2VV8A

Co-bound structure of bjfixlh
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 25
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv8A00
4R3AA 2BASA 2WKRA 4GS9A 4LLOB 1XJ4A 2YKHA 5DKKA 3MQOA 4EQ1A 2Z6CA 2M1CA 2V9AA 4HI4A 2QHKA 1BYWA 1OTEA 2PYRA 3P7NA 2V1AA 4DJ3A 4EEPA 5HDCA 3F1NB 3E4PA 5HSQA 1S4RA 1DRMA 1TS6A 5EFWA 1T1AA 4GHIA 5J4EA 2YKFA 1P0ZA 3H82A 5DKLA 3UMDA 1D06A 4GW9A 1Y28A 2PYPA 5I5LA 4F3LA 4HJ3A 3HJKA 1OTAA 5J7EA 5F6AA 2EA9A 4I5SA 4JGPA 3F1OB 4HY8A 4KUKA 4EETB 1LL8A 4WLAA 4MN5A 5IS1A 4BBUA 3CAXA 1UWNX 3MQQA 4LPZA 2R78A 5G4ZA 5HZHA 3MXQA 4HH3A 2P7JA 4M4XA 4BBVA 4WL9A 4HP4A 1F98A 3FG8A 1X0OA 4PKYA 2W0NA 1LSWA 4H6JA 3K3CA 5AVFA 5A8BA 2OWHA 2QJ7A 4XT2B 1GSVA 4HH2A 2V0WA 4PKYG 1WA9A 4L9GA 1S67L 3D72A 2QJ5A 4KUOA 1OT9A 2VV7A 3LIDA 3LYXA 3NOUC 2KDKA 4EEUA 3BWLA 3IS2A 4L9FA 4HIAA 1LSVA 4F3LB 3NOPC 2VEAA 3F1PA 2GJ3A 4WF0A 5F69A 4RQ9A 3H9WA 3ULFA 1N9OA 3H7WB 1DP6A 3NJAA 3VE3A 3RTYA 3GDIA 2V1BA 1UWPX 1N9NA 3MJQA 3NOTC 3LIEA 3LI8A 2PD8A 1XJ3A 4EERA 4R38A 2PR6A 2VV6A 2INWA 2W27A 5J3WA 4I3JA 3MR0A 2V0UA 4GCZA 1V9ZA 3ZQ5A 2ZBBA 5HD3A 2D01A 4LRXC 4HHDA 2ZOHA 1XFNA 2JN7A 4EESA 1G28A 2VV8A 4HJ6A 5AVEA 3BY9A 5HWTA 1F9IA 5HWVA 2A24B 4BBTA 5G4YA 1P97A 3SW1A 4GS9B 2PHYA 4LRZE 1T1BA 3UB8A 4HJ4A 3A0SA 4B9OA 1LSXA 3F1NA 2QWSA 3MFXA 4K08A 3PHYA 3UB6A 3UMEA 1XJ2A 3C8CA 3RH8B 2L0WA 4JGOA 2WKQA 4NXFA 3LICA 1OTBA 3FC7A 5HD5A 1S66L 3IBRA 5F68A 2H28A 4I39A 3VOLA 4GHIB 3C2WA 3A0RA 3EEHA 1MZUA 4WN5A 1LT0A 2OWJA 3LIFA 3H82B 4LRYC 5DJTA 3E4QA 1D7EA 3ICYA 3K3DA 1XFQA 1KOUA 3GECA 1T1CA 4JGRA 5IU1A 4KQDA 4NXBA 4R70A 4I38A 5F5YA 3OLOA 3A0VA 1ODVA 3UB9A 2K7SA 1EW0A 4L9EA 1S1YA 3B33A 2PR5A 4E04A 1T18A 4EXOA 2Z6DA 1GSXA 1JNUA 4XT2A 3UE6A 1OT6A 4I3AA 4H6JB 3LUQA 1T19A 2I9VA 2J80A 2PD7A 1S4SA 1OJ5A 1VB6A 1NWZA 2ZOIA 3PYPA 4HNBA 4HP9A 1TS8A 5TBMA 2CMNA 2VLGA 5HDSA 3EWKA 4DJ2A 1OJGA 1DP8A 3IS2B 4HOIA 3LI9A 3T50A 4NXEA 1TS7A 1GSWA 3H7WA 5DJUA 4EW7A 2JHEA 2HV1A 3F1PB 2L4RA 2WKPA 3VE4A 1N9LA 4I3IA 4R6LA 3NHQA 4YWZA 2PDRA 4JGQA 1OTDA 2B02A 2L1MA 3G6OA 3LIBA 3CWFA 2OOLA 1S1ZA 1XJ6A 3UB7A 3E4OA 1TS0A 5KIZA 4NXGA 3BY8A 1UGUA 4HQAA 3CLOA 2KX6A 4WUJA 1OTIA 2QKPA 5HWWA 2D02A 3LIAA 3F1OA 1V9YA 5HDDA 4MN6A 1DP9A 3HJIA 3KX0X 5TBMB 2A24A
chains in the Genus database with same CATH superfamily
2DCFA 2EWVA 3UPPA 3JVUA 5E2EA 2XRNA 1ES3A 4GKUA 4RVAA 3BECA 2YKHA 1FCNA 4X69A 4YOFA 2V9AA 4B4ZA 2QHKA 1OTEA 5E2HA 3IF6A 1CK3A 5HDCA 2ZQ8A 1G6AA 2OSUA 3E4PA 4G3VA 3BYDA 3T4TA 4EWFA 1L2SA 5EFWA 3CZDA 3IT9A 3G2YA 4DE0A 1K38A 2B95A 4XXRA 4E3IA 1BLPA 2PYPA 3NDGA 4F3LA 3G31A 3DTMA 4PM5A 2EA9A 1XKZA 3OBFA 4HY8A 1YLPA 1H0MA 2JKRI 2WKEA 2K2NA 4JPMA 3MMHA 3CAXA 1UWNX 2HDSA 5G4ZA 3BRMA 5M18A 3CMZA 1KDWA 4HP4A 4ZJ1A 4WEJA 3SOIA 4PKYA 2W0NA 3A3IA 2W3DA 4Y15A 5AQ7A 4N9LA 3UNWA 2Y4AA 2XH9A 1GSVA 3IHBA 1MKMA 4HH2A 5L2FA 3IWIA 2J3TD 3LR5A 3CITA 4L9GA 2ZQ7A 5CHUA 5DF8A 1OT9A 1E3UA 5L8MA 1K54C 2JKRM 3T4OA 5HPFA 1NYYA 3V39A 1GHMA 2Y8HA 3CPTB 3DBAA 3V3SA 3WS1A 1W8YA 2O9AA 5FI6A 5U47A 3MFDA 2VEAA 1L0EA 3LO7A 3F1PA 5HW3A 1HLUP 2V8CA 4RQ9A 2Y79A 4WELA 3GTCA 2J3WA 4X6TA 1PZPA 2XA7S 2VGLM 2EFUA 5KSHA 1KE4A 4DKIA 1IYOA 4LV3A 3W4QA 2Y59A 2V1BA 1UWPX 4MMNA 3UO9A 1N9NA 3NOTC 3LIEA 3GVBA 3TSGA 2XD1A 3ZG7B 5EV0A 3RXWA 4R38A 5HAIA 5TFQA 5IT5A 3PR6A 4CQHA 4JLFA 1W8QA 5AJGA 4MEZA 4YNRA 5HD3A 2ZJ9A 1Q2QA 5A91A 3FYZA 3BFEA 2ZOHA 5DF7A 3HLFA 2VGLS 3N8RA 3SS3A 4EESA 1G28A 3MF0A 5I94A 5L10A 2VV8A 1YAXA 5EOEA 1TF1A 5EUAA 3KSGA 5HPIA 2XD5A 1YPRA 1ES4A 1BT5A 3SS5A 1NZUA 1W7FA 5J8XA 4DXBA 4DE1A 5HWVA 4BBTA 3VSKA 5G4YA 1P97A 2JKFA 4PM7A 2OAP1 1T1BA 4ME4A 2VKSA 2WYXA 4HJ4A 3A0SA 2JC7A 1CI9A 1IFQA 1LSXA 3IXHA 4Q0HA 2A2LA 3MFXA 1VQQA 3E2KA 3UB6A 3UMEA 1VM1A 4S2LA 3C8CA 4CLCC 1VHMA 3FWLA 1K56A 4FUWA 4LENA 5EVLA 1OTBA 5HAPA 5HD5A 1YLZA 3UE3A 3PAEA 2EXBA 1BLCA 3C2WA 4EU0A 3KO6A 4WN5A 4D2OA 3IBJA 4KZ5A 2Y2KA 3LIFA 5L07A 4FH4A 5F1GA 3E4QA 4EBPA 4MN7A 1FCOA 2LB9A 3V67A 2H5SA 5CTNA 1JWVA 4KQDA 4NXBA 4MDZA 1STZA 4I38A 1H8ZA 4AFIA 3UB9A 3AGFA 4UQIM 2P9VA 2K7SA 3PBOA 4K91A 4JKTA 2ZLYA 3DTKA 4IBXA 3IWOA 2HJEA 3O88A 1RGZA 5GLDA 3B33A 2PR5A 2Y2OA 3NIAA 4ZTKA 3QP4A 4KQQA 3UE6A 4P6ZM 1YQSA 3ITAA 4H6JB 5CECA 4HEFA 3K2NA 3G30A 1S4SA 5C5KA 2GNXA 3P01A 1NRJA 4OP8A 5LBRA 1FR1A 3LCEA 2EX2A 3WS2A 4UQIS 3JYIA 4HP9A 4U0TA 1TS8A 1FR6A 5HL6A 4R0QA 4OQIA 3HL9A 4E6XA 3OCNA 1O7EA 1BLSA 4IUKA 3P98A 4JF5A 2B5RA 4HOIA 4E3NA 3SH8A 3LI9A 1KVLA 4DDSA 2IWBA 3QP6A 3QP5A 4P6ZS 2HZ5A 2Q9NA 2WKPA 4JBFA 3UPNA 2M7UA 3VV4A 4I3IA 4KENB 4R6LA 2PDRA 5DVAA 3MXSA 3ZVTA 5CGXA 3BLMA 2UV0E 3FPVA 5TJJA 1YSQA 5F1FA 1N4OA 1DJAA 1K6RA 4OVDA 4NXGA 1N9BA 3BEBA 3HREA 2C6WB 1UGUA 3MS6A 4UEYA 4LV1A 2V2FF 5FAQA 4MCWA 2XSSA 1ACFA 4IUHA 2D02A 3C4OA 4MBFA 2WUQA 3F1OA 1MBLA 3T1SA 5CRFA 1F2KA 5EVIB 3KX0X 1K4FA 4P0MA 3MQ0A 2OLUA 3Q7ZA 4LLOB 3IF6C 1SKOB 5DKKA 2XK1A 3Q07A 2Z6CA 2QMIA 4PMAA 4N92A 2FFFB 1BYWA 1GHPA 5A92A 5CHMA 2DNSA 3MSHA 4EEPA 3F1NB 5GLBA 4UA7A 2BTFP 1S4RA 4P85A 1TS6A 1LL9A 3P09A 4OONA 5GL9A 3WS0A 2YKFA 2VGKA 1P0ZA 1G6OA 