4FOFA

Crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
AVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASLHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title A Photo-Labile Thioether Linkage to Phycoviolobilin Provides the Foundation for the Blue/Green Photocycles in DXCF-Cyanobacteriochromes.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2012-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4fofA00
2M7VA 5HPIA 3MQ0A 4RQ9A 3S7QA 2B18A 3E98A 4Z1WA 4YNRA 3NOPC 4PAUA 4CQHA 3TRCA 4Q0IA 4MDZA 3CITA 3G6OA 2OOLA 2GX5A 2O9BA 4O0PA 2VZWA 1MKMA 2XSSA 3VV4A 3C2WA 3DBAA 2VJWA 4Q0HA 5TJJA 2O0YA 2M7UA 4G3VA 5LBRA 3S7PA 2W3GA 4ETZA 2K31A 2QYBA 2VKSA 4MN7A 2W3DA 4GW9A 4Y3IA 3EEAA 2XROA 3RFBA 2HGVA 2G7UA 4G3WA 1YSPA 3IBJA 4IUHA 2LB5A 3NHQA 4MMNA 4EUVA 3KO6A 3OBFA 3S7OA 2W1TB 4IUKA 4LRYC 3KSGA 2VEAA 2KLIA 4G3KA 5AJGA 3NOTC 3D3OA 4R6LA 3OOVA 5HPFA 3KSIA 3W2ZA 2W3EA 2K2NA 2IA2A 4IJGA 3LFVA 4E04A 4EU0A 4ETXA 4O01A 4QPRA 3MMHA 1VHMA 4GLQA 4DN0A 4LRXC 4FOFA 1TF1A 5K5BA 2LB9A 4Y2FA 1YSQA 2Y79A 5C5KA 3NOUC 2ZMFA 4BWIA 3MF0A 4ZRRA 5DFYA 2W1TA 4MCWA 4R70A 5HL6A 1YKDA 2XRNA 2W3HA 4O8GA 3E0YA 4Y5FA 3BJNA 3CI6A 5I5LA 2O9AA 4Q0JA 3R4KA 4LRZE 2O9CA 3IBRA 2W3FA 3ZQ5A 4ME4A 1F5MA 1STZA 5HSQA 4DMZA 3K2NA 1TD5A 1MC0A 2KOIA 2Y8HA 5DFXA 1ZTUA 2O99A 3KSHA 5L8MA 3S7NA 3KSFA 4YOFA 3O5YA 3HCYA 2W1RA
chains in the Genus database with same CATH superfamily
2PYRA 2WGWA 3MR0A 2HP9A 3DW0A 3FPWA 5EOOA 3F1NA 1IYQA 4X68A 3V39A 1NRFA 4Y13A 1K55C 2ZBBA 3CITA 4GN2A 4GHIA 3O88A 1F9IA 3C7VA 5CHUA 3E4PA 3BM6A 3T1RA 4MN6A 4HQAA 2W27A 2HDSA 3BQ8A 1BLPA 3PBNA 2FFFB 3ZG0A 3GMWA 1J9MA 3HJIA 1GSXA 3VMAA 5HWWA 1JWZA 3KYQA 3KO6A 1MWTA 1S4SA 5FQKA 1EI5A 3KSGA 4E6WA 1IYSA 1G6OA 4YWZA 1ZKJA 1G6AA 3IXHA 4P85A 3SOIA 3ZCZA 4LLOB 5KMWA 3G4PA 2XLNA 5EPHA 4E04A 1PIOA 2HJ9C 3OC2A 1K56A 3L9KA 1TF1A 2V0WA 1TS0A 5E2FA 3RXXA 1SZVA 3R7WB 3E4OA 3LEZA 3BJNA 3CAXA 5CGXA 3Q7VA 2OAP1 5F5YA 1Z09A 3A0RA 1LSWA 5HDDA 4X55A 2Y91A 1DJBA 3NJAA 3LY3A 5FAPA 1NJ4A 5AQBA 5KIZA 4RQ9A 4UA7A 2OLVA 4WEKA 2A2LA 4Q0IA 4R3JA 3BFDA 2PBDP 2L4RA 3T1SA 1XJ3A 3GR2A 3BECA 3M6HA 3JVVA 1MWRA 3HLDA 3CHWP 1VETA 2YKFA 3ZVWA 2Y55A 2JKRI 4ETZA 2K31A 3GV9A 1H8MA 2WK0A 3L7HA 1LI0A 5FSRA 2HP6A 1L0FA 4LRYC 3GTCA 1Y4OA 5TR7A 3TSGA 5A8BA 4ZDXA 1K54A 3EQUA 2QMIA 1KVMA 4F94A 4I3JA 3OZHA 2C5WB 4GS9B 5EVLA 1FCNA 1K57A 1IELA 1UWNX 1XA1A 1A0KA 1YSQA 2DRWA 1N9OA 3Q7ZA 4E3LA 1VB6A 3WS2A 4JF6A 4K0WA 1IOUA 2WGWB 5FAQA 1U60A 3CZDA 3IX8A 2R9XA 3F1NB 2INWA 1RP5A 2Y2KA 3QP1A 2XFTA 1P9WA 4GHIB 3IT9A 1TD5A 3BFCA 3N8RA 1LSVA 2WKPA 3QP5A 3AGEA 1PNEA 3S7NA 4YOFA 3O5YA 3FG8A 2H0TA 3CUEC 4R0QA 4OQGA 1L0DA 1PZOA 5CX7A 3UPOA 4E3OA 3PBQA 4MDZA 1H8ZA 5GLCA 4NK3A 4C6YA 4WZ5A 2GX5A 2JCHA 1JWVA 4PM6A 5M18A 1XKZA 4M3KA 4IBXA 1D7EA 1C3BA 4GOGA 4MN7A 2BLSA 2XDMA 3LUQA 4KZ7A 3UDXA 1FSWA 3U2AA 3GSGA 1FCMA 4C75A 5EVEA 5DF8A 2JKRM 5CEBA 3H9WA 1PWGA 1CEGA 5AJGA 3E2LA 3RXWA 1LL9A 4U3TA 4EQIA 4E3MA 1PW1A 5HARA 2W3EA 2K2NA 3VE3A 3Q7VB 4JGQA 4IJGA 2GDNA 1WE4A 5HW3A 2EWWA 3B42A 5CXWA 1PI5A 3QP4A 5I94A 4WEJA 2ZOIA 4MCWA 2XRNA 5E2EA 2P74A 5FA7A 4WM9A 5IU1A 2WKRA 1ALQA 4GB7A 3LIAA 2EX9A 2PYPA 3HL9A 1BLHA 4EEUA 1V9YA 5AQAA 3T1XA 1AXBA 1MZUA 3FPVA 5L8MA 3KYZA 2WGVA 3UPNA 2PU4A 5F68A 1VETB 4N1XA 3Q07A 2G2UA 3UE1A 3IWQA 3ZG9B 1BZAA 3BQAA 1LHYA 4E3NA 1XGJA 2OOLA 5KZHA 2VZWA 3A0SA 4PMAA 4LENA 2Y59A 1NLYA 4FSFA 3SH9A 5FEGA 3PTEA 4RX2A 3RJUA 4WN5A 4PM9A 5J7EA 2ZC4B 1K25A 2D01A 4GCZA 4ARZA 4KZBA 1OJ5A 4LPZA 3W4QA 3HLWA 4M4XA 2KDKA 3NHQA 4QHCA 1WYCA 4KQDA 1S4RA 3ZDJA 2D02A 1UWPX 3S4XA 3T12B 3ZG8B 2XA7M 1ZC2A 2WZXA 3PBRA 3NECA 2YKHA 3V5MA 4DN0A 3ZVTA 5K5BA 4IHQA 3NI9A 2OV5A 4BWIA 2HJEA 1YLTA 2UV0E 1T19A 3E2KA 4MEZA 3MKEA 3N8LA 4JGPA 2ZD8A 2E8JA 3ZFZA 4N92A 1WA9A 3ZG7B 4KZ8A 3RH8B 4X25A 2Q9MA 3QP8A 1ES5A 1H8YA 3MQOA 3IH8A 2ZL1A 1YLJA 3LIFA 4ZJ3A 5L10A 3WS4A 3SZTA 2J3TC 3W4PA 2Y2PA 3IXGA 5TBMB 4DDSA 4YNRA 1FSYA 2PDRA 5BOHA 3E98A 3GRJA 4HH3A 2PT7A 4LV0A 1O07A 3ZNYA 4S2PA 1ESIA 1W63M 5HWTA 1K6SA 3MFDA 4N9LA 4BLMA 3N6IA 2PBYA 3GVBA 2M7UA 4MBKA 1ERMA 4D60A 4EW7A 3FWLA 3UB9A 2ZMAA 2P08A 1T18A 4IEDA 4YINA 2G7UA 2J80A 3VSKA 3EWKA 5GLDA 2ZQDA 3T4QA 4S2OA 2OLUA 1TS7A 3HUOA 4R6LA 4Y0OA 4FD8A 4B4XA 4S2IA 3D72A 4FH4A 3IX4A 2DNSA 4QPRA 4EV4A 2J9OA 1VHMA 3C4OA 3V3SA 1GSWA 3IX3A 2PD8A 4NXBA 3CLOA 2CMNA 1K6RA 1OMEA 4KQRA 2FZ0A 3IBRA 1H3QA 1KE4A 3MXSA 1STZA 5HSQA 3T1QB 3PR6A 2V9AA 4Y7PA 1W79A 3NC8A 4NEED 3MSHA 2B18A 1XX2A 2X02A 4Z1WA 4ARZB 4I5SA 1YQSA 3Q1FA 3A3IA 2PD7A 4ZBEA 3N7WA 2X71A 3UMEA 1CF0A 4RA7A 3DBAA 1UGUA 4WMCA 5EV0A 4JBFA 3S7PA 5DJUA 4JLFA 4PKYA 5TGFA 2QPNA 3PBOA 3HBRA 1K54C 3ITBA 1FCOA 4WL9A 1ODVA 1CQAA 5F1FA 2JKTI 