4FOFA

Crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
AVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASLHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
publication title A Photo-Labile Thioether Linkage to Phycoviolobilin Provides the Foundation for the Blue/Green Photocycles in DXCF-Cyanobacteriochromes.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2012-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4fofA00
1TD5A 1STZA 4ETZA 2W1RA 3K2NA 3RFBA 1YKDA 4R6LA 2G7UA 3BJNA 4GW9A 3LFVA 5DFYA 2W3DA 2KLIA 4CQHA 4Q0IA 1YSPA 3ZQ5A 4EU0A 4BWIA 2IA2A 3C2WA 4ETXA 3NOTC 2VZWA 4QPRA 3W2ZA 4FOFA 4LRZE 3R4KA 4O01A 1YSQA 2LB5A 2LB9A 3S7QA 2HGVA 3NHQA 4Q0JA 4RQ9A 2VKSA 3IBRA 3MQ0A 4O0PA 4YNRA 4YOFA 2QYBA 2W1TB 2ZMFA 4DN0A 2M7VA 4IUKA 4MMNA 4MDZA 2VJWA 4G3KA 5HPFA 1F5MA 2M7UA 4IJGA 1MKMA 4Y5FA 3MMHA 3S7OA 5HL6A 3O5YA 2OOLA 4MCWA 2W3HA 3IBJA 2XSSA 5TJJA 2K2NA 4LRXC 2Y8HA 3KO6A 5C5KA 2O99A 3KSHA 4MN7A 3E0YA 4Z1WA 3DBAA 2XRNA 3NOPC 4DMZA 3VV4A 2O9AA 3S7PA 3S7NA 3KSGA 3OBFA 4R70A 2GX5A 2VEAA 5AJGA 2W3EA 3CI6A 5I5LA 1ZTUA 3EEAA 5L8MA 4GLQA 3CITA 5HPIA 2O0YA 3E98A 4Y3IA 2K31A 2B18A 2W1TA 4ZRRA 5K5BA 3MF0A 4EUVA 4O8GA 4Q0HA 4G3VA 2O9CA 2W3FA 5HSQA 4E04A 3KSIA 1VHMA 4IUHA 2KOIA 5LBRA 3NOUC 3KSFA 1MC0A 3G6OA 3HCYA 3D3OA 3OOVA 4ME4A 3TRCA 5DFXA 2Y79A 1TF1A 4G3WA 2W3GA 4LRYC 4PAUA 2O9BA 4Y2FA 2XROA
chains in the Genus database with same CATH superfamily
4ETZA 2ZOIA 1I5QA 3HLFA 3P7NA 3ZFZA 3A3DA 4DDSA 2W3DA 3BFGA 4KG5A 2WUQA 3FG8A 4H6JB 4ETXA 1CEFA 2QHKA 3MBZA 3HVFA 3DTEA 2HZ5A 2A2LA 3CHWP 2VV6A 5E2EA 4QJGA 1J3WA 4FCFA 3W8KA 4O0PA 2XH9A 1L2SA 3UPOA 3VP3A 4OONA 4XT2A 1TS0A 2PT7A 2J3WA 4MBFA 2XDMA 3N6IA 2FZ0A 4HY8A 4B93A 1LL5A 2INWA 4FH4A 2EFXA 3O5YA 4S2MA 4E3JA 4KQDA 4KZ8A 2K2NA 3UPPA 4CLCC 1P9RA 3QNBA 3OCNA 4MN7A 2XK1A 4Z1WA 4MNRA 1XGIA 3HLWA 3S7NA 5HDSA 1ERMA 4E3KA 4LCLA 2ZQDA 1YMXA 3IS2A 2ZL1B 3Q7VA 2RL3A 5E2HA 4ZRRA 4JXVA 5K5BA 4HEFA 1H8YA 2J80A 2BLSA 3ZG0A 4IUHA 3E4PA 3RXXA 5M18A 4WELA 1HD8A 1PW1A 4Y0OA 3B33A 3UE3A 2Y2LA 4X68A 3C5AA 4X1LA 1FQGA 1H8ZA 5L2FA 4LLOB 2W1RA 1T1CA 3BW6A 1OMEA 1G6AA 4MBHA 4D2OA 3SW1A 2ZC3B 2WKRA 4HJ4A 5CHJA 3BY9A 3O87A 4E6WA 2B02A 3C8CA 5HWWA 2Y2IA 4P6ZM 5A90A 2DNSA 3KYEA 4DDYA 4QD4A 2ZC5B 4OP5A 5IHVA 1E3UA 1L0EA 3GVBA 1L0DA 4CJNA 5HDCA 1JTDA 4G3KA 2FFYA 2WGIA 1Q2PA 1OTEA 3PTEA 3MMHA 4JF6A 4ESPA 4ID4A 1TS6A 2XSSA 4N9KA 4UA9A 4YWZA 3WRTA 2VX8A 2L1MA 3DTIA 5EVID 4QY5A 5FEGA 4II7A 2W1TA 1CK3A 3AGEA 3WS0A 3CLOA 1LSXA 3HBRA 2QMIA 3RH8B 4XUXA 3HLEA 1CQAA 1PI4A 4ARZA 2WKIA 2KDKA 2P74A 3ZG8B 4BENA 1LL9A 3NOUC 3BWLA 2PDRA 3HCYA 1ALQA 3NJAA 4GD6A 3D3OA 2Q0OA 3N8LA 1YQSA 3MXRA 3FKVA 5L09A 1IFQA 2PR5A 2A49A 3LFVA 3M2JA 4KZ5A 3BY8A 1ESUA 4S2LA 1HVBA 3ITAA 5HX9A 4C3QA 3N8SA 4DXBA 5FATA 4R4RA 3ZHHA 5DF9A 3G31A 3R4KA 4BL2A 5FEFA 3HL9A 2L0WA 4N1XA 1G6OA 1DRMA 2UV0E 4OVDA 5FI7A 4UQIM 1I2SA 1S0WA 2PHYA 4DE2A 4MDZA 2VJWA 1SDEA 2P9VA 3B42A 1WA9A 3OCLA 1G5UA 1XFNA 1RCJA 2EWWA 1YM1A 5DTKA 3A3FA 1LSWA 4LGWA 5FL3A 1D06A 4GDNA 1KGGA 4JGQA 3K3CA 2VEAA 2FFFB 3CI6A 1IKIA 2J9OA 1MY8A 1CJFA 3E98A 1GSWA 2WK0A 4PKYG 3PYPA 5FQQA 4G3VA 4HESA 4I3AA 3MJQA 5DF8A 2A3UA 2Y2KA 3MKFA 2O9BA 2OWHA 4P6BA 3IT9A 4CPKA 5HDDA 3U4LP 4HOIA 1RP5A 1M40A 3PAGA 3VOZA 3IF6B 1S67L 4Y0TA 2X01A 3EEHA 3ZYTA 5J4EA 1Q2QA 2PD7A 1YMSA 2OLVA 3LR0A 5JYPA 4LCMA 3NOTC 3SH7A 1F9IA 3VOLA 4FOFA 4U3TA 5FDHA 3BFDA 1YSQA 4OQGA 3UMEA 2HGVA 1L3LA 1FSYA 4CLCD 2G2WA 5EE8A 2OV5A 4HHDA 1KE3A 2QYBA 3P09A 4KQRA 5A91A 2P08A 3ZNTA 1ES4A 4HJ3A 4RX2A 4KZ7A 1K56D 2BTFP 4I39A 4IBXA 4OP8A 2WZXA 1I2WA 4S2NA 3P01A 3N8RA 3OPRA 1T19A 4X56A 5GLCA 4EQ1A 4Y15A 2ACGA 2PYPA 2VV7A 4DJ3A 1SKFA 3KSGA 1JWZA 3LIBA 4DF6A 3NECA 1VETB 3DTKA 5L8MA 1CEGA 1ES2A 4OQHA 4Y17A 2YKFA 2OAQ1 3CPTA 5EVIB 3T4QA 4GHIB 1IYPA 4UA6A 2ZM8A 3ZVWA 1TDGA 5F6AA 3EQUA 3UO9A 3HUOA 1MWTA 4WYYA 1KDWA 4KZ3A 4QB8A 3DAVA 3KSFA 4JF5A 1HTZA 2WGWB 1AWIA 5AQAA 3A3IA 2XFSA 2VGLS 4X6TA 3EGXC 4K0XA 1O07A 5HD3A 4KG2A 4E3LA 4GW9A 4S2PA 3T4SA 1F98A 1PRQA 4RYEA 3QP6A 3ZQ5A 1K38A 5A93A 3NCKA 4GB7A 2IA2A 1PZPA 1BYWA 2Z6DA 3UNWA 4UAAA 2EX9A 3E2KA 3LI9A 3H9WA 3T4KA 4GN2A 3QHYA 1W63Q 4YNRA 3M6BA 4QHCA 4DN0A 1IELA 4EEUA 2ZC6B 1KGFA 3HLGA 1N9OA 3GMWA 3EOIA 2ZQ9A 5A8BA 1N9LA 2Y2QA 4UHUA 2XEPA 4B88A 2PBYA 3GSGA 2PRFA 4XXRA 3E0YA 4DE3A 5EOOA 1NXYA 3R7WB 2MJ6A 2VK3A 1IYSA 1BLHA 1S1ZA 4UEYA 4Y0UA 3L7HA 4R3JA 3C38A 4EBPA 5EOEA 4GDBA 4WZ4A 4WF0A 2H10A 3S4XA 1KGEA 4HQAA 2VLGA 5FQMA 3HUMA 2V8FA 3LO7A 1NYMA 5EVLA 1OTDA 2ZMAA 4PAUA 5CRFA 5KSHA 3F1PA 3MR0A 3FV7A 5CXWA 3UE0A 3O88A 4GNUA 2G7UA 3BJNA 2IWCA 3HJKA 2V8CA 2ZC4B 1FCMA 2GZAA 2VA0A 1SKOB 3T4JA 4GS9A 4X53A 3H82B 2ZJ9A 4S2JA 1RGYA 1L0FA 2QZ6A 