4MN5A

Crystal structure of pas domain of s. aureus yycg
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
103
Chain Sequence
RRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLGLIARVNFSTIVQETGFVTGYIAVLHDVTEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein kinase WalK
publication title Crystal structure of PAS domain of S. aureus YycG
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 18
structure length 103
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mn5A00
1X0OA 2JHEA 5TBMB 4HY8A 1F9IA 1BYWA 1LSWA 2VV6A 4WL9A 4HQAA 4HI4A 4R38A 1LSXA 3EEHA 3HJIA 3K3CA 1OJ5A 3IS2A 4LRZE 2OWJA 4WUJA 4NXEA 4HOIA 3H82B 3ULFA 2L4RA 3A0RA 4EEUA 2L1MA 1OTIA 2PR6A 2YKHA 2HV1A 2B02A 3RTYA 1LL8A 4HP4A 1NWZA 2CMNA 2EA9A 3MXQA 5F5YA 4HH3A 1MZUA 3VE3A 2J80A 2YKFA 4WF0A 4HJ4A 5HWTA 2ZOIA 4R6LA 4XT2A 4B9OA 4M4XA 2QKPA 4WLAA 1GSWA 4GS9B 3NHQA 4BBTA 4MN6A 1T1AA 3P7NA 2W0NA 3F1NA 3FG8A 4NXBA 1Y28A 3LIEA 3LIAA 3RH8B 4JGPA 2INWA 3E4QA 1OTEA 3LUQA 4I3IA 4YWZA 5J7EA 4HJ3A 5HZHA 4BBVA 1WA9A 3E4OA 2JN7A 4I3AA 4DJ2A 5HSQA 1S4RA 4EESA 4NXFA 1XFNA 2V1AA 5A8BA 4MN5A 1VB6A 3LI9A 5AVFA 2KDKA 4EEPA 3F1OA 4HIAA 2PD8A 3PHYA 1UWNX 1LT0A 4I38A 3E4PA 3LI8A 2R78A 2PR5A 1XJ6A 3LIBA 2BASA 2I9VA 2PYRA 3CAXA 4NXGA 2OWHA 1T1BA 2VV8A 1TS0A 2V0WA 1F98A 2PD7A 2WKPA 3G6OA 4DJ3A 2QWSA 4BBUA 3C2WA 2D02A 3IS2B 3GDIA 3MQQA 1JNUA 1T19A 4HNBA 2M1CA 3ICYA 3UB7A 3SW1A 4H6JA 1D06A 1DP9A 2ZOHA 1D7EA 4HH2A 1P0ZA 2V9AA 4LRXC 4GHIA 1DP8A 4PKYA 1XJ4A 3MJQA 5G4YA 5I5LA 1OTAA 5DJTA 3UMEA 4HHDA 3LYXA 4F3LA 1XJ2A 1S67L 5J4EA 2W27A 3VOLA 2A24A 1V9YA 4L9GA 4I39A 3H9WA 2GJ3A 1GSXA 4XT2B 3UB9A 1OT6A 3CWFA 2PHYA 4PKYG 2VV7A 4HP9A 3F1NB 4EETB 3H7WB 2VEAA 3K3DA 2VLGA 1OT9A 3MQOA 3F1PA 1OTDA 3OLOA 1TS8A 3VE4A 1XFQA 1S1YA 3ZQ5A 2QJ5A 1XJ3A 2OOLA 5TBMA 1UGUA 2QJ7A 1G28A 1LSVA 4WN5A 5IS1A 4E04A 5HWVA 2L0WA 5AVEA 3C8CA 5HDDA 2PYPA 3HJKA 4EQ1A 5HD3A 2KX6A 2V1BA 3F1OB 2P7JA 3H82A 4GCZA 4I3JA 1ODVA 3NJAA 5DJUA 3UB8A 4LPZA 3MR0A 5KIZA 3A0SA 5HDSA 1N9LA 3BY9A 3A0VA 3CLOA 3PYPA 3NOUC 5DKLA 1TS7A 1N9NA 5DKKA 4RQ9A 5F68A 1S1ZA 2H28A 3NOPC 1DP6A 4GS9A 2PDRA 1S4SA 5EFWA 1P97A 4EXOA 1DRMA 3UE6A 4H6JB 1OTBA 1T18A 3GECA 2V0UA 4L9FA 3KX0X 4GHIB 3T50A 2Z6DA 1TS6A 4GW9A 1N9OA 1KOUA 4EW7A 4F3LB 3MFXA 2D01A 4KQDA 2WKQA 3H7WA 3UMDA 1UWPX 5F6AA 4KUOA 1S66L 2A24B 4JGRA 3LIDA 2ZBBA 3FC7A 3D72A 4R3AA 4EERA 4HJ6A 3BY8A 4I5SA 5J3WA 3BWLA 4LLOB 4JGQA 5HWWA 2WKRA 4KUKA 1V9ZA 1GSVA 2K7SA 3LICA 4L9EA 1T1CA 4K08A 2QHKA 1OJGA 4JGOA 3EWKA 5G4ZA 3LIFA 4R70A 3F1PB 5HD5A 3B33A 3UB6A 3NOTC 2Z6CA 3IBRA 5HDCA 5F69A 1EW0A 4LRYC 5IU1A
chains in the Genus database with same CATH superfamily
4X69A 1X0OA 1K4FA 1BULA 1BUEA 5FDHA 1PZPA 3UN7A 4DE1A 4FUWA 2HF6A 4IBXA 4OKPA 3FKWA 5DVAA 4UA6A 5FAOA 2HJEA 5EE8A 3EEAA 1TDLA 4Q0JA 1IYQA 4R3JA 1YLZA 2R9WA 4H8RA 5M18A 1K54C 3Q81A 3H82B 4OVDA 3A3JA 2ZMFA 2JC7A 3ULFA 4E6WA 5CERA 3PBSA 2L4RA 1PW1A 1K56D 3A0RA 4FTXA 2G2WA 1YLYA 2HV1A 3MZDA 5L2FA 5CEDA 4HP4A 1NWZA 2CMNA 4IUKA 2EA9A 2XH9A 2XEPA 5F5YA 5HX9A 3T1QB 3VE3A 1STZA 4HJ4A 2ZOIA 4XT2A 3N8LA 4B9OA 2HZ5A 2OLVA 1HLUP 1GSWA 3C4PA 4OP5A 5GLAA 3LR4A 4BBTA 1E25A 4MN6A 2WZXA 3ZGAB 2W0NA 2GDNA 4R3BA 4S2MA 1JWVA 3IHBA 3W4PA 2EX8A 3FG8A 2B18A 2XSSA 1IOUA 3LIAA 5L07A 2JCHA 1TD5A 3LUQA 1W8YA 2Y2NA 4OPZA 2LB5A 4YWZA 1CJFA 4BBVA 2H0YA 3N8RA 1BLSA 1WA9A 3IH9A 3QP1A 3QHYA 3UE1A 2JN7A 5L10A 4I3AA 1F2KA 2JE5A 5HSQA 5FDSA 2VGLM 1K57C 3GRJA 1YSQA 1P9WA 1MY8A 4CJNA 3IXDA 3EOIA 5FQ9A 4BMWA 3MQ0A 5AVFA 4X6TA 1IKIA 4HIAA 3Q7ZA 5JYPA 1W63M 5CGXA 3T4OA 4BL2A 1LT0A 2EFXA 3PBQA 3NY4A 3T1RA 3OZHA 3ZVTA 2CC1A 2Z2LB 5EM1A 1DJBA 3CG5A 3VMAA 5E2EA 3LI8A 4PM7A 3LIBA 4NXGA 4JKTA 2OWHA 3T4TA 2HDUA 1TS0A 4IVKA 3VP2A 3IX3A 1EROA 3G6OA 1IFQA 2FZ0A 3DWKA 3WS4A 4PAUA 4G3VA 4OQGA 3C2WA 3ZG9B 2ZL1A 3WS5A 4U0TA 1JNUA 1PFLA 5HFOA 4DE3A 3WRZA 1T19A 4HNBA 1L0FA 5CXWA 3SW1A 3T1SA 1D06A 4QB8A 1YAXA 1DP9A 2ZOHA 4HH2A 4MNRA 4LRXC 4GHIA 1DP8A 5IHVA 2O9AA 4OOMA 4KG6A 4LV0A 3C5AA 1IEMA 4OOYA 1D1JA 3LYXA 4LFUA 5A90A 3OPPA 3G31A 3NCKA 2M7VA 4L9GA 4I39A 3H9WA 2GJ3A 4XT2B 1OMEA 4Y5FA 1YMXA 4Q8IA 3RXXA 1MKMA 4PKYG 3L7HA 4KENB 4RX3A 5E2GA 2O99A 3C30A 4ID4A 2O0YA 2Y2GA 4EUVA 3TG9A 2JKTM 1CEFA 2ZMVA 3VE4A 1IYSA 3T4LA 3VSKA 4Q0IA 3CPTA 1JVJA 5CRFA 3UO9A 3T4QA 1FCMA 2OOLA 1UGUA 2QJ7A 3TOIA 4NETA 3IWQA 1LSVA 1YLTA 3S4XA 5HWVA 2XFTA 3A3EA 1K55C 2H5SA 3UY6A 4BLMA 4OPRA 3PBNA 1YKDA 1MWUA 3IH8A 4WBGA 2JKTI 1ZTUA 4QY6A 3NJAA 3ZG8B 1Q2PA 3BFCA 5DJUA 2UV0E 4WMCA 3TW8A 4OQHA 4LPZA 4FH4A 3BECA 4EV4A 4OPQA 5EVIA 5EVLA 3O86A 5GHXA 4G3KA 3IX4A 4NEED 1E3UA 2QPNA 3NOUC 5DKLA 4KQQA 1TS7A 4MMNA 2I72A 3E2KA 3AGFA 1OPXA 1J9MA 1RCJA 4MDZA 3P01A 2ZL1B 1ES4A 3TSGA 3ZG0A 5EFWA 1H8YA 1P97A 3UDXA 3N7WA 1SZVA 1T18A 2X02A 1CQAA 4L9FA 1YSPA 4YNRA 3OCNA 3FPVA 1H5XA 4YFMA 4GHIB 2ZD8A 3D4FA 4EW7A 4DKIA 3OPHA 2WKQA 1YLWA 2Y2HA 3OCLA 5HL1A 2ZQCA 3LO7A 2XF3A 5F6AA 3WS2A 3VSLA 3LIDA 3VP1A 1PWGA 5TJJA 1L0EA 2WKIA 1PYYA 3BY8A 2O9CA 4I5SA 4ZDXA 2ZM8A 1W8QA 5HW3A 3E0YA 2WUQA 2VZWA 5HWWA 4P6BA 4B88A 4KUKA 3SS5A 4DE0A 3N4IA 5TGFA 1GSVA 