4FOFA

Crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
AVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASLHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
publication title A Photo-Labile Thioether Linkage to Phycoviolobilin Provides the Foundation for the Blue/Green Photocycles in DXCF-Cyanobacteriochromes.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 56
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2012-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4fofA00
3S7NA 4CQHA 1YKDA 2XRNA 5HSQA 4G3WA 1MKMA 4GW9A 4Y2FA 3NHQA 3E98A 4DN0A 2B18A 1STZA 2VZWA 2W3DA 5DFXA 2O9AA 4YNRA 3R4KA 1VHMA 5HPFA 3C2WA 2M7VA 4LRZE 2QYBA 4DMZA 4RQ9A 1TD5A 5TJJA 3KSHA 2IA2A 3MQ0A 2O99A 2W3GA 3CITA 4Q0HA 3MF0A 2W1RA 3NOUC 2W3HA 3NOTC 1YSQA 4GLQA 4IJGA 4EU0A 3LFVA 2W3FA 2KOIA 4LRXC 2LB9A 2K31A 3BJNA 3W2ZA 4YOFA 5LBRA 2VEAA 2XROA 3TRCA 3DBAA 3E0YA 4MDZA 4R6LA 5L8MA 5K5BA 3CI6A 2O9CA 3KSGA 4MN7A 3D3OA 3KSIA 4ME4A 2W1TA 3S7QA 1ZTUA 5I5LA 2Y8HA 3HCYA 3NOPC 2W1TB 3K2NA 5HPIA 4FOFA 2KLIA 3O5YA 2XSSA 2Y79A 4G3VA 2HGVA 4Y5FA 5AJGA 4PAUA 4O8GA 3MMHA 3KO6A 4IUHA 3OOVA 2ZMFA 4Q0IA 3IBJA 2VJWA 4G3KA 1F5MA 4MMNA 3EEAA 4MCWA 4Y3IA 3ZQ5A 2GX5A 1TF1A 4ZRRA 3VV4A 3OBFA 1YSPA 4O0PA 4R70A 2M7UA 4LRYC 1MC0A 4Z1WA 3S7OA 4BWIA 4ETXA 4E04A 2W3EA 3KSFA 2VKSA 4ETZA 3S7PA 5HL6A 2OOLA 5DFYA 4IUKA 4EUVA 2K2NA 3IBRA 4QPRA 3G6OA 4Q0JA 3RFBA 4O01A 5C5KA 2G7UA 2LB5A 2O0YA 2O9BA
chains in the Genus database with same CATH superfamily
2X02A 4G3WA 2RCXA 3SW1A 4X56A 5FQ9A 3MQOA 2EWVA 3MZFA 4MEZA 4QD4A 1T1BA 4N1XA 4X55A 1SDNA 3Q7ZA 4BL3A 1H0MA 4EBPA 2M7VA 1K6RA 4WMCD 5A92A 1GHPA 5EVIC 2H10A 3BLMA 2BLSA 4Q0HA 4JGOA 1FR6A 5M18A 4JGQA 4JXSA 4OPZA 2B95A 1XGJA 1KGFA 4RA7A 3TJZC 3VMAA 4BQMA 3BJNA 3LIDA 4F3LB 4KZ9A 3TW8A 4NEED 4EBNA 2OLUA 3FC7A 2Y2NA 3IXDA 3BFGA 3LR5A 4B88A 4IVIA 1YLTA 1RP5A 2V0WA 1UWPX 3ICYA 3W8KA 3MMHA 3EGXC 3KYQA 4K91A 3GSGA 2VJWA 5HWTA 1HD8A 1T19A 4N9KA 2X01A 3MXRA 2W0NA 3HLDA 5HW3A 3LEQA 3DTEA 5D3OA 1D7EA 3V39A 5TR7A 1EI5A 2ACGA 3QP1A 4GZBA 3ITBA 1LL9A 4P6ZS 5E2FA 2XFSA 5E43A 3WS4A 1G28A 4OH0A 1Y28A 3S22A 3MFXA 4IEDA 3NBLA 5EE8A 2O9BA 2OSUA 5GLAA 2WYXA 1XPBA 3WS0A 2J3TC 3WWXA 4CLCE 1P0ZA 4BBUA 2R9XA 3LGOA 3P01A 2Q0OA 1S4RA 4X69A 2L1MA 3BQ8A 4WYYA 3NY4A 1P9RA 2ZM0A 2IWCA 1OMEA 3GMWA 4DMZA 3BW6A 2W3GA 5CECA 5M19A 4OOLA 5DTKA 4HJ4A 1JNUA 3JYIA 4B9OA 3HBRA 3GVBA 5HX9A 1N4OA 3QNCA 3C4OA 2EXAA 2B02A 2H5SA 1IYOA 5KIZA 3VFHA 4C3QA 1NLYA 2LB9A 1YM1A 1NYYA 4R3AA 5IHVA 5DJUA 3EQUA 4GDBA 4MN7A 5FL3A 3F1NA 3O86A 5FAPA 1ONHA 3VE4A 1BZAA 1JWZA 1MXOA 4HJ3A 5GHXA 5F6AA 2V20A 3D9YA 1OT9A 4WZ5A 3GRJA 3IS2B 1TF1A 4HBUA 4NKPA 4HJ6A 4Z1WA 4BWIA 1QMEA 3T1SA 1JTGA 2L0WA 3G30A 1OTAA 5GHYA 4P0MA 3ZDJA 3SS5A 5FQJA 3UE6A 3KYEA 4DJ2A 4BL2A 3UMEA 1SDEA 2A24A 3E4PA 3UE3A 1NYMA 4B4ZA 5IT5A 2LB5A 5HAPA 3GR2A 1PW8A 3W4OA 1HLUP 1SKOB 2XA7M 3UDXA 4ARZA 2EX8A 2FH5A 4KQQA 3GECA 4BBVA 4JLFA 4NXGA 1AXBA 5E2GA 2W3DA 1VETA 4WLAA 3R7WB 5J7EA 2JN7A 5HPFA 5EVEA 3MR0A 2BASA 3LY4A 1GCEA 4HP4A 4LPZA 2JKFA 1PZPA 1F9IA 1NZOA 1K4FA 3MQ0A 2O99A 2QJ7A 4E6XA 4UEYA 1XJ6A 1YSQA 1IEMA 4KZ4A 2J8YA 2JCHA 4U3TA 5CX7A 3QP5A 1XKZA 5KSHA 2FFFB 3A0SA 3RXWA 2Y2OA 2JKRM 3UMDA 2EXBA 4E3IA 3VP0A 2C6WB 4S2NC 2VGJA 3H82B 1OTDA 3M6BA 1NZUA 1ZTUA 4MN6A 3CPTB 4FOFA 3HLEA 2WKQA 5CTNA 1HVBA 1XJ2A 4OQGA 4O8GA 2HDQA 3UDIA 4Q0IA 5CERA 2HDUA 3MS6A 2KDKA 4R4SA 3JPUA 2KX6A 4HY8A 2EX6A 3LYXA 1LSXA 1LHYA 1JWPA 2HZ5A 2J3WA 1ACFA 3IF6C 3K3CA 2DNSA 2QHKA 3RJUA 3LIFA 2ZQAA 1OTIA 1BYWA 1K56A 3IHAA 5KMWA 1TS8A 4X68A 3IHBA 4ZDXA 2VZWA 1HTZA 1FSYA 2D01A 3C7VA 4LRZE 1T18A 3UO9A 3G4PA 3NULA 4I39A 2W3HA 3T4KA 1W8QA 4EQIA 3P7NA 2WGVA 3B47A 3HLBA 1P9WA 4ID4A 4ZJ2A 2K7SA 3F1OA 4Y0TA 3CHWP 5FAQA 4I3AA 2PBYA 3HLFA 4BBTA 4I3IA 1XJ4A 3Q7VA 5EVID 1FIKA 1ZKJA 3NJAA 4EERA 3VP1A 2V8FA 4H6JA 4CLCC 1NRJA 5HFOA 3N7WA 4GS9B 4MMNA 5HARA 1IELA 1FQGA 2XGNA 4HQAA 3HVFA 1F98A 2VV7A 3OLOA 4KZ5A 4E3JA 1KDWA 1ZC2A 2RL3A 1M40A 3M2KA 4QY5A 3T50A 5L10A 2BTFP 2WAFA 2PR5A 4Q8IA 5TFQA 5HL6A 3MXQA 3CZDA 1WYCA 3KYZA 3G6OA 3LY3A 3QP6A 4PPRA 4Q0JA 3PYPA 2Q9NA 5GLDA 2ZQ7A 3HL9A 1LSVA 5AQ9A 5GLBA 3GQZA 3ZNYA 2W27A 3V3SA 3EEHA 3FZCA 3C8CA 3E98A 3QHYA 4KZ7A 2XLNA 5AQBA 2WGWA 4BMWA 2GJ3A 3T1QB 3A3EA 5J3WA 2PAVP 1CQAA 1LL5A 5TJJA 4NG2A 3T4SA 3LIEA 1BTLA 2W1RA 3GV9A 4X1MA 3NOTC 3T4LA 4EEUA 4IVKA 5FATA 3IWOA 3MZDA 1A0KA 4EETB 5CHJA 1XX2A 2J3TD 1NWZA 5EFWA 5FQKA 1WA9A 1FCOA 3FPWA 2O9CA 