2VV8A

Co-bound structure of bjfixlh
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
molecule tags Signaling protein
source organism Bradyrhizobium japonicum
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
total genus 25
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv8A00
1NWZA 2L4RA 4GHIB 3NOPC 4I39A 5IU1A 4I3IA 5TBMB 3K3CA 4HHDA 5HZHA 1XFNA 2W27A 4L9GA 3A0VA 1OT9A 4EERA 4R6LA 1OJGA 1DRMA 3VOLA 4XT2A 2WKPA 1TS0A 1OT6A 4BBVA 4E04A 1DP6A 3A0RA 2PD8A 5HDDA 2VEAA 5DKKA 4HNBA 4M4XA 3UB6A 2L0WA 5J3WA 3E4PA 3LIDA 1G28A 1KOUA 3BWLA 4GS9B 1P97A 1LT0A 1OTAA 3VE4A 1V9ZA 4EEPA 5HWWA 2PR5A 3H82A 3LIFA 3MXQA 3PHYA 3VE3A 4HP4A 1S4SA 1X0OA 2VV8A 3CWFA 1LL8A 2A24A 5HSQA 5DKLA 1JNUA 1XFQA 2M1CA 2V9AA 2QJ5A 3IS2B 4PKYG 4EETB 1P0ZA 4R38A 5J7EA 5IS1A 3UB9A 1GSWA 3F1OB 4NXFA 5A8BA 5J4EA 4HI4A 4KQDA 1UWNX 4JGOA 3LI9A 4GW9A 1LSVA 2QHKA 4HY8A 3T50A 4HIAA 5EFWA 1BYWA 5AVFA 1EW0A 4LRYC 3RTYA 1T19A 3RH8B 1S1ZA 4EESA 4BBTA 3MQOA 5F69A 3P7NA 2KDKA 3C2WA 1T1AA 3LUQA 5HD3A 4DJ3A 3LIAA 3LI8A 4JGQA 3NOTC 3G6OA 1MZUA 4HP9A 1OTIA 2A24B 4MN6A 3H7WB 3H7WA 2JN7A 3H82B 4H6JA 1XJ4A 3NHQA 4GS9A 3LYXA 1GSVA 3F1PB 2R78A 3K3DA 4PKYA 5G4ZA 5HWVA 2QKPA 2Z6DA 1TS6A 5F68A 5HDSA 2YKHA 4JGPA 3ZQ5A 2J80A 5KIZA 1D7EA 4LLOB 1UGUA 3LIEA 1DP8A 1GSXA 3MFXA 4KUOA 2KX6A 1LSWA 2OWHA 2VLGA 2B02A 2W0NA 2ZOHA 1Y28A 2CMNA 1T18A 3C8CA 3CLOA 1ODVA 2GJ3A 4H6JB 4KUKA 4LPZA 4GHIA 3IS2A 3KX0X 2I9VA 4NXGA 1S66L 3A0SA 3FC7A 2JHEA 4I3JA 4LRZE 4RQ9A 5G4YA 5F6AA 4LRXC 1S1YA 2L1MA 2ZOIA 1F9IA 4HJ3A 1WA9A 1TS8A 2PDRA 3EEHA 3UMEA 1DP9A 2VV7A 1XJ3A 2D01A 3GECA 1F98A 4WF0A 1D06A 3UE6A 3IBRA 4HJ6A 1T1BA 3PYPA 1XJ2A 4JGRA 1VB6A 4I38A 2K7SA 2H28A 3GDIA 4MN5A 4WN5A 4XT2B 3NOUC 2V0UA 3D72A 1OTEA 2EA9A 4EQ1A 1OTBA 3F1OA 1S4RA 2ZBBA 2BASA 2YKFA 2VV6A 3F1NA 4L9FA 4HQAA 4HOIA 2HV1A 4HH3A 2P7JA 2WKQA 5TBMA 2PR6A 4DJ2A 3SW1A 3HJIA 2D02A 2PYPA 3UMDA 3B33A 3OLOA 5AVEA 2PYRA 3MJQA 4BBUA 3ULFA 4NXEA 5HWTA 4EEUA 1OTDA 3E4OA 3H9WA 3HJKA 2PHYA 3BY9A 1T1CA 3F1NB 3MR0A 4F3LA 3EWKA 5HD5A 4HJ4A 3CAXA 1TS7A 3LIBA 3UB8A 4R70A 3FG8A 3ICYA 3LICA 4EXOA 1XJ6A 2INWA 2V1BA 2QWSA 1N9NA 1N9OA 2V0WA 3BY8A 4HH2A 2V1AA 1V9YA 4R3AA 5F5YA 5HDCA 4NXBA 5I5LA 4YWZA 4EW7A 1S67L 2WKRA 4L9EA 4WUJA 5DJUA 2OWJA 3MQQA 2PD7A 2OOLA 4I3AA 3UB7A 4I5SA 4WLAA 4GCZA 1N9LA 4F3LB 4K08A 3NJAA 3E4QA 4B9OA 2Z6CA 1LSXA 3F1PA 4WL9A 2QJ7A 5DJTA 1UWPX 1OJ5A
chains in the Genus database with same CATH superfamily
4Y3IA 3M6HA 3AGEA 1KGGA 4NG2A 5CHMA 5CTNA 1WYBA 3IBJA 4K91A 4QWOA 2UV0E 3BFGA 4GLQA 4O01A 3SH9A 2H0YA 2Y59A 3DTMA 3KSHA 3UB6A 3MZFA 3BWLA 1GCEA 1P97A 2P74A 5HWWA 3MXQA 2VV8A 2A24A 5GLAA 5EPHA 2Y55A 4E3OA 4HY8A 4EEPA 2G7UA 3VFHA 4P85A 5A92A 3TJZC 2O99A 3GSGA 2A24B 3T4TA 4H6JA 3V50A 3F1PB 4DF6A 1GA9A 1LI9A 4PM5A 1K25A 1YAXA 3T4LA 5JYOA 4U3TA 4YFMA 4QY5A 5F6AA 3IXDA 2G2UA 1XJ3A 4BD1A 2OAP1 1JWPA 2V20A 4MMNA 4GD8A 1ZG4A 4EQ1A 1IFQA 4HQAA 1CI8A 5M18A 2ZL1B 4N9KA 3ULFA 1W79A 5TJJA 3EWKA 3OPRA 4UHUA 4BMWA 4MCWA 1XJ6A 2WKEA 1NWZA 1FSYA 4HHDA 1U60A 3OBFA 4PM7A 1K55A 2WKPA 4O7DA 3IQAA 3D4FA 2EXAA 2WGVA 3PXPA 5FQMA 5KZHA 3IX3A 3LIFA 2ZM0A 5HAPA 1IYOA 2UWXA 5FASA 1BLSA 3A3FA 4NXFA 5GLCA 1FQGA 3DTKA 2ZMAA 3FV7A 3WS1A 1LSVA 3O87A 4Y0OA 3MZDA 2XFTA 5GHXA 3EEAA 4EETB 5A90A 1MZUA 4LCMA 4P87A 4L0LA 2X01A 4GS9A 1G5UA 4ESPA 3I7JA 4Q0JA 3V5MA 1TS6A 2HDUA 3MS6A 4QD4A 2J80A 1NZOA 1ZHHB 1D7EA 3BFCA 3T4QA 3LIEA 4S2NA 3QP6A 2OWHA 2Y2LA 1T18A 1RGZA 5CGWA 5F69A 2JC7A 5G4YA 1VHMA 5DF9A 3G30A 1F9IA 5I94A 4GZBA 5CX7A 3IF6A 5FI6A 5IHVA 4E6WA 3PYPA 4I38A 1QMFA 3ZG8B 4DKIA 2J7VA 4GN2A 2OSUA 3F1NA 4ZDXA 4X68A 3ZNYA 2BTFP 1E4DA 2WUQA 1K38A 5D3OA 3F1NB 4BQMA 3ZG5A 2H10A 4KENB 5GL9A 2AVXA 4ZRRA 3ITBA 1VETB 5HDCA 1EWZA 4QB8A 4KZBA 1J9MA 1N9LA 4HBUA 1PI5A 2IWCA 2QZ6A 3VOLA 1SZVA 4GHIB 4E3LA 5EVID 3T4JA 2VK3A 4YOFA 5U47A 3VP2A 1CQAA 1YSQA 5KSHA 2FFFB 4OPYA 2VEAA 3Q7ZA 4DRTA 4O0PA 3VMAA 3LIDA 3EGXC 3UDFA 1BLCA 1LT0A 1V9ZA 3L7HA 4S2JA 3CHWP 1OMEA 4WELA 3EGDC 4Q0HA 4GB7A 2BG1A 4ARZA 2PBYA 5HD3A 2KDKA 2HGVA 3NOTC 3ZCZA 4GD6A 3UDIA 4MN6A 3H7WB 3P98A 2JN7A 4KQOA 4EBNA 1XPBA 3EQVA 5G4ZA 4DMZA 3IT9A 2XA7S 2J3WA 1LL5A 4ARZB 1HVBA 1TDLA 4WZ5A 3K2NA 4NXEA 2GJ3A 4LPZA 3KX0X 2ZC4B 3QP2A 1K4FA 2Y79A 2XRNA 3IF5A 1S0WA 3IBRA 4O8GA 2K7SA 3D72A 1A0KA 2X02A 3G31A 3A3IA 3HBRA 4ZAMA 4QPRA 4CJNA 1XGIA 1ZC2A 3BY8A 4HH2A 2HDSA 3IHBA 4YWZA 1PIOA 4JXVA 1YKDA 2Z6CA 4Q0IA 4UA7A 1JWVA 5TR7A 3C38A 3A0SA 3S7QA 1LHYA 5IU1A 4N92A 4M3KA 3M6BA 1MWUA 5TFQA 2C5WB 2O9AA 3W4QA 3QHYA 4KZ4A 2L0WA 1Z09A 1KOUA 3LY4A 1TD5A 5EV0A 4S2PA 5E2GA 4R38A 2W3HA 3F1OB 5FAQA 2RCXA 5EECA 3E98A 3T1QB 1MWTA 2JKTI 1ES5A 4IBRA 4DDYA 2HZ5A 3WRTA 3BFEA 3CUEA 1Y54A 4BENA 5KIZA 1K6SA 3LR5A 4OKPA 3B47A 1YLPA 1UGUA 3OPLA 4KUOA 1ERQA 4DJ2A 1P9RA 3WS5A 4S2MA 3FC7A 3PR6A 3KO6A 4GKUA 3ZVWA 1SDEA 1XA1A 1SCWA 4WF0A 3WS0A 5HAQA 1CEFA 4HJ6A 1T1BA 3O5YA 2EA9A 4RA7A 1ES3A 2XEPA 4HOIA 4B4XA 1FIKA 1JTDA 2DMWA 1OTDA 3E4OA 3H9WA 4LV1A 4FH4A 4DE1A 4R70A 3O86A 1NLZA 5KSCA 2HDQA 3KYZA 5CHUA 1ONGA 4WUJA 1I2SA 1XP4A 4F3LB 2ZMFA 