3VOYA 4QD4A 1T1CA 4K08A 1DJAA 4EU0A 5CTNA 1N4OA 3LIFA 4WEJA 2MJ6A 4BD0A 2ZC7A 2J3WA 3FZCA 4F94A 1ZHHB 5DFXA 1BSGA 3C7UA 3UB6A 1AWIA 3IBRA 5F69A 1I5QA 5EPHA 3CPTB 5FEGA 4LRYC 3BQAA 2HDQA 5A93A 4ETXA 4QHCA 4HY8A 1ZG6A 3A3IA 2WYXA 4N1XA 5L09A 1KGFA 1W79A 3VV4A 3BLMA 3IS2A 5BOHA 4FD8A 2E8JA 3IBJA 4E3JA 2OWJA 4UA9A 4NXEA 4HOIA 3AGDA 4MN7A 3LEQA 3BQ8A 1GA9A 1GHIA 3BFGA 3KYEA 2Y2KA 5DFYA 2P9VA 1XP4A 4N1HA 3GMWA 4LV3A 4JF5A 1OTIA 2J3TC 2PRFA 3EQUA 4KZ6A 2OAQ1 5EVIB 3NDEA 2B02A 5F1GA 4CQHA 3UPPA 1A0KA 1LL8A 1L0DA 1PNEA 4EBPA 1WYCA 3MXQA 3G2ZA 2J80A 4WF0A 3B47A 5EV0A 1RP5A 1TF1A 1ERQA 5C5KA 4M4XA 2QKPA 4Y0TA 1Z09A 3T12B 5EECA 3SOIA 5L8MA 4NXBA 1H8ZA 3NDGA 3BFFA 1CI8A 3W4OA 3E4QA 3MXSA 3TE8A 3Q82A 1MKIA 3BRMA 2VJWA 3IF6A 3JYIA 4I3IA 5J7EA 2G2UA 4WM9A 2VGJA 4S2NA 4BL3A 3S22A 2X01A 3BLSA 1JWZA 1ZG4A 3UE0A 4JF4A 5FSRA 2ZQ7A 3G4PA 3FKVA 3R7WA 3UDIA 1TVFA 4EESA 3LGOA 5A8BA 4MN5A 1S6RA 1EWZA 1KGGA 1ZKJA 3LI9A 4BWIA 2DRWA 3F1OA 1QMEA 4M3KA 4CLCE 2V8CA 2PD8A 1XA1A 4D60A 1ACFA 2Y2MA 4R0QA 4LENA 1ES5A 4FOFA 4QWOA 1UWNX 2B95A 1NRFA 1XXMA 3V3RA 1W63Q 4LCMA 5FEFA 3E4PA 4HESA 1XJ6A 3QP2A 2BASA 4DRTA 5GHYA 4WELA 2VV8A 1K6RA 2PD7A 3MZFA 4KZBA 3DAVA 3IS2B 1FOFA 5TR7A 1DY6A 4JXGA 4HEFA 2P08A 3O5YA 3JVUA 4N92A 3IT9A 3Q7VA 5GLDA 2P9VB 3U2AA 5EVIC 2V9AA 5JYOA 4PKYA 1XJ4A 4OPYA 3P98A 5CGWA 3UB5P 2HJ9C 1NRJA 2XA7S 2XROA 2W27A 3OC2A 3VOLA 5FASA 4UQIM 3PBTA 4DDSA 2HGVA 1M40A 2KLIA 4WZ4A 5FATA 4ARZB 4GB7A 3UB9A 1H3QA 3CWFA 4ETZA 2PHYA 5E2FA 4JBFA 1ES2A 5FI7A 2VV7A 1HD8A 1CEGA 1TEMA 1MXOA 2J7VA 1CK3A 3DBAA 3Q07A 4CLCA 4EETB 4AFIA 2ZC4B 2FH5A 2JKRM 2Y2LA 3AGEA 3RFBA 3F1PA 4GNUA 1OTDA 4LV2A 3OLOA 4KG2A 2XRNA 1BT5A 1SDEA 4RVAA 3LR5A 5FQMA 1S1YA 2OV5A 1L2SA 1XJ3A 3V67A 1H8MA 5TBMA 3W2ZA 1G28A 3SS3A 3QP4A 3V3SA 2PU2A 3NECA 3UDFA 3VP3A 1BLHA 4E04A 4E3MA 4Y3IA 5HPIA 2L0WA 3C8CA 5CHUA 3LR3A 5HDDA 4Y7PA 2PYPA 5CX7A 5HD3A 4P85A 4BQMA 2V1BA 3F1OB 2P7JA 1IKGA 4GCZA 5DTTA 4OH0A 1PW8A 3N6IA 2LB9A 2JKRI 2Q9MA 1VETA 4I3JA 1ODVA 2NUTC 2Y2QA 1ONGA 2HP6A 3UB8A 2WGWA 1NZOA 3E2LA 3MR0A 4X1LA 2EX9A 5AQAA 3BM6A 2BTFP 2EFUA 1G6AA 4IUHA 4FH2A 2FFFB 1KVMA 2PBDP 4EBLA 5DKKA 3ZCZA 2W1RA 3WRTA 1S1ZA 3G2YA 3T4KA 2EX2A 4R4SA 1YQSA 3UNWA 4GS9A 1ERMA 3KO6A 1FSYA 2A49A 1FIKA 3IXGA 3UE6A 1OTBA 1IYOA 3Q7VB 4FCFA 2J3TD 1F5MA 3PR6A 3GQZA 1KE3A 3KX0X 4R1GA 4GW9A 4HBTA 4LCLA 1KOUA 1MWTA 3LR0A 5EVEA 3MFXA 4KQDA 5GLBA 4GLQA 5EOEA 3H7WA 1UWPX 4RYEA 2Y55A 4IVIA 4YOFA 4OONA 3D72A 4R3AA 1JTGA 2BG1A 4NK3A 4PM9A 5FQIA 4KZ3A 5J3WA 3BWLA 3K2NA 1Y4OA 4MEZA 2QYBA 3JVVA 2J8YA 3ZFZA 4WZ5A 3V50A 5HAPA 3DW0A 3GSGA 4EBNA 4CLCB 3SH7A 2WKHA 1OJGA 1XX2A 3S1YA 4E3NA 4UAAA 1NJ4A 5GHZA 3ITBA 3O3VA 1NLZA 4R70A 4Z1WA 3F1PB 3FPWA 3KSFA 5FI2A 5HDCA 2C5WB 4K0WA 2ZJ9A 1EW0A 4O7DA 2Y2PA 4BJPA 1PI5A 4ZAMA 1WE4A 3S7QA 4R4RA 4C75A 5EUAA 2JHEA 1O7EA 5TBMB 1FCOA 1F9IA 3ISGA 4GDBA 1LSWA 4E6XA 2VKSA 5FQQA 4WL9A 4Y2FA 1LSXA 1BLPA 4X56A 2VGLS 1NYYA 4KQRA 4U3TA 5DTSA 1KDSA 3K3CA 4IEDA 4OLGA 1OJ5A 2AVXA 3BW6A 4MLLA 4GJ4A 4WUJA 1BLCA 3O87A 5FA7A 3W4QA 3S7PA 2WGWB 1YT4A 3LFVA 4DXCA 2W3FA 3C4OA 4HBUA 2PR6A 2YKHA 1LL9A 4KZAA 4Q0HA 4BENA 3RTYA 3MFDA 4JXWA 1MZUA 2Y59A 2YKFA 2EWVA 1AXBA 5KMWA 3A3DA 2P74A 4R6LA 3HLWA 4GS9B 3NHQA 2Z2MB 2EXBA 3MKFA 3HUOA 4O0PA 4UA7A 1Y28A 3LIEA 1E3UD 4UHUA 4KZ9A 4N9KA 4JGPA 4GOGA 2WAFA 4S2KA 1OTEA 1LI9A 4GKUA 4S2OA 1HTZA 2WK0A 4HJ3A 1L3LA 1MPLA 1PRQA 3GVBA 3HCYA 4Y17A 3NBLA 4ZRRA 1BZAA 4DN0A 1C3BA 5F82A 3T4SA 2PBYA 2Y2IA 3BEBA 3UPNA 4CLCC 1O07A 2Y2JA 4R23A 5HAIA 2ZC6B 4NXFA 1XFNA 1KGEA 1NZUA 2V1AA 4ZBEA 2KDKA 3PBOA 1LHYA 5CGSA 4ME4A 3PHYA 5DF9A 3IF5A 4E3LA 2UWXA 3R4KA 1W5DA 2DNSA 4X1MA 3KYQA 4JXSA 3HLGA 1LLBA 5AJGA 3QP5A 1XKZA 2PR5A 5F1FA 4G3WA 1YM1A 2HDSA 2I9VA 2PYRA 1WYBA 4MBKA 3M2KA 2QMIA 4WYYA 1T1BA 2V0WA 4K0XA 4GD8A 1F98A 3DTIA 4K91A 4DJ3A 5HARA 4BBUA 1TDGA 2D02A 5FAQA 3RJUA 3GDIA 4OLDA 2ZC5B 5F83A 5IT5A 1N9BA 2IA2A 2W3EA 2M1CA 3ICYA 2X71A 3UB7A 4MBHA 3KSIA 2WZZA 4IBRA 4GD6A 1D7EA 2C6WB 1P0ZA 4QY5A 1CF0A 2ACGA 4YINA 4P6ZS 5M1AA 3SS4A 5A91A 1GCEA 3OBFA 5G4YA 3UMEA 4KZ8A 3PAEA 1XJ2A 1SKOA 1S67L 1W7FA 3IXBA 1Q2QA 3M6HA 3HUMA 1LI0A 4NG2A 1V9YA 2JBFA 1GSXA 3QNCA 2Q0OA 3V39A 1OT6A 4GDNA 2DMWA 3ZYTA 5DF7A 4PHTA 3OPRA 3IWOA 1VEUA 1PZOA 3G34A 3HUNA 1KE0A 1ESUA 2V1ZA 2VEAA 1SKFA 2V2FF 1XA7A 2VLGA 4RA7A 1OT9A 3MQOA 1FSWA 3BJNA 1EI5A 1TS8A 3UE3A 2XD5A 5FQKA 2WADA 3PTEA 1K56A 5D3OA 4WZ5C 5K5BA 2W3DA 3CITA 4WN5A 4GZBA 4LV1A 5AVEA 1RGYA 3HJKA 3ZG5A 3CUEA 4N9LA 3HREA 4ZJ3A 4OQIA 3BFEA 4ESPA 4KG5A 3GTCA 1GHMA 1G5UA 4ZJ2A 2XK1A 4DMZA 3ZDJA 1K6SA 4EWFA 2HDRA 3IHAA 3CMZA 2GZAA 5KIZA 1VQQA 2E8IA 3A0VA 3CLOA 3PYPA 3EQVA 3MKEA 4S2IA 1KE4A 4DXBA 3O88A 4MBFA 5F68A 3NOPC 1DP6A 5E43A 1G6OA 3TJZC 1IYPA 5FQJA 2PDRA 1QMFA 4Y15A 2V8FA 4EXOA 1DRMA 1FR1A 4C3QA 1KVLA 3A3FA 3NULA 2PAVP 3GECA 2V0UA 1FR6A 5E2HA 4Y0UA 3CJMA 1IELA 1SDNA 2Y8HA 5AQ9A 3IX8A 5FI6A 3W8KA 3T50A 2Z6DA 3LY3A 2Y4AA 3IXHA 1XGJA 1SKOB 2D01A 3VP0A 4IHQA 2WGVA 3D9YA 4LGWA 2H0TA 3ZNTA 1JWPA 2ZQAA 3ZNYA 4KUOA 1Z6FA 2A2LA 2QZ6A 4EERA 4HJ6A 4MCWA 3Q1FA 4LLOB 5I94A 3IF6B 3LCEA 