2JC7A 2MJ6A 4K0WA 3Q82A 4E3NA 1N9OA 2R9WA 1K57A 2XD5A 2XF3A 3NECA 2PT7A 3QP4A 3AGEA 2PD8A 4G3KA 1CI9A 3UY6A 4GHIB 3ZQ5A 1T1AA 4JXVA 4KZAA 4Y0OA 2PYRA 1ESUA 3W4QA 4ETXA 4GD8A 1O7EA 1TS7A 4X53A 3SH9A 2ZQ9A 4S2IA 3IBRA 1RCJA 3G32A 4HOIA 1N9BA 2Q9MA 1NY0A 5DF9A 1S6RA 2A24B 3UB5P 4P6ZM 1BLPA 2GNXA 1H5XA 2Y91A 3NHQA 1W63Q 3Q07A 1VETB 3G2ZA 4XUZA 1VM1A 4CJNA 1TS0A 1YT4A 3ZG9B 2VV6A 4MNRA 1G5UA 3OCLA 2WKIA 4EW7A 3C5AA 1I5QA 2QKPA 1ES3A 4KUKA 4EESA 2ZL1A 1CEGA 4OOYA 3LEZA 4KZBA 5G4ZA 4L9EA 2P9VB 1QMFA 3EGDC 3UNWA 1OJGA 2ZM8A 4ME4A 5GL9A 2EFUA 5CEDA 4R4RA 2M1CA 4G3VA 3V50A 4JPMA 3EWKA 4C75A 4S2MA 3WRTA 4ZTKA 2HDSA 1UGUA 4FCFA 4FH2A 3JVUA 3CJMA 3UB6A 4Y15A 1K6SA 1DJBA 4RX2A 3OPPA 4ZRRA 5EPHA 4GD6A 3OBFA 3U4LP 3PR6A 3S7OA 1YMSA 3QP2A 2WK0A 5CXWA 3RFBA 4KG6A 1N9LA 3PBRA 1E3UD 1FCMA 1ERMA 3ZG7B 3S7NA 5F82A 2HP6A 2HDRA 2XRNA 1H8MA 1MKMA 2ZMAA 4Y2FA 4KZ3A 1DRMA 3V5MA 3MZEA 1GA9A 3BRMA 1K57C 3ZGAB 1GA0A 3C2WA 1XGIA 4X25A 4IHQA 4MBFA 2A2LA 2JKTI 4YFMA 1WE4A 4S2NA 3UPNA 4R3BA 4HBTA 1LI0A 3BFCA 4NETA 1MWSA 4OQHA 3MF0A 1E3UA 2A49A 2ZC3B 3VP4A 3ZYTA 3UB8A 1ZHHB 3HJKA 1IFQA 1L0FA 1CEFA 4RX3A 3PBNA 2PYPA 3MXSA 4OONA 3F1OB 3LO7A 4HESA 3DBAA 4I5SA 2A3UA 4N92A 2HJEA 3C4PA 1XXMA 4QU3A 1W63M 1XJ3A 2HGVA 3Q7VB 5L09A 3PHYA 5GLCA 1RGYA 3IF6A 4H6JB 4OPYA 4D60A 1EWZA 3GDIA 4R70A 4GCZA 4LRYC 4E04A 2L4RA 2W3EA 5F1FA 2C5WB 3NCKA 1FCNA 1LSWA 1IKGA 3DAVA 2OWHA 4XT2A 2XEPA 2XH9A 4GOGA 1W5DA 5EVIB 4JF5A 1YKDA 3VOZA 3SS3A 4Y17A 2QJ5A 4X6TA 4GN2A 1I2SA 3F1PA 4E3OA 2OAP1 1L2SA 3MBZA 3QNBA 5DF7A 3MFDA 2WGWB 3MQQA 2FZ0A 4GNUA 4Y0UA 3ZVWA 4A5RA 1VEUA 3H9WA 3ZFZA 2IA2A 3FKWA 4E3MA 2V2FF 3VSLA 2VA0A 4S2LA 2HP9A 4CLCA 3O87A 4L9GA 4E3KA 3H7WA 1H3QA 3RH8B 1TDGA 2DCFA 4DE3A 1W8YA 2VEAA 2HPBA 3IX3A 1J9MA 1K55C 3HLCA 2INWA 2ZM2A 5AVFA 4M4XA 4LENA 3O5YA 2HV1A 2Y79A 5AJGA 1S1YA 2J7VA 2PHYA 4WM9A 1NJ4A 1P97A 2ZMFA 2DMWA 3G34A 4OQIA 4L9FA 2QZ6A 2EA9A 3HLGA 5HDDA 2UWXA 4X1LA 1BULA 1XP4A 1ES4A 3ITAA 2VGLS 4QHCA 4ETZA 5CRFA 4HP9A 2GZAA 4E6WA 2K2NA 3NIAA 2VK3A 1EW0A 4PM6A 3BFDA 1K56D 4LLOB 1GSWA 1PI5A 4UA9A 2J9OA 1KDSA 3WS2A 3EOIA 4HNBA 2V1BA 4HIAA 1LT0A 2PR6A 1DP8A 4Y7PA 1RGZA 1DY6A 1L0GA 4DN0A 1PZOA 4KZ8A 3QP8A 3FYZA 2O9AA 1ALQA 5HD5A 1OPXA 3ZG5A 2WZXA 4N1HA 1PNEA 2WADA 2ZQCA 5CHUA 1TD5A 1ONGA 3HUOA 4FH4A 2FFYA 2ZMVA 1K4EA 4EEPA 1I2WA 2XQZA 5DTTA 4GLQA 5U47A 4YWZA 4QB8A 5FI7A 4YOFA 2QWSA 1DP6A 1W7FA 4R6LA 4JKTA 3KSGA 3S7QA 2Y8HA 2PD7A 3NOPC 3K2NA 4JF4A 2EFXA 2D02A 3CMZA 3AGDA 2J80A 3ZG0A 4D2OA 2OV5A 4GJ4A 1KVMA 3A3DA 3I7JA 4KQRA 1PI4A 5CTMA 1YSPA 1HZOA 3A0VA 1C3BA 4O0PA 1BT5A 4P85A 4LV1A 3N4IA 5HDSA 1IOUA 1CK3A 4DE2A 4QWOA 4LGWA 2OOLA 3HLWA 3HREA 4NK3A 5HAIA 1ERQA 3LI9A 3UB9A 4WEKA 1BLHA 4OLGA 5EM1A 3E2KA 5TGFA 3UDFA 1CF0A 4XXRA 4IBRA 4C6YA 2P74A 2Y2HA 1FSWA 2V8CA 3TOIA 1Y54A 1KE0A 1H8YA 1STZA 4DXCA 4EV4A 1JWVA 3LR3A 3CAXA 3K3DA 3BFEA 3UE0A 1K54C 1GSVA 2ZC6B 1U60A 2H28A 1S0WA 1LI9A 3IX4A 3VFFA 1MY8A 3VOYA 4IJGA 5CGWA 2W3FA 2E8IA 4UQIS 4MBKA 5E2EA 2XDMA 2WKEA 1VQQA 5LBRA 1KE3A 4NXFA 1FR1A 1XA1A 1YLPA 2W1TA 1LLBA 1EROA 4MN5A 3TG9A 3JVVA 5KSCA 4PM9A 2XSSA 3IF5A 3E2LA 4KUOA 5CGSA 4PAUA 2H0TA 5I94A 1ZG4A 2Y2QA 3AGFA 5A8BA 5EV0A 1F5MA 1D06A 3IF6B 4EBLA 3C38A 3A3FA 3E4QA 4Y3IA 3LR4A 3ZNTA 4B4XA 5DJTA 2VX8A 2Y4AA 2VLGA 4WUJA 3KSFA 3F1NB 2Y2PA 3G31A 4CPKA 4FD8A 3T4OA 1KVLA 4UAAA 4JGRA 4QPRA 4WN5A 1AWIA 2HJ9C 4OQ0A 4R38A 5AQAA 5CGXA 3U2AA 3B3XA 4RVAA 1TEMA 4EWFA 2P7JA 4XT2B 3UE1A 2GX5A 4MBHA 4II7A 4ZBEA 3RTYA 5IS1A 3LI8A 2DRWA 4WL9A 3IXGA 3KX0X 2XK1A 4S2PA 1G6OA 1S66L 4BD1A 3BWLA 3UB7A 3P09A 3MKFA 3H82A 5FQIA 3BYDA 2Z2MB 1V9YA 3RXXA 3KSHA 5A90A 1VEUB 4DKIA 1BLCA 3NOUC 1Q2PA 4ARZB 1K0KA 1KE4A 4WELA 2ZLYA 3S4XA 1MBLA 3C30A 4N9LA 1ES5A 3T4TA 4CLCB 3T4QA 2K31A 3D72A 5L8MA 4DE0A 1S4SA 3V3RA 2JBFA 5DKKA 4HEFA 5DKLA 3IH9A 2PBDP 3IQAA 3BY8A 3G35A 5FEFA 1M6KA 4FSFA 4LV0A 1O07A 3VV4A 3T12B 1PRQA 2VGKA 4M3KA 2V1ZA 2JKTM 2Y2KA 5FSRA 2VKSA 5EOOA 5L07A 3LIAA 1YLYA 4E3LA 3LIBA 5DFYA 2JKGA 4KQOA 3E4OA 3FWLA 4ZAMA 2HP5A 2XFTA 2G7UA 3MJQA 3LICA 3A0RA 3V67A 3FV7A 4KENB 2WUQA 4UA7A 1H8ZA 4GW9A 4ZJ1A 4XUXA 3B42A 2Y2GA 2JHEA 3HUMA 3ZHHA 4S2OA 5F5YA 3CG5A 2ZC7A 1ZG6A 3OPRA 5MC7A 2ZD8A 3FKVA 4DXBA 4GDNA 1K55A 5HL1A 4Y13A 5F1GA 1MWUA 4K08A 1TS6A 4WMCA 4OP8A 1XFQA 4BD0A 1T1CA 4BLMA 4GS9A 3LCEA 5HD3A 2ZQ8A 3VP2A 4PKYA 3VP3A 3E0YA 2YKHA 5K5BA 5EUAA 4EXOA 2R78A 1S67L 5FASA 3BY9A 3BM6A 5TBMA 3TSGA 1NXYA 3OCNA 1DP9A 2ZBBA 3IH8A 1F2KA 3DWKA 4OOMA 