4MN5A

Crystal structure of pas domain of s. aureus yycg
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
103
Chain Sequence
RRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLGLIARVNFSTIVQETGFVTGYIAVLHDVTEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein kinase WalK
publication title Crystal structure of PAS domain of S. aureus YycG
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 18
structure length 103
sequence length 107
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mn5A00
5J4EA 3E4PA 5EFWA 2R78A 1GSXA 4EEPA 3G6OA 4GS9B 5A8BA 4JGPA 2H28A 1LSWA 4DJ2A 4NXFA 4EQ1A 3NOUC 2INWA 3IS2B 4EETB 3LIBA 3E4QA 3KX0X 3UMDA 4HQAA 3NHQA 4I38A 4JGQA 5I5LA 2ZOIA 5F5YA 4HH2A 4LRYC 2VLGA 4L9GA 4LRZE 3ZQ5A 4NXGA 3GDIA 1UGUA 1F98A 1NWZA 3LI8A 3LYXA 3H82A 4LLOB 1TS0A 2A24A 3P7NA 2OWHA 4LRXC 3MQOA 4BBUA 1D06A 3MXQA 2M1CA 5AVFA 2VEAA 2QWSA 4I3JA 1S1YA 4MN5A 3A0RA 2PR5A 4JGRA 1GSVA 4K08A 1VB6A 5J3WA 4HH3A 3SW1A 4BBTA 3F1OB 3MJQA 1OTAA 1F9IA 4L9EA 1N9NA 2EA9A 1DRMA 5HWVA 1LT0A 3D72A 2ZOHA 3CLOA 2OWJA 3RH8B 4WF0A 3F1NA 3H7WB 3K3DA 4HIAA 3H82B 4B9OA 5DKLA 4LPZA 2V0UA 4R3AA 4NXBA 1OJ5A 3EEHA 5DJUA 5IS1A 4H6JB 1OT6A 5HSQA 3A0SA 3HJIA 1DP8A 1XFNA 5HZHA 4L9FA 5TBMB 4EESA 2B02A 3NJAA 3EWKA 3C2WA 4R6LA 2VV7A 4HI4A 2Z6CA 3PYPA 1S66L 2D02A 4GHIB 3UB6A 2QJ5A 2PD7A 4WUJA 3F1PA 2V1AA 5F6AA 3UMEA 5KIZA 1OTDA 1OTIA 1S4SA 1LL8A 2QHKA 4WLAA 3UE6A 3UB9A 5F69A 4E04A 1MZUA 2WKPA 4HNBA 1OT9A 1TS7A 5DKKA 2I9VA 4I3IA 4HY8A 1N9LA 2KX6A 1S1ZA 4EW7A 3LICA 4MN6A 5DJTA 5HWTA 2VV8A 3UB8A 3MR0A 3B33A 3OLOA 3VE3A 4JGOA 2D01A 1DP9A 1XFQA 4HOIA 3CWFA 1T19A 4GS9A 1V9ZA 2PD8A 1OJGA 1JNUA 2L1MA 1OTEA 1DP6A 2ZBBA 2V0WA 1TS6A 2YKHA 4EXOA 1LSXA 2W27A 3F1PB 3CAXA 3PHYA 2PR6A 2V1BA 1X0OA 5HD3A 4EERA 4NXEA 5HD5A 2PYRA 1XJ6A 3A0VA 2KDKA 5IU1A 4GCZA 5AVEA 3NOTC 1S4RA 4HJ3A 2K7SA 1N9OA 4PKYA 2BASA 3MQQA 4KUOA 2A24B 4HP9A 4KQDA 1T1BA 1T18A 4EEUA 2GJ3A 1T1AA 2QJ7A 3BWLA 4F3LA 3NOPC 5F68A 3UB7A 1WA9A 1KOUA 2JN7A 4HJ6A 2PDRA 4HHDA 4XT2A 4RQ9A 3C8CA 2YKFA 2QKPA 2WKQA 1Y28A 1GSWA 1OTBA 4I5SA 3F1OA 3ULFA 1ODVA 5HWWA 4YWZA 3FG8A 3VOLA 4WN5A 2VV6A 4WL9A 4PKYG 3MFXA 2W0NA 1XJ4A 2P7JA 1S67L 5G4YA 1LSVA 1UWNX 1UWPX 5HDDA 1BYWA 4DJ3A 3K3CA 3F1NB 2J80A 3BY9A 1TS8A 2L4RA 4HP4A 2PHYA 5G4ZA 3H7WA 4I39A 3LIDA 5HDCA 5HDSA 4H6JA 4F3LB 3LIFA 4HJ4A 4R70A 5TBMA 3LIEA 3LUQA 3HJKA 4XT2B 2V9AA 4I3AA 3IS2A 3GECA 3E4OA 5J7EA 3LIAA 4GHIA 4KUKA 3IBRA 2CMNA 2Z6DA 2JHEA 4R38A 3T50A 1T1CA 3BY8A 3H9WA 1XJ2A 2HV1A 2OOLA 1V9YA 2WKRA 1P0ZA 3VE4A 3RTYA 1EW0A 2L0WA 2PYPA 1G28A 4BBVA 3FC7A 4GW9A 1D7EA 4M4XA 1P97A 3LI9A 1XJ3A 3ICYA
chains in the Genus database with same CATH superfamily
5GLDA 3SS5A 3PBRA 1M40A 4OLGA 2IWDA 1LSWA 1PWGA 4WEJA 3OPHA 4KZ9A 4NXFA 3G4PA 4EQ1A 1YLJA 4MMNA 1NRJA 4EETB 2HGVA 5DFXA 4DN0A 4E3JA 4KZBA 3E0YA 3LIBA 3PAGA 2WGVA 4KZ3A 5E2EA 5CX7A 2R9WA 3NHQA 3M6BA 4Q0JA 2P74A 4X53A 2GX5A 5E43A 3CMZA 5F5YA 4HH2A 2OLUA 3MXRA 3L7HA 1BLCA 3Q07A 1E25A 5CHJA 2VGKA 1WYCA 2OLVA 5MC7A 1MC0A 2ZM8A 3LI8A 3DTKA 5HL1A 2JC7A 4K0WA 4PPRA 1L0GA 2A24A 2E8IA 2R9XA 4DE1A 1PNEA 4BBUA 1QMFA 3LEZA 5AVFA 5TGFA 2VEAA 1G5UA 1S1YA 1NYMA 3UNWA 3P09A 1GSVA 3IWOA 3HLWA 3HREA 5J3WA 4IVIA 4LGWA 3PTEA 4BL2A 4BBTA 1NY0A 3IX4A 4JF5A 3QHYA 3NY4A 4OPZA 3MJQA 3U4LP 2HDUA 5EPHA 2W3HA 5LBRA 2ZC3B 3LR4A 3SS3A 3LY4A 3IX8A 2A3UA 2EA9A 3C4OA 2FFFB 1RCJA 2HZ5A 4DKIA 3CUEC 1CQAA 4OVDA 5KSHA 1JWVA 5HWVA 1MKMA 2C6WB 3BFCA 3D72A 2HP9A 2Y59A 1CJFA 5FEGA 5EECA 3HL9A 2O9AA 3BQ8A 5GL9A 3RH8B 3V5MA 2ZL1A 3QNBA 1YMXA 3H7WB 5CHMA 1Z09A 3K3DA 4LV2A 2V0UA 4R3AA 5A93A 3CPTB 3EEHA 1VEUA 4KZAA 5FA7A 5IS1A 3VMAA 1XKZA 3TOIA 3HCYA 4QU3A 1DP8A 3E2LA 3O5YA 4EESA 5HL6A 2XFSA 4R1GA 4WZ4A 1BZAA 1FSWA 1IYPA 3UPNA 4R6LA 5FL3A 5DTTA 3PYPA 3HVFA 2D02A 4GD6A 4G3VA 1NRFA 3FV7A 2XROA 2NUPC 1CI8A 3F1PA 3UDIA 1VHMA 3UDXA 4OOLA 3M6HA 1ZG6A 3HLCA 1MWUA 4ESPA 3BLSA 4ETZA 1NZOA 2BG1A 4B4XA 3BEBA 2X71A 3T1RA 2KLIA 3NULA 4WLAA 3W8KA 2Q9MA 2ZQAA 3WS1A 4YNRA 5F69A 3O88A 4HNBA 3O87A 1K55A 1GHIA 4WBGA 3R4KA 4IUKA 5DF7A 2G2UA 5HWTA 1GA9A 3VSKA 4ZBEA 3GSGA 5DF8A 3OLOA 1RGYA 4OQGA 1XFQA 1W5DA 3OCLA 3CWFA 1T19A 3ITAA 3UO9A 2ZQCA 1V9ZA 4S2KA 2V1ZA 3LEQA 5EUAA 4LV0A 1ZC2A 3EQVA 3OBFA 1FSYA 2YKHA 2W27A 5FI6A 3CAXA 5CXWA 5HFOA 4KENB 2O0YA 4EERA 1MY8A 3MS6A 5AQBA 5FI7A 4UHUA 2KDKA 4E3MA 5IU1A 4UA9A 2EFXA 2ZM2A 5BOHA 3DTIA 2Q0OA 5GHZA 1E3UD 2K7SA 1N9OA 4PKYA 2WADA 2A24B 2WYXA 1LL9A 5L8MA 1T18A 4EEUA 1WYBA 4OQ0A 1Q2QA 2EWWA 1T1AA 4FCFA 1NLZA 3E2KA 5GHYA 1WA9A 4LFUA 3Q81A 3IHBA 1H8ZA 4HJ6A 2WZZA 2PU4A 4HHDA 4XT2A 4P6BA 3AGDA 5AQAA 1F5MA 2WKQA 1K57A 3FKWA 2VKSA 1OTBA 4I5SA 1KDWA 3V3SA 2CC1A 1HLUP 3ULFA 4GD8A 3FG8A 4PKYG 4B4ZA 2W0NA 3GR2A 1TVFA 3IH8A 1LL5A 2EXBA 2PU2A 3PBQA 3ZG7B 4R23A 1UWPX 2Y55A 1BYWA 2XRNA 2ZL1B 5JYPA 4HBUA 1TS8A 2L4RA 5FDSA 3FKVA 4GN2A 2XLNA 4HP4A 1O07A 1L0EA 3VP1A 1KVLA 3B3XA 1IYOA 4N92A 2XR0A 4MLLA 4H6JA 3BLMA 3WS0A 3V50A 4F3LB 2OAQ1 2W3EA 1IOUA 1PIOA 4R70A 3HUMA 3HJKA 1MBLA 4XUZA 3RXWA 5CHUA 3DW0A 5J8XA 4GHIA 1ALQA 2BLSA 2JHEA 3KSIA 3SS4A 3W4PA 1H3QA 2VGJA 