5DKLA 3ITBA 5CXWA 5F83A 1MY8A 1Y28A 1K4EA 2ZMFA 3O87A 2WKHA 1OTAA 5FAOA 2IA2A 4X25A 1YMXA 2OV5A 5EECA 5FQJA 4EUZA 2JCHA 3M2JA 2V1ZA 5CEBA 2O9CA 4C75A 1XA1A 4RA7A 3FV7A 3IHAA 2H0YA 5EM0A 2R78A 3MXQA 1JWPA 4HH3A 2P7JA 5DTSA 4WL9A 2EX6A 1X0OA 1FILA 4K0WA 2GDNA 4H6JA 4OPRA 3K3CA 4WBGA 4OQ0A 3LEZA 4E3JA 1W63Q 3QHYA 4Y7PA 4KZ4A 3WWXA 1J3WA 1YLTA 5CGWA 4PKYG 5E2GA 5FASA 2HF6A 4D60A 1F5MA 1S67L 3C5AA 5M19A 2JBFA 3D72A 3LIDA 3HLGA 3LYXA 1HVBA 5HX9A 4EEUA 2Y2GA 3T1RA 2G2WA 3SZTA 3BM6A 2EX9A 4MLLA 3Q7VA 4ZBEA 4KZ7A 4HIAA 1W5DA 2ZMAA 4Y0OA 2GJ3A 4WF0A 4E3MA 2Y55A 1OMEA 3HUNA 4DDYA 4FH2A 1N9OA 2Q9MA 2J9PA 3W4PA 3VP4A 4GLQA 3A3EA 3TJZC 2NUTC 4FTXA 2XFTA 1XJ3A 4ZAMA 3C30A 3L9KA 1AXBA 1ZKJA 2W27A 4I3JA 5CEDA 1V9ZA 4OQGA 3PTEA 1MXOA 2ZBBA 4OPYA 2E8JA 2D01A 2R9WA 4LRXC 3B42A 3T4KA 3JVVA 4X1MA 2ZD8A 1FIKA 4KZ6A 3LGOA 4Q8IA 4LCLA 3OPRA 3O5YA 1L0GA 4HJ6A 3BY9A 3G35A 5EVIA 3DWKA 1K56D 1PFLA 1PRQA 1PWGA 1E4DA 4XUZA 2W1TA 2K31A 1RP5A 4EQIA 2MJ6A 3S7PA 2A24B 1RCJA 3BW6A 4QWOA 4KG6A 3SW1A 4GS9B 2PHYA 3O86A 1J9MA 2J9OA 4NEED 3O3VA 3F1NA 5EE8A 2G7UA 2QWSA 2ZL1B 3LY3A 3PHYA 3UY6A 3TOIA 3QNBA 3NY4A 3KYQA 4L0LA 2XA7M 2WKQA 4NXFA 3LICA 2WK0A 3ZG0A 4NETA 3WS4A 1BLHA 2ACGA 4B88A 4FD8A 4OOYA 5TR7A 4Y2FA 2PU2A 5FSRA 1CI8A 1FSYA 3IXDA 1LL5A 1MZUA 3VP2A 4OPQA 3U2AA 4IVIA 3MXRA 2EXAA 1VEUB 2Y2PA 4ZJ2A 2Y2MA 2WGWA 4RX3A 3ICYA 1T1CA 2VZWA 4JGRA 2WZZA 2GZAA 4WMCD 5F5YA 3A0VA 3ZCZA 1ODVA 3DAVA 4R4RA 3HUMA 3ISGA 4BWIA 2J3TC 3ZG8B 5A93A 4UA9A 1T18A 4DN0A 2XFSA 3IXGA 2Z6DA 2FFYA 3UDXA 3WRZA 3LEQA 4KG2A 4NG2A 3VFFA 2P04A 1OT6A 4P87A 4R23A 4I3AA 2ZM2A 2O0YA 4Q0JA 1G68A 3LR4A 3IXBA 1NRFA 3NCKA 4R3JA 1NWZA 1GCEA 3R7WB 4Y17A 3PYPA 3ZVWA 1NZOA 1PW8A 1JWZA 3NBLA 5TBMA 2WAFA 3NECA 4QU3A 5TGFA 2O9BA 1WE4A 1DP8A 4CLCD 4IVKA 4NXEA 3BLSA 1ES2A 4P6BA 2HV1A 4R4SA 2L4RA 4RYEA 4S2IA 4GOGA 4HBUA 3VE4A 3NHQA 4YWZA 4S2OA 3ZYTA 4JGQA 1OTDA 2FH5A 4ETXA 3G6OA 1ALQA 2FZ0A 3VP0A 1XJ6A 3QP8A 2ZQDA 1TS0A 3OOVA 4LCMA 2EFXA 4FOFA 2KLIA 4GD8A 2DRWA 4HQAA 5DFXA 4WUJA 4QJGA 4JXWA 5HDDA 4S2NA 1DP9A 1YLYA 4O8GA 4GDBA 4JF6A 4ETZA 2HP9A 3MBZA 3AGDA 4GN2A 4S2PA 2A24A 3SH7A 5IHVA 4R3AA 2WKRA 1CJFA 2XEPA 1NY0A 4GS9A 4OLDA 1K25A 5FQQA 2HP5A 2BG1A 4CJNA 5FI7A 5JYPA 1IKGA 3MKEA 2ZL1A 4HI4A 5AQ9A 3T4LA 2PYRA 2V1AA 1PNEA 2A3UA 4XUXA 2HDQA 2XDMA 4GJ4A 4IEDA 4OP5A 4KZ8A 2VGJA 3ZFZA 3N8SA 5EOOA 2X71A 4N1HA 2QZ6A 4GZBA 1T1AA 2Y2HA 1O07A 5CGSA 5J4EA 4X53A 1KE0A 1CEGA 1YMSA 2UWXA 3SS4A 2XROA 1VEUA 4Y13A 3CPTA 1P9RA 3BJNA 2X01A 1Z09A 4U3TA 3N8LA 1L0DA 3EGXC 5I5LA 3U4LP 2DMWA 1CEFA 3CHWP 4EV4A 2PU4A 3EGDC 5J7EA 3WRTA 1AWIA 2C5WB 1VETB 2XLNA 4JGPA 2KOIA 4KUKA 4WLAA 2VK3A 3OPPA 2G2UA 3A3DA 2BLSA 1LHYA 2Y2QA 3D4FA 4BBUA 3C4PA 4QHCA 4LPZA 5HZHA 3CUEC 3UE0A 3N7WA 2J8YA 3PBQA 4JF4A 3FG8A 1DJCA 4BJPA 5F82A 4NK3A 1LSWA 3KSIA 3NC8A 1ONHA 4ESPA 5AVFA 5A8BA 2OWHA 2QJ7A 4XT2B 4PAUA 2PT7A 4E6WA 4QD4A 1L0FA 2V0WA 1SDNA 1WA9A 3UN7A 3HCYA 2IWCA 2VA0A 5CX7A 4KG5A 4YFMA 2QJ5A 3T1XA 3NOUC 1IOUA 1NLYA 3EQVA 4ARZB 3BWLA 4HESA 4MBKA 1JTDA 3D9YA 5DTTA 4F3LB 4U0XA 3ZGAB 1XPBA 5F69A 4HBTA 3L7HA 5FDSA 1PI5A 3NI9A 1I2SA 3H7WB 4S2MA 3ULFA 1DP6A 3E0YA 3BQAA 3G34A 3GDIA 1BZAA 1FSWA 3HBRA 4CLCE 2ZMVA 3EEAA 2VX8A 3LI8A 5KMWA 2PD8A 3AGEA 4QY6A 1W63M 4EERA 2PR6A 3IX8A 3HLWA 1JVJA 3OZHA 3IX3A 3MR0A 4WM9A 2V0UA 3HLCA 4QB8A 2RCXA 1E25A 2WAEA 5EVIC 3VSLA 4KZAA 2XGNA 4Y0UA 3VOZA 3LR0A 4O0PA 1MC0A 2ZC3B 2NUPC 1KGGA 3S4XA 4OH0A 5FAPA 4WZ4A 1GHIA 4PHTA 3B3XA 5E2FA 1E3UD 1WYBA 4LV0A 2JKTI 1EI5A 1BSGA 4LRZE 1Z6FA 1KVMA 4R1GA 4B9OA 3CUEA 4MNRA 3PXPA 3OCLA 2OAQ1 1XJ2A 3RH8B 2L0WA 4PM6A 4CPKA 4Q0IA 3FC7A 5HFOA 1S66L 3IBRA 5F68A 4I39A 3FKVA 4IBRA 2QPNA 3IH8A 3C7VA 4GHIB 1ERQA 1LT0A 2OWJA 5AQBA 5DFYA 2W3FA 3H82B 5FATA 4LRYC 2ZC6B 5DJTA 3DW0A 2JKTM 5KZHA 1VETA 1D7EA 1KOUA 3PBSA 1FQGA 5GHXA 5IU1A 5FQIA 3QNCA 1CF0A 2PRFA 1ZHHB 3PBTA 4R3BA 1IEMA 2P08A 3KSHA 4NKPA 3MZDA 2ZM0A 2ZC5B 3VFHA 1S1YA 4BD1A 4EXOA 1L3LA 1XGIA 3DTIA 2J7VA 1GSXA 1JNUA 4KQRA 2W3GA 3DTEA 4G3WA 4XT2A 3VP1A 5HL1A 1LI9A 3IQAA 3LUQA 4E3KA 2I9VA 1W79A 1WYCA 3PAGA 1LLBA 3GQZA 3N4IA 1OJ5A 1VB6A 4DE3A 5D3OA 1XP4A 3VP3A 4ZRRA 5FDHA 1FCMA 1GA0A 3OC2A 4LGWA 4ARZA 1GA9A 4OQHA 1M40A 2CMNA 3HUOA 3IX4A 3CG5A 2VLGA 3Q1FA 4BL3A 5EM1A 3IS2B 1SKOA 3T12B 4B4XA 3V3RA 3T50A 1U60A 3IH9A 1TS7A 2QYBA 3C38A 2RL3A 5KSCA 4UA6A 1HTZA 3H7WA 4EW7A 3UDIA 2JHEA 3ZHHA 3ZNYA 3KSFA 5E43A 4O7DA 1N9LA 3MZEA 2P9VB 2ZC7A 2Z2MB 1P9WA 3QP1A 3TE8A 1CQAA 3LIBA 2WZXA 3A3FA 3CWFA 2OOLA 1D1JA 2O99A 2Y2LA 1TEMA 4JXVA 2Y2JA 3EQUA 4LV2A 3KYEA 2IWDA 3E4OA 5GLAA 3I7JA 3BY8A 5GLCA 4EUVA 3RJUA 3CLOA 4S2NC 2KX6A 1OTIA 5FL3A 5HWWA 1Y54A 2ZM8A 5GHYA 2ZQAA 4GNUA 1TVFA 2V8FA 2JKGA 3HJIA 1ONGA 2WADA 2BASA 5DF9A 3HLDA 1BTLA 1XJ4A 1A0KA 1TDLA 3MQOA 4EQ1A 4UAAA 2M1CA 1SHVA 3VOYA 3HLEA 2R9XA 3P7NA 3BFGA 4BENA 1SKFA 4DJ3A 2VJWA 2AVXA 5EPHA 1HZOA 1IKIA 4Z1WA 5HSQA 4OLGA 4QY5A 1ESIA 1DRMA 4DF6A 3T4SA 1QMEA 3ZG9B 4GHIA 1K55C 3M6BA 3VMAA 4CLCB 3H82A 5FQ9A 3LFVA 3TG9A 3LR3A 3UMDA 1D06A 1TD5A 2EWWA 1NLZA 1PIOA 3W4OA 4GW9A 