5G4YA 4IUHA 1KGEA 2Y55A 1YLWA 2UV0E 3IBJA 1SHVA 5L2FA 4HI4A 3SZTA 3O88A 2PU4A 3N8LA 4LFUA 2EX2A 1LL8A 1XA7A 2EX9A 2M7UA 5AQ7A 1FILA 1VB6A 5J8XA 3S7PA 3NDGA 2V9AA 1E25A 4JF6A 5AVEA 2VGLM 4NXEA 2PDRA 1N9NA 1SCWA 4U0TA 5HSQA 1W79A 4LCMA 3WS5A 1SKFA 2WAEA 2Y2JA 5CHMA 4WBGA 1KGGA 2CMNA 5CEBA 4BJPA 2ZC4B 3DTMA 5HAQA 4CLCD 4F94A 3PXPA 3HUNA 3OPHA 4EUZA 3N8RA 4P87A 5DVAA 4WZ4A 1KOUA 1NRFA 5J4EA 4GHIA 3TE8A 2IWBA 5FI2A 2PU2A 2Y2IA 3DW0A 3IXBA 3O3VA 2OLVA 4R3JA 5BOHA 5F69A 2ZOHA 2W1TB 1K38A 5FA7A 3A3IA 4OLDA 4PMAA 2WKHA 4FTXA 4KG5A 2P08A 4L0LA 3PBOA 3A3JA 4BENA 3ZCZA 1J3WA 4ESPA 2B5RA 4MCWA 2AVXA 1BUEA 3M2JA 3MSHA 4JXWA 4MLLA 3MKEA 1GSXA 3NC8A 1PFLA 4KZ6A 1IKIA 2CC1A 1MKIA 3M6HA 4R0QA 5A93A 4EQ1A 1K54A 1JVJA 3ULFA 3PAGA 2JE5A 1IYSA 2H0YA 5C5KA 2WKPA 4DRTA 1YLZA 3CUEA 2PRFA 1MWRA 2Z2LB 4YINA 1PYYA 3OC2A 1E4DA 3BFFA 4HH3A 5FDSA 5EECA 4UA6A 1WYBA 4PHTA 2P9VA 4YNRA 2ZJ9A 3R4KA 3CWFA 2XR0A 1VHMA 1MZUA 3ZVTA 2YKFA 3Q1FA 4KG2A 3SH7A 2J9PA 2ZOIA 3PAEA 3W4PA 3GTCA 1MWTA 2ZQDA 3S1YA 1S1ZA 3EQVA 4EU0A 3IWQA 1YPRA 3PBQA 4LRXC 4OPQA 4F3LA 4PM5A 3OPLA 1PW1A 4B93A 3TRCA 4UQIM 5A91A 2V1AA 5I5LA 5HPIA 5F83A 2X71A 5E2HA 4ZJ3A 3BLSA 2Y2LA 1GHIA 4DDSA 2P04A 2ZL1B 4DE1A 1NLZA 2BG1A 4GB7A 3DTKA 1G6AA 1SZVA 3FPVA 1MC0A 2JKRI 4DDYA 4IUKA 4LV3A 4OPRA 3LR0A 1Q2QA 2XA7S 5G18A 5FQQA 3WRZA 1K25A 4S2JA 4I3JA 4NXBA 3VOLA 5FQMA 2I72A 5GHZA 4WZ5C 2VV8A 4CQHA 4WEJA 4HH2A 4JXGA 4U0XA 5EVLA 1V9ZA 1ES2A 5EM0A 3Q81A 1UWNX 5F68A 1TVFA 3WS1A 5HZHA 1L0EA 4FUWA 4UHUA 4AFIA 2QYBA 4R1GA 4RQ9A 3PTEA 4WF0A 3IT9A 5DTSA 3T1RA 3DWZA 4H8RA 4JBFA 5KZHA 4QY6A 1CI8A 3LFVA 4OVDA 1BSGA 3IWIA 3BQAA 3W2ZA 3IX8A 4O7DA 3G2YA 2Z6CA 5DF8A 3HJIA 2NUTC 2I9VA 3CUEC 3D3OA 2IWDA 4PM7A 3IXHA 3ZG8B 4S2KA 2HF6A 4DJ3A 5TBMB 3P98A 1YLJA 1G68A 3OOVA 3N6IA 5EVIA 1PWDA 3NI9A 2Z6DA 3IS2A 1PWGA 3EEAA 1OJ5A 2WGIA 3SS4A 1OTBA 3L7HA 2OAQ1 1TDLA 3FG8A 4LCLA 2G2UA 1OT6A 1GHMA 2Y59A 4EUVA 2WZZA 1PWCA 3D4FA 3PBTA 3NDEA 5JYPA 1XFNA 4OP5A 1MPLA 1DJAA 1SKOA 1YQSA 4LV2A 1JTDA 3ISGA 3VE3A 3PBSA 3SOIA 3UPOA 1Z09A 3BECA 2B18A 4PM8A 3R7WA 5DFXA 5HDCA 3OZHA 1D1JA 2QMIA 5EOEA 1BLSA 1Z6FA 2V0UA 2WKRA 2G2WA 3BEBA 5JYOA 4R23A 3T1XA 4KQDA 1X0OA 3CITA 2ZC5B 2Y2MA 1ESIA 3F1PB 4QJGA 5FI6A 2KOIA 4IBXA 3N8SA 2XROA 4Z9QA 3SH8A 2XD1A 4MDZA 1OTEA 3VSKA 3CI6A 2NUPC 3KSIA 1IYQA 3CPTA 1YAXA 2OWJA 3HCYA 2KLIA 1FOFA 3DTIA 4Y5FA 5HWVA 3KO6A 5FAOA 3UPPA 3T4JA 3C7UA 3H7WB 1YMXA 5IU1A 1ODVA 4K0XA 5FEGA 4OKPA 3LUQA 3UN7A 5M1AA 4RYEA 1L3LA 4PKYG 1Y4OA 5HWWA 3L9KA 4JGPA 1CJFA 2EWWA 5FDHA 4DF6A 1DJCA 1L0DA 3B33A 4I38A 4P6BA 4HHDA 3CLOA 4GKUA 1IYPA 4O01A 1PIOA 2E8JA 2QPNA 2GDNA 2O0YA
chains in the Genus database with same CATH topology
2PR6A 1DP8A 5HSQA 2W27A 4G3WA 3SW1A 3EEHA 3C8CA 3MQOA 3E98A 2EWVA 4DN0A 1T1BA 4BMWA 2O9AA 2GJ3A 5HD5A 5J3WA 1OPXA 2M7VA 2CMNA 4BJPA 1TD5A 5TJJA 3T4SA 4CLCD 3LIEA 3PXPA 4JGOA 4Q0HA 2W1RA 4JGQA 2ZMVA 3T4LA 3NOTC 4EEPA 4EEUA 4GLQA 1KOUA 4EETB 4YWZA 3TJZC 2J3TD 5J4EA 4GHIA 1NWZA 3BJNA 3LIDA 3TE8A 4YOFA 4F3LB 2QWSA 1DP6A 5EFWA 3TW8A 4NEED 4R6LA 1WA9A 3FC7A 3FPWA 2O9CA 3KSGA 2MJ6A 5F69A 3S7QA 2ZOHA 3LR5A 2Y8HA 2PD7A 3NOPC 2W1TB 3K2NA 2V0WA 1UWPX 2D02A 1N9OA 3ICYA 3MMHA 2P08A 2PT7A 2J80A 4L0LA 3EGXC 3KYQA 3PBOA 2VJWA 2PD8A 4G3KA 4GJ4A 5HWTA 1T19A 4MCWA 4GHIB 3ZQ5A 1T1AA 2W0NA 2PYRA 1YSPA 3A0VA 4O0PA 4ETXA 1GSXA 1D7EA 5HDSA 1TS7A 1IOUA 2OOLA 3IBRA 4HOIA 4P6ZS 4EQ1A 3ULFA 1G28A 3LI9A 3UB9A 1Y28A 5DF9A 3MFXA 4WEKA 2WKPA 5C5KA 2A24B 3CUEA 2O9BA 4P6ZM 2GNXA 3OC2A 2J3TC 3NHQA 4HH3A 4CLCE 1P0ZA 4BBUA 3P01A 1W63Q 1STZA 4PHTA 1S4RA 2L1MA 3BQ8A 4YNRA 3R4KA 3LR3A 3CWFA 1VHMA 1MZUA 1P9RA 3CAXA 3K3DA 2YKFA 4DMZA 1GSVA 1TS0A 3BW6A 2VV6A 2ZOIA 3OCLA 2W3GA 4OOLA 4HJ4A 4EW7A 1JNUA 4B9OA 2H28A 2QKPA 4KUKA 4EESA 2B02A 1S1ZA 3EQVA 5KIZA 4IJGA 4EU0A 2W3FA 4UQIS 1NLYA 3PBQA 5G4ZA 4LRXC 4F3LA 2LB9A 4L9EA 4R3AA 5LBRA 4NXFA 4B93A 3TRCA 3EGDC 5DJUA 4UQIM 1OJGA 3EQUA 4MN7A 4ME4A 2W1TA 5FL3A 4MN5A 2V1AA 3JVVA 3F1NA 5I5LA 5HPIA 2M1CA 2XSSA 4KUOA 4G3VA 4PAUA 3VE4A 2P04A 3EWKA 1NLZA 4HJ3A 5A8BA 1F5MA 1D06A 5F6AA 1UGUA 3C38A 1OT9A 3E4QA 3JVUA 4Y3IA 3IS2B 3LR4A 3UB6A 1TF1A 4NKPA 4ZRRA 3OBFA 3PR6A 5DJTA 3FPVA 2VX8A 3S7OA 4HJ6A 1MC0A 2JKRI 2VLGA 4Z1WA 2L0WA 4BWIA 1OTAA 4WUJA 3KSFA 3F1NB 3T4OA 4IUKA 3UE6A 4JGRA 4QPRA 4WN5A 4DJ2A 4R38A 2HJ9C 3LR0A 3UMEA 2XA7S 3RFBA 3U2AA 2A24A 3E4PA 1N9LA 3PBRA 3UE3A 2P7JA 4I3JA 4XT2B 5IT5A 2LB5A 4NXBA 3VOLA 2GX5A 4II7A 3S7NA 2VV8A 2XA7M 3RTYA 4CQHA 