1F2KA 2HDRA 2XF3A 4DXCA 3GMWA 3NDGA 3H9WA 5FAPA 3MSHA 1V9YA 3BJNA 1YMSA 3A3DA 4GOGA 3RTYA 4RA7A 5L2FA 3KYZA 2PYPA 4MN7A 4BBVA 3IF6A 3FC7A 5F83A 3VP3A 3M2KA 4R0QA 4Y17A 4CLCD 4FUWA 2JKRI 3IBJA 4M4XA 1G6OA 4PM9A 1PW1A 3G32A 2XSSA 3QP5A 1W8YA 1NZUA 3ISGA 5EFWA 3UB5P 2M7VA 1K54A 1YSPA 4EEPA 3PAEA 4RX3A 3S7PA 2H28A 1K6RA 4DJ2A 3G31A 3NOUC 2ZQ9A 2GZAA 3FZCA 4EV4A 2O99A 3KX0X 3IHAA 1BLSA 2XFTA 4HQAA 4JGQA 1FCNA 5I5LA 3RJUA 3EGXC 4MCWA 5GLBA 3WWXA 2ZOIA 2V8CA 4N1XA 2VGLS 4CQHA 1XA1A 2UV0E 2VLGA 4LRZE 3ZQ5A 5TR7A 2J9PA 3LY3A 1L3LA 5FQQA 3MKFA 3G34A 3G2YA 3IQAA 1K56D 1UGUA 4O01A 3ZG9B 3TG9A 2PBDP 5FAQA 3HLFA 3BM6A 1PI5A 5EVIC 4U3TA 5EOEA 1TS0A 4R4SA 4HBTA 3CPTA 4HESA 3P7NA 4GNUA 4BWIA 3MQOA 2J3TC 3S7NA 3ZGAB 4P6ZS 1ESUA 4I3JA 5FSRA 1ES2A 4MN5A 2Y2JA 4G3KA 3T4JA 5CTMA 2LB5A 1VB6A 2A2LA 1IKIA 2Y79A 4Y15A 3O3VA 3A3IA 2OAP1 4QJGA 2DMWA 2W3FA 1GA0A 4DE2A 3UE0A 3VP2A 3BFEA 4O8GA 4ZDXA 3OZHA 3CI6A 2LB9A 2W3DA 1MXOA 4C75A 3E98A 4II7A 1JWZA 2J7VA 1ONHA 1DRMA 3S7QA 5CGSA 2HJEA 3PXPA 4GDNA 1W7FA 3LCEA 1Y54A 3F1NA 1BUEA 3DWKA 2XH9A 3T1XA 4B9OA 2VK3A 4LPZA 5AQ7A 3MZFA 5KZHA 4H6JB 3V67A 4WELA 4UQIM 4X1MA 3QNCA 4OP8A 2Y2PA 2B02A 2B95A 2VJWA 3IWIA 4IVKA 2RL3A 2VV7A 2Z6CA 1S66L 2FH5A 4GHIB 4S2NC 3UB6A 2QJ5A 3SH7A 4QB8A 4Y7PA 3UMEA 2EX9A 3WRTA 3FYZA 3TW8A 2Y2QA 3OPLA 4X55A 1D1JA 1SDNA 2VZWA 4GZBA 4JBFA 3ZDJA 2Y2KA 4QPRA 3IF6B 3UY6A 2P04A 4X56A 2XD5A 3T4SA 1SHVA 3NBLA 4ETXA 3C7VA 1MZUA 4RVAA 1EI5A 2WKPA 1OT9A 5CTNA 5DKKA 4DXBA 4I3IA 4K91A 1YLTA 3VV4A 4EBNA 1S1ZA 1K6SA 2VV8A 3KYEA 4ZRRA 2XQZA 2X01A 1GHPA 2C5WB 2D01A 2I72A 1DP9A 2HJ9C 4GDBA 3Q7VA 5HARA 3NDEA 4OOMA 2PD8A 1OJGA 2BTFP 1JNUA 2HP6A 1OTEA 3PBOA 4WZ5A 4MEZA 4JXSA 1CF0A 4EXOA 3IXHA 4U0TA 3S7OA 4AFIA 4KZ8A 4A5RA 3T4KA 1TD5A 1TDGA 3PHYA 1X0OA 5HD3A 1YSQA 3A0VA 1PI4A 3D9YA 2HPBA 4GB7A 3NCKA 4GCZA 5AVEA 4P85A 1S4RA 2EX8A 3JYIA 1SZVA 1LHYA 3G2ZA 4WMCD 3SOIA 2JKRM 4DMZA 4R3JA 2IWCA 4E3LA 1IFQA 2QJ7A 4YOFA 4FH2A 4F3LA 5F68A 4EQIA 3QP1A 2K31A 5DFYA 3S4XA 1OPXA 5EVLA 5FQKA 3ZG0A 1JWPA 4QD4A 4CLCE 3R7WA 1BT5A 3IX3A 3OPRA 3VP4A 3C8CA 1BLPA 1Y28A 1PZOA 3Q1FA 1ZG4A 3B42A 5CGWA 1ODVA 4KZ5A 3VOLA 3LO7A 4WL9A 2DCFA 3SH9A 3LR3A 2P7JA 1YKDA 2EX2A 3VFHA 1AWIA 4ZAMA 1UWNX 5E2GA 2ZMFA 1IELA 5F1GA 5CECA 2WGIA 3MBZA 3WRZA 3F1NB 4L0LA 2WKHA 4OH0A 1E3UA 5E2FA 2H10A 4LENA 5G4ZA 3N8RA 1KGEA 3P01A 4C6YA 3SH8A 3N8SA 1O7EA 5HDCA 5HDSA 1NLYA 5GLAA 3KSHA 4X68A 4KZ4A 1LI0A 3LIFA 3VP0A 4FH4A 3N7WA 3D4FA 3T4OA 1KGFA 4KUKA 2Y2LA 4N1HA 3SZTA 2CMNA 2JKFA 3ZYTA 3DTMA 1W79A 3LR0A 4NETA 3T50A 3MQ0A 3BY8A 4QHCA 4RYEA 1CK3A 1YAXA 5L10A 1W8QA 3CZDA 4IJGA 3IWQA 5FQIA 2KOIA 4DE3A 4BQMA 2ZQDA 1KDSA 1HD8A 4X69A 3T12B 1KGGA 3ZCZA 3LI9A 1XJ3A 5I94A 2ZQ8A 2JKTI 3IT9A 4P87A 1AXBA 3E4PA 2UWXA 2P9VB 3Q7VB 4O0PA 3T1SA 5A8BA 1FR6A 3D3OA 2INWA 1YLPA 3IS2B 4OKPA 1K55C 1OMEA 3E4QA 2QZ6A 4N9LA 2E8JA 1TEMA 2JE5A 1I2WA 4I38A 1PYYA 5FATA 1BTLA 3U2AA 4LRYC 3HLBA 4L9GA 3GDIA 3RXXA 3QP2A 5KSCA 4B93A 3MZDA 1F98A 1NWZA 1LLBA 2GNXA 4XUXA 5G18A 1DJAA 3EEAA 3LYXA 3MMHA 4EUVA 4CLCA 4KG2A 4LV3A 3WS4A 5E2HA 1D06A 3MXQA 1WE4A 2M1CA 4FSFA 1VQQA 3V39A 4Q8IA 2QWSA 3BFGA 4MBKA 3FPWA 2PR5A 4JGRA 3R7WB 4HEFA 4ZJ1A 2WKIA 3L9KA 4K08A 2H0TA 1CEFA 1VETA 5HAIA 3SW1A 3V3RA 4DRTA 3PR6A 4D60A 3ZFZA 4QY6A 1ZKJA 3BQAA 2V20A 5FQJA 3LFVA 1OTAA 4L9EA 2NUTC 4NEED 3DBAA 1N9NA 1NJ4A 4E3NA 1H5XA 2ZMVA 1S6RA 4KQRA 2ZOHA 3CLOA 3OOVA 1MPLA 3KSFA 3OC2A 1K56A 1K57C 5JYOA 4JXGA 5DVAA 4HIAA 3H82B 5DKLA 5EM0A 5DTSA 2ZQ7A 5M19A 1SKFA 1OT6A 3MF0A 3A0SA 4E3KA 3ITBA 4GLQA 1XFNA 5HZHA 1FCOA 5D3OA 4OOYA 3S1YA 3EWKA 5F1FA 3IH9A 3ZNTA 2XA7S 5HW3A 3C2WA 4MBFA 4HI4A 3UE1A 5EVID 5CRFA 2ZC5B 2PD7A 4Y0TA 5A92A 1YPRA 3TJZC 1TF1A 1Y4OA 1Z6FA 2V1AA 1FR1A 4E3IA 4WEKA 2J3TD 5KIZA 1OTDA 5FAOA 1S4SA 3W2ZA 1YLZA 3EOIA 1ZTUA 1MWRA 5U47A 1M6KA 1E4DA 2ZMAA 3UB9A 4E04A 2V2FF 1I5QA 1SDEA 1TS7A 3QP4A 3T4TA 2I9VA 4XXRA 4HY8A 1H0MA 3HUOA 5DJTA 3C38A 4BENA 3B33A 3O86A 5HPIA 2WZXA 2ZJ9A 4OPYA 4GS9A 3GVBA 3IF6C 1ONGA 2ZD8A 4ZJ3A 1ESIA 3PBSA 1W63Q 4JXWA 2RCXA 4JPMA 2ZBBA 1U60A 1TS6A 2V0WA 1FQGA 5FEFA 1L2SA 1DJCA 1K38A 1K25A 5EV0A 4PM5A 2PR6A 1C3BA 2ZC4B 1HZOA 2V1BA 4NG2A 5L07A 2JKGA 4R3BA 1K54C 2FZ0A 2K2NA 1XJ6A 3T4LA 1XX2A 2W3GA 3C5AA 1VM1A 3NOTC 3MKEA 3GV9A 3PBTA 4D2OA 1ACFA 5EVEA 5TJJA 2BASA 4IEDA 4KUOA 1YQSA 4KQDA 4CLCB 4BL3A 1SCWA 2GDNA 2WAFA 3G35A 3GTCA 4PM8A 3FPVA 3BWLA 4DE0A 4PHTA 2WKEA 3NOPC 1ES5A 3ZG8B 1KOUA 3CUEA 2J8YA 1MKIA 2PDRA 1IYSA 1VETB 4DF6A 4MDZA 4RQ9A 2YKFA 4X25A 2PAVP 2QKPA 1HVBA 2IWBA 3F1OA 5EVIB 5HWWA 3VOYA 5DTKA 4YWZA 3B47A 3JVVA 4CPKA 2VV6A 4WN5A 4S2IA 2JBFA 2Y2NA 2QYBA 1NXYA 1HTZA 1LSVA 2VX8A 4M3KA 5CEDA 3VOZA 2DNSA 4DJ3A 1ES4A 1NYYA 3A3JA 3BY9A 1SKOB 4UAAA 2QMIA 1YLYA 2G7UA 4WMCA 3HUNA 1P9RA 3LIDA 2EX6A 4BD0A 4IHQA 2P9VA 2Z2MB 2EXAA 3ZG5A 1YM1A 1CEGA 5F82A 1EROA 5TBMA 3LIEA 2O9CA 3UE3A 5C5KA 3LUQA 1IKGA 4DDSA 4I3AA 3IS2A 3GECA 5J7EA 3LIAA 5HX9A 1MWSA 3IBRA 5AJGA 2XGNA 4KQOA 3C30A 2Y4AA 4OPRA 5K5BA 1FOFA 2Y8HA 4S2PA 1XP4A 1T1CA 2HF6A 1XJ2A 4S2OA 4Q0IA 3VE4A 4KG5A 4MNRA 4IBXA 3BECA 2Y2HA 2XA7M 4EWFA 