4DXCA 3NDEA 4HJ3A 3HJKA 1XX2A 4M3KA 2WGIA 3PBNA 5F6AA 4KZ3A 4C3QA 4I5SA 3T4QA 1YT4A 2JE5A 5FQKA 3F1OB 1HD8A 5L09A 5HARA 4EETB 3RXXA 1LL8A 4ID4A 2W1RA 1G5UA 1LI0A 4MN5A 5IS1A 1KDSA 3GR2A 2EX8A 3MQQA 2Q0OA 4M4XA 4E3OA 4BBVA 1F98A 1SZVA 1H8YA 4C6YA 4PM8A 3RFBA 1EWZA 1SDEA 1H5XA 4X1LA 2X02A 2W3EA 4E3LA 1EROA 3PBRA 5A90A 3G4PA 4N9KA 3SH9A 1K57C 2ZQCA 3V50A 4KUOA 2VV7A 4O01A 5CHJA 1IELA 4KZBA 1I2WA 1MWSA 2KDKA 3GMWA 2B18A 3IS2A 2E8IA 4L9FA 3V5MA 1K54A 1BUEA 1KGEA 1TDGA 3GRJA 3FKWA 3IF5A 1LSVA 3NOPC 4JXSA 2A49A 1PYYA 1ZG6A 5K5BA 5EVEA 4GB7A 3H9WA 4WZ5C 3UDFA 3NJAA 3VE3A 3RTYA 1PWDA 3S1YA 2WGVA 4LFUA 3MJQA 2ZC4B 4Y3IA 3Q82A 3QP2A 4PPRA 4BMWA 3S7OA 2H0TA 2VV6A 1H8MA 2INWA 5J3WA 4OOMA 4X56A 3ZNTA 4A5RA 4FCFA 3TW8A 1YLWA 4BD0A 3Q81A 5DTKA 1NXYA 1MPLA 4GCZA 3R4KA 4WMCA 3ZQ5A 3M2KA 3M6HA 1K55A 4HHDA 3TRCA 4PM9A 1OPXA 1XFNA 1ES5A 2JN7A 2V20A 3LY4A 3DWZA 4WEKA 5AVEA 2I72A 4GDNA 1ESUA 1MWUA 5HWTA 3UE1A 1SCWA 1F9IA 4MBHA 1PW1A 3OPLA 1ZC2A 3MKFA 5HAQA 2HGVA 4JXGA 3CJMA 3GSGA 3Q7VB 3S7QA 2PAVP 1NYMA 1K0KA 2GX5A 3D3OA 1M6KA 5MC7A 2Y2NA 3UB8A 1KGFA 2H10A 1BULA 1XA7A 4OKPA 2CC1A 4K08A 2HPBA 3IF6B 4EBNA 4KZ9A 4JGOA 5FA7A 2OLVA 2WKIA 3CI6A 3R7WA 1S6RA 1YKDA 4X68A 2H28A 4IJGA 4CLCA 5JYOA 4S2KA 3VOLA 5FEGA 1K57A 2Y91A 3A0RA 3FZCA 3EEHA 3HLBA 2HDUA 5M1AA 5GHZA 4Z9QA 3KYZA 4Y5FA 4H8RA 5AQAA 4EBLA 3K3DA 1XFQA 3GECA 4BL2A 3BFCA 3E2LA 3BFDA 3MZFA 4R70A 2LB5A 3OLOA 2Z2LB 1KE3A 4B93A 1DY6A 1PZOA 2ZQ9A 5G18A 3T1QB 3G2ZA 3ZG5A 1EW0A 2W1TB 4UHUA 4DRTA 4WZ5A 4X55A 4L9EA 3GV9A 4IHQA 1PI4A 4E04A 5EVID 1DJBA 4N1XA 4ZDXA 3BFFA 1ERMA 3IWQA 1JTGA 1PWCA 1T19A 4FSFA 4OOLA 1FOFA 2J80A 1I5QA 4WYYA 4F94A 3W2ZA 2PD7A 3B47A 3W8KA 4RX2A 1IYQA 3C7UA 2ZOIA 3S22A 2XR0A 1XXMA 4HNBA 2HJ9C 1S0WA 2P74A 1MWRA 3NULA 3HVFA 5BOHA 5HDSA 4G3KA 3EWKA 3A3JA 4DJ2A 2HP6A 1OJGA 4DMZA 1C3BA 3FPWA 2WGWB 1GSWA 3UPOA 5DJUA 3EOIA 2M7VA 3F1PB 1NJ4A 1XGJA 1ZTUA 3UB5P 1YSPA 4S2JA 5FQMA 2XQZA 3WS5A 5FEFA 2Y2IA 1Y4OA 2B02A 1QMFA 2L1MA 4ZJ3A 5CERA 4GD6A 1YM1A 1RGYA 1S1ZA 3OPHA 4K0XA 3UB7A 1IYSA 5CTMA 4QPRA 2PBYA 5KIZA 1H3QA 1K6SA 4DE2A 4II7A 4KQOA 5FI2A 2QKPA 4BLMA 3E98A 3N6IA 3LIAA 3G32A 1V9YA 4Y0TA 4YINA 4MN6A 4BQMA 3T4JA 1MKIA 2HDRA 1Q2PA 3ZDJA 1YLJA 1MWTA 4OPZA 1IYPA 2PBDP 2XF3A 3S7NA 1ZG4A 3JPUA 5TBMB 2W3HA 3BQ8A
chains in the Genus database with same CATH topology
3MQ0A 2EWVA 4R3AA 2BASA 2WKRA 3JVUA 5DF9A 2XRNA 4GS9A 4LLOB 1XJ4A 2YKHA 5DKKA 3MQOA 4EQ1A 4YOFA 2Z6CA 2M1CA 2V9AA 4HI4A 2QHKA 1BYWA 1OTEA 3T4LA 2PYRA 3P7NA 2V1AA 4DJ3A 4EEPA 2VJWA 5HDCA 3F1NB 3E4PA 4Z1WA 5HSQA 4G3VA 4GJ4A 3T4TA 1S4RA 1DRMA 3T4SA 1TS6A 5EFWA 1T1AA 4GHIA 5J4EA 2YKFA 1P0ZA 4CLCB 1G6OA 3H82A 2XROA 3LFVA 5DKLA 3LR3A 3UMDA 1D06A 1P9RA 1TD5A 3BJNA 2EWWA 1NLZA 4GW9A 3EGXC 1Y28A 2PYPA 5I5LA 4F3LA 2ZMFA 4HJ3A 3HJKA 2DMWA 1OTAA 3EGDC 5J7EA 3PBNA 5F6AA 2EA9A 2IA2A 4I5SA 3T4QA 4JGPA 2KOIA 3F1OB 3OBFA 4HY8A 4KUKA 4EETB 1LL8A 4WLAA 2O9CA 2W1RA 4MN5A 2JKRI 5IS1A 2K2NA 3MMHA 4BBUA 3CAXA 1UWNX 3MQQA 4LPZA 2R78A 5G4ZA 5HZHA 3MXQA 3CUEC 4HH3A 2P7JA 4M4XA 4BBVA 4WL9A 4HP4A 1F98A 3PBQA 4WEJA 3FG8A 1X0OA 3RFBA 4BJPA 4PKYA 2W0NA 2W3DA 1LSWA 3KSIA 4H6JA 3K3CA 2W3EA 5AVFA 5A8BA 3PBRA 2OWHA 1W63Q 2QJ7A 4XT2B 1GSVA 4PAUA 2PT7A 1MKMA 4HH2A 2V0WA 4PKYG 1WA9A 2J3TD 3LR5A 3CITA 2HF6A 3HCYA 4L9GA 1F5MA 1S67L 2VA0A 5CX7A 3D72A 2QJ5A 4KUOA 1OT9A 2VV7A 3LIDA 5L8MA 4O01A 2JKRM 3LYXA 3NOUC 3T4OA 1IOUA 2KDKA 4EEUA 1NLYA 5HPFA 3EQVA 4ARZB 2B18A 3BWLA 3IS2A 2Y8HA 4L9FA 3DBAA 2O9AA 4HIAA 1LSVA 4F3LB 3NOPC 2VEAA 3F1PA 2GJ3A 4WF0A 5K5BA 5F69A 4RQ9A 3H9WA 2Y79A 4WELA 2J3WA 3ULFA 1N9OA 2XA7S 3H7WB 2VGLM 1DP6A 3E0YA 3NJAA 5KSHA 3BQAA 3VE3A 3RTYA 3GDIA 2V1BA 1UWPX 4GLQA 4MMNA 1N9NA 3MJQA 2ZMVA 3EEAA 4CLCE 3NOTC 3LIEA 3TJZC 2NUTC 2VX8A 3LI8A 4Y3IA 2PD8A 1W63M 1XJ3A 3C30A 4EERA 4R38A 4BMWA 2PR6A 3S7OA 2VV6A 1H8MA 2INWA 2W27A 5J3WA 5IT5A 3PR6A 4OOMA 4CQHA 3TW8A 4I3JA 5AJGA 3MR0A 2V0UA 4GCZA 1V9ZA 3R4KA 3ZQ5A 2ZBBA 4YNRA 5HD3A 2D01A 4LRXC 3B42A 3T4KA 3JVVA 4HHDA 3TRCA 2ZOHA 1OPXA 1XFNA 2VGLS 2JN7A 4EESA 3LR0A 1G28A 3MF0A 3O5YA 2VV8A 4WEKA 4HJ6A 5AVEA 3BY9A 4O0PA 1MC0A 1YAXA 2NUPC 1TF1A 5HWTA 3KSGA 5HPIA 2W1TA 1F9IA 4PHTA 2K31A 2MJ6A 3S7PA 2HGVA 5HWVA 2A24B 3BW6A 4BBTA 5G4YA 3S7QA 1P97A 2JKTI 3SW1A 4GS9B 2PHYA 2GX5A 2OAP1 3D3OA 4LRZE 1T1BA 4ME4A 5MC7A 2VKSA 3UB8A 4HJ4A 3A0SA 4NEED 4B9OA 3CUEA 1IFQA 1LSXA 3PXPA 3F1NA 4Q0HA 2A2LA 2G7UA 2QWSA 3MFXA 4K08A 3PHYA 3UB6A 3UMEA 3OCLA 2OAQ1 1XJ2A 3C8CA 3RH8B 2L0WA 3KYQA 1VHMA 4CLCC 4L0LA 2XA7M 4JGOA 2WKQA 4NXFA 3LICA 1OTBA 4Q0IA 3CI6A 3R7WA 1YKDA 3FC7A 5HD5A 1S66L 3IBRA 5F68A 4Y2FA 2H28A 4IJGA 4CLCA 4I39A 3UE3A 3VOLA 4GHIB 3C2WA 4EU0A 3A0RA 3KO6A 3EEHA 1MZUA 4WN5A 3IBJA 1LT0A 2OWJA 3LIFA 3U2AA 5DFYA 2W3FA 3H82B 4LRYC 5DJTA 3KYZA 3E4QA 2JKTM 4Y5FA 4MN7A 2LB9A 3V67A 1D7EA 3ICYA 3K3DA 1XFQA 1KOUA 3GECA 1T1CA 3PBSA 2VZWA 4JGRA 5IU1A 4KQDA 4NXBA 2GZAA 4MDZA 1STZA 4R70A 2LB5A 4I38A 5F5YA 3OLOA 3A0VA 4AFIA 4B93A 1ODVA 1ZHHB 3UB9A 3PBTA 2P08A 4UQIM 3KSHA 2K7SA 3PBOA 4NKPA 4BWIA 1EW0A 2J3TC 