2VV8A

Co-bound structure of bjfixlh
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein
total genus 25
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv8A00
3C8CA 3LICA 3HJKA 2QJ5A 3A0VA 4PKYG 1DP9A 4MN5A 3GDIA 5KIZA 4WLAA 1UWPX 3NOTC 4GCZA 5DJTA 4BBVA 1TS0A 2ZBBA 2GJ3A 3LIAA 4F3LA 1T1CA 3PYPA 3P7NA 4XT2A 1OTDA 1XJ3A 4JGQA 3MXQA 3NOUC 2BASA 4R70A 3MJQA 1UGUA 2Z6DA 2D01A 4BBUA 4EERA 3VE3A 4HH2A 1WA9A 2Z6CA 3B33A 3BWLA 4HNBA 1GSWA 2A24A 5DKKA 3A0RA 2K7SA 1D7EA 1T1BA 2QHKA 5F6AA 3BY8A 1OTBA 1UWNX 2HV1A 2WKRA 1XFQA 2VV7A 3VE4A 5TBMB 1X0OA 3EWKA 4I3JA 2EA9A 2L4RA 2I9VA 2QJ7A 3ZQ5A 2INWA 3F1OA 4L9GA 3BY9A 5HDDA 4DJ3A 3A0SA 4NXBA 3H9WA 2OWJA 4WN5A 4WL9A 5J7EA 4YWZA 3HJIA 3NHQA 1N9OA 3MQQA 2W0NA 3LI9A 3UMEA 5EFWA 2M1CA 4M4XA 1T1AA 2PYPA 3G6OA 4BBTA 4I3AA 1LL8A 4GS9B 2L1MA 2P7JA 4HOIA 1OTIA 4GHIB 2PD7A 4KUOA 4NXGA 5HDSA 1P97A 5J3WA 3H82B 2PR6A 2WKPA 3F1PB 5G4YA 1OTEA 4KQDA 4PKYA 1LSXA 1XFNA 1P0ZA 4R3AA 3LIDA 3IS2B 4JGPA 1V9ZA 4I38A 4GW9A 4E04A 3CLOA 1F9IA 2ZOIA 3LYXA 3KX0X 2V0UA 3MQOA 2KX6A 3H7WA 1OT6A 3F1NB 4LRZE 1S4SA 2JHEA 5IU1A 3E4OA 1XJ6A 3VOLA 2PYRA 3E4QA 1TS6A 4H6JB 2B02A 3MR0A 4R6LA 3NJAA 2OOLA 3RTYA 1TS8A 4HIAA 3UB7A 4L9FA 4LRXC 5TBMA 2W27A 1JNUA 2V0WA 4HJ6A 5HWWA 3K3DA 4HY8A 5J4EA 4HH3A 4RQ9A 4HJ4A 4K08A 4JGRA 2VLGA 4KUKA 3UB8A 3D72A 4B9OA 4WUJA 1TS7A 3LUQA 2H28A 2WKQA 3UE6A 4EESA 1LT0A 2VV8A 1GSVA 1ODVA 3IBRA 4L9EA 3E4PA 2PR5A 3K3CA 2VEAA 4HJ3A 5F5YA 2YKFA 1LSWA 5AVFA 4EETB 1NWZA 1S66L 4I3IA 4GS9A 5HD3A 3EEHA 3LIEA 5F68A 4GHIA 4HHDA 3SW1A 3C2WA 3H82A 3F1PA 3CWFA 1S4RA 1S1YA 2V9AA 1EW0A 1KOUA 4MN6A 2PDRA 1V9YA 3LIFA 1DRMA 4LPZA 1MZUA 1OTAA 2KDKA 5HWVA 1OT9A 1OJGA 1T18A 1F98A 2PD8A 3F1NA 5HSQA 4DJ2A 4EQ1A 1OJ5A 1N9NA 1N9LA 1Y28A 5HD5A 4JGOA 1DP6A 1T19A 4I39A 4H6JA 1S67L 5HWTA 4F3LB 1D06A 4NXEA 1LSVA 3CAXA 1S1ZA 3PHYA 3H7WB 3ULFA 4XT2B 4HI4A 4LRYC 5I5LA 4EEPA 1DP8A 2CMNA 4EW7A 5IS1A 2QWSA 3FC7A 2D02A 1XJ4A 3GECA 3LIBA 5HDCA 5HZHA 5A8BA 2A24B 2QKPA 3MFXA 5G4ZA 2YKHA 2V1AA 3OLOA 2L0WA 1GSXA 3UB6A 4EEUA 5DJUA 4R38A 4HP4A 2JN7A 4HP9A 5AVEA 3T50A 2J80A 3NOPC 2ZOHA 2VV6A 1VB6A 3ICYA 3UB9A 3FG8A 3LI8A 2V1BA 5F69A 2PHYA 3F1OB 4LLOB 1BYWA 3UMDA 4HQAA 1XJ2A 4EXOA 1G28A 2R78A 4WF0A 5DKLA 3RH8B 2OWHA 4I5SA 3IS2A 4NXFA
chains in the Genus database with same CATH superfamily
3W8KA 5TR7A 3JVVA 2XLNA 3FWLA 3LR4A 1K6RA 1MKMA 3LICA 1EWZA 3O87A 3A0VA 4IHQA 3P98A 1WYCA 3LY4A 1RCJA 1O7EA 4Y0OA 3IX8A 5KIZA 4WLAA 2J7VA 5MC7A 2VGLS 4ZBEA 1NZUA 5F82A 1YAXA 3PYPA 5DF9A 4C6YA 3P7NA 1DY6A 2Y2MA 4XT2A 3QP4A 1OTDA 3QP8A 2I72A 4NKPA 1H8ZA 4LENA 2BASA 2C6WB 4P85A 4CJNA 4Q0IA 1S0WA 4KZ5A 1LLBA 4Z1WA 5EOEA 4BBUA 2XQZA 2OAQ1 4S2IA 4DXCA 4HNBA 3DAVA 4A5RA 1GSWA 4Y15A 2WUQA 4X68A 3TJZC 4FH2A 1G5UA 1MXOA 3G31A 3A0RA 3Q7VA 2LB5A 2K7SA 1F5MA 2GDNA 5F6AA 2ZD8A 3O88A 4DXBA 3BFFA 1E25A 3R7WB 4N9LA 1W63M 4GOGA 3C4OA 2Z2MB 5TBMB 2ZMAA 2XEPA 4ZAMA 3W4QA 4U3TA 5K5BA 3OCLA 5AQ7A 4WMCD 1NRJA 2QJ7A 1Q2QA 3LEZA 5M19A 3F1OA 4L9GA 3EQVA 1ZG6A 1K55C 2Y2QA 1SDEA 4DJ3A 2O99A 3A0SA 3IXBA 4X55A 4CQHA 5GLCA 3HJIA 3NHQA 5IT5A 4LFUA 2W0NA 3BQ8A 2M1CA 3L7HA 4R4RA 1VEUA 2PYPA 4KG6A 4OPRA 4GS9B 4JXVA 5CHMA 3SH7A 2L1MA 2P7JA 4HOIA 4KUOA 4P6ZS 3RXXA 3B47A 1BTLA 5L09A 2PR6A 4MBHA 5AQAA 4PKYA 1JWPA 3OC2A 2CC1A 4R3AA 5HARA 1K0KA 1W8QA 3CPTB 1SCWA 3A3FA 3B42A 4KZ3A 3AGFA 3E98A 1F9IA 1CJFA 2QZ6A 4OLGA 2ZQDA 1D1JA 2HJ9C 2HDUA 1JWZA 2AVXA 1MPLA 3MQOA 3ZCZA 1IKIA 3H7WA 3RFBA 3EQUA 4GLQA 4E3LA 3FKWA 2PBDP 3BRMA 1CEFA 2NUTC 4UEYA 2VGLM 4OKPA 4OONA 2QPNA 3V5MA 4X25A 5DF8A 3V67A 3B3XA 2PYRA 4OQ0A 3E4QA 2HF6A 3QP5A 3PXPA 2IWDA 3EOIA 2P9VA 3T4SA 3VSLA 4R6LA 1CEGA 3IXHA 1L0DA 2E8IA 4L9FA 3OCNA 4B93A 4HEFA 1JNUA 2V0WA 2ZMVA 3C38A 1PWDA 5J4EA 2NUPC 2X71A 4HJ4A 2VLGA 4KUKA 2Y2OA 3UB8A 3ZG7B 1PW1A 5E2FA 2WKHA 4Y0TA 4DRTA 3WS1A 1IEMA 1LI0A 1HD8A 1I2SA 1M6KA 3UPNA 1Z6FA 5HAIA 1YSQA 3E4PA 3MZFA 4R3JA 2OAP1 3N6IA 3G4PA 4JPMA 5EVID 1HZOA 5HFOA 3HLFA 4I3IA 1NRFA 3NC8A 5L8MA 3M6BA 2W3GA 3EEHA 3O3VA 1J9MA 4WEJA 1NZOA 4O8GA 1QMFA 4EU0A 3CI6A 4PHTA 2ZQ7A 2G2UA 3H82A 3NDEA 3TE8A 3S7QA 2WGWB 4GN2A 4N1XA 3HUOA 1L2SA 3S1YA 3LY3A 4MDZA 2V9AA 5M1AA 1EW0A 4IBRA 3Q07A 4LV2A 2HGVA 4N92A 3LIFA 1DRMA 4MBKA 4WBGA 2IWCA 1VEUB 5HWVA 4CPKA 3ITBA 3MKEA 1F98A 3HLEA 5F1FA 2PD8A 1MWRA 4BQMA 2EXBA 3T4KA 5HSQA 1ZC2A 4CLCB 1ZG4A 1N9NA 4WM9A 3PTEA 1HVBA 5HD5A 4JGOA 1DP6A 3M6HA 3BLSA 1IYOA 2ZC6B 2K2NA 4GKUA 1FQGA 4IUHA 5HWTA 2Y2PA 3NULA 1G68A 3O5YA 4MBFA 4ETZA 1S1ZA 3VOZA 1YMXA 5CRFA 3H7WB 2ZM8A 5BOHA 1W63Q 4HI4A 1PWGA 3ZDJA 1DJCA 2JKRI 1FOFA 4DE0A 4N1HA 2OV5A 2D02A 4U0XA 4LGWA 5EM0A 4C75A 4Y17A 1CI8A 3QNBA 1JTDA 2MJ6A 2XA7M 2YKHA 4S2PA 4S2KA 2Q0OA 3DWKA 4OOMA 2JN7A 5CEDA 5AVEA 4KZ6A 3BLMA 1NYYA 4OH0A 2C5WB 3LGOA 3UB9A 5L2FA 4PM8A 4LLOB 2DNSA 5EECA 3UMDA 2Y2LA 4EXOA 5KSHA 1K56D 2OWHA 1XGIA 2DMWA 5CECA 1AXBA 1XA7A 3UE3A 1AWIA 1TD5A 1W5DA 3HJKA 3FPWA 2QJ5A 5CEBA 1DP9A 2OLVA 3EGDC 1ZHHB 1VETB 3AGDA 3G32A 3GV9A 5E2EA 1MWTA 5FASA 1KVMA 5FQMA 1K55A 5HPFA 5E2HA 4GCZA 4X1MA 4R4SA 4F3LA 4MMNA 