1LT0A 4S2OA 4I38A 1YLZA 4B4XA 4X69A 3NULA 4HP9A 1TEMA 2VKSA 5GLAA 3TG9A 4HP4A 3T4OA 4WMCA 4E3MA 4BBUA 2OLUA 2M7VA 4YINA 1PIOA 3G2YA 3DW0A 1YLPA 3KYZA 1D7EA 2XGNA 5M1AA 3SS5A 3VP4A 2PBDP 1YT4A 1YAXA 4NXEA 4OOLA 3KO6A 3UDFA 3F1NA 1SZVA 3VMAA 2HPBA 4XUZA 3HLDA 4GD8A 2HP9A 2ZC7A 1P0ZA 1CI9A 2WKHA 3CMZA 1BTLA 1LL8A 4BQMA 4HH2A 5IS1A 3GTCA 4JXWA 4JXSA 5CECA 3O86A 3LIAA 3QP8A 1VEUB 2Z2MB 3HREA 1JVJA 1E25A 2QKPA 1PWDA 3IWQA 5FDSA 2Q9NA 2XA7S 4U0XA 1BLCA 4HH3A 5AQBA 1IOUA 3ZG9B 2J8YA 4LV3A 3PBNA 2NUPC 1PW8A 4HBUA 1JWVA 1DJAA 2XR0A 1S4SA 4BWIA 4Y13A 4ZTKA 1Z6FA 4EUZA 3IXDA 4C75A 1YPRA 1JNUA 3NHQA 5HARA 3OPPA 3Q81A 4JF4A 3JPUA 3K3DA 4K08A 4S2NC 5AVEA 1P9WA 1J9MA 1YLJA 4U0TA 1NLYA 1FCOA 5FAPA 1WYBA 2ZM0A 4NEED 5FI2A 3VFFA 3BECA 5HL6A 1UWPX 3QP5A 3HLBA 3G4PA 3V3RA 3BEBA 3LY3A 1ONHA 1IEMA 2JC7A 2A24A 2V2FF 1VQQA 4KZBA 5HAPA 3W4PA 1ESIA 1V9YA 3N4IA 4LV2A 3JVUA 3EEAA 3AGFA 1S66L 4KZ4A 3VSKA 3MZEA 1XA7A 2B18A 1PNEA 4RVAA 1W63M 4Y7PA 3V50A 1VETA 2KOIA 1E3UD 3LI8A 2Z6CA 4HNBA 3TJZC 4OPYA 1WYCA 5KZHA 3FWLA 3IH9A 5EPHA 1N9NA 3A0RA 5EM0A 2W3GA 1X0OA 4KENB 4OQ0A 2J9PA 1ACFA 5GHYA 3V5MA 2OSUA 3UB8A 2Y2OA 1LLBA 4MEZA 1JTGA 2WKEA 4JXGA 3DTMA 5AQ7A 3QP4A 3C7UA 2OWJA 3V3SA 3ULFA 3LY4A 4OPZA 1EW0A 4P87A 4C6YA 3LIDA 5FQJA 4RQ9A 1T18A 5HZHA 3Q82A 3OPLA 4BLMA 3MKEA 4GOGA 2ZQAA 4Z9QA 3VE4A 2V1BA 3A0SA 2BG1A 4R1GA 5FA7A 4R4SA 3GDIA 2W27A 3V67A 4LRXC 3G35A 3GQZA 4UA7A 1FR6A 2WADA 1FCNA 1KVMA 3BFCA 2XRNA 4GCZA 4HBTA 1MZUA 5FI6A 4OLDA 3S7PA 5HAQA 2YKHA 5FSRA 3BYDA 4DKIA 4EBNA 2Y2PA 4F3LA 2ZLYA 3MSHA 2VGLM 4EV4A 4L9FA 3R7WA 1BUEA 5F69A 5M19A 3OPHA 5HL1A 1OTIA 1H3QA 3H7WA 3OOVA 2HP6A 4ME4A 5DFXA 1DJBA 1F2KA 1STZA 3ZG5A 3UDXA 4WM9A 3TW8A 3WS5A 4R6LA 1K57A 5I94A 3CWFA 1HLUP 4X55A 4IVKA 2J7VA 5BOHA 1NRJA 3BFFA 3Q07A 1XPBA 3SH8A 2R78A 5CGXA 2JKTI 2Y2NA 1T1BA 4IHQA 4FD8A 1LI9A 3G2ZA 5EUAA 4OPQA 5EM1A 1SKOA 2JKGA 3E2LA 5G4YA 3H82A 1XXMA 3IX4A 1W7FA 3F1OB 3IS2B 4YFMA 3MZDA 3IBRA 3Q7VB 3MFDA 5AQ9A 2IWDA 5FQKA 2L4RA 1FIKA 4IUKA 1MBLA 1LI0A 1XJ3A 1F5MA 3WWXA 5G4ZA 4Y5FA 4MCWA 2XD5A 3IBJA 2H28A 2Y2HA 2J3TC 3NY4A 4H6JA 5C5KA 2H0TA 1XJ2A 3G30A 1LSVA 1MKIA 1OJ5A 3NOPC 4N92A 2HJ9C 3MQQA 4NXFA 2ZM2A 4I5SA 4IBRA 1TVFA 1PWGA 1NYYA 2E8IA 3LUQA 3HJIA 4S2IA 2O9CA 1PZOA 1MWRA 4KUKA 2V20A 1K54A 1C3BA 4E3OA 3BRMA 5LBRA 1ZC2A 1A0KA 1KOUA 4OOMA 2Y4AA 2Y79A 4LRYC 4JLFA 1EROA 3D72A 2ZOHA 3UE1A 3TSGA 1K6RA 2HDQA 4NXBA 3DWZA 3PBTA 3EWKA 2ZL1A 3A0VA 2Z2LB 4O01A 3NIAA 2IWBA 4I3IA 5TBMB 1OT9A 4BD1A 1SHVA 3BQ8A 4OQIA 3T4LA 4EXOA 2G2UA 2W1TB 4Q8IA 3N7WA 1VM1A 4BMWA 3T1SA 4BD0A 4ARZB 2WKQA 5HPFA 2JKTM 1XJ4A 5EV0A 1NRFA 3UPNA 3NBLA 2W3HA 3C30A 2WGVA 1GSXA 3PBQA 5CHUA 5TJJA 1NLZA 2V0WA 4PM9A 4FUWA 4EESA 3TE8A 4L9GA 4BL3A 2JHEA 3JYIA 3T1XA 3VFHA 3PBOA 4E3NA 4R70A 4WEKA 4PM7A 2JN7A 3LYXA 4P85A 2XA7M 5HWTA 4GLQA 3IXHA 1IKGA 3ZG7B 1K4EA 3QP2A 1ODVA 3UB9A 2QWSA 1K25A 4EWFA 1GCEA 4JKTA 1G68A 2HJEA 5E43A 1Z09A 4WL9A 3MFXA 5CX7A 4L0LA 3SS3A 4QU3A 3UB7A 2Y91A 3VP1A 3QNCA 3I7JA 4EW7A 2JE5A 1QMFA 4IVIA 2PU4A 2XQZA 2X02A 2XLNA 3OZHA 5DJTA 2P9VB 3VE3A 2ZD8A 1P97A 2KLIA 4KZAA 1PI5A 4Q0IA 3IXGA 1TDLA 3ZGAB 2OAP1 2VZWA 4HI4A 4WBGA 4WN5A 3MZFA 3LCEA 1ES3A 5FQIA 3FZCA 5HAIA 3S7QA 5DTSA 5EVEA 3NDEA 3ZNYA 1SDNA 3T12B 3UMDA 2ZQ7A 1SCWA 3FKWA 1T1AA 3ISGA 2R9WA 4PPRA 1NZOA 5HWVA 5GHXA 3ITBA 2OOLA 1YLWA 1OTBA 3LEQA 5MC7A 3WS2A 1UWNX 3BLMA 4CLCB 3EQVA 3IWOA 1HZOA 5AJGA 2EX6A 2P7JA 2DCFA 1QMEA 3BQAA 5GHZA 4I3JA 4MN5A 4BJPA 3LEZA 5A92A 3U2AA 5U47A 2ZBBA 3HUNA 1W8QA 5J3WA 1IYQA 2PU2A 1K57C 4WMCD 1NWZA 4NG2A 1ZHHB 4H8RA 4DE1A 1KVLA 5F1FA 2HDSA 3ZCZA 2Q9MA 3MXSA 2D01A 3W4OA 2B5RA 1H0MA 2D02A 2XROA 1TD5A 1N4OA 1AXBA 4BBVA 3RFBA 1K4FA 5J7EA 4GKUA 4ZBEA 2FH5A 3PBRA 5KMWA 5CTMA 1K55A 3C7VA 1YSPA 1U60A 5FQ9A 3EGDC 3LR5A 3SS4A 3RXWA 4EEPA 2HDUA 3DWKA 5DF7A 4ZJ3A 2J3TD 1NZUA 3B3XA 2WKPA 2Y2GA 3M2KA 1W79A 4PM5A 3FYZA 1CI8A 2EX8A 1ZG4A 3CPTB 3RJUA 4AFIA 1FR1A 2HDRA 4GZBA 4MMNA 4EERA 2M7UA 1GA9A 1MKMA 3F1OA 4KG6A 3IF6A 1BLSA 5EFWA 4MBKA 5CGWA 3C4OA 4OH0A 2O99A 3LGOA 2EFUA 4PKYA 4QWOA 3SOIA 1GHMA 1Y4OA 1K54C 3OBFA 3GECA 4F94A 2UWXA 5JYOA 5J8XA 4KQOA 4Y3IA 1DJCA 2WYXA 4WLAA 4ZJ2A 1ONGA 5E2FA 3IXBA 2B95A 3IQAA 4E04A 2EWVA 1V9ZA 5FASA 5DKLA 2PD8A 3G6OA 3TOIA 1K6SA 1TF1A 4FSFA 4E3IA 4Y2FA 4O7DA 4X1MA 3ICYA 2QJ7A 3LIFA 2VGKA 2ZMVA 5CTNA 5E2GA 2W0NA 4RA7A 3NI9A 3C2WA 1GSVA 2PR6A 4DRTA 3ZVTA 2GNXA 4R38A 5EVIA 4GHIA 4R23A 2LB9A 5DJUA 1XJ6A 4Q0JA 5F83A 1XP4A 3NDGA 2JKRI 3UDIA 2JKFA 3SH9A 4YOFA 3GR2A 2WGWA 4NETA 2HP5A 5TBMA 2XFTA 2JBFA 2AVXA 1EI5A 4LPZA 3C4PA 1GA0A 3LR4A 1S1YA 1CF0A 1BT5A 3G32A 1NJ4A 3F1PB 2K7SA 1OT6A 4S2KA 1BZAA 2I72A 4PM8A 5KSCA 5FAQA 1IYOA 3S22A 1VB6A 2P04A 5I5LA 3BFEA 5FAOA 