2W1TB 2HJEA 4L9EA 4IHQA 1S1YA 3B33A 2PR5A 4E04A 1T18A 4DN0A 4EXOA 2Z6DA 1GSXA 1JNUA 2W3GA 4G3WA 4XT2A 3UE6A 2P04A 4P6ZM 1OT6A 4I3AA 4H6JB 2O0YA 3LUQA 1T19A 4FSFA 2I9VA 4OOLA 4Q0JA 2J80A 3K2NA 3LR4A 3W2ZA 2PD7A 3B47A 1S4SA 5C5KA 2GNXA 3P01A 1NRJA 1OJ5A 1VB6A 5LBRA 1NWZA 4UQIS 3R7WB 4ZRRA 2ZOIA 3PYPA 4HNBA 3OC2A 4HP9A 5HL6A 1TS8A 4ARZA 2HJ9C 3OCNA 5TBMA 2CMNA 2VLGA 4IUKA 5HDSA 4G3KA 3EWKA 2O9BA 4DJ2A 1OJGA 1DP8A 3IS2B 4HOIA 4CLCD 4DMZA 3LI9A 3T50A 4NXEA 1TS7A 2QYBA 3C38A 3FPWA 4P6ZS 1GSWA 3H7WA 5DJUA 4EW7A 3EOIA 2M7VA 2JHEA 2HV1A 3F1PB 3KSFA 2L4RA 1ZTUA 1YSPA 2WKPA 3VE4A 2M7UA 1N9LA 3VV4A 4I3IA 4R6LA 3NHQA 4YWZA 3ZYTA 2PDRA 4JGQA 1OTDA 2B02A 2L1MA 1P9WA 2FH5A 3TE8A 4ETXA 3G6OA 3LIBA 2FZ0A 3CWFA 2OOLA 2O99A 1S1ZA 3FPVA 1XJ6A 3EQUA 3UB7A 5TJJA 1YSQA 3E4OA 4QPRA 1TS0A 5KIZA 3OOVA 1H3QA 4FOFA 4NXGA 3BY8A 1UGUA 2KLIA 4UEYA 4HQAA 4EUVA 4II7A 4KQOA 3CLOA 5DFXA 2KX6A 4MCWA 2XSSA 4WUJA 1OTIA 5FL3A 2QKPA 4IUHA 3E98A 5HWWA 2D02A 3LIAA 3F1OA 1V9YA 5HDDA 4MN6A 1DP9A 4O8GA 3T4JA 4ETZA 3HJIA 3KX0X 3S7NA 5TBMB 2W3HA 3BQ8A 2A24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3A A;  2BAS A;  2WKR A;  4GS9 A;  4LLO B;  1XJ4 A;  2YKH A;  5DKK A;  3MQO A;  4EQ1 A;  2Z6C A;  2M1C A;  2V9A A;  4HI4 A;  2QHK A;  1BYW A;  1OTE A;  2PYR A;  3P7N A;  2V1A A;  4DJ3 A;  4EEP A;  5HDC A;  3F1N B;  3E4P A;  5HSQ A;  1S4R A;  1DRM A;  1TS6 A;  5EFW A;  1T1A A;  4GHI A;  5J4E A;  2YKF A;  1P0Z A;  3H82 A;  5DKL A;  3UMD A;  1D06 A;  4GW9 A;  1Y28 A;  2PYP A;  5I5L A;  4F3L A;  4HJ3 A;  3HJK A;  1OTA A;  5J7E A;  5F6A A;  2EA9 A;  4I5S A;  4JGP A;  3F1O B;  4HY8 A;  4KUK A;  4EET B;  1LL8 A;  4WLA A;  4MN5 A;  5IS1 A;  4BBU A;  3CAX A;  1UWN X;  3MQQ A;  4LPZ A;  2R78 A;  5G4Z A;  5HZH A;  3MXQ A;  4HH3 A;  2P7J A;  4M4X A;  4BBV A;  4WL9 A;  4HP4 A;  1F98 A;  3FG8 A;  1X0O A;  4PKY A;  2W0N A;  1LSW A;  4H6J A;  3K3C A;  5AVF A;  5A8B A;  2OWH A;  2QJ7 A;  4XT2 B;  1GSV A;  4HH2 A;  2V0W A;  4PKY G;  1WA9 A;  4L9G A;  1S67 L;  3D72 A;  2QJ5 A;  4KUO A;  1OT9 A;  2VV7 A;  3LID A;  3LYX A;  3NOU C;  2KDK A;  4EEU A;  3BWL A;  3IS2 A;  4L9F A;  4HIA A;  1LSV A;  4F3L B;  3NOP C;  2VEA A;  3F1P A;  2GJ3 A;  4WF0 A;  5F69 A;  4RQ9 A;  3H9W A;  3ULF A;  1N9O A;  3H7W B;  1DP6 A;  3NJA A;  3VE3 A;  3RTY A;  3GDI A;  2V1B A;  1UWP X;  1N9N A;  3MJQ A;  3NOT C;  3LIE A;  3LI8 A;  2PD8 A;  1XJ3 A;  4EER A;  4R38 A;  2PR6 A;  2VV6 A;  2INW A;  2W27 A;  5J3W A;  4I3J A;  3MR0 A;  2V0U A;  4GCZ A;  1V9Z A;  3ZQ5 A;  2ZBB A;  5HD3 A;  2D01 A;  4LRX C;  4HHD A;  2ZOH A;  1XFN A;  2JN7 A;  4EES A;  1G28 A;  2VV8 A;  4HJ6 A;  5AVE A;  3BY9 A;  5HWT A;  1F9I A;  5HWV A;  2A24 B;  4BBT A;  5G4Y A;  1P97 A;  3SW1 A;  4GS9 B;  2PHY A;  4LRZ E;  1T1B A;  3UB8 A;  4HJ4 A;  3A0S A;  4B9O A;  1LSX A;  3F1N A;  2QWS A;  3MFX A;  4K08 A;  3PHY A;  3UB6 A;  3UME A;  1XJ2 A;  3C8C A;  3RH8 B;  2L0W A;  4JGO A;  2WKQ A;  4NXF A;  3LIC A;  1OTB A;  3FC7 A;  5HD5 A;  1S66 L;  3IBR A;  5F68 A;  2H28 A;  4I39 A;  3VOL A;  4GHI B;  3C2W A;  3A0R A;  3EEH A;  1MZU A;  4WN5 A;  1LT0 A;  2OWJ A;  3LIF A;  3H82 B;  4LRY C;  5DJT A;  3E4Q A;  1D7E A;  3ICY A;  3K3D A;  1XFQ A;  1KOU A;  3GEC A;  1T1C A;  4JGR A;  5IU1 A;  4KQD A;  4NXB A;  4R70 A;  4I38 A;  5F5Y A;  3OLO A;  3A0V A;  1ODV A;  3UB9 A;  2K7S A;  1EW0 A;  4L9E A;  1S1Y A;  3B33 A;  2PR5 A;  4E04 A;  1T18 A;  4EXO A;  2Z6D A;  1GSX A;  1JNU A;  4XT2 A;  3UE6 A;  1OT6 A;  4I3A A;  4H6J B;  3LUQ A;  1T19 A;  2I9V A;  2J80 A;  2PD7 A;  1S4S A;  1OJ5 A;  1VB6 A;  1NWZ A;  2ZOI A;  3PYP A;  4HNB A;  4HP9 A;  1TS8 A;  5TBM A;  2CMN A;  2VLG A;  5HDS A;  3EWK A;  4DJ2 A;  1OJG A;  1DP8 A;  3IS2 B;  4HOI A;  3LI9 A;  3T50 A;  4NXE A;  1TS7 A;  1GSW A;  3H7W A;  5DJU A;  4EW7 A;  2JHE A;  2HV1 A;  3F1P B;  2L4R A;  2WKP A;  3VE4 A;  1N9L A;  4I3I A;  4R6L A;  3NHQ A;  4YWZ A;  2PDR A;  4JGQ A;  1OTD A;  2B02 A;  2L1M A;  3G6O A;  3LIB A;  3CWF A;  2OOL A;  1S1Z A;  1XJ6 A;  3UB7 A;  3E4O A;  1TS0 A;  5KIZ A;  4NXG A;  3BY8 A;  1UGU A;  4HQA A;  3CLO A;  2KX6 A;  4WUJ A;  1OTI A;  2QKP A;  5HWW A;  2D02 A;  3LIA A;  3F1O A;  1V9Y A;  5HDD A;  4MN6 A;  1DP9 A;  3HJI A;  3KX0 X;  5TBM B;  2A24 A; 
#chains in the Genus database with same CATH topology