1T1CA 3VSKA 4ZJ1A 1E3UD 1BUEA 3LEQA 4OQHA 2P08A 4O01A 2EFUA 4GDBA 2XF3A 3MJQA 1UGUA 3NBLA 5GLAA 2ZLYA 4DN0A 3BJNA 1XXMA 4HH2A 3T4JA 3GVBA 3B33A 3PAGA 2W3DA 2G7UA 3SH9A 2A24A 1NY0A 1XGJA 3BFEA 3ITAA 3BFDA 1D7EA 1I2WA 2QHKA 3Q7ZA 2QMIA 5EE8A 3IH8A 1OTBA 2HV1A 3KSFA 3NIAA 3OPHA 3IF6A 2ZJ9A 4IBXA 3WRZA 2WKRA 1LL5A 3M2JA 3PBTA 2VV7A 3VE4A 3EWKA 4I3JA 3S4XA 2H0TA 4B88A 3T4LA 1ONGA 3IHBA 2GNXA 3ZQ5A 2W3HA 1GCEA 5F1GA 3JVUA 3A3EA 1ZKJA 3KSHA 1NLYA 2XFTA 3LR0A 3H9WA 3PBOA 4WL9A 4MNRA 3MQQA 2VA0A 5DTSA 5DTKA 5HAPA 5IHVA 1T1AA 1Q2PA 1G6OA 3A3JA 4I3AA 1LL8A 4QHCA 3IX3A 4G3VA 2EXAA 3IWIA 3SS5A 1KDWA 4RVAA 4Y3IA 5HDSA 2VX8A 2JKTI 1P97A 2V2FF 5GHZA 3F1PB 1MWSA 4YFMA 1OTEA 4KQDA 3ZNYA 1TVFA 1BZAA 2WKEA 1YQSA 4S2JA 2Y55A 3LYXA 4YINA 4S2MA 2WAEA 2V0UA 3E0YA 1W79A 4JXWA 4LRZE 1STZA 4ARZB 3V50A 1MBLA 2JHEA 3RXWA 4JKTA 4Y13A 3BEBA 1GHPA 2WGVA 4P6BA 2FFYA 5IU1A 4CLCD 3E4OA 2IWBA 2RL3A 1XJ6A 2PAVP 3KYEA 3ZG9B 3VOLA 1TS6A 3MBZA 4H6JB 3CUEA 5F83A 2J8YA 3W4OA 2B02A 1FIKA 2KLIA 4IEDA 4QY6A 2OOLA 4CLCE 3S7NA 1XP4A 3RTYA 2FH5A 4QB8A 3UB7A 3VMAA 1KE3A 3MXSA 2XSSA 2W1TB 2JKTM 4HJ6A 5HWWA 3K3DA 4E6WA 3DTMA 4G3WA 2A3UA 2PRFA 2A49A 1WE4A 4B9OA 4WEKA 3T1XA 3LUQA 3VFFA 1KDSA 3DTKA 1YLYA 4EBLA 3K3CA 5CERA 3UN7A 4KZAA 3WS2A 4ETXA 5F5YA 2YKFA 3MZDA 4JXSA 2ZQCA 1NXYA 4QWOA 3QP2A 1S66L 1Y54A 5G18A 3UY6A 5F68A 4GHIA 4LV0A 3E2LA 3C2WA 3FKVA 4OPQA 2Z2LB 5AQ9A 3GMWA 3CWFA 4IVKA 4ESPA 3GQZA 4K0WA 1ES5A 3ZFZA 1BULA 4MN6A 4JBFA 4DDSA 4LPZA 1ERMA 3IBJA 3BFGA 2KDKA 2ZC5B 1XA1A 3JYIA 3KO6A 3IWOA 1K6SA 3S7PA 3IF6C 1T18A 4E3IA 5E2GA 4X1LA 5FL3A 3F1NA 3AGEA 5I94A 4ZJ3A 4EQ1A 1N9LA 4XXRA 5JYPA 5FQIA 3UB5P 1EROA 3N8SA 4JF5A 5DVAA 3FV7A 1SDNA 4DKIA 3VP3A 5FA7A 4PM5A 1N9BA 5CHJA 4UA7A 3WS0A 3PHYA 3G2YA 4E3NA 2XA7S 3ZHHA 5KZHA 2ZQ8A 3MFDA 2RCXA 3ULFA 4YOFA 4XT2B 3PBNA 3I7JA 5FDHA 4WMCA 3W4PA 4EEPA 2XRNA 2VGKA 2XD5A 4EW7A 5IS1A 1SKOA 2B95A 3HLCA 1KE0A 2ZQAA 3GECA 3LIBA 1G6AA 3CITA 4RYEA 2XROA 5HW3A 4BLMA 5HZHA 3CZDA 1K4FA 3JPUA 4D60A 1N4OA 5A8BA 1FCNA 2VGJA 3Q7VB 5G4ZA 2O0YA 1PNEA 4KQOA 2HDRA 2PBYA 4X69A 4OP5A 4R1GA 2JKFA 4HP4A 3D9YA 1CF0A 1S6RA 5EPHA 4EBNA 2ZOHA 4OQGA 4ME4A 1MY8A 2VV6A 1H8YA 4HESA 3FG8A 3LI8A 2QYBA 3HLDA 5CHUA 2OLUA 3F1OB 3VP0A 2WADA 4K91A 5L10A 2KOIA 2J3WA 4EUVA 1YLTA 2Y4AA 2HP5A 3UE1A 3V3SA 4I5SA 5C5KA 3IS2A 3CUEC 1BLPA 4O0PA 1PFLA 2B5RA 2R9WA 1GA9A 3PBRA 3K2NA 5EUAA 1PIOA 4PKYG 3NY4A 5E43A 3EGXC 4UA6A 4MN5A 3CJMA 3N4IA 3T1RA 4GD8A 4GNUA 4S2OA 1TDGA 1PZOA 4FSFA 3GDIA 1H0MA 3GRJA 1PYYA 3NOTC 5DJTA 1FCOA 2WGIA 4O7DA 3T1SA 2ZBBA 4S2LA 2XDMA 3C30A 3LIAA 4GZBA 4MCWA 1KE4A 4Y0UA 1PI5A 3G34A 2X02A 2WZZA 4U0TA 3SS4A 1XJ3A 4JGQA 3NOUC 3QHYA 1XX2A 2XGNA 2Z6DA 4OP8A 1H5XA 2WKIA 3VE3A 2V20A 2WK0A 1WA9A 2ZM2A 2Z6CA 2K31A 1YM1A 4JF6A 4S2NA 5FDSA 3DW0A 3UDFA 5EVLA 5FEGA 2P9VB 2DRWA 2ZQ9A 5CGWA 3S22A 4E3JA 3MF0A 1IELA 1CI9A 1L0GA 5EVIA 3T1QB 1XFQA 4R0QA 1GHIA 2BTFP 3WRTA 1X0OA 4LV1A 3LR3A 2X01A 5KSCA 4GDNA 2INWA 1I5QA 2PT7A 4ID4A 3BY9A 2EX8A 3S7OA 4CLCC 3D3OA 3OPRA 2ZMFA 3LFVA 4NXBA 1IFQA 2OWJA 4WN5A 3UDIA 4OPZA 1JVJA 3KYZA 4FUWA 1N9OA 2FZ0A 1J3WA 1VHMA 3UMEA 5FATA 4M4XA 1FCMA 3T4OA 1YMSA 4LV3A 3G6OA 4BBTA 1BSGA 2JKRM 3A3IA 4E3KA 5HPIA 3IH9A 2P04A 2Y91A 3OOVA 1OTIA 3SH8A 4IVIA 2PD7A 4NXGA 1BLHA 3H82B 3VP2A 4KQQA 1VM1A 5FQJA 2Y2HA 4YNRA 3GTCA 1P0ZA 5HX9A 3HREA 3HUNA 4KZ8A 1IYQA 3IS2B 5KMWA 1V9ZA 4I38A 4GW9A 3CLOA 1PW8A 5FAQA 3KX0X 2PU2A 2EWVA 2KX6A 3R4KA 5GHXA 1JTGA 4UQIM 1HTZA 1S4SA 4H8RA 3V39A 5JYOA 2J3TD 2Y2IA 1O07A 1XPBA 4JF4A 3C7VA 2Y79A 2J9OA 2OSUA 3R7WA 4QPRA 2VKSA 5A92A 2WZXA 4ZJ2A 3HLBA 2IA2A 5TBMA 2W27A 4E6XA 3UDXA 5AQBA 1H8MA 2Y2JA 4HH3A 4K08A 4JGRA 3D72A 4EUZA 1PRQA 4EWFA 5CX7A 4JLFA 1E4DA 3HBRA 3HLGA 1K56A 4BL2A 5DFXA 2HZ5A 1C3BA 5GHYA 4EESA 1LT0A 4KG2A 1NJ4A 1ZTUA 3IBRA 3NI9A 1GA0A 2VEAA 1LL9A 4MEZA 2ZL1A 4EETB 1NWZA 3FYZA 4GS9A 4L0LA 3C5AA 1U60A 4HHDA 3C4PA 4KENB 3WS4A 1LI9A 1F2KA 1S4RA 1S1YA 4EV4A 1YLWA 3CPTA 1KVLA 1E3UA 1KOUA 4S2NC 4KZ7A 1A0KA 3KYQA 4K0XA 2Q9MA 1K54C 2W3FA 3HCYA 1V9YA 4KG5A 4Q8IA 1IYPA 1MZUA 4KQRA 3RJUA 2J9PA 1FR6A 1OTAA 1VQQA 2R9XA 1KGFA 1TDLA 4XUZA 4NETA 2UWXA 1OJGA 5EVIC 3P01A 4M3KA 2XH9A 1KGGA 4DJ2A 5CGSA 5DTTA 1OJ5A 5TFQA 1Y28A 4UA9A 4RA7A 1T19A 3EEAA 4BWIA 4QD4A 5DF7A 4B4ZA 2ZC3B 4I39A 1YPRA 1S67L 1EI5A 4FH4A 4F3LB 5CTMA 4NXEA 3OZHA 4D2OA 5L07A 3VP4A 3WWXA 3OBFA 3E2KA 5I5LA 3NECA 1IOUA 4FOFA 4P87A 1WYBA 3VFHA 5FI6A 1BLCA 5A90A 1XJ4A 3PBSA 2HDQA 4B4XA 1KGEA 4DE3A 5HL1A 2HP6A 1IKGA 1GHMA 5DFYA 1YLPA 3QNCA 4PM9A 1MWUA 2A24B 3IXDA 5FAOA 5TGFA 4GB7A 4QU3A 3C7UA 2V1AA 4QJGA 3OLOA 5A93A 4MN7A 3KSGA 1ACFA 1GSXA 2ZC7A 3UB6A 2M7VA 3IF6B 4EEUA 5DJUA 4R38A 4DF6A 4HP9A 3A3DA 3T50A 5D3OA 3UO9A 1YT4A 2J80A 3SS3A 3U2AA 3ZG5A 4LCMA 3ICYA 4F94A 1ESIA 2V1BA 5F69A 3HL9A 4WZ4A 2WAFA 1NYMA 1BYWA 3TSGA 1ERQA 2WGWA 3HLWA 1H3QA 5M18A 1DJAA 2XR0A 1XJ2A 1K57C 1G28A 2R78A 4WF0A 2V8CA 5DKLA 4FD8A 3LO7A 4WZ5C 1CK3A 2H5SA 3KSIA 4QY5A 4NXFA 2ZL1B 4BD1A 5CTNA 3DBAA 4DE1A 2Y2GA 5U47A 2O9AA 3C8CA 3SZTA 1SZVA 1CQAA 4MLLA 3N7WA 