5CXWA 4B9OA 2HPBA 2EX8A 3FYZA 1DJBA 1AWIA 3JPUA 3B3XA 4QJGA 2V8CA 1ZKJA 1MKMA 3FKVA 5DKLA 3C4OA 3S7PA 4R4RA 5IS1A 2WADA 1PZPA 2WGWA 3KSIA 1TDGA 3LO7A 3BFDA 5EFWA 1BYWA 1EW0A 1ES2A 3RH8B 1H0MA 1YLZA 2XR0A 4MBFA 5DVAA 3G32A 3VSKA 1NY0A 1I5QA 3PBTA 3K3DA 2HP6A 5HWVA 3NDGA 4JGPA 2EFXA 3WS4A 1DJCA 4OP5A 2P08A 3MXSA 2ZOHA 2O9CA 3C8CA 3RJUA 5L8MA 4S2LA 4OVDA 4R0QA 1RGYA 2J9OA 3R7WB 3C7VA 4G3KA 4S2OA 3EQUA 1XJ2A 4K0XA 1OTBA 2RL3A 2BASA 4DDSA 1N9BA 3HJIA 3MJQA 4LV2A 3PAEA 3MR0A 3QNCA 2W3DA 5K5BA 1N9OA 4OLGA 1BZAA 4FH2A 3UB7A 4WLAA 3T4SA 4ID4A 4PM8A 4Y2FA 3G34A 3TG9A 1MWSA 1Z6FA 3A3DA 4R1GA 1K0KA 1O07A 4R6LA 2K2NA 1ESIA 4PHTA 1DP6A 5DKKA 1FOFA 5EUAA 2DNSA 3SS4A 2V8FA 4EU0A 4PKYG 4ZBEA 5EVLA 2X71A 1L0EA 3MQ0A 2QYBA 4QU3A 2GDNA 3S1YA 4R23A 3MBZA 3OZHA 3ZFZA 1T1AA 3LIAA 3LI8A 4WEJA 4Y5FA 1YT4A 3H82B 5TGFA 3NBLA 4ZJ2A 2ZC6B 4X6TA 2YKHA 4JPMA 3C4PA 3HLCA 3MFXA 3CLOA 1NLYA 1NYMA 3FWLA 4LRXC 4E3MA 4X1MA 5CERA 2D01A 3S7NA 1J3WA 1F98A 1ZTUA 3HLWA 2H5SA 3FPVA 4C75A 2WZXA 5E2HA 3V3RA 4NKPA 2PR6A 3BM6A 5FAPA 1IELA 4YINA 4NEED 2PHYA 4U0TA 1KE0A 5HD5A 1TS7A 3FG8A 4EXOA 1Q2QA 2QWSA 2W3GA 4JBFA 5F5YA 3VOYA 4R3AA 2ZC3B 3BEBA 3GRJA 3L9KA 2J3TD 3ITAA 4OOLA 1BLHA 1NJ4A 5L2FA 4RVAA 4PPRA 4PM9A 5FI7A 3BLMA 1KE3A 1L0DA 4UEYA 5HFOA 3N8RA 1BULA 5CGSA 3VE3A 1GHPA 5AQBA 3CWFA 2FFYA 1P0ZA 3RXWA 5J7EA 1PW1A 5FI2A 3SS3A 3LEQA 4HIAA 1QMEA 1ONHA 1S1ZA 3MQOA 4WMCA 1K56A 4BLMA 3R7WA 1NRFA 2HP5A 3ZG0A 3RFBA 3KYQA 4CLCA 4KZ7A 5F68A 4XXRA 2CMNA 1ODVA 3TE8A 4NXGA 1PWGA 1PZOA 5E2FA 2ZOIA 1W7FA 2PBDP 4JXWA 1DP9A 2Y2QA 3UE0A 4GOGA 1S4RA 4X55A 3VP1A 1GHIA 2JKTM 4EUZA 1XGJA 4GJ4A 2D02A 4P6ZS 1FR6A 4X53A 3UPNA 2PT7A 3CAXA 5CEDA 4OPRA 4S2NC 3O3VA 2EX9A 3S7OA 3ISGA 4CLCB 4JF4A 3NJAA 5F83A 4G3VA 1ALQA 3NOPC 4NK3A 5HZHA 3MZEA 4Q8IA 4OQGA 1I2WA 3M2KA 1OT9A 3OPHA 1OT6A 5GLDA 5FQJA 3MMHA 3GTCA 3IF6B 3H82A 1XA7A 2PAVP 3LR0A 2JKFA 1GSWA 5J4EA 5DF7A 2HDRA 4FCFA 5HAIA 1F2KA 3RTYA 2ZQ8A 4H8RA 5EVIB 3QP5A 1K55C 4BWIA 4OOMA 3UE3A 3T1RA 2WGIA 2XD1A 3NECA 1YQSA 5DF8A 5J8XA 5BOHA 2W0NA 1E3UD 4FSFA 5FEGA 1TF1A 3IS2A 4KQQA 4C6YA 2EX2A 1SKOA 3NULA 2WAFA 3QNBA 5FA7A 1KDWA 2WZZA 3FPWA 1PNEA 4R3JA 4EWFA 1SHVA 3GDIA 5FQ9A 3E2KA 1OTEA 3F1OA 2ZBBA 3Q7VB 1AXBA 4DE3A 1G6OA 2Q9NA 1M6KA 4HJ4A 3LIBA 3UB8A 2XQZA 3ICYA 3LR4A 2WKRA 4WMCD 3G4PA 2PD7A 4I5SA 4K08A 3E4QA 3TOIA 4ETZA 3P01A 4KQRA 3ZNTA 1PRQA 1JWZA 2JKRM 1RP5A 4HBTA 2VJWA 2W1TB 4KZ6A 3VE4A 3UE1A 2PR5A 3HUNA 4HP4A 1C3BA 5HSQA 5DTKA 1FR1A 5A8BA 4IBXA 1UWNX 4KQDA 4OQHA 4RX2A 4II7A 4D2OA 3IWQA 3BECA 2DRWA 1VEUB 5F1GA 2W1RA 1PYYA 5L09A 5HX9A 4MBKA 3UO9A 3A3JA 4UQIS 4KZAA 3V67A 2Y2NA 3ZQ5A 1M40A 4LV0A 1GSXA 1CJFA 3IF6C 1LLBA 4NETA 3ZDJA 4KUKA 1BTLA 1IYSA 4LRZE 2L1MA 1VM1A 3BLSA 1GHMA 4EBPA 1K54A 1PW8A 1BSGA 3WS2A 3HLFA 2H0TA 4HH3A 2Y8HA 3M2JA 4UQIM 3N4IA 4KG6A 1PFLA 3Q7VA 1MKIA 2ZM2A 3LR3A 4EEUA 5FEFA 4JXGA 3LICA 1IYQA 1PWDA 1E3UA 4OQIA 3A3EA 3PBNA 2B95A 3TW8A 3LGOA 2Y91A 2QMIA 2Y2KA 1SKFA 2QJ7A 3VOZA 5GHYA 1KGEA 2EXBA 1OPXA 2XFSA 5TBMB 4E3JA 3K3CA 4IUHA 1W63M 3DWKA 4XT2A 1FCNA 2GX5A 2ZC5B 3UNWA 4WEKA 5J3WA 4R3BA 2WGWB 4MN7A 4X56A 1KGFA 3GMWA 2CC1A 2IWDA 1X0OA 4JF6A 5FL3A 2M1CA 3MKEA 3KSFA 3HUMA 4GW9A 4IUKA 2E8IA 4LRYC 3LUQA 4DJ3A 3G6OA 3T1SA 4IJGA 1L3LA 1H5XA 4ZJ1A 4S2KA 1VEUA 1XJ4A 2XD5A 3LYXA 3NY4A 5HDSA 1H8YA 3IXGA 5AJGA 1NXYA 2Z2LB 4RQ9A 2Y4AA 2JHEA 4I3JA 5KMWA 4S2IA 1S1YA 5C5KA 2NUTC 2PDRA 4D60A 4KG2A 5CGXA 3HREA 4ZJ3A 2A49A 4R4SA 3UPOA 3CUEC 3MF0A 2YKFA 3CPTA 5DFXA 2LB9A 2Y2PA 5AVEA 1LL9A 1LI0A 4U0XA 5HL1A 3HJKA 3BY9A 1T1CA 5CHJA 2ZQDA 4RYEA 4IHQA 4BJPA 2Q0OA 3C5AA 1PI4A 4Y17A 5EVIC 2J9PA 3TRCA 1YLWA 4K0WA 1VETA 3CMZA 3V39A 4RX3A 2Y2MA 2R9WA 3Q07A 2PD8A 5A93A 2Y2GA 3T1XA 1JTGA 2WKHA 1SKOB 1JVJA 2EFUA 3UB5P 2V9AA 4EBLA 3PBOA 4DXCA 4FTXA 1K54C 3UN7A 2B18A 4N9LA 3T4KA 4MEZA 1ES4A 2ZLYA 5FAOA 1FCMA 5LBRA 3ZG7B 5FDHA 2VA0A 3NIAA 4P0MA 2ZQAA 3BQAA 3JYIA 3OOVA 3N8LA 5EVIA 3BW6A 3HLBA 1HZOA 1P9WA 5MC7A 1DP8A 4E3IA 3F1PA 3MXRA 4E04A 2JE5A 2VGKA 4GDBA 4PM6A 5HPFA 1IYPA 1IEMA 2EWWA 3IH8A 1D06A 4E3NA 3DAVA 2VGLS 2PU2A 1W63Q 1XKZA 2H28A 4A5RA 1D1JA 4L9FA 2VV6A 3IWIA 3SW1A 3G2ZA 3OLOA 4PMAA 5L07A 4ETXA 3SH8A 5CTMA 4B4ZA 4PAUA 2XK1A 2O9BA 3Q81A 4L9EA 4EUVA 2OWJA 4I3AA 4WBGA 5EVEA 3D3OA 5DJTA 3HLGA 3NDEA 1NYYA 4I3IA 2EWVA 4CLCD 3WRZA 1HLUP 3CJMA 4L9GA 3PBQA 3LEZA 3LY3A 1OJGA 1TS0A 1CF0A 3PTEA 5M19A 4OH0A 4M4XA 5AQ7A 4HEFA 1H8MA 1FILA 1WE4A 4G3WA 1S4SA 3GQZA 2XGNA 3G2YA 1LL8A 1XFQA 3IXBA 5HL6A 5L10A 1IKGA 4KZ5A 5EE8A 3T50A 1W8YA 2M7VA 1K57C 2R9XA 3N6IA 5EM0A 1IOUA 2A2LA 3HCYA 2EX6A 2IA2A 3G35A 4PKYA 1GSVA 4FD8A 2QKPA 3U2AA 3ZYTA 4LLOB 5DFYA 4UA9A 2B02A 3Q1FA 3N8SA 3Q82A 3FKWA 2ACGA 3OPPA 1MBLA 4CPKA 1WA9A 1TS8A 3MFDA 1HD8A 3IX4A 2VV7A 3GECA 3S4XA 3BRMA 4DE2A 2ZQ7A 5AQAA 3VP4A 1BUEA 3VSLA 2V1ZA 2VGJA 2G2WA 4XT2B 2ZJ9A 2ZQ9A 2M7UA 2HV1A 2WYXA 3QP8A 3C7UA 1YLYA 3B33A 3E2LA 3KSGA 4YNRA 2K31A 2B5RA 2OAQ1 1KVMA 5EOOA 2Q9MA 2Y2OA 1K6RA 4WZ5C 2V1BA 1N9NA 3W4PA 2XROA 4E3KA 2PU4A 1HTZA 2W3EA 4WL9A 1STZA 1OJ5A 4N1XA 3CPTB 3IH9A 1ACFA 4EERA 