 2DCF A;  2EWV A;  3UPP A;  3JVU A;  5E2E A;  2XRN A;  1ES3 A;  4GKU A;  4RVA A;  3BEC A;  2YKH A;  1FCN A;  4X69 A;  4YOF A;  2V9A A;  4B4Z A;  2QHK A;  1OTE A;  5E2H A;  3IF6 A;  1CK3 A;  5HDC A;  2ZQ8 A;  1G6A A;  2OSU A;  3E4P A;  4G3V A;  3BYD A;  3T4T A;  4EWF A;  1L2S A;  5EFW A;  3CZD A;  3IT9 A;  3G2Y A;  4DE0 A;  1K38 A;  2B95 A;  4XXR A;  4E3I A;  1BLP A;  2PYP A;  3NDG A;  4F3L A;  3G31 A;  3DTM A;  4PM5 A;  2EA9 A;  1XKZ A;  3OBF A;  4HY8 A;  1YLP A;  1H0M A;  2JKR I;  2WKE A;  2K2N A;  4JPM A;  3MMH A;  3CAX A;  1UWN X;  2HDS A;  5G4Z A;  3BRM A;  5M18 A;  3CMZ A;  1KDW A;  4HP4 A;  4ZJ1 A;  4WEJ A;  3SOI A;  4PKY A;  2W0N A;  3A3I A;  2W3D A;  4Y15 A;  5AQ7 A;  4N9L A;  3UNW A;  2Y4A A;  2XH9 A;  1GSV A;  3IHB A;  1MKM A;  4HH2 A;  5L2F A;  3IWI A;  2J3T D;  3LR5 A;  3CIT A;  4L9G A;  2ZQ7 A;  5CHU A;  5DF8 A;  1OT9 A;  1E3U A;  5L8M A;  1K54 C;  2JKR M;  3T4O A;  5HPF A;  1NYY A;  3V39 A;  1GHM A;  2Y8H A;  3CPT B;  3DBA A;  3V3S A;  3WS1 A;  1W8Y A;  2O9A A;  5FI6 A;  5U47 A;  3MFD A;  2VEA A;  1L0E A;  3LO7 A;  3F1P A;  5HW3 A;  1HLU P;  2V8C A;  4RQ9 A;  2Y79 A;  4WEL A;  3GTC A;  2J3W A;  4X6T A;  1PZP A;  2XA7 S;  2VGL M;  2EFU A;  5KSH A;  1KE4 A;  4DKI A;  1IYO A;  4LV3 A;  3W4Q A;  2Y59 A;  2V1B A;  1UWP X;  4MMN A;  3UO9 A;  1N9N A;  3NOT C;  3LIE A;  3GVB A;  3TSG A;  2XD1 A;  3ZG7 B;  5EV0 A;  3RXW A;  4R38 A;  5HAI A;  5TFQ A;  5IT5 A;  3PR6 A;  4CQH A;  4JLF A;  1W8Q A;  5AJG A;  4MEZ A;  4YNR A;  5HD3 A;  2ZJ9 A;  1Q2Q A;  5A91 A;  3FYZ A;  3BFE A;  2ZOH A;  5DF7 A;  3HLF A;  2VGL S;  3N8R A;  3SS3 A;  4EES A;  1G28 A;  3MF0 A;  5I94 A;  5L10 A;  2VV8 A;  1YAX A;  5EOE A;  1TF1 A;  5EUA A;  3KSG A;  5HPI A;  2XD5 A;  1YPR A;  1ES4 A;  1BT5 A;  3SS5 A;  1NZU A;  1W7F A;  5J8X A;  4DXB A;  4DE1 A;  5HWV A;  4BBT A;  3VSK A;  5G4Y A;  1P97 A;  2JKF A;  4PM7 A;  2OAP 1;  1T1B A;  4ME4 A;  2VKS A;  2WYX A;  4HJ4 A;  3A0S A;  2JC7 A;  1CI9 A;  1IFQ A;  1LSX A;  3IXH A;  4Q0H A;  2A2L A;  3MFX A;  1VQQ A;  3E2K A;  3UB6 A;  3UME A;  1VM1 A;  4S2L A;  3C8C A;  4CLC C;  1VHM A;  3FWL A;  1K56 A;  4FUW A;  4LEN A;  5EVL A;  1OTB A;  5HAP A;  5HD5 A;  1YLZ A;  3UE3 A;  3PAE A;  2EXB A;  1BLC A;  3C2W A;  4EU0 A;  3KO6 A;  4WN5 A;  4D2O A;  3IBJ A;  4KZ5 A;  2Y2K A;  3LIF A;  5L07 A;  4FH4 A;  5F1G A;  3E4Q A;  4EBP A;  4MN7 A;  1FCO A;  2LB9 A;  3V67 A;  2H5S A;  5CTN A;  1JWV A;  4KQD A;  4NXB A;  4MDZ A;  1STZ A;  4I38 A;  1H8Z A;  4AFI A;  3UB9 A;  3AGF A;  4UQI M;  2P9V A;  2K7S A;  3PBO A;  4K91 A;  4JKT A;  2ZLY A;  3DTK A;  4IBX A;  3IWO A;  2HJE A;  3O88 A;  1RGZ A;  5GLD A;  3B33 A;  2PR5 A;  2Y2O A;  3NIA A;  4ZTK A;  3QP4 A;  4KQQ A;  3UE6 A;  4P6Z M;  1YQS A;  3ITA A;  4H6J B;  5CEC A;  4HEF A;  3K2N A;  3G30 A;  1S4S A;  5C5K A;  2GNX A;  3P01 A;  1NRJ A;  4OP8 A;  5LBR A;  1FR1 A;  3LCE A;  2EX2 A;  3WS2 A;  4UQI S;  3JYI A;  4HP9 A;  4U0T A;  1TS8 A;  1FR6 A;  5HL6 A;  4R0Q A;  4OQI A;  3HL9 A;  4E6X A;  3OCN A;  1O7E A;  1BLS A;  4IUK A;  3P98 A;  4JF5 A;  2B5R A;  4HOI A;  4E3N A;  3SH8 A;  3LI9 A;  1KVL A;  4DDS A;  2IWB A;  3QP6 A;  3QP5 A;  4P6Z S;  2HZ5 A;  2Q9N A;  2WKP A;  4JBF A;  3UPN A;  2M7U A;  3VV4 A;  4I3I A;  4KEN B;  4R6L A;  2PDR A;  5DVA A;  3MXS A;  3ZVT A;  5CGX A;  3BLM A;  2UV0 E;  3FPV A;  5TJJ A;  1YSQ A;  5F1F A;  1N4O A;  1DJA A;  1K6R A;  4OVD A;  4NXG A;  1N9B A;  3BEB A;  3HRE A;  2C6W B;  1UGU A;  3MS6 A;  4UEY A;  4LV1 A;  2V2F F;  5FAQ A;  4MCW A;  2XSS A;  1ACF A;  4IUH A;  2D02 A;  3C4O A;  4MBF A;  2WUQ A;  3F1O A;  1MBL A;  3T1S A;  5CRF A;  1F2K A;  5EVI B;  3KX0 X;  1K4F A;  4P0M A;  3MQ0 A;  2OLU A;  3Q7Z A;  4LLO B;  3IF6 C;  1SKO B;  5DKK A;  2XK1 A;  3Q07 A;  2Z6C A;  2QMI A;  4PMA A;  4N92 A;  2FFF B;  1BYW A;  1GHP A;  5A92 A;  5CHM A;  2DNS A;  3MSH A;  4EEP A;  3F1N B;  5GLB A;  4UA7 A;  2BTF P;  1S4R A;  4P85 A;  1TS6 A;  1LL9 A;  3P09 A;  4OON A;  5GL9 A;  3WS0 A;  2YKF A;  2VGK A;  1P0Z A;  1G6O A;  5DKL A;  3ITB A;  5CXW A;  5F83 A;  1MY8 A;  1Y28 A;  1K4E A;  2ZMF A;  3O87 A;  2WKH A;  1OTA A;  5FAO A;  2IA2 A;  4X25 A;  1YMX A;  2OV5 A;  5EEC A;  5FQJ A;  4EUZ A;  2JCH A;  3M2J A;  2V1Z A;  5CEB A;  2O9C A;  4C75 A;  1XA1 A;  4RA7 A;  3FV7 A;  3IHA A;  2H0Y A;  5EM0 A;  2R78 A;  3MXQ A;  1JWP A;  4HH3 A;  2P7J A;  5DTS A;  4WL9 A;  2EX6 A;  1X0O A;  1FIL A;  4K0W A;  2GDN A;  4H6J A;  4OPR A;  3K3C A;  4WBG A;  4OQ0 A;  3LEZ A;  4E3J A;  1W63 Q;  3QHY A;  4Y7P A;  4KZ4 A;  3WWX A;  1J3W A;  1YLT A;  5CGW A;  4PKY G;  5E2G A;  5FAS A;  2HF6 A;  4D60 A;  1F5M A;  1S67 L;  3C5A A;  5M19 A;  2JBF A;  3D72 A;  3LID A;  3HLG A;  3LYX A;  1HVB A;  5HX9 A;  4EEU A;  2Y2G A;  3T1R A;  2G2W A;  3SZT A;  3BM6 A;  2EX9 A;  4MLL A;  3Q7V A;  4ZBE A;  4KZ7 A;  4HIA A;  1W5D A;  2ZMA A;  4Y0O A;  2GJ3 A;  4WF0 A;  4E3M A;  2Y55 A;  1OME A;  3HUN A;  4DDY A;  4FH2 A;  1N9O A;  2Q9M A;  2J9P A;  3W4P A;  3VP4 A;  4GLQ A;  3A3E A;  3TJZ C;  2NUT C;  4FTX A;  2XFT A;  1XJ3 A;  4ZAM A;  3C30 A;  3L9K A;  1AXB A;  1ZKJ A;  2W27 A;  4I3J A;  5CED A;  1V9Z A;  4OQG A;  3PTE A;  1MXO A;  2ZBB A;  4OPY A;  2E8J A;  2D01 A;  2R9W A;  4LRX C;  3B42 A;  3T4K A;  3JVV A;  4X1M A;  2ZD8 A;  1FIK A;  4KZ6 A;  3LGO A;  4Q8I A;  4LCL A;  3OPR A;  3O5Y A;  1L0G A;  4HJ6 A;  3BY9 A;  3G35 A;  5EVI A;  3DWK A;  1K56 D;  1PFL A;  1PRQ A;  1PWG A;  1E4D A;  4XUZ A;  2W1T A;  2K31 A;  1RP5 A;  4EQI A;  2MJ6 A;  3S7P A;  2A24 B;  1RCJ A;  3BW6 A;  4QWO A;  4KG6 A;  3SW1 A;  4GS9 B;  2PHY A;  3O86 A;  1J9M A;  2J9O A;  4NEE D;  3O3V A;  3F1N A;  5EE8 A;  2G7U A;  2QWS A;  