4ARZA 4WEJA 4HH2A 2XRNA 5IS1A 1H8MA 3LI8A 1MKMA 4Y2FA 2FH5A 4WL9A 1DRMA 3GECA 4BBVA 1V9ZA 4NXGA 3KX0X 2W3DA 1G6OA 4WLAA 1UWNX 5F68A 3R7WB 5J7EA 2JN7A 5HZHA 5HPFA 3C2WA 3MR0A 1S66L 2BASA 4IHQA 4AFIA 3BWLA 3UB7A 2A2LA 2JKTI 2QYBA 3H82A 4LPZA 4HP4A 4RQ9A 1V9YA 1F9IA 3KSHA 4WF0A 3MQ0A 2O99A 2QJ7A 3MF0A 3NOUC 4UEYA 4ARZB 1XJ6A 1YSQA 4WELA 3ZYTA 3C30A 5CX7A 3UB8A 5KSHA 1ZHHB 3LFVA 3HJKA 3A0SA 1IFQA 3T4TA 3BQAA 4CLCB 2JKRM 3T4QA 3PBNA 3UMDA 2K31A 2PYPA 3W2ZA 2Z6CA 3F1OB 4I5SA 3DBAA 3D72A 5L8MA 3HJIA 3H82B 2HJEA 1OTDA 2NUTC 2I9VA 3CUEC 1S4SA 3D3OA 1ZTUA 1W63M 4MN6A 5DKKA 2HF6A 4FOFA 5DKLA 2WKQA 1XJ3A 4DJ3A 2HGVA 1XJ2A 5TBMB 3BY8A 4O8GA 3PHYA 3OOVA 4Q0IA 4HIAA 4H6JB 2Z6DA 3IS2A 2KDKA 3EEAA 1OJ5A 4FSFA 2KX6A 4HY8A 1OTBA 3VV4A 3GDIA 3LYXA 1LSXA 2OAQ1 4R70A 4GCZA 3FG8A 4LRYC 2JKTM 4E04A 2L4RA 2W3EA 1OT6A 2VKSA 3LIAA 1LSWA 3LIBA 5DFYA 4KQOA 2J3WA 2OWHA 3E4OA 4EUVA 3PBTA 4XT2A 1XFNA 3K3CA 2G7UA 3MJQA 2QHKA 3LIFA 3LICA 3A0RA 3V67A 1OTIA 1BYWA 1YKDA 1TS8A 3PBSA 3VE3A 2QJ5A 4GW9A 3F1PA 3B42A 2OAP1 2B18A 2JHEA 2VZWA 3R7WA 5DFXA 5HDCA 5F5YA 2D01A 3MQQA 2FZ0A 4LRZE 5MC7A 1T18A 2V0UA 2WKRA 3H9WA 4I39A 4KQDA 2IA2A 1X0OA 3CITA 4K08A 1TS6A 2W3HA 1XFQA 3T4KA 2VA0A 1T1CA 3P7NA 3F1PB 4CLCA 4L9GA 3B47A 4GS9A 1P9WA 2KOIA 3H7WA 5HD3A 2K7SA 3F1OA 1H3QA 3RH8B 2VEAA 2XROA 4PKYA 3E0YA 2YKHA 4MDZA 1OTEA 4I3AA 5K5BA 3CI6A 2NUPC 3KSIA 4EXOA 2R78A 1S67L 2INWA 4BBTA 4I3IA 1YAXA 2OWJA 3HCYA 3BY9A 5AVFA 2KLIA 4M4XA 1XJ4A 5TBMA 3O5YA 3OCNA 2HV1A 2Y79A 1DP9A 2ZBBA 4Y5FA 5AJGA 1S1YA 3NJAA 5HWVA 3KO6A 2PHYA 4OOMA 5G4YA 4EERA 4IUHA 1P97A 4H6JA 2ZMFA 4CLCC 1NRJA 3IBJA 2DMWA 4GS9B 4HI4A 3T4JA 4MMNA 3H7WB 5IU1A 1ODVA 4L9FA 2EA9A 4HQAA 5HDDA 1F98A 1LL8A 3LUQA 2VV7A 3OLOA 2M7UA 4PKYG 5HWWA 4JGPA 1VB6A 2EWWA 3T50A 2VGLS 4ETZA 2PR5A 3S7PA 5HL6A 3MXQA 4HP9A 2GZAA 3B33A 4I38A 2K2NA 3KYZA 4HHDA 2V9AA 3CLOA 1EW0A 3G6OA 4Q0JA 4LLOB 5AVEA 3PYPA 1GSWA 4O01A 2VGLM 1LSVA 4NXEA 2PDRA 1N9NA 3EOIA 2V1BA 2O0YA 4HNBA 1LT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7N A;  4CQH A;  1YKD A;  2XRN A;  5HSQ A;  4G3W A;  1MKM A;  4GW9 A;  4Y2F A;  3NHQ A;  3E98 A;  4DN0 A;  2B18 A;  1STZ A;  2VZW A;  2W3D A;  5DFX A;  2O9A A;  4YNR A;  3R4K A;  1VHM A;  5HPF A;  3C2W A;  2M7V A;  4LRZ E;  2QYB A;  4DMZ A;  4RQ9 A;  1TD5 A;  5TJJ A;  3KSH A;  2IA2 A;  3MQ0 A;  2O99 A;  2W3G A;  3CIT A;  4Q0H A;  3MF0 A;  2W1R A;  3NOU C;  2W3H A;  3NOT C;  1YSQ A;  4GLQ A;  4IJG A;  4EU0 A;  3LFV A;  2W3F A;  2KOI A;  4LRX C;  2LB9 A;  2K31 A;  3BJN A;  3W2Z A;  4YOF A;  5LBR A;  2VEA A;  2XRO A;  3TRC A;  3DBA A;  3E0Y A;  4MDZ A;  4R6L A;  5L8M A;  5K5B A;  3CI6 A;  2O9C A;  3KSG A;  4MN7 A;  3D3O A;  3KSI A;  4ME4 A;  2W1T A;  3S7Q A;  1ZTU A;  5I5L A;  2Y8H A;  3HCY A;  3NOP C;  2W1T B;  3K2N A;  5HPI A;  4FOF A;  2KLI A;  3O5Y A;  2XSS A;  2Y79 A;  4G3V A;  2HGV A;  4Y5F A;  5AJG A;  4PAU A;  4O8G A;  3MMH A;  3KO6 A;  4IUH A;  3OOV A;  2ZMF A;  4Q0I A;  3IBJ A;  2VJW A;  4G3K A;  1F5M A;  4MMN A;  3EEA A;  4MCW A;  4Y3I A;  3ZQ5 A;  2GX5 A;  1TF1 A;  4ZRR A;  3VV4 A;  3OBF A;  1YSP A;  4O0P A;  4R70 A;  2M7U A;  4LRY C;  1MC0 A;  4Z1W A;  3S7O A;  4BWI A;  4ETX A;  4E04 A;  2W3E A;  3KSF A;  2VKS A;  4ETZ A;  3S7P A;  5HL6 A;  2OOL A;  5DFY A;  4IUK A;  4EUV A;  2K2N A;  3IBR A;  4QPR A;  3G6O A;  4Q0J A;  3RFB A;  4O01 A;  5C5K A;  2G7U A;  2LB5 A;  2O0Y A;  2O9B A; 
#chains in the Genus database with same CATH topology
 2X02 A;  4G3W A;  2RCX A;  3SW1 A;  4X56 A;  5FQ9 A;  3MQO A;  2EWV A;  3MZF A;  4MEZ A;  4QD4 A;  1T1B A;  4N1X A;  4X55 A;  1SDN A;  3Q7Z A;  4BL3 A;  1H0M A;  4EBP A;  2M7V A;  1K6R A;  4WMC D;  5A92 A;  1GHP A;  5EVI C;  2H10 A;  3BLM A;  2BLS A;  4Q0H A;  4JGO A;  1FR6 A;  5M18 A;  4JGQ A;  4JXS A;  4OPZ A;  2B95 A;  1XGJ A;  1KGF A;  4RA7 A;  3TJZ C;  3VMA A;  4BQM A;  3BJN A;  3LID A;  4F3L B;  4KZ9 A;  3TW8 A;  4NEE D;  4EBN A;  2OLU A;  3FC7 A;  2Y2N A;  3IXD A;  3BFG A;  3LR5 A;  4B88 A;  4IVI A;  1YLT A;  1RP5 A;  2V0W A;  1UWP X;  3ICY A;  3W8K A;  3MMH A;  3EGX C;  3KYQ A;  4K91 A;  3GSG A;  2VJW A;  5HWT A;  1HD8 A;  1T19 A;  4N9K A;  2X01 A;  3MXR A;  2W0N A;  3HLD A;  5HW3 A;  3LEQ A;  3DTE A;  5D3O A;  1D7E A;  3V39 A;  5TR7 A;  1EI5 A;  2ACG A;  3QP1 A;  4GZB A;  3ITB A;  1LL9 A;  4P6Z S;  5E2F A;  2XFS A;  5E43 A;  3WS4 A;  1G28 A;  4OH0 A;  1Y28 A;  3S22 A;  3MFX A;  4IED A;  3NBL