1MWRA 2DCFA 2WKRA 4EQIA 1K0KA 2R9XA 3MZEA 1VEUB 1V9ZA 1H0MA 5U47A 2K7SA 4RX2A 2VK3A 2QHKA 4JGOA 4E3OA 3D3OA 1U60A 2V20A 3C38A 2K31A 3M6BA 3OOVA 4S2JA 2Z6CA 3R7WB 3DTEA 1GHPA 4XXRA 2K2NA 2VA0A 3QP8A 4S2LA 2OLUA 2W3GA 2M7UA 4S2PA 4CLCD 1BYWA 2VV6A 4HQAA 4HI4A 4R38A 3QP6A 1S0WA 3EEHA 3HJIA 1PWCA 4PM5A 4PMAA 5CEBA 2WGIA 4LRZE 4X55A 2XR0A 4GN2A 3MBZA 5CECA 5AQBA 3E98A 2BLSA 1CI9A 2OSUA 4A5RA 3VFFA 4EEUA 2L1MA 4PM8A 3HBRA 3VP4A 4B4XA 4JLFA 1G68A 1Y54A 3MXRA 4JF6A 1L0GA 4QJGA 1MWSA 1FCNA 3VFHA 1ZC2A 2ZC3B 4HH3A 3S7OA 5HWTA 1MC0A 4WLAA 4E3KA 1GA0A 3P09A 4NKPA 1T1AA 4DE2A 2XFSA 3P7NA 3F1NA 4E3IA 2P04A 4XUZA 1NY0A 4X68A 4KZ7A 3FWLA 3RH8B 5AQ7A 2INWA 3FV7A 3DTKA 2HP5A 2WKEA 3NIAA 3JPUA 4JXVA 4PM6A 5TFQA 1VM1A 5HZHA 1DJCA 5GLCA 5FAPA 3IF6C 3MSHA 4UQIS 3E4OA 4U0XA 4DJ2A 2J9PA 4S2NC 3WS0A 4Z9QA 1YLJA 3B3XA 3HLFA 1S4RA 5HPFA 4DDYA 2EXAA 1VB6A 4II7A 4EEPA 2HP9A 3N8SA 1BTLA 1I2SA 2ZQDA 4OP8A 1K54A 3G32A 3CZDA 3IWIA 1MBLA 2ZQ8A 4JPMA 2EX6A 1K4EA 4I38A 3CI6A 3KSHA 2R78A 3DWZA 3RXWA 4KZ5A 3CAXA 3S7NA 3SH8A 5FL3A 4B93A 2Q9NA 1YPRA 1VETB 3CUEC 3QNBA 2WKPA 4P6ZM 2Y91A 2ZM0A 3FYZA 2A3UA 1XGIA 1I2WA 2QWSA 4EUZA 2H10A 3WS1A 3MQQA 3ZHHA 2Y79A 4QU3A 2W1TA 1LL5A 3HVFA 4KZ4A 3BFDA 4H6JA 1NYMA 1M6KA 5M19A 3V5MA 3VOZA 1ES3A 2ZM2A 4L0LA 2PT7A 2IWDA 3MJQA 4WMCD 5I5LA 3SZTA 1OTAA 5DJTA 4CPKA 4HHDA 4F3LA 3M2JA 3GV9A 3IQAA 5J4EA 1K25A 5EVID 1HVBA 5CHJA 2A24A 1FILA 4B4ZA 5DF8A 3TRCA 3KYZA 1K38A 2IWCA 1J3WA 2PU4A 4HP9A 3F1NB 5J8XA 1K57A 3H7WB 3BYDA 5CTMA 3K3DA 3MMHA 5A92A 1ALQA 1XFQA 3HLBA 5GL9A 2EWWA 3PBRA 2G7UA 1SHVA 1E4DA 4UEYA 2XDMA 3MF0A 3B42A 3EGXC 3PXPA 5G18A 3ZQ5A 2QJ5A 4Y13A 2JKGA 4C6YA 2XQZA 3G30A 1PI4A 3C7VA 4BD1A 2GX5A 5EOOA 3LY4A 1NLYA 5IS1A 2GNXA 1XPBA 2WAEA 5HL6A 3DTMA 4EQ1A 3NC8A 3UPOA 1JTDA 2KX6A 5DTKA 3H82A 1HZOA 3OPLA 3NI9A 3U4LP 5KZHA 3ZG7B 2RL3A 3HLCA 3HLDA 5KSCA 5EM0A 2Y2OA 5HAQA 1ESIA 3A0SA 4ZTKA 4FSFA 1KDWA 2XA7M 5HDSA 1N9LA 3BY9A 2JKFA 4O8GA 3EGDC 1PWDA 1NXYA 2ZMAA 4QPRA 4P0MA 4WEKA 3T4JA 1N9NA 1SCWA 5KSHA 3I7JA 4RQ9A 4O01A 2H28A 4X25A 2ZLYA 4XUXA 5LBRA 3PAGA 2W1TB 3ITAA 2XGNA 1S4SA 3HL9A 4PPRA 2RCXA 2IWBA 4H6JB 3CHWP 4DF6A 2XLNA 4ARZA 2VGKA 3MS6A 3WWXA 4Y0OA 1TS6A 3GR2A 1N9OA 4F3LB 3SH9A 3UMDA 1YLPA 1S66L 2A24B 4D2OA 2FFYA 4JGRA 3ZVWA 2ZBBA 3FC7A 3LEZA 5MC7A 4KQOA 3KSGA 2W3HA 2B5RA 4JGQA 2J9OA 4IJGA 2NUPC 2O9BA 2OAP1 1P9RA 3LICA 5CHMA 4L9EA 1ONHA 2XD1A 3EWKA 1YMSA 5G4ZA 2HPBA 2ZQ9A 4OOLA 1FQGA 2KOIA 1PIOA 2VX8A 1K55A 4OQ0A 5HD5A 3B33A 3NOTC 3T1XA 3G35A 4P87A 4ZJ1A 1RGZA 1VHMA 3HLEA 5IU1A 4X53A 3L9KA
chains in the Genus database with same CATH topology
3BQAA 1X0OA 3S7QA 2JHEA 2W3GA 2M7UA 4ETXA 5TBMB 4HY8A 4CLCD 1F9IA 1BYWA 1LSWA 2VV6A 2VKSA 4WL9A 4HQAA 4HI4A 4R38A 2HF6A 4Y2FA 1LSXA 3EEHA 2HJEA 3VV4A 3EEAA 2VGLS 4Q0JA 3HJIA 3K3CA 1OJ5A 3BW6A 3IS2A 4GJ4A 3IBJA 4LRZE 2OWJA 4WUJA 4NXEA 4HOIA 3H82B 3E98A 4MN7A 2ZMFA 3BQ8A 3ULFA 3PBSA 2L4RA 5DFYA 3S7PA 3A0RA 4EEUA 2L1MA 3LFVA 1OTIA 2J3TC 2W3FA 3EQUA 2PR6A 2OAQ1 2YKHA 2HV1A 4Q0HA 2B02A 4CQHA 3RTYA 1LL8A 4HP4A 1NWZA 2CMNA 4IUKA 2EA9A 3MXQA 5F5YA 4HH3A 1MZUA 3S7OA 3VE3A 2J80A 2YKFA 1STZA 2EWVA 3B47A 4WF0A 4HJ4A 5HWTA 2ZOIA 1TF1A 4R6LA 4XT2A 4B9OA 1MC0A 5C5KA 4M4XA 2QKPA 4WLAA 1GSWA 4GS9B 3LR4A 3NHQA 4NKPA 4BBTA 4MN6A 1T1AA 3P7NA 2W0NA 3F1NA 5L8MA 3FG8A 2P04A 2B18A 4NXBA 4O0PA 2XSSA 1Y28A 3LIEA 1IOUA 3LIAA 3RH8B 4JGPA 2INWA 3E4QA 1TD5A 3TE8A 2VJWA 1OTEA 3LUQA 4I3IA 2LB5A 4YWZA 5J7EA 4HJ3A 5HZHA 3HCYA 4BBVA 4ZRRA 4DN0A 1WA9A 3T4SA 4UQIS 3E4OA 2JN7A 4I3AA 4DJ2A 5HSQA 2VGLM 4CLCC 3R7WA 1YSQA 1P9WA 1S4RA 4EESA 4NXFA 1XFNA 5HPFA 3EOIA 2V1AA 5A8BA 4MN5A 4BMWA 1VB6A 3LI9A 3MQ0A 2KDKA 4II7A 5AVFA 4BWIA 3F1OA 4EEPA 3PBOA 4CLCE 4HIAA 2PD8A 4ME4A 3PHYA 5DF9A 1W63M 3R4KA 3T4OA 4FOFA 1UWNX 1LT0A 3KYQA 3PBQA 4I38A 5AJGA 3CI6A 1W63Q 3E4PA 3KSHA 3LI8A 2R78A 2PR5A 1XJ6A 4G3WA 3LIBA 2BASA 2I9VA 2PYRA 3CAXA 4NXGA 3S7NA 5FL3A 4B93A 2OWHA 3T4TA 1T1BA 2VV8A 4WELA 1TS0A 2V0WA 1F98A 2PD7A 3CUEC 2WKPA 4P6ZM 3G6OA 1IFQA 2FZ0A 4DJ3A 4PAUA 4G3VA 2QWSA 4BBUA 3C2WA 2D02A 3IS2B 3GDIA 3MQQA 5IT5A 2Y79A 2W1TA 1JNUA 2IA2A 1T19A 2P08A 3O5YA 4HNBA 2W3EA 2M1CA 3JVUA 3ICYA 3UB7A 3SW1A 4H6JA 1D06A 3KSIA 1YAXA 3U2AA 1DP9A 2ZOHA 1D7EA 4HH2A 1P0ZA 2V9AA 4LRXC 4L0LA 2PT7A 1DP8A 4GHIA 4PKYA 2O9AA 4OOMA 4P6ZS 1XJ4A 3MJQA 5G4YA 3OBFA 5I5LA 1OTAA 5DJTA 3UMEA 4HHDA 3LYXA 4F3LA 1XJ2A 1S67L 2HJ9C 5J4EA 1NRJA 2M7VA 2XA7S 2XROA 2W27A 3OC2A 3VOLA 4UQIM 3PBTA 2A24A 2HGVA 2KLIA 1V9YA 4ARZB 4L9GA 4I39A 3H9WA 2GJ3A 1GSXA 4XT2B 3UB9A 4Y5FA 1H3QA 1OT6A 3CWFA 2PHYA 4ETZA 1MKMA 4PKYG 2VV7A 3TRCA 2DMWA 3KYZA 3ZYTA 4PHTA 2O99A 3C30A 4HP9A 3DBAA 3F1NB 4CLCA 4EETB 3H7WB 4AFIA 2O0YA 2VEAA 4EUVA 3K3DA 2VLGA 2FH5A 1OT9A 2JKRM 3MQOA 3MMHA 2JKTM 3RFBA 3F1PA 1OTDA 2ZMVA 3BJNA 3OLOA 1TS8A 3UE3A 3VE4A 1XFQA 3T4LA 2EWWA 3PBRA 2G7UA 2XRNA 4Q0IA 4UEYA 3MF0A 3B42A 3EGXC 3PXPA 3LR5A 1S1YA 3ZQ5A 2QJ5A 1XJ3A 3V67A 3T4QA 1H8MA 2OOLA 5TBMA 3W2ZA 1UGUA 2QJ7A 1G28A 1LSVA 2GX5A 5K5BA 2W3DA 3CITA 4WN5A 1NLYA 5IS1A 4E04A 5HWVA 4Y3IA 5HPIA 2L0WA 5AVEA 3C8CA 2GNXA 3LR3A 5HDDA 