2HDRA 5IHVA 3SS3A 4BBTA 5A92A 2NUPC 2Z2MB 1HD8A 1K57C 2QKPA 3IHBA 3MBZA 3MXRA 1XFQA 3K3CA 1N9BA 4KZAA 3W2ZA 4ID4A 4BMWA 1DJAA 1PRQA 3LFVA 4P6ZM 4ETXA 3EEHA 2ZL1B 2B5RA 1QMFA 4FOFA 4LRXC 2VGLM 1MPLA 3WS5A 2VK3A 4NXFA 4S2KA 4X1LA 4OQHA 4ZAMA 3T4TA 1S66L 1YKDA 5EVIA 1EROA 4E6XA 4UAAA 2I72A 2O9AA 3OCLA 4GNUA 4Q0JA 3K3DA 1NZUA 3MFXA 1H5XA 3Q81A 3MS6A 2Y8HA 2ZQCA 4MLLA 2VGKA 1P0ZA 3OPLA 4S2NA 1HVBA 4Z9QA 2HDUA 4WZ5C 2Z6DA 3LI8A 5F83A 4RX3A 2V20A 5HDSA 1VM1A 2GNXA 4PAUA 2HF6A 1OTAA 4P87A 2H0YA 1SCWA 3T4SA 1IFQA 3I7JA 3PBSA 3T50A 4DKIA 1G28A 4EBPA 1N9NA 4HI4A 5E2GA 1E4DA 2VJWA 2XGNA 3NBLA 4KZ6A 4S2LA 5TJJA 2VV6A 3OLOA 2PR5A 5M19A 1LLBA 1GA0A 4KENB 4KZ5A 2W3DA 3NDGA 5G4YA 1YSPA 3LR5A 1DY6A 2LB5A 3HREA 1CK3A 2ZQAA 4HJ4A 5AVEA 4R4RA 1I2SA 5HD5A 2HP5A 4FTXA 1S0WA 4H6JA 2JN7A 5M1AA 3KSIA 1H0MA 4HJ6A 2JKTM 4CLCE 1YLWA 4EQ1A 2X01A 3HLCA 4JXWA 4DE1A 1P97A 3G2YA 5FI7A 2J3WA 3PYPA 3C5AA 3AGFA 3VFHA 3NOUC 2L1MA 2V1AA 4DDYA 1FQGA 4OLDA 2W1TA 4WBGA 3IF6A 4PPRA 2W3HA 1M40A 1E3UA 4JPMA 4KUKA 1BSGA 4XXRA 3G35A 1LL8A 4KZ9A 1I5QA 4AFIA 1Y28A 1YAXA 3UB8A 2PAVP 5J4EA 4R38A 1N4OA 4U0XA 1G5UA 5FEFA 4N9KA 4QJGA 2PHYA 1GHMA 2Y2GA 2ZC5B 1LI9A 4S2JA 3G6OA 3FKWA 4EEPA 4UEYA 2Y2HA 3EGXC 1F2KA 2EXAA 2XSSA 3VV4A 4UQIS 4OPYA 4QY5A 3PHYA 1T1AA 5L07A 3IF5A 2FH5A 2IWCA 4GZBA 1CI9A 1FILA 1K4FA 2Y2IA 2HDQA 3IBJA 1TS8A 3A3EA 2QWSA 3O87A 5A93A 3S7OA 4DE2A 1DP9A 1LSXA 3CPTA 2KLIA 3DWKA 3SW1A 5EVIB 1EW0A 4CJNA 2M1CA 5CGWA 2P04A 3PXPA 1OT9A 2Z6CA 3UPPA 1W5DA 3MZEA 5F6AA 4NKPA 2BG1A 5F69A 5HAIA 1WYBA 2P9VA 4X53A 2NUTC 2ZM8A 1S67L 4GLQA 3DTKA 5FQ9A 4O7DA 4C3QA 1BT5A 2PU2A 1XA7A 3H7WA 3E4QA 2ZC3B 5GHXA 3QNCA 4B9OA 1TEMA 5U47A 2PRFA 4L9GA 3W8KA 4Y5FA 2EX6A 2OWHA 3H82A 2WAFA 3GQZA 2O9CA 4X69A 3CWFA 1JVJA 4EWFA 3BY9A 3JVUA 3V3RA 1ES4A 1GHPA 4KG2A 1N9LA 4OPZA 4H8RA 3MZFA 3ZYTA 5HPIA 2HV1A 2CC1A 3CJMA 3UMDA 4HH2A 3T4KA 1HLUP 2EX8A 3VE4A 4DF6A 1YMSA 3LICA 3UDFA 2O9BA 4WF0A 3KYEA 1I2WA 1SDEA 3C2WA 4H6JB 5HDCA 3F1OA 5FDHA 1XJ2A 2QJ5A 2PR6A 3G30A 4GDBA 3UN7A 1W8YA 2ACGA 2HGVA 3IS2A 1CI8A 2EFUA 1LL5A 3JPUA 3LIDA 1FR1A 3ISGA 3A3FA 3OBFA 2W1TB 1XP4A 4OLGA 3IF6B 4EBNA 2VX8A 5JYPA 4E3JA 3NOTC 3LEQA 3QP6A 5CTNA 3MZDA 1ERQA 4IBRA 3IHAA 5L09A 5KSHA 2RCXA 1TVFA 3KX0X 4ZJ2A 3BFGA 2LB9A 1W63Q 4Y0TA 2QHKA 5FQQA 2EA9A 2Z2LB 1KOUA 4BL2A 4WMCD 4B4ZA 3SS4A 1SHVA 1DJCA 2XQZA 2V8FA 3WRZA 5CTMA 3T4LA 1YLPA 4R23A 2HZ5A 4DE0A 2WKIA 4LCLA 2VA0A 4NETA 2FFYA 3D9YA 3VOYA 4ME4A 1F5MA 3A3DA 4DMZA 3K2NA 3VP0A 1BTLA 2A24A 4MNRA 2A3UA 2W1RA 2M7VA 1GSVA 3T4JA 2HPBA 3S7QA 3LGOA 1VEUA 1O7EA 2P7JA 5DTSA 4CQHA 3G32A 1MWSA 3TJZC 3DTMA 3LR0A 5GLBA 3WS1A 1L2SA 4PM8A 4OPRA 2AVXA 4GKUA 3S22A 1NRJA 1W7FA 4JF5A 5EVID 1BUEA 1XGIA 2ZQ9A 5CERA 2DMWA 5FL3A 3SS5A 2P9VB 2VV8A 4KG5A 4Y3IA 5CECA 3CG5A 5JYOA 3M6BA 1L0EA 3PAGA 1RGZA 4HIAA 1BLCA 5G18A 5EFWA 3G34A 5EM1A 3H7WB 4CPKA 2V8CA 4YFMA 2ZJ9A 4G3KA 1MBLA 2XD1A 3MJQA 4LGWA 3UDIA 4N1HA 1DRMA 5EOEA 4JGRA 1G68A 2V0UA 5EVIC 1RCJA 3MXQA 4LV2A 5TFQA 2UWXA 1PWDA 5FQJA 4R70A 4II7A 1OTDA 4LV3A 4ZTKA 3RTYA 5CGSA 2XK1A 1TS6A 4S2NC 1NY0A 5AQ9A 4HHDA 5DFXA 4EUZA 4QD4A 3VSLA 4A5RA 3HCYA 2ZOHA 2Y2QA 5HZHA 5F82A 2ZC7A 1K38A 4K91A 3B33A 4DJ2A 2WUQA 4IVIA 4QU3A 3TRCA 4OVDA 1NYYA 3EQVA 3VOZA 2DCFA 3ICYA 4HJ3A 3TG9A 2XH9A 4B93A 3DTEA 3UE0A 4OONA 2WGIA 4RVAA 4MN5A 4KZ3A 1E3UD 5LBRA 1Y54A 3HJKA 4U0TA 3EEAA 2XROA 2WADA 4WZ4A 5MC7A 4HP9A 4X56A 1ONHA 2IWDA 4EUVA 1XJ6A 2B02A 3IWIA 5DJTA 1YPRA 1JWPA 1CJFA 1NXYA 3D3OA 4S2MA 1PFLA 3C4PA 3BLSA 4BBVA 1V9ZA 2J8YA 3CMZA 1OTIA 4OQ0A 3IF6C 2W0NA 3DTIA 4CLCA 3MMHA 2C6WB 2R9WA 4EBLA 3BY8A 1MWUA 3UO9A 3LY4A 3E0YA 3FKVA 1VEUB 1XJ4A 3IXBA 1KGEA 4JKTA 5I5LA 4XUXA 2OAQ1 3ZGAB 1KE0A 3SH7A 2W3FA 2Y2LA 4UHUA 4ZJ1A 1XFNA 4LFUA 1NWZA 4WLAA 4UA9A 2Y2NA 3VFFA 3VP3A 3QP2A 2MJ6A 4PKYG 2Y2MA 5E2HA 4E3IA 2JBFA 2ZLYA 1RGYA 1SKOA 5FQMA 4R4SA 3BRMA 4EERA 1W8QA 3ZG5A 2QZ6A 4O0PA 2ZC6B 4D2OA 2ZQ8A 4EXOA 2XEPA 4I3AA 3D4FA 4KQQA 2O0YA 1KDSA 5CEDA 1AWIA 4JXSA 3OPHA 3LCEA 3FV7A 4KG6A 5HAQA 3LR3A 4G3WA 2WKHA 4EESA 1PI4A 4MBFA 1SDNA 5GHYA 1PWCA 1IYPA 2EX2A 4HESA 2J7VA 3U4LP 3OPPA 3UE6A 5J3WA 1ES2A 5EUAA 3UNWA 2RL3A 4Y17A 1OTEA 4XT2A 4KUOA 5HAPA 5L2FA 3FZCA 3OPRA 4L0LA 3P01A 4JXVA 5HL6A 1BULA 2A49A 3DWZA 2EXBA 3ZNTA 3B47A 4PM7A 1FIKA 4GD8A 1ACFA 4LRZE 2VGJA 1PW8A 4GDNA 1ES3A 2EWVA 1F98A 1MC0A 2V2FF 5CHMA 2KOIA 1ZTUA 3KSHA 4P0MA 1VQQA 4MBHA 4WELA 5FASA 4R3BA 3MQ0A 3IXDA 1YLYA 5DF9A 3C38A 1MKIA 4R3AA 1T1CA 2QJ7A 3O3VA 4DRTA 5GLAA 3G2ZA 1IYOA 5HL1A 1CEFA 1MKMA 5DF7A 4JF4A 1IEMA 3W4OA 3UE3A 3B3XA 5GHZA 1IKGA 5CHJA 1K55A 3TW8A 3JYIA 3UB6A 1MXOA 4G3VA 2W3GA 4K08A 2QYBA 1T1BA 2VKSA 4GW9A 4CLCB 4E3KA 2E8IA 4HY8A 4BD1A 3RFBA 2H5SA 2XA7S 2Q0OA 2JC7A 