4DDYA 5AJGA 2BLSA 3UPPA 4CLCA 2ACGA 3UE0A 3ZG0A 1UWPX 2W1RA 4UAAA 4BBVA 1TS0A 1W7FA 2GJ3A 2Y8HA 2JKGA 4N9KA 3IT9A 1RGYA 3TG9A 3G2ZA 1YKDA 4BJPA 4E3MA 1JWVA 3MXQA 4RX3A 3Q81A 3W2ZA 3FPVA 4R70A 3Q82A 2WYXA 5TJJA 2XFSA 2PU4A 2D01A 4EERA 4DMZA 1LHYA 2HPBA 4NK3A 1L3LA 3U4LP 3BWLA 4OQIA 4PPRA 5GLDA 2JCHA 3CMZA 5DKKA 5HAQA 3OPLA 1T1BA 3NDGA 2EX9A 3BY8A 1UWNX 2G2WA 4ZRRA 3ZNTA 2HP9A 4Q0JA 1BLSA 4XUXA 1K38A 2EA9A 2XD1A 4RX2A 2L4RA 4ZDXA 2I9VA 5A91A 2GX5A 3FZCA 2VZWA 3N8RA 1NLZA 5HDDA 2J3TC 3N8LA 3BFCA 2Q9NA 5J7EA 1Y4OA 4YWZA 5EOOA 1DJBA 4DE2A 3VP1A 3LI9A 1FILA 4NEED 5EFWA 5EM1A 4IJGA 1L0EA 5CXWA 3DTEA 1VETA 2EFXA 5FQQA 3IF5A 4GHIB 1ALQA 5GLBA 2GZAA 4UQIS 3CHWP 5J3WA 1RGZA 4OOYA 2WKPA 5G4YA 4AFIA 2P74A 4OPYA 1LSXA 4Z9QA 4EQIA 1XFNA 3LIDA 2XK1A 4JGPA 4PAUA 5CGXA 4E04A 2ZOIA 1SKFA 2H10A 2FFFB 2UV0E 3NCKA 2VK3A 3MMHA 4R3BA 2ZC4B 3GR2A 1TF1A 1OT6A 4P6ZM 1IYSA 3IX4A 2DCFA 3F1NB 4FCFA 4Y2FA 4Y5FA 4GJ4A 3IQAA 1ESUA 4KZ4A 4Y7PA 3BECA 4II7A 2BG1A 3G30A 1RP5A 3PAEA 5FSRA 2HDSA 1K54A 4BMWA 3MR0A 3NJAA 1MKIA 1TS8A 4HIAA 4BENA 5FAPA 4LRXC 4HBTA 3VV4A 1ES2A 5J8XA 1K25A 4ZTKA 3MS6A 4E3OA 1SKOB 3G35A 3TRCA 4HY8A 4RQ9A 3IHAA 3V3RA 1P9RA 3DWZA 4WUJA 1TS7A 4X56A 4PM7A 2H28A 2WKQA 3ZYTA 4HBUA 2Y2KA 4BL3A 2B18A 3UE6A 3BW6A 4PMAA 1TEMA 2VV8A 2JE5A 4X53A 1GSVA 1ODVA 4L9EA 2PR5A 2JBFA 4IUKA 2A2LA 4OVDA 1MC0A 3TW8A 4HJ3A 5FEFA 1LSWA 5AVFA 3T4QA 1HLUP 4FTXA 5HD3A 3LIEA 3UNWA 2ZM0A 1ONHA 3MKFA 2O9CA 3MSHA 3O86A 3SW1A 3CG5A 1M40A 3F1PA 1PZPA 3D4FA 1Z09A 3BYDA 3Q1FA 2EX2A 4G3KA 3LR5A 2PDRA 2HJEA 4KZ9A 3GSGA 2VJWA 1OT9A 1PWCA 2Y59A 3LCEA 1P9WA 4OLDA 2M7UA 4ARZA 2V8FA 1FSWA 3IWQA 1SHVA 2O9BA 1PI4A 5FQ9A 4LCLA 1YLZA 4C3QA 3WS5A 3MQ0A 5EVEA 5FQKA 3QP1A 1K57A 4PM6A 4H6JA 1ES4A 1YSPA 4KZBA 4WYYA 3BQAA 3MZEA 1D06A 4WZ5A 3ZVWA 2LB9A 1LSVA 3CAXA 4X6TA 4R23A 4JXGA 4OOLA 2E8JA 5LBRA 3T4TA 3UPOA 3T12B 4LRYC 4UHUA 5EV0A 1DP8A 2W1TA 2CMNA 2Y2NA 3BM6A 5FI2A 2QWSA 3FC7A 3P09A 3L9KA 2EX6A 4WELA 5HDCA 5HL6A 3ISGA 3OPPA 3PR6A 4BD0A 1ES3A 4Q0HA 1BT5A 3IXGA 2QKPA 1K4EA 3QP6A 3MFXA 5FI7A 3ZGAB 4EBPA 2L0WA 3M2KA 3MXRA 5EVIB 2W3EA 3VOYA 3ZG8B 4P0MA 1W8YA 3DTIA 1OPXA 3NOPC 3HVFA 1VB6A 1FR1A 2EWWA 3TOIA 2PHYA 2V1ZA 5GL9A 4HQAA 3PBQA 2JC7A 3RH8B 1OMEA 3SOIA 4GD6A 1L0FA 3ZVTA 1FSYA 1QMEA 1YLJA 3HUMA 4NG2A 1XKZA 2H0YA
chains in the Genus database with same CATH topology
3DBAA 3JVVA 3UE3A 2O9AA 3LR4A 1TD5A 3C8CA 3PBRA 3K2NA 1MKMA 3LICA 3HJKA 3FPWA 2QJ5A 3A0VA 4PKYG 4IHQA 1DP9A 3EGDC 1ZHHB 3EGXC 5AJGA 4MN5A 4CLCA 4FSFA 5HPFA 3GDIA 5KIZA 4WLAA 5MC7A 1UWPX 3NOTC 4GCZA 2W1RA 5DJTA 2VGLS 4BBVA 1TS0A 2ZBBA 2GJ3A 2Y8HA 3C30A 3LIAA 4F3LA 4MMNA 1YAXA 1T1CA 3PYPA 5DF9A 4MCWA 3P7NA 1YKDA 2P08A 4XT2A 4BJPA 1OTDA 4O01A 1XJ3A 4JGQA 3MXQA 3NOUC 4NKPA 3W2ZA 2BASA 3FPVA 4R70A 4Q0IA 3MJQA 1UGUA 5TJJA 4Z1WA 2Z6DA 2D01A 4DN0A 4BBUA 4EERA 3BJNA 3VE3A 4HH2A 3T4JA 4DMZA 1WA9A 2OAQ1 2Z6CA 2K31A 3B33A 3BWLA 4HNBA 1GSWA 2W3DA 2G7UA 3TJZC 2A24A 5DKKA 3A0RA 2LB5A 2K7SA 1D7EA 1F5MA 1T1BA 2QHKA 5F6AA 3BY8A 1OTBA 1UWNX 2HV1A 3KSFA 4ZRRA 3MF0A 3R7WB 4Q0JA 2WKRA 1XFQA 1W63M 3PBTA 2VV7A 3VE4A 5TBMB 1X0OA 3EWKA 4I3JA 2EA9A 3LR3A 5K5BA 2L4RA 3OCLA 2I9VA 2GX5A 3T4LA 1NRJA 2QJ7A 2GNXA 2VZWA 3ZQ5A 2W3HA 2PT7A 2INWA 3F1OA 4L9GA 3BY9A 3EQVA 3S7OA 4CLCC 1NLZA 5HDDA 3D3OA 2J3TC 2ZMFA 3LFVA 4DJ3A 3JVUA 2O99A 3A0SA 3KSHA 4NXBA 1NLYA 3LR0A 3H9WA 3PBOA 4CQHA 1IFQA 2OWJA 4WN5A 4WL9A 5J7EA 4YWZA 3HJIA 3NHQA 3KYZA 5IT5A 1N9OA 2FZ0A 3MQQA 2VA0A 2W0NA 3BQ8A 1VHMA 3LI9A 3UMEA 4NEED 5EFWA 2M1CA 4M4XA 3T4OA 1T1AA 2PYPA 3G6OA 1G6OA 4BBTA 2JKRM 4IJGA 4I3AA 1LL8A 4GS9B 5HPIA 2L1MA 2P04A 2P7JA 4HOIA 4G3VA 3OOVA 1OTIA 4GHIB 2PD7A 2GZAA 4KUOA 4NXGA 4P6ZS 4Y3IA 5HDSA 4UQIS 2VX8A 2JKTI 1P97A 5J3WA 3B47A 3H82B 2PR6A 2WKPA 3F1PB 5G4YA 4AFIA 1OTEA 4KQDA 4PKYA 1LSXA 3OC2A 4YNRA 1XFNA 1P0ZA 4R3AA 3LIDA 3B42A 3IS2B 4JGPA 1V9ZA 4I38A 4PAUA 4GW9A 4E04A 3CLOA 1F9IA 2ZOIA 3E98A 3LYXA 3KX0X 2HJ9C 2V0UA 3MQOA 3MMHA 2EWVA 2KX6A 3R4KA 3E0YA 3H7WA 1TF1A 1OT6A 4P6ZM 3RFBA 3EQUA 4UQIM 4GLQA 3F1NB 4LRZE 1STZA 1S4SA 4ARZB 4Y2FA 4Y5FA 4GJ4A 2JHEA 2NUTC 4UEYA 4II7A 5IU1A 4CLCD 3E4OA 2VGLM 1XJ6A 2J3TD 3V67A 3VOLA 2PYRA 3E4QA 2HF6A 1TS6A 3PXPA 4H6JB 3CUEA 3EOIA 4BMWA 3T4SA 2B02A 3MR0A 4R6LA 3NJAA 2KLIA 2Y79A 2OOLA 3R7WA 4CLCE 4QPRA 3S7NA 3RTYA 2FH5A 1TS8A 4HIAA 3UB7A 2VKSA 4L9FA 4LRXC 3OCNA 4B93A 3VV4A 2IA2A 2XSSA 5TBMA 2W1TB 2W27A 2JKTM 1JNUA 2V0WA 4HJ6A 2ZMVA 3C38A 5HWWA 3K3DA 3TRCA 4HY8A 5J4EA 2NUPC 4G3WA 1H8MA 4HH3A 4RQ9A 4HJ4A 4K08A 4JGRA 2VLGA 1P9RA 4KUKA 3UB8A 3D72A 4B9OA 4WEKA 4WUJA 5CX7A 1TS7A 3LUQA 2H28A 2WKQA 3ZYTA 2B18A 5DFXA 3UE6A 4EESA 3BW6A 1LT0A 2VV8A 1GSVA 1ODVA 1YSQA 1ZTUA 3IBRA 4L9EA 3E4PA 2PR5A 4IUKA 3K3CA 2A2LA 2VEAA 2OAP1 1MC0A 4ETXA 3TW8A 4HJ3A 5F5YA 2YKFA 1LSWA 5AVFA 3T4QA 4EETB 1NWZA 1S66L 4I3IA 5L8MA 4GS9A 5HD3A 2W3GA 3EEHA 4L0LA 3LIEA 4WEJA 4O8GA 5F68A 4GHIA 4EU0A 4HHDA 3CI6A 2O9CA 4PHTA 3SW1A 3C2WA 3H82A 3F1PA 3TE8A 3S7QA 3CWFA 1S4RA 1S1YA 4MDZA 2V9AA 1EW0A 1KOUA 2HGVA 3KYQA 3LR5A 4G3KA 4MN6A 2W3FA 