5HL6A 2PYPA 3HJKA 4EQ1A 5CX7A 5HD3A 3CUEA 2KX6A 2V1BA 3F1OB 2P7JA 3H82A 3PBNA 4GCZA 1YKDA 2LB9A 2JKRI 2JKTI 1ZTUA 4I3JA 1ODVA 3NJAA 2NUTC 5DJUA 4DMZA 3UB8A 3TW8A 4LPZA 3MR0A 2GZAA 5KIZA 3A0SA 4FSFA 2XA7M 5HDSA 4G3KA 1N9LA 3BY9A 3A0VA 3CLOA 4NEED 3PYPA 3EQVA 3EGDC 4O8GA 4IUHA 3NOUC 5DKLA 4QPRA 1TS7A 4MMNA 4WEKA 3T4JA 1N9NA 5DKKA 5KSHA 2W1RA 1OPXA 4RQ9A 4O01A 5F68A 1S1ZA 2H28A 3NOPC 3T4KA 1DP6A 4MDZA 3P01A 5LBRA 1G6OA 3TJZC 2W1TB 4GS9A 2PDRA 1S4SA 5EFWA 1P97A 4EXOA 1DRMA 3KO6A 3UE6A 4H6JB 1OTBA 1T18A 3GECA 2V0UA 4L9FA 2J3TD 1YSPA 4YNRA 3OCNA 1F5MA 3PR6A 3FPVA 2Y8HA 4ARZA 3KX0X 4GHIB 3T50A 2Z6DA 1TS6A 4GW9A 1N9OA 1KOUA 4EW7A 4F3LB 3LR0A 3MFXA 2D01A 4KQDA 4IHQA 2WKQA 4GLQA 3H7WA 3OCLA 3UMDA 1UWPX 5F6AA 4KUOA 4YOFA 1S66L 2A2LA 2A24B 4JGRA 3LIDA 2ZBBA 3FC7A 3D72A 4R3AA 5TJJA 4HJ6A 4EERA 5MC7A 4MCWA 3BY8A 2O9CA 4I5SA 4KQOA 5J3WA 3KSGA 2W3HA 3BWLA 3K2NA 4LLOB 3E0YA 2QYBA 2VZWA 3JVVA 4JGQA 5HWWA 4IJGA 2WKRA 4KUKA 2NUPC 2O9BA 2OAP1 1V9ZA 1GSVA 2K7SA 4CLCB 1P9RA 3LICA 4L9EA 1T1CA 2QHKA 4K08A 4EU0A 1OJGA 4JGOA 3EWKA 5G4ZA 3LIFA 4OOLA 4WEJA 2MJ6A 2KOIA 2VX8A 2J3WA 3D3OA 3C38A 1NLZA 4R70A 4Z1WA 2K31A 1ZHHB 3F1PB 5HD5A 3B33A 5DFXA 3FPWA 3OOVA 3KSFA 3UB6A 3NOTC 2Z6CA 3R7WB 3IBRA 5HDCA 5F69A 1EW0A 2K2NA 1VHMA 4BJPA 2VA0A 4LRYC 5IU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0O A;  2JHE A;  5TBM B;  4HY8 A;  1F9I A;  1BYW A;  1LSW A;  2VV6 A;  4WL9 A;  4HQA A;  4HI4 A;  4R38 A;  1LSX A;  3EEH A;  3HJI A;  3K3C A;  1OJ5 A;  3IS2 A;  4LRZ E;  2OWJ A;  4WUJ A;  4NXE A;  4HOI A;  3H82 B;  3ULF A;  2L4R A;  3A0R A;  4EEU A;  2L1M A;  1OTI A;  2PR6 A;  2YKH A;  2HV1 A;  2B02 A;  3RTY A;  1LL8 A;  4HP4 A;  1NWZ A;  2CMN A;  2EA9 A;  3MXQ A;  5F5Y A;  4HH3 A;  1MZU A;  3VE3 A;  2J80 A;  2YKF A;  4WF0 A;  4HJ4 A;  5HWT A;  2ZOI A;  4R6L A;  4XT2 A;  4B9O A;  4M4X A;  2QKP A;  4WLA A;  1GSW A;  4GS9 B;  3NHQ A;  4BBT A;  4MN6 A;  1T1A A;  3P7N A;  2W0N A;  3F1N A;  3FG8 A;  4NXB A;  1Y28 A;  3LIE A;  3LIA A;  3RH8 B;  4JGP A;  2INW A;  3E4Q A;  1OTE A;  3LUQ A;  4I3I A;  4YWZ A;  5J7E A;  4HJ3 A;  5HZH A;  4BBV A;  1WA9 A;  3E4O A;  2JN7 A;  4I3A A;  4DJ2 A;  5HSQ A;  1S4R A;  4EES A;  4NXF A;  1XFN A;  2V1A A;  5A8B A;  4MN5 A;  1VB6 A;  3LI9 A;  5AVF A;  2KDK A;  4EEP A;  3F1O A;  4HIA A;  2PD8 A;  3PHY A;  1UWN X;  1LT0 A;  4I38 A;  3E4P A;  3LI8 A;  2R78 A;  2PR5 A;  1XJ6 A;  3LIB A;  2BAS A;  2I9V A;  2PYR A;  3CAX A;  4NXG A;  2OWH A;  1T1B A;  2VV8 A;  1TS0 A;  2V0W A;  1F98 A;  2PD7 A;  2WKP A;  3G6O A;  4DJ3 A;  2QWS A;  4BBU A;  3C2W A;  2D02 A;  3IS2 B;  3GDI A;  3MQQ A;  1JNU A;  1T19 A;  4HNB A;  2M1C A;  3ICY A;  3UB7 A;  3SW1 A;  4H6J A;  1D06 A;  1DP9 A;  2ZOH A;  1D7E A;  4HH2 A;  1P0Z A;  2V9A A;  4LRX C;  4GHI A;  1DP8 A;  4PKY A;  1XJ4 A;  3MJQ A;  5G4Y A;  5I5L A;  1OTA A;  5DJT A;  3UME A;  4HHD A;  3LYX A;  4F3L A;  1XJ2 A;  1S67 L;  5J4E A;  2W27 A;  3VOL A;  2A24 A;  1V9Y A;  4L9G A;  4I39 A;  3H9W A;  2GJ3 A;  1GSX A;  4XT2 B;  3UB9 A;  1OT6 A;  3CWF A;  2PHY A;  4PKY G;  2VV7 A;  4HP9 A;  3F1N B;  4EET B;  3H7W B;  2VEA A;  3K3D A;  2VLG A;  1OT9 A;  3MQO A;  3F1P A;  1OTD A;  3OLO A;  1TS8 A;  3VE4 A;  1XFQ A;  1S1Y A;  3ZQ5 A;  2QJ5 A;  1XJ3 A;  2OOL A;  5TBM A;  1UGU A;  2QJ7 A;  1G28 A;  1LSV A;  4WN5 A;  5IS1 A;  4E04 A;  5HWV A;  2L0W A;  5AVE A;  3C8C A;  5HDD A;  2PYP A;  3HJK A;  4EQ1 A;  5HD3 A;  2KX6 A;  2V1B A;  3F1O B;  2P7J A;  3H82 A;  4GCZ A;  4I3J A;  1ODV A;  3NJA A;  5DJU A;  3UB8 A;  4LPZ A;  3MR0 A;  5KIZ A;  3A0S A;  5HDS A;  1N9L A;  3BY9 A;  3A0V A;  3CLO A;  3PYP A;  3NOU C;  5DKL A;  1TS7 A;  1N9N A;  5DKK A;  4RQ9 A;  5F68 A;  1S1Z A;  2H28 A;  3NOP C;  1DP6 A;  4GS9 A;  2PDR A;  1S4S A;  5EFW A;  1P97 A;  4EXO A;  1DRM A;  3UE6 A;  4H6J B;  1OTB A;  1T18 A;  3GEC A;  2V0U A;  4L9F A;  3KX0 X;  4GHI B;  3T50 A;  2Z6D A;  1TS6 A;  4GW9 A;  1N9O A;  1KOU A;  4EW7 A;  4F3L B;  3MFX A;  2D01 A;  4KQD A;  2WKQ A;  3H7W A;  3UMD A;  1UWP X;  5F6A A;  4KUO A;  1S66 L;  2A24 B;  4JGR A;  3LID A;  2ZBB A;  3FC7 A;  3D72 A;  4R3A A;  4EER A;  4HJ6 A;  3BY8 A;  4I5S A;  5J3W A;  3BWL A;  4LLO B;  4JGQ A;  5HWW A;  2WKR A;  4KUK A;  1V9Z A;  1GSV A;  2K7S A;  3LIC A;  4L9E A;  1T1C A;  4K08 A;  2QHK A;  1OJG A;  4JGO A;  3EWK A;  5G4Z A;  3LIF A;  4R70 A;  3F1P B;  5HD5 A;  3B33 A;  3UB6 A;  3NOT C;  2Z6C A;  3IBR A;  5HDC A;  5F69 A;  1EW0 A;  4LRY C;  5IU1 A; 
#chains in the Genus database with same CATH topology