3NC8A 1K4EA 4Z1WA 4DE0A 4OPZA 1EROA 3DTIA 4MLLA 3E4PA 3SH7A 3LFVA 1BLPA 2FH5A 5GHZA 2QJ5A 2HP9A 5AQ9A 2OV5A 2XA7M 3VP0A 3TSGA 4HESA 2Y2JA 5FSRA 2XDMA 4JGQA 4HP9A 1OTIA 4OPQA 5FQQA 1H8ZA 3PAGA 3R4KA 4MBHA 3OCLA 1YM1A 4CQHA 5F82A 3OCNA 3ZHHA 1L0FA 3BFFA 1W5DA 2ZMVA 4GNUA 3PBRA 3DW0A 1YMXA 3V3SA 1Y28A 1NZUA 5E43A 2Y2HA 1H3QA 1YLJA 2BLSA 3AGDA 2J3TC 2ZL1A 1CI9A 3UE6A 4BD0A 4WYYA 2P9VA 4WN5A 3CG5A 4KZ8A 3MSHA 4Y0TA 5TBMA 2WKQA 4N1HA 1KDSA 4BL2A 2HJEA 2JBFA 2GZAA 3SZTA 3HLEA 5HWTA 4DXBA 3IHAA 3HUOA 4DN0A 2WK0A 3UDXA 5DJUA 3PBSA 2VZWA 3MQQA 1ESUA 4X1LA 2J8YA 1UWPX 1GA0A 4I39A 1YSPA 1XFNA 4JKTA 3QP1A 1DRMA 3B42A 4BBVA 3IXHA 1RCJA 5HDDA 3MKFA 1G28A 3BYDA 1OTAA 5DTTA 3OC2A 3VFFA 1Q2PA 3CZDA 4Y7PA 1JNUA 3IS2B 3QP4A 3C30A 4Z9QA 4JGOA 4Y15A 1DJAA 4LFUA 5AVFA 2VGLM 1TEMA 5CECA 1T19A 3IWOA 5EM1A 4UAAA 2R78A 1BT5A 3HL9A 5CRFA 1F5MA 1E25A 1MC0A 3ZG9B 4X69A 2W3FA 3GV9A 5FQKA 2VX8A 4IVKA 1VQQA 2PRFA 5DTSA 3NCKA 1K57A 2GNXA 3EEHA 2W1TA 4X25A 1S6RA 4JGRA 4MN5A 3CITA 3NOUC 3DTEA 4CLCC 4EV4A 4F94A 2PYRA 2XLNA 4F3LA 1WYCA 2VKSA 5HPIA 3NI9A 4BL3A 1TVFA 5CEBA 3GVBA 2JKGA 4NXBA 2WAEA 1EI5A 1K56D 5FQIA 1N4OA 4LGWA 4IVIA 2L4RA 5FDSA 2W27A 4EQIA 2I72A 4OOYA 1YPRA 2DCFA 2FZ0A 3N7WA 1PWCA 3UB9A 1DY6A 2C6WB 2V2FF 2XH9A 4EESA 3W4OA 4BBTA 3U4LP 3P7NA 3WWXA 2O0YA 4FOFA 1XX2A 4WM9A 3GR2A 4P6BA 3NHQA 1SDNA 3VV4A 1IKIA 3SS5A 4JLFA 1Y4OA 1NRJA 5EOEA 3HLDA 2KX6A 1LSWA 2VLGA 4ME4A 4H6JB 4GHIA 1L2SA 2I9VA 1S66L 1O7EA 3LCEA 3ZVTA 1FCOA 5G18A 4HJ3A 4OQ0A 3D9YA 2Z2MB 3UMEA 4Y0UA 2ZQCA 3BQ8A 3E0YA 4LV3A 2V0UA 4C3QA 4LENA 1G6AA 4CLCE 2P7JA 2LB5A 4OLDA 3DWZA 3UMDA 2PYPA 2IWBA 4QY6A 4KZ9A 2OLVA 4KZ3A 1MXOA 2ZC7A 4MNRA 5I5LA 2OLUA 2V1AA 1S67L 2ZM8A 3O88A 4GCZA 1LSXA 3HVFA 3IX8A 3UPPA 5FATA 4P6ZM 3T12B 3ZGAB 3EOIA 3A0VA 1KE4A 1W8QA 2XF3A 4B88A 1XXMA 3A0RA 2KLIA 5IT5A 4HNBA 1CK3A 2MJ6A 4GS9B 2JKRI 5GLBA 3PHYA 4Y13A 3FZCA 1MWRA 2KOIA 4GDNA 4HI4A 3LI9A 2P9VB 2QHKA 4LCLA 4JXSA 1MPLA 4WZ4A 3SOIA 3C2WA 2QPNA 2XSSA 3H7WA 2P04A 5JYPA 1L0GA 4QHCA 2Z6DA 3S22A 4FUWA 4ZTKA 3UY6A 4IEDA 4KG5A 2A3UA 5HARA 4XUXA 4E6XA 2HF6A 1CEGA 5A91A 1ERMA 1MY8A 4AFIA 1ZG6A 2ZD8A 1YLTA 2E8JA 1VB6A 4EW7A 3RXXA 2JCHA 5F1FA 4UA6A 4B93A 3VP3A 1G68A 3BJNA 1FSWA 3W2ZA 3W8KA 2Y2IA 4JF5A 2WKIA 4BBUA 3P09A 1YMSA 2HJ9C 4OP8A 5M1AA 5HW3A 2INWA 4MDZA 1KVLA 3CI6A 4OONA 2V0WA 3JVUA 2NUPC 1V9YA 4XUZA 3DBAA 3JVVA 2OOLA 3T4OA 3KYEA 5E2EA 3AGFA
chains in the Genus database with same CATH topology
4Y3IA 3IBJA 4EERA 2JKRM 4GLQA 4Z1WA 4O01A 3KSHA 2VJWA 3UB6A 2W1TB 3E4PA 3BWLA 1MKMA 1P97A 3VE4A 5HWWA 3LFVA 2PR5A 3MXQA 2FH5A 4HP4A 2VV8A 2A24A 5HSQA 5DKLA 2QJ5A 3S7PA 5IS1A 3KSIA 5A8BA 4KQDA 1UWNX 4HY8A 2XA7M 4II7A 5EFWA 1BYWA 1EW0A 3RH8B 4EEPA 2G7UA 4JGQA 4HP9A 3TJZC 1OTIA 2O99A 2A24B 2W1RA 3T4TA 4H6JA 3PBTA 4UQIS 3F1PB 3K3DA 3V67A 3R4KA 5HWVA 3OCLA 1YAXA 4CQHA 4JGPA 3T4LA 3ZQ5A 3OCNA 2ZMVA 1GSXA 3PBRA 2P08A 2ZOHA 1Y28A 2O9CA 3C8CA 5L8MA 4KUKA 4LRZE 5F6AA 2L1MA 3R7WB 1H3QA 2J3TC 1XJ3A 4G3KA 3UE6A 3EQUA 1XJ2A 2OAP1 4MMNA 4WN5A 4EQ1A 1OTBA 1IFQA 2BASA 4HQAA 4HH3A 5TBMA 2WKQA 2Y8HA 3HJIA 4UQIM 2HJEA 3MJQA 2GZAA 3ULFA 5HWTA 3LR3A 4EEUA 3MR0A 5TJJA 3EWKA 4DN0A 3LICA 4BMWA 2W3DA 1XJ6A 4MCWA 5K5BA 1N9OA 5DJUA 3PBSA 2VZWA 3MQQA 3UB7A 4WLAA 3PBNA 3T4SA 3TW8A 4Y2FA 2QJ7A 1UWPX 1NWZA 1OPXA 4I39A 1YSPA 5TBMB 3K3CA 4HHDA 1XFNA 4IUHA 3OBFA 1W63M 4R6LA 2K2NA 1DRMA 4XT2A 2GX5A 2WKPA 4PHTA 3B42A 4BBVA 1DP6A 5HDDA 5DKKA 4WEKA 3PXPA 5J3WA 4MN7A 1G28A 1OTAA 3OC2A 3LIFA 1X0OA 5FL3A 1JNUA 2M1CA 3IS2B 4PKYG 4EU0A 3C30A 3MQ0A 2QYBA 4NXFA 3KSFA 4JGOA 4GW9A 1LSVA 4IUKA 5AVFA 2VGLM 4LRYC 1T19A 3EEAA 4EETB 1T1AA 3LUQA 4DJ3A 3LIAA 3LI8A 4WEJA 3G6OA 1MZUA 4Y5FA 4IJGA 3H82B 4L0LA 1XJ4A 4GS9A 3LYXA 2R78A 4Q0JA 1TS6A 5HDSA 2YKHA 5AJGA 1F5MA 2J80A 1MC0A 1ZHHB 1D7EA 3T4QA 2W3FA 2VX8A 3LIEA 3MFXA 2OWHA 1T18A 3CLOA 4RQ9A 5F69A 1NLYA 5G4YA 2JHEA 4I3JA 1VHMA 5DF9A 4LRXC 1S1YA 1F9IA 2GNXA 5C5KA 2NUTC 2PDRA 5CX7A 3EEHA 2D01A 2W1TA 3S7NA 1F98A 1ZTUA 3PYPA 3FPVA 4JGRA 4MN5A 4I38A 3CITA 3NOUC 3CUEC 4CLCC 3MF0A 2YKFA 3F1NA 5DFXA 2LB9A 4NKPA 2PR6A 5AVEA 2PYRA 4NEED 4F3LA 3HJKA 2PHYA 2VKSA 1T1CA 3BY9A 3F1NB 5HPIA 5HD5A 1TS7A 3FG8A 4EXOA 4IHQA 4BJPA 4ZRRA 2QWSA 2W3GA 5F5YA 4R3AA 5HDCA 4NXBA 2J3TD 1N9LA 4OOLA 3VOLA 3TRCA 2L4RA 4GHIB 3T4JA 2W27A 4UEYA 4YOFA 1YSQA 5KSHA 2PD8A 2VEAA 2FZ0A 4O0PA 3LIDA 3EGXC 1LT0A 1V9ZA 3VE3A 3CWFA 2V9AA 1P0ZA 4WELA 5J7EA 3PBOA 3UB9A 3EGDC 4Q0HA 4HIAA 2B18A 3T4KA 4ARZA 4EESA 1S1ZA 4BBTA 3MQOA 5HD3A 3P7NA 2KDKA 5LBRA 2O0YA 2HGVA 3NOTC 4FOFA 3R7WA 4MN6A 3H7WB 2JN7A 2VA0A 3RFBA 4KQOA 3BQAA 3KYQA 3NHQA 3OOVA 4CLCA 3VV4A 3EQVA 5G4ZA 3BW6A 4DMZA 5F68A 2XA7S 2J3WA 4ARZB 1NRJA 5MC7A 1P9WA 1DP8A 2KX6A 1LSWA 2VLGA 3F1PA 4ME4A 2CMNA 3K2NA 4NXEA 1ODVA 2GJ3A 4H6JB 3TE8A 4LPZA 4GHIA 3KX0X 4NXGA 2I9VA 4E04A 1S66L 2ZOIA 4HJ3A 5HPFA 3UMEA 1DP9A 2Y79A 2XRNA 2EWWA 3BQ8A 1D06A 3IBRA 2VGLS 3E0YA 4O8GA 1W63Q 2K7SA 2H28A 2V0UA 3D72A 1S4RA 4L9FA 2VV6A 4CLCE 2JKTM 2P7JA 2LB5A 3SW1A 4GJ4A 2D02A 2PYPA 3UMDA 3OLOA 4P6ZS 4ETXA 2PT7A 3CAXA 4QPRA 