4X1LA 4QY5A 4LCMA 3DAVA 1P97A 4LV1A 3CJMA 4KZ6A 3ICYA 2VGLM 1YT4A 2ZLYA 2ZM0A 5J4EA 4QWOA 2R78A 1GSXA 4E6XA 4S2JA 3BYDA 3G6OA 1BSGA 4GS9B 2M7UA 4JGPA 3IXDA 1ERQA 3WS5A 5HAPA 3TSGA 3HLDA 2P08A 1H8YA 4Y3IA 1A0KA 1MWTA 4OP5A 4ID4A 3CITA 1K4FA 3W4QA 3UMDA 4U0XA 4YFMA 4ARZA 4P6ZM 3AGFA 2W1TA 4Y5FA 2Z2LB 4IBRA 3BW6A 1XPBA 4NXGA 1GHMA 1S0WA 3NIAA 4Q0HA 1FILA 4OQHA 3N8LA 1KE0A 5AQ9A 3A3FA 3OCNA 1PRQA 3H82A 4WZ5C 4LLOB 2WUQA 2HDQA 4OPQA 2OWHA 4LRXC 5EE8A 3ZNYA 4JLFA 3NI9A 4JF6A 2DRWA 1EWZA 5IHVA 4ZJ2A 2Y2MA 2OV5A 3A0RA 1QMEA 5EOOA 1XXMA 4NKPA 4HH3A 4FOFA 2J9OA 4ME4A 2Y2OA 3LR5A 3F1OB 3TRCA 4JF4A 3MXSA 3UPPA 1F9IA 2V8FA 3EQUA 2H0YA 2X02A 3DWZA 3W4OA 4FTXA 3NC8A 4BD1A 3PBNA 4EU0A 1K0KA 1LT0A 3UN7A 2PBYA 2OWJA 1L0FA 4UA6A 1W63M 3IF5A 4WF0A 4OLDA 1JTDA 4KQQA 3QP6A 2XD1A 4NXBA 1OJ5A 4S2LA 4EUZA 5DJUA 4Y0UA 5CEBA 4OQIA 1ERMA 2WGWA 5HSQA 2FFYA 3HJIA 1ES3A 2B5RA 4LCLA 3VFFA 4Y0OA 1DJBA 4L9FA 4JXVA 5TBMB 1I2SA 3NJAA 3JVUA 3C4PA 4UEYA 1XGJA 2AVXA 1IEMA 1J3WA 3KYQA 3S22A 4WUJA 5F6AA 2VA0A 4E3OA 1OTIA 2XDMA 3BFFA 3UPOA 1LL8A 2Y91A 2QHKA 4MBHA 4UQIS 2HDSA 4Z9QA 1TDLA 3GQZA 5TFQA 1KVMA 1RP5A 3UE6A 3HLGA 5FQ9A 3A3EA 3KO6A 1PW8A 3CHWP 1LI9A 2EFUA 1N4OA 3CG5A 3ZHHA 4N9KA 2IA2A 1JTGA 2WK0A 3UDFA 2OSUA 4EW7A 1N9LA 2KX6A 3DTEA 3LICA 4MN6A 5A90A 1VEUB 3UB8A 2MJ6A 3MR0A 4PM6A 1RGZA 4JKTA 4GKUA 1N9BA 4JGOA 4P0MA 3VE3A 3VSLA 3RFBA 2ZC7A 4HOIA 2XEPA 3HBRA 4Y2FA 3T1QB 4BMWA 4BLMA 1Q2PA 2L1MA 2B18A 3Q7ZA 1DP6A 1KE4A 4YINA 3AGEA 5EVIA 4ARZB 1LSXA 5HPFA 2W1TB 3F1PB 1JVJA 2A49A 1PFLA 3BRMA 4NXEA 4IUHA 1ZHHB 1G6AA 5HD5A 1PWCA 2PYRA 4WM9A 4UA7A 1BLHA 4PAUA 3MFDA 4HJ3A 4S2MA 1SKOA 3MQQA 1FIKA 3P98A 2ACGA 2O9BA 4HP9A 3T4QA 1T1BA 4R4RA 4B88A 5A91A 2EWVA 2GJ3A 2PRFA 3ZVWA 1KE3A 2HP5A 3LGOA 1PZPA 3FWLA 3K2NA 1BULA 3UB7A 3ZVTA 1IYQA 3N4IA 4RX2A 2JN7A 4PM7A 5FQMA 5L09A 2JCHA 3NECA 1GSWA 1XGIA 2ZC6B 4CLCC 2QPNA 4ZTKA 5CGXA 2Y2IA 4KG6A 3HLEA 3MFXA 1FCMA 1XJ4A 1S67L 5FASA 1H8MA 5G4YA 2PT7A 1STZA 4O7DA 5EM1A 5FI2A 2WAEA 3TE8A 5HDDA 4C3QA 3I7JA 4PMAA 3K3CA 1DY6A 4EBPA 2J80A 3IXBA 3JPUA 1GCEA 5HAQA 4X6TA 5IT5A 4S2NA 2PHYA 2W1RA 3H7WA 4EBLA 4I39A 4G3WA 4K0XA 3MZEA 2WGWB 3C7UA 3Q82A 5FDHA 4F94A 4HJ4A 3BFDA 2J3WA 1XA7A 3KSGA 1CI9A 5M18A 5GHXA 5GLCA 3OPPA 3M2JA 5M1AA 5KMWA 2Y2GA 1YLWA 2V9AA 4XT2B 3E4OA 2H5SA 4FD8A 3EGDC 4NK3A 5CERA 2Z6DA 4OONA 4H8RA 4KZ7A 3GRJA 3G30A 4R38A 4CJNA 2Q9NA 3IXGA 1K4EA 1G68A 2HV1A 2OOLA 2WKRA 4BJPA 1P0ZA 4E6WA 1EW0A 5DF9A 2L0WA 4Z1WA 3N6IA 4WYYA 3WS2A 4DDYA 1G28A 1J9MA 2G2WA 4GJ4A 4GW9A 1D7EA 2XK1A 1L0DA 1P9WA 3QP8A 4Y13A 2JKTM 1PWDA
chains in the Genus database with same CATH topology
2VGLM 2JKTI 5J4EA 3E4PA 5EFWA 2R78A 1GSXA 2M7VA 3PBRA 1YSPA 4EEPA 3G6OA 4O0PA 3S7PA 4GS9B 2M7UA 5A8BA 4JGPA 2H28A 1LSWA 4WEJA 4DJ2A 4NXFA 3D3OA 4EQ1A 2P08A 3NOUC 4Y3IA 2INWA 4MMNA 1NRJA 3CITA 3IS2B 4EETB 2GZAA 2HGVA 5DFXA 4DN0A 2O99A 3E0YA 3LIBA 3E4QA 3KX0X 3UMDA 5CX7A 4HQAA 3NHQA 4ARZA 4Q0JA 4P6ZM 4I38A 4JGQA 5I5LA 2W1TA 3EGXC 4MCWA 4Y5FA 2GX5A 2ZOIA 5F5YA 4HH2A 2VGLS 3U2AA 4CQHA 3BW6A 4LRYC 2VLGA 4L9GA 4LRZE 3ZQ5A 4NXGA 3GDIA 4Q0HA 4B93A 1UGUA 1F98A 4O01A 1NWZA 2GNXA 5MC7A 1MC0A 3LI8A 3OCNA 3EEAA 3LYXA 3H82A 3MMHA 4LLOB 1TS0A 2A24A 4EUVA 4CLCA 3P7NA 2OWHA 4LRXC 3MQOA 4BWIA 4BBUA 1D06A 2J3TC 3MXQA 2M1CA 3S7NA 4FSFA 5AVFA 4P6ZS 2VEAA 2QWSA 4I3JA 3FPWA 1S1YA 4MN5A 3A0RA 2PR5A 4G3KA 3T4JA 4JGRA 4NKPA 3R7WB 2LB5A 1GSVA 4K08A 1VB6A 2A2LA 2Y79A 5J3WA 4HH3A 4FOFA 2OAP1 4ME4A 3SW1A 2DMWA 3PR6A 4BBTA 2W3FA 3LR5A 3F1OB 3TRCA 3BQAA 3MJQA 3LFVA 1OTAA 1F9IA 4L9EA 4O8GA 2NUTC 2W3HA 4NEED 3EQUA 3CI6A 2LB9A 2W3DA 5LBRA 3DBAA 1N9NA 3LR4A 3E98A 4II7A 2EA9A 1DRMA 3S7QA 2ZMVA 3CUEC 3PBNA 4EU0A 2HJEA 5KSHA 5HWVA 1LT0A 1MKMA 3D72A 2ZOHA 3CLOA 3OOVA 3PXPA 2OWJA 3KSFA 2O9AA 3OC2A 3BQ8A 3RH8B 1W63M 4WF0A 3F1NA 3H7WB 3K3DA 4HIAA 3H82B 4B9OA 5DKLA 4LPZA 2V0UA 4R3AA 4NXBA 1OJ5A 3EEHA 5DJUA 5IS1A 4H6JB 3V67A 4WELA 1OT6A 4UQIM 3HCYA 3MF0A 5HSQA 3A0SA 3HJIA 4GLQA 1DP8A 1XFNA 5HZHA 4L9FA 3O5YA 5TBMB 4EESA 5HL6A 2B02A 3NJAA 3JVUA 4UEYA 3EWKA 2VJWA 2XA7S 3C2WA 2VV7A 4HI4A 4R6LA 2Z6CA 5FL3A 3PYPA 1S66L 2FH5A 2D02A 4GHIB 3UB6A 4G3VA 2QJ5A 3KYQA 2PD7A 2XROA 4WUJA 2NUPC 3F1PA 1VHMA 1TF1A 2V1AA 5F6AA 3TJZC 2VA0A 4WEKA 3UMEA 2J3TD 4OOLA 1OTDA 5KIZA 1OTIA 1S4SA 3TW8A 3W2ZA 1LL8A 3EOIA 1ZTUA 4ETZA 2QHKA 2VZWA 4UQIS 4QPRA 2KLIA 4WLAA 3UE6A 2P04A 3UB9A 3KO6A 4YNRA 5F69A 3T4SA 4E04A 4ETXA 1MZUA 2WKPA 4HNBA 1OT9A 1TS7A 2IA2A 5DKKA 3T4TA 2I9VA 4I3IA 3R4KA 4IUKA 4HY8A 1N9LA 2KX6A 1S1ZA 3VV4A 4EW7A 3LICA 4MN6A 5DJTA 2VV8A 5HWTA 3C38A 3UB8A 4ZRRA 2MJ6A 3MR0A 3B33A 5HPIA 3OLOA 3VE3A 4JGOA 2D01A 3RFBA 1DP9A 1XFQA 3OCLA 2HJ9C 4HOIA 3CWFA 1T19A 4GS9A 4Y2FA 4BMWA 1V9ZA 4OOMA 2PD8A 1OJGA 1JNUA 2L1MA 2B18A 3EQVA 1OTEA 3OBFA 3PBSA 1DP6A 3PBOA 1W63Q 2ZBBA 2V0WA 1TS6A 2YKHA 4ARZB 4EXOA 1LSXA 2W27A 3S7OA 4AFIA 5HPFA 2W1TB 3F1PB 3CAXA 3T4KA 1TD5A 3PHYA 2PR6A 2V1BA 1X0OA 2O0YA 5HD3A 4EERA 1YSQA 4NXEA 4IUHA 1ZHHB 5HD5A 2FZ0A 2K2NA 2PYRA 1XJ6A 3T4LA 3A0VA 2KDKA 2W3GA 5IU1A 4PAUA 4GCZA 5AVEA 3NOTC 1S4RA 4HJ3A 3PBTA 2K7SA 5TJJA 1N9OA 