4EETB 2V0UA 4GS9B 4HJ6A 5HPIA 3CUEC 1FOFA 3CZDA 3IHBA 1MWSA 4Q0HA 2QJ5A 4BBTA 2VGJA 2W3FA 4JGRA 2RCXA 5GLBA 3VP0A 3PBSA 3KSIA 2WAFA 4B4ZA 1UGUA 2ZQ8A 3V39A 1MC0A 3D9YA 5L10A 3FPVA 3P98A 4K0WA 2DRWA 2V1ZA 5CERA 3K2NA 1YKDA 5F5YA 4NK3A 2V1AA 4OOYA 1ERQA 1FILA 4WZ5A 2EX2A 2XD1A 2I9VA 2HV1A 4JGOA 4EU0A 1WE4A 3F1NB 5AVFA 3W2ZA 2X71A 1DP9A 4D60A 4OLGA 2WZZA 4XT2B 3PXPA 3PR6A 2KX6A 3LIEA 1Y28A 3MQ0A 3UE6A 1XGJA 2M1CA 4DJ2A 5TR7A 4P6ZS 1MWUA 4R0QA 2HF6A 2Y55A 1G28A 3PAEA 3SZTA 2EXAA 3IHAA 4P0MA 2Y8HA 2JKRM 4B9OA 2QPNA 3A3JA 2CC1A 1OPXA 4PM6A 3S1YA 5DTTA 2C6WB 4HIAA 3QP1A 3E4OA 3Q1FA 1KDSA 1YLTA 1ZTUA 1PYYA 4N9LA 3KX0X 4JBFA 3CG5A 4CLCA 1ZG6A 3WS4A 2PYRA 3CAXA 3JVVA 5HSQA 3NC8A 5D3OA 1BLPA 1K55C 1MXOA 5L07A 3GRJA 1FSWA 1K56A 4K91A 3TRCA 4G3WA 4X25A 1NY0A 3BM6A 1XA1A 3A3EA 2C5WB 3UN7A 1GHPA 1M6KA 4KUOA 1H8MA 4PHTA 5DFYA 3KYQA 4KQQA 5DVAA 5F1GA 2Y2JA 4CQHA 1GHIA 5GL9A 3M6HA 2A24B 1VEUA 4QPRA 4DE0A 2JCHA 3T1RA 1JWPA 1BSGA 3T4TA 4LRZE 3BLSA 5KIZA 4MN6A 4RX3A 5CEBA 4NKPA 1YLYA 2WAEA 5TGFA 1PFLA 3B47A 3IF6C 3FPWA 4R3BA 3UB5P 5F68A 1XFQA 5G18A 3FC7A 4M4XA 1EWZA 1RGZA 1DP8A 4KZ6A 4N1HA 4IJGA 2VV8A 3S7OA 2GJ3A 4ZDXA 4UQIS 5CGSA 5IU1A 3KSHA 3DBAA 1N9BA 3WS1A 1S4RA 4CLCE 4LV1A 1XX2A 5TFQA 5CHMA 3L9KA 3D4FA 5GLDA 4MLLA 4FTXA 3E4QA 4EQIA 3T50A 3UB6A 5DKKA 3CITA 2XF3A 5HD5A 3GV9A 4O8GA 4LENA 3O3VA 2E8JA 1LHYA 1ZKJA 4LV0A 1DP6A 2R9XA 1H5XA 4JPMA 3ZDJA 2Y2MA 1PWCA 4EBLA 3UY6A 1BULA 3MQOA 1K0KA 4GJ4A 5EVIC 5HW3A 4FH2A 1S6RA 2Y59A 3IH8A 5F82A 3Q7ZA 2CMNA 1L0GA 2LB5A 3CUEA 5HFOA 1KE0A 1DY6A 4ZAMA 4F3LB 4LFUA 3CJMA 3IX8A 4OPRA 4QY6A 4A5RA 3IF5A 2EA9A 5IT5A 2ZMFA 4WEJA 3W4QA 3MXQA 4DXCA 1D1JA 2H5SA 2V9AA 3PHYA 1TS7A 3OC2A 2ZQCA 3OLOA 1W5DA 2H0YA 3H7WB 3VSLA 4WUJA 4L9EA 2GDNA 1ES5A 3HLCA 1OTAA 1E4DA 3T1QB 2PAVP 2NUTC 4NXGA 4DMZA 5EECA 5CEDA 3VV4A 3WRZA 2BASA 2O9AA 1TS8A 4R3AA 3LICA 2GX5A 4E6XA 2W3EA 2EXBA 3IX3A 2DMWA 4PMAA 4M3KA 3VOYA 1XKZA 3RTYA 4ZJ1A 1MPLA 2O0YA 2K31A 1O7EA 3LR3A 3AGDA 3MF0A 3VP2A 4EUVA 3MS6A 1KE4A 4IEDA 1Y54A 3IWIA 4JGPA 1VHMA 1OJGA 4OKPA 4WZ5C 3G34A 4KZ9A 1W8YA
chains in the Genus database with same CATH topology
1STZA 3EGXC 4ETZA 2ZOIA 3ICYA 5HD3A 3TW8A 3P7NA 2QJ7A 4R6LA 4GW9A 3LIFA 3CWFA 3T4SA 2W3DA 1F98A 2ZMVA 2W0NA 3ZQ5A 3FG8A 4H6JB 1NRJA 2IA2A 3C2WA 1GSVA 4ETXA 2PR6A 2GNXA 1BYWA 2R78A 2Z6DA 2JKTI 2QHKA 1T1BA 4R38A 4IHQA 4GHIA 2LB9A 5DJUA 2A2LA 1XJ6A 4Q0JA 3LI9A 3H9WA 5G4YA 3T4KA 3H82A 2VV6A 2JKRI 3F1OB 3IS2B 1W63Q 3IBRA 4YNRA 4O0PA 4YOFA 4DN0A 2L4RA 4EEUA 4IUKA 5TBMA 1N9OA 4XT2A 1TS0A 1XJ3A 2PT7A 3EOIA 2J3WA 1F5MA 2FZ0A 5A8BA 4HY8A 5G4ZA 4B93A 1N9LA 2INWA 4Y5FA 4LPZA 3O5YA 4MCWA 3IBJA 3LR4A 1S1YA 2H28A 4KQDA 2K2NA 2J3TC 4H6JA 4CLCC 1P9RA 5C5KA 3F1PB 2K7SA 1OT6A 3OCNA 4MN7A 3E0YA 1XJ2A 1LSVA 4Z1WA 3NOPC 1OJ5A 3S7NA 5HDSA 2HJ9C 3MQQA 1VB6A 2P04A 5I5LA 3R7WB 2MJ6A 4EETB 2V0UA 4NXFA 4GS9B 4I5SA 4HJ6A 3IS2A 5HPIA 1S1ZA 4UEYA 3CUEC 4ZRRA 3LUQA 5K5BA 3HJIA 4Q0HA 2J80A 2O9CA 2QJ5A 4BBTA 2W3FA 3C38A 4JGRA 4KUKA 3PBSA 3KSIA 4IUHA 3E4PA 1UGUA 4WF0A 5LBRA 4HQAA 1MC0A 2VLGA 4WELA 3FPVA 1KOUA 1OTDA 4OOMA 2Y79A 3B33A 3UE3A 4LRYC 4PAUA 3D72A 5KSHA 3F1PA 2ZOHA 3MR0A 4LLOB 2W1RA 3K2NA 1YKDA 1T1CA 3BW6A 2G7UA 5F5YA 3BJNA 3HJKA 2V1AA 4NXBA 3SW1A 2GZAA 3PBTA 2I9VA 2VA0A 2HV1A 4JGOA 2WKRA 3T4JA 3EWKA 4GS9A 4HJ4A 4EU0A 3H82B 3BY9A 3F1NB 2B02A 3C8CA 5AVFA 3W2ZA 5HWWA 3A0VA 4O01A 4P6ZM 1LT0A 4I38A 4I3IA 1DP9A 5TBMB 1OT9A 4XT2B 4HP9A 3PXPA 3BQ8A 3PR6A 2VKSA 2KX6A 4HP4A 3T4OA 3LIEA 3T4LA 4EXOA 1Y28A 3MQ0A 3UE6A 2W1TB 4BBUA 2M1CA 2M7VA 4DJ2A 5HDCA 4BMWA 4P6ZS 3KYZA 4ARZB 2WKQA 4G3KA 5HPFA 2HF6A 1D7EA 1XJ4A 2JKTM 1G28A 1OTEA 3MMHA 2W3HA 3C30A 1YAXA 1TS6A 1GSXA 2XSSA 3PBQA 5TJJA 4NXEA 1NLZA 2V0WA 4OOLA 2Y8HA 3KO6A 2JKRM 3F1NA 4EESA 4B9OA 3TE8A 4YWZA 1OPXA 4L9GA 4HIAA 1P0ZA 2JHEA 3PBOA 2VX8A 2L1MA 3E4OA 4R70A 4WEKA 2JN7A 3LYXA 1LL8A 4HH2A 1ZTUA 5IS1A 2XA7M 5HWTA 4GLQA 3KX0X 3LIAA 4CLCA 4II7A 1ODVA 2W1TA 3UB9A 2QWSA 2PYRA 1LSXA 3CLOA 3RH8B 3CAXA 3JVVA 2QKPA 5HSQA 4ARZA 2HJEA 2KDKA 4WL9A 3MFXA 3NOUC 3BWLA 5CX7A 2PDRA 3HCYA 3NJAA 2XA7S 4L0LA 3D3OA 3UB7A 3TRCA 4EW7A 4G3WA 4HH3A 1IOUA 4KUOA 5DJTA 3PBNA 1H8MA 4PHTA 2NUPC 1IFQA 2PR5A 3LFVA 5DFYA 3VE3A 3KYQA 1P97A 2KLIA 4CQHA 3BY8A 1S4SA 4Q0IA 4BWIA 2OAP1 2A24B 2VZWA 4QPRA 4HI4A 4WN5A 3T4TA 4LRZE 5DF9A 3R4KA 5KIZA 4MN6A 3S7QA 1JNUA 3NHQA 4NKPA 2L0WA 1G6OA 1DRMA 3B47A 3FPWA 3UMDA 4UQIM 3K3DA 5F68A 2PHYA 4K08A 1T1AA 5AVEA 1P9WA 1XFQA 3FC7A 4M4XA 4MDZA 1DP8A 2VJWA 1NLYA 5HWVA 3B42A 2VV8A 4IJGA 4NEED 1WA9A 3S7OA 5HL6A 2OOLA 3OCLA 1UWPX 2GJ3A 1XFNA 4UQIS 1OTBA 2EWWA 5IU1A 1LSWA 5FL3A 5MC7A 1D06A 1UWNX 2A24A 3KSHA 4CLCB 3DBAA 3EQVA 4JGQA 1S4RA 3K3CA 4CLCE 2VEAA 5AJGA 1V9YA 