A;  5EE8 A;  2O9B A;  2OSU A;  5GLA A;  2WYX A;  1XPB A;  3WS0 A;  2J3T C;  3WWX A;  4CLC E;  1P0Z A;  4BBU A;  2R9X A;  3LGO A;  3P01 A;  2Q0O A;  1S4R A;  4X69 A;  2L1M A;  3BQ8 A;  4WYY A;  3NY4 A;  1P9R A;  2ZM0 A;  2IWC A;  1OME A;  3GMW A;  4DMZ A;  3BW6 A;  2W3G A;  5CEC A;  5M19 A;  4OOL A;  5DTK A;  4HJ4 A;  1JNU A;  3JYI A;  4B9O A;  3HBR A;  3GVB A;  5HX9 A;  1N4O A;  3QNC A;  3C4O A;  2EXA A;  2B02 A;  2H5S A;  1IYO A;  5KIZ A;  3VFH A;  4C3Q A;  1NLY A;  2LB9 A;  1YM1 A;  1NYY A;  4R3A A;  5IHV A;  5DJU A;  3EQU A;  4GDB A;  4MN7 A;  5FL3 A;  3F1N A;  3O86 A;  5FAP A;  1ONH A;  3VE4 A;  1BZA A;  1JWZ A;  1MXO A;  4HJ3 A;  5GHX A;  5F6A A;  2V20 A;  3D9Y A;  1OT9 A;  4WZ5 A;  3GRJ A;  3IS2 B;  1TF1 A;  4HBU A;  4NKP A;  4HJ6 A;  4Z1W A;  4BWI A;  1QME A;  3T1S A;  1JTG A;  2L0W A;  3G30 A;  1OTA A;  5GHY A;  4P0M A;  3ZDJ A;  3SS5 A;  5FQJ A;  3UE6 A;  3KYE A;  4DJ2 A;  4BL2 A;  3UME A;  1SDE A;  2A24 A;  3E4P A;  3UE3 A;  1NYM A;  4B4Z A;  5IT5 A;  2LB5 A;  5HAP A;  3GR2 A;  1PW8 A;  3W4O A;  1HLU P;  1SKO B;  2XA7 M;  3UDX A;  4ARZ A;  2EX8 A;  2FH5 A;  4KQQ A;  3GEC A;  4BBV A;  4JLF A;  4NXG A;  1AXB A;  5E2G A;  2W3D A;  1VET A;  4WLA A;  3R7W B;  5J7E A;  2JN7 A;  5HPF A;  5EVE A;  3MR0 A;  2BAS A;  3LY4 A;  1GCE A;  4HP4 A;  4LPZ A;  2JKF A;  1PZP A;  1F9I A;  1NZO A;  1K4F A;  3MQ0 A;  2O99 A;  2QJ7 A;  4E6X A;  4UEY A;  1XJ6 A;  1YSQ A;  1IEM A;  4KZ4 A;  2J8Y A;  2JCH A;  4U3T A;  5CX7 A;  3QP5 A;  1XKZ A;  5KSH A;  2FFF B;  3A0S A;  3RXW A;  2Y2O A;  2JKR M;  3UMD A;  2EXB A;  4E3I A;  3VP0 A;  2C6W B;  4S2N C;  2VGJ A;  3H82 B;  1OTD A;  3M6B A;  1NZU A;  1ZTU A;  4MN6 A;  3CPT B;  4FOF A;  3HLE A;  2WKQ A;  5CTN A;  1HVB A;  1XJ2 A;  4OQG A;  4O8G A;  2HDQ A;  3UDI A;  4Q0I A;  5CER A;  2HDU A;  3MS6 A;  2KDK A;  4R4S A;  3JPU A;  2KX6 A;  4HY8 A;  2EX6 A;  3LYX A;  1LSX A;  1LHY A;  1JWP A;  2HZ5 A;  2J3W A;  1ACF A;  3IF6 C;  3K3C A;  2DNS A;  2QHK A;  3RJU A;  3LIF A;  2ZQA A;  1OTI A;  1BYW A;  1K56 A;  3IHA A;  5KMW A;  1TS8 A;  4X68 A;  3IHB A;  4ZDX A;  2VZW A;  1HTZ A;  1FSY A;  2D01 A;  3C7V A;  4LRZ E;  1T18 A;  3UO9 A;  3G4P A;  3NUL A;  4I39 A;  2W3H A;  3T4K A;  1W8Q A;  4EQI A;  3P7N A;  2WGV A;  3B47 A;  3HLB A;  1P9W A;  4ID4 A;  4ZJ2 A;  2K7S A;  3F1O A;  4Y0T A;  3CHW P;  5FAQ A;  4I3A A;  2PBY A;  3HLF A;  4BBT A;  4I3I A;  1XJ4 A;  3Q7V A;  5EVI D;  1FIK A;  1ZKJ A;  3NJA A;  4EER A;  3VP1 A;  2V8F A;  4H6J A;  4CLC C;  1NRJ A;  5HFO A;  3N7W A;  4GS9 B;  4MMN A;  5HAR A;  1IEL A;  1FQG A;  2XGN A;  4HQA A;  3HVF A;  1F98 A;  2VV7 A;  3OLO A;  4KZ5 A;  4E3J A;  1KDW A;  1ZC2 A;  2RL3 A;  1M40 A;  3M2K A;  4QY5 A;  3T50 A;  5L10 A;  2BTF P;  2WAF A;  2PR5 A;  4Q8I A;  5TFQ A;  5HL6 A;  3MXQ A;  3CZD A;  1WYC A;  3KYZ A;  3G6O A;  3LY3 A;  3QP6 A;  4PPR A;  4Q0J A;  3PYP A;  2Q9N A;  5GLD A;  2ZQ7 A;  3HL9 A;  1LSV A;  5AQ9 A;  5GLB A;  3GQZ A;  3ZNY A;  2W27 A;  3V3S A;  3EEH A;  3FZC A;  3C8C A;  3E98 A;  3QHY A;  4KZ7 A;  2XLN A;  5AQB A;  2WGW A;  4BMW A;  2GJ3 A;  3T1Q B;  3A3E A;  5J3W A;  2PAV P;  1CQA A;  1LL5 A;  5TJJ A;  4NG2 A;  3T4S A;  3LIE A;  1BTL A;  2W1R A;  3GV9 A;  4X1M A;  3NOT C;  3T4L A;  4EEU A;  4IVK A;  5FAT A;  3IWO A;  3MZD A;  1A0K A;  4EET B;  5CHJ A;  1XX2 A;  2J3T D;  1NWZ A;  5EFW A;  5FQK A;  1WA9 A;  1FCO A;  3FPW A;  2O9C A;  2JC7 A;  2MJ6 A;  4K0W A;  3Q82 A;  4E3N A;  1N9O A;  2R9W A;  1K57 A;  2XD5 A;  2XF3 A;  3NEC A;  2PT7 A;  3QP4 A;  3AGE A;  2PD8 A;  4G3K A;  1CI9 A;  3UY6 A;  4GHI B;  3ZQ5 A;  1T1A A;  4JXV A;  4KZA A;  4Y0O A;  2PYR A;  1ESU A;  3W4Q A;  4ETX A;  4GD8 A;  1O7E A;  1TS7 A;  4X53 A;  3SH9 A;  2ZQ9 A;  4S2I A;  3IBR A;  1RCJ A;  3G32 A;  4HOI A;  1N9B A;  2Q9M A;  1NY0 A;  5DF9 A;  1S6R A;  2A24 B;  3UB5 P;  4P6Z M;  1BLP A;  2GNX A;  1H5X A;  2Y91 A;  3NHQ A;  1W63 Q;  3Q07 A;  1VET B;  3G2Z A;  4XUZ A;  1VM1 A;  4CJN A;  1TS0 A;  1YT4 A;  3ZG9 B;  2VV6 A;  4MNR A;  1G5U A;  3OCL A;  2WKI A;  4EW7 A;  3C5A A;  1I5Q A;  2QKP A;  1ES3 A;  4KUK A;  4EES A;  2ZL1 A;  1CEG A;  4OOY A;  3LEZ A;  4KZB A;  5G4Z A;  4L9E A;  2P9V B;  1QMF A;  3EGD C;  3UNW A;  1OJG A;  2ZM8 A;  4ME4 A;  5GL9 A;  2EFU A;  5CED A;  4R4R A;  2M1C A;  4G3V A;  3V50 A;  4JPM A;  3EWK A;  4C75 A;  4S2M A;  3WRT A;  4ZTK A;  2HDS A;  1UGU A;  4FCF A;  4FH2 A;  3JVU A;  3CJM