2ZL1 B;  3LY3 A;  3PHY A;  3UY6 A;  3TOI A;  3QNB A;  3NY4 A;  3KYQ A;  4L0L A;  2XA7 M;  2WKQ A;  4NXF A;  3LIC A;  2WK0 A;  3ZG0 A;  4NET A;  3WS4 A;  1BLH A;  2ACG A;  4B88 A;  4FD8 A;  4OOY A;  5TR7 A;  4Y2F A;  2PU2 A;  5FSR A;  1CI8 A;  1FSY A;  3IXD A;  1LL5 A;  1MZU A;  3VP2 A;  4OPQ A;  3U2A A;  4IVI A;  3MXR A;  2EXA A;  1VEU B;  2Y2P A;  4ZJ2 A;  2Y2M A;  2WGW A;  4RX3 A;  3ICY A;  1T1C A;  2VZW A;  4JGR A;  2WZZ A;  2GZA A;  4WMC D;  5F5Y A;  3A0V A;  3ZCZ A;  1ODV A;  3DAV A;  4R4R A;  3HUM A;  3ISG A;  4BWI A;  2J3T C;  3ZG8 B;  5A93 A;  4UA9 A;  1T18 A;  4DN0 A;  2XFS A;  3IXG A;  2Z6D A;  2FFY A;  3UDX A;  3WRZ A;  3LEQ A;  4KG2 A;  4NG2 A;  3VFF A;  2P04 A;  1OT6 A;  4P87 A;  4R23 A;  4I3A A;  2ZM2 A;  2O0Y A;  4Q0J A;  1G68 A;  3LR4 A;  3IXB A;  1NRF A;  3NCK A;  4R3J A;  1NWZ A;  1GCE A;  3R7W B;  4Y17 A;  3PYP A;  3ZVW A;  1NZO A;  1PW8 A;  1JWZ A;  3NBL A;  5TBM A;  2WAF A;  3NEC A;  4QU3 A;  5TGF A;  2O9B A;  1WE4 A;  1DP8 A;  4CLC D;  4IVK A;  4NXE A;  3BLS A;  1ES2 A;  4P6B A;  2HV1 A;  4R4S A;  2L4R A;  4RYE A;  4S2I A;  4GOG A;  4HBU A;  3VE4 A;  3NHQ A;  4YWZ A;  4S2O A;  3ZYT A;  4JGQ A;  1OTD A;  2FH5 A;  4ETX A;  3G6O A;  1ALQ A;  2FZ0 A;  3VP0 A;  1XJ6 A;  3QP8 A;  2ZQD A;  1TS0 A;  3OOV A;  4LCM A;  2EFX A;  4FOF A;  2KLI A;  4GD8 A;  2DRW A;  4HQA A;  5DFX A;  4WUJ A;  4QJG A;  4JXW A;  5HDD A;  4S2N A;  1DP9 A;  1YLY A;  4O8G A;  4GDB A;  4JF6 A;  4ETZ A;  2HP9 A;  3MBZ A;  3AGD A;  4GN2 A;  4S2P A;  2A24 A;  3SH7 A;  5IHV A;  4R3A A;  2WKR A;  1CJF A;  2XEP A;  1NY0 A;  4GS9 A;  4OLD A;  1K25 A;  5FQQ A;  2HP5 A;  2BG1 A;  4CJN A;  5FI7 A;  5JYP A;  1IKG A;  3MKE A;  2ZL1 A;  4HI4 A;  5AQ9 A;  3T4L A;  2PYR A;  2V1A A;  1PNE A;  2A3U A;  4XUX A;  2HDQ A;  2XDM A;  4GJ4 A;  4IED A;  4OP5 A;  4KZ8 A;  2VGJ A;  3ZFZ A;  3N8S A;  5EOO A;  2X71 A;  4N1H A;  2QZ6 A;  4GZB A;  1T1A A;  2Y2H A;  1O07 A;  5CGS A;  5J4E A;  4X53 A;  1KE0 A;  1CEG A;  1YMS A;  2UWX A;  3SS4 A;  2XRO A;  1VEU A;  4Y13 A;  3CPT A;  1P9R A;  3BJN A;  2X01 A;  1Z09 A;  4U3T A;  3N8L A;  1L0D A;  3EGX C;  5I5L A;  3U4L P;  2DMW A;  1CEF A;  3CHW P;  4EV4 A;  2PU4 A;  3EGD C;  5J7E A;  3WRT A;  1AWI A;  2C5W B;  1VET B;  2XLN A;  4JGP A;  2KOI A;  4KUK A;  4WLA A;  2VK3 A;  3OPP A;  2G2U A;  3A3D A;  2BLS A;  1LHY A;  2Y2Q A;  3D4F A;  4BBU A;  3C4P A;  4QHC A;  4LPZ A;  5HZH A;  3CUE C;  3UE0 A;  3N7W A;  2J8Y A;  3PBQ A;  4JF4 A;  3FG8 A;  1DJC A;  4BJP A;  5F82 A;  4NK3 A;  1LSW A;  3KSI A;  3NC8 A;  1ONH A;  4ESP A;  5AVF A;  5A8B A;  2OWH A;  2QJ7 A;  4XT2 B;  4PAU A;  2PT7 A;  4E6W A;  4QD4 A;  1L0F A;  2V0W A;  1SDN A;  1WA9 A;  3UN7 A;  3HCY A;  2IWC A;  2VA0 A;  5CX7 A;  4KG5 A;  4YFM A;  2QJ5 A;  3T1X A;  3NOU C;  1IOU A;  1NLY A;  3EQV A;  4ARZ B;  3BWL A;  4HES A;  4MBK A;  1JTD A;  3D9Y A;  5DTT A;  4F3L B;  4U0X A;  3ZGA B;  1XPB A;  5F69 A;  4HBT A;  3L7H A;  5FDS A;  1PI5 A;  3NI9 A;  1I2S A;  3H7W B;  4S2M A;  3ULF A;  1DP6 A;  3E0Y A;  3BQA A;  3G34 A;  3GDI A;  1BZA A;  1FSW A;  3HBR A;  4CLC E;  2ZMV A;  3EEA A;  2VX8 A;  3LI8 A;  5KMW A;  2PD8 A;  3AGE A;  4QY6 A;  1W63 M;  4EER A;  2PR6 A;  3IX8 A;  3HLW A;  1JVJ A;  3OZH A;  3IX3 A;  3MR0 A;  4WM9 A;  2V0U A;  3HLC A;  4QB8 A;  2RCX A;  1E25 A;  2WAE A;  5EVI C;  3VSL A;  4KZA A;  2XGN A;  4Y0U A;  3VOZ A;  3LR0 A;  4O0P A;  1MC0 A;  2ZC3 B;  2NUP C;  1KGG A;  3S4X A;  4OH0 A;  5FAP A;  4WZ4 A;  1GHI A;  4PHT A;  3B3X A;  5E2F A;  1E3U D;  1WYB A;  4LV0 A;  2JKT I;  1EI5 A;  1BSG A;  4LRZ E;  1Z6F A;  1KVM A;  4R1G A;  4B9O A;  3CUE A;  4MNR A;  3PXP A;  3OCL A;  2OAQ 1;  1XJ2 A;  3RH8 B;  2L0W A;  4PM6 A;  4CPK A;  4Q0I A;  3FC7 A;  5HFO A;  1S66 L;  3IBR A;  5F68 A;  4I39 A;  3FKV A;  4IBR A;  2QPN A;  3IH8 A;  3C7V A;  4GHI B;  1ERQ A;  1LT0 A;  2OWJ A;  5AQB A;  5DFY A;  2W3F A;  3H82 B;  5FAT A;  4LRY C;  2ZC6 B;  5DJT A;  3DW0 A;  2JKT M;  5KZH A;  1VET A;  1D7E A;  1KOU A;  3PBS A;  1FQG A;  5GHX A;  5IU1 A;  5FQI A;  3QNC A;  1CF0 A;  2PRF A;  1ZHH B;  3PBT A;  4R3B A;  1IEM A;  2P08 A;  3KSH A;  4NKP A;  3MZD A;  2ZM0 A;  2ZC5 B;  3VFH A;  1S1Y A;  4BD1 A;  4EXO A;  1L3L A;  1XGI A;  3DTI A;  2J7V A;  1GSX A;  1JNU A;  4KQR A;  2W3G A;  3DTE A;  4G3W A;  4XT2 A;  3VP1 A;  5HL1 A;  1LI9 A;  3IQA A;  3LUQ A;  4E3K A;  2I9V A;  1W79 A;  1WYC A;  3PAG A;  1LLB A;  3GQZ A;  3N4I A;  1OJ5 A;  1VB6 A;  4DE3 A;  5D3O A;  1XP4 A;  3VP3 A;  4ZRR A;  5FDH A;  1FCM A;  1GA0 A;  3OC2 A;  4LGW A;  4ARZ A;  1GA9 A;  4OQH A;  1M40 A;  2CMN A;  3HUO A;  3IX4 A;  3CG5 A;  2VLG A;  3Q1F A;  4BL3 A;  5EM1 A;  3IS2 B;  1SKO A;  3T12 B;  4B4X A;  3V3R A;  3T50 A;  1U60 A;  3IH9 A;  1TS7 A;  2QYB A;  3C38 A;  2RL3 A;  5KSC A;  4UA6 A;  1HTZ A;  3H7W A;  4EW7 A;  3UDI A;  2JHE A;  3ZHH A;  3ZNY A;  3KSF A;  5E43 A;  4O7D A;  1N9L A;  3MZE A;  2P9V B;  2ZC7 A;  2Z2M B;  1P9W A;  3QP1 A;  3TE8 A;  1CQA A;  3LIB A;  