2P7JA 3BQAA 3CI6A 3JVUA 3EEAA 4I3JA 3E4QA 4MN5A 1S66L 3T50A 3UB6A 5DKKA 4BJPA 3CITA 3E98A 3U2AA 1GSWA 2B18A 5HD5A 2ZBBA 1W63M 4PKYG 3PYPA 4O8GA 4G3VA 5J3WA 4I3AA 1NWZA 2KOIA 3MJQA 3LI8A 1DP6A 1ZHHB 2Z6CA 4HNBA 3TJZC 2D01A 1N9NA 3A0RA 2W3GA 2OWHA 2O9BA 2D02A 3MQOA 1X0OA 2XROA 1TD5A 4GJ4A 5HDDA 3UB8A 4BBVA 3RFBA 4HOIA 5J7EA 2FH5A 3PBRA 1S67L 1YSPA 3EEHA 3ZYTA 5J4EA 2PD7A 3EGDC 3LR5A 3LR0A 2OWJA 2CMNA 3NOTC 1F9IA 3VOLA 4FOFA 4EEPA 3ULFA 1YSQA 2LB5A 3CUEA 3UMEA 1EW0A 2HGVA 3LIDA 2J3TD 4RQ9A 4CLCD 2WKPA 1T18A 5HZHA 4F3LB 4HHDA 2EA9A 2QYBA 5IT5A 2ZMFA 4AFIA 4WEJA 3MXQA 2P08A 4MMNA 4EERA 4HJ3A 3VE4A 2V9AA 2M7UA 3PHYA 2V1BA 1MKMA 1TS7A 3A0SA 3F1OA 3OC2A 4I39A 3OLOA 3GDIA 2W27A 3H7WB 4WUJA 4L9EA 3V67A 4LRXC 1OTAA 5EFWA 3P01A 1T19A 2O99A 4EQ1A 2NUTC 4NXGA 2XRNA 4GCZA 4DMZA 2PYPA 3VV4A 4PKYA 2VV7A 2BASA 1MZUA 2O9AA 4DJ3A 3S7PA 3KSGA 3LIBA 2YKHA 3OBFA 1TS8A 4R3AA 3LICA 2GX5A 3GECA 2W3EA 2DMWA 5L8MA 4F3LA 2YKFA 3RTYA 2OAQ1 2O0YA 4KQOA 4Y3IA 2K31A 2VGLM 3LR3A 4L9FA 3MF0A 4WLAA 3T4QA 4GHIB 4EUVA 5F6AA 3EQUA 4E04A 4JGPA 3R7WA 1VHMA 2EWVA 1V9ZA 1OJGA 5F69A 5DKLA 1OTIA 3KSFA 1H3QA 2PD8A 3G6OA 3H7WA 3OOVA 4ME4A 5DFXA 1TF1A 4FSFA 2VGLS 4Y2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TD5 A;  1STZ A;  4ETZ A;  2W1R A;  3K2N A;  3RFB A;  1YKD A;  4R6L A;  2G7U A;  3BJN A;  4GW9 A;  3LFV A;  5DFY A;  2W3D A;  2KLI A;  4CQH A;  4Q0I A;  1YSP A;  3ZQ5 A;  4EU0 A;  4BWI A;  2IA2 A;  3C2W A;  4ETX A;  3NOT C;  2VZW A;  4QPR A;  3W2Z A;  4FOF A;  4LRZ E;  3R4K A;  4O01 A;  1YSQ A;  2LB5 A;  2LB9 A;  3S7Q A;  2HGV A;  3NHQ A;  4Q0J A;  4RQ9 A;  2VKS A;  3IBR A;  3MQ0 A;  4O0P A;  4YNR A;  4YOF A;  2QYB A;  2W1T B;  2ZMF A;  4DN0 A;  2M7V A;  4IUK A;  4MMN A;  4MDZ A;  2VJW A;  4G3K A;  5HPF A;  1F5M A;  2M7U A;  4IJG A;  1MKM A;  4Y5F A;  3MMH A;  3S7O A;  5HL6 A;  3O5Y A;  2OOL A;  4MCW A;  2W3H A;  3IBJ A;  2XSS A;  5TJJ A;  2K2N A;  4LRX C;  2Y8H A;  3KO6 A;  5C5K A;  2O99 A;  3KSH A;  4MN7 A;  3E0Y A;  4Z1W A;  3DBA A;  2XRN A;  3NOP C;  4DMZ A;  3VV4 A;  2O9A A;  3S7P A;  3S7N A;  3KSG A;  3OBF A;  4R70 A;  2GX5 A;  2VEA A;  5AJG A;  2W3E A;  3CI6 A;  5I5L A;  1ZTU A;  3EEA A;  5L8M A;  4GLQ A;  3CIT A;  5HPI A;  2O0Y A;  3E98 A;  4Y3I A;  2K31 A;  2B18 A;  2W1T A;  4ZRR A;  5K5B A;  3MF0 A;  4EUV A;  4O8G A;  4Q0H A;  4G3V A;  2O9C A;  2W3F A;  5HSQ A;  4E04 A;  3KSI A;  1VHM A;  4IUH A;  2KOI A;  5LBR A;  3NOU C;  3KSF A;  1MC0 A;  3G6O A;  3HCY A;  3D3O A;  3OOV A;  4ME4 A;  3TRC A;  5DFX A;  2Y79 A;  1TF1 A;  4G3W A;  2W3G A;  4LRY C;  4PAU A;  2O9B A;  4Y2F A;  2XRO A; 
#chains in the Genus database with same CATH topology
 4ETZ A;  2ZOI A;  1I5Q A;  3HLF A;  3P7N A;  3ZFZ A;  3A3D A;  4DDS A;  2W3D A;  3BFG A;  4KG5 A;  2WUQ A;  3FG8 A;  4H6J B;  4ETX A;  1CEF A;  2QHK A;  3MBZ A;  3HVF A;  3DTE A;  2HZ5 A;  2A2L A;  3CHW P;  2VV6 A;  5E2E A;  4QJG A;  1J3W A;  4FCF A;  3W8K A;  4O0P A;  2XH9 A;  1L2S A;  3UPO A;  3VP3 A;  4OON A;  4XT2 A;  1TS0 A;  2PT7 A;  2J3W A;  4MBF A;  2XDM A;  3N6I A;  2FZ0 A;  4HY8 A;  4B93 A;  1LL5 A;  2INW A;  4FH4 A;  2EFX A;  3O5Y A;  4S2M A;  4E3J A;  4KQD A;  4KZ8 A;  2K2N A;  3UPP A;  4CLC C;  1P9R A;  3QNB A;  3OCN A;  4MN7 A;  2XK1 A;  4Z1W A;  4MNR A;  1XGI A;  3HLW A;  3S7N A;  5HDS A;  1ERM A;  4E3K A;  4LCL A;  2ZQD A;  1YMX A;  3IS2 A;  2ZL1 B;  3Q7V A;  2RL3 A;  5E2H A;  4ZRR A;  4JXV A;  5K5B A;  4HEF A;  1H8Y A;  2J80 A;  2BLS A;  3ZG0 A;  4IUH A;  3E4P A;  3RXX A;  5M18 A;  4WEL A;  1HD8 A;  1PW1 A;  4Y0O A;  3B33 A;  3UE3 A;  2Y2L A;  4X68 A;  3C5A A;  4X1L A;  1FQG A;  1H8Z A;  5L2F A;  4LLO B;  2W1R A;  1T1C A;  3BW6 A;  1OME A;  1G6A A;  4MBH A;  4D2O A;  3SW1 A;  2ZC3 B;  2WKR A;  4HJ4 A;  5CHJ A;  3BY9 A;  3O87 A;  4E6W A;  2B02 A;  3C8C A;  5HWW A;  2Y2I A;  4P6Z M;  5A90 A;  2DNS A;  3KYE A;  4DDY A;  4QD4 A;  2ZC5 B;  4OP5 A;  5IHV A;  1E3U A;  1L0E A;  3GVB A;  1L0D A;  4CJN A;  5HDC A;  1JTD A;  4G3K A;  2FFY A;  2WGI A;  1Q2P A;  1OTE A;  3PTE A;  3MMH A;  4JF6 A;  4ESP A;  4ID4 A;  1TS6 A;  2XSS A;  4N9K A;  4UA9 A;  4YWZ A;  3WRT A;  2VX8 A;  2L1M A;  3DTI A;  5EVI D;  4QY5 A;  5FEG A;  4II7 A;  2W1T A;  1CK3 A;  3AGE A;  3WS0 A;  3CLO A;  1LSX A;  3HBR A;  2QMI A;  3RH8 B;  4XUX A;  3HLE A;  1CQA A;  1PI4 A;  4ARZ A;  2WKI A;  2KDK A;  2P74 A;  3ZG8 B;  4BEN A;  1LL9 A;  3NOU C;  3BWL A;  2PDR A;  3HCY A;  1ALQ A;  3NJA A;  4GD6 A;  3D3O A;  2Q0O A;  3N8L A;  1YQS A;  3MXR A;  3FKV A;  5L09 A;  1IFQ A;  2PR5 A;  2A49 A;  3LFV A;  3M2J A;  4KZ5 A;  3BY8 A;  1ESU A;  4S2L A;  1HVB A;  3ITA A;  5HX9 A;  4C3Q A;  3N8S A;  4DXB