y A;  3MXQ A;  3PHY A;  3R4K A;  4I38 A;  3JVU A;  2A24 B;  4GS9 B;  4H6J A;  2A2L A;  3W2Z A;  5HWV A;  3TE8 A;  1F9I A;  3F1P B;  2PR6 A;  4HP9 A;  3JVV A;  4B93 A;  5HSQ A;  1YSP A;  2WKR A;  3H82 A;  4JGR A;  5I5L A;  2W3H A;  4HJ3 A;  2GJ3 A;  5KIZ A;  3F1N B;  1YSQ A;  5HWW A;  1OTD A;  4R38 A;  1S4S A;  2O99 A;  3A0V A;  4LPZ A;  4MDZ A;  2HGV A;  5HDC A;  1S1Z A;  3U2A A;  3LUQ A;  2XA7 S;  4K08 A;  3VE4 A;  4XT2 B;  5DFX A;  3T4S A;  5MC7 A;  4MMN A;  4HOI A;  4DJ3 A;  4HI4 A;  1UGU A;  3S7Q A;  1S4R A;  3RTY A;  2GX5 A;  2VZW A;  3T4K A;  3LR4 A;  1DP9 A;  1T1A A;  4BMW A;  5HL6 A;  4BBT A;  2YKH A;  4IUK A;  2VEA A;  3EGD C;  3UME A;  3S7N A;  4HNB A;  4AFI A;  2INW A;  2B02 A;  2KLI A;  2W3E A;  4KQD A;  4EQ1 A;  2PD7 A;  4UQI S;  4BBV A;  1GSV A;  1V9Y A;  3MQO A;  4CLC A;  3E4O A;  3NOT C;  2K2N A;  2L1M A;  3ICY A;  4PKY G;  4KUO A;  3PR6 A;  1T1B A;  2HF6 A;  3IBJ A;  3CWF A;  4L9F A;  4L9E A;  4EET B;  1KOU A;  4B9O A;  3UE6 A;  3HJI A;  5IS1 A;  4Y2F A;  3UMD A;  3F1P A;  3KSI A;  4LRY C;  3NOP C;  3LIC A;  4KUK A;  4IUH A;  3CI6 A;  2O0Y A;  4UQI M;  2V9A A;  4PAU A;  4Y3I A;  4NXF A;  4WUJ A;  3V67 A;  3B42 A;  3OLO A;  5TBM A;  4MCW A;  4WL9 A;  3H7W A;  3PXP A;  1JNU A;  2NUT C;  3IBR A;  3KSF A;  3UB8 A;  1G28 A;  3LR5 A;  5KSH A;  3KYZ A;  1VB6 A;  3MR0 A;  4EUV A;  1N9O A;  3PBS A;  4R70 A;  2O9A A;  2K7S A;  3EEH A;  4ETX A;  3VOL A;  4F3L B;  1ZTU A;  4GLQ A;  2XRO A;  4GHI B;  3R7W B;  2VV6 A;  1P97 A;  1TS7 A;  4BBU A;  5IT5 A;  2Z6C A;  3F1O A;  5HD5 A;  4WLA A;  2PYP A;  4IHQ A;  4IJG A;  1F98 A;  5DKK A;  1TS6 A;  3CIT A;  3NOU C;  3OCL A;  3BY9 A;  4R3A A;  2Z6D A;  2QKP A;  5C5K A;  4NEE D;  3H9W A;  2L0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...