3UY6A 3UB5P 1PYYA 1EWZA 3BYDA 4JXGA 4IUKA 1X0OA 2OWJA 5A90A 4OOYA 2BTFP 2OSUA 3OOVA 1TDLA 3GDIA 4LV1A 5E43A 1GA9A 3BEBA 1NYMA 2WYXA 1L3LA 3LIBA 4OP8A 1S1ZA 3IQAA 2XD5A 4Q8IA 3MF0A 1Q2PA 5DFYA 1L0GA 1SKFA 3LYXA 1SKOB 1FR6A 3P09A 2JKFA 2ZQ7A 1GCEA 2Y4AA 4I38A 2KX6A 4IVKA 4BBUA 1TDGA 3NULA 2ZMVA 3F1PA 2O99A 1ESUA 3PAEA 3Q82A 1KGGA 4FCFA 1DP6A 1XPBA 5TBMA 4PHTA 4DJ3A 5EE8A 4LCMA 4QB8A 4DE3A 5HWVA 1E25A 4KZ4A 1GHIA 3NCKA 3N8SA 5EM0A 4JGOA 3NY4A 3LI9A 1ZG4A 4OH0A 4BQMA 1LT0A 5F1GA 2WAEA 4R1GA 1D06A 4Q0HA 2VV7A 1PZPA 4RYEA 4OP5A 4F3LA 5CRFA 3O86A 4XT2B 4WUJA 3QNBA 1Z6FA 4BL3A 4GD6A 3VP4A 5DKLA 1K4EA 4B88A 1S1YA 5DVAA 3HLGA 1JTGA 2B95A 1OPXA 3A3JA 4I39A 3LIEA 2WKQA 3MKFA 5J8XA 5AVFA 4NG2A 1P9RA 3BLMA 1FOFA 4DXCA 3FC7A 2G2WA 2XR0A 2IA2A 4EU0A 5HD3A 4FH2A 5GL9A 1HTZA 4UA6A 1S6RA 2JE5A 4HNBA 4NXEA 5FI6A 2ZMFA 5FAOA 5FQIA 4O8GA 3G31A 3OCNA 3CI6A 2V1ZA 5FI2A 2H28A 3C8CA 1OT6A 3LO7A 1YT4A 2ZM0A 3HVFA 4GJ4A 3SH8A 2XF3A 3P7NA 3KSFA 1HZOA 5EECA 3VP2A 1D1JA 3ITAA 2GZAA 4CLCD 1YLZA 1KDWA 3CUEA 1JTDA 5DTTA 2WZZA 1JNUA 3HLFA 2H10A 1OJGA 2J3TD 3UB7A 4OOMA 1DP8A 3C30A 4UQIM 5HFOA 4P6ZS 2JHEA 3CPTB 1K0KA 5IS1A 4PM5A 2VGLS 5FDSA 4OPQA 4CLCC 4EETB 3V67A 3VOLA 2IWBA 2K7SA 4K0XA 4KQOA 3WRTA 3TOIA 4OQIA 4BD0A 4HP4A 4O01A 2Y2OA 3WS0A 3F1PB 4I3IA 4Y2FA 5C5KA 4FUWA 4X6TA 4HEFA 4QWOA 4ZRRA 2VLGA 1Q2QA 1NZOA 3H82B 2I9VA 1ZHHB 4X1MA 2V1BA 3ZQ5A 3HLEA 5IT5A 3V50A 1K56D 2JKGA 4HBUA 1QMEA 4Y15A 3QHYA 5DKKA 4DXBA 2J9PA 3A0VA 3BFFA 4F3LB 1IKIA 3R7WA 5D3OA 1MY8A 3NOPC 1J3WA 5HX9A 3MQQA 3T4OA 3BFEA 3EOIA 3C7UA 3HLBA 5FATA 3PBTA 3TE8A 3M2KA 2R78A 1NLZA 1ONGA 4OKPA 4Y0UA 3F1OB 3BWLA 3M2JA 5A91A 4P6BA 3IS2B 5KSCA 4IUHA 2Q9NA 4MMNA 4HOIA 3BW6A 4NXGA 1M6KA 2EFXA 4XUZA 1KGFA 2VEAA 4BJPA 2GJ3A 2Y2JA 4WYYA 3N4IA 5G4ZA 5HPFA 3VP1A 2BASA 2ZM2A 3NDEA 4HBTA 3FYZA 2WKEA 5AQ7A 3AGDA 4OOLA 4ESPA 3ULFA 1KE3A 1ZG6A 3DAVA 1KVLA 3P98A 2Y79A 1BLSA 3GECA 1XXMA 5DTKA 4BENA 3IWOA 3WWXA 2XFSA 3HUMA 3R4KA 3ZHHA 3IH9A 4GS9A 4L9EA 3NIAA 4QY6A 4L9FA 1YM1A 1YMXA 2A24B 3HUNA 3LR4A 3EGDC 1BYWA 3S1YA 1OTBA 2L0WA
chains in the Genus database with same CATH topology
3ZYTA 5HPIA 2PDRA 3MQ0A 2HV1A 2PYRA 5DF9A 3MR0A 3FPWA 3UMDA 4HH2A 3E98A 3C38A 3T4KA 3F1NA 4R3AA 4HH3A 1T1CA 2QJ7A 3VE4A 2PT7A 2ZBBA 3CITA 3LICA 4GHIA 2O9BA 4WF0A 1F9IA 1W63M 1MKMA 5HWTA 3E4PA 3C2WA 3UE3A 4MN6A 4HQAA 4H6JB 5HDCA 3F1OA 2M7UA 3TW8A 3UB6A 1XJ2A 2QJ5A 2PR6A 2W27A 3BQ8A 4G3VA 4EW7A 2W3GA 4K08A 3PBNA 2QYBA 1T1BA 2VKSA 3UB9A 4GW9A 4CLCB 2P08A 3HJIA 1T18A 4HY8A 3RFBA 1GSXA 2HGVA 2XA7S 5HWWA 3IS2A 2G7UA 2J80A 3LIDA 3EWKA 3KYQA 3KO6A 3OBFA 1S4SA 2W1TB 4IUKA 3KSGA 1X0OA 2OWJA 3T4QA 2VX8A 1G6OA 4YWZA 3NOTC 1TS7A 4R6LA 3OOVA 4LLOB 3GDIA 3D72A 5KSHA 3KX0X 4E04A 4QPRA 2HJ9C 1VHMA 3OC2A 3LIBA 1TF1A 1GSWA 2V0WA 1S1ZA 2LB9A 1W63Q 1TS0A 2QHKA 2EA9A 3MF0A 1KOUA 2PD8A 5DFYA 4NXBA 3CLOA 3LYXA 3R7WB 3E4OA 2CMNA 3BJNA 3CAXA 2FZ0A 3T4LA 4I38A 2OAP1 2KX6A 5F5YA 2VA0A 3IBRA 1H3QA 4ME4A 4BBUA 1F5MA 1STZA 5HSQA 4DMZA 3K2NA 2ZMVA 3F1PA 2O99A 3A0RA 2A24A 3PR6A 1LSWA 5HDDA 2V9AA 1DP6A 3NJAA 5TBMA 2W1RA 2M7VA 4PHTA 4NEED 4DJ3A 1GSVA 3T4JA 5KIZA 4RQ9A 3S7QA 2B18A 5HWVA 4Z1WA 2P7JA 4ARZB 4I5SA 4JGOA 4WEKA 2A2LA 4CQHA 4Q0IA 3TJZC 3LI9A 3LR0A 2L4RA 1LT0A 2PD7A 1XJ3A 3UMEA 1NRJA 3DBAA 1UGUA 1D06A 3JVVA 4Q0HA 2VV7A 2YKFA 2DMWA 3S7PA 4F3LA 2JKRI 5DJUA 5FL3A 4ETZA 2K31A 4PKYA 4XT2B 4WUJA 1H8MA 2VV8A 4Y3IA 3PBOA 4WL9A 1ODVA 5DKLA 4HIAA 2JKTI 1S1YA 5EFWA 4BBTA 3H7WB 2NUPC 1OPXA 4I39A 4LRYC 5A8BA 3LIEA 2WKQA 2QKPA 4G3KA 5AVFA 3EQUA 1P9RA 3MJQA 3FC7A 1XFQA 3K3CA 3W2ZA 4I3JA 4GS9B 4BMWA 2IA2A 1DRMA 3LFVA 4P6ZM 4JGRA 5HD3A 4EU0A 4ETXA 2V0UA 3EEHA 1UWNX 3MXQA 4LRXC 4FOFA 2VGLM 1YSQA 4HNBA 4NXEA 4NXFA 1N9OA 2ZMFA 1VB6A 3T4TA 4R70A 1S66L 1IOUA 1YKDA 4II7A 4O8GA 1OTDA 3OCNA 3RTYA 3F1NB 3CI6A 2INWA 1TS6A 2O9AA 3OCLA 2H28A 3C8CA 4Q0JA 1OT6A 3K3DA 3MFXA 1P9WA 4GHIB 1TD5A 4GJ4A 2Y8HA 4HHDA 5DFXA 1LSVA 2WKPA 1P0ZA 3P7NA 3S7NA 3KSFA 4YOFA 3O5YA 3FG8A 3HCYA 2ZOHA 2Z6DA 3LI8A 5HZHA 3CUEC 5HDSA 4YNRA 2GNXA 3B33A 4DJ2A 5CX7A 2GZAA 2HF6A 1OTAA 4PAUA 3TRCA 3PBQA 3EQVA 4MDZA 4CLCD 3T4SA 1IFQA 2GX5A 3ICYA 3PBSA 4HJ3A 3T50A 3CUEA 4B93A 1JNUA 1G28A 1N9NA 4HI4A 2VJWA 5TJJA 1D7EA 2VV6A 3OLOA 2PR5A 4MN5A 5LBRA 1OJGA 2J3TD 4MN7A 3HJKA 2W3DA 3UB7A 4OOMA 3EEAA 3LUQA 2XROA 1DP8A 3C30A 5MC7A 5G4YA 4UQIM 4HP9A 3U2AA 1YSPA 3LR5A 2LB5A 4EUVA 1XJ6A 4P6ZS 2B02A 2JHEA 2JKRM 5IS1A 3H9WA 5DJTA 4HJ4A 5AVEA 5AJGA 2VGLS 5HD5A 4CLCC 3D3OA 4EETB 4H6JA 3V67A 2JN7A 1V9ZA 4BBVA 3KSIA 3VOLA 4HJ6A 2JKTM 2W3EA 2K2NA 3VE3A 2K7SA 4CLCE 4JGQA 4EQ1A 1OTIA 4KQOA 4IJGA 2W0NA 4HP4A 4O01A 4CLCA 1P97A 3MMHA 2J3WA 2EWWA 3F1PB 4I3IA 3B42A 3PYPA 4Y2FA 3BY8A 5C5KA 3NOUC 