3BY8A 4PAUA 4HH2A 2V1AA 5I5LA 4YWZA 1S67L 2O9BA 4L9EA 4EUVA 2OWJA 3S7OA 4I3AA 4GCZA 4CLCB 3D3OA 1YKDA 3NJAA 2Z6CA 1LSXA 4Q0IA 5DJTA 3C38A 3A0SA 3S7QA 4G3VA 5IU1A 3NOPC 4I3IA 2EWVA 4P6ZM 4CLCD 5HZHA 3EOIA 4L9GA 3A0VA 3PBQA 1OT9A 1OJGA 2O9AA 1TS0A 1OT6A 3A0RA 2KLIA 5IT5A 4HNBA 4M4XA 2MJ6A 3MMHA 2L0WA 1KOUA 4GS9B 2JKRI 1TD5A 1H8MA 3H82A 3PHYA 4G3WA 1S4SA 1LL8A 1XFQA 5HL6A 4R38A 2W3HA 3LR0A 2KOIA 1GSWA 3F1OB 5J4EA 4HI4A 3LI9A 2QHKA 3T50A 2M7VA 3E98A 3RTYA 1IOUA 3C2WA 4BWIA 4OOMA 2A2LA 3HCYA 2XSSA 2JKTI 3UE3A 3H7WA 2P04A 2IA2A 4PKYA 1GSVA 2QKPA 2Z6DA 3CUEA 3U2AA 5KIZA 3LR5A 3ZYTA 3B47A 4LLOB 1UGUA 4KUOA 5DFYA 2W0NA 4DJ2A 1P9RA 2B02A 4FSFA 1TF1A 3IS2A 2HF6A 3FC7A 3PR6A 3KO6A 1WA9A 1TS8A 3GECA 2VV7A 4AFIA 3FPWA 4WF0A 4HJ6A 1T1BA 1VB6A 4EW7A 3O5YA 3GDIA 4XT2B 1OTEA 2EA9A 4B93A 3F1OA 3BJNA 2ZBBA 2M7UA 4HOIA 2HV1A 3W2ZA 3B33A 4BBUA 3KSGA 4YNRA 1G6OA 2DMWA 2K31A 1OTDA 3E4OA 3H9WA 2OAQ1 2HJ9C 4HJ4A 3LIBA 3UB8A 4R70A 3ICYA 1NLZA 2INWA 4MDZA 3CI6A 2V1BA 1N9NA 2V0WA 3JVUA 2NUPC 1V9YA 2XROA 3KYZA 3LR4A 2WKRA 4WUJA 3DBAA 2PD7A 3JVVA 2OOLA 4F3LB 4I5SA 3T4OA 2W3EA 2ZMFA 4K08A 3E4QA 4B9OA 4WL9A 4ETZA 1STZA 3P01A 1OJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWZ A;  2L4R A;  4GHI B;  3NOP C;  4I39 A;  5IU1 A;  4I3I A;  5TBM B;  3K3C A;  4HHD A;  5HZH A;  1XFN A;  2W27 A;  4L9G A;  3A0V A;  1OT9 A;  4EER A;  4R6L A;  1OJG A;  1DRM A;  3VOL A;  4XT2 A;  2WKP A;  1TS0 A;  1OT6 A;  4BBV A;  4E04 A;  1DP6 A;  3A0R A;  2PD8 A;  5HDD A;  2VEA A;  5DKK A;  4HNB A;  4M4X A;  3UB6 A;  2L0W A;  5J3W A;  3E4P A;  3LID A;  1G28 A;  1KOU A;  3BWL A;  4GS9 B;  1P97 A;  1LT0 A;  1OTA A;  3VE4 A;  1V9Z A;  4EEP A;  5HWW A;  2PR5 A;  3H82 A;  3LIF A;  3MXQ A;  3PHY A;  3VE3 A;  4HP4 A;  1S4S A;  1X0O A;  2VV8 A;  3CWF A;  1LL8 A;  2A24 A;  5HSQ A;  5DKL A;  1JNU A;  1XFQ A;  2M1C A;  2V9A A;  2QJ5 A;  3IS2 B;  4PKY G;  4EET B;  1P0Z A;  4R38 A;  5J7E A;  5IS1 A;  3UB9 A;  1GSW A;  3F1O B;  4NXF A;  5A8B A;  5J4E A;  4HI4 A;  4KQD A;  1UWN X;  4JGO A;  3LI9 A;  4GW9 A;  1LSV A;  2QHK A;  4HY8 A;  3T50 A;  4HIA A;  5EFW A;  1BYW A;  5AVF A;  1EW0 A;  4LRY C;  3RTY A;  1T19 A;  3RH8 B;  1S1Z A;  4EES A;  4BBT A;  3MQO A;  5F69 A;  3P7N A;  2KDK A;  3C2W A;  1T1A A;  3LUQ A;  5HD3 A;  4DJ3 A;  3LIA A;  3LI8 A;  4JGQ A;  3NOT C;  3G6O A;  1MZU A;  4HP9 A;  1OTI A;  2A24 B;  4MN6 A;  3H7W B;  3H7W A;  2JN7 A;  3H82 B;  4H6J A;  1XJ4 A;  3NHQ A;  4GS9 A;  3LYX A;  1GSV A;  3F1P B;  2R78 A;  3K3D A;  4PKY A;  5G4Z A;  5HWV A;  2QKP A;  2Z6D A;  1TS6 A;  5F68 A;  5HDS A;  2YKH A;  4JGP A;  3ZQ5 A;  2J80 A;  5KIZ A;  1D7E A;  4LLO B;  1UGU A;  3LIE A;  1DP8 A;  1GSX A;  3MFX A;  4KUO A;  2KX6 A;  1LSW A;  2OWH A;  2VLG A;  2B02 A;  2W0N A;  2ZOH A;  1Y28 A;  2CMN A;  1T18 A;  3C8C A;  3CLO A;  1ODV A;  2GJ3 A;  4H6J B;  4KUK A;  4LPZ A;  4GHI A;  3IS2 A;  3KX0 X;  2I9V A;  4NXG A;  1S66 L;  3A0S A;  3FC7 A;  2JHE A;  4I3J A;  4LRZ E;  4RQ9 A;  5G4Y A;  5F6A A;  4LRX C;  1S1Y A;  2L1M A;  2ZOI A;  1F9I A;  4HJ3 A;  1WA9 A;  1TS8 A;  2PDR A;  3EEH A;  3UME A;  1DP9 A;  2VV7 A;  1XJ3 A;  2D01 A;  3GEC A;  1F98 A;  4WF0 A;  1D06 A;  3UE6 A;  3IBR A;  4HJ6 A;  1T1B A;  3PYP A;  1XJ2 A;  4JGR A;  1VB6 A;  4I38 A;  2K7S A;  2H28 A;  3GDI A;  4MN5 A;  4WN5 A;  4XT2 B;  3NOU C;  2V0U A;  3D72 A;  1OTE A;  2EA9 A;  4EQ1 A;  1OTB A;  3F1O A;  1S4R A;  2ZBB A;  2BAS A;  2YKF A;  2VV6 A;  3F1N A;  4L9F A;  4HQA A;  4HOI A;  2HV1 A;  4HH3 A;  2P7J A;  2WKQ A;  5TBM A;  2PR6 A;  4DJ2 A;  3SW1 A;  3HJI A;  2D02 A;  2PYP A;  3UMD A;  3B33 A;  3OLO A;  5AVE A;  2PYR A;  3MJQ A;  4BBU A;  3ULF A;  4NXE A;  5HWT A;  4EEU A;  1OTD A;  3E4O A;  3H9W A;  3HJK A;  2PHY A;  3BY9 A;  1T1C A;  3F1N B;  3MR0 A;  4F3L A;  3EWK A;  5HD5 A;  4HJ4 A;  3CAX A;  1TS7 A;  3LIB A;  3UB8 A;  4R70 A;  3FG8 A;  3ICY A;  3LIC A;  4EXO A;  1XJ6 A;  2INW A;  2V1B A;  2QWS A;  1N9N A;  1N9O A;  2V0W A;  3BY8 A;  4HH2 A;  2V1A A;  1V9Y A;  4R3A A;  5F5Y A;  5HDC A;  4NXB A;  5I5L A;  4YWZ A;  4EW7 A;  1S67 L;  2WKR A;  4L9E A;  4WUJ A;  5DJU A;  2OWJ A;  3MQQ A;  2PD7 A;  2OOL A;  4I3A A;  3UB7 A;  4I5S A;  4WLA A;  4GCZ A;  1N9L A;  4F3L B;  4K08 A;  3NJA A;  3E4Q A;  4B9O A;  2Z6C A;  1LSX A;  3F1P A;  4WL9 A;  2QJ7 A;  5DJT A;  1UWP X;  1OJ5 A; 
#chains in the Genus database with same CATH topology