2WZX A;  3A3F A;  3CWF A;  2OOL A;  1D1J A;  2O99 A;  2Y2L A;  1TEM A;  4JXV A;  2Y2J A;  3EQU A;  4LV2 A;  3KYE A;  2IWD A;  3E4O A;  5GLA A;  3I7J A;  3BY8 A;  5GLC A;  4EUV A;  3RJU A;  3CLO A;  4S2N C;  2KX6 A;  1OTI A;  5FL3 A;  5HWW A;  1Y54 A;  2ZM8 A;  5GHY A;  2ZQA A;  4GNU A;  1TVF A;  2V8F A;  2JKG A;  3HJI A;  1ONG A;  2WAD A;  2BAS A;  5DF9 A;  3HLD A;  1BTL A;  1XJ4 A;  1A0K A;  1TDL A;  3MQO A;  4EQ1 A;  4UAA A;  2M1C A;  1SHV A;  3VOY A;  3HLE A;  2R9X A;  3P7N A;  3BFG A;  4BEN A;  1SKF A;  4DJ3 A;  2VJW A;  2AVX A;  5EPH A;  1HZO A;  1IKI A;  4Z1W A;  5HSQ A;  4OLG A;  4QY5 A;  1ESI A;  1DRM A;  4DF6 A;  3T4S A;  1QME A;  3ZG9 B;  4GHI A;  1K55 C;  3M6B A;  3VMA A;  4CLC B;  3H82 A;  5FQ9 A;  3LFV A;  3TG9 A;  3LR3 A;  3UMD A;  1D06 A;  1TD5 A;  2EWW A;  1NLZ A;  1PIO A;  3W4O A;  4GW9 A;  4DXC A;  3NDE A;  4HJ3 A;  3HJK A;  1XX2 A;  4M3K A;  2WGI A;  3PBN A;  5F6A A;  4KZ3 A;  4C3Q A;  4I5S A;  3T4Q A;  1YT4 A;  2JE5 A;  5FQK A;  3F1O B;  1HD8 A;  5L09 A;  5HAR A;  4EET B;  3RXX A;  1LL8 A;  4ID4 A;  2W1R A;  1G5U A;  1LI0 A;  4MN5 A;  5IS1 A;  1KDS A;  3GR2 A;  2EX8 A;  3MQQ A;  2Q0O A;  4M4X A;  4E3O A;  4BBV A;  1F98 A;  1SZV A;  1H8Y A;  4C6Y A;  4PM8 A;  3RFB A;  1EWZ A;  1SDE A;  1H5X A;  4X1L A;  2X02 A;  2W3E A;  4E3L A;  1ERO A;  3PBR A;  5A90 A;  3G4P A;  4N9K A;  3SH9 A;  1K57 C;  2ZQC A;  3V50 A;  4KUO A;  2VV7 A;  4O01 A;  5CHJ A;  1IEL A;  4KZB A;  1I2W A;  1MWS A;  2KDK A;  3GMW A;  2B18 A;  3IS2 A;  2E8I A;  4L9F A;  3V5M A;  1K54 A;  1BUE A;  1KGE A;  1TDG A;  3GRJ A;  3FKW A;  3IF5 A;  1LSV A;  3NOP C;  4JXS A;  2A49 A;  1PYY A;  1ZG6 A;  5K5B A;  5EVE A;  4GB7 A;  3H9W A;  4WZ5 C;  3UDF A;  3NJA A;  3VE3 A;  3RTY A;  1PWD A;  3S1Y A;  2WGV A;  4LFU A;  3MJQ A;  2ZC4 B;  4Y3I A;  3Q82 A;  3QP2 A;  4PPR A;  4BMW A;  3S7O A;  2H0T A;  2VV6 A;  1H8M A;  2INW A;  5J3W A;  4OOM A;  4X56 A;  3ZNT A;  4A5R A;  4FCF A;  3TW8 A;  1YLW A;  4BD0 A;  3Q81 A;  5DTK A;  1NXY A;  1MPL A;  4GCZ A;  3R4K A;  4WMC A;  3ZQ5 A;  3M2K A;  3M6H A;  1K55 A;  4HHD A;  3TRC A;  4PM9 A;  1OPX A;  1XFN A;  1ES5 A;  2JN7 A;  2V20 A;  3LY4 A;  3DWZ A;  4WEK A;  5AVE A;  2I72 A;  4GDN A;  1ESU A;  1MWU A;  5HWT A;  3UE1 A;  1SCW A;  1F9I A;  4MBH A;  1PW1 A;  3OPL A;  1ZC2 A;  3MKF A;  5HAQ A;  2HGV A;  4JXG A;  3CJM A;  3GSG A;  3Q7V B;  3S7Q A;  2PAV P;  1NYM A;  1K0K A;  2GX5 A;  3D3O A;  1M6K A;  5MC7 A;  2Y2N A;  3UB8 A;  1KGF A;  2H10 A;  1BUL A;  1XA7 A;  4OKP A;  2CC1 A;  4K08 A;  2HPB A;  3IF6 B;  4EBN A;  4KZ9 A;  4JGO A;  5FA7 A;  2OLV A;  2WKI A;  3CI6 A;  3R7W A;  1S6R A;  1YKD A;  4X68 A;  2H28 A;  4IJG A;  4CLC A;  5JYO A;  4S2K A;  3VOL A;  5FEG A;  1K57 A;  2Y91 A;  3A0R A;  3FZC A;  3EEH A;  3HLB A;  2HDU A;  5M1A A;  5GHZ A;  4Z9Q A;  3KYZ A;  4Y5F A;  4H8R A;  5AQA A;  4EBL A;  3K3D A;  1XFQ A;  3GEC A;  4BL2 A;  3BFC A;  3E2L A;  3BFD A;  3MZF A;  4R70 A;  2LB5 A;  3OLO A;  2Z2L B;  1KE3 A;  4B93 A;  1DY6 A;  1PZO A;  2ZQ9 A;  5G18 A;  3T1Q B;  3G2Z A;  3ZG5 A;  1EW0 A;  2W1T B;  4UHU A;  4DRT A;  4WZ5 A;  4X55 A;  4L9E A;  3GV9 A;  4IHQ A;  1PI4 A;  4E04 A;  5EVI D;  1DJB A;  4N1X A;  4ZDX A;  3BFF A;  1ERM A;  3IWQ A;  1JTG A;  1PWC A;  1T19 A;  4FSF A;  4OOL A;  1FOF A;  2J80 A;  1I5Q A;  4WYY A;  4F94 A;  3W2Z A;  2PD7 A;  3B47 A;  3W8K A;  4RX2 A;  1IYQ A;  3C7U A;  2ZOI A;  3S22 A;  2XR0 A;  1XXM A;  4HNB A;  2HJ9 C;  1S0W A;  2P74 A;  1MWR A;  3NUL A;  3HVF A;  5BOH A;  5HDS A;  4G3K A;  3EWK A;  3A3J A;  4DJ2 A;  2HP6 A;  1OJG A;  4DMZ A;  1C3B A;  3FPW A;  2WGW B;  1GSW A;  3UPO A;  5DJU A;  3EOI A;  2M7V A;  3F1P B;  1NJ4 A;  1XGJ A;  1ZTU A;  3UB5 P;  1YSP A;  4S2J A;  5FQM A;  2XQZ A;  3WS5 A;  5FEF A;  2Y2I A;  1Y4O A;  2B02 A;  1QMF A;  2L1M A;  4ZJ3 A;  5CER A;  4GD6 A;  1YM1 A;  1RGY A;  1S1Z A;  3OPH A;  4K0X A;  3UB7 A;  1IYS A;  5CTM A;  4QPR A;  2PBY A;  5KIZ A;  1H3Q A;  1K6S A;  4DE2 A;  4II7 A;  4KQO A;  5FI2 A;  2QKP A;  4BLM A;  3E98 A;  3N6I A;  3LIA A;  3G32 A;  1V9Y A;  4Y0T A;  4YIN A;  4MN6 A;  4BQM A;  3T4J A;  1MKI A;  2HDR A;  1Q2P A;  3ZDJ A;  1YLJ A;  1MWT A;  4OPZ A;  1IYP A;  2PBD P;  2XF3 A;  3S7N A;  1ZG4 A;  3JPU A;  5TBM B;  2W3H A;  3BQ8 A; 
#chains in the Genus database with same CATH homology