A;  5FAT A;  4R4R A;  3ZHH A;  5DF9 A;  3G31 A;  3R4K A;  4BL2 A;  5FEF A;  3HL9 A;  2L0W A;  4N1X A;  1G6O A;  1DRM A;  2UV0 E;  4OVD A;  5FI7 A;  4UQI M;  1I2S A;  1S0W A;  2PHY A;  4DE2 A;  4MDZ A;  2VJW A;  1SDE A;  2P9V A;  3B42 A;  1WA9 A;  3OCL A;  1G5U A;  1XFN A;  1RCJ A;  2EWW A;  1YM1 A;  5DTK A;  3A3F A;  1LSW A;  4LGW A;  5FL3 A;  1D06 A;  4GDN A;  1KGG A;  4JGQ A;  3K3C A;  2VEA A;  2FFF B;  3CI6 A;  1IKI A;  2J9O A;  1MY8 A;  1CJF A;  3E98 A;  1GSW A;  2WK0 A;  4PKY G;  3PYP A;  5FQQ A;  4G3V A;  4HES A;  4I3A A;  3MJQ A;  5DF8 A;  2A3U A;  2Y2K A;  3MKF A;  2O9B A;  2OWH A;  4P6B A;  3IT9 A;  4CPK A;  5HDD A;  3U4L P;  4HOI A;  1RP5 A;  1M40 A;  3PAG A;  3VOZ A;  3IF6 B;  1S67 L;  4Y0T A;  2X01 A;  3EEH A;  3ZYT A;  5J4E A;  1Q2Q A;  2PD7 A;  1YMS A;  2OLV A;  3LR0 A;  5JYP A;  4LCM A;  3NOT C;  3SH7 A;  1F9I A;  3VOL A;  4FOF A;  4U3T A;  5FDH A;  3BFD A;  1YSQ A;  4OQG A;  3UME A;  2HGV A;  1L3L A;  1FSY A;  4CLC D;  2G2W A;  5EE8 A;  2OV5 A;  4HHD A;  1KE3 A;  2QYB A;  3P09 A;  4KQR A;  5A91 A;  2P08 A;  3ZNT A;  1ES4 A;  4HJ3 A;  4RX2 A;  4KZ7 A;  1K56 D;  2BTF P;  4I39 A;  4IBX A;  4OP8 A;  2WZX A;  1I2W A;  4S2N A;  3P01 A;  3N8R A;  3OPR A;  1T19 A;  4X56 A;  5GLC A;  4EQ1 A;  4Y15 A;  2ACG A;  2PYP A;  2VV7 A;  4DJ3 A;  1SKF A;  3KSG A;  1JWZ A;  3LIB A;  4DF6 A;  3NEC A;  1VET B;  3DTK A;  5L8M A;  1CEG A;  1ES2 A;  4OQH A;  4Y17 A;  2YKF A;  2OAQ 1;  3CPT A;  5EVI B;  3T4Q A;  4GHI B;  1IYP A;  4UA6 A;  2ZM8 A;  3ZVW A;  1TDG A;  5F6A A;  3EQU A;  3UO9 A;  3HUO A;  1MWT A;  4WYY A;  1KDW A;  4KZ3 A;  4QB8 A;  3DAV A;  3KSF A;  4JF5 A;  1HTZ A;  2WGW B;  1AWI A;  5AQA A;  3A3I A;  2XFS A;  2VGL S;  4X6T A;  3EGX C;  4K0X A;  1O07 A;  5HD3 A;  4KG2 A;  4E3L A;  4GW9 A;  4S2P A;  3T4S A;  1F98 A;  1PRQ A;  4RYE A;  3QP6 A;  3ZQ5 A;  1K38 A;  5A93 A;  3NCK A;  4GB7 A;  2IA2 A;  1PZP A;  1BYW A;  2Z6D A;  3UNW A;  4UAA A;  2EX9 A;  3E2K A;  3LI9 A;  3H9W A;  3T4K A;  4GN2 A;  3QHY A;  1W63 Q;  4YNR A;  3M6B A;  4QHC A;  4DN0 A;  1IEL A;  4EEU A;  2ZC6 B;  1KGF A;  3HLG A;  1N9O A;  3GMW A;  3EOI A;  2ZQ9 A;  5A8B A;  1N9L A;  2Y2Q A;  4UHU A;  2XEP A;  4B88 A;  2PBY A;  3GSG A;  2PRF A;  4XXR A;  3E0Y A;  4DE3 A;  5EOO A;  1NXY A;  3R7W B;  2MJ6 A;  2VK3 A;  1IYS A;  1BLH A;  1S1Z A;  4UEY A;  4Y0U A;  3L7H A;  4R3J A;  3C38 A;  4EBP A;  5EOE A;  4GDB A;  4WZ4 A;  4WF0 A;  2H10 A;  3S4X A;  1KGE A;  4HQA A;  2VLG A;  5FQM A;  3HUM A;  2V8F A;  3LO7 A;  1NYM A;  5EVL A;  1OTD A;  2ZMA A;  4PAU A;  5CRF A;  5KSH A;  3F1P A;  3MR0 A;  3FV7 A;  5CXW A;  3UE0 A;  3O88 A;  4GNU A;  2G7U A;  3BJN A;  2IWC A;  3HJK A;  2V8C A;  2ZC4 B;  1FCM A;  2GZA A;  2VA0 A;  1SKO B;  3T4J A;  4GS9 A;  4X53 A;  3H82 B;  2ZJ9 A;  4S2J A;  1RGY A;  1L0F A;  2QZ6 A;  1LT0 A;  4S2O A;  4I38 A;  1YLZ A;  4B4X A;  4X69 A;  3NUL A;  4HP9 A;  1TEM A;  2VKS A;  5GLA A;  3TG9 A;  4HP4 A;  3T4O A;  4WMC A;  4E3M A;  4BBU A;  2OLU A;  2M7V A;  4YIN A;  1PIO A;  3G2Y A;  3DW0 A;  1YLP A;  3KYZ A;  1D7E A;  2XGN A;  5M1A A;  3SS5 A;  3VP4 A;  2PBD P;  1YT4 A;  1YAX A;  4NXE A;  4OOL A;  3KO6 A;  3UDF A;  3F1N A;  1SZV A;  3VMA A;  2HPB A;  4XUZ A;  3HLD A;  4GD8 A;  2HP9 A;  2ZC7 A;  1P0Z A;  1CI9 A;  2WKH A;  3CMZ A;  1BTL A;  1LL8 A;  4BQM A;  4HH2 A;  5IS1 A;  3GTC A;  4JXW A;  4JXS A;  5CEC A;  3O86 A;  3LIA A;  3QP8 A;  1VEU B;  2Z2M B;  3HRE A;  1JVJ A;  1E25 A;  2QKP A;  1PWD A;  3IWQ A;  5FDS A;  2Q9N A;  2XA7 S;  4U0X A;  1BLC A;  4HH3 A;  5AQB A;  1IOU A;  3ZG9 B;  2J8Y A;  4LV3 A;  3PBN A;  2NUP C;  1PW8 A;  4HBU A;  1JWV A;  1DJA A;  2XR0 A;  1S4S A;  4BWI A;  4Y13 A;  4ZTK A;  1Z6F A;  4EUZ A;  3IXD A;  4C75 A;  1YPR A;  1JNU A;  3NHQ A;  5HAR A;  3OPP A;  3Q81 A;  4JF4 A;  3JPU A;  3K3D A;  4K08 A;  4S2N C;  5AVE A;  1P9W A;  1J9M A;  1YLJ A;  4U0T A;  1NLY A;  1FCO A;  5FAP A;  1WYB A;  2ZM0 A;  4NEE D;  5FI2 A;  3VFF A;  3BEC A;  5HL6 A;  1UWP X;  3QP5 A;  3HLB A;  3G4P A;  3V3R A;  3BEB A;  3LY3 A;  1ONH A;  1IEM A;  2JC7 A;  2A24 A;  2V2F F;  1VQQ A;  4KZB A;  5HAP A;  3W4P A;  1ESI A;  1V9Y A;  3N4I A;  4LV2 A;  3JVU A;  3EEA A;  3AGF A;  1S66 L;  4KZ4 A;  3VSK A;  3MZE A;  1XA7 A;  2B18 A;  1PNE A;  4RVA A;  1W63 M;  4Y7P A;  3V50 A;  1VET A;  2KOI A;  1E3U D;  3LI8 A;  2Z6C A;  4HNB A;  3TJZ C;  4OPY A;  1WYC A;  5KZH A;  3FWL A;  3IH9 A;  5EPH A;  1N9N A;  3A0R A;  5EM0 A;  2W3G A;  1X0O A;  4KEN B;  4OQ0 A;  2J9P A;  1ACF A;  5GHY A;  3V5M A;  2OSU A;  3UB8 A;  2Y2O A;  1LLB A;  4MEZ A;  1JTG A;  2WKE A;  4JXG A;  3DTM A;  5AQ7 A;  3QP4 A;  3C7U A;  2OWJ A;  