2L1MA 2V1AA 4ZRRA 2W1TA 2ZOIA 4MCWA 4WEJA 2XRNA 2W3HA 2VLGA 3E0YA 4KUKA 5IU1A 1XJ4A 3H82B 2I9VA 2WKRA 1ZHHB 5I5LA 3LIAA 2OAQ1 2V1BA 2PYPA 3ZQ5A 2W3FA 1LL8A 5IT5A 4EEUA 1V9YA 1XFNA 4AFIA 1NWZA 4WLAA 1Y28A 1YAXA 1MZUA 3FPVA 3UB8A 5L8MA 3KYZA 5DKKA 2MJ6A 4PKYG 5F68A 5J4EA 3A0VA 4R38A 4F3LB 3R7WA 2PHYA 3BQAA 3NOPC 4EERA 3MQQA 3T4OA 3G6OA 3EOIA 2OOLA 4O0PA 4EEPA 2VZWA 3A0SA 4UEYA 3EGXC 3PBTA 3TE8A 4EXOA 2XSSA 3VV4A 4UQIS 2R78A 1NLZA 1NLYA 4FSFA 4I3AA 3F1OB 3PHYA 3BWLA 1T1AA 2O0YA 4WN5A 2FH5A 5J7EA 2D01A 4GCZA 4ARZA 3LR3A 3IS2B 1OJ5A 4G3WA 3IBJA 4LPZA 4M4XA 1TS8A 4EESA 4IUHA 2KDKA 3NHQA 4HOIA 4MMNA 2QWSA 3BW6A 4NXGA 4KQDA 1S4RA 3S7OA 1DP9A 1LSXA 2VEAA 2KLIA 3SW1A 4BJPA 1EW0A 2GJ3A 2M1CA 5G4ZA 2D02A 3UE6A 5HPFA 1UWPX 2P04A 3PXPA 5J3WA 2XA7M 2BASA 1OT9A 2Z6CA 3PBRA 5F6AA 1OTEA 4NKPA 4XT2A 4KUOA 5F69A 2YKHA 4OOLA 2NUTC 1S67L 3ULFA 4GLQA 4DN0A 5K5BA 4L0LA 4IHQA 2Y79A 4BWIA 3GECA 3H7WA 3P01A 2HJEA 3E4QA 5HL6A 1T19A 4B9OA 4L9GA 4JGPA 4Y5FA 3B47A 1WA9A 2OWHA 3H82A 3R4KA 4LRZE 4GS9A 2O9CA 4L9EA 3RH8B 4L9FA 2EWVA 3CWFA 1F98A 3MQOA 1MC0A 2KOIA 2A24B 3LR4A 1ZTUA 3LIFA 3BY9A 3JVUA 3KSHA 3EGDC 1BYWA 2J3TC 1N9LA 5TBMB 1OTBA 2L0WA 4WELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7V A;  5HPI A;  3MQ0 A;  4RQ9 A;  3S7Q A;  2B18 A;  3E98 A;  4Z1W A;  4YNR A;  3NOP C;  4PAU A;  4CQH A;  3TRC A;  4Q0I A;  4MDZ A;  3CIT A;  3G6O A;  2OOL A;  2GX5 A;  2O9B A;  4O0P A;  2VZW A;  1MKM A;  2XSS A;  3VV4 A;  3C2W A;  3DBA A;  2VJW A;  4Q0H A;  5TJJ A;  2O0Y A;  2M7U A;  4G3V A;  5LBR A;  3S7P A;  2W3G A;  4ETZ A;  2K31 A;  2QYB A;  2VKS A;  4MN7 A;  2W3D A;  4GW9 A;  4Y3I A;  3EEA A;  2XRO A;  3RFB A;  2HGV A;  2G7U A;  4G3W A;  1YSP A;  3IBJ A;  4IUH A;  2LB5 A;  3NHQ A;  4MMN A;  4EUV A;  3KO6 A;  3OBF A;  3S7O A;  2W1T B;  4IUK A;  4LRY C;  3KSG A;  2VEA A;  2KLI A;  4G3K A;  5AJG A;  3NOT C;  3D3O A;  4R6L A;  3OOV A;  5HPF A;  3KSI A;  3W2Z A;  2W3E A;  2K2N A;  2IA2 A;  4IJG A;  3LFV A;  4E04 A;  4EU0 A;  4ETX A;  4O01 A;  4QPR A;  3MMH A;  1VHM A;  4GLQ A;  4DN0 A;  4LRX C;  4FOF A;  1TF1 A;  5K5B A;  2LB9 A;  4Y2F A;  1YSQ A;  2Y79 A;  5C5K A;  3NOU C;  2ZMF A;  4BWI A;  3MF0 A;  4ZRR A;  5DFY A;  2W1T A;  4MCW A;  4R70 A;  5HL6 A;  1YKD A;  2XRN A;  2W3H A;  4O8G A;  3E0Y A;  4Y5F A;  3BJN A;  3CI6 A;  5I5L A;  2O9A A;  4Q0J A;  3R4K A;  4LRZ E;  2O9C A;  3IBR A;  2W3F A;  3ZQ5 A;  4ME4 A;  1F5M A;  1STZ A;  5HSQ A;  4DMZ A;  3K2N A;  1TD5 A;  1MC0 A;  2KOI A;  2Y8H A;  5DFX A;  1ZTU A;  2O99 A;  3KSH A;  5L8M A;  3S7N A;  3KSF A;  4YOF A;  3O5Y A;  3HCY A;  2W1R A; 
#chains in the Genus database with same CATH topology
 2PYR A;  2WGW A;  3MR0 A;  2HP9 A;  3DW0 A;  3FPW A;  5EOO A;  3F1N A;  1IYQ A;  4X68 A;  3V39 A;  1NRF A;  4Y13 A;  1K55 C;  2ZBB A;  3CIT A;  4GN2 A;  4GHI A;  3O88 A;  1F9I A;  3C7V A;  5CHU A;  3E4P A;  3BM6 A;  3T1R A;  4MN6 A;  4HQA A;  2W27 A;  2HDS A;  3BQ8 A;  1BLP A;  3PBN A;  2FFF B;  3ZG0 A;  3GMW A;  1J9M A;  3HJI A;  1GSX A;  3VMA A;  5HWW A;  1JWZ A;  3KYQ A;  3KO6 A;  1MWT A;  1S4S A;  5FQK A;  1EI5 A;  3KSG A;  4E6W A;  1IYS A;  1G6O A;  4YWZ A;  1ZKJ A;  1G6A A;  3IXH A;  4P85 A;  3SOI A;  3ZCZ A;  4LLO B;  5KMW A;  3G4P A;  2XLN A;  5EPH A;  4E04 A;  1PIO A;  2HJ9 C;  3OC2 A;  1K56 A;  3L9K A;  1TF1 A;  2V0W A;  1TS0 A;  5E2F A;  3RXX A;  1SZV A;  3R7W B;  3E4O A;  3LEZ A;  3BJN A;  3CAX A;  5CGX A;  3Q7V A;  2OAP 1;  5F5Y A;  1Z09 A;  3A0R A;  1LSW A;  5HDD A;  4X55 A;  2Y91 A;  1DJB A;  3NJA A;  3LY3 A;  5FAP A;  1NJ4 A;  5AQB A;  5KIZ A;  4RQ9 A;  4UA7 A;  2OLV A;  4WEK A;  2A2L A;  4Q0I A;  4R3J A;  3BFD A;  2PBD P;  2L4R A;  3T1S A;  1XJ3 A;  3GR2 A;  3BEC A;  3M6H A;  3JVV A;  1MWR A;  3HLD A;  3CHW P;  1VET A;  2YKF A;  3ZVW A;  2Y55 A;  2JKR I;  4ETZ A;  2K31 A;  3GV9 A;  1H8M A;  2WK0 A;  3L7H A;  1LI0 A;  5FSR A;  2HP6 A;  1L0F A;  4LRY C;  3GTC A;  1Y4O A;  5TR7 A;  3TSG A;  5A8B A;  4ZDX A;  1K54 A;  3EQU A;  2QMI A;  1KVM A;  4F94 A;  4I3J A;  3OZH A;  2C5W B;  4GS9 B;  5EVL A;  1FCN A;  1K57 A;  1IEL A;  1UWN X;  1XA1 A;  1A0K A;  1YSQ A;  2DRW A;  1N9O A;  3Q7Z A;  4E3L A;  1VB6 A;  3WS2 A;  4JF6 A;  4K0W A;  1IOU A;  2WGW B;  5FAQ A;  1U60 A;  3CZD A;  3IX8 A;  2R9X A;  3F1N B;  2INW A;  1RP5 A;  2Y2K A;  3QP1 A;  2XFT A;  1P9W A;  4GHI B;  3IT9 A;  1TD5 A;  3BFC A;  3N8R A;  1LSV A;  2WKP A;  3QP5 A;  3AGE A;  1PNE A;  3S7N A;  4YOF A;  3O5Y A;  3FG8 A;  2H0T A;  3CUE C;  4R0Q A;  4OQG A;  1L0D A;  1PZO A;  5CX7 A;  3UPO A;  4E3O A;  3PBQ A;  4MDZ A;  1H8Z A;  5GLC A;  4NK3 A;  4C6Y A;  4WZ5 A;  2GX5 A;  2JCH A;  1JWV A;  4PM6 A;  