 3MQ0 A;  2EWV A;  4R3A A;  2BAS A;  2WKR A;  3JVU A;  5DF9 A;  2XRN A;  4GS9 A;  4LLO B;  1XJ4 A;  2YKH A;  5DKK A;  3MQO A;  4EQ1 A;  4YOF A;  2Z6C A;  2M1C A;  2V9A A;  4HI4 A;  2QHK A;  1BYW A;  1OTE A;  3T4L A;  2PYR A;  3P7N A;  2V1A A;  4DJ3 A;  4EEP A;  2VJW A;  5HDC A;  3F1N B;  3E4P A;  4Z1W A;  5HSQ A;  4G3V A;  4GJ4 A;  3T4T A;  1S4R A;  1DRM A;  3T4S A;  1TS6 A;  5EFW A;  1T1A A;  4GHI A;  5J4E A;  2YKF A;  1P0Z A;  4CLC B;  1G6O A;  3H82 A;  2XRO A;  3LFV A;  5DKL A;  3LR3 A;  3UMD A;  1D06 A;  1P9R A;  1TD5 A;  3BJN A;  2EWW A;  1NLZ A;  4GW9 A;  3EGX C;  1Y28 A;  2PYP A;  5I5L A;  4F3L A;  2ZMF A;  4HJ3 A;  3HJK A;  2DMW A;  1OTA A;  3EGD C;  5J7E A;  3PBN A;  5F6A A;  2EA9 A;  2IA2 A;  4I5S A;  3T4Q A;  4JGP A;  2KOI A;  3F1O B;  3OBF A;  4HY8 A;  4KUK A;  4EET B;  1LL8 A;  4WLA A;  2O9C A;  2W1R A;  4MN5 A;  2JKR I;  5IS1 A;  2K2N A;  3MMH A;  4BBU A;  3CAX A;  1UWN X;  3MQQ A;  4LPZ A;  2R78 A;  5G4Z A;  5HZH A;  3MXQ A;  3CUE C;  4HH3 A;  2P7J A;  4M4X A;  4BBV A;  4WL9 A;  4HP4 A;  1F98 A;  3PBQ A;  4WEJ A;  3FG8 A;  1X0O A;  3RFB A;  4BJP A;  4PKY A;  2W0N A;  2W3D A;  1LSW A;  3KSI A;  4H6J A;  3K3C A;  2W3E A;  5AVF A;  5A8B A;  3PBR A;  2OWH A;  1W63 Q;  2QJ7 A;  4XT2 B;  1GSV A;  4PAU A;  2PT7 A;  1MKM A;  4HH2 A;  2V0W A;  4PKY G;  1WA9 A;  2J3T D;  3LR5 A;  3CIT A;  2HF6 A;  3HCY A;  4L9G A;  1F5M A;  1S67 L;  2VA0 A;  5CX7 A;  3D72 A;  2QJ5 A;  4KUO A;  1OT9 A;  2VV7 A;  3LID A;  5L8M A;  4O01 A;  2JKR M;  3LYX A;  3NOU C;  3T4O A;  1IOU A;  2KDK A;  4EEU A;  1NLY A;  5HPF A;  3EQV A;  4ARZ B;  2B18 A;  3BWL A;  3IS2 A;  2Y8H A;  4L9F A;  3DBA A;  2O9A A;  4HIA A;  1LSV A;  4F3L B;  3NOP C;  2VEA A;  3F1P A;  2GJ3 A;  4WF0 A;  5K5B A;  5F69 A;  4RQ9 A;  3H9W A;  2Y79 A;  4WEL A;  2J3W A;  3ULF A;  1N9O A;  2XA7 S;  3H7W B;  2VGL M;  1DP6 A;  3E0Y A;  3NJA A;  5KSH A;  3BQA A;  3VE3 A;  3RTY A;  3GDI A;  2V1B A;  1UWP X;  4GLQ A;  4MMN A;  1N9N A;  3MJQ A;  2ZMV A;  3EEA A;  4CLC E;  3NOT C;  3LIE A;  3TJZ C;  2NUT C;  2VX8 A;  3LI8 A;  4Y3I A;  2PD8 A;  1W63 M;  1XJ3 A;  3C30 A;  4EER A;  4R38 A;  4BMW A;  2PR6 A;  3S7O A;  2VV6 A;  1H8M A;  2INW A;  2W27 A;  5J3W A;  5IT5 A;  3PR6 A;  4OOM A;  4CQH A;  3TW8 A;  4I3J A;  5AJG A;  3MR0 A;  2V0U A;  4GCZ A;  1V9Z A;  3R4K A;  3ZQ5 A;  2ZBB A;  4YNR A;  5HD3 A;  2D01 A;  4LRX C;  3B42 A;  3T4K A;  3JVV A;  4HHD A;  3TRC A;  2ZOH A;  1OPX A;  1XFN A;  2VGL S;  2JN7 A;  4EES A;  3LR0 A;  1G28 A;  3MF0 A;  3O5Y A;  2VV8 A;  4WEK A;  4HJ6 A;  5AVE A;  3BY9 A;  4O0P A;  1MC0 A;  1YAX A;  2NUP C;  1TF1 A;  5HWT A;  3KSG A;  5HPI A;  2W1T A;  1F9I A;  4PHT A;  2K31 A;  2MJ6 A;  3S7P A;  2HGV A;  5HWV A;  2A24 B;  3BW6 A;  4BBT A;  5G4Y A;  3S7Q A;  1P97 A;  2JKT I;  3SW1 A;  4GS9 B;  2PHY A;  2GX5 A;  2OAP 1;  3D3O A;  4LRZ E;  1T1B A;  4ME4 A;  5MC7 A;  2VKS A;  3UB8 A;  4HJ4 A;  3A0S A;  4NEE D;  4B9O A;  3CUE A;  1IFQ A;  1LSX A;  3PXP A;  3F1N A;  4Q0H A;  2A2L A;  2G7U A;  2QWS A;  3MFX A;  4K08 A;  3PHY A;  3UB6 A;  3UME A;  3OCL A;  2OAQ 1;  1XJ2 A;  3C8C A;  3RH8 B;  2L0W A;  3KYQ A;  1VHM A;  4CLC C;  4L0L A;  2XA7 M;  4JGO A;  2WKQ A;  4NXF A;  3LIC A;  1OTB A;  4Q0I A;  3CI6 A;  3R7W A;  1YKD A;  3FC7 A;  5HD5 A;  1S66 L;  3IBR A;  5F68 A;  4Y2F A;  2H28 A;  4IJG A;  4CLC A;  4I39 A;  3UE3 A;  3VOL A;  4GHI B;  3C2W A;  4EU0 A;  3A0R A;  3KO6 A;  3EEH A;  1MZU A;  4WN5 A;  3IBJ A;  1LT0 A;  2OWJ A;  3LIF A;  3U2A A;  5DFY A;  2W3F A;  3H82 B;  4LRY C;  5DJT A;  3KYZ A;  3E4Q A;  2JKT M;  4Y5F A;  4MN7 A;  2LB9 A;  3V67 A;  1D7E A;  3ICY A;  3K3D A;  1XFQ A;  1KOU A;  3GEC A;  1T1C A;  3PBS A;  2VZW A;  4JGR A;  5IU1 A;  4KQD A;  4NXB A;  2GZA A;  4MDZ A;  1STZ A;  4R70 A;  2LB5 A;  4I38 A;  5F5Y A;  3OLO A;  3A0V A;  4AFI A;  4B93 A;  1ODV A;  1ZHH B;  3UB9 A;  3PBT A;  2P08 A;  4UQI M;  3KSH A;  2K7S A;  3PBO A;  4NKP A;  4BWI A;  1EW0 A;  2J3T C;  2W1T B;  2HJE A;  4L9E A;  4IHQ A;  1S1Y A;  3B33 A;  2PR5 A;  4E04 A;  1T18 A;  4DN0 A;  4EXO A;  2Z6D A;  1GSX A;  1JNU A;  2W3G A;  4G3W A;  4XT2 A;  3UE6 A;  2P04 A;  4P6Z M;  1OT6 A;  4I3A A;  4H6J B;  2O0Y A;  3LUQ A;  1T19 A;  4FSF A;  2I9V A;  4OOL A;  4Q0J A;  2J80 A;  3K2N A;  3LR4 A;  3W2Z A;  2PD7 A;  3B47 A;  1S4S A;  5C5K A;  2GNX A;  3P01 A;  1NRJ A;  1OJ5 A;  1VB6 A;  5LBR A;  1NWZ A;  4UQI S;  3R7W B;  4ZRR A;  2ZOI A;  3PYP A;  4HNB A;  3OC2 A;  4HP9 A;  5HL6 A;  1TS8 A;  4ARZ A;  2HJ9 C;  3OCN A;  5TBM A;  2CMN A;  2VLG A;  4IUK A;  5HDS A;  4G3K A;  3EWK A;  2O9B A;  4DJ2 A;  1OJG A;  1DP8 A;  3IS2 B;  4HOI A;  4CLC D;  4DMZ A;  3LI9 A;  3T50 A;  4NXE A;  1TS7 A;  2QYB A;  3C38 A;  3FPW A;  4P6Z S;  1GSW A;  3H7W A;  5DJU A;  4EW7 A;  3EOI A;  2M7V A;  2JHE A;  2HV1 A;  3F1P B;  3KSF A;  2L4R A;  1ZTU A;  1YSP A;  2WKP A;  3VE4 A;  2M7U A;  1N9L A;  3VV4 A;  4I3I A;  4R6L A;  3NHQ A;  4YWZ A;  3ZYT A;  2PDR A;  4JGQ A;  1OTD A;  2B02 A;  2L1M A;  1P9W A;  2FH5 A;  3TE8 A;  4ETX A;  3G6O A;  3LIB A;  2FZ0 A;  3CWF A;  2OOL A;  2O99 A;  1S1Z A;  3FPV A;  1XJ6 A;  3EQU A;  3UB7 A;  5TJJ A;  1YSQ A;  3E4O A;  4QPR A;  1TS0 A;  5KIZ A;  3OOV A;  1H3Q A;  4FOF A;  4NXG A;  3BY8 A;  1UGU A;  2KLI A;  4UEY A;  4HQA A;  4EUV A;  4II7 A;  4KQO A;  3CLO A;  5DFX A;  2KX6 A;  4MCW A;  2XSS A;  4WUJ A;  1OTI A;  5FL3 A;  2QKP A;  4IUH A;  3E98 A;  5HWW A;  2D02 A;  3LIA A;  3F1O A;  1V9Y A;  5HDD A;  4MN6 A;  1DP9 A;  4O8G A;  3T4J A;  4ETZ A;  3HJI A;  3KX0 X;  3S7N A;  5TBM B;  2W3H A;  3BQ8 A;  2A24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...