 4Y3I A;  3M6H A;  3AGE A;  1KGG A;  4NG2 A;  5CHM A;  5CTN A;  1WYB A;  3IBJ A;  4K91 A;  4QWO A;  2UV0 E;  3BFG A;  4GLQ A;  4O01 A;  3SH9 A;  2H0Y A;  2Y59 A;  3DTM A;  3KSH A;  3UB6 A;  3MZF A;  3BWL A;  1GCE A;  1P97 A;  2P74 A;  5HWW A;  3MXQ A;  2VV8 A;  2A24 A;  5GLA A;  5EPH A;  2Y55 A;  4E3O A;  4HY8 A;  4EEP A;  2G7U A;  3VFH A;  4P85 A;  5A92 A;  3TJZ C;  2O99 A;  3GSG A;  2A24 B;  3T4T A;  4H6J A;  3V50 A;  3F1P B;  4DF6 A;  1GA9 A;  1LI9 A;  4PM5 A;  1K25 A;  1YAX A;  3T4L A;  5JYO A;  4U3T A;  4YFM A;  4QY5 A;  5F6A A;  3IXD A;  2G2U A;  1XJ3 A;  4BD1 A;  2OAP 1;  1JWP A;  2V20 A;  4MMN A;  4GD8 A;  1ZG4 A;  4EQ1 A;  1IFQ A;  4HQA A;  1CI8 A;  5M18 A;  2ZL1 B;  4N9K A;  3ULF A;  1W79 A;  5TJJ A;  3EWK A;  3OPR A;  4UHU A;  4BMW A;  4MCW A;  1XJ6 A;  2WKE A;  1NWZ A;  1FSY A;  4HHD A;  1U60 A;  3OBF A;  4PM7 A;  1K55 A;  2WKP A;  4O7D A;  3IQA A;  3D4F A;  2EXA A;  2WGV A;  3PXP A;  5FQM A;  5KZH A;  3IX3 A;  3LIF A;  2ZM0 A;  5HAP A;  1IYO A;  2UWX A;  5FAS A;  1BLS A;  3A3F A;  4NXF A;  5GLC A;  1FQG A;  3DTK A;  2ZMA A;  3FV7 A;  3WS1 A;  1LSV A;  3O87 A;  4Y0O A;  3MZD A;  2XFT A;  5GHX A;  3EEA A;  4EET B;  5A90 A;  1MZU A;  4LCM A;  4P87 A;  4L0L A;  2X01 A;  4GS9 A;  1G5U A;  4ESP A;  3I7J A;  4Q0J A;  3V5M A;  1TS6 A;  2HDU A;  3MS6 A;  4QD4 A;  2J80 A;  1NZO A;  1ZHH B;  1D7E A;  3BFC A;  3T4Q A;  3LIE A;  4S2N A;  3QP6 A;  2OWH A;  2Y2L A;  1T18 A;  1RGZ A;  5CGW A;  5F69 A;  2JC7 A;  5G4Y A;  1VHM A;  5DF9 A;  3G30 A;  1F9I A;  5I94 A;  4GZB A;  5CX7 A;  3IF6 A;  5FI6 A;  5IHV A;  4E6W A;  3PYP A;  4I38 A;  1QMF A;  3ZG8 B;  4DKI A;  2J7V A;  4GN2 A;  2OSU A;  3F1N A;  4ZDX A;  4X68 A;  3ZNY A;  2BTF P;  1E4D A;  2WUQ A;  1K38 A;  5D3O A;  3F1N B;  4BQM A;  3ZG5 A;  2H10 A;  4KEN B;  5GL9 A;  2AVX A;  4ZRR A;  3ITB A;  1VET B;  5HDC A;  1EWZ A;  4QB8 A;  4KZB A;  1J9M A;  1N9L A;  4HBU A;  1PI5 A;  2IWC A;  2QZ6 A;  3VOL A;  1SZV A;  4GHI B;  4E3L A;  5EVI D;  3T4J A;  2VK3 A;  4YOF A;  5U47 A;  3VP2 A;  1CQA A;  1YSQ A;  5KSH A;  2FFF B;  4OPY A;  2VEA A;  3Q7Z A;  4DRT A;  4O0P A;  3VMA A;  3LID A;  3EGX C;  3UDF A;  1BLC A;  1LT0 A;  1V9Z A;  3L7H A;  4S2J A;  3CHW P;  1OME A;  4WEL A;  3EGD C;  4Q0H A;  4GB7 A;  2BG1 A;  4ARZ A;  2PBY A;  5HD3 A;  2KDK A;  2HGV A;  3NOT C;  3ZCZ A;  4GD6 A;  3UDI A;  4MN6 A;  3H7W B;  3P98 A;  2JN7 A;  4KQO A;  4EBN A;  1XPB A;  3EQV A;  5G4Z A;  4DMZ A;  3IT9 A;  2XA7 S;  2J3W A;  1LL5 A;  4ARZ B;  1HVB A;  1TDL A;  4WZ5 A;  3K2N A;  4NXE A;  2GJ3 A;  4LPZ A;  3KX0 X;  2ZC4 B;  3QP2 A;  1K4F A;  2Y79 A;  2XRN A;  3IF5 A;  1S0W A;  3IBR A;  4O8G A;  2K7S A;  3D72 A;  1A0K A;  2X02 A;  3G31 A;  3A3I A;  3HBR A;  4ZAM A;  4QPR A;  4CJN A;  1XGI A;  1ZC2 A;  3BY8 A;  4HH2 A;  2HDS A;  3IHB A;  4YWZ A;  1PIO A;  4JXV A;  1YKD A;  2Z6C A;  4Q0I A;  4UA7 A;  1JWV A;  5TR7 A;  3C38 A;  3A0S A;  3S7Q A;  1LHY A;  5IU1 A;  4N92 A;  4M3K A;  3M6B A;  1MWU A;  5TFQ A;  2C5W B;  2O9A A;  3W4Q A;  3QHY A;  4KZ4 A;  2L0W A;  1Z09 A;  1KOU A;  3LY4 A;  1TD5 A;  5EV0 A;  4S2P A;  5E2G A;  4R38 A;  2W3H A;  3F1O B;  5FAQ A;  2RCX A;  5EEC A;  3E98 A;  3T1Q B;  1MWT A;  2JKT I;  1ES5 A;  4IBR A;  4DDY A;  2HZ5 A;  3WRT A;  3BFE A;  3CUE A;  1Y54 A;  4BEN A;  5KIZ A;  1K6S A;  3LR5 A;  4OKP A;  3B47 A;  1YLP A;  1UGU A;  3OPL A;  4KUO A;  1ERQ A;  4DJ2 A;  1P9R A;  3WS5 A;  4S2M A;  3FC7 A;  3PR6 A;  3KO6 A;  4GKU A;  3ZVW A;  1SDE A;  1XA1 A;  1SCW A;  4WF0 A;  3WS0 A;  5HAQ A;  1CEF A;  4HJ6 A;  1T1B A;  3O5Y A;  2EA9 A;  4RA7 A;  1ES3 A;  2XEP A;  4HOI A;  4B4X A;  1FIK A;  1JTD A;  2DMW A;  1OTD A;  3E4O A;  3H9W A;  4LV1 A;  4FH4 A;  4DE1 A;  4R70 A;  3O86 A;  1NLZ A;  5KSC A;  2HDQ A;  3KYZ A;  5CHU A;  1ONG A;  4WUJ A;  1I2S A;  1XP4 A;  4F3L B;  2ZMF A;  5CXW A;  4B9O A;  2HPB A;  2EX8 A;  3FYZ A;  1DJB A;  1AWI A;  3JPU A;  3B3X A;  4QJG A;  2V8C A;  1ZKJ A;  1MKM A;  3FKV A;  5DKL A;  3C4O A;  3S7P A;  4R4R A;  5IS1 A;  2WAD A;  1PZP A;  2WGW A;  3KSI A;  1TDG A;  3LO7 A;  3BFD A;  5EFW A;  1BYW A;  1EW0 A;  1ES2 A;  3RH8 B;  1H0M A;  1YLZ A;  2XR0 A;  4MBF A;  5DVA A;  3G32 A;  3VSK A;  1NY0 A;  1I5Q A;  3PBT A;  3K3D A;  2HP6 A;  5HWV A;  3NDG A;  4JGP A;  2EFX A;  3WS4 A;  1DJC A;  4OP5 A;  2P08 A;  3MXS A;  2ZOH A;  2O9C A;  3C8C A;  3RJU A;  5L8M A;  4S2L A;  4OVD A;  4R0Q A;  1RGY A;  2J9O A;  3R7W B;  3C7V A;  4G3K A;  4S2O A;  3EQU A;  1XJ2 A;  4K0X A;  1OTB A;  2RL3 A;  2BAS A;  4DDS A;  1N9B A;  3HJI A;  3MJQ A;  4LV2 A;  3PAE A;  3MR0 A;  3QNC A;  2W3D A;  5K5B A;  1N9O A;  4OLG A;  1BZA A;  4FH2 A;  3UB7 A;  4WLA A;  3T4S A;  4ID4 A;  4PM8 A;  4Y2F A;  3G34 A;  3TG9 A;  1MWS A;  1Z6F A;  3A3D A;  4R1G A;  1K0K A;  1O07 A;  4R6L A;  2K2N A;  1ESI A;  4PHT A;  1DP6 A;  5DKK A;  1FOF A;  5EUA A;  2DNS A;  3SS4 A;  2V8F A;  4EU0 A;  4PKY G;  4ZBE A;  5EVL A;  2X71 A;  1L0E A;  3MQ0 A;  2QYB A;  4QU3 A;  2GDN A;  3S1Y A;  4R23 A;  3MBZ A;  3OZH A;  3ZFZ A;  1T1A A;  3LIA A;  3LI8 A;  4WEJ A;  4Y5F A;  1YT4 A;  3H82 B;  5TGF A;  3NBL A;  4ZJ2 A;  2ZC6 B;  4X6T A;  2YKH A;  4JPM A;  3C4P A;  3HLC A;  3MFX A;  3CLO A;  1NLY A;  1NYM A;  3FWL A;  4LRX C;  4E3M A;  4X1M A;  5CER A;  2D01 A;  3S7N A;  1J3W A;  1F98 A;  1ZTU A;  3HLW A;  2H5S A;  3FPV A;  4C75 A;  2WZX A;  5E2H A;  3V3R A;  4NKP A;  2PR6 A;  3BM6 A;  5FAP A;  1IEL A;  4YIN A;  4NEE D;  2PHY A;  4U0T A;  1KE0 A;  5HD5 A;  1TS7 A;  3FG8 A;  4EXO A;  1Q2Q A;  2QWS A;  2W3G A;  4JBF A;  5F5Y A;  3VOY A;  4R3A A;  2ZC3 B;  3BEB A;  3GRJ A;  3L9K A;  