5M18 A;  1XKZ A;  4M3K A;  4IBX A;  1D7E A;  1C3B A;  4GOG A;  4MN7 A;  2BLS A;  2XDM A;  3LUQ A;  4KZ7 A;  3UDX A;  1FSW A;  3U2A A;  3GSG A;  1FCM A;  4C75 A;  5EVE A;  5DF8 A;  2JKR M;  5CEB A;  3H9W A;  1PWG A;  1CEG A;  5AJG A;  3E2L A;  3RXW A;  1LL9 A;  4U3T A;  4EQI A;  4E3M A;  1PW1 A;  5HAR A;  2W3E A;  2K2N A;  3VE3 A;  3Q7V B;  4JGQ A;  4IJG A;  2GDN A;  1WE4 A;  5HW3 A;  2EWW A;  3B42 A;  5CXW A;  1PI5 A;  3QP4 A;  5I94 A;  4WEJ A;  2ZOI A;  4MCW A;  2XRN A;  5E2E A;  2P74 A;  5FA7 A;  4WM9 A;  5IU1 A;  2WKR A;  1ALQ A;  4GB7 A;  3LIA A;  2EX9 A;  2PYP A;  3HL9 A;  1BLH A;  4EEU A;  1V9Y A;  5AQA A;  3T1X A;  1AXB A;  1MZU A;  3FPV A;  5L8M A;  3KYZ A;  2WGV A;  3UPN A;  2PU4 A;  5F68 A;  1VET B;  4N1X A;  3Q07 A;  2G2U A;  3UE1 A;  3IWQ A;  3ZG9 B;  1BZA A;  3BQA A;  1LHY A;  4E3N A;  1XGJ A;  2OOL A;  5KZH A;  2VZW A;  3A0S A;  4PMA A;  4LEN A;  2Y59 A;  1NLY A;  4FSF A;  3SH9 A;  5FEG A;  3PTE A;  4RX2 A;  3RJU A;  4WN5 A;  4PM9 A;  5J7E A;  2ZC4 B;  1K25 A;  2D01 A;  4GCZ A;  4ARZ A;  4KZB A;  1OJ5 A;  4LPZ A;  3W4Q A;  3HLW A;  4M4X A;  2KDK A;  3NHQ A;  4QHC A;  1WYC A;  4KQD A;  1S4R A;  3ZDJ A;  2D02 A;  1UWP X;  3S4X A;  3T12 B;  3ZG8 B;  2XA7 M;  1ZC2 A;  2WZX A;  3PBR A;  3NEC A;  2YKH A;  3V5M A;  4DN0 A;  3ZVT A;  5K5B A;  4IHQ A;  3NI9 A;  2OV5 A;  4BWI A;  2HJE A;  1YLT A;  2UV0 E;  1T19 A;  3E2K A;  4MEZ A;  3MKE A;  3N8L A;  4JGP A;  2ZD8 A;  2E8J A;  3ZFZ A;  4N92 A;  1WA9 A;  3ZG7 B;  4KZ8 A;  3RH8 B;  4X25 A;  2Q9M A;  3QP8 A;  1ES5 A;  1H8Y A;  3MQO A;  3IH8 A;  2ZL1 A;  1YLJ A;  3LIF A;  4ZJ3 A;  5L10 A;  3WS4 A;  3SZT A;  2J3T C;  3W4P A;  2Y2P A;  3IXG A;  5TBM B;  4DDS A;  4YNR A;  1FSY A;  2PDR A;  5BOH A;  3E98 A;  3GRJ A;  4HH3 A;  2PT7 A;  4LV0 A;  1O07 A;  3ZNY A;  4S2P A;  1ESI A;  1W63 M;  5HWT A;  1K6S A;  3MFD A;  4N9L A;  4BLM A;  3N6I A;  2PBY A;  3GVB A;  2M7U A;  4MBK A;  1ERM A;  4D60 A;  4EW7 A;  3FWL A;  3UB9 A;  2ZMA A;  2P08 A;  1T18 A;  4IED A;  4YIN A;  2G7U A;  2J80 A;  3VSK A;  3EWK A;  5GLD A;  2ZQD A;  3T4Q A;  4S2O A;  2OLU A;  1TS7 A;  3HUO A;  4R6L A;  4Y0O A;  4FD8 A;  4B4X A;  4S2I A;  3D72 A;  4FH4 A;  3IX4 A;  2DNS A;  4QPR A;  4EV4 A;  2J9O A;  1VHM A;  3C4O A;  3V3S A;  1GSW A;  3IX3 A;  2PD8 A;  4NXB A;  3CLO A;  2CMN A;  1K6R A;  1OME A;  4KQR A;  2FZ0 A;  3IBR A;  1H3Q A;  1KE4 A;  3MXS A;  1STZ A;  5HSQ A;  3T1Q B;  3PR6 A;  2V9A A;  4Y7P A;  1W79 A;  3NC8 A;  4NEE D;  3MSH A;  2B18 A;  1XX2 A;  2X02 A;  4Z1W A;  4ARZ B;  4I5S A;  1YQS A;  3Q1F A;  3A3I A;  2PD7 A;  4ZBE A;  3N7W A;  2X71 A;  3UME A;  1CF0 A;  4RA7 A;  3DBA A;  1UGU A;  4WMC A;  5EV0 A;  4JBF A;  3S7P A;  5DJU A;  4JLF A;  4PKY A;  5TGF A;  2QPN A;  3PBO A;  3HBR A;  1K54 C;  3ITB A;  1FCO A;  4WL9 A;  1ODV A;  1CQA A;  5F1F A;  2JKT I;  2HDR A;  5IHV A;  3SS3 A;  4BBT A;  5A92 A;  2NUP C;  2Z2M B;  1HD8 A;  1K57 C;  2QKP A;  3IHB A;  3MBZ A;  3MXR A;  1XFQ A;  3K3C A;  1N9B A;  4KZA A;  3W2Z A;  4ID4 A;  4BMW A;  1DJA A;  1PRQ A;  3LFV A;  4P6Z M;  4ETX A;  3EEH A;  2ZL1 B;  2B5R A;  1QMF A;  4FOF A;  4LRX C;  2VGL M;  1MPL A;  3WS5 A;  2VK3 A;  4NXF A;  4S2K A;  4X1L A;  4OQH A;  4ZAM A;  3T4T A;  1S66 L;  1YKD A;  5EVI A;  1ERO A;  4E6X A;  4UAA A;  2I72 A;  2O9A A;  3OCL A;  4GNU A;  4Q0J A;  3K3D A;  1NZU A;  3MFX A;  1H5X A;  3Q81 A;  3MS6 A;  2Y8H A;  2ZQC A;  4MLL A;  2VGK A;  1P0Z A;  3OPL A;  4S2N A;  1HVB A;  4Z9Q A;  2HDU A;  4WZ5 C;  2Z6D A;  3LI8 A;  5F83 A;  4RX3 A;  2V20 A;  5HDS A;  1VM1 A;  2GNX A;  4PAU A;  2HF6 A;  1OTA A;  4P87 A;  2H0Y A;  1SCW A;  3T4S A;  1IFQ A;  3I7J A;  3PBS A;  3T50 A;  4DKI A;  1G28 A;  4EBP A;  1N9N A;  4HI4 A;  5E2G A;  1E4D A;  2VJW A;  2XGN A;  3NBL A;  4KZ6 A;  4S2L A;  5TJJ A;  2VV6 A;  3OLO A;  2PR5 A;  5M19 A;  1LLB A;  1GA0 A;  4KEN B;  4KZ5 A;  2W3D A;  3NDG A;  5G4Y A;  1YSP A;  3LR5 A;  1DY6 A;  2LB5 A;  3HRE A;  1CK3 A;  2ZQA A;  4HJ4 A;  5AVE A;  4R4R A;  1I2S A;  5HD5 A;  2HP5 A;  4FTX A;  1S0W A;  4H6J A;  2JN7 A;  5M1A A;  3KSI A;  1H0M A;  4HJ6 A;  2JKT M;  4CLC E;  1YLW A;  4EQ1 A;  2X01 A;  3HLC A;  4JXW A;  4DE1 A;  1P97 A;  3G2Y A;  5FI7 A;  2J3W A;  3PYP A;  3C5A A;  3AGF A;  3VFH A;  3NOU C;  2L1M A;  2V1A A;  4DDY A;  1FQG A;  4OLD A;  2W1T A;  4WBG A;  3IF6 A;  4PPR A;  2W3H A;  1M40 A;  1E3U A;  4JPM A;  4KUK A;  1BSG A;  4XXR A;  3G35 A;  1LL8 A;  4KZ9 A;  1I5Q A;  4AFI A;  1Y28 A;  1YAX A;  3UB8 A;  2PAV P;  5J4E A;  4R38 A;  1N4O A;  4U0X A;  1G5U A;  5FEF A;  4N9K A;  4QJG A;  2PHY A;  1GHM A;  2Y2G A;  2ZC5 B;  1LI9 A;  4S2J A;  3G6O A;  3FKW A;  4EEP