3V3S A;  3ULF A;  3LY4 A;  4OPZ A;  1EW0 A;  4P87 A;  4C6Y A;  3LID A;  5FQJ A;  4RQ9 A;  1T18 A;  5HZH A;  3Q82 A;  3OPL A;  4BLM A;  3MKE A;  4GOG A;  2ZQA A;  4Z9Q A;  3VE4 A;  2V1B A;  3A0S A;  2BG1 A;  4R1G A;  5FA7 A;  4R4S A;  3GDI A;  2W27 A;  3V67 A;  4LRX C;  3G35 A;  3GQZ A;  4UA7 A;  1FR6 A;  2WAD A;  1FCN A;  1KVM A;  3BFC A;  2XRN A;  4GCZ A;  4HBT A;  1MZU A;  5FI6 A;  4OLD A;  3S7P A;  5HAQ A;  2YKH A;  5FSR A;  3BYD A;  4DKI A;  4EBN A;  2Y2P A;  4F3L A;  2ZLY A;  3MSH A;  2VGL M;  4EV4 A;  4L9F A;  3R7W A;  1BUE A;  5F69 A;  5M19 A;  3OPH A;  5HL1 A;  1OTI A;  1H3Q A;  3H7W A;  3OOV A;  2HP6 A;  4ME4 A;  5DFX A;  1DJB A;  1F2K A;  1STZ A;  3ZG5 A;  3UDX A;  4WM9 A;  3TW8 A;  3WS5 A;  4R6L A;  1K57 A;  5I94 A;  3CWF A;  1HLU P;  4X55 A;  4IVK A;  2J7V A;  5BOH A;  1NRJ A;  3BFF A;  3Q07 A;  1XPB A;  3SH8 A;  2R78 A;  5CGX A;  2JKT I;  2Y2N A;  1T1B A;  4IHQ A;  4FD8 A;  1LI9 A;  3G2Z A;  5EUA A;  4OPQ A;  5EM1 A;  1SKO A;  2JKG A;  3E2L A;  5G4Y A;  3H82 A;  1XXM A;  3IX4 A;  1W7F A;  3F1O B;  3IS2 B;  4YFM A;  3MZD A;  3IBR A;  3Q7V B;  3MFD A;  5AQ9 A;  2IWD A;  5FQK A;  2L4R A;  1FIK A;  4IUK A;  1MBL A;  1LI0 A;  1XJ3 A;  1F5M A;  3WWX A;  5G4Z A;  4Y5F A;  4MCW A;  2XD5 A;  3IBJ A;  2H28 A;  2Y2H A;  2J3T C;  3NY4 A;  4H6J A;  5C5K A;  2H0T A;  1XJ2 A;  3G30 A;  1LSV A;  1MKI A;  1OJ5 A;  3NOP C;  4N92 A;  2HJ9 C;  3MQQ A;  4NXF A;  2ZM2 A;  4I5S A;  4IBR A;  1TVF A;  1PWG A;  1NYY A;  2E8I A;  3LUQ A;  3HJI A;  4S2I A;  2O9C A;  1PZO A;  1MWR A;  4KUK A;  2V20 A;  1K54 A;  1C3B A;  4E3O A;  3BRM A;  5LBR A;  1ZC2 A;  1A0K A;  1KOU A;  4OOM A;  2Y4A A;  2Y79 A;  4LRY C;  4JLF A;  1ERO A;  3D72 A;  2ZOH A;  3UE1 A;  3TSG A;  1K6R A;  2HDQ A;  4NXB A;  3DWZ A;  3PBT A;  3EWK A;  2ZL1 A;  3A0V A;  2Z2L B;  4O01 A;  3NIA A;  2IWB A;  4I3I A;  5TBM B;  1OT9 A;  4BD1 A;  1SHV A;  3BQ8 A;  4OQI A;  3T4L A;  4EXO A;  2G2U A;  2W1T B;  4Q8I A;  3N7W A;  1VM1 A;  4BMW A;  3T1S A;  4BD0 A;  4ARZ B;  2WKQ A;  5HPF A;  2JKT M;  1XJ4 A;  5EV0 A;  1NRF A;  3UPN A;  3NBL A;  2W3H A;  3C30 A;  2WGV A;  1GSX A;  3PBQ A;  5CHU A;  5TJJ A;  1NLZ A;  2V0W A;  4PM9 A;  4FUW A;  4EES A;  3TE8 A;  4L9G A;  4BL3 A;  2JHE A;  3JYI A;  3T1X A;  3VFH A;  3PBO A;  4E3N A;  4R70 A;  4WEK A;  4PM7 A;  2JN7 A;  3LYX A;  4P85 A;  2XA7 M;  5HWT A;  4GLQ A;  3IXH A;  1IKG A;  3ZG7 B;  1K4E A;  3QP2 A;  1ODV A;  3UB9 A;  2QWS A;  1K25 A;  4EWF A;  1GCE A;  4JKT A;  1G68 A;  2HJE A;  5E43 A;  1Z09 A;  4WL9 A;  3MFX A;  5CX7 A;  4L0L A;  3SS3 A;  4QU3 A;  3UB7 A;  2Y91 A;  3VP1 A;  3QNC A;  3I7J A;  4EW7 A;  2JE5 A;  1QMF A;  4IVI A;  2PU4 A;  2XQZ A;  2X02 A;  2XLN A;  3OZH A;  5DJT A;  2P9V B;  3VE3 A;  2ZD8 A;  1P97 A;  2KLI A;  4KZA A;  1PI5 A;  4Q0I A;  3IXG A;  1TDL A;  3ZGA B;  2OAP 1;  2VZW A;  4HI4 A;  4WBG A;  4WN5 A;  3MZF A;  3LCE A;  1ES3 A;  5FQI A;  3FZC A;  5HAI A;  3S7Q A;  5DTS A;  5EVE A;  3NDE A;  3ZNY A;  1SDN A;  3T12 B;  3UMD A;  2ZQ7 A;  1SCW A;  3FKW A;  1T1A A;  3ISG A;  2R9W A;  4PPR A;  1NZO A;  5HWV A;  5GHX A;  3ITB A;  2OOL A;  1YLW A;  1OTB A;  3LEQ A;  5MC7 A;  3WS2 A;  1UWN X;  3BLM A;  4CLC B;  3EQV A;  3IWO A;  1HZO A;  5AJG A;  2EX6 A;  2P7J A;  2DCF A;  1QME A;  3BQA A;  5GHZ A;  4I3J A;  4MN5 A;  4BJP A;  3LEZ A;  5A92 A;  3U2A A;  5U47 A;  2ZBB A;  3HUN A;  1W8Q A;  5J3W A;  1IYQ A;  2PU2 A;  1K57 C;  4WMC D;  1NWZ A;  4NG2 A;  1ZHH B;  4H8R A;  4DE1 A;  1KVL A;  5F1F A;  2HDS A;  3ZCZ A;  2Q9M A;  3MXS A;  2D01 A;  3W4O A;  2B5R A;  1H0M A;  2D02 A;  2XRO A;  1TD5 A;  1N4O A;  1AXB A;  4BBV A;  3RFB A;  1K4F A;  5J7E A;  4GKU A;  4ZBE A;  2FH5 A;  3PBR A;  5KMW A;  5CTM A;  1K55 A;  3C7V A;  1YSP A;  1U60 A;  5FQ9 A;  3EGD C;  3LR5 A;  3SS4 A;  3RXW A;  4EEP A;  2HDU A;  3DWK A;  5DF7 A;  4ZJ3 A;  2J3T D;  1NZU A;  3B3X A;  2WKP A;  2Y2G A;  3M2K A;  1W79 A;  4PM5 A;  3FYZ A;  1CI8 A;  2EX8 A;  1ZG4 A;  3CPT B;  3RJU A;  4AFI A;  1FR1 A;  2HDR A;  4GZB A;  4MMN A;  4EER A;  2M7U A;  1GA9 A;  1MKM A;  3F1O A;  4KG6 A;  3IF6 A;  1BLS A;  5EFW A;  4MBK A;  5CGW A;  3C4O A;  4OH0 A;  2O99 A;  3LGO A;  2EFU A;  4PKY A;  4QWO A;  3SOI A;  1GHM A;  1Y4O A;  1K54 C;  3OBF A;  3GEC A;  4F94 A;  2UWX A;  5JYO A;  5J8X A;  4KQO A;  4Y3I A;  1DJC A;  2WYX A;  4WLA A;  4ZJ2 A;  1ONG A;  5E2F A;  3IXB A;  2B95 A;  3IQA A;  4E04 A;  2EWV A;  1V9Z A;  5FAS A;  5DKL A;  2PD8 A;  3G6O A;  3TOI A;  1K6S A;  1TF1 A;  4FSF A;  4E3I A;  4Y2F A;  4O7D A;  4X1M A;  3ICY A;  2QJ7 A;  3LIF A;  2VGK A;  2ZMV A;  5CTN A;  5E2G A;  2W0N A;  4RA7 A;  3NI9 A;  3C2W A;  1GSV A;  