4PKYA 2BASA 3MQQA 4KUOA 2A24B 2O9BA 4HP9A 4KQDA 3T4QA 4CLCB 1T1BA 5L8MA 2JKRM 1T18A 4EEUA 2EWVA 4DMZA 2GJ3A 2EWWA 1T1AA 1IFQA 3FPVA 1NLZA 2QJ7A 4YOFA 3BWLA 4PHTA 3K2NA 4F3LA 3NOPC 5F68A 3UB7A 1WA9A 2K31A 1KOUA 5DFYA 3CUEA 1OPXA 2JN7A 4HJ6A 2PDRA 4HHDA 4XT2A 4CLCE 4MDZA 3R7WA 4RQ9A 3C8CA 2YKFA 2QKPA 1F5MA 2WKQA 1Y28A 1GSWA 2VKSA 1OTBA 4I5SA 4CLCC 3F1OA 3B42A 3ULFA 1ODVA 5HWWA 4YWZA 3FG8A 3VOLA 3B47A 3JVVA 2VV6A 4WN5A 4WL9A 4PKYG 3MFXA 2W0NA 3LR3A 1XJ4A 2P7JA 1YKDA 1S67L 1H8MA 2QYBA 3PBQA 5G4YA 2PT7A 1LSVA 2VX8A 1STZA 1UWNX 3TE8A 1UWPX 5HDDA 2ZMFA 1BYWA 2XRNA 4DJ3A 3K3CA 3F1NB 2J80A 4L0LA 3BY9A 1TS8A 2L4RA 5IT5A 4HP4A 2PHYA 5G4ZA 2W1RA 3H7WA 3P01A 4I39A 2G7UA 4G3WA 1P9RA 3LIDA 5HDCA 5HDSA 1NLYA 4IHQA 4H6JA 3KSHA 4F3LB 2OAQ1 3LIFA 2W3EA 4HJ4A 1IOUA 2J3WA 4R70A 3KSGA 5TBMA 3LIEA 2O9CA 3UE3A 5C5KA 3LUQA 3HJKA 2V9AA 4XT2B 4I3AA 3IS2A 3GECA 3E4OA 5J7EA 3LIAA 3T4OA 4GHIA 4KUKA 3EGDC 3IBRA 2CMNA 4KQOA 5AJGA 2Z6DA 3ZYTA 2JHEA 3KSIA 3C30A 5K5BA 2Y8HA 1H3QA 4R38A 3LR0A 3T50A 1T1CA 3MQ0A 2HF6A 3BY8A 3H9WA 1XJ2A 2HV1A 4Q0IA 2OOLA 1V9YA 2WKRA 3BJNA 4BJPA 1P0ZA 1YAXA 3VE4A 3RTYA 4IJGA 1EW0A 5DF9A 2L0WA 4Z1WA 3KYZA 2PYPA 4MN7A 2XA7M 1G28A 4BBVA 2KOIA 3FC7A 4GJ4A 4GW9A 1D7EA 4CLCD 2JKRI 3IBJA 4M4XA 1G6OA 1P9WA 1P97A 2JKTM 2XSSA 3LI9A 1XJ3A 3ICYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J4E A;  3E4P A;  5EFW A;  2R78 A;  1GSX A;  4EEP A;  3G6O A;  4GS9 B;  5A8B A;  4JGP A;  2H28 A;  1LSW A;  4DJ2 A;  4NXF A;  4EQ1 A;  3NOU C;  2INW A;  3IS2 B;  4EET B;  3LIB A;  3E4Q A;  3KX0 X;  3UMD A;  4HQA A;  3NHQ A;  4I38 A;  4JGQ A;  5I5L A;  2ZOI A;  5F5Y A;  4HH2 A;  4LRY C;  2VLG A;  4L9G A;  4LRZ E;  3ZQ5 A;  4NXG A;  3GDI A;  1UGU A;  1F98 A;  1NWZ A;  3LI8 A;  3LYX A;  3H82 A;  4LLO B;  1TS0 A;  2A24 A;  3P7N A;  2OWH A;  4LRX C;  3MQO A;  4BBU A;  1D06 A;  3MXQ A;  2M1C A;  5AVF A;  2VEA A;  2QWS A;  4I3J A;  1S1Y A;  4MN5 A;  3A0R A;  2PR5 A;  4JGR A;  1GSV A;  4K08 A;  1VB6 A;  5J3W A;  4HH3 A;  3SW1 A;  4BBT A;  3F1O B;  3MJQ A;  1OTA A;  1F9I A;  4L9E A;  1N9N A;  2EA9 A;  1DRM A;  5HWV A;  1LT0 A;  3D72 A;  2ZOH A;  3CLO A;  2OWJ A;  3RH8 B;  4WF0 A;  3F1N A;  3H7W B;  3K3D A;  4HIA A;  3H82 B;  4B9O A;  5DKL A;  4LPZ A;  2V0U A;  4R3A A;  4NXB A;  1OJ5 A;  3EEH A;  5DJU A;  5IS1 A;  4H6J B;  1OT6 A;  5HSQ A;  3A0S A;  3HJI A;  1DP8 A;  1XFN A;  5HZH A;  4L9F A;  5TBM B;  4EES A;  2B02 A;  3NJA A;  3EWK A;  3C2W A;  4R6L A;  2VV7 A;  4HI4 A;  2Z6C A;  3PYP A;  1S66 L;  2D02 A;  4GHI B;  3UB6 A;  2QJ5 A;  2PD7 A;  4WUJ A;  3F1P A;  2V1A A;  5F6A A;  3UME A;  5KIZ A;  1OTD A;  1OTI A;  1S4S A;  1LL8 A;  2QHK A;  4WLA A;  3UE6 A;  3UB9 A;  5F69 A;  4E04 A;  1MZU A;  2WKP A;  4HNB A;  1OT9 A;  1TS7 A;  5DKK A;  2I9V A;  4I3I A;  4HY8 A;  1N9L A;  2KX6 A;  1S1Z A;  4EW7 A;  3LIC A;  4MN6 A;  5DJT A;  5HWT A;  2VV8 A;  3UB8 A;  3MR0 A;  3B33 A;  3OLO A;  3VE3 A;  4JGO A;  2D01 A;  1DP9 A;  1XFQ A;  4HOI A;  3CWF A;  1T19 A;  4GS9 A;  1V9Z A;  2PD8 A;  1OJG A;  1JNU A;  2L1M A;  1OTE A;  1DP6 A;  2ZBB A;  2V0W A;  1TS6 A;  2YKH A;  4EXO A;  1LSX A;  2W27 A;  3F1P B;  3CAX A;  3PHY A;  2PR6 A;  2V1B A;  1X0O A;  5HD3 A;  4EER A;  4NXE A;  5HD5 A;  2PYR A;  1XJ6 A;  3A0V A;  2KDK A;  5IU1 A;  4GCZ A;  5AVE A;  3NOT C;  1S4R A;  4HJ3 A;  2K7S A;  1N9O A;  4PKY A;  2BAS A;  3MQQ A;  4KUO A;  2A24 B;  4HP9 A;  4KQD A;  1T1B A;  1T18 A;  4EEU A;  2GJ3 A;  1T1A A;  2QJ7 A;  3BWL A;  4F3L A;  3NOP C;  5F68 A;  3UB7 A;  1WA9 A;  1KOU A;  2JN7 A;  4HJ6 A;  2PDR A;  4HHD A;  4XT2 A;  4RQ9 A;  3C8C A;  2YKF A;  2QKP A;  2WKQ A;  1Y28 A;  1GSW A;  1OTB A;  4I5S A;  3F1O A;  3ULF A;  1ODV A;  5HWW A;  4YWZ A;  3FG8 A;  3VOL A;  4WN5 A;  2VV6 A;  4WL9 A;  4PKY G;  3MFX A;  2W0N A;  1XJ4 A;  2P7J A;  1S67 L;  5G4Y A;  1LSV A;  1UWN X;  1UWP X;  5HDD A;  1BYW A;  4DJ3 A;  3K3C A;  3F1N B;  2J80 A;  3BY9 A;  1TS8 A;  2L4R A;  4HP4 A;  2PHY A;  5G4Z A;  3H7W A;  4I39 A;  3LID A;  5HDC A;  5HDS A;  4H6J A;  4F3L B;  3LIF A;  4HJ4 A;  4R70 A;  5TBM A;  3LIE A;  3LUQ A;  3HJK A;  4XT2 B;  2V9A A;  4I3A A;  3IS2 A;  3GEC A;  3E4O A;  5J7E A;  3LIA A;  4GHI A;  4KUK A;  3IBR A;  2CMN A;  2Z6D A;  2JHE A;  4R38 A;  3T50 A;  1T1C A;  3BY8 A;  3H9W A;  1XJ2 A;  2HV1 A;  2OOL A;  1V9Y A;  2WKR A;  1P0Z A;  3VE4 A;  3RTY A;  1EW0 A;  2L0W A;  2PYP A;  1G28 A;  4BBV A;  3FC7 A;  4GW9 A;  1D7E A;  4M4X A;  1P97 A;  3LI9 A;  1XJ3 A;  3ICY A; 
#chains in the Genus database with same CATH topology