2J3T D;  3ITA A;  4OOL A;  1BLH A;  1NJ4 A;  5L2F A;  4RVA A;  4PPR A;  4PM9 A;  5FI7 A;  3BLM A;  1KE3 A;  1L0D A;  4UEY A;  5HFO A;  3N8R A;  1BUL A;  5CGS A;  3VE3 A;  1GHP A;  5AQB A;  3CWF A;  2FFY A;  1P0Z A;  3RXW A;  5J7E A;  1PW1 A;  5FI2 A;  3SS3 A;  3LEQ A;  4HIA A;  1QME A;  1ONH A;  1S1Z A;  3MQO A;  4WMC A;  1K56 A;  4BLM A;  3R7W A;  1NRF A;  2HP5 A;  3ZG0 A;  3RFB A;  3KYQ A;  4CLC A;  4KZ7 A;  5F68 A;  4XXR A;  2CMN A;  1ODV A;  3TE8 A;  4NXG A;  1PWG A;  1PZO A;  5E2F A;  2ZOI A;  1W7F A;  2PBD P;  4JXW A;  1DP9 A;  2Y2Q A;  3UE0 A;  4GOG A;  1S4R A;  4X55 A;  3VP1 A;  1GHI A;  2JKT M;  4EUZ A;  1XGJ A;  4GJ4 A;  2D02 A;  4P6Z S;  1FR6 A;  4X53 A;  3UPN A;  2PT7 A;  3CAX A;  5CED A;  4OPR A;  4S2N C;  3O3V A;  2EX9 A;  3S7O A;  3ISG A;  4CLC B;  4JF4 A;  3NJA A;  5F83 A;  4G3V A;  1ALQ A;  3NOP C;  4NK3 A;  5HZH A;  3MZE A;  4Q8I A;  4OQG A;  1I2W A;  3M2K A;  1OT9 A;  3OPH A;  1OT6 A;  5GLD A;  5FQJ A;  3MMH A;  3GTC A;  3IF6 B;  3H82 A;  1XA7 A;  2PAV P;  3LR0 A;  2JKF A;  1GSW A;  5J4E A;  5DF7 A;  2HDR A;  4FCF A;  5HAI A;  1F2K A;  3RTY A;  2ZQ8 A;  4H8R A;  5EVI B;  3QP5 A;  1K55 C;  4BWI A;  4OOM A;  3UE3 A;  3T1R A;  2WGI A;  2XD1 A;  3NEC A;  1YQS A;  5DF8 A;  5J8X A;  5BOH A;  2W0N A;  1E3U D;  4FSF A;  5FEG A;  1TF1 A;  3IS2 A;  4KQQ A;  4C6Y A;  2EX2 A;  1SKO A;  3NUL A;  2WAF A;  3QNB A;  5FA7 A;  1KDW A;  2WZZ A;  3FPW A;  1PNE A;  4R3J A;  4EWF A;  1SHV A;  3GDI A;  5FQ9 A;  3E2K A;  1OTE A;  3F1O A;  2ZBB A;  3Q7V B;  1AXB A;  4DE3 A;  1G6O A;  2Q9N A;  1M6K A;  4HJ4 A;  3LIB A;  3UB8 A;  2XQZ A;  3ICY A;  3LR4 A;  2WKR A;  4WMC D;  3G4P A;  2PD7 A;  4I5S A;  4K08 A;  3E4Q A;  3TOI A;  4ETZ A;  3P01 A;  4KQR A;  3ZNT A;  1PRQ A;  1JWZ A;  2JKR M;  1RP5 A;  4HBT A;  2VJW A;  2W1T B;  4KZ6 A;  3VE4 A;  3UE1 A;  2PR5 A;  3HUN A;  4HP4 A;  1C3B A;  5HSQ A;  5DTK A;  1FR1 A;  5A8B A;  4IBX A;  1UWN X;  4KQD A;  4OQH A;  4RX2 A;  4II7 A;  4D2O A;  3IWQ A;  3BEC A;  2DRW A;  1VEU B;  5F1G A;  2W1R A;  1PYY A;  5L09 A;  5HX9 A;  4MBK A;  3UO9 A;  3A3J A;  4UQI S;  4KZA A;  3V67 A;  2Y2N A;  3ZQ5 A;  1M40 A;  4LV0 A;  1GSX A;  1CJF A;  3IF6 C;  1LLB A;  4NET A;  3ZDJ A;  4KUK A;  1BTL A;  1IYS A;  4LRZ E;  2L1M A;  1VM1 A;  3BLS A;  1GHM A;  4EBP A;  1K54 A;  1PW8 A;  1BSG A;  3WS2 A;  3HLF A;  2H0T A;  4HH3 A;  2Y8H A;  3M2J A;  4UQI M;  3N4I A;  4KG6 A;  1PFL A;  3Q7V A;  1MKI A;  2ZM2 A;  3LR3 A;  4EEU A;  5FEF A;  4JXG A;  3LIC A;  1IYQ A;  1PWD A;  1E3U A;  4OQI A;  3A3E A;  3PBN A;  2B95 A;  3TW8 A;  3LGO A;  2Y91 A;  2QMI A;  2Y2K A;  1SKF A;  2QJ7 A;  3VOZ A;  5GHY A;  1KGE A;  2EXB A;  1OPX A;  2XFS A;  5TBM B;  4E3J A;  3K3C A;  4IUH A;  1W63 M;  3DWK A;  4XT2 A;  1FCN A;  2GX5 A;  2ZC5 B;  3UNW A;  4WEK A;  5J3W A;  4R3B A;  2WGW B;  4MN7 A;  4X56 A;  1KGF A;  3GMW A;  2CC1 A;  2IWD A;  1X0O A;  4JF6 A;  5FL3 A;  2M1C A;  3MKE A;  3KSF A;  3HUM A;  4GW9 A;  4IUK A;  2E8I A;  4LRY C;  3LUQ A;  4DJ3 A;  3G6O A;  3T1S A;  4IJG A;  1L3L A;  1H5X A;  4ZJ1 A;  4S2K A;  1VEU A;  1XJ4 A;  2XD5 A;  3LYX A;  3NY4 A;  5HDS A;  1H8Y A;  3IXG A;  5AJG A;  1NXY A;  2Z2L B;  4RQ9 A;  2Y4A A;  2JHE A;  4I3J A;  5KMW A;  4S2I A;  1S1Y A;  5C5K A;  2NUT C;  2PDR A;  4D60 A;  4KG2 A;  5CGX A;  3HRE A;  4ZJ3 A;  2A49 A;  4R4S A;  3UPO A;  3CUE C;  3MF0 A;  2YKF A;  3CPT A;  5DFX A;  2LB9 A;  2Y2P A;  5AVE A;  1LL9 A;  1LI0 A;  4U0X A;  5HL1 A;  3HJK A;  3BY9 A;  1T1C A;  5CHJ A;  2ZQD A;  4RYE A;  4IHQ A;  4BJP A;  2Q0O A;  3C5A A;  1PI4 A;  4Y17 A;  5EVI C;  2J9P A;  3TRC A;  1YLW A;  4K0W A;  1VET A;  3CMZ A;  3V39 A;  4RX3 A;  2Y2M A;  2R9W A;  3Q07 A;  2PD8 A;  5A93 A;  2Y2G A;  3T1X A;  1JTG A;  2WKH A;  1SKO B;  1JVJ A;  2EFU A;  3UB5 P;  2V9A A;  4EBL A;  3PBO A;  4DXC A;  4FTX A;  1K54 C;  3UN7 A;  2B18 A;  4N9L A;  3T4K A;  4MEZ A;  1ES4 A;  2ZLY A;  5FAO A;  1FCM A;  5LBR A;  3ZG7 B;  5FDH A;  2VA0 A;  3NIA A;  4P0M A;  2ZQA A;  3BQA A;  3JYI A;  3OOV A;  3N8L A;  5EVI A;  3BW6 A;  3HLB A;  1HZO A;  1P9W A;  5MC7 A;  1DP8 A;  4E3I A;  3F1P A;  3MXR A;  4E04 A;  2JE5 A;  2VGK A;  4GDB A;  4PM6 A;  5HPF A;  1IYP A;  1IEM A;  2EWW A;  3IH8 A;  1D06 A;  4E3N A;  3DAV A;  2VGL S;  2PU2 A;  1W63 Q;  1XKZ A;  2H28 A;  4A5R A;  1D1J A;  4L9F A;  2VV6 A;  3IWI A;  3SW1 A;  3G2Z A;  3OLO A;  4PMA A;  5L07 A;  4ETX A;  3SH8 A;  5CTM A;  4B4Z A;  4PAU A;  2XK1 A;  2O9B A;  3Q81 A;  4L9E A;  4EUV A;  2OWJ A;  4I3A A;  4WBG A;  5EVE A;  3D3O A;  5DJT A;  3HLG A;  3NDE A;  1NYY A;  4I3I A;  2EWV A;  4CLC D;  3WRZ A;  1HLU P;  3CJM A;  4L9G A;  3PBQ A;  3LEZ A;  3LY3 A;  1OJG A;  1TS0 A;  1CF0 A;  3PTE A;  5M19 A;  4OH0 A;  4M4X A;  5AQ7 A;  4HEF A;  1H8M A;  1FIL A;  1WE4 A;  4G3W A;  1S4S A;  3GQZ A;  2XGN A;  3G2Y A;  1LL8 A;  1XFQ A;  3IXB A;  5HL6 A;  5L10 A;  1IKG A;  4KZ5 A;  5EE8 A;  3T50 A;  1W8Y A;  2M7V A;  1K57 C;  2R9X A;  3N6I A;  5EM0 A;  1IOU A;  2A2L A;  3HCY A;  2EX6 