3HCYA 2PDRA 1V9YA 3LIFA 1DRMA 2HJEA 4LPZA 1MZUA 1OTAA 3IBJA 2KDKA 2VJWA 4NXFA 5HWVA 1OT9A 1OJGA 3KO6A 3S7PA 1T18A 1F98A 3P01A 5FL3A 1P9WA 2PD8A 2M7UA 3F1NA 4ARZA 3T4KA 5HSQA 4DJ2A 4EQ1A 2O9BA 4CLCB 1N9NA 1N9LA 1Y28A 3MQ0A 5HD5A 4JGOA 1DP6A 1T19A 3EEAA 4BWIA 2K2NA 4I39A 4H6JA 1S67L 4IUHA 5HWTA 1YSPA 4F3LB 3BQAA 1D06A 2LB9A 4NXEA 3O5YA 1LSVA 4ETZA 3CAXA 1S1ZA 3PHYA 2XA7S 4OOLA 3OBFA 3H7WB 4YOFA 3ULFA 5LBRA 4XT2B 3PBNA 3T4TA 1W63Q 4HI4A 4LRYC 5I5LA 4EEPA 1IOUA 1DP8A 2W1TA 2CMNA 2XRNA 4FOFA 4EW7A 5IS1A 2JKRI 2QWSA 3FC7A 2D02A 1XJ4A 3PBSA 3GECA 3LIBA 4WELA 5HDCA 5HL6A 3PR6A 3CITA 2XROA 4Q0HA 5HZHA 5DFYA 5A8BA 2A24B 2QKPA 2MJ6A 3MFXA 2XA7M 5G4ZA 2YKHA 2V1AA 2O0YA 3OLOA 4KQOA 2L0WA 4MN7A 3KSGA 1GSXA 3UB6A 2M7VA 4EEUA 5DJUA 4OOMA 4R38A 4HP4A 2JN7A 2W3EA 4HP9A 5AVEA 3T50A 1OPXA 2J80A 3NOPC 2ZOHA 3U2AA 4ME4A 2VV6A 1VB6A 3ICYA 3UB9A 2EWWA 3FG8A 3LI8A 2QYBA 2V1BA 5F69A 2PHYA 3F1OB 4LLOB 1BYWA 3UMDA 1H3QA 2KOIA 4HQAA 2J3WA 3PBQA 1XJ2A 4EXOA 4EUVA 1G28A 2R78A 4WF0A 5DKLA 5KSHA 3RH8B 2OWHA 4I5SA 5C5KA 2DMWA 3IS2A 3KSIA 3CUEC 4O0PA 1OJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8C A;  3LIC A;  3HJK A;  2QJ5 A;  3A0V A;  4PKY G;  1DP9 A;  4MN5 A;  3GDI A;  5KIZ A;  4WLA A;  1UWP X;  3NOT C;  4GCZ A;  5DJT A;  4BBV A;  1TS0 A;  2ZBB A;  2GJ3 A;  3LIA A;  4F3L A;  1T1C A;  3PYP A;  3P7N A;  4XT2 A;  1OTD A;  1XJ3 A;  4JGQ A;  3MXQ A;  3NOU C;  2BAS A;  4R70 A;  3MJQ A;  1UGU A;  2Z6D A;  2D01 A;  4BBU A;  4EER A;  3VE3 A;  4HH2 A;  1WA9 A;  2Z6C A;  3B33 A;  3BWL A;  4HNB A;  1GSW A;  2A24 A;  5DKK A;  3A0R A;  2K7S A;  1D7E A;  1T1B A;  2QHK A;  5F6A A;  3BY8 A;  1OTB A;  1UWN X;  2HV1 A;  2WKR A;  1XFQ A;  2VV7 A;  3VE4 A;  5TBM B;  1X0O A;  3EWK A;  4I3J A;  2EA9 A;  2L4R A;  2I9V A;  2QJ7 A;  3ZQ5 A;  2INW A;  3F1O A;  4L9G A;  3BY9 A;  5HDD A;  4DJ3 A;  3A0S A;  4NXB A;  3H9W A;  2OWJ A;  4WN5 A;  4WL9 A;  5J7E A;  4YWZ A;  3HJI A;  3NHQ A;  1N9O A;  3MQQ A;  2W0N A;  3LI9 A;  3UME A;  5EFW A;  2M1C A;  4M4X A;  1T1A A;  2PYP A;  3G6O A;  4BBT A;  4I3A A;  1LL8 A;  4GS9 B;  2L1M A;  2P7J A;  4HOI A;  1OTI A;  4GHI B;  2PD7 A;  4KUO A;  4NXG A;  5HDS A;  1P97 A;  5J3W A;  3H82 B;  2PR6 A;  2WKP A;  3F1P B;  5G4Y A;  1OTE A;  4KQD A;  4PKY A;  1LSX A;  1XFN A;  1P0Z A;  4R3A A;  3LID A;  3IS2 B;  4JGP A;  1V9Z A;  4I38 A;  4GW9 A;  4E04 A;  3CLO A;  1F9I A;  2ZOI A;  3LYX A;  3KX0 X;  2V0U A;  3MQO A;  2KX6 A;  3H7W A;  1OT6 A;  3F1N B;  4LRZ E;  1S4S A;  2JHE A;  5IU1 A;  3E4O A;  1XJ6 A;  3VOL A;  2PYR A;  3E4Q A;  1TS6 A;  4H6J B;  2B02 A;  3MR0 A;  4R6L A;  3NJA A;  2OOL A;  3RTY A;  1TS8 A;  4HIA A;  3UB7 A;  4L9F A;  4LRX C;  5TBM A;  2W27 A;  1JNU A;  2V0W A;  4HJ6 A;  5HWW A;  3K3D A;  4HY8 A;  5J4E A;  4HH3 A;  4RQ9 A;  4HJ4 A;  4K08 A;  4JGR A;  2VLG A;  4KUK A;  3UB8 A;  3D72 A;  4B9O A;  4WUJ A;  1TS7 A;  3LUQ A;  2H28 A;  2WKQ A;  3UE6 A;  4EES A;  1LT0 A;  2VV8 A;  1GSV A;  1ODV A;  3IBR A;  4L9E A;  3E4P A;  2PR5 A;  3K3C A;  2VEA A;  4HJ3 A;  5F5Y A;  2YKF A;  1LSW A;  5AVF A;  4EET B;  1NWZ A;  1S66 L;  4I3I A;  4GS9 A;  5HD3 A;  3EEH A;  3LIE A;  5F68 A;  4GHI A;  4HHD A;  3SW1 A;  3C2W A;  3H82 A;  3F1P A;  3CWF A;  1S4R A;  1S1Y A;  2V9A A;  1EW0 A;  1KOU A;  4MN6 A;  2PDR A;  1V9Y A;  3LIF A;  1DRM A;  4LPZ A;  1MZU A;  1OTA A;  2KDK A;  5HWV A;  1OT9 A;  1OJG A;  1T18 A;  1F98 A;  2PD8 A;  3F1N A;  5HSQ A;  4DJ2 A;  4EQ1 A;  1OJ5 A;  1N9N A;  1N9L A;  1Y28 A;  5HD5 A;  4JGO A;  1DP6 A;  1T19 A;  4I39 A;  4H6J A;  1S67 L;  5HWT A;  4F3L B;  1D06 A;  4NXE A;  1LSV A;  3CAX A;  1S1Z A;  3PHY A;  3H7W B;  3ULF A;  4XT2 B;  4HI4 A;  4LRY C;  5I5L A;  4EEP A;  1DP8 A;  2CMN A;  4EW7 A;  5IS1 A;  2QWS A;  3FC7 A;  2D02 A;  1XJ4 A;  3GEC A;  3LIB A;  5HDC A;  5HZH A;  5A8B A;  2A24 B;  2QKP A;  3MFX A;  5G4Z A;  2YKH A;  2V1A A;  3OLO A;  2L0W A;  1GSX A;  3UB6 A;  4EEU A;  5DJU A;  4R38 A;  4HP4 A;  2JN7 A;  4HP9 A;  5AVE A;  3T50 A;  2J80 A;  3NOP C;  2ZOH A;  2VV6 A;  1VB6 A;  3ICY A;  3UB9 A;  3FG8 A;  3LI8 A;  2V1B A;  5F69 A;  2PHY A;  3F1O B;  4LLO B;  1BYW A;  3UMD A;  4HQA A;  1XJ2 A;  4EXO A;  1G28 A;  2R78 A;  4WF0 A;  5DKL A;  3RH8 B;  2OWH A;  4I5S A;  3IS2 A;  4NXF A; 
#chains in the Genus database with same CATH topology