 5GLD A;  3SS5 A;  3PBR A;  1M40 A;  4OLG A;  2IWD A;  1LSW A;  1PWG A;  4WEJ A;  3OPH A;  4KZ9 A;  4NXF A;  3G4P A;  4EQ1 A;  1YLJ A;  4MMN A;  1NRJ A;  4EET B;  2HGV A;  5DFX A;  4DN0 A;  4E3J A;  4KZB A;  3E0Y A;  3LIB A;  3PAG A;  2WGV A;  4KZ3 A;  5E2E A;  5CX7 A;  2R9W A;  3NHQ A;  3M6B A;  4Q0J A;  2P74 A;  4X53 A;  2GX5 A;  5E43 A;  3CMZ A;  5F5Y A;  4HH2 A;  2OLU A;  3MXR A;  3L7H A;  1BLC A;  3Q07 A;  1E25 A;  5CHJ A;  2VGK A;  1WYC A;  2OLV A;  5MC7 A;  1MC0 A;  2ZM8 A;  3LI8 A;  3DTK A;  5HL1 A;  2JC7 A;  4K0W A;  4PPR A;  1L0G A;  2A24 A;  2E8I A;  2R9X A;  4DE1 A;  1PNE A;  4BBU A;  1QMF A;  3LEZ A;  5AVF A;  5TGF A;  2VEA A;  1G5U A;  1S1Y A;  1NYM A;  3UNW A;  3P09 A;  1GSV A;  3IWO A;  3HLW A;  3HRE A;  5J3W A;  4IVI A;  4LGW A;  3PTE A;  4BL2 A;  4BBT A;  1NY0 A;  3IX4 A;  4JF5 A;  3QHY A;  3NY4 A;  4OPZ A;  3MJQ A;  3U4L P;  2HDU A;  5EPH A;  2W3H A;  5LBR A;  2ZC3 B;  3LR4 A;  3SS3 A;  3LY4 A;  3IX8 A;  2A3U A;  2EA9 A;  3C4O A;  2FFF B;  1RCJ A;  2HZ5 A;  4DKI A;  3CUE C;  1CQA A;  4OVD A;  5KSH A;  1JWV A;  5HWV A;  1MKM A;  2C6W B;  3BFC A;  3D72 A;  2HP9 A;  2Y59 A;  1CJF A;  5FEG A;  5EEC A;  3HL9 A;  2O9A A;  3BQ8 A;  5GL9 A;  3RH8 B;  3V5M A;  2ZL1 A;  3QNB A;  1YMX A;  3H7W B;  5CHM A;  1Z09 A;  3K3D A;  4LV2 A;  2V0U A;  4R3A A;  5A93 A;  3CPT B;  3EEH A;  1VEU A;  4KZA A;  5FA7 A;  5IS1 A;  3VMA A;  1XKZ A;  3TOI A;  3HCY A;  4QU3 A;  1DP8 A;  3E2L A;  3O5Y A;  4EES A;  5HL6 A;  2XFS A;  4R1G A;  4WZ4 A;  1BZA A;  1FSW A;  1IYP A;  3UPN A;  4R6L A;  5FL3 A;  5DTT A;  3PYP A;  3HVF A;  2D02 A;  4GD6 A;  4G3V A;  1NRF A;  3FV7 A;  2XRO A;  2NUP C;  1CI8 A;  3F1P A;  3UDI A;  1VHM A;  3UDX A;  4OOL A;  3M6H A;  1ZG6 A;  3HLC A;  1MWU A;  4ESP A;  3BLS A;  4ETZ A;  1NZO A;  2BG1 A;  4B4X A;  3BEB A;  2X71 A;  3T1R A;  2KLI A;  3NUL A;  4WLA A;  3W8K A;  2Q9M A;  2ZQA A;  3WS1 A;  4YNR A;  5F69 A;  3O88 A;  4HNB A;  3O87 A;  1K55 A;  1GHI A;  4WBG A;  3R4K A;  4IUK A;  5DF7 A;  2G2U A;  5HWT A;  1GA9 A;  3VSK A;  4ZBE A;  3GSG A;  5DF8 A;  3OLO A;  1RGY A;  4OQG A;  1XFQ A;  1W5D A;  3OCL A;  3CWF A;  1T19 A;  3ITA A;  3UO9 A;  2ZQC A;  1V9Z A;  4S2K A;  2V1Z A;  3LEQ A;  5EUA A;  4LV0 A;  1ZC2 A;  3EQV A;  3OBF A;  1FSY A;  2YKH A;  2W27 A;  5FI6 A;  3CAX A;  5CXW A;  5HFO A;  4KEN B;  2O0Y A;  4EER A;  1MY8 A;  3MS6 A;  5AQB A;  5FI7 A;  4UHU A;  2KDK A;  4E3M A;  5IU1 A;  4UA9 A;  2EFX A;  2ZM2 A;  5BOH A;  3DTI A;  2Q0O A;  5GHZ A;  1E3U D;  2K7S A;  1N9O A;  4PKY A;  2WAD A;  2A24 B;  2WYX A;  1LL9 A;  5L8M A;  1T18 A;  4EEU A;  1WYB A;  4OQ0 A;  1Q2Q A;  2EWW A;  1T1A A;  4FCF A;  1NLZ A;  3E2K A;  5GHY A;  1WA9 A;  4LFU A;  3Q81 A;  3IHB A;  1H8Z A;  4HJ6 A;  2WZZ A;  2PU4 A;  4HHD A;  4XT2 A;  4P6B A;  3AGD A;  5AQA A;  1F5M A;  2WKQ A;  1K57 A;  3FKW A;  2VKS A;  1OTB A;  4I5S A;  1KDW A;  3V3S A;  2CC1 A;  1HLU P;  3ULF A;  4GD8 A;  3FG8 A;  4PKY G;  4B4Z A;  2W0N A;  3GR2 A;  1TVF A;  3IH8 A;  1LL5 A;  2EXB A;  2PU2 A;  3PBQ A;  3ZG7 B;  4R23 A;  1UWP X;  2Y55 A;  1BYW A;  2XRN A;  2ZL1 B;  5JYP A;  4HBU A;  1TS8 A;  2L4R A;  5FDS A;  3FKV A;  4GN2 A;  2XLN A;  4HP4 A;  1O07 A;  1L0E A;  3VP1 A;  1KVL A;  3B3X A;  1IYO A;  4N92 A;  2XR0 A;  4MLL A;  4H6J A;  3BLM A;  3WS0 A;  3V50 A;  4F3L B;  2OAQ 1;  2W3E A;  1IOU A;  1PIO A;  4R70 A;  3HUM A;  3HJK A;  1MBL A;  4XUZ A;  3RXW A;  5CHU A;  3DW0 A;  5J8X A;  4GHI A;  1ALQ A;  2BLS A;  2JHE A;  3KSI A;  3SS4 A;  3W4P A;  1H3Q A;  2VGJ A;  1F2K A;  2HDR A;  2XF3 A;  4DXC A;  3GMW A;  3NDG A;  3H9W A;  5FAP A;  3MSH A;  1V9Y A;  3BJN A;  1YMS A;  3A3D A;  4GOG A;  3RTY A;  4RA7 A;  5L2F A;  3KYZ A;  2PYP A;  4MN7 A;  4BBV A;  3IF6 A;  3FC7 A;  5F83 A;  3VP3 A;  3M2K A;  4R0Q A;  4Y17 A;  4CLC D;  4FUW A;  2JKR I;  3IBJ A;  4M4X A;  1G6O A;  4PM9 A;  1PW1 A;  3G32 A;  2XSS A;  3QP5 A;  1W8Y A;  1NZU A;  3ISG A;  5EFW A;  3UB5 P;  2M7V A;  1K54 A;  1YSP A;  4EEP A;  3PAE A;  4RX3 A;  3S7P A;  2H28 A;  1K6R A;  4DJ2 A;  3G31 A;  3NOU C;  2ZQ9 A;  2GZA A;  3FZC A;  4EV4 A;  2O99 A;  3KX0 X;  3IHA A;  1BLS A;  2XFT A;  4HQA A;  4JGQ A;  1FCN A;  5I5L A;  3RJU A;  3EGX C;  4MCW A;  5GLB A;  3WWX A;  2ZOI A;  2V8C A;  4N1X A;  2VGL S;  4CQH A;  1XA1 A;  2UV0 E;  2VLG A;  4LRZ E;  3ZQ5 A;  5TR7 A;  2J9P A;  3LY3 A;  1L3L A;  5FQQ A;  3MKF A;  3G34 A;  3G2Y A;  3IQA A;  1K56 D;  1UGU A;  4O01 A;  3ZG9 B;  3TG9 A;  2PBD P;  5FAQ A;  3HLF A;  3BM6 A;  1PI5 A;  5EVI C;  4U3T A;  5EOE A;  1TS0 A;  4R4S A;  4HBT A;  3CPT A;  4HES A;  3P7N A;  4GNU A;  4BWI A;  3MQO A;  2J3T C;  3S7N A;  3ZGA B;  4P6Z S;  1ESU A;  4I3J A;  5FSR A;  1ES2 A;  4MN5 A;  2Y2J A;  4G3K A;  3T4J A;  5CTM A;  2LB5 A;  1VB6 A;  2A2L A;  1IKI A;  2Y79 A;  4Y15 A;  3O3V A;  3A3I A;  2OAP 1;  4QJG A;  2DMW A;  2W3F A;  1GA0 A;  4DE2 A;  3UE0 A;  3VP2 A;  3BFE A;  4O8G A;  4ZDX A;  3OZH A;  3CI6 A;  2LB9 A;  2W3D A;  1MXO A;  4C75 A;  3E98 A;  4II7 A;  1JWZ A;  2J7V A;  1ONH A;  1DRM A;  3S7Q A;  5CGS A;  2HJE A;  3PXP A;  4GDN A;  1W7F A;  3LCE A;  1Y54 A;  3F1N A;  1BUE A;  3DWK A;  2XH9 A;  3T1X A;  4B9O A;  2VK3 A;  4LPZ A;  5AQ7 A;  3MZF A;  5KZH A;  4H6J B;  3V67 A;  4WEL A;  4UQI M;  4X1M A;  3QNC A;  4OP8 A;  2Y2P A;  2B02 A;  2B95 A;  2VJW A;  3IWI A;  4IVK A;  2RL3 A;  2VV7 A;  2Z6C A;  1S66 L;  2FH5 A;  4GHI B;  4S2N C;  3UB6 A;  2QJ5 A;  3SH7 A;  4QB8 A;  4Y7P A;  3UME A;  2EX9 A;  3WRT A;  3FYZ A;  3TW8 A;  2Y2Q A;  3OPL A;  4X55 A;  