 4X69 A;  1X0O A;  1K4F A;  1BUL A;  1BUE A;  5FDH A;  1PZP A;  3UN7 A;  4DE1 A;  4FUW A;  2HF6 A;  4IBX A;  4OKP A;  3FKW A;  5DVA A;  4UA6 A;  5FAO A;  2HJE A;  5EE8 A;  3EEA A;  1TDL A;  4Q0J A;  1IYQ A;  4R3J A;  1YLZ A;  2R9W A;  4H8R A;  5M18 A;  1K54 C;  3Q81 A;  3H82 B;  4OVD A;  3A3J A;  2ZMF A;  2JC7 A;  3ULF A;  4E6W A;  5CER A;  3PBS A;  2L4R A;  1PW1 A;  1K56 D;  3A0R A;  4FTX A;  2G2W A;  1YLY A;  2HV1 A;  3MZD A;  5L2F A;  5CED A;  4HP4 A;  1NWZ A;  2CMN A;  4IUK A;  2EA9 A;  2XH9 A;  2XEP A;  5F5Y A;  5HX9 A;  3T1Q B;  3VE3 A;  1STZ A;  4HJ4 A;  2ZOI A;  4XT2 A;  3N8L A;  4B9O A;  2HZ5 A;  2OLV A;  1HLU P;  1GSW A;  3C4P A;  4OP5 A;  5GLA A;  3LR4 A;  4BBT A;  1E25 A;  4MN6 A;  2WZX A;  3ZGA B;  2W0N A;  2GDN A;  4R3B A;  4S2M A;  1JWV A;  3IHB A;  3W4P A;  2EX8 A;  3FG8 A;  2B18 A;  2XSS A;  1IOU A;  3LIA A;  5L07 A;  2JCH A;  1TD5 A;  3LUQ A;  1W8Y A;  2Y2N A;  4OPZ A;  2LB5 A;  4YWZ A;  1CJF A;  4BBV A;  2H0Y A;  3N8R A;  1BLS A;  1WA9 A;  3IH9 A;  3QP1 A;  3QHY A;  3UE1 A;  2JN7 A;  5L10 A;  4I3A A;  1F2K A;  2JE5 A;  5HSQ A;  5FDS A;  2VGL M;  1K57 C;  3GRJ A;  1YSQ A;  1P9W A;  1MY8 A;  4CJN A;  3IXD A;  3EOI A;  5FQ9 A;  4BMW A;  3MQ0 A;  5AVF A;  4X6T A;  1IKI A;  4HIA A;  3Q7Z A;  5JYP A;  1W63 M;  5CGX A;  3T4O A;  4BL2 A;  1LT0 A;  2EFX A;  3PBQ A;  3NY4 A;  3T1R A;  3OZH A;  3ZVT A;  2CC1 A;  2Z2L B;  5EM1 A;  1DJB A;  3CG5 A;  3VMA A;  5E2E A;  3LI8 A;  4PM7 A;  3LIB A;  4NXG A;  4JKT A;  2OWH A;  3T4T A;  2HDU A;  1TS0 A;  4IVK A;  3VP2 A;  3IX3 A;  1ERO A;  3G6O A;  1IFQ A;  2FZ0 A;  3DWK A;  3WS4 A;  4PAU A;  4G3V A;  4OQG A;  3C2W A;  3ZG9 B;  2ZL1 A;  3WS5 A;  4U0T A;  1JNU A;  1PFL A;  5HFO A;  4DE3 A;  3WRZ A;  1T19 A;  4HNB A;  1L0F A;  5CXW A;  3SW1 A;  3T1S A;  1D06 A;  4QB8 A;  1YAX A;  1DP9 A;  2ZOH A;  4HH2 A;  4MNR A;  4LRX C;  4GHI A;  1DP8 A;  5IHV A;  2O9A A;  4OOM A;  4KG6 A;  4LV0 A;  3C5A A;  1IEM A;  4OOY A;  1D1J A;  3LYX A;  4LFU A;  5A90 A;  3OPP A;  3G31 A;  3NCK A;  2M7V A;  4L9G A;  4I39 A;  3H9W A;  2GJ3 A;  4XT2 B;  1OME A;  4Y5F A;  1YMX A;  4Q8I A;  3RXX A;  1MKM A;  4PKY G;  3L7H A;  4KEN B;  4RX3 A;  5E2G A;  2O99 A;  3C30 A;  4ID4 A;  2O0Y A;  2Y2G A;  4EUV A;  3TG9 A;  2JKT M;  1CEF A;  2ZMV A;  3VE4 A;  1IYS A;  3T4L A;  3VSK A;  4Q0I A;  3CPT A;  1JVJ A;  5CRF A;  3UO9 A;  3T4Q A;  1FCM A;  2OOL A;  1UGU A;  2QJ7 A;  3TOI A;  4NET A;  3IWQ A;  1LSV A;  1YLT A;  3S4X A;  5HWV A;  2XFT A;  3A3E A;  1K55 C;  2H5S A;  3UY6 A;  4BLM A;  4OPR A;  3PBN A;  1YKD A;  1MWU A;  3IH8 A;  4WBG A;  2JKT I;  1ZTU A;  4QY6 A;  3NJA A;  3ZG8 B;  1Q2P A;  3BFC A;  5DJU A;  2UV0 E;  4WMC A;  3TW8 A;  4OQH A;  4LPZ A;  4FH4 A;  3BEC A;  4EV4 A;  4OPQ A;  5EVI A;  5EVL A;  3O86 A;  5GHX A;  4G3K A;  3IX4 A;  4NEE D;  1E3U A;  2QPN A;  3NOU C;  5DKL A;  4KQQ A;  1TS7 A;  4MMN A;  2I72 A;  3E2K A;  3AGF A;  1OPX A;  1J9M A;  1RCJ A;  4MDZ A;  3P01 A;  2ZL1 B;  1ES4 A;  3TSG A;  3ZG0 A;  5EFW A;  1H8Y A;  1P97 A;  3UDX A;  3N7W A;  1SZV A;  1T18 A;  2X02 A;  1CQA A;  4L9F A;  1YSP A;  4YNR A;  3OCN A;  3FPV A;  1H5X A;  4YFM A;  4GHI B;  2ZD8 A;  3D4F A;  4EW7 A;  4DKI A;  3OPH A;  2WKQ A;  1YLW A;  2Y2H A;  3OCL A;  5HL1 A;  2ZQC A;  3LO7 A;  2XF3 A;  5F6A A;  3WS2 A;  3VSL A;  3LID A;  3VP1 A;  1PWG A;  5TJJ A;  1L0E A;  2WKI A;  1PYY A;  3BY8 A;  2O9C A;  4I5S A;  4ZDX A;  2ZM8 A;  1W8Q A;  5HW3 A;  3E0Y A;  2WUQ A;  2VZW A;  5HWW A;  4P6B A;  4B88 A;  4KUK A;  3SS5 A;  4DE0 A;  3N4I A;  5TGF A;  1GSV A;  3VOY A;  4QD4 A;  1T1C A;  4K08 A;  1DJA A;  4EU0 A;  5CTN A;  1N4O A;  3LIF A;  4WEJ A;  2MJ6 A;  4BD0 A;  2ZC7 A;  2J3W A;  3FZC A;  4F94 A;  1ZHH B;  5DFX A;  1BSG A;  3C7U A;  3UB6 A;  1AWI A;  3IBR A;  5F69 A;  1I5Q A;  5EPH A;  3CPT B;  5FEG A;  4LRY C;  3BQA A;  2HDQ A;  5A93 A;  4ETX A;  4QHC A;  4HY8 A;  1ZG6 A;  3A3I A;  2WYX A;  4N1X A;  5L09 A;  1KGF A;  1W79 A;  3VV4 A;  3BLM A;  3IS2 A;  5BOH A;  4FD8 A;  2E8J A;  3IBJ A;  4E3J A;  2OWJ A;  4UA9 A;  4NXE A;  4HOI A;  3AGD A;  4MN7 A;  3LEQ A;  3BQ8 A;  1GA9 A;  1GHI A;  3BFG A;  3KYE A;  2Y2K A;  5DFY A;  2P9V A;  1XP4 A;  4N1H A;  3GMW A;  4LV3 A;  4JF5 A;  1OTI A;  2J3T C;  2PRF A;  3EQU A;  4KZ6 A;  2OAQ 1;  5EVI B;  3NDE A;  2B02 A;  5F1G A;  4CQH A;  3UPP A;  1A0K A;  1LL8 A;  1L0D A;  1PNE A;  4EBP A;  1WYC A;  3MXQ A;  3G2Z A;  2J80 A;  4WF0 A;  3B47 A;  5EV0 A;  1RP5 A;  1TF1 A;  1ERQ A;  5C5K A;  4M4X A;  2QKP A;  4Y0T A;  1Z09 A;  3T12 B;  5EEC A;  3SOI A;  5L8M A;  4NXB A;  1H8Z A;  3NDG A;  3BFF A;  1CI8 A;  3W4O A;  3E4Q A;  3MXS A;  3TE8 A;  3Q82 A;  1MKI A;  3BRM A;  2VJW A;  3IF6 A;  3JYI A;  4I3I A;  5J7E A;  2G2U A;  4WM9 A;  2VGJ A;  4S2N A;  4BL3 A;  3S22 A;  2X01 A;  3BLS A;  1JWZ A;  1ZG4 A;  3UE0 A;  4JF4 A;  5FSR A;  2ZQ7 A;  3G4P A;  3FKV A;  3R7W A;  3UDI A;  1TVF A;  4EES A;  3LGO A;  5A8B A;  4MN5 A;  1S6R A;  1EWZ A;  1KGG A;  1ZKJ A;  3LI9 A;  4BWI A;  2DRW A;  3F1O A;  1QME A;  4M3K A;  4CLC E;  2V8C A;  2PD8 A;  1XA1 A;  4D60 A;  1ACF A;  2Y2M A;  4R0Q A;  4LEN A;  1ES5 A;  4FOF A;  4QWO A;  1UWN X;  2B95 A;  1NRF A;  1XXM A;  3V3R A;  1W63 Q;  4LCM A;  5FEF A;  3E4P A;  4HES A;  1XJ6 A;  3QP2 A;  2BAS A;  4DRT A;  5GHY A;  4WEL A;  2VV8 A;  1K6R A;  2PD7 A;  3MZF A;  4KZB A;  3DAV A;  3IS2 B;  1FOF A;  5TR7 A;  1DY6 A;  4JXG A;  4HEF A;  2P08 A;  3O5Y A;  3JVU A;  4N92 A;  3IT9 A;  3Q7V A;  5GLD A;  2P9V B;  3U2A A;  5EVI C;  2V9A A;  5JYO A;  4PKY A;  