 3W8K A;  5TR7 A;  3JVV A;  2XLN A;  3FWL A;  3LR4 A;  1K6R A;  1MKM A;  3LIC A;  1EWZ A;  3O87 A;  3A0V A;  4IHQ A;  3P98 A;  1WYC A;  3LY4 A;  1RCJ A;  1O7E A;  4Y0O A;  3IX8 A;  5KIZ A;  4WLA A;  2J7V A;  5MC7 A;  2VGL S;  4ZBE A;  1NZU A;  5F82 A;  1YAX A;  3PYP A;  5DF9 A;  4C6Y A;  3P7N A;  1DY6 A;  2Y2M A;  4XT2 A;  3QP4 A;  1OTD A;  3QP8 A;  2I72 A;  4NKP A;  1H8Z A;  4LEN A;  2BAS A;  2C6W B;  4P85 A;  4CJN A;  4Q0I A;  1S0W A;  4KZ5 A;  1LLB A;  4Z1W A;  5EOE A;  4BBU A;  2XQZ A;  2OAQ 1;  4S2I A;  4DXC A;  4HNB A;  3DAV A;  4A5R A;  1GSW A;  4Y15 A;  2WUQ A;  4X68 A;  3TJZ C;  4FH2 A;  1G5U A;  1MXO A;  3G31 A;  3A0R A;  3Q7V A;  2LB5 A;  2K7S A;  1F5M A;  2GDN A;  5F6A A;  2ZD8 A;  3O88 A;  4DXB A;  3BFF A;  1E25 A;  3R7W B;  4N9L A;  1W63 M;  4GOG A;  3C4O A;  2Z2M B;  5TBM B;  2ZMA A;  2XEP A;  4ZAM A;  3W4Q A;  4U3T A;  5K5B A;  3OCL A;  5AQ7 A;  4WMC D;  1NRJ A;  2QJ7 A;  1Q2Q A;  3LEZ A;  5M19 A;  3F1O A;  4L9G A;  3EQV A;  1ZG6 A;  1K55 C;  2Y2Q A;  1SDE A;  4DJ3 A;  2O99 A;  3A0S A;  3IXB A;  4X55 A;  4CQH A;  5GLC A;  3HJI A;  3NHQ A;  5IT5 A;  4LFU A;  2W0N A;  3BQ8 A;  2M1C A;  3L7H A;  4R4R A;  1VEU A;  2PYP A;  4KG6 A;  4OPR A;  4GS9 B;  4JXV A;  5CHM A;  3SH7 A;  2L1M A;  2P7J A;  4HOI A;  4KUO A;  4P6Z S;  3RXX A;  3B47 A;  1BTL A;  5L09 A;  2PR6 A;  4MBH A;  5AQA A;  4PKY A;  1JWP A;  3OC2 A;  2CC1 A;  4R3A A;  5HAR A;  1K0K A;  1W8Q A;  3CPT B;  1SCW A;  3A3F A;  3B42 A;  4KZ3 A;  3AGF A;  3E98 A;  1F9I A;  1CJF A;  2QZ6 A;  4OLG A;  2ZQD A;  1D1J A;  2HJ9 C;  2HDU A;  1JWZ A;  2AVX A;  1MPL A;  3MQO A;  3ZCZ A;  1IKI A;  3H7W A;  3RFB A;  3EQU A;  4GLQ A;  4E3L A;  3FKW A;  2PBD P;  3BRM A;  1CEF A;  2NUT C;  4UEY A;  2VGL M;  4OKP A;  4OON A;  2QPN A;  3V5M A;  4X25 A;  5DF8 A;  3V67 A;  3B3X A;  2PYR A;  4OQ0 A;  3E4Q A;  2HF6 A;  3QP5 A;  3PXP A;  2IWD A;  3EOI A;  2P9V A;  3T4S A;  3VSL A;  4R6L A;  1CEG A;  3IXH A;  1L0D A;  2E8I A;  4L9F A;  3OCN A;  4B93 A;  4HEF A;  1JNU A;  2V0W A;  2ZMV A;  3C38 A;  1PWD A;  5J4E A;  2NUP C;  2X71 A;  4HJ4 A;  2VLG A;  4KUK A;  2Y2O A;  3UB8 A;  3ZG7 B;  1PW1 A;  5E2F A;  2WKH A;  4Y0T A;  4DRT A;  3WS1 A;  1IEM A;  1LI0 A;  1HD8 A;  1I2S A;  1M6K A;  3UPN A;  1Z6F A;  5HAI A;  1YSQ A;  3E4P A;  3MZF A;  4R3J A;  2OAP 1;  3N6I A;  3G4P A;  4JPM A;  5EVI D;  1HZO A;  5HFO A;  3HLF A;  4I3I A;  1NRF A;  3NC8 A;  5L8M A;  3M6B A;  2W3G A;  3EEH A;  3O3V A;  1J9M A;  4WEJ A;  1NZO A;  4O8G A;  1QMF A;  4EU0 A;  3CI6 A;  4PHT A;  2ZQ7 A;  2G2U A;  3H82 A;  3NDE A;  3TE8 A;  3S7Q A;  2WGW B;  4GN2 A;  4N1X A;  3HUO A;  1L2S A;  3S1Y A;  3LY3 A;  4MDZ A;  2V9A A;  5M1A A;  1EW0 A;  4IBR A;  3Q07 A;  4LV2 A;  2HGV A;  4N92 A;  3LIF A;  1DRM A;  4MBK A;  4WBG A;  2IWC A;  1VEU B;  5HWV A;  4CPK A;  3ITB A;  3MKE A;  1F98 A;  3HLE A;  5F1F A;  2PD8 A;  1MWR A;  4BQM A;  2EXB A;  3T4K A;  5HSQ A;  1ZC2 A;  4CLC B;  1ZG4 A;  1N9N A;  4WM9 A;  3PTE A;  1HVB A;  5HD5 A;  4JGO A;  1DP6 A;  3M6H A;  3BLS A;  1IYO A;  2ZC6 B;  2K2N A;  4GKU A;  1FQG A;  4IUH A;  5HWT A;  2Y2P A;  3NUL A;  1G68 A;  3O5Y A;  4MBF A;  4ETZ A;  1S1Z A;  3VOZ A;  1YMX A;  5CRF A;  3H7W B;  2ZM8 A;  5BOH A;  1W63 Q;  4HI4 A;  1PWG A;  3ZDJ A;  1DJC A;  2JKR I;  1FOF A;  4DE0 A;  4N1H A;  2OV5 A;  2D02 A;  4U0X A;  4LGW A;  5EM0 A;  4C75 A;  4Y17 A;  1CI8 A;  3QNB A;  1JTD A;  2MJ6 A;  2XA7 M;  2YKH A;  4S2P A;  4S2K A;  2Q0O A;  3DWK A;  4OOM A;  2JN7 A;  5CED A;  5AVE A;  4KZ6 A;  3BLM A;  1NYY A;  4OH0 A;  2C5W B;  3LGO A;  3UB9 A;  5L2F A;  4PM8 A;  4LLO B;  2DNS A;  5EEC A;  3UMD A;  2Y2L A;  4EXO A;  5KSH A;  1K56 D;  2OWH A;  1XGI A;  2DMW A;  5CEC A;  1AXB A;  1XA7 A;  3UE3 A;  1AWI A;  1TD5 A;  1W5D A;  3HJK A;  3FPW A;  2QJ5 A;  5CEB A;  1DP9 A;  2OLV A;  3EGD C;  1ZHH B;  1VET B;  3AGD A;  3G32 A;  3GV9 A;  5E2E A;  1MWT A;  5FAS A;  1KVM A;  5FQM A;  1K55 A;  5HPF A;  5E2H A;  4GCZ A;  4X1M A;  4R4S A;  4F3L A;  4MMN A;  1T1C A;  3VSK A;  4ZJ1 A;  1E3U D;  1BUE A;  3LEQ A;  4OQH A;  2P08 A;  4O01 A;  2EFU A;  4GDB A;  2XF3 A;  3MJQ A;  1UGU A;  3NBL A;  5GLA A;  2ZLY A;  4DN0 A;  3BJN A;  1XXM A;  4HH2 A;  3T4J A;  3GVB A;  3B33 A;  3PAG A;  2W3D A;  2G7U A;  3SH9 A;  2A24 A;  1NY0 A;  1XGJ A;  3BFE A;  3ITA A;  3BFD A;  1D7E A;  1I2W A;  2QHK A;  3Q7Z A;  2QMI A;  5EE8 A;  3IH8 A;  1OTB A;  2HV1 A;  3KSF A;  3NIA A;  3OPH A;  3IF6 A;  2ZJ9 A;  4IBX A;  3WRZ A;  2WKR A;  1LL5 A;  3M2J A;  3PBT A;  2VV7 A;  3VE4 A;  3EWK A;  4I3J A;  3S4X A;  2H0T A;  4B88 A;  3T4L A;  1ONG A;  3IHB A;  2GNX A;  3ZQ5 A;  2W3H A;  1GCE A;  5F1G A;  3JVU A;  3A3E A;  1ZKJ A;  3KSH A;  1NLY A;  2XFT A;  3LR0 A;  3H9W A;  3PBO A;  4WL9 A;  4MNR A;  3MQQ A;  2VA0 A;  5DTS A;  5DTK A;  5HAP A;  5IHV A;  1T1A A;  1Q2P A;  1G6O A;  3A3J A;  4I3A A;  1LL8 A;  4QHC A;  3IX3 A;  4G3V A;  2EXA A;  3IWI A;  3SS5 A;  1KDW A;  4RVA A;  4Y3I A;  5HDS A;  2VX8 A;  2JKT I;  1P97 A;  2V2F F;  5GHZ A;  3F1P B;  1MWS A;  4YFM A;  1OTE A;  4KQD A;  3ZNY A;  1TVF A;  1BZA A;  2WKE A;  1YQS A;  4S2J A;  2Y55 A;  3LYX A;  4YIN A;  4S2M A;  2WAE A;  2V0U A;  3E0Y A;  1W79 A;  4JXW A;  4LRZ E;  1STZ A;  4ARZ B;  3V50 A;  1MBL A;  2JHE A;  3RXW A;  4JKT A;  4Y13 A;  3BEB A;  1GHP A;  2WGV A;  4P6B A;  2FFY A;  5IU1 A;  4CLC D;  3E4O A;  2IWB A;  2RL3 A;  1XJ6 A;  2PAV P;  3KYE A;  3ZG9 B;  3VOL A;  1TS6 A;  3MBZ A;  4H6J B;  3CUE A;  5F83 A;  2J8Y A;  3W4O A;  2B02 A;  1FIK A;  2KLI A;  4IED A;  4QY6 A;  2OOL A;  4CLC E;  3S7N A;  1XP4 A;  3RTY A;  2FH5 A;  4QB8 A;  3UB7 A;  3VMA A;  1KE3 A;  3MXS A;  2XSS A;  2W1T