1D1J A;  1SDN A;  2VZW A;  4GZB A;  4JBF A;  3ZDJ A;  2Y2K A;  4QPR A;  3IF6 B;  3UY6 A;  2P04 A;  4X56 A;  2XD5 A;  3T4S A;  1SHV A;  3NBL A;  4ETX A;  3C7V A;  1MZU A;  4RVA A;  1EI5 A;  2WKP A;  1OT9 A;  5CTN A;  5DKK A;  4DXB A;  4I3I A;  4K91 A;  1YLT A;  3VV4 A;  4EBN A;  1S1Z A;  1K6S A;  2VV8 A;  3KYE A;  4ZRR A;  2XQZ A;  2X01 A;  1GHP A;  2C5W B;  2D01 A;  2I72 A;  1DP9 A;  2HJ9 C;  4GDB A;  3Q7V A;  5HAR A;  3NDE A;  4OOM A;  2PD8 A;  1OJG A;  2BTF P;  1JNU A;  2HP6 A;  1OTE A;  3PBO A;  4WZ5 A;  4MEZ A;  4JXS A;  1CF0 A;  4EXO A;  3IXH A;  4U0T A;  3S7O A;  4AFI A;  4KZ8 A;  4A5R A;  3T4K A;  1TD5 A;  1TDG A;  3PHY A;  1X0O A;  5HD3 A;  1YSQ A;  3A0V A;  1PI4 A;  3D9Y A;  2HPB A;  4GB7 A;  3NCK A;  4GCZ A;  5AVE A;  4P85 A;  1S4R A;  2EX8 A;  3JYI A;  1SZV A;  1LHY A;  3G2Z A;  4WMC D;  3SOI A;  2JKR M;  4DMZ A;  4R3J A;  2IWC A;  4E3L A;  1IFQ A;  2QJ7 A;  4YOF A;  4FH2 A;  4F3L A;  5F68 A;  4EQI A;  3QP1 A;  2K31 A;  5DFY A;  3S4X A;  1OPX A;  5EVL A;  5FQK A;  3ZG0 A;  1JWP A;  4QD4 A;  4CLC E;  3R7W A;  1BT5 A;  3IX3 A;  3OPR A;  3VP4 A;  3C8C A;  1BLP A;  1Y28 A;  1PZO A;  3Q1F A;  1ZG4 A;  3B42 A;  5CGW A;  1ODV A;  4KZ5 A;  3VOL A;  3LO7 A;  4WL9 A;  2DCF A;  3SH9 A;  3LR3 A;  2P7J A;  1YKD A;  2EX2 A;  3VFH A;  1AWI A;  4ZAM A;  1UWN X;  5E2G A;  2ZMF A;  1IEL A;  5F1G A;  5CEC A;  2WGI A;  3MBZ A;  3WRZ A;  3F1N B;  4L0L A;  2WKH A;  4OH0 A;  1E3U A;  5E2F A;  2H10 A;  4LEN A;  5G4Z A;  3N8R A;  1KGE A;  3P01 A;  4C6Y A;  3SH8 A;  3N8S A;  1O7E A;  5HDC A;  5HDS A;  1NLY A;  5GLA A;  3KSH A;  4X68 A;  4KZ4 A;  1LI0 A;  3LIF A;  3VP0 A;  4FH4 A;  3N7W A;  3D4F A;  3T4O A;  1KGF A;  4KUK A;  2Y2L A;  4N1H A;  3SZT A;  2CMN A;  2JKF A;  3ZYT A;  3DTM A;  1W79 A;  3LR0 A;  4NET A;  3T50 A;  3MQ0 A;  3BY8 A;  4QHC A;  4RYE A;  1CK3 A;  1YAX A;  5L10 A;  1W8Q A;  3CZD A;  4IJG A;  3IWQ A;  5FQI A;  2KOI A;  4DE3 A;  4BQM A;  2ZQD A;  1KDS A;  1HD8 A;  4X69 A;  3T12 B;  1KGG A;  3ZCZ A;  3LI9 A;  1XJ3 A;  5I94 A;  2ZQ8 A;  2JKT I;  3IT9 A;  4P87 A;  1AXB A;  3E4P A;  2UWX A;  2P9V B;  3Q7V B;  4O0P A;  3T1S A;  5A8B A;  1FR6 A;  3D3O A;  2INW A;  1YLP A;  3IS2 B;  4OKP A;  1K55 C;  1OME A;  3E4Q A;  2QZ6 A;  4N9L A;  2E8J A;  1TEM A;  2JE5 A;  1I2W A;  4I38 A;  1PYY A;  5FAT A;  1BTL A;  3U2A A;  4LRY C;  3HLB A;  4L9G A;  3GDI A;  3RXX A;  3QP2 A;  5KSC A;  4B93 A;  3MZD A;  1F98 A;  1NWZ A;  1LLB A;  2GNX A;  4XUX A;  5G18 A;  1DJA A;  3EEA A;  3LYX A;  3MMH A;  4EUV A;  4CLC A;  4KG2 A;  4LV3 A;  3WS4 A;  5E2H A;  1D06 A;  3MXQ A;  1WE4 A;  2M1C A;  4FSF A;  1VQQ A;  3V39 A;  4Q8I A;  2QWS A;  3BFG A;  4MBK A;  3FPW A;  2PR5 A;  4JGR A;  3R7W B;  4HEF A;  4ZJ1 A;  2WKI A;  3L9K A;  4K08 A;  2H0T A;  1CEF A;  1VET A;  5HAI A;  3SW1 A;  3V3R A;  4DRT A;  3PR6 A;  4D60 A;  3ZFZ A;  4QY6 A;  1ZKJ A;  3BQA A;  2V20 A;  5FQJ A;  3LFV A;  1OTA A;  4L9E A;  2NUT C;  4NEE D;  3DBA A;  1N9N A;  1NJ4 A;  4E3N A;  1H5X A;  2ZMV A;  1S6R A;  4KQR A;  2ZOH A;  3CLO A;  3OOV A;  1MPL A;  3KSF A;  3OC2 A;  1K56 A;  1K57 C;  5JYO A;  4JXG A;  5DVA A;  4HIA A;  3H82 B;  5DKL A;  5EM0 A;  5DTS A;  2ZQ7 A;  5M19 A;  1SKF A;  1OT6 A;  3MF0 A;  3A0S A;  4E3K A;  3ITB A;  4GLQ A;  1XFN A;  5HZH A;  1FCO A;  5D3O A;  4OOY A;  3S1Y A;  3EWK A;  5F1F A;  3IH9 A;  3ZNT A;  2XA7 S;  5HW3 A;  3C2W A;  4MBF A;  4HI4 A;  3UE1 A;  5EVI D;  5CRF A;  2ZC5 B;  2PD7 A;  4Y0T A;  5A92 A;  1YPR A;  3TJZ C;  1TF1 A;  1Y4O A;  1Z6F A;  2V1A A;  1FR1 A;  4E3I A;  4WEK A;  2J3T D;  5KIZ A;  1OTD A;  5FAO A;  1S4S A;  3W2Z A;  1YLZ A;  3EOI A;  1ZTU A;  1MWR A;  5U47 A;  1M6K A;  1E4D A;  2ZMA A;  3UB9 A;  4E04 A;  2V2F F;  1I5Q A;  1SDE A;  1TS7 A;  3QP4 A;  3T4T A;  2I9V A;  4XXR A;  4HY8 A;  1H0M A;  3HUO A;  5DJT A;  3C38 A;  4BEN A;  3B33 A;  3O86 A;  5HPI A;  2WZX A;  2ZJ9 A;  4OPY A;  4GS9 A;  3GVB A;  3IF6 C;  1ONG A;  2ZD8 A;  4ZJ3 A;  1ESI A;  3PBS A;  1W63 Q;  4JXW A;  2RCX A;  4JPM A;  2ZBB A;  1U60 A;  1TS6 A;  2V0W A;  1FQG A;  5FEF A;  1L2S A;  1DJC A;  1K38 A;  1K25 A;  5EV0 A;  4PM5 A;  2PR6 A;  1C3B A;  2ZC4 B;  1HZO A;  2V1B A;  4NG2 A;  5L07 A;  2JKG A;  4R3B A;  1K54 C;  2FZ0 A;  2K2N A;  1XJ6 A;  3T4L A;  1XX2 A;  2W3G A;  3C5A A;  1VM1 A;  3NOT C;  3MKE A;  3GV9 A;  3PBT A;  4D2O A;  1ACF A;  5EVE A;  5TJJ A;  2BAS A;  4IED A;  4KUO A;  1YQS A;  4KQD A;  4CLC B;  4BL3 A;  1SCW A;  2GDN A;  2WAF A;  3G35 A;  3GTC A;  4PM8 A;  3FPV A;  3BWL A;  4DE0 A;  4PHT A;  2WKE A;  3NOP C;  1ES5 A;  3ZG8 B;  1KOU A;  3CUE A;  2J8Y A;  1MKI A;  2PDR A;  1IYS A;  1VET B;  4DF6 A;  4MDZ A;  4RQ9 A;  2YKF A;  4X25 A;  2PAV P;  2QKP A;  1HVB A;  2IWB A;  3F1O A;  5EVI B;  5HWW A;  3VOY A;  5DTK A;  4YWZ A;  3B47 A;  3JVV A;  4CPK A;  2VV6 A;  4WN5 A;  4S2I A;  2JBF A;  2Y2N A;  2QYB A;  1NXY A;  1HTZ A;  1LSV A;  2VX8 A;  4M3K A;  5CED A;  3VOZ A;  2DNS A;  4DJ3 A;  1ES4 A;  1NYY A;  3A3J A;  3BY9 A;  1SKO B;  4UAA A;  2QMI A;  1YLY A;  