A;  3UB6 A;  4Y15 A;  1K6S A;  1DJB A;  4RX2 A;  3OPP A;  4ZRR A;  5EPH A;  4GD6 A;  3OBF A;  3U4L P;  3PR6 A;  3S7O A;  1YMS A;  3QP2 A;  2WK0 A;  5CXW A;  3RFB A;  4KG6 A;  1N9L A;  3PBR A;  1E3U D;  1FCM A;  1ERM A;  3ZG7 B;  3S7N A;  5F82 A;  2HP6 A;  2HDR A;  2XRN A;  1H8M A;  1MKM A;  2ZMA A;  4Y2F A;  4KZ3 A;  1DRM A;  3V5M A;  3MZE A;  1GA9 A;  3BRM A;  1K57 C;  3ZGA B;  1GA0 A;  3C2W A;  1XGI A;  4X25 A;  4IHQ A;  4MBF A;  2A2L A;  2JKT I;  4YFM A;  1WE4 A;  4S2N A;  3UPN A;  4R3B A;  4HBT A;  1LI0 A;  3BFC A;  4NET A;  1MWS A;  4OQH A;  3MF0 A;  1E3U A;  2A49 A;  2ZC3 B;  3VP4 A;  3ZYT A;  3UB8 A;  1ZHH B;  3HJK A;  1IFQ A;  1L0F A;  1CEF A;  4RX3 A;  3PBN A;  2PYP A;  3MXS A;  4OON A;  3F1O B;  3LO7 A;  4HES A;  3DBA A;  4I5S A;  2A3U A;  4N92 A;  2HJE A;  3C4P A;  1XXM A;  4QU3 A;  1W63 M;  1XJ3 A;  2HGV A;  3Q7V B;  5L09 A;  3PHY A;  5GLC A;  1RGY A;  3IF6 A;  4H6J B;  4OPY A;  4D60 A;  1EWZ A;  3GDI A;  4R70 A;  4GCZ A;  4LRY C;  4E04 A;  2L4R A;  2W3E A;  5F1F A;  2C5W B;  3NCK A;  1FCN A;  1LSW A;  1IKG A;  3DAV A;  2OWH A;  4XT2 A;  2XEP A;  2XH9 A;  4GOG A;  1W5D A;  5EVI B;  4JF5 A;  1YKD A;  3VOZ A;  3SS3 A;  4Y17 A;  2QJ5 A;  4X6T A;  4GN2 A;  1I2S A;  3F1P A;  4E3O A;  2OAP 1;  1L2S A;  3MBZ A;  3QNB A;  5DF7 A;  3MFD A;  2WGW B;  3MQQ A;  2FZ0 A;  4GNU A;  4Y0U A;  3ZVW A;  4A5R A;  1VEU A;  3H9W A;  3ZFZ A;  2IA2 A;  3FKW A;  4E3M A;  2V2F F;  3VSL A;  2VA0 A;  4S2L A;  2HP9 A;  4CLC A;  3O87 A;  4L9G A;  4E3K A;  3H7W A;  1H3Q A;  3RH8 B;  1TDG A;  2DCF A;  4DE3 A;  1W8Y A;  2VEA A;  2HPB A;  3IX3 A;  1J9M A;  1K55 C;  3HLC A;  2INW A;  2ZM2 A;  5AVF A;  4M4X A;  4LEN A;  3O5Y A;  2HV1 A;  2Y79 A;  5AJG A;  1S1Y A;  2J7V A;  2PHY A;  4WM9 A;  1NJ4 A;  1P97 A;  2ZMF A;  2DMW A;  3G34 A;  4OQI A;  4L9F A;  2QZ6 A;  2EA9 A;  3HLG A;  5HDD A;  2UWX A;  4X1L A;  1BUL A;  1XP4 A;  1ES4 A;  3ITA A;  2VGL S;  4QHC A;  4ETZ A;  5CRF A;  4HP9 A;  2GZA A;  4E6W A;  2K2N A;  3NIA A;  2VK3 A;  1EW0 A;  4PM6 A;  3BFD A;  1K56 D;  4LLO B;  1GSW A;  1PI5 A;  4UA9 A;  2J9O A;  1KDS A;  3WS2 A;  3EOI A;  4HNB A;  2V1B A;  4HIA A;  1LT0 A;  2PR6 A;  1DP8 A;  4Y7P A;  1RGZ A;  1DY6 A;  1L0G A;  4DN0 A;  1PZO A;  4KZ8 A;  3QP8 A;  3FYZ A;  2O9A A;  1ALQ A;  5HD5 A;  1OPX A;  3ZG5 A;  2WZX A;  4N1H A;  1PNE A;  2WAD A;  2ZQC A;  5CHU A;  1TD5 A;  1ONG A;  3HUO A;  4FH4 A;  2FFY A;  2ZMV A;  1K4E A;  4EEP A;  1I2W A;  2XQZ A;  5DTT A;  4GLQ A;  5U47 A;  4YWZ A;  4QB8 A;  5FI7 A;  4YOF A;  2QWS A;  1DP6 A;  1W7F A;  4R6L A;  4JKT A;  3KSG A;  3S7Q A;  2Y8H A;  2PD7 A;  3NOP C;  3K2N A;  4JF4 A;  2EFX A;  2D02 A;  3CMZ A;  3AGD A;  2J80 A;  3ZG0 A;  4D2O A;  2OV5 A;  4GJ4 A;  1KVM A;  3A3D A;  3I7J A;  4KQR A;  1PI4 A;  5CTM A;  1YSP A;  1HZO A;  3A0V A;  1C3B A;  4O0P A;  1BT5 A;  4P85 A;  4LV1 A;  3N4I A;  5HDS A;  1IOU A;  1CK3 A;  4DE2 A;  4QWO A;  4LGW A;  2OOL A;  3HLW A;  3HRE A;  4NK3 A;  5HAI A;  1ERQ A;  3LI9 A;  3UB9 A;  4WEK A;  1BLH A;  4OLG A;  5EM1 A;  3E2K A;  5TGF A;  3UDF A;  1CF0 A;  4XXR A;  4IBR A;  4C6Y A;  2P74 A;  2Y2H A;  1FSW A;  2V8C A;  3TOI A;  1Y54 A;  1KE0 A;  1H8Y A;  1STZ A;  4DXC A;  4EV4 A;  1JWV A;  3LR3 A;  3CAX A;  3K3D A;  3BFE A;  3UE0 A;  1K54 C;  1GSV A;  2ZC6 B;  1U60 A;  2H28 A;  1S0W A;  1LI9 A;  3IX4 A;  3VFF A;  1MY8 A;  3VOY A;  4IJG A;  5CGW A;  2W3F A;  2E8I A;  4UQI S;  4MBK A;  5E2E A;  2XDM A;  2WKE A;  1VQQ A;  5LBR A;  1KE3 A;  4NXF A;  1FR1 A;  1XA1 A;  1YLP A;  2W1T A;  1LLB A;  1ERO A;  4MN5 A;  3TG9 A;  3JVV A;  5KSC A;  4PM9 A;  2XSS A;  3IF5 A;  3E2L A;  4KUO A;  5CGS A;  4PAU A;  2H0T A;  5I94 A;  1ZG4 A;  2Y2Q A;  3AGF A;  5A8B A;  5EV0 A;  1F5M A;  1D06 A;  3IF6 B;  4EBL A;  3C38 A;  3A3F A;  3E4Q A;  4Y3I A;  3LR4 A;  3ZNT A;  4B4X A;  5DJT A;  2VX8 A;  2Y4A A;  2VLG A;  4WUJ A;  3KSF A;  3F1N B;  2Y2P A;  3G31 A;  4CPK A;  4FD8 A;  3T4O A;  1KVL A;  4UAA A;  4JGR A;  4QPR A;  4WN5 A;  1AWI A;  2HJ9 C;  4OQ0 A;  4R38 A;  5AQA A;  5CGX A;  3U2A A;  3B3X A;  4RVA A;  1TEM A;  4EWF A;  2P7J A;  4XT2 B;  3UE1 A;  2GX5 A;  4MBH A;  4II7 A;  4ZBE A;  3RTY A;  5IS1 A;  3LI8 A;  2DRW A;  4WL9 A;  3IXG A;  3KX0 X;  2XK1 A;  4S2P A;  1G6O A;  1S66 L;  4BD1 A;  3BWL A;  3UB7 A;  3P09 A;  3MKF A;  3H82 A;  5FQI A;  3BYD A;  2Z2M B;  1V9Y A;  3RXX A;  3KSH A;  5A90 A;  1VEU B;  4DKI A;  1BLC