A;  2IA2 A;  3G35 A;  4PKY A;  1GSV A;  4FD8 A;  2QKP A;  3U2A A;  3ZYT A;  4LLO B;  5DFY A;  4UA9 A;  2B02 A;  3Q1F A;  3N8S A;  3Q82 A;  3FKW A;  2ACG A;  3OPP A;  1MBL A;  4CPK A;  1WA9 A;  1TS8 A;  3MFD A;  1HD8 A;  3IX4 A;  2VV7 A;  3GEC A;  3S4X A;  3BRM A;  4DE2 A;  2ZQ7 A;  5AQA A;  3VP4 A;  1BUE A;  3VSL A;  2V1Z A;  2VGJ A;  2G2W A;  4XT2 B;  2ZJ9 A;  2ZQ9 A;  2M7U A;  2HV1 A;  2WYX A;  3QP8 A;  3C7U A;  1YLY A;  3B33 A;  3E2L A;  3KSG A;  4YNR A;  2K31 A;  2B5R A;  2OAQ 1;  1KVM A;  5EOO A;  2Q9M A;  2Y2O A;  1K6R A;  4WZ5 C;  2V1B A;  1N9N A;  3W4P A;  2XRO A;  4E3K A;  2PU4 A;  1HTZ A;  2W3E A;  4WL9 A;  1STZ A;  1OJ5 A;  4N1X A;  3CPT B;  3IH9 A;  1ACF A;  4EER A;  3NC8 A;  1K4E A;  4Z1W A;  4DE0 A;  4OPZ A;  1ERO A;  3DTI A;  4MLL A;  3E4P A;  3SH7 A;  3LFV A;  1BLP A;  2FH5 A;  5GHZ A;  2QJ5 A;  2HP9 A;  5AQ9 A;  2OV5 A;  2XA7 M;  3VP0 A;  3TSG A;  4HES A;  2Y2J A;  5FSR A;  2XDM A;  4JGQ A;  4HP9 A;  1OTI A;  4OPQ A;  5FQQ A;  1H8Z A;  3PAG A;  3R4K A;  4MBH A;  3OCL A;  1YM1 A;  4CQH A;  5F82 A;  3OCN A;  3ZHH A;  1L0F A;  3BFF A;  1W5D A;  2ZMV A;  4GNU A;  3PBR A;  3DW0 A;  1YMX A;  3V3S A;  1Y28 A;  1NZU A;  5E43 A;  2Y2H A;  1H3Q A;  1YLJ A;  2BLS A;  3AGD A;  2J3T C;  2ZL1 A;  1CI9 A;  3UE6 A;  4BD0 A;  4WYY A;  2P9V A;  4WN5 A;  3CG5 A;  4KZ8 A;  3MSH A;  4Y0T A;  5TBM A;  2WKQ A;  4N1H A;  1KDS A;  4BL2 A;  2HJE A;  2JBF A;  2GZA A;  3SZT A;  3HLE A;  5HWT A;  4DXB A;  3IHA A;  3HUO A;  4DN0 A;  2WK0 A;  3UDX A;  5DJU A;  3PBS A;  2VZW A;  3MQQ A;  1ESU A;  4X1L A;  2J8Y A;  1UWP X;  1GA0 A;  4I39 A;  1YSP A;  1XFN A;  4JKT A;  3QP1 A;  1DRM A;  3B42 A;  4BBV A;  3IXH A;  1RCJ A;  5HDD A;  3MKF A;  1G28 A;  3BYD A;  1OTA A;  5DTT A;  3OC2 A;  3VFF A;  1Q2P A;  3CZD A;  4Y7P A;  1JNU A;  3IS2 B;  3QP4 A;  3C30 A;  4Z9Q A;  4JGO A;  4Y15 A;  1DJA A;  4LFU A;  5AVF A;  2VGL M;  1TEM A;  5CEC A;  1T19 A;  3IWO A;  5EM1 A;  4UAA A;  2R78 A;  1BT5 A;  3HL9 A;  5CRF A;  1F5M A;  1E25 A;  1MC0 A;  3ZG9 B;  4X69 A;  2W3F A;  3GV9 A;  5FQK A;  2VX8 A;  4IVK A;  1VQQ A;  2PRF A;  5DTS A;  3NCK A;  1K57 A;  2GNX A;  3EEH A;  2W1T A;  4X25 A;  1S6R A;  4JGR A;  4MN5 A;  3CIT A;  3NOU C;  3DTE A;  4CLC C;  4EV4 A;  4F94 A;  2PYR A;  2XLN A;  4F3L A;  1WYC A;  2VKS A;  5HPI A;  3NI9 A;  4BL3 A;  1TVF A;  5CEB A;  3GVB A;  2JKG A;  4NXB A;  2WAE A;  1EI5 A;  1K56 D;  5FQI A;  1N4O A;  4LGW A;  4IVI A;  2L4R A;  5FDS A;  2W27 A;  4EQI A;  2I72 A;  4OOY A;  1YPR A;  2DCF A;  2FZ0 A;  3N7W A;  1PWC A;  3UB9 A;  1DY6 A;  2C6W B;  2V2F F;  2XH9 A;  4EES A;  3W4O A;  4BBT A;  3U4L P;  3P7N A;  3WWX A;  2O0Y A;  4FOF A;  1XX2 A;  4WM9 A;  3GR2 A;  4P6B A;  3NHQ A;  1SDN A;  3VV4 A;  1IKI A;  3SS5 A;  4JLF A;  1Y4O A;  1NRJ A;  5EOE A;  3HLD A;  2KX6 A;  1LSW A;  2VLG A;  4ME4 A;  4H6J B;  4GHI A;  1L2S A;  2I9V A;  1S66 L;  1O7E A;  3LCE A;  3ZVT A;  1FCO A;  5G18 A;  4HJ3 A;  4OQ0 A;  3D9Y A;  2Z2M B;  3UME A;  4Y0U A;  2ZQC A;  3BQ8 A;  3E0Y A;  4LV3 A;  2V0U A;  4C3Q A;  4LEN A;  1G6A A;  4CLC E;  2P7J A;  2LB5 A;  4OLD A;  3DWZ A;  3UMD A;  2PYP A;  2IWB A;  4QY6 A;  4KZ9 A;  2OLV A;  4KZ3 A;  1MXO A;  2ZC7 A;  4MNR A;  5I5L A;  2OLU A;  2V1A A;  1S67 L;  2ZM8 A;  3O88 A;  4GCZ A;  1LSX A;  3HVF A;  3IX8 A;  3UPP A;  5FAT A;  4P6Z M;  3T12 B;  3ZGA B;  3EOI A;  3A0V A;  1KE4 A;  1W8Q A;  2XF3 A;  4B88 A;  1XXM A;  3A0R A;  2KLI A;  5IT5 A;  4HNB A;  1CK3 A;  2MJ6 A;  4GS9 B;  2JKR I;  5GLB A;  3PHY A;  4Y13 A;  3FZC A;  1MWR A;  2KOI A;  4GDN A;  4HI4 A;  3LI9 A;  2P9V B;  2QHK A;  4LCL A;  4JXS A;  1MPL A;  4WZ4 A;  3SOI A;  3C2W A;  2QPN A;  2XSS A;  3H7W A;  2P04 A;  5JYP A;  1L0G A;  4QHC A;  2Z6D A;  3S22 A;  4FUW A;  4ZTK A;  3UY6 A;  4IED A;  4KG5 A;  2A3U A;  5HAR A;  4XUX A;  4E6X A;  2HF6 A;  1CEG A;  5A91 A;  1ERM A;  1MY8 A;  4AFI A;  1ZG6 A;  2ZD8 A;  1YLT A;  2E8J A;  1VB6 A;  4EW7 A;  3RXX A;  2JCH A;  5F1F A;  4UA6 A;  4B93 A;  3VP3 A;  1G68 A;  3BJN A;  1FSW A;  3W2Z A;  3W8K A;  2Y2I A;  4JF5 A;  2WKI A;  4BBU A;  3P09 A;  1YMS A;  2HJ9 C;  4OP8 A;  5M1A A;  5HW3 A;  2INW A;  4MDZ A;  1KVL A;  3CI6 A;  4OON A;  2V0W A;  3JVU A;  2NUP C;  1V9Y A;  4XUZ A;  3DBA A;  3JVV A;  2OOL A;  3T4O A;  3KYE A;  5E2E A;  3AGF A; 
#chains in the Genus database with same CATH homology