2PR6 A;  4DRT A;  3ZVT A;  2GNX A;  4R38 A;  5EVI A;  4GHI A;  4R23 A;  2LB9 A;  5DJU A;  1XJ6 A;  4Q0J A;  5F83 A;  1XP4 A;  3NDG A;  2JKR I;  3UDI A;  2JKF A;  3SH9 A;  4YOF A;  3GR2 A;  2WGW A;  4NET A;  2HP5 A;  5TBM A;  2XFT A;  2JBF A;  2AVX A;  1EI5 A;  4LPZ A;  3C4P A;  1GA0 A;  3LR4 A;  1S1Y A;  1CF0 A;  1BT5 A;  3G32 A;  1NJ4 A;  3F1P B;  2K7S A;  1OT6 A;  4S2K A;  1BZA A;  2I72 A;  4PM8 A;  5KSC A;  5FAQ A;  1IYO A;  3S22 A;  1VB6 A;  2P04 A;  5I5L A;  3BFE A;  5FAO A;  4EET B;  2V0U A;  4GS9 B;  4HJ6 A;  5HPI A;  3CUE C;  1FOF A;  3CZD A;  3IHB A;  1MWS A;  4Q0H A;  2QJ5 A;  4BBT A;  2VGJ A;  2W3F A;  4JGR A;  2RCX A;  5GLB A;  3VP0 A;  3PBS A;  3KSI A;  2WAF A;  4B4Z A;  1UGU A;  2ZQ8 A;  3V39 A;  1MC0 A;  3D9Y A;  5L10 A;  3FPV A;  3P98 A;  4K0W A;  2DRW A;  2V1Z A;  5CER A;  3K2N A;  1YKD A;  5F5Y A;  4NK3 A;  2V1A A;  4OOY A;  1ERQ A;  1FIL A;  4WZ5 A;  2EX2 A;  2XD1 A;  2I9V A;  2HV1 A;  4JGO A;  4EU0 A;  1WE4 A;  3F1N B;  5AVF A;  3W2Z A;  2X71 A;  1DP9 A;  4D60 A;  4OLG A;  2WZZ A;  4XT2 B;  3PXP A;  3PR6 A;  2KX6 A;  3LIE A;  1Y28 A;  3MQ0 A;  3UE6 A;  1XGJ A;  2M1C A;  4DJ2 A;  5TR7 A;  4P6Z S;  1MWU A;  4R0Q A;  2HF6 A;  2Y55 A;  1G28 A;  3PAE A;  3SZT A;  2EXA A;  3IHA A;  4P0M A;  2Y8H A;  2JKR M;  4B9O A;  2QPN A;  3A3J A;  2CC1 A;  1OPX A;  4PM6 A;  3S1Y A;  5DTT A;  2C6W B;  4HIA A;  3QP1 A;  3E4O A;  3Q1F A;  1KDS A;  1YLT A;  1ZTU A;  1PYY A;  4N9L A;  3KX0 X;  4JBF A;  3CG5 A;  4CLC A;  1ZG6 A;  3WS4 A;  2PYR A;  3CAX A;  3JVV A;  5HSQ A;  3NC8 A;  5D3O A;  1BLP A;  1K55 C;  1MXO A;  5L07 A;  3GRJ A;  1FSW A;  1K56 A;  4K91 A;  3TRC A;  4G3W A;  4X25 A;  1NY0 A;  3BM6 A;  1XA1 A;  3A3E A;  2C5W B;  3UN7 A;  1GHP A;  1M6K A;  4KUO A;  1H8M A;  4PHT A;  5DFY A;  3KYQ A;  4KQQ A;  5DVA A;  5F1G A;  2Y2J A;  4CQH A;  1GHI A;  5GL9 A;  3M6H A;  2A24 B;  1VEU A;  4QPR A;  4DE0 A;  2JCH A;  3T1R A;  1JWP A;  1BSG A;  3T4T A;  4LRZ E;  3BLS A;  5KIZ A;  4MN6 A;  4RX3 A;  5CEB A;  4NKP A;  1YLY A;  2WAE A;  5TGF A;  1PFL A;  3B47 A;  3IF6 C;  3FPW A;  4R3B A;  3UB5 P;  5F68 A;  1XFQ A;  5G18 A;  3FC7 A;  4M4X A;  1EWZ A;  1RGZ A;  1DP8 A;  4KZ6 A;  4N1H A;  4IJG A;  2VV8 A;  3S7O A;  2GJ3 A;  4ZDX A;  4UQI S;  5CGS A;  5IU1 A;  3KSH A;  3DBA A;  1N9B A;  3WS1 A;  1S4R A;  4CLC E;  4LV1 A;  1XX2 A;  5TFQ A;  5CHM A;  3L9K A;  3D4F A;  5GLD A;  4MLL A;  4FTX A;  3E4Q A;  4EQI A;  3T50 A;  3UB6 A;  5DKK A;  3CIT A;  2XF3 A;  5HD5 A;  3GV9 A;  4O8G A;  4LEN A;  3O3V A;  2E8J A;  1LHY A;  1ZKJ A;  4LV0 A;  1DP6 A;  2R9X A;  1H5X A;  4JPM A;  3ZDJ A;  2Y2M A;  1PWC A;  4EBL A;  3UY6 A;  1BUL A;  3MQO A;  1K0K A;  4GJ4 A;  5EVI C;  5HW3 A;  4FH2 A;  1S6R A;  2Y59 A;  3IH8 A;  5F82 A;  3Q7Z A;  2CMN A;  1L0G A;  2LB5 A;  3CUE A;  5HFO A;  1KE0 A;  1DY6 A;  4ZAM A;  4F3L B;  4LFU A;  3CJM A;  3IX8 A;  4OPR A;  4QY6 A;  4A5R A;  3IF5 A;  2EA9 A;  5IT5 A;  2ZMF A;  4WEJ A;  3W4Q A;  3MXQ A;  4DXC A;  1D1J A;  2H5S A;  2V9A A;  3PHY A;  1TS7 A;  3OC2 A;  2ZQC A;  3OLO A;  1W5D A;  2H0Y A;  3H7W B;  3VSL A;  4WUJ A;  4L9E A;  2GDN A;  1ES5 A;  3HLC A;  1OTA A;  1E4D A;  3T1Q B;  2PAV P;  2NUT C;  4NXG A;  4DMZ A;  5EEC A;  5CED A;  3VV4 A;  3WRZ A;  2BAS A;  2O9A A;  1TS8 A;  4R3A A;  3LIC A;  2GX5 A;  4E6X A;  2W3E A;  2EXB A;  3IX3 A;  2DMW A;  4PMA A;  4M3K A;  3VOY A;  1XKZ A;  3RTY A;  4ZJ1 A;  1MPL A;  2O0Y A;  2K31 A;  1O7E A;  3LR3 A;  3AGD A;  3MF0 A;  3VP2 A;  4EUV A;  3MS6 A;  1KE4 A;  4IED A;  1Y54 A;  3IWI A;  4JGP A;  1VHM A;  1OJG A;  4OKP A;  4WZ5 C;  3G34 A;  4KZ9 A;  1W8Y A; 
#chains in the Genus database with same CATH homology
 1STZ A;  3EGX C;  4ETZ A;  2ZOI A;  3ICY A;  5HD3 A;  3TW8 A;  3P7N A;  2QJ7 A;  4R6L A;  4GW9 A;  3LIF A;  3CWF A;  3T4S A;  2W3D A;  1F98 A;  2ZMV A;  2W0N A;  3ZQ5 A;  3FG8 A;  4H6J B;  1NRJ A;  2IA2 A;  3C2W A;  1GSV A;  4ETX A;  2PR6 A;  2GNX A;  1BYW A;  2R78 A;  2Z6D A;  2JKT I;  2QHK A;  1T1B A;  4R38 A;  4IHQ A;  4GHI A;  2LB9 A;  5DJU A;  2A2L A;  1XJ6 A;  4Q0J A;  3LI9 A;  3H9W A;  5G4Y A;  3T4K A;  3H82 A;  2VV6 A;  2JKR I;  3F1O B;  3IS2 B;  1W63 Q;  3IBR A;  4YNR A;  4O0P A;  4YOF A;  4DN0 A;  2L4R A;  4EEU A;  4IUK A;  5TBM A;  1N9O A;  4XT2 A;  1TS0 A;  1XJ3 A;  2PT7 A;  3EOI A;  2J3W A;  1F5M A;  2FZ0 A;  5A8B A;  4HY8 A;  5G4Z A;  4B93 A;  1N9L A;  2INW A;  4Y5F A;  4LPZ A;  3O5Y A;  4MCW A;  3IBJ A;  3LR4 A;  1S1Y A;  2H28 A;  4KQD A;  2K2N A;  2J3T C;  4H6J A;  4CLC C;  1P9R A;  5C5K A;  3F1P B;  2K7S A;  1OT6 A;  3OCN A;  4MN7 A;  3E0Y A;  1XJ2 A;  1LSV A;  4Z1W A;  3NOP C;  1OJ5 A;  3S7N A;  5HDS