2G7U A;  4WMC A;  3HUN A;  1P9R A;  3LID A;  2EX6 A;  4BD0 A;  4IHQ A;  2P9V A;  2Z2M B;  2EXA A;  3ZG5 A;  1YM1 A;  1CEG A;  5F82 A;  1ERO A;  5TBM A;  3LIE A;  2O9C A;  3UE3 A;  5C5K A;  3LUQ A;  1IKG A;  4DDS A;  4I3A A;  3IS2 A;  3GEC A;  5J7E A;  3LIA A;  5HX9 A;  1MWS A;  3IBR A;  5AJG A;  2XGN A;  4KQO A;  3C30 A;  2Y4A A;  4OPR A;  5K5B A;  1FOF A;  2Y8H A;  4S2P A;  1XP4 A;  1T1C A;  2HF6 A;  1XJ2 A;  4S2O A;  4Q0I A;  3VE4 A;  4KG5 A;  4MNR A;  4IBX A;  3BEC A;  2Y2H A;  2XA7 M;  4EWF A;  4X1L A;  4QY5 A;  4LCM A;  3DAV A;  1P97 A;  4LV1 A;  3CJM A;  4KZ6 A;  3ICY A;  2VGL M;  1YT4 A;  2ZLY A;  2ZM0 A;  5J4E A;  4QWO A;  2R78 A;  1GSX A;  4E6X A;  4S2J A;  3BYD A;  3G6O A;  1BSG A;  4GS9 B;  2M7U A;  4JGP A;  3IXD A;  1ERQ A;  3WS5 A;  5HAP A;  3TSG A;  3HLD A;  2P08 A;  1H8Y A;  4Y3I A;  1A0K A;  1MWT A;  4OP5 A;  4ID4 A;  3CIT A;  1K4F A;  3W4Q A;  3UMD A;  4U0X A;  4YFM A;  4ARZ A;  4P6Z M;  3AGF A;  2W1T A;  4Y5F A;  2Z2L B;  4IBR A;  3BW6 A;  1XPB A;  4NXG A;  1GHM A;  1S0W A;  3NIA A;  4Q0H A;  1FIL A;  4OQH A;  3N8L A;  1KE0 A;  5AQ9 A;  3A3F A;  3OCN A;  1PRQ A;  3H82 A;  4WZ5 C;  4LLO B;  2WUQ A;  2HDQ A;  4OPQ A;  2OWH A;  4LRX C;  5EE8 A;  3ZNY A;  4JLF A;  3NI9 A;  4JF6 A;  2DRW A;  1EWZ A;  5IHV A;  4ZJ2 A;  2Y2M A;  2OV5 A;  3A0R A;  1QME A;  5EOO A;  1XXM A;  4NKP A;  4HH3 A;  4FOF A;  2J9O A;  4ME4 A;  2Y2O A;  3LR5 A;  3F1O B;  3TRC A;  4JF4 A;  3MXS A;  3UPP A;  1F9I A;  2V8F A;  3EQU A;  2H0Y A;  2X02 A;  3DWZ A;  3W4O A;  4FTX A;  3NC8 A;  4BD1 A;  3PBN A;  4EU0 A;  1K0K A;  1LT0 A;  3UN7 A;  2PBY A;  2OWJ A;  1L0F A;  4UA6 A;  1W63 M;  3IF5 A;  4WF0 A;  4OLD A;  1JTD A;  4KQQ A;  3QP6 A;  2XD1 A;  4NXB A;  1OJ5 A;  4S2L A;  4EUZ A;  5DJU A;  4Y0U A;  5CEB A;  4OQI A;  1ERM A;  2WGW A;  5HSQ A;  2FFY A;  3HJI A;  1ES3 A;  2B5R A;  4LCL A;  3VFF A;  4Y0O A;  1DJB A;  4L9F A;  4JXV A;  5TBM B;  1I2S A;  3NJA A;  3JVU A;  3C4P A;  4UEY A;  1XGJ A;  2AVX A;  1IEM A;  1J3W A;  3KYQ A;  3S22 A;  4WUJ A;  5F6A A;  2VA0 A;  4E3O A;  1OTI A;  2XDM A;  3BFF A;  3UPO A;  1LL8 A;  2Y91 A;  2QHK A;  4MBH A;  4UQI S;  2HDS A;  4Z9Q A;  1TDL A;  3GQZ A;  5TFQ A;  1KVM A;  1RP5 A;  3UE6 A;  3HLG A;  5FQ9 A;  3A3E A;  3KO6 A;  1PW8 A;  3CHW P;  1LI9 A;  2EFU A;  1N4O A;  3CG5 A;  3ZHH A;  4N9K A;  2IA2 A;  1JTG A;  2WK0 A;  3UDF A;  2OSU A;  4EW7 A;  1N9L A;  2KX6 A;  3DTE A;  3LIC A;  4MN6 A;  5A90 A;  1VEU B;  3UB8 A;  2MJ6 A;  3MR0 A;  4PM6 A;  1RGZ A;  4JKT A;  4GKU A;  1N9B A;  4JGO A;  4P0M A;  3VE3 A;  3VSL A;  3RFB A;  2ZC7 A;  4HOI A;  2XEP A;  3HBR A;  4Y2F A;  3T1Q B;  4BMW A;  4BLM A;  1Q2P A;  2L1M A;  2B18 A;  3Q7Z A;  1DP6 A;  1KE4 A;  4YIN A;  3AGE A;  5EVI A;  4ARZ B;  1LSX A;  5HPF A;  2W1T B;  3F1P B;  1JVJ A;  2A49 A;  1PFL A;  3BRM A;  4NXE A;  4IUH A;  1ZHH B;  1G6A A;  5HD5 A;  1PWC A;  2PYR A;  4WM9 A;  4UA7 A;  1BLH A;  4PAU A;  3MFD A;  4HJ3 A;  4S2M A;  1SKO A;  3MQQ A;  1FIK A;  3P98 A;  2ACG A;  2O9B A;  4HP9 A;  3T4Q A;  1T1B A;  4R4R A;  4B88 A;  5A91 A;  2EWV A;  2GJ3 A;  2PRF A;  3ZVW A;  1KE3 A;  2HP5 A;  3LGO A;  1PZP A;  3FWL A;  3K2N A;  1BUL A;  3UB7 A;  3ZVT A;  1IYQ A;  3N4I A;  4RX2 A;  2JN7 A;  4PM7 A;  5FQM A;  5L09 A;  2JCH A;  3NEC A;  1GSW A;  1XGI A;  2ZC6 B;  4CLC C;  2QPN A;  4ZTK A;  5CGX A;  2Y2I A;  4KG6 A;  3HLE A;  3MFX A;  1FCM A;  1XJ4 A;  1S67 L;  5FAS A;  1H8M A;  5G4Y A;  2PT7 A;  1STZ A;  4O7D A;  5EM1 A;  5FI2 A;  2WAE A;  3TE8 A;  5HDD A;  4C3Q A;  3I7J A;  4PMA A;  3K3C A;  1DY6 A;  4EBP A;  2J80 A;  3IXB A;  3JPU A;  1GCE A;  5HAQ A;  4X6T A;  5IT5 A;  4S2N A;  2PHY A;  2W1R A;  3H7W A;  4EBL A;  4I39 A;  4G3W A;  4K0X A;  3MZE A;  2WGW B;  3C7U A;  3Q82 A;  5FDH A;  4F94 A;  4HJ4 A;  3BFD A;  2J3W A;  1XA7 A;  3KSG A;  1CI9 A;  5M18 A;  5GHX A;  5GLC A;  3OPP A;  3M2J A;  5M1A A;  5KMW A;  2Y2G A;  1YLW A;  2V9A A;  4XT2 B;  3E4O A;  2H5S A;  4FD8 A;  3EGD C;  4NK3 A;  5CER A;  2Z6D A;  4OON A;  4H8R A;  4KZ7 A;  3GRJ A;  3G30 A;  4R38 A;  4CJN A;  2Q9N A;  3IXG A;  1K4E A;  1G68 A;  2HV1 A;  2OOL A;  2WKR A;  4BJP A;  1P0Z A;  4E6W A;  1EW0 A;  5DF9 A;  2L0W A;  4Z1W A;  3N6I A;  4WYY A;  3WS2 A;  4DDY A;  1G28 A;  1J9M A;  2G2W A;  4GJ4 A;  4GW9 A;  1D7E A;  2XK1 A;  1L0D A;  1P9W A;  3QP8 A;  4Y13 A;  2JKT M;  1PWD A; 
#chains in the Genus database with same CATH homology