B;  2JKT M;  4HJ6 A;  5HWW A;  3K3D A;  4E6W A;  3DTM A;  4G3W A;  2A3U A;  2PRF A;  2A49 A;  1WE4 A;  4B9O A;  4WEK A;  3T1X A;  3LUQ A;  3VFF A;  1KDS A;  3DTK A;  1YLY A;  4EBL A;  3K3C A;  5CER A;  3UN7 A;  4KZA A;  3WS2 A;  4ETX A;  5F5Y A;  2YKF A;  3MZD A;  4JXS A;  2ZQC A;  1NXY A;  4QWO A;  3QP2 A;  1S66 L;  1Y54 A;  5G18 A;  3UY6 A;  5F68 A;  4GHI A;  4LV0 A;  3E2L A;  3C2W A;  3FKV A;  4OPQ A;  2Z2L B;  5AQ9 A;  3GMW A;  3CWF A;  4IVK A;  4ESP A;  3GQZ A;  4K0W A;  1ES5 A;  3ZFZ A;  1BUL A;  4MN6 A;  4JBF A;  4DDS A;  4LPZ A;  1ERM A;  3IBJ A;  3BFG A;  2KDK A;  2ZC5 B;  1XA1 A;  3JYI A;  3KO6 A;  3IWO A;  1K6S A;  3S7P A;  3IF6 C;  1T18 A;  4E3I A;  5E2G A;  4X1L A;  5FL3 A;  3F1N A;  3AGE A;  5I94 A;  4ZJ3 A;  4EQ1 A;  1N9L A;  4XXR A;  5JYP A;  5FQI A;  3UB5 P;  1ERO A;  3N8S A;  4JF5 A;  5DVA A;  3FV7 A;  1SDN A;  4DKI A;  3VP3 A;  5FA7 A;  4PM5 A;  1N9B A;  5CHJ A;  4UA7 A;  3WS0 A;  3PHY A;  3G2Y A;  4E3N A;  2XA7 S;  3ZHH A;  5KZH A;  2ZQ8 A;  3MFD A;  2RCX A;  3ULF A;  4YOF A;  4XT2 B;  3PBN A;  3I7J A;  5FDH A;  4WMC A;  3W4P A;  4EEP A;  2XRN A;  2VGK A;  2XD5 A;  4EW7 A;  5IS1 A;  1SKO A;  2B95 A;  3HLC A;  1KE0 A;  2ZQA A;  3GEC A;  3LIB A;  1G6A A;  3CIT A;  4RYE A;  2XRO A;  5HW3 A;  4BLM A;  5HZH A;  3CZD A;  1K4F A;  3JPU A;  4D60 A;  1N4O A;  5A8B A;  1FCN A;  2VGJ A;  3Q7V B;  5G4Z A;  2O0Y A;  1PNE A;  4KQO A;  2HDR A;  2PBY A;  4X69 A;  4OP5 A;  4R1G A;  2JKF A;  4HP4 A;  3D9Y A;  1CF0 A;  1S6R A;  5EPH A;  4EBN A;  2ZOH A;  4OQG A;  4ME4 A;  1MY8 A;  2VV6 A;  1H8Y A;  4HES A;  3FG8 A;  3LI8 A;  2QYB A;  3HLD A;  5CHU A;  2OLU A;  3F1O B;  3VP0 A;  2WAD A;  4K91 A;  5L10 A;  2KOI A;  2J3W A;  4EUV A;  1YLT A;  2Y4A A;  2HP5 A;  3UE1 A;  3V3S A;  4I5S A;  5C5K A;  3IS2 A;  3CUE C;  1BLP A;  4O0P A;  1PFL A;  2B5R A;  2R9W A;  1GA9 A;  3PBR A;  3K2N A;  5EUA A;  1PIO A;  4PKY G;  3NY4 A;  5E43 A;  3EGX C;  4UA6 A;  4MN5 A;  3CJM A;  3N4I A;  3T1R A;  4GD8 A;  4GNU A;  4S2O A;  1TDG A;  1PZO A;  4FSF A;  3GDI A;  1H0M A;  3GRJ A;  1PYY A;  3NOT C;  5DJT A;  1FCO A;  2WGI A;  4O7D A;  3T1S A;  2ZBB A;  4S2L A;  2XDM A;  3C30 A;  3LIA A;  4GZB A;  4MCW A;  1KE4 A;  4Y0U A;  1PI5 A;  3G34 A;  2X02 A;  2WZZ A;  4U0T A;  3SS4 A;  1XJ3 A;  4JGQ A;  3NOU C;  3QHY A;  1XX2 A;  2XGN A;  2Z6D A;  4OP8 A;  1H5X A;  2WKI A;  3VE3 A;  2V20 A;  2WK0 A;  1WA9 A;  2ZM2 A;  2Z6C A;  2K31 A;  1YM1 A;  4JF6 A;  4S2N A;  5FDS A;  3DW0 A;  3UDF A;  5EVL A;  5FEG A;  2P9V B;  2DRW A;  2ZQ9 A;  5CGW A;  3S22 A;  4E3J A;  3MF0 A;  1IEL A;  1CI9 A;  1L0G A;  5EVI A;  3T1Q B;  1XFQ A;  4R0Q A;  1GHI A;  2BTF P;  3WRT A;  1X0O A;  4LV1 A;  3LR3 A;  2X01 A;  5KSC A;  4GDN A;  2INW A;  1I5Q A;  2PT7 A;  4ID4 A;  3BY9 A;  2EX8 A;  3S7O A;  4CLC C;  3D3O A;  3OPR A;  2ZMF A;  3LFV A;  4NXB A;  1IFQ A;  2OWJ A;  4WN5 A;  3UDI A;  4OPZ A;  1JVJ A;  3KYZ A;  4FUW A;  1N9O A;  2FZ0 A;  1J3W A;  1VHM A;  3UME A;  5FAT A;  4M4X A;  1FCM A;  3T4O A;  1YMS A;  4LV3 A;  3G6O A;  4BBT A;  1BSG A;  2JKR M;  3A3I A;  4E3K A;  5HPI A;  3IH9 A;  2P04 A;  2Y91 A;  3OOV A;  1OTI A;  3SH8 A;  4IVI A;  2PD7 A;  4NXG A;  1BLH A;  3H82 B;  3VP2 A;  4KQQ A;  1VM1 A;  5FQJ A;  2Y2H A;  4YNR A;  3GTC A;  1P0Z A;  5HX9 A;  3HRE A;  3HUN A;  4KZ8 A;  1IYQ A;  3IS2 B;  5KMW A;  1V9Z A;  4I38 A;  4GW9 A;  3CLO A;  1PW8 A;  5FAQ A;  3KX0 X;  2PU2 A;  2EWV A;  2KX6 A;  3R4K A;  5GHX A;  1JTG A;  4UQI M;  1HTZ A;  1S4S A;  4H8R A;  3V39 A;  5JYO A;  2J3T D;  2Y2I A;  1O07 A;  1XPB A;  4JF4 A;  3C7V A;  2Y79 A;  2J9O A;  2OSU A;  3R7W A;  4QPR A;  2VKS A;  5A92 A;  2WZX A;  4ZJ2 A;  3HLB A;  2IA2 A;  5TBM A;  2W27 A;  4E6X A;  3UDX A;  5AQB A;  1H8M A;  2Y2J A;  4HH3 A;  4K08 A;  4JGR A;  3D72 A;  4EUZ A;  1PRQ A;  4EWF A;  5CX7 A;  4JLF A;  1E4D A;  3HBR A;  3HLG A;  1K56 A;  4BL2 A;  5DFX A;  2HZ5 A;  1C3B A;  5GHY A;  4EES A;  1LT0 A;  4KG2 A;  1NJ4 A;  1ZTU A;  3IBR A;  3NI9 A;  1GA0 A;  2VEA A;  1LL9 A;  4MEZ A;  2ZL1 A;  4EET B;  1NWZ A;  3FYZ A;  4GS9 A;  4L0L A;  3C5A A;  1U60 A;  4HHD A;  3C4P A;  4KEN B;  3WS4 A;  1LI9 A;  1F2K A;  1S4R A;  1S1Y A;  4EV4 A;  1YLW A;  3CPT A;  1KVL A;  1E3U A;  1KOU A;  4S2N C;  4KZ7 A;  1A0K A;  3KYQ A;  4K0X A;  2Q9M A;  1K54 C;  2W3F A;  3HCY A;  1V9Y A;  4KG5 A;  4Q8I A;  1IYP A;  1MZU A;  4KQR A;  3RJU A;  2J9P A;  1FR6 A;  1OTA A;  1VQQ A;  2R9X A;  1KGF A;  1TDL A;  4XUZ A;  4NET A;  2UWX A;  1OJG A;  5EVI C;  3P01 A;  4M3K A;  2XH9 A;  1KGG A;  4DJ2 A;  5CGS A;  5DTT A;  1OJ5 A;  5TFQ A;  1Y28 A;  4UA9 A;  4RA7 A;  1T19 A;  3EEA A;  4BWI A;  4QD4 A;  5DF7 A;  4B4Z A;  2ZC3 B;  4I39 A;  1YPR A;  1S67 L;  1EI5 A;  4FH4 A;  4F3L B;  5CTM A;  4NXE A;  3OZH A;  4D2O A;  5L07 A;  3VP4 A;  3WWX A;  3OBF A;  3E2K A;  5I5L A;  3NEC A;  1IOU A;  4FOF A;  4P87 A;  1WYB A;  3VFH A;  5FI6 A;  1BLC A;  5A90 A;  1XJ4 A;  3PBS A;  2HDQ A;  4B4X A;  1KGE A;  4DE3 A;  5HL1 