1XJ4 A;  4OPY A;  3P98 A;  5CGW A;  3UB5 P;  2HJ9 C;  1NRJ A;  2XA7 S;  2XRO A;  2W27 A;  3OC2 A;  3VOL A;  5FAS A;  4UQI M;  3PBT A;  4DDS A;  2HGV A;  1M40 A;  2KLI A;  4WZ4 A;  5FAT A;  4ARZ B;  4GB7 A;  3UB9 A;  1H3Q A;  3CWF A;  4ETZ A;  2PHY A;  5E2F A;  4JBF A;  1ES2 A;  5FI7 A;  2VV7 A;  1HD8 A;  1CEG A;  1TEM A;  1MXO A;  2J7V A;  1CK3 A;  3DBA A;  3Q07 A;  4CLC A;  4EET B;  4AFI A;  2ZC4 B;  2FH5 A;  2JKR M;  2Y2L A;  3AGE A;  3RFB A;  3F1P A;  4GNU A;  1OTD A;  4LV2 A;  3OLO A;  4KG2 A;  2XRN A;  1BT5 A;  1SDE A;  4RVA A;  3LR5 A;  5FQM A;  1S1Y A;  2OV5 A;  1L2S A;  1XJ3 A;  3V67 A;  1H8M A;  5TBM A;  3W2Z A;  1G28 A;  3SS3 A;  3QP4 A;  3V3S A;  2PU2 A;  3NEC A;  3UDF A;  3VP3 A;  1BLH A;  4E04 A;  4E3M A;  4Y3I A;  5HPI A;  2L0W A;  3C8C A;  5CHU A;  3LR3 A;  5HDD A;  4Y7P A;  2PYP A;  5CX7 A;  5HD3 A;  4P85 A;  4BQM A;  2V1B A;  3F1O B;  2P7J A;  1IKG A;  4GCZ A;  5DTT A;  4OH0 A;  1PW8 A;  3N6I A;  2LB9 A;  2JKR I;  2Q9M A;  1VET A;  4I3J A;  1ODV A;  2NUT C;  2Y2Q A;  1ONG A;  2HP6 A;  3UB8 A;  2WGW A;  1NZO A;  3E2L A;  3MR0 A;  4X1L A;  2EX9 A;  5AQA A;  3BM6 A;  2BTF P;  2EFU A;  1G6A A;  4IUH A;  4FH2 A;  2FFF B;  1KVM A;  2PBD P;  4EBL A;  5DKK A;  3ZCZ A;  2W1R A;  3WRT A;  1S1Z A;  3G2Y A;  3T4K A;  2EX2 A;  4R4S A;  1YQS A;  3UNW A;  4GS9 A;  1ERM A;  3KO6 A;  1FSY A;  2A49 A;  1FIK A;  3IXG A;  3UE6 A;  1OTB A;  1IYO A;  3Q7V B;  4FCF A;  2J3T D;  1F5M A;  3PR6 A;  3GQZ A;  1KE3 A;  3KX0 X;  4R1G A;  4GW9 A;  4HBT A;  4LCL A;  1KOU A;  1MWT A;  3LR0 A;  5EVE A;  3MFX A;  4KQD A;  5GLB A;  4GLQ A;  5EOE A;  3H7W A;  1UWP X;  4RYE A;  2Y55 A;  4IVI A;  4YOF A;  4OON A;  3D72 A;  4R3A A;  1JTG A;  2BG1 A;  4NK3 A;  4PM9 A;  5FQI A;  4KZ3 A;  5J3W A;  3BWL A;  3K2N A;  1Y4O A;  4MEZ A;  2QYB A;  3JVV A;  2J8Y A;  3ZFZ A;  4WZ5 A;  3V50 A;  5HAP A;  3DW0 A;  3GSG A;  4EBN A;  4CLC B;  3SH7 A;  2WKH A;  1OJG A;  1XX2 A;  3S1Y A;  4E3N A;  4UAA A;  1NJ4 A;  5GHZ A;  3ITB A;  3O3V A;  1NLZ A;  4R70 A;  4Z1W A;  3F1P B;  3FPW A;  3KSF A;  5FI2 A;  5HDC A;  2C5W B;  4K0W A;  2ZJ9 A;  1EW0 A;  4O7D A;  2Y2P A;  4BJP A;  1PI5 A;  4ZAM A;  1WE4 A;  3S7Q A;  4R4R A;  4C75 A;  5EUA A;  2JHE A;  1O7E A;  5TBM B;  1FCO A;  1F9I A;  3ISG A;  4GDB A;  1LSW A;  4E6X A;  2VKS A;  5FQQ A;  4WL9 A;  4Y2F A;  1LSX A;  1BLP A;  4X56 A;  2VGL S;  1NYY A;  4KQR A;  4U3T A;  5DTS A;  1KDS A;  3K3C A;  4IED A;  4OLG A;  1OJ5 A;  2AVX A;  3BW6 A;  4MLL A;  4GJ4 A;  4WUJ A;  1BLC A;  3O87 A;  5FA7 A;  3W4Q A;  3S7P A;  2WGW B;  1YT4 A;  3LFV A;  4DXC A;  2W3F A;  3C4O A;  4HBU A;  2PR6 A;  2YKH A;  1LL9 A;  4KZA A;  4Q0H A;  4BEN A;  3RTY A;  3MFD A;  4JXW A;  1MZU A;  2Y59 A;  2YKF A;  2EWV A;  1AXB A;  5KMW A;  3A3D A;  2P74 A;  4R6L A;  3HLW A;  4GS9 B;  3NHQ A;  2Z2M B;  2EXB A;  3MKF A;  3HUO A;  4O0P A;  4UA7 A;  1Y28 A;  3LIE A;  1E3U D;  4UHU A;  4KZ9 A;  4N9K A;  4JGP A;  4GOG A;  2WAF A;  4S2K A;  1OTE A;  1LI9 A;  4GKU A;  4S2O A;  1HTZ A;  2WK0 A;  4HJ3 A;  1L3L A;  1MPL A;  1PRQ A;  3GVB A;  3HCY A;  4Y17 A;  3NBL A;  4ZRR A;  1BZA A;  4DN0 A;  1C3B A;  5F82 A;  3T4S A;  2PBY A;  2Y2I A;  3BEB A;  3UPN A;  4CLC C;  1O07 A;  2Y2J A;  4R23 A;  5HAI A;  2ZC6 B;  4NXF A;  1XFN A;  1KGE A;  1NZU A;  2V1A A;  4ZBE A;  2KDK A;  3PBO A;  1LHY A;  5CGS A;  4ME4 A;  3PHY A;  5DF9 A;  3IF5 A;  4E3L A;  2UWX A;  3R4K A;  1W5D A;  2DNS A;  4X1M A;  3KYQ A;  4JXS A;  3HLG A;  1LLB A;  5AJG A;  3QP5 A;  1XKZ A;  2PR5 A;  5F1F A;  4G3W A;  1YM1 A;  2HDS A;  2I9V A;  2PYR A;  1WYB A;  4MBK A;  3M2K A;  2QMI A;  4WYY A;  1T1B A;  2V0W A;  4K0X A;  4GD8 A;  1F98 A;  3DTI A;  4K91 A;  4DJ3 A;  5HAR A;  4BBU A;  1TDG A;  2D02 A;  5FAQ A;  3RJU A;  3GDI A;  4OLD A;  2ZC5 B;  5F83 A;  5IT5 A;  1N9B A;  2IA2 A;  2W3E A;  2M1C A;  3ICY A;  2X71 A;  3UB7 A;  4MBH A;  3KSI A;  2WZZ A;  4IBR A;  4GD6 A;  1D7E A;  2C6W B;  1P0Z A;  4QY5 A;  1CF0 A;  2ACG A;  4YIN A;  4P6Z S;  5M1A A;  3SS4 A;  5A91 A;  1GCE A;  3OBF A;  5G4Y A;  3UME A;  4KZ8 A;  3PAE A;  1XJ2 A;  1SKO A;  1S67 L;  1W7F A;  3IXB A;  1Q2Q A;  3M6H A;  3HUM A;  1LI0 A;  4NG2 A;  1V9Y A;  2JBF A;  1GSX A;  3QNC A;  2Q0O A;  3V39 A;  1OT6 A;  4GDN A;  2DMW A;  3ZYT A;  5DF7 A;  4PHT A;  3OPR A;  3IWO A;  1VEU A;  1PZO A;  3G34 A;  3HUN A;  1KE0 A;  1ESU A;  2V1Z A;  2VEA A;  1SKF A;  2V2F F;  1XA7 A;  2VLG A;  4RA7 A;  1OT9 A;  3MQO A;  1FSW A;  3BJN A;  1EI5 A;  1TS8 A;  3UE3 A;  2XD5 A;  5FQK A;  2WAD A;  3PTE A;  1K56 A;  5D3O A;  4WZ5 C;  5K5B A;  2W3D A;  3CIT A;  4WN5 A;  4GZB A;  4LV1 A;  5AVE A;  1RGY A;  3HJK A;  3ZG5 A;  3CUE A;  4N9L A;  3HRE A;  4ZJ3 A;  4OQI A;  3BFE A;  4ESP A;  4KG5 A;  3GTC A;  1GHM A;  1G5U A;  4ZJ2 A;  2XK1 A;  4DMZ A;  3ZDJ A;  1K6S A;  4EWF A;  2HDR A;  3IHA A;  3CMZ A;  2GZA A;  5KIZ A;  1VQQ A;  2E8I A;  3A0V A;  3CLO A;  3PYP A;  3EQV A;  3MKE A;  4S2I A;  1KE4 A;  4DXB A;  3O88 A;  4MBF A;  5F68 A;  3NOP C;  1DP6 A;  5E43 A;  1G6O A;  