A;  3NOU C;  1Q2P A;  4ARZ B;  1K0K A;  1KE4 A;  4WEL A;  2ZLY A;  3S4X A;  1MBL A;  3C30 A;  4N9L A;  1ES5 A;  3T4T A;  4CLC B;  3T4Q A;  2K31 A;  3D72 A;  5L8M A;  4DE0 A;  1S4S A;  3V3R A;  2JBF A;  5DKK A;  4HEF A;  5DKL A;  3IH9 A;  2PBD P;  3IQA A;  3BY8 A;  3G35 A;  5FEF A;  1M6K A;  4FSF A;  4LV0 A;  1O07 A;  3VV4 A;  3T12 B;  1PRQ A;  2VGK A;  4M3K A;  2V1Z A;  2JKT M;  2Y2K A;  5FSR A;  2VKS A;  5EOO A;  5L07 A;  3LIA A;  1YLY A;  4E3L A;  3LIB A;  5DFY A;  2JKG A;  4KQO A;  3E4O A;  3FWL A;  4ZAM A;  2HP5 A;  2XFT A;  2G7U A;  3MJQ A;  3LIC A;  3A0R A;  3V67 A;  3FV7 A;  4KEN B;  2WUQ A;  4UA7 A;  1H8Z A;  4GW9 A;  4ZJ1 A;  4XUX A;  3B42 A;  2Y2G A;  2JHE A;  3HUM A;  3ZHH A;  4S2O A;  5F5Y A;  3CG5 A;  2ZC7 A;  1ZG6 A;  3OPR A;  5MC7 A;  2ZD8 A;  3FKV A;  4DXB A;  4GDN A;  1K55 A;  5HL1 A;  4Y13 A;  5F1G A;  1MWU A;  4K08 A;  1TS6 A;  4WMC A;  4OP8 A;  1XFQ A;  4BD0 A;  1T1C A;  4BLM A;  4GS9 A;  3LCE A;  5HD3 A;  2ZQ8 A;  3VP2 A;  4PKY A;  3VP3 A;  3E0Y A;  2YKH A;  5K5B A;  5EUA A;  4EXO A;  2R78 A;  1S67 L;  5FAS A;  3BY9 A;  3BM6 A;  5TBM A;  3TSG A;  1NXY A;  3OCN A;  1DP9 A;  2ZBB A;  3IH8 A;  1F2K A;  3DWK A;  4OOM A;  5G4Y A;  4IUH A;  1KGE A;  2Y55 A;  1YLW A;  2UV0 E;  3IBJ A;  1SHV A;  5L2F A;  4HI4 A;  3SZT A;  3O88 A;  2PU4 A;  3N8L A;  4LFU A;  2EX2 A;  1LL8 A;  1XA7 A;  2EX9 A;  2M7U A;  5AQ7 A;  1FIL A;  1VB6 A;  5J8X A;  3S7P A;  3NDG A;  2V9A A;  1E25 A;  4JF6 A;  5AVE A;  2VGL M;  4NXE A;  2PDR A;  1N9N A;  1SCW A;  4U0T A;  5HSQ A;  1W79 A;  4LCM A;  3WS5 A;  1SKF A;  2WAE A;  2Y2J A;  5CHM A;  4WBG A;  1KGG A;  2CMN A;  5CEB A;  4BJP A;  2ZC4 B;  3DTM A;  5HAQ A;  4CLC D;  4F94 A;  3PXP A;  3HUN A;  3OPH A;  4EUZ A;  3N8R A;  4P87 A;  5DVA A;  4WZ4 A;  1KOU A;  1NRF A;  5J4E A;  4GHI A;  3TE8 A;  2IWB A;  5FI2 A;  2PU2 A;  2Y2I A;  3DW0 A;  3IXB A;  3O3V A;  2OLV A;  4R3J A;  5BOH A;  5F69 A;  2ZOH A;  2W1T B;  1K38 A;  5FA7 A;  3A3I A;  4OLD A;  4PMA A;  2WKH A;  4FTX A;  4KG5 A;  2P08 A;  4L0L A;  3PBO A;  3A3J A;  4BEN A;  3ZCZ A;  1J3W A;  4ESP A;  2B5R A;  4MCW A;  2AVX A;  1BUE A;  3M2J A;  3MSH A;  4JXW A;  4MLL A;  3MKE A;  1GSX A;  3NC8 A;  1PFL A;  4KZ6 A;  1IKI A;  2CC1 A;  1MKI A;  3M6H A;  4R0Q A;  5A93 A;  4EQ1 A;  1K54 A;  1JVJ A;  3ULF A;  3PAG A;  2JE5 A;  1IYS A;  2H0Y A;  5C5K A;  2WKP A;  4DRT A;  1YLZ A;  3CUE A;  2PRF A;  1MWR A;  2Z2L B;  4YIN A;  1PYY A;  3OC2 A;  1E4D A;  3BFF A;  4HH3 A;  5FDS A;  5EEC A;  4UA6 A;  1WYB A;  4PHT A;  2P9V A;  4YNR A;  2ZJ9 A;  3R4K A;  3CWF A;  2XR0 A;  1VHM A;  1MZU A;  3ZVT A;  2YKF A;  3Q1F A;  4KG2 A;  3SH7 A;  2J9P A;  2ZOI A;  3PAE A;  3W4P A;  3GTC A;  1MWT A;  2ZQD A;  3S1Y A;  1S1Z A;  3EQV A;  4EU0 A;  3IWQ A;  1YPR A;  3PBQ A;  4LRX C;  4OPQ A;  4F3L A;  4PM5 A;  3OPL A;  1PW1 A;  4B93 A;  3TRC A;  4UQI M;  5A91 A;  2V1A A;  5I5L A;  5HPI A;  5F83 A;  2X71 A;  5E2H A;  4ZJ3 A;  3BLS A;  2Y2L A;  1GHI A;  4DDS A;  2P04 A;  2ZL1 B;  4DE1 A;  1NLZ A;  2BG1 A;  4GB7 A;  3DTK A;  1G6A A;  1SZV A;  3FPV A;  1MC0 A;  2JKR I;  4DDY A;  4IUK A;  4LV3 A;  4OPR A;  3LR0 A;  1Q2Q A;  2XA7 S;  5G18 A;  5FQQ A;  3WRZ A;  1K25 A;  4S2J A;  4I3J A;  4NXB A;  3VOL A;  5FQM A;  2I72 A;  5GHZ A;  4WZ5 C;  2VV8 A;  4CQH A;  4WEJ A;  4HH2 A;  4JXG A;  4U0X A;  5EVL A;  1V9Z A;  1ES2 A;  5EM0 A;  3Q81 A;  1UWN X;  5F68 A;  1TVF A;  3WS1 A;  5HZH A;  1L0E A;  4FUW A;  4UHU A;  4AFI A;  2QYB A;  4R1G A;  4RQ9 A;  3PTE A;  4WF0 A;  3IT9 A;  5DTS A;  3T1R A;  3DWZ A;  4H8R A;  4JBF A;  5KZH A;  4QY6 A;  1CI8 A;  3LFV A;  4OVD A;  1BSG A;  3IWI A;  3BQA A;  3W2Z A;  3IX8 A;  4O7D A;  3G2Y A;  2Z6C A;  5DF8 A;  3HJI A;  2NUT C;  2I9V A;  3CUE C;  3D3O A;  2IWD A;  4PM7 A;  3IXH A;  3ZG8 B;  4S2K A;  2HF6 A;  4DJ3 A;  5TBM B;  3P98 A;  1YLJ A;  1G68 A;  3OOV A;  3N6I A;  5EVI A;  1PWD A;  3NI9 A;  2Z6D A;  3IS2 A;  1PWG A;  3EEA A;  1OJ5 A;  2WGI A;  3SS4 A;  1OTB A;  3L7H A;  2OAQ 1;  1TDL A;  3FG8 A;  4LCL A;  2G2U A;  1OT6 A;  1GHM A;  2Y59 A;  4EUV A;  2WZZ A;  1PWC A;  3D4F A;  3PBT A;  3NDE A;  5JYP A;  1XFN A;  4OP5 A;  1MPL A;  1DJA A;  1SKO A;  1YQS A;  4LV2 A;  1JTD A;  3ISG A;  3VE3 A;  3PBS A;  3SOI A;  3UPO A;  1Z09 A;  3BEC A;  2B18 A;  4PM8 A;  3R7W A;  5DFX A;  5HDC A;  3OZH A;  1D1J A;  2QMI A;  5EOE A;  1BLS A;  1Z6F A;  2V0U A;  2WKR A;  2G2W A;  3BEB