 2VGL M;  2JKT I;  5J4E A;  3E4P A;  5EFW A;  2R78 A;  1GSX A;  2M7V A;  3PBR A;  1YSP A;  4EEP A;  3G6O A;  4O0P A;  3S7P A;  4GS9 B;  2M7U A;  5A8B A;  4JGP A;  2H28 A;  1LSW A;  4WEJ A;  4DJ2 A;  4NXF A;  3D3O A;  4EQ1 A;  2P08 A;  3NOU C;  4Y3I A;  2INW A;  4MMN A;  1NRJ A;  3CIT A;  3IS2 B;  4EET B;  2GZA A;  2HGV A;  5DFX A;  4DN0 A;  2O99 A;  3E0Y A;  3LIB A;  3E4Q A;  3KX0 X;  3UMD A;  5CX7 A;  4HQA A;  3NHQ A;  4ARZ A;  4Q0J A;  4P6Z M;  4I38 A;  4JGQ A;  5I5L A;  2W1T A;  3EGX C;  4MCW A;  4Y5F A;  2GX5 A;  2ZOI A;  5F5Y A;  4HH2 A;  2VGL S;  3U2A A;  4CQH A;  3BW6 A;  4LRY C;  2VLG A;  4L9G A;  4LRZ E;  3ZQ5 A;  4NXG A;  3GDI A;  4Q0H A;  4B93 A;  1UGU A;  1F98 A;  4O01 A;  1NWZ A;  2GNX A;  5MC7 A;  1MC0 A;  3LI8 A;  3OCN A;  3EEA A;  3LYX A;  3H82 A;  3MMH A;  4LLO B;  1TS0 A;  2A24 A;  4EUV A;  4CLC A;  3P7N A;  2OWH A;  4LRX C;  3MQO A;  4BWI A;  4BBU A;  1D06 A;  2J3T C;  3MXQ A;  2M1C A;  3S7N A;  4FSF A;  5AVF A;  4P6Z S;  2VEA A;  2QWS A;  4I3J A;  3FPW A;  1S1Y A;  4MN5 A;  3A0R A;  2PR5 A;  4G3K A;  3T4J A;  4JGR A;  4NKP A;  3R7W B;  2LB5 A;  1GSV A;  4K08 A;  1VB6 A;  2A2L A;  2Y79 A;  5J3W A;  4HH3 A;  4FOF A;  2OAP 1;  4ME4 A;  3SW1 A;  2DMW A;  3PR6 A;  4BBT A;  2W3F A;  3LR5 A;  3F1O B;  3TRC A;  3BQA A;  3MJQ A;  3LFV A;  1OTA A;  1F9I A;  4L9E A;  4O8G A;  2NUT C;  2W3H A;  4NEE D;  3EQU A;  3CI6 A;  2LB9 A;  2W3D A;  5LBR A;  3DBA A;  1N9N A;  3LR4 A;  3E98 A;  4II7 A;  2EA9 A;  1DRM A;  3S7Q A;  2ZMV A;  3CUE C;  3PBN A;  4EU0 A;  2HJE A;  5KSH A;  5HWV A;  1LT0 A;  1MKM A;  3D72 A;  2ZOH A;  3CLO A;  3OOV A;  3PXP A;  2OWJ A;  3KSF A;  2O9A A;  3OC2 A;  3BQ8 A;  3RH8 B;  1W63 M;  4WF0 A;  3F1N A;  3H7W B;  3K3D A;  4HIA A;  3H82 B;  4B9O A;  5DKL A;  4LPZ A;  2V0U A;  4R3A A;  4NXB A;  1OJ5 A;  3EEH A;  5DJU A;  5IS1 A;  4H6J B;  3V67 A;  4WEL A;  1OT6 A;  4UQI M;  3HCY A;  3MF0 A;  5HSQ A;  3A0S A;  3HJI A;  4GLQ A;  1DP8 A;  1XFN A;  5HZH A;  4L9F A;  3O5Y A;  5TBM B;  4EES A;  5HL6 A;  2B02 A;  3NJA A;  3JVU A;  4UEY A;  3EWK A;  2VJW A;  2XA7 S;  3C2W A;  2VV7 A;  4HI4 A;  4R6L A;  2Z6C A;  5FL3 A;  3PYP A;  1S66 L;  2FH5 A;  2D02 A;  4GHI B;  3UB6 A;  4G3V A;  2QJ5 A;  3KYQ A;  2PD7 A;  2XRO A;  4WUJ A;  2NUP C;  3F1P A;  1VHM A;  1TF1 A;  2V1A A;  5F6A A;  3TJZ C;  2VA0 A;  4WEK A;  3UME A;  2J3T D;  4OOL A;  1OTD A;  5KIZ A;  1OTI A;  1S4S A;  3TW8 A;  3W2Z A;  1LL8 A;  3EOI A;  1ZTU A;  4ETZ A;  2QHK A;  2VZW A;  4UQI S;  4QPR A;  2KLI A;  4WLA A;  3UE6 A;  2P04 A;  3UB9 A;  3KO6 A;  4YNR A;  5F69 A;  3T4S A;  4E04 A;  4ETX A;  1MZU A;  2WKP A;  4HNB A;  1OT9 A;  1TS7 A;  2IA2 A;  5DKK A;  3T4T A;  2I9V A;  4I3I A;  3R4K A;  4IUK A;  4HY8 A;  1N9L A;  2KX6 A;  1S1Z A;  3VV4 A;  4EW7 A;  3LIC A;  4MN6 A;  5DJT A;  2VV8 A;  5HWT A;  3C38 A;  3UB8 A;  4ZRR A;  2MJ6 A;  3MR0 A;  3B33 A;  5HPI A;  3OLO A;  3VE3 A;  4JGO A;  2D01 A;  3RFB A;  1DP9 A;  1XFQ A;  3OCL A;  2HJ9 C;  4HOI A;  3CWF A;  1T19 A;  4GS9 A;  4Y2F A;  4BMW A;  1V9Z A;  4OOM A;  2PD8 A;  1OJG A;  1JNU A;  2L1M A;  2B18 A;  3EQV A;  1OTE A;  3OBF A;  3PBS A;  1DP6 A;  3PBO A;  1W63 Q;  2ZBB A;  2V0W A;  1TS6 A;  2YKH A;  4ARZ B;  4EXO A;  1LSX A;  2W27 A;  3S7O A;  4AFI A;  5HPF A;  2W1T B;  3F1P B;  3CAX A;  3T4K A;  1TD5 A;  3PHY A;  2PR6 A;  2V1B A;  1X0O A;  2O0Y A;  5HD3 A;  4EER A;  1YSQ A;  4NXE A;  4IUH A;  1ZHH B;  5HD5 A;  2FZ0 A;  2K2N A;  2PYR A;  1XJ6 A;  3T4L A;  3A0V A;  2KDK A;  2W3G A;  5IU1 A;  4PAU A;  4GCZ A;  5AVE A;  3NOT C;  1S4R A;  4HJ3 A;  3PBT A;  2K7S A;  5TJJ A;  1N9O A;  4PKY A;  2BAS A;  3MQQ A;  4KUO A;  2A24 B;  2O9B A;  4HP9 A;  4KQD A;  3T4Q A;  4CLC B;  1T1B A;  5L8M A;  2JKR M;  1T18 A;  4EEU A;  2EWV A;  4DMZ A;  2GJ3 A;  2EWW A;  1T1A A;  1IFQ A;  3FPV A;  1NLZ A;  2QJ7 A;  4YOF A;  3BWL A;  4PHT A;  3K2N A;  4F3L A;  3NOP C;  5F68 A;  3UB7 A;  1WA9 A;  2K31 A;  1KOU A;  5DFY A;  3CUE A;  1OPX A;  2JN7 A;  4HJ6 A;  2PDR A;  4HHD A;  4XT2 A;  4CLC E;  4MDZ A;  3R7W A;  4RQ9 A;  3C8C A;  2YKF A;  2QKP A;  1F5M A;  2WKQ A;  1Y28 A;  1GSW A;  2VKS A;  1OTB A;  4I5S A;  4CLC C;  3F1O A;  3B42 A;  3ULF A;  1ODV A;  5HWW A;  4YWZ A;  3FG8 A;  3VOL A;  3B47 A;  3JVV A;  2VV6 A;  4WN5 A;  4WL9 A;  4PKY G;  3MFX A;  2W0N A;  3LR3 A;  1XJ4 A;  2P7J A;  1YKD A;  1S67 L;  1H8M A;  2QYB A;  3PBQ A;  5G4Y A;  2PT7 A;  1LSV A;  2VX8 A;  1STZ A;  1UWN X;  3TE8 A;  1UWP X;  5HDD A;  2ZMF A;  1BYW A;  2XRN A;  4DJ3 A;  3K3C A;  3F1N B;  2J80 A;  4L0L A;  3BY9 A;  1TS8 A;  2L4R A;  5IT5 A;  4HP4 A;  2PHY A;  5G4Z A;  2W1R A;  3H7W A;  3P01 A;  4I39 A;  2G7U A;  4G3W A;  1P9R A;  3LID A;  5HDC A;  5HDS A;  1NLY A;  4IHQ A;  4H6J A;  3KSH A;  4F3L B;  2OAQ 1;  3LIF A;  2W3E A;  4HJ4 A;  1IOU A;  2J3W A;  4R70 A;  3KSG A;  5TBM A;  3LIE A;  2O9C A;  3UE3 A;  5C5K A;  3LUQ A;  3HJK A;  2V9A A;  4XT2 B;  4I3A A;  3IS2 A;  3GEC A;  3E4O A;  5J7E A;  3LIA A;  3T4O A;  4GHI A;  4KUK A;  3EGD C;  3IBR A;  2CMN A;  4KQO A;  5AJG A;  2Z6D A;  3ZYT A;  2JHE A;  3KSI A;  3C30 A;  5K5B A;  2Y8H A;  1H3Q A;  4R38 A;  3LR0 A;  3T50 A;  1T1C A;  3MQ0 A;  2HF6 A;  3BY8 A;  3H9W A;  1XJ2 A;  2HV1 A;  4Q0I A;  2OOL A;  1V9Y A;  2WKR A;  3BJN A;  4BJP A;  1P0Z A;  1YAX A;  3VE4 A;  3RTY A;  4IJG A;  1EW0 A;  5DF9 A;  2L0W A;  4Z1W A;  3KYZ A;  2PYP A;  4MN7 A;  2XA7 M;  1G28 A;  4BBV A;  2KOI A;  3FC7 A;  4GJ4 A;  4GW9 A;  1D7E A;  4CLC D;  2JKR I;  3IBJ A;  4M4X A;  1G6O A;  1P9W A;  1P97 A;  2JKT M;  2XSS A;  3LI9 A;  1XJ3 A;  3ICY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...