3TJZ C;  1IYP A;  5FQJ A;  2PDR A;  1QMF A;  4Y15 A;  2V8F A;  4EXO A;  1DRM A;  1FR1 A;  4C3Q A;  1KVL A;  3A3F A;  3NUL A;  2PAV P;  3GEC A;  2V0U A;  1FR6 A;  5E2H A;  4Y0U A;  3CJM A;  1IEL A;  1SDN A;  2Y8H A;  5AQ9 A;  3IX8 A;  5FI6 A;  3W8K A;  3T50 A;  2Z6D A;  3LY3 A;  2Y4A A;  3IXH A;  1XGJ A;  1SKO B;  2D01 A;  3VP0 A;  4IHQ A;  2WGV A;  3D9Y A;  4LGW A;  2H0T A;  3ZNT A;  1JWP A;  2ZQA A;  3ZNY A;  4KUO A;  1Z6F A;  2A2L A;  2QZ6 A;  4EER A;  4HJ6 A;  4MCW A;  3Q1F A;  4LLO B;  5I94 A;  3IF6 B;  3LCE A;  1MWR A;  2DCF A;  2WKR A;  4EQI A;  1K0K A;  2R9X A;  3MZE A;  1VEU B;  1V9Z A;  1H0M A;  5U47 A;  2K7S A;  4RX2 A;  2VK3 A;  2QHK A;  4JGO A;  4E3O A;  3D3O A;  1U60 A;  2V20 A;  3C38 A;  2K31 A;  3M6B A;  3OOV A;  4S2J A;  2Z6C A;  3R7W B;  3DTE A;  1GHP A;  4XXR A;  2K2N A;  2VA0 A;  3QP8 A;  4S2L A;  2OLU A;  2W3G A;  2M7U A;  4S2P A;  4CLC D;  1BYW A;  2VV6 A;  4HQA A;  4HI4 A;  4R38 A;  3QP6 A;  1S0W A;  3EEH A;  3HJI A;  1PWC A;  4PM5 A;  4PMA A;  5CEB A;  2WGI A;  4LRZ E;  4X55 A;  2XR0 A;  4GN2 A;  3MBZ A;  5CEC A;  5AQB A;  3E98 A;  2BLS A;  1CI9 A;  2OSU A;  4A5R A;  3VFF A;  4EEU A;  2L1M A;  4PM8 A;  3HBR A;  3VP4 A;  4B4X A;  4JLF A;  1G68 A;  1Y54 A;  3MXR A;  4JF6 A;  1L0G A;  4QJG A;  1MWS A;  1FCN A;  3VFH A;  1ZC2 A;  2ZC3 B;  4HH3 A;  3S7O A;  5HWT A;  1MC0 A;  4WLA A;  4E3K A;  1GA0 A;  3P09 A;  4NKP A;  1T1A A;  4DE2 A;  2XFS A;  3P7N A;  3F1N A;  4E3I A;  2P04 A;  4XUZ A;  1NY0 A;  4X68 A;  4KZ7 A;  3FWL A;  3RH8 B;  5AQ7 A;  2INW A;  3FV7 A;  3DTK A;  2HP5 A;  2WKE A;  3NIA A;  3JPU A;  4JXV A;  4PM6 A;  5TFQ A;  1VM1 A;  5HZH A;  1DJC A;  5GLC A;  5FAP A;  3IF6 C;  3MSH A;  4UQI S;  3E4O A;  4U0X A;  4DJ2 A;  2J9P A;  4S2N C;  3WS0 A;  4Z9Q A;  1YLJ A;  3B3X A;  3HLF A;  1S4R A;  5HPF A;  4DDY A;  2EXA A;  1VB6 A;  4II7 A;  4EEP A;  2HP9 A;  3N8S A;  1BTL A;  1I2S A;  2ZQD A;  4OP8 A;  1K54 A;  3G32 A;  3CZD A;  3IWI A;  1MBL A;  2ZQ8 A;  4JPM A;  2EX6 A;  1K4E A;  4I38 A;  3CI6 A;  3KSH A;  2R78 A;  3DWZ A;  3RXW A;  4KZ5 A;  3CAX A;  3S7N A;  3SH8 A;  5FL3 A;  4B93 A;  2Q9N A;  1YPR A;  1VET B;  3CUE C;  3QNB A;  2WKP A;  4P6Z M;  2Y91 A;  2ZM0 A;  3FYZ A;  2A3U A;  1XGI A;  1I2W A;  2QWS A;  4EUZ A;  2H10 A;  3WS1 A;  3MQQ A;  3ZHH A;  2Y79 A;  4QU3 A;  2W1T A;  1LL5 A;  3HVF A;  4KZ4 A;  3BFD A;  4H6J A;  1NYM A;  1M6K A;  5M19 A;  3V5M A;  3VOZ A;  1ES3 A;  2ZM2 A;  4L0L A;  2PT7 A;  2IWD A;  3MJQ A;  4WMC D;  5I5L A;  3SZT A;  1OTA A;  5DJT A;  4CPK A;  4HHD A;  4F3L A;  3M2J A;  3GV9 A;  3IQA A;  5J4E A;  1K25 A;  5EVI D;  1HVB A;  5CHJ A;  2A24 A;  1FIL A;  4B4Z A;  5DF8 A;  3TRC A;  3KYZ A;  1K38 A;  2IWC A;  1J3W A;  2PU4 A;  4HP9 A;  3F1N B;  5J8X A;  1K57 A;  3H7W B;  3BYD A;  5CTM A;  3K3D A;  3MMH A;  5A92 A;  1ALQ A;  1XFQ A;  3HLB A;  5GL9 A;  2EWW A;  3PBR A;  2G7U A;  1SHV A;  1E4D A;  4UEY A;  2XDM A;  3MF0 A;  3B42 A;  3EGX C;  3PXP A;  5G18 A;  3ZQ5 A;  2QJ5 A;  4Y13 A;  2JKG A;  4C6Y A;  2XQZ A;  3G30 A;  1PI4 A;  3C7V A;  4BD1 A;  2GX5 A;  5EOO A;  3LY4 A;  1NLY A;  5IS1 A;  2GNX A;  1XPB A;  2WAE A;  5HL6 A;  3DTM A;  4EQ1 A;  3NC8 A;  3UPO A;  1JTD A;  2KX6 A;  5DTK A;  3H82 A;  1HZO A;  3OPL A;  3NI9 A;  3U4L P;  5KZH A;  3ZG7 B;  2RL3 A;  3HLC A;  3HLD A;  5KSC A;  5EM0 A;  2Y2O A;  5HAQ A;  1ESI A;  3A0S A;  4ZTK A;  4FSF A;  1KDW A;  2XA7 M;  5HDS A;  1N9L A;  3BY9 A;  2JKF A;  4O8G A;  3EGD C;  1PWD A;  1NXY A;  2ZMA A;  4QPR A;  4P0M A;  4WEK A;  3T4J A;  1N9N A;  1SCW A;  5KSH A;  3I7J A;  4RQ9 A;  4O01 A;  2H28 A;  4X25 A;  2ZLY A;  4XUX A;  5LBR A;  3PAG A;  2W1T B;  3ITA A;  2XGN A;  1S4S A;  3HL9 A;  4PPR A;  2RCX A;  2IWB A;  4H6J B;  3CHW P;  4DF6 A;  2XLN A;  4ARZ A;  2VGK A;  3MS6 A;  3WWX A;  4Y0O A;  1TS6 A;  3GR2 A;  1N9O A;  4F3L B;  3SH9 A;  3UMD A;  1YLP A;  1S66 L;  2A24 B;  4D2O A;  2FFY A;  4JGR A;  3ZVW A;  2ZBB A;  3FC7 A;  3LEZ A;  5MC7 A;  4KQO A;  3KSG A;  2W3H A;  2B5R A;  4JGQ A;  2J9O A;  4IJG A;  2NUP C;  2O9B A;  2OAP 1;  1P9R A;  3LIC A;  5CHM A;  4L9E A;  1ONH A;  2XD1 A;  3EWK A;  1YMS A;  5G4Z A;  2HPB A;  2ZQ9 A;  4OOL A;  1FQG A;  2KOI A;  1PIO A;  2VX8 A;  1K55 A;  4OQ0 A;  5HD5 A;  3B33 A;  3NOT C;  3T1X A;  3G35 A;  4P87 A;  4ZJ1 A;  1RGZ A;  1VHM A;  3HLE A;  5IU1 A;  4X53 A;  3L9K A; 
#chains in the Genus database with same CATH homology