A;  2HP6 A;  1IKG A;  1GHM A;  5DFY A;  1YLP A;  3QNC A;  4PM9 A;  1MWU A;  2A24 B;  3IXD A;  5FAO A;  5TGF A;  4GB7 A;  4QU3 A;  3C7U A;  2V1A A;  4QJG A;  3OLO A;  5A93 A;  4MN7 A;  3KSG A;  1ACF A;  1GSX A;  2ZC7 A;  3UB6 A;  2M7V A;  3IF6 B;  4EEU A;  5DJU A;  4R38 A;  4DF6 A;  4HP9 A;  3A3D A;  3T50 A;  5D3O A;  3UO9 A;  1YT4 A;  2J80 A;  3SS3 A;  3U2A A;  3ZG5 A;  4LCM A;  3ICY A;  4F94 A;  1ESI A;  2V1B A;  5F69 A;  3HL9 A;  4WZ4 A;  2WAF A;  1NYM A;  1BYW A;  3TSG A;  1ERQ A;  2WGW A;  3HLW A;  1H3Q A;  5M18 A;  1DJA A;  2XR0 A;  1XJ2 A;  1K57 C;  1G28 A;  2R78 A;  4WF0 A;  2V8C A;  5DKL A;  4FD8 A;  3LO7 A;  4WZ5 C;  1CK3 A;  2H5S A;  3KSI A;  4QY5 A;  4NXF A;  2ZL1 B;  4BD1 A;  5CTN A;  3DBA A;  4DE1 A;  2Y2G A;  5U47 A;  2O9A A;  3C8C A;  3SZT A;  1SZV A;  1CQA A;  4MLL A;  3N7W A;  4DDY A;  5AJG A;  2BLS A;  3UPP A;  4CLC A;  2ACG A;  3UE0 A;  3ZG0 A;  1UWP X;  2W1R A;  4UAA A;  4BBV A;  1TS0 A;  1W7F A;  2GJ3 A;  2Y8H A;  2JKG A;  4N9K A;  3IT9 A;  1RGY A;  3TG9 A;  3G2Z A;  1YKD A;  4BJP A;  4E3M A;  1JWV A;  3MXQ A;  4RX3 A;  3Q81 A;  3W2Z A;  3FPV A;  4R70 A;  3Q82 A;  2WYX A;  5TJJ A;  2XFS A;  2PU4 A;  2D01 A;  4EER A;  4DMZ A;  1LHY A;  2HPB A;  4NK3 A;  1L3L A;  3U4L P;  3BWL A;  4OQI A;  4PPR A;  5GLD A;  2JCH A;  3CMZ A;  5DKK A;  5HAQ A;  3OPL A;  1T1B A;  3NDG A;  2EX9 A;  3BY8 A;  1UWN X;  2G2W A;  4ZRR A;  3ZNT A;  2HP9 A;  4Q0J A;  1BLS A;  4XUX A;  1K38 A;  2EA9 A;  2XD1 A;  4RX2 A;  2L4R A;  4ZDX A;  2I9V A;  5A91 A;  2GX5 A;  3FZC A;  2VZW A;  3N8R A;  1NLZ A;  5HDD A;  2J3T C;  3N8L A;  3BFC A;  2Q9N A;  5J7E A;  1Y4O A;  4YWZ A;  5EOO A;  1DJB A;  4DE2 A;  3VP1 A;  3LI9 A;  1FIL A;  4NEE D;  5EFW A;  5EM1 A;  4IJG A;  1L0E A;  5CXW A;  3DTE A;  1VET A;  2EFX A;  5FQQ A;  3IF5 A;  4GHI B;  1ALQ A;  5GLB A;  2GZA A;  4UQI S;  3CHW P;  5J3W A;  1RGZ A;  4OOY A;  2WKP A;  5G4Y A;  4AFI A;  2P74 A;  4OPY A;  1LSX A;  4Z9Q A;  4EQI A;  1XFN A;  3LID A;  2XK1 A;  4JGP A;  4PAU A;  5CGX A;  4E04 A;  2ZOI A;  1SKF A;  2H10 A;  2FFF B;  2UV0 E;  3NCK A;  2VK3 A;  3MMH A;  4R3B A;  2ZC4 B;  3GR2 A;  1TF1 A;  1OT6 A;  4P6Z M;  1IYS A;  3IX4 A;  2DCF A;  3F1N B;  4FCF A;  4Y2F A;  4Y5F A;  4GJ4 A;  3IQA A;  1ESU A;  4KZ4 A;  4Y7P A;  3BEC A;  4II7 A;  2BG1 A;  3G30 A;  1RP5 A;  3PAE A;  5FSR A;  2HDS A;  1K54 A;  4BMW A;  3MR0 A;  3NJA A;  1MKI A;  1TS8 A;  4HIA A;  4BEN A;  5FAP A;  4LRX C;  4HBT A;  3VV4 A;  1ES2 A;  5J8X A;  1K25 A;  4ZTK A;  3MS6 A;  4E3O A;  1SKO B;  3G35 A;  3TRC A;  4HY8 A;  4RQ9 A;  3IHA A;  3V3R A;  1P9R A;  3DWZ A;  4WUJ A;  1TS7 A;  4X56 A;  4PM7 A;  2H28 A;  2WKQ A;  3ZYT A;  4HBU A;  2Y2K A;  4BL3 A;  2B18 A;  3UE6 A;  3BW6 A;  4PMA A;  1TEM A;  2VV8 A;  2JE5 A;  4X53 A;  1GSV A;  1ODV A;  4L9E A;  2PR5 A;  2JBF A;  4IUK A;  2A2L A;  4OVD A;  1MC0 A;  3TW8 A;  4HJ3 A;  5FEF A;  1LSW A;  5AVF A;  3T4Q A;  1HLU P;  4FTX A;  5HD3 A;  3LIE A;  3UNW A;  2ZM0 A;  1ONH A;  3MKF A;  2O9C A;  3MSH A;  3O86 A;  3SW1 A;  3CG5 A;  1M40 A;  3F1P A;  1PZP A;  3D4F A;  1Z09 A;  3BYD A;  3Q1F A;  2EX2 A;  4G3K A;  3LR5 A;  2PDR A;  2HJE A;  4KZ9 A;  3GSG A;  2VJW A;  1OT9 A;  1PWC A;  2Y59 A;  3LCE A;  1P9W A;  4OLD A;  2M7U A;  4ARZ A;  2V8F A;  1FSW A;  3IWQ A;  1SHV A;  2O9B A;  1PI4 A;  5FQ9 A;  4LCL A;  1YLZ A;  4C3Q A;  3WS5 A;  3MQ0 A;  5EVE A;  5FQK A;  3QP1 A;  1K57 A;  4PM6 A;  4H6J A;  1ES4 A;  1YSP A;  4KZB A;  4WYY A;  3BQA A;  3MZE A;  1D06 A;  4WZ5 A;  3ZVW A;  2LB9 A;  1LSV A;  3CAX A;  4X6T A;  4R23 A;  4JXG A;  4OOL A;  2E8J A;  5LBR A;  3T4T A;  3UPO A;  3T12 B;  4LRY C;  4UHU A;  5EV0 A;  1DP8 A;  2W1T A;  2CMN A;  2Y2N A;  3BM6 A;  5FI2 A;  2QWS A;  3FC7 A;  3P09 A;  3L9K A;  2EX6 A;  4WEL A;  5HDC A;  5HL6 A;  3ISG A;  3OPP A;  3PR6 A;  4BD0 A;  1ES3 A;  4Q0H A;  1BT5 A;  3IXG A;  2QKP A;  1K4E A;  3QP6 A;  3MFX A;  5FI7 A;  3ZGA B;  4EBP A;  2L0W A;  3M2K A;  3MXR A;  5EVI B;  2W3E A;  3VOY A;  3ZG8 B;  4P0M A;  1W8Y A;  3DTI A;  1OPX A;  3NOP C;  3HVF A;  1VB6 A;  1FR1 A;  2EWW A;  3TOI A;  2PHY A;  2V1Z A;  5GL9 A;  4HQA A;  3PBQ A;  2JC7 A;  3RH8 B;  1OME A;  3SOI A;  4GD6 A;  1L0F A;  3ZVT A;  1FSY A;  1QME A;  1YLJ A;  3HUM A;  4NG2 A;  1XKZ A;  2H0Y A; 
#chains in the Genus database with same CATH homology