A;  4UEY A;  2Y2H A;  3EGX C;  1F2K A;  2EXA A;  2XSS A;  3VV4 A;  4UQI S;  4OPY A;  4QY5 A;  3PHY A;  1T1A A;  5L07 A;  3IF5 A;  2FH5 A;  2IWC A;  4GZB A;  1CI9 A;  1FIL A;  1K4F A;  2Y2I A;  2HDQ A;  3IBJ A;  1TS8 A;  3A3E A;  2QWS A;  3O87 A;  5A93 A;  3S7O A;  4DE2 A;  1DP9 A;  1LSX A;  3CPT A;  2KLI A;  3DWK A;  3SW1 A;  5EVI B;  1EW0 A;  4CJN A;  2M1C A;  5CGW A;  2P04 A;  3PXP A;  1OT9 A;  2Z6C A;  3UPP A;  1W5D A;  3MZE A;  5F6A A;  4NKP A;  2BG1 A;  5F69 A;  5HAI A;  1WYB A;  2P9V A;  4X53 A;  2NUT C;  2ZM8 A;  1S67 L;  4GLQ A;  3DTK A;  5FQ9 A;  4O7D A;  4C3Q A;  1BT5 A;  2PU2 A;  1XA7 A;  3H7W A;  3E4Q A;  2ZC3 B;  5GHX A;  3QNC A;  4B9O A;  1TEM A;  5U47 A;  2PRF A;  4L9G A;  3W8K A;  4Y5F A;  2EX6 A;  2OWH A;  3H82 A;  2WAF A;  3GQZ A;  2O9C A;  4X69 A;  3CWF A;  1JVJ A;  4EWF A;  3BY9 A;  3JVU A;  3V3R A;  1ES4 A;  1GHP A;  4KG2 A;  1N9L A;  4OPZ A;  4H8R A;  3MZF A;  3ZYT A;  5HPI A;  2HV1 A;  2CC1 A;  3CJM A;  3UMD A;  4HH2 A;  3T4K A;  1HLU P;  2EX8 A;  3VE4 A;  4DF6 A;  1YMS A;  3LIC A;  3UDF A;  2O9B A;  4WF0 A;  3KYE A;  1I2W A;  1SDE A;  3C2W A;  4H6J B;  5HDC A;  3F1O A;  5FDH A;  1XJ2 A;  2QJ5 A;  2PR6 A;  3G30 A;  4GDB A;  3UN7 A;  1W8Y A;  2ACG A;  2HGV A;  3IS2 A;  1CI8 A;  2EFU A;  1LL5 A;  3JPU A;  3LID A;  1FR1 A;  3ISG A;  3A3F A;  3OBF A;  2W1T B;  1XP4 A;  4OLG A;  3IF6 B;  4EBN A;  2VX8 A;  5JYP A;  4E3J A;  3NOT C;  3LEQ A;  3QP6 A;  5CTN A;  3MZD A;  1ERQ A;  4IBR A;  3IHA A;  5L09 A;  5KSH A;  2RCX A;  1TVF A;  3KX0 X;  4ZJ2 A;  3BFG A;  2LB9 A;  1W63 Q;  4Y0T A;  2QHK A;  5FQQ A;  2EA9 A;  2Z2L B;  1KOU A;  4BL2 A;  4WMC D;  4B4Z A;  3SS4 A;  1SHV A;  1DJC A;  2XQZ A;  2V8F A;  3WRZ A;  5CTM A;  3T4L A;  1YLP A;  4R23 A;  2HZ5 A;  4DE0 A;  2WKI A;  4LCL A;  2VA0 A;  4NET A;  2FFY A;  3D9Y A;  3VOY A;  4ME4 A;  1F5M A;  3A3D A;  4DMZ A;  3K2N A;  3VP0 A;  1BTL A;  2A24 A;  4MNR A;  2A3U A;  2W1R A;  2M7V A;  1GSV A;  3T4J A;  2HPB A;  3S7Q A;  3LGO A;  1VEU A;  1O7E A;  2P7J A;  5DTS A;  4CQH A;  3G32 A;  1MWS A;  3TJZ C;  3DTM A;  3LR0 A;  5GLB A;  3WS1 A;  1L2S A;  4PM8 A;  4OPR A;  2AVX A;  4GKU A;  3S22 A;  1NRJ A;  1W7F A;  4JF5 A;  5EVI D;  1BUE A;  1XGI A;  2ZQ9 A;  5CER A;  2DMW A;  5FL3 A;  3SS5 A;  2P9V B;  2VV8 A;  4KG5 A;  4Y3I A;  5CEC A;  3CG5 A;  5JYO A;  3M6B A;  1L0E A;  3PAG A;  1RGZ A;  4HIA A;  1BLC A;  5G18 A;  5EFW A;  3G34 A;  5EM1 A;  3H7W B;  4CPK A;  2V8C A;  4YFM A;  2ZJ9 A;  4G3K A;  1MBL A;  2XD1 A;  3MJQ A;  4LGW A;  3UDI A;  4N1H A;  1DRM A;  5EOE A;  4JGR A;  1G68 A;  2V0U A;  5EVI C;  1RCJ A;  3MXQ A;  4LV2 A;  5TFQ A;  2UWX A;  1PWD A;  5FQJ A;  4R70 A;  4II7 A;  1OTD A;  4LV3 A;  4ZTK A;  3RTY A;  5CGS A;  2XK1 A;  1TS6 A;  4S2N C;  1NY0 A;  5AQ9 A;  4HHD A;  5DFX A;  4EUZ A;  4QD4 A;  3VSL A;  4A5R A;  3HCY A;  2ZOH A;  2Y2Q A;  5HZH A;  5F82 A;  2ZC7 A;  1K38 A;  4K91 A;  3B33 A;  4DJ2 A;  2WUQ A;  4IVI A;  4QU3 A;  3TRC A;  4OVD A;  1NYY A;  3EQV A;  3VOZ A;  2DCF A;  3ICY A;  4HJ3 A;  3TG9 A;  2XH9 A;  4B93 A;  3DTE A;  3UE0 A;  4OON A;  2WGI A;  4RVA A;  4MN5 A;  4KZ3 A;  1E3U D;  5LBR A;  1Y54 A;  3HJK A;  4U0T A;  3EEA A;  2XRO A;  2WAD A;  4WZ4 A;  5MC7 A;  4HP9 A;  4X56 A;  1ONH A;  2IWD A;  4EUV A;  1XJ6 A;  2B02 A;  3IWI A;  5DJT A;  1YPR A;  1JWP A;  1CJF A;  1NXY A;  3D3O A;  4S2M A;  1PFL A;  3C4P A;  3BLS A;  4BBV A;  1V9Z A;  2J8Y A;  3CMZ A;  1OTI A;  4OQ0 A;  3IF6 C;  2W0N A;  3DTI A;  4CLC A;  3MMH A;  2C6W B;  2R9W A;  4EBL A;  3BY8 A;  1MWU A;  3UO9 A;  3LY4 A;  3E0Y A;  3FKV A;  1VEU B;  1XJ4 A;  3IXB A;  1KGE A;  4JKT A;  5I5L A;  4XUX A;  2OAQ 1;  3ZGA B;  1KE0 A;  3SH7 A;  2W3F A;  2Y2L A;  4UHU A;  4ZJ1 A;  1XFN A;  4LFU A;  1NWZ A;  4WLA A;  4UA9 A;  2Y2N A;  3VFF A;  3VP3 A;  3QP2 A;  2MJ6 A;  4PKY G;  2Y2M A;  5E2H A;  4E3I A;  2JBF A;  2ZLY A;  1RGY A;  1SKO A;  5FQM A;  4R4S A;  3BRM A;  4EER A;  1W8Q A;  3ZG5 A;  2QZ6 A;  4O0P A;  2ZC6 B;  4D2O A;  2ZQ8 A;  4EXO A;  2XEP A;  4I3A A;  3D4F A;  4KQQ A;  2O0Y A;  1KDS A;  5CED A;  1AWI A;  4JXS A;  3OPH A;  3LCE A;  3FV7 A;  4KG6 A;  5HAQ A;  3LR3 A;  4G3W A;  2WKH A;  4EES A;  1PI4 A;  4MBF A;  1SDN A;  5GHY A;  1PWC A;  1IYP A;  2EX2 A;  4HES A;  2J7V A;  3U4L P;  3OPP A;  3UE6 A;  5J3W A;  1ES2 A;  5EUA A;  3UNW A;  2RL3 A;  4Y17 A;  1OTE A;  4XT2 A;  4KUO A;  5HAP A;  5L2F A;  3FZC A;  3OPR A;  4L0L A;  3P01 A;  4JXV A;  5HL6 A;  1BUL A;  2A49 A;  3DWZ A;  2EXB A;  3ZNT A;  3B47 A;  4PM7 A;  1FIK A;  4GD8 A;  1ACF A;  4LRZ E;  2VGJ A;  1PW8 A;  4GDN A;  1ES3 A;  2EWV A;  1F98 A;  1MC0 A;  2V2F F;  5CHM A;  2KOI A;  1ZTU