 3BQA A;  1X0O A;  3S7Q A;  2JHE A;  2W3G A;  2M7U A;  4ETX A;  5TBM B;  4HY8 A;  4CLC D;  1F9I A;  1BYW A;  1LSW A;  2VV6 A;  2VKS A;  4WL9 A;  4HQA A;  4HI4 A;  4R38 A;  2HF6 A;  4Y2F A;  1LSX A;  3EEH A;  2HJE A;  3VV4 A;  3EEA A;  2VGL S;  4Q0J A;  3HJI A;  3K3C A;  1OJ5 A;  3BW6 A;  3IS2 A;  4GJ4 A;  3IBJ A;  4LRZ E;  2OWJ A;  4WUJ A;  4NXE A;  4HOI A;  3H82 B;  3E98 A;  4MN7 A;  2ZMF A;  3BQ8 A;  3ULF A;  3PBS A;  2L4R A;  5DFY A;  3S7P A;  3A0R A;  4EEU A;  2L1M A;  3LFV A;  1OTI A;  2J3T C;  2W3F A;  3EQU A;  2PR6 A;  2OAQ 1;  2YKH A;  2HV1 A;  4Q0H A;  2B02 A;  4CQH A;  3RTY A;  1LL8 A;  4HP4 A;  1NWZ A;  2CMN A;  4IUK A;  2EA9 A;  3MXQ A;  5F5Y A;  4HH3 A;  1MZU A;  3S7O A;  3VE3 A;  2J80 A;  2YKF A;  1STZ A;  2EWV A;  3B47 A;  4WF0 A;  4HJ4 A;  5HWT A;  2ZOI A;  1TF1 A;  4R6L A;  4XT2 A;  4B9O A;  1MC0 A;  5C5K A;  4M4X A;  2QKP A;  4WLA A;  1GSW A;  4GS9 B;  3LR4 A;  3NHQ A;  4NKP A;  4BBT A;  4MN6 A;  1T1A A;  3P7N A;  2W0N A;  3F1N A;  5L8M A;  3FG8 A;  2P04 A;  2B18 A;  4NXB A;  4O0P A;  2XSS A;  1Y28 A;  3LIE A;  1IOU A;  3LIA A;  3RH8 B;  4JGP A;  2INW A;  3E4Q A;  1TD5 A;  3TE8 A;  2VJW A;  1OTE A;  3LUQ A;  4I3I A;  2LB5 A;  4YWZ A;  5J7E A;  4HJ3 A;  5HZH A;  3HCY A;  4BBV A;  4ZRR A;  4DN0 A;  1WA9 A;  3T4S A;  4UQI S;  3E4O A;  2JN7 A;  4I3A A;  4DJ2 A;  5HSQ A;  2VGL M;  4CLC C;  3R7W A;  1YSQ A;  1P9W A;  1S4R A;  4EES A;  4NXF A;  1XFN A;  5HPF A;  3EOI A;  2V1A A;  5A8B A;  4MN5 A;  4BMW A;  1VB6 A;  3LI9 A;  3MQ0 A;  2KDK A;  4II7 A;  5AVF A;  4BWI A;  3F1O A;  4EEP A;  3PBO A;  4CLC E;  4HIA A;  2PD8 A;  4ME4 A;  3PHY A;  5DF9 A;  1W63 M;  3R4K A;  3T4O A;  4FOF A;  1UWN X;  1LT0 A;  3KYQ A;  3PBQ A;  4I38 A;  5AJG A;  3CI6 A;  1W63 Q;  3E4P A;  3KSH A;  3LI8 A;  2R78 A;  2PR5 A;  1XJ6 A;  4G3W A;  3LIB A;  2BAS A;  2I9V A;  2PYR A;  3CAX A;  4NXG A;  3S7N A;  5FL3 A;  4B93 A;  2OWH A;  3T4T A;  1T1B A;  2VV8 A;  4WEL A;  1TS0 A;  2V0W A;  1F98 A;  2PD7 A;  3CUE C;  2WKP A;  4P6Z M;  3G6O A;  1IFQ A;  2FZ0 A;  4DJ3 A;  4PAU A;  4G3V A;  2QWS A;  4BBU A;  3C2W A;  2D02 A;  3IS2 B;  3GDI A;  3MQQ A;  5IT5 A;  2Y79 A;  2W1T A;  1JNU A;  2IA2 A;  1T19 A;  2P08 A;  3O5Y A;  4HNB A;  2W3E A;  2M1C A;  3JVU A;  3ICY A;  3UB7 A;  3SW1 A;  4H6J A;  1D06 A;  3KSI A;  1YAX A;  3U2A A;  1DP9 A;  2ZOH A;  1D7E A;  4HH2 A;  1P0Z A;  2V9A A;  4LRX C;  4L0L A;  2PT7 A;  1DP8 A;  4GHI A;  4PKY A;  2O9A A;  4OOM A;  4P6Z S;  1XJ4 A;  3MJQ A;  5G4Y A;  3OBF A;  5I5L A;  1OTA A;  5DJT A;  3UME A;  4HHD A;  3LYX A;  4F3L A;  1XJ2 A;  1S67 L;  2HJ9 C;  5J4E A;  1NRJ A;  2M7V A;  2XA7 S;  2XRO A;  2W27 A;  3OC2 A;  3VOL A;  4UQI M;  3PBT A;  2A24 A;  2HGV A;  2KLI A;  1V9Y A;  4ARZ B;  4L9G A;  4I39 A;  3H9W A;  2GJ3 A;  1GSX A;  4XT2 B;  3UB9 A;  4Y5F A;  1H3Q A;  1OT6 A;  3CWF A;  2PHY A;  4ETZ A;  1MKM A;  4PKY G;  2VV7 A;  3TRC A;  2DMW A;  3KYZ A;  3ZYT A;  4PHT A;  2O99 A;  3C30 A;  4HP9 A;  3DBA A;  3F1N B;  4CLC A;  4EET B;  3H7W B;  4AFI A;  2O0Y A;  2VEA A;  4EUV A;  3K3D A;  2VLG A;  2FH5 A;  1OT9 A;  2JKR M;  3MQO A;  3MMH A;  2JKT M;  3RFB A;  3F1P A;  1OTD A;  2ZMV A;  3BJN A;  3OLO A;  1TS8 A;  3UE3 A;  3VE4 A;  1XFQ A;  3T4L A;  2EWW A;  3PBR A;  2G7U A;  2XRN A;  4Q0I A;  4UEY A;  3MF0 A;  3B42 A;  3EGX C;  3PXP A;  3LR5 A;  1S1Y A;  3ZQ5 A;  2QJ5 A;  1XJ3 A;  3V67 A;  3T4Q A;  1H8M A;  2OOL A;  5TBM A;  3W2Z A;  1UGU A;  2QJ7 A;  1G28 A;  1LSV A;  2GX5 A;  5K5B A;  2W3D A;  3CIT A;  4WN5 A;  1NLY A;  5IS1 A;  4E04 A;  5HWV A;  4Y3I A;  5HPI A;  2L0W A;  5AVE A;  3C8C A;  2GNX A;  3LR3 A;  5HDD A;  5HL6 A;  2PYP A;  3HJK A;  4EQ1 A;  5CX7 A;  5HD3 A;  3CUE A;  2KX6 A;  2V1B A;  3F1O B;  2P7J A;  3H82 A;  3PBN A;  4GCZ A;  1YKD A;  2LB9 A;  2JKR I;  2JKT I;  1ZTU A;  4I3J A;  1ODV A;  3NJA A;  2NUT C;  5DJU A;  4DMZ A;  3UB8 A;  3TW8 A;  4LPZ A;  3MR0 A;  2GZA A;  5KIZ A;  3A0S A;  4FSF A;  2XA7 M;  5HDS A;  4G3K A;  1N9L A;  3BY9 A;  3A0V A;  3CLO A;  4NEE D;  3PYP A;  3EQV A;  3EGD C;  4O8G A;  4IUH A;  3NOU C;  5DKL A;  4QPR A;  1TS7 A;  4MMN A;  4WEK A;  3T4J A;  1N9N A;  5DKK A;  5KSH A;  2W1R A;  1OPX A;  4RQ9 A;  4O01 A;  5F68 A;  1S1Z A;  2H28 A;  3NOP C;  3T4K A;  1DP6 A;  4MDZ A;  3P01 A;  5LBR A;  1G6O A;  3TJZ C;  2W1T B;  4GS9 A;  2PDR A;  1S4S A;  5EFW A;  1P97 A;  4EXO A;  1DRM A;  3KO6 A;  3UE6 A;  4H6J B;  1OTB A;  1T18 A;  3GEC A;  2V0U A;  4L9F A;  2J3T D;  1YSP A;  4YNR A;  3OCN A;  1F5M A;  3PR6 A;  3FPV A;  2Y8H A;  4ARZ A;  3KX0 X;  4GHI B;  3T50 A;  2Z6D A;  1TS6 A;  4GW9 A;  1N9O A;  1KOU A;  4EW7 A;  4F3L B;  3LR0 A;  3MFX A;  2D01 A;  4KQD A;  4IHQ A;  2WKQ A;  4GLQ A;  3H7W A;  3OCL A;  3UMD A;  1UWP X;  5F6A A;  4KUO A;  4YOF A;  1S66 L;  2A2L A;  2A24 B;  4JGR A;  3LID A;  2ZBB A;  3FC7 A;  3D72 A;  4R3A A;  5TJJ A;  4HJ6 A;  4EER A;  5MC7 A;  4MCW A;  3BY8 A;  2O9C A;  4I5S A;  4KQO A;  5J3W A;  3KSG A;  2W3H A;  3BWL A;  3K2N A;  4LLO B;  3E0Y A;  2QYB A;  2VZW A;  3JVV A;  4JGQ A;  5HWW A;  4IJG A;  2WKR A;  4KUK A;  2NUP C;  2O9B A;  2OAP 1;  1V9Z A;  1GSV A;  2K7S A;  4CLC B;  1P9R A;  3LIC A;  4L9E A;  1T1C A;  2QHK A;  4K08 A;  4EU0 A;  1OJG A;  4JGO A;  3EWK A;  5G4Z A;  3LIF A;  4OOL A;  4WEJ A;  2MJ6 A;  2KOI A;  2VX8 A;  2J3W A;  3D3O A;  3C38 A;  1NLZ A;  4R70 A;  4Z1W A;  2K31 A;  1ZHH B;  3F1P B;  5HD5 A;  3B33 A;  5DFX A;  3FPW A;  3OOV A;  3KSF A;  3UB6 A;  3NOT C;  2Z6C A;  3R7W B;  3IBR A;  5HDC A;  5F69 A;  1EW0 A;  2K2N A;  1VHM A;  4BJP A;  2VA0 A;  4LRY C;  5IU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...