A;  2HJ9 C;  3MQQ A;  1VB6 A;  2P04 A;  5I5L A;  3R7W B;  2MJ6 A;  4EET B;  2V0U A;  4NXF A;  4GS9 B;  4I5S A;  4HJ6 A;  3IS2 A;  5HPI A;  1S1Z A;  4UEY A;  3CUE C;  4ZRR A;  3LUQ A;  5K5B A;  3HJI A;  4Q0H A;  2J80 A;  2O9C A;  2QJ5 A;  4BBT A;  2W3F A;  3C38 A;  4JGR A;  4KUK A;  3PBS A;  3KSI A;  4IUH A;  3E4P A;  1UGU A;  4WF0 A;  5LBR A;  4HQA A;  1MC0 A;  2VLG A;  4WEL A;  3FPV A;  1KOU A;  1OTD A;  4OOM A;  2Y79 A;  3B33 A;  3UE3 A;  4LRY C;  4PAU A;  3D72 A;  5KSH A;  3F1P A;  2ZOH A;  3MR0 A;  4LLO B;  2W1R A;  3K2N A;  1YKD A;  1T1C A;  3BW6 A;  2G7U A;  5F5Y A;  3BJN A;  3HJK A;  2V1A A;  4NXB A;  3SW1 A;  2GZA A;  3PBT A;  2I9V A;  2VA0 A;  2HV1 A;  4JGO A;  2WKR A;  3T4J A;  3EWK A;  4GS9 A;  4HJ4 A;  4EU0 A;  3H82 B;  3BY9 A;  3F1N B;  2B02 A;  3C8C A;  5AVF A;  3W2Z A;  5HWW A;  3A0V A;  4O01 A;  4P6Z M;  1LT0 A;  4I38 A;  4I3I A;  1DP9 A;  5TBM B;  1OT9 A;  4XT2 B;  4HP9 A;  3PXP A;  3BQ8 A;  3PR6 A;  2VKS A;  2KX6 A;  4HP4 A;  3T4O A;  3LIE A;  3T4L A;  4EXO A;  1Y28 A;  3MQ0 A;  3UE6 A;  2W1T B;  4BBU A;  2M1C A;  2M7V A;  4DJ2 A;  5HDC A;  4BMW A;  4P6Z S;  3KYZ A;  4ARZ B;  2WKQ A;  4G3K A;  5HPF A;  2HF6 A;  1D7E A;  1XJ4 A;  2JKT M;  1G28 A;  1OTE A;  3MMH A;  2W3H A;  3C30 A;  1YAX A;  1TS6 A;  1GSX A;  2XSS A;  3PBQ A;  5TJJ A;  4NXE A;  1NLZ A;  2V0W A;  4OOL A;  2Y8H A;  3KO6 A;  2JKR M;  3F1N A;  4EES A;  4B9O A;  3TE8 A;  4YWZ A;  1OPX A;  4L9G A;  4HIA A;  1P0Z A;  2JHE A;  3PBO A;  2VX8 A;  2L1M A;  3E4O A;  4R70 A;  4WEK A;  2JN7 A;  3LYX A;  1LL8 A;  4HH2 A;  1ZTU A;  5IS1 A;  2XA7 M;  5HWT A;  4GLQ A;  3KX0 X;  3LIA A;  4CLC A;  4II7 A;  1ODV A;  2W1T A;  3UB9 A;  2QWS A;  2PYR A;  1LSX A;  3CLO A;  3RH8 B;  3CAX A;  3JVV A;  2QKP A;  5HSQ A;  4ARZ A;  2HJE A;  2KDK A;  4WL9 A;  3MFX A;  3NOU C;  3BWL A;  5CX7 A;  2PDR A;  3HCY A;  3NJA A;  2XA7 S;  4L0L A;  3D3O A;  3UB7 A;  3TRC A;  4EW7 A;  4G3W A;  4HH3 A;  1IOU A;  4KUO A;  5DJT A;  3PBN A;  1H8M A;  4PHT A;  2NUP C;  1IFQ A;  2PR5 A;  3LFV A;  5DFY A;  3VE3 A;  3KYQ A;  1P97 A;  2KLI A;  4CQH A;  3BY8 A;  1S4S A;  4Q0I A;  4BWI A;  2OAP 1;  2A24 B;  2VZW A;  4QPR A;  4HI4 A;  4WN5 A;  3T4T A;  4LRZ E;  5DF9 A;  3R4K A;  5KIZ A;  4MN6 A;  3S7Q A;  1JNU A;  3NHQ A;  4NKP A;  2L0W A;  1G6O A;  1DRM A;  3B47 A;  3FPW A;  3UMD A;  4UQI M;  3K3D A;  5F68 A;  2PHY A;  4K08 A;  1T1A A;  5AVE A;  1P9W A;  1XFQ A;  3FC7 A;  4M4X A;  4MDZ A;  1DP8 A;  2VJW A;  1NLY A;  5HWV A;  3B42 A;  2VV8 A;  4IJG A;  4NEE D;  1WA9 A;  3S7O A;  5HL6 A;  2OOL A;  3OCL A;  1UWP X;  2GJ3 A;  1XFN A;  4UQI S;  1OTB A;  2EWW A;  5IU1 A;  1LSW A;  5FL3 A;  5MC7 A;  1D06 A;  1UWN X;  2A24 A;  3KSH A;  4CLC B;  3DBA A;  3EQV A;  4JGQ A;  1S4R A;  3K3C A;  4CLC E;  2VEA A;  5AJG A;  1V9Y A;  2P7J A;  3BQA A;  3CI6 A;  3JVU A;  3EEA A;  4I3J A;  3E4Q A;  4MN5 A;  1S66 L;  3T50 A;  3UB6 A;  5DKK A;  4BJP A;  3CIT A;  3E98 A;  3U2A A;  1GSW A;  2B18 A;  5HD5 A;  2ZBB A;  1W63 M;  4PKY G;  3PYP A;  4O8G A;  4G3V A;  5J3W A;  4I3A A;  1NWZ A;  2KOI A;  3MJQ A;  3LI8 A;  1DP6 A;  1ZHH B;  2Z6C A;  4HNB A;  3TJZ C;  2D01 A;  1N9N A;  3A0R A;  2W3G A;  2OWH A;  2O9B A;  2D02 A;  3MQO A;  1X0O A;  2XRO A;  1TD5 A;  4GJ4 A;  5HDD A;  3UB8 A;  4BBV A;  3RFB A;  4HOI A;  5J7E A;  2FH5 A;  3PBR A;  1S67 L;  1YSP A;  3EEH A;  3ZYT A;  5J4E A;  2PD7 A;  3EGD C;  3LR5 A;  3LR0 A;  2OWJ A;  2CMN A;  3NOT C;  1F9I A;  3VOL A;  4FOF A;  4EEP A;  3ULF A;  1YSQ A;  2LB5 A;  3CUE A;  3UME A;  1EW0 A;  2HGV A;  3LID A;  2J3T D;  4RQ9 A;  4CLC D;  2WKP A;  1T18 A;  5HZH A;  4F3L B;  4HHD A;  2EA9 A;  2QYB A;  5IT5 A;  2ZMF A;  4AFI A;  4WEJ A;  3MXQ A;  2P08 A;  4MMN A;  4EER A;  4HJ3 A;  3VE4 A;  2V9A A;  2M7U A;  3PHY A;  2V1B A;  1MKM A;  1TS7 A;  3A0S A;  3F1O A;  3OC2 A;  4I39 A;  3OLO A;  3GDI A;  2W27 A;  3H7W B;  4WUJ A;  4L9E A;  3V67 A;  4LRX C;  1OTA A;  5EFW A;  3P01 A;  1T19 A;  2O99 A;  4EQ1 A;  2NUT C;  4NXG A;  2XRN A;  4GCZ A;  4DMZ A;  2PYP A;  3VV4 A;  4PKY A;  2VV7 A;  2BAS A;  1MZU A;  2O9A A;  4DJ3 A;  3S7P A;  3KSG A;  3LIB A;  2YKH A;  3OBF A;  1TS8 A;  4R3A A;  3LIC A;  2GX5 A;  3GEC A;  2W3E A;  2DMW A;  5L8M A;  4F3L A;  2YKF A;  3RTY A;  2OAQ 1;  2O0Y A;  4KQO A;  4Y3I A;  2K31 A;  2VGL M;  3LR3 A;  4L9F A;  3MF0 A;  4WLA A;  3T4Q A;  4GHI B;  4EUV A;  5F6A A;  3EQU A;  4E04 A;  4JGP A;  3R7W A;  1VHM A;  2EWV A;  1V9Z A;  1OJG A;  5F69 A;  5DKL A;  1OTI A;  3KSF A;  1H3Q A;  2PD8 A;  3G6O A;  3H7W A;  3OOV A;  4ME4 A;  5DFX A;  1TF1 A;  4FSF A;  2VGL S;  4Y2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...