A;  3KSH A;  4P0M A;  1VQQ A;  4MBH A;  4WEL A;  5FAS A;  4R3B A;  3MQ0 A;  3IXD A;  1YLY A;  5DF9 A;  3C38 A;  1MKI A;  4R3A A;  1T1C A;  2QJ7 A;  3O3V A;  4DRT A;  5GLA A;  3G2Z A;  1IYO A;  5HL1 A;  1CEF A;  1MKM A;  5DF7 A;  4JF4 A;  1IEM A;  3W4O A;  3UE3 A;  3B3X A;  5GHZ A;  1IKG A;  5CHJ A;  1K55 A;  3TW8 A;  3JYI A;  3UB6 A;  1MXO A;  4G3V A;  2W3G A;  4K08 A;  2QYB A;  1T1B A;  2VKS A;  4GW9 A;  4CLC B;  4E3K A;  2E8I A;  4HY8 A;  4BD1 A;  3RFB A;  2H5S A;  2XA7 S;  2Q0O A;  2JC7 A;  3UY6 A;  3UB5 P;  1PYY A;  1EWZ A;  3BYD A;  4JXG A;  4IUK A;  1X0O A;  2OWJ A;  5A90 A;  4OOY A;  2BTF P;  2OSU A;  3OOV A;  1TDL A;  3GDI A;  4LV1 A;  5E43 A;  1GA9 A;  3BEB A;  1NYM A;  2WYX A;  1L3L A;  3LIB A;  4OP8 A;  1S1Z A;  3IQA A;  2XD5 A;  4Q8I A;  3MF0 A;  1Q2P A;  5DFY A;  1L0G A;  1SKF A;  3LYX A;  1SKO B;  1FR6 A;  3P09 A;  2JKF A;  2ZQ7 A;  1GCE A;  2Y4A A;  4I38 A;  2KX6 A;  4IVK A;  4BBU A;  1TDG A;  3NUL A;  2ZMV A;  3F1P A;  2O99 A;  1ESU A;  3PAE A;  3Q82 A;  1KGG A;  4FCF A;  1DP6 A;  1XPB A;  5TBM A;  4PHT A;  4DJ3 A;  5EE8 A;  4LCM A;  4QB8 A;  4DE3 A;  5HWV A;  1E25 A;  4KZ4 A;  1GHI A;  3NCK A;  3N8S A;  5EM0 A;  4JGO A;  3NY4 A;  3LI9 A;  1ZG4 A;  4OH0 A;  4BQM A;  1LT0 A;  5F1G A;  2WAE A;  4R1G A;  1D06 A;  4Q0H A;  2VV7 A;  1PZP A;  4RYE A;  4OP5 A;  4F3L A;  5CRF A;  3O86 A;  4XT2 B;  4WUJ A;  3QNB A;  1Z6F A;  4BL3 A;  4GD6 A;  3VP4 A;  5DKL A;  1K4E A;  4B88 A;  1S1Y A;  5DVA A;  3HLG A;  1JTG A;  2B95 A;  1OPX A;  3A3J A;  4I39 A;  3LIE A;  2WKQ A;  3MKF A;  5J8X A;  5AVF A;  4NG2 A;  1P9R A;  3BLM A;  1FOF A;  4DXC A;  3FC7 A;  2G2W A;  2XR0 A;  2IA2 A;  4EU0 A;  5HD3 A;  4FH2 A;  5GL9 A;  1HTZ A;  4UA6 A;  1S6R A;  2JE5 A;  4HNB A;  4NXE A;  5FI6 A;  2ZMF A;  5FAO A;  5FQI A;  4O8G A;  3G31 A;  3OCN A;  3CI6 A;  2V1Z A;  5FI2 A;  2H28 A;  3C8C A;  1OT6 A;  3LO7 A;  1YT4 A;  2ZM0 A;  3HVF A;  4GJ4 A;  3SH8 A;  2XF3 A;  3P7N A;  3KSF A;  1HZO A;  5EEC A;  3VP2 A;  1D1J A;  3ITA A;  2GZA A;  4CLC D;  1YLZ A;  1KDW A;  3CUE A;  1JTD A;  5DTT A;  2WZZ A;  1JNU A;  3HLF A;  2H10 A;  1OJG A;  2J3T D;  3UB7 A;  4OOM A;  1DP8 A;  3C30 A;  4UQI M;  5HFO A;  4P6Z S;  2JHE A;  3CPT B;  1K0K A;  5IS1 A;  4PM5 A;  2VGL S;  5FDS A;  4OPQ A;  4CLC C;  4EET B;  3V67 A;  3VOL A;  2IWB A;  2K7S A;  4K0X A;  4KQO A;  3WRT A;  3TOI A;  4OQI A;  4BD0 A;  4HP4 A;  4O01 A;  2Y2O A;  3WS0 A;  3F1P B;  4I3I A;  4Y2F A;  5C5K A;  4FUW A;  4X6T A;  4HEF A;  4QWO A;  4ZRR A;  2VLG A;  1Q2Q A;  1NZO A;  3H82 B;  2I9V A;  1ZHH B;  4X1M A;  2V1B A;  3ZQ5 A;  3HLE A;  5IT5 A;  3V50 A;  1K56 D;  2JKG A;  4HBU A;  1QME A;  4Y15 A;  3QHY A;  5DKK A;  4DXB A;  2J9P A;  3A0V A;  3BFF A;  4F3L B;  1IKI A;  3R7W A;  5D3O A;  1MY8 A;  3NOP C;  1J3W A;  5HX9 A;  3MQQ A;  3T4O A;  3BFE A;  3EOI A;  3C7U A;  3HLB A;  5FAT A;  3PBT A;  3TE8 A;  3M2K A;  2R78 A;  1NLZ A;  1ONG A;  4OKP A;  4Y0U A;  3F1O B;  3BWL A;  3M2J A;  5A91 A;  4P6B A;  3IS2 B;  5KSC A;  4IUH A;  2Q9N A;  4MMN A;  4HOI A;  3BW6 A;  4NXG A;  1M6K A;  2EFX A;  4XUZ A;  1KGF A;  2VEA A;  4BJP A;  2GJ3 A;  2Y2J A;  4WYY A;  3N4I A;  5G4Z A;  5HPF A;  3VP1 A;  2BAS A;  2ZM2 A;  3NDE A;  4HBT A;  3FYZ A;  2WKE A;  5AQ7 A;  3AGD A;  4OOL A;  4ESP A;  3ULF A;  1KE3 A;  1ZG6 A;  3DAV A;  1KVL A;  3P98 A;  2Y79 A;  1BLS A;  3GEC A;  1XXM A;  5DTK A;  4BEN A;  3IWO A;  3WWX A;  2XFS A;  3HUM A;  3R4K A;  3ZHH A;  3IH9 A;  4GS9 A;  4L9E A;  3NIA A;  4QY6 A;  4L9F A;  1YM1 A;  1YMX A;  2A24 B;  3HUN A;  3LR4 A;  3EGD C;  1BYW A;  3S1Y A;  1OTB A;  2L0W A; 
#chains in the Genus database with same CATH homology
 3ZYT A;  5HPI A;  2PDR A;  3MQ0 A;  2HV1 A;  2PYR A;  5DF9 A;  3MR0 A;  3FPW A;  3UMD A;  4HH2 A;  3E98 A;  3C38 A;  3T4K A;  3F1N A;  4R3A A;  4HH3 A;  1T1C A;  2QJ7 A;  3VE4 A;  2PT7 A;  2ZBB A;  3CIT A;  3LIC A;  4GHI A;  2O9B A;  4WF0 A;  1F9I A;  1W63 M;  1MKM A;  5HWT A;  3E4P A;  3C2W A;  3UE3 A;  4MN6 A;  4HQA A;  4H6J B;  5HDC A;  3F1O A;  2M7U A;  3TW8 A;  3UB6 A;  1XJ2 A;  2QJ5 A;  2PR6 A;  2W27 A;  3BQ8 A;  4G3V A;  4EW7 A;  2W3G A;  4K08 A;  3PBN A;  2QYB A;  1T1B A;  2VKS A;  3UB9 A;  4GW9 A;  4CLC B;  2P08 A;  3HJI A;  1T18 A;  4HY8 A;  3RFB A;  1GSX A;  2HGV A;  2XA7 S;  5HWW A;  3IS2 A;  2G7U A;  2J80 A;  3LID A;  3EWK A;  3KYQ A;  3KO6 A;  3OBF A;  1S4S A;  2W1T B;  4IUK A;  3KSG A;  1X0O A;  2OWJ A;  3T4Q A;  2VX8 A;  1G6O A;  4YWZ A;  3NOT C;  1TS7 A;  4R6L A;  3OOV A;  4LLO B;  3GDI A;  3D72 A;  5KSH A;  3KX0 X;  4E04 A;  4QPR A;  2HJ9 C;  1VHM A;  3OC2 A;  3LIB A;  1TF1 A;  1GSW A;  2V0W A;  1S1Z A;  