 3DBA A;  3JVV A;  3UE3 A;  2O9A A;  3LR4 A;  1TD5 A;  3C8C A;  3PBR A;  3K2N A;  1MKM A;  3LIC A;  3HJK A;  3FPW A;  2QJ5 A;  3A0V A;  4PKY G;  4IHQ A;  1DP9 A;  3EGD C;  1ZHH B;  3EGX C;  5AJG A;  4MN5 A;  4CLC A;  4FSF A;  5HPF A;  3GDI A;  5KIZ A;  4WLA A;  5MC7 A;  1UWP X;  3NOT C;  4GCZ A;  2W1R A;  5DJT A;  2VGL S;  4BBV A;  1TS0 A;  2ZBB A;  2GJ3 A;  2Y8H A;  3C30 A;  3LIA A;  4F3L A;  4MMN A;  1YAX A;  1T1C A;  3PYP A;  5DF9 A;  4MCW A;  3P7N A;  1YKD A;  2P08 A;  4XT2 A;  4BJP A;  1OTD A;  4O01 A;  1XJ3 A;  4JGQ A;  3MXQ A;  3NOU C;  4NKP A;  3W2Z A;  2BAS A;  3FPV A;  4R70 A;  4Q0I A;  3MJQ A;  1UGU A;  5TJJ A;  4Z1W A;  2Z6D A;  2D01 A;  4DN0 A;  4BBU A;  4EER A;  3BJN A;  3VE3 A;  4HH2 A;  3T4J A;  4DMZ A;  1WA9 A;  2OAQ 1;  2Z6C A;  2K31 A;  3B33 A;  3BWL A;  4HNB A;  1GSW A;  2W3D A;  2G7U A;  3TJZ C;  2A24 A;  5DKK A;  3A0R A;  2LB5 A;  2K7S A;  1D7E A;  1F5M A;  1T1B A;  2QHK A;  5F6A A;  3BY8 A;  1OTB A;  1UWN X;  2HV1 A;  3KSF A;  4ZRR A;  3MF0 A;  3R7W B;  4Q0J A;  2WKR A;  1XFQ A;  1W63 M;  3PBT A;  2VV7 A;  3VE4 A;  5TBM B;  1X0O A;  3EWK A;  4I3J A;  2EA9 A;  3LR3 A;  5K5B A;  2L4R A;  3OCL A;  2I9V A;  2GX5 A;  3T4L A;  1NRJ A;  2QJ7 A;  2GNX A;  2VZW A;  3ZQ5 A;  2W3H A;  2PT7 A;  2INW A;  3F1O A;  4L9G A;  3BY9 A;  3EQV A;  3S7O A;  4CLC C;  1NLZ A;  5HDD A;  3D3O A;  2J3T C;  2ZMF A;  3LFV A;  4DJ3 A;  3JVU A;  2O99 A;  3A0S A;  3KSH A;  4NXB A;  1NLY A;  3LR0 A;  3H9W A;  3PBO A;  4CQH A;  1IFQ A;  2OWJ A;  4WN5 A;  4WL9 A;  5J7E A;  4YWZ A;  3HJI A;  3NHQ A;  3KYZ A;  5IT5 A;  1N9O A;  2FZ0 A;  3MQQ A;  2VA0 A;  2W0N A;  3BQ8 A;  1VHM A;  3LI9 A;  3UME A;  4NEE D;  5EFW A;  2M1C A;  4M4X A;  3T4O A;  1T1A A;  2PYP A;  3G6O A;  1G6O A;  4BBT A;  2JKR M;  4IJG A;  4I3A A;  1LL8 A;  4GS9 B;  5HPI A;  2L1M A;  2P04 A;  2P7J A;  4HOI A;  4G3V A;  3OOV A;  1OTI A;  4GHI B;  2PD7 A;  2GZA A;  4KUO A;  4NXG A;  4P6Z S;  4Y3I A;  5HDS A;  4UQI S;  2VX8 A;  2JKT I;  1P97 A;  5J3W A;  3B47 A;  3H82 B;  2PR6 A;  2WKP A;  3F1P B;  5G4Y A;  4AFI A;  1OTE A;  4KQD A;  4PKY A;  1LSX A;  3OC2 A;  4YNR A;  1XFN A;  1P0Z A;  4R3A A;  3LID A;  3B42 A;  3IS2 B;  4JGP A;  1V9Z A;  4I38 A;  4PAU A;  4GW9 A;  4E04 A;  3CLO A;  1F9I A;  2ZOI A;  3E98 A;  3LYX A;  3KX0 X;  2HJ9 C;  2V0U A;  3MQO A;  3MMH A;  2EWV A;  2KX6 A;  3R4K A;  3E0Y A;  3H7W A;  1TF1 A;  1OT6 A;  4P6Z M;  3RFB A;  3EQU A;  4UQI M;  4GLQ A;  3F1N B;  4LRZ E;  1STZ A;  1S4S A;  4ARZ B;  4Y2F A;  4Y5F A;  4GJ4 A;  2JHE A;  2NUT C;  4UEY A;  4II7 A;  5IU1 A;  4CLC D;  3E4O A;  2VGL M;  1XJ6 A;  2J3T D;  3V67 A;  3VOL A;  2PYR A;  3E4Q A;  2HF6 A;  1TS6 A;  3PXP A;  4H6J B;  3CUE A;  3EOI A;  4BMW A;  3T4S A;  2B02 A;  3MR0 A;  4R6L A;  3NJA A;  2KLI A;  2Y79 A;  2OOL A;  3R7W A;  4CLC E;  4QPR A;  3S7N A;  3RTY A;  2FH5 A;  1TS8 A;  4HIA A;  3UB7 A;  2VKS A;  4L9F A;  4LRX C;  3OCN A;  4B93 A;  3VV4 A;  2IA2 A;  2XSS A;  5TBM A;  2W1T B;  2W27 A;  2JKT M;  1JNU A;  2V0W A;  4HJ6 A;  2ZMV A;  3C38 A;  5HWW A;  3K3D A;  3TRC A;  4HY8 A;  5J4E A;  2NUP C;  4G3W A;  1H8M A;  4HH3 A;  4RQ9 A;  4HJ4 A;  4K08 A;  4JGR A;  2VLG A;  1P9R A;  4KUK A;  3UB8 A;  3D72 A;  4B9O A;  4WEK A;  4WUJ A;  5CX7 A;  1TS7 A;  3LUQ A;  2H28 A;  2WKQ A;  3ZYT A;  2B18 A;  5DFX A;  3UE6 A;  4EES A;  3BW6 A;  1LT0 A;  2VV8 A;  1GSV A;  1ODV A;  1YSQ A;  1ZTU A;  3IBR A;  4L9E A;  3E4P A;  2PR5 A;  4IUK A;  3K3C A;  2A2L A;  2VEA A;  2OAP 1;  1MC0 A;  4ETX A;  3TW8 A;  4HJ3 A;  5F5Y A;  2YKF A;  1LSW A;  5AVF A;  3T4Q A;  4EET B;  1NWZ A;  1S66 L;  4I3I A;  5L8M A;  4GS9 A;  5HD3 A;  2W3G A;  3EEH A;  4L0L A;  3LIE A;  4WEJ A;  4O8G A;  5F68 A;  4GHI A;  4EU0 A;  4HHD A;  3CI6 A;  2O9C A;  4PHT A;  3SW1 A;  3C2W A;  3H82 A;  3F1P A;  3TE8 A;  3S7Q A;  3CWF A;  1S4R A;  1S1Y A;  4MDZ A;  2V9A A;  1EW0 A;  1KOU A;  2HGV A;  3KYQ A;  3LR5 A;  4G3K A;  4MN6 A;  2W3F A;  3HCY A;  2PDR A;  1V9Y A;  3LIF A;  1DRM A;  2HJE A;  4LPZ A;  1MZU A;  1OTA A;  3IBJ A;  2KDK A;  2VJW A;  4NXF A;  5HWV A;  1OT9 A;  1OJG A;  3KO6 A;  3S7P A;  1T18 A;  1F98 A;  3P01 A;  5FL3 A;  1P9W A;  2PD8 A;  2M7U A;  3F1N A;  4ARZ A;  3T4K A;  5HSQ A;  4DJ2 A;  4EQ1 A;  2O9B A;  4CLC B;  1N9N A;  1N9L A;  1Y28 A;  3MQ0 A;  5HD5 A;  4JGO A;  1DP6 A;  1T19 A;  3EEA A;  4BWI A;  2K2N A;  4I39 A;  4H6J A;  1S67 L;  4IUH A;  5HWT A;  1YSP A;  4F3L B;  3BQA A;  1D06 A;  2LB9 A;  4NXE A;  3O5Y A;  1LSV A;  4ETZ A;  3CAX A;  1S1Z A;  3PHY A;  2XA7 S;  4OOL A;  3OBF A;  3H7W B;  4YOF A;  3ULF A;  5LBR A;  4XT2 B;  3PBN A;  3T4T A;  1W63 Q;  4HI4 A;  4LRY C;  5I5L A;  4EEP A;  1IOU A;  1DP8 A;  2W1T A;  2CMN A;  2XRN A;  4FOF A;  4EW7 A;  5IS1 A;  2JKR I;  2QWS A;  3FC7 A;  2D02 A;  1XJ4 A;  3PBS A;  3GEC A;  3LIB A;  4WEL A;  5HDC A;  5HL6 A;  3PR6 A;  3CIT A;  2XRO A;  4Q0H A;  5HZH A;  5DFY A;  5A8B A;  2A24 B;  2QKP A;  2MJ6 A;  3MFX A;  2XA7 M;  5G4Z A;  2YKH A;  2V1A A;  2O0Y A;  3OLO A;  4KQO A;  2L0W A;  4MN7 A;  3KSG A;  1GSX A;  3UB6 A;  2M7V A;  4EEU A;  5DJU A;  4OOM A;  4R38 A;  4HP4 A;  2JN7 A;  2W3E A;  4HP9 A;  5AVE A;  3T50 A;  1OPX A;  2J80 A;  3NOP C;  2ZOH A;  3U2A A;  4ME4 A;  2VV6 A;  1VB6 A;  3ICY A;  3UB9 A;  2EWW A;  3FG8 A;  3LI8 A;  2QYB A;  2V1B A;  5F69 A;  2PHY A;  3F1O B;  4LLO B;  1BYW A;  3UMD A;  1H3Q A;  2KOI A;  4HQA A;  2J3W A;  3PBQ A;  1XJ2 A;  4EXO A;  4EUV A;  1G28 A;  2R78 A;  4WF0 A;  5DKL A;  5KSH A;  3RH8 B;  2OWH A;  4I5S A;  5C5K A;  2DMW A;  3IS2 A;  3KSI A;  3CUE C;  4O0P A;  1OJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...