 4Y3I A;  3IBJ A;  4EER A;  2JKR M;  4GLQ A;  4Z1W A;  4O01 A;  3KSH A;  2VJW A;  3UB6 A;  2W1T B;  3E4P A;  3BWL A;  1MKM A;  1P97 A;  3VE4 A;  5HWW A;  3LFV A;  2PR5 A;  3MXQ A;  2FH5 A;  4HP4 A;  2VV8 A;  2A24 A;  5HSQ A;  5DKL A;  2QJ5 A;  3S7P A;  5IS1 A;  3KSI A;  5A8B A;  4KQD A;  1UWN X;  4HY8 A;  2XA7 M;  4II7 A;  5EFW A;  1BYW A;  1EW0 A;  3RH8 B;  4EEP A;  2G7U A;  4JGQ A;  4HP9 A;  3TJZ C;  1OTI A;  2O99 A;  2A24 B;  2W1R A;  3T4T A;  4H6J A;  3PBT A;  4UQI S;  3F1P B;  3K3D A;  3V67 A;  3R4K A;  5HWV A;  3OCL A;  1YAX A;  4CQH A;  4JGP A;  3T4L A;  3ZQ5 A;  3OCN A;  2ZMV A;  1GSX A;  3PBR A;  2P08 A;  2ZOH A;  1Y28 A;  2O9C A;  3C8C A;  5L8M A;  4KUK A;  4LRZ E;  5F6A A;  2L1M A;  3R7W B;  1H3Q A;  2J3T C;  1XJ3 A;  4G3K A;  3UE6 A;  3EQU A;  1XJ2 A;  2OAP 1;  4MMN A;  4WN5 A;  4EQ1 A;  1OTB A;  1IFQ A;  2BAS A;  4HQA A;  4HH3 A;  5TBM A;  2WKQ A;  2Y8H A;  3HJI A;  4UQI M;  2HJE A;  3MJQ A;  2GZA A;  3ULF A;  5HWT A;  3LR3 A;  4EEU A;  3MR0 A;  5TJJ A;  3EWK A;  4DN0 A;  3LIC A;  4BMW A;  2W3D A;  1XJ6 A;  4MCW A;  5K5B A;  1N9O A;  5DJU A;  3PBS A;  2VZW A;  3MQQ A;  3UB7 A;  4WLA A;  3PBN A;  3T4S A;  3TW8 A;  4Y2F A;  2QJ7 A;  1UWP X;  1NWZ A;  1OPX A;  4I39 A;  1YSP A;  5TBM B;  3K3C A;  4HHD A;  1XFN A;  4IUH A;  3OBF A;  1W63 M;  4R6L A;  2K2N A;  1DRM A;  4XT2 A;  2GX5 A;  2WKP A;  4PHT A;  3B42 A;  4BBV A;  1DP6 A;  5HDD A;  5DKK A;  4WEK A;  3PXP A;  5J3W A;  4MN7 A;  1G28 A;  1OTA A;  3OC2 A;  3LIF A;  1X0O A;  5FL3 A;  1JNU A;  2M1C A;  3IS2 B;  4PKY G;  4EU0 A;  3C30 A;  3MQ0 A;  2QYB A;  4NXF A;  3KSF A;  4JGO A;  4GW9 A;  1LSV A;  4IUK A;  5AVF A;  2VGL M;  4LRY C;  1T19 A;  3EEA A;  4EET B;  1T1A A;  3LUQ A;  4DJ3 A;  3LIA A;  3LI8 A;  4WEJ A;  3G6O A;  1MZU A;  4Y5F A;  4IJG A;  3H82 B;  4L0L A;  1XJ4 A;  4GS9 A;  3LYX A;  2R78 A;  4Q0J A;  1TS6 A;  5HDS A;  2YKH A;  5AJG A;  1F5M A;  2J80 A;  1MC0 A;  1ZHH B;  1D7E A;  3T4Q A;  2W3F A;  2VX8 A;  3LIE A;  3MFX A;  2OWH A;  1T18 A;  3CLO A;  4RQ9 A;  5F69 A;  1NLY A;  5G4Y A;  2JHE A;  4I3J A;  1VHM A;  5DF9 A;  4LRX C;  1S1Y A;  1F9I A;  2GNX A;  5C5K A;  2NUT C;  2PDR A;  5CX7 A;  3EEH A;  2D01 A;  2W1T A;  3S7N A;  1F98 A;  1ZTU A;  3PYP A;  3FPV A;  4JGR A;  4MN5 A;  4I38 A;  3CIT A;  3NOU C;  3CUE C;  4CLC C;  3MF0 A;  2YKF A;  3F1N A;  5DFX A;  2LB9 A;  4NKP A;  2PR6 A;  5AVE A;  2PYR A;  4NEE D;  4F3L A;  3HJK A;  2PHY A;  2VKS A;  1T1C A;  3BY9 A;  3F1N B;  5HPI A;  5HD5 A;  1TS7 A;  3FG8 A;  4EXO A;  4IHQ A;  4BJP A;  4ZRR A;  2QWS A;  2W3G A;  5F5Y A;  4R3A A;  5HDC A;  4NXB A;  2J3T D;  1N9L A;  4OOL A;  3VOL A;  3TRC A;  2L4R A;  4GHI B;  3T4J A;  2W27 A;  4UEY A;  4YOF A;  1YSQ A;  5KSH A;  2PD8 A;  2VEA A;  2FZ0 A;  4O0P A;  3LID A;  3EGX C;  1LT0 A;  1V9Z A;  3VE3 A;  3CWF A;  2V9A A;  1P0Z A;  4WEL A;  5J7E A;  3PBO A;  3UB9 A;  3EGD C;  4Q0H A;  4HIA A;  2B18 A;  3T4K A;  4ARZ A;  4EES A;  1S1Z A;  4BBT A;  3MQO A;  5HD3 A;  3P7N A;  2KDK A;  5LBR A;  2O0Y A;  2HGV A;  3NOT C;  4FOF A;  3R7W A;  4MN6 A;  3H7W B;  2JN7 A;  2VA0 A;  3RFB A;  4KQO A;  3BQA A;  3KYQ A;  3NHQ A;  3OOV A;  4CLC A;  3VV4 A;  3EQV A;  5G4Z A;  3BW6 A;  4DMZ A;  5F68 A;  2XA7 S;  2J3W A;  4ARZ B;  1NRJ A;  5MC7 A;  1P9W A;  1DP8 A;  2KX6 A;  1LSW A;  2VLG A;  3F1P A;  4ME4 A;  2CMN A;  3K2N A;  4NXE A;  1ODV A;  2GJ3 A;  4H6J B;  3TE8 A;  4LPZ A;  4GHI A;  3KX0 X;  4NXG A;  2I9V A;  4E04 A;  1S66 L;  2ZOI A;  4HJ3 A;  5HPF A;  3UME A;  1DP9 A;  2Y79 A;  2XRN A;  2EWW A;  3BQ8 A;  1D06 A;  3IBR A;  2VGL S;  3E0Y A;  4O8G A;  1W63 Q;  2K7S A;  2H28 A;  2V0U A;  3D72 A;  1S4R A;  4L9F A;  2VV6 A;  4CLC E;  2JKT M;  2P7J A;  2LB5 A;  3SW1 A;  4GJ4 A;  2D02 A;  2PYP A;  3UMD A;  3OLO A;  4P6Z S;  4ETX A;  2PT7 A;  3CAX A;  4QPR A;  3BY8 A;  4PAU A;  4HH2 A;  2V1A A;  5I5L A;  4YWZ A;  1S67 L;  2O9B A;  4L9E A;  4EUV A;  2OWJ A;  3S7O A;  4I3A A;  4GCZ A;  4CLC B;  3D3O A;  1YKD A;  3NJA A;  2Z6C A;  1LSX A;  4Q0I A;  5DJT A;  3C38 A;  3A0S A;  3S7Q A;  4G3V A;  5IU1 A;  3NOP C;  4I3I A;  2EWV A;  4P6Z M;  4CLC D;  5HZH A;  3EOI A;  4L9G A;  3A0V A;  3PBQ A;  1OT9 A;  1OJG A;  2O9A A;  1TS0 A;  1OT6 A;  3A0R A;  2KLI A;  5IT5 A;  4HNB A;  4M4X A;  2MJ6 A;  3MMH A;  2L0W A;  1KOU A;  4GS9 B;  2JKR I;  1TD5 A;  1H8M A;  3H82 A;  3PHY A;  4G3W A;  1S4S A;  1LL8 A;  1XFQ A;  5HL6 A;  4R38 A;  2W3H A;  3LR0 A;  2KOI A;  1GSW A;  3F1O B;  5J4E A;  4HI4 A;  3LI9 A;  2QHK A;  3T50 A;  2M7V A;  3E98 A;  3RTY A;  1IOU A;  3C2W A;  4BWI A;  4OOM A;  2A2L A;  3HCY A;  2XSS A;  2JKT I;  3UE3 A;  3H7W A;  2P04 A;  2IA2 A;  4PKY A;  1GSV A;  2QKP A;  2Z6D A;  3CUE A;  3U2A A;  5KIZ A;  3LR5 A;  3ZYT A;  3B47 A;  4LLO B;  1UGU A;  4KUO A;  5DFY A;  2W0N A;  4DJ2 A;  1P9R A;  2B02 A;  4FSF A;  1TF1 A;  3IS2 A;  2HF6 A;  3FC7 A;  3PR6 A;  3KO6 A;  1WA9 A;  1TS8 A;  3GEC A;  2VV7 A;  4AFI A;  3FPW A;  4WF0 A;  4HJ6 A;  1T1B A;  1VB6 A;  4EW7 A;  3O5Y A;  3GDI A;  4XT2 B;  1OTE A;  2EA9 A;  4B93 A;  3F1O A;  3BJN A;  2ZBB A;  2M7U A;  4HOI A;  2HV1 A;  3W2Z A;  3B33 A;  4BBU A;  3KSG A;  4YNR A;  1G6O A;  2DMW A;  2K31 A;  1OTD A;  3E4O A;  3H9W A;  2OAQ 1;  2HJ9 C;  4HJ4 A;  3LIB A;  3UB8 A;  4R70 A;  3ICY A;  1NLZ A;  2INW A;  4MDZ A;  3CI6 A;  2V1B A;  1N9N A;  2V0W A;  3JVU A;  2NUP C;  1V9Y A;  2XRO A;  3KYZ A;  3LR4 A;  2WKR A;  4WUJ A;  3DBA A;  2PD7 A;  3JVV A;  2OOL A;  4F3L B;  4I5S A;  3T4O A;  2W3E A;  2ZMF A;  4K08 A;  3E4Q A;  4B9O A;  4WL9 A;  4ETZ A;  1STZ A;  3P01 A;  1OJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...