2LB9 A;  1W63 Q;  1TS0 A;  2QHK A;  2EA9 A;  3MF0 A;  1KOU A;  2PD8 A;  5DFY A;  4NXB A;  3CLO A;  3LYX A;  3R7W B;  3E4O A;  2CMN A;  3BJN A;  3CAX A;  2FZ0 A;  3T4L A;  4I38 A;  2OAP 1;  2KX6 A;  5F5Y A;  2VA0 A;  3IBR A;  1H3Q A;  4ME4 A;  4BBU A;  1F5M A;  1STZ A;  5HSQ A;  4DMZ A;  3K2N A;  2ZMV A;  3F1P A;  2O99 A;  3A0R A;  2A24 A;  3PR6 A;  1LSW A;  5HDD A;  2V9A A;  1DP6 A;  3NJA A;  5TBM A;  2W1R A;  2M7V A;  4PHT A;  4NEE D;  4DJ3 A;  1GSV A;  3T4J A;  5KIZ A;  4RQ9 A;  3S7Q A;  2B18 A;  5HWV A;  4Z1W A;  2P7J A;  4ARZ B;  4I5S A;  4JGO A;  4WEK A;  2A2L A;  4CQH A;  4Q0I A;  3TJZ C;  3LI9 A;  3LR0 A;  2L4R A;  1LT0 A;  2PD7 A;  1XJ3 A;  3UME A;  1NRJ A;  3DBA A;  1UGU A;  1D06 A;  3JVV A;  4Q0H A;  2VV7 A;  2YKF A;  2DMW A;  3S7P A;  4F3L A;  2JKR I;  5DJU A;  5FL3 A;  4ETZ A;  2K31 A;  4PKY A;  4XT2 B;  4WUJ A;  1H8M A;  2VV8 A;  4Y3I A;  3PBO A;  4WL9 A;  1ODV A;  5DKL A;  4HIA A;  2JKT I;  1S1Y A;  5EFW A;  4BBT A;  3H7W B;  2NUP C;  1OPX A;  4I39 A;  4LRY C;  5A8B A;  3LIE A;  2WKQ A;  2QKP A;  4G3K A;  5AVF A;  3EQU A;  1P9R A;  3MJQ A;  3FC7 A;  1XFQ A;  3K3C A;  3W2Z A;  4I3J A;  4GS9 B;  4BMW A;  2IA2 A;  1DRM A;  3LFV A;  4P6Z M;  4JGR A;  5HD3 A;  4EU0 A;  4ETX A;  2V0U A;  3EEH A;  1UWN X;  3MXQ A;  4LRX C;  4FOF A;  2VGL M;  1YSQ A;  4HNB A;  4NXE A;  4NXF A;  1N9O A;  2ZMF A;  1VB6 A;  3T4T A;  4R70 A;  1S66 L;  1IOU A;  1YKD A;  4II7 A;  4O8G A;  1OTD A;  3OCN A;  3RTY A;  3F1N B;  3CI6 A;  2INW A;  1TS6 A;  2O9A A;  3OCL A;  2H28 A;  3C8C A;  4Q0J A;  1OT6 A;  3K3D A;  3MFX A;  1P9W A;  4GHI B;  1TD5 A;  4GJ4 A;  2Y8H A;  4HHD A;  5DFX A;  1LSV A;  2WKP A;  1P0Z A;  3P7N A;  3S7N A;  3KSF A;  4YOF A;  3O5Y A;  3FG8 A;  3HCY A;  2ZOH A;  2Z6D A;  3LI8 A;  5HZH A;  3CUE C;  5HDS A;  4YNR A;  2GNX A;  3B33 A;  4DJ2 A;  5CX7 A;  2GZA A;  2HF6 A;  1OTA A;  4PAU A;  3TRC A;  3PBQ A;  3EQV A;  4MDZ A;  4CLC D;  3T4S A;  1IFQ A;  2GX5 A;  3ICY A;  3PBS A;  4HJ3 A;  3T50 A;  3CUE A;  4B93 A;  1JNU A;  1G28 A;  1N9N A;  4HI4 A;  2VJW A;  5TJJ A;  1D7E A;  2VV6 A;  3OLO A;  2PR5 A;  4MN5 A;  5LBR A;  1OJG A;  2J3T D;  4MN7 A;  3HJK A;  2W3D A;  3UB7 A;  4OOM A;  3EEA A;  3LUQ A;  2XRO A;  1DP8 A;  3C30 A;  5MC7 A;  5G4Y A;  4UQI M;  4HP9 A;  3U2A A;  1YSP A;  3LR5 A;  2LB5 A;  4EUV A;  1XJ6 A;  4P6Z S;  2B02 A;  2JHE A;  2JKR M;  5IS1 A;  3H9W A;  5DJT A;  4HJ4 A;  5AVE A;  5AJG A;  2VGL S;  5HD5 A;  4CLC C;  3D3O A;  4EET B;  4H6J A;  3V67 A;  2JN7 A;  1V9Z A;  4BBV A;  3KSI A;  3VOL A;  4HJ6 A;  2JKT M;  2W3E A;  2K2N A;  3VE3 A;  2K7S A;  4CLC E;  4JGQ A;  4EQ1 A;  1OTI A;  4KQO A;  4IJG A;  2W0N A;  4HP4 A;  4O01 A;  4CLC A;  1P97 A;  3MMH A;  2J3W A;  2EWW A;  3F1P B;  4I3I A;  3B42 A;  3PYP A;  4Y2F A;  3BY8 A;  5C5K A;  3NOU C;  2L1M A;  2V1A A;  4ZRR A;  2W1T A;  2ZOI A;  4MCW A;  4WEJ A;  2XRN A;  2W3H A;  2VLG A;  3E0Y A;  4KUK A;  5IU1 A;  1XJ4 A;  3H82 B;  2I9V A;  2WKR A;  1ZHH B;  5I5L A;  3LIA A;  2OAQ 1;  2V1B A;  2PYP A;  3ZQ5 A;  2W3F A;  1LL8 A;  5IT5 A;  4EEU A;  1V9Y A;  1XFN A;  4AFI A;  1NWZ A;  4WLA A;  1Y28 A;  1YAX A;  1MZU A;  3FPV A;  3UB8 A;  5L8M A;  3KYZ A;  5DKK A;  2MJ6 A;  4PKY G;  5F68 A;  5J4E A;  3A0V A;  4R38 A;  4F3L B;  3R7W A;  2PHY A;  3BQA A;  3NOP C;  4EER A;  3MQQ A;  3T4O A;  3G6O A;  3EOI A;  2OOL A;  4O0P A;  4EEP A;  2VZW A;  3A0S A;  4UEY A;  3EGX C;  3PBT A;  3TE8 A;  4EXO A;  2XSS A;  3VV4 A;  4UQI S;  2R78 A;  1NLZ A;  1NLY A;  4FSF A;  4I3A A;  3F1O B;  3PHY A;  3BWL A;  1T1A A;  2O0Y A;  4WN5 A;  2FH5 A;  5J7E A;  2D01 A;  4GCZ A;  4ARZ A;  3LR3 A;  3IS2 B;  1OJ5 A;  4G3W A;  3IBJ A;  4LPZ A;  4M4X A;  1TS8 A;  4EES A;  4IUH A;  2KDK A;  3NHQ A;  4HOI A;  4MMN A;  2QWS A;  3BW6 A;  4NXG A;  4KQD A;  1S4R A;  3S7O A;  1DP9 A;  1LSX A;  2VEA A;  2KLI A;  3SW1 A;  4BJP A;  1EW0 A;  2GJ3 A;  2M1C A;  5G4Z A;  2D02 A;  3UE6 A;  5HPF A;  1UWP X;  2P04 A;  3PXP A;  5J3W A;  2XA7 M;  2BAS A;  1OT9 A;  2Z6C A;  3PBR A;  5F6A A;  1OTE A;  4NKP A;  4XT2 A;  4KUO A;  5F69 A;  2YKH A;  4OOL A;  2NUT C;  1S67 L;  3ULF A;  4GLQ A;  4DN0 A;  5K5B A;  4L0L A;  4IHQ A;  2Y79 A;  4BWI A;  3GEC A;  3H7W A;  3P01 A;  2HJE A;  3E4Q A;  5HL6 A;  1T19 A;  4B9O A;  4L9G A;  4JGP A;  4Y5F A;  3B47 A;  1WA9 A;  2OWH A;  3H82 A;  3R4K A;  4LRZ E;  4GS9 A;  2O9C A;  4L9E A;  3RH8 B;  4L9F A;  2EWV A;  3CWF A;  1F98 A;  3MQO A;  1MC0 A;  2KOI A;  2A24 B;  3LR4 A;  1ZTU A;  3LIF A;  3BY9 A;  3JVU A;  3KSH A;  3EGD C;  1BYW A;  2J3T C;  1N9L A;  5TBM B;  1OTB A;  2L0W A;  4WEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...