A;  5JYO A;  4R23 A;  3T1X A;  4KQD A;  1X0O A;  3CIT A;  2ZC5 B;  2Y2M A;  1ESI A;  3F1P B;  4QJG A;  5FI6 A;  2KOI A;  4IBX A;  3N8S A;  2XRO A;  4Z9Q A;  3SH8 A;  2XD1 A;  4MDZ A;  1OTE A;  3VSK A;  3CI6 A;  2NUP C;  3KSI A;  1IYQ A;  3CPT A;  1YAX A;  2OWJ A;  3HCY A;  2KLI A;  1FOF A;  3DTI A;  4Y5F A;  5HWV A;  3KO6 A;  5FAO A;  3UPP A;  3T4J A;  3C7U A;  3H7W B;  1YMX A;  5IU1 A;  1ODV A;  4K0X A;  5FEG A;  4OKP A;  3LUQ A;  3UN7 A;  5M1A A;  4RYE A;  1L3L A;  4PKY G;  1Y4O A;  5HWW A;  3L9K A;  4JGP A;  1CJF A;  2EWW A;  5FDH A;  4DF6 A;  1DJC A;  1L0D A;  3B33 A;  4I38 A;  4P6B A;  4HHD A;  3CLO A;  4GKU A;  1IYP A;  4O01 A;  1PIO A;  2E8J A;  2QPN A;  2GDN A;  2O0Y A; 
#chains in the Genus database with same CATH homology
 2PR6 A;  1DP8 A;  5HSQ A;  2W27 A;  4G3W A;  3SW1 A;  3EEH A;  3C8C A;  3MQO A;  3E98 A;  2EWV A;  4DN0 A;  1T1B A;  4BMW A;  2O9A A;  2GJ3 A;  5HD5 A;  5J3W A;  1OPX A;  2M7V A;  2CMN A;  4BJP A;  1TD5 A;  5TJJ A;  3T4S A;  4CLC D;  3LIE A;  3PXP A;  4JGO A;  4Q0H A;  2W1R A;  4JGQ A;  2ZMV A;  3T4L A;  3NOT C;  4EEP A;  4EEU A;  4GLQ A;  1KOU A;  4EET B;  4YWZ A;  3TJZ C;  2J3T D;  5J4E A;  4GHI A;  1NWZ A;  3BJN A;  3LID A;  3TE8 A;  4YOF A;  4F3L B;  2QWS A;  1DP6 A;  5EFW A;  3TW8 A;  4NEE D;  4R6L A;  1WA9 A;  3FC7 A;  3FPW A;  2O9C A;  3KSG A;  2MJ6 A;  5F69 A;  3S7Q A;  2ZOH A;  3LR5 A;  2Y8H A;  2PD7 A;  3NOP C;  2W1T B;  3K2N A;  2V0W A;  1UWP X;  2D02 A;  1N9O A;  3ICY A;  3MMH A;  2P08 A;  2PT7 A;  2J80 A;  4L0L A;  3EGX C;  3KYQ A;  3PBO A;  2VJW A;  2PD8 A;  4G3K A;  4GJ4 A;  5HWT A;  1T19 A;  4MCW A;  4GHI B;  3ZQ5 A;  1T1A A;  2W0N A;  2PYR A;  1YSP A;  3A0V A;  4O0P A;  4ETX A;  1GSX A;  1D7E A;  5HDS A;  1TS7 A;  1IOU A;  2OOL A;  3IBR A;  4HOI A;  4P6Z S;  4EQ1 A;  3ULF A;  1G28 A;  3LI9 A;  3UB9 A;  1Y28 A;  5DF9 A;  3MFX A;  4WEK A;  2WKP A;  5C5K A;  2A24 B;  3CUE A;  2O9B A;  4P6Z M;  2GNX A;  3OC2 A;  2J3T C;  3NHQ A;  4HH3 A;  4CLC E;  1P0Z A;  4BBU A;  3P01 A;  1W63 Q;  1STZ A;  4PHT A;  1S4R A;  2L1M A;  3BQ8 A;  4YNR A;  3R4K A;  3LR3 A;  3CWF A;  1VHM A;  1MZU A;  1P9R A;  3CAX A;  3K3D A;  2YKF A;  4DMZ A;  1GSV A;  1TS0 A;  3BW6 A;  2VV6 A;  2ZOI A;  3OCL A;  2W3G A;  4OOL A;  4HJ4 A;  4EW7 A;  1JNU A;  4B9O A;  2H28 A;  2QKP A;  4KUK A;  4EES A;  2B02 A;  1S1Z A;  3EQV A;  5KIZ A;  4IJG A;  4EU0 A;  2W3F A;  4UQI S;  1NLY A;  3PBQ A;  5G4Z A;  4LRX C;  4F3L A;  2LB9 A;  4L9E A;  4R3A A;  5LBR A;  4NXF A;  4B93 A;  3TRC A;  3EGD C;  5DJU A;  4UQI M;  1OJG A;  3EQU A;  4MN7 A;  4ME4 A;  2W1T A;  5FL3 A;  4MN5 A;  2V1A A;  3JVV A;  3F1N A;  5I5L A;  5HPI A;  2M1C A;  2XSS A;  4KUO A;  4G3V A;  4PAU A;  3VE4 A;  2P04 A;  3EWK A;  1NLZ A;  4HJ3 A;  5A8B A;  1F5M A;  1D06 A;  5F6A A;  1UGU A;  3C38 A;  1OT9 A;  3E4Q A;  3JVU A;  4Y3I A;  3IS2 B;  3LR4 A;  3UB6 A;  1TF1 A;  4NKP A;  4ZRR A;  3OBF A;  3PR6 A;  5DJT A;  3FPV A;  2VX8 A;  3S7O A;  4HJ6 A;  1MC0 A;  2JKR I;  2VLG A;  4Z1W A;  2L0W A;  4BWI A;  1OTA A;  4WUJ A;  3KSF A;  3F1N B;  3T4O A;  4IUK A;  3UE6 A;  4JGR A;  4QPR A;  4WN5 A;  4DJ2 A;  4R38 A;  2HJ9 C;  3LR0 A;  3UME A;  2XA7 S;  3RFB A;  3U2A A;  2A24 A;  3E4P A;  1N9L A;  3PBR A;  3UE3 A;  2P7J A;  4I3J A;  4XT2 B;  5IT5 A;  2LB5 A;  4NXB A;  3VOL A;  2GX5 A;  4II7 A;  3S7N A;  2VV8 A;  2XA7 M;  3RTY A;  4CQH A;  4ARZ A;  4WEJ A;  4HH2 A;  2XRN A;  5IS1 A;  1H8M A;  3LI8 A;  1MKM A;  4Y2F A;  2FH5 A;  4WL9 A;  1DRM A;  3GEC A;  4BBV A;  1V9Z A;  4NXG A;  3KX0 X;  2W3D A;  1G6O A;  4WLA A;  1UWN X;  5F68 A;  3R7W B;  5J7E A;  2JN7 A;  5HZH A;  5HPF A;  3C2W A;  3MR0 A;  1S66 L;  2BAS A;  4IHQ A;  4AFI A;  3BWL A;  3UB7 A;  2A2L A;  2JKT I;  2QYB A;  3H82 A;  4LPZ A;  4HP4 A;  4RQ9 A;  1V9Y A;  1F9I A;  3KSH A;  4WF0 A;  3MQ0 A;  2O99 A;  2QJ7 A;  3MF0 A;  3NOU C;  4UEY A;  4ARZ B;  1XJ6 A;  1YSQ A;  4WEL A;  3ZYT A;  3C30 A;  5CX7 A;  3UB8 A;  5KSH A;  1ZHH B;  3LFV A;  3HJK A;  3A0S A;  1IFQ A;  3T4T A;  3BQA A;  4CLC B;  2JKR M;  3T4Q A;  3PBN A;  3UMD A;  2K31 A;  2PYP A;  3W2Z A;  2Z6C A;  3F1O B;  4I5S A;  3DBA A;  3D72 A;  5L8M A;  3HJI A;  3H82 B;  2HJE A;  1OTD A;  2NUT C;  2I9V A;  3CUE C;  1S4S A;  3D3O A;  1ZTU A;  1W63 M;  4MN6 A;  5DKK A;  2HF6 A;  4FOF A;  5DKL A;  2WKQ A;  1XJ3 A;  4DJ3 A;  2HGV A;  1XJ2 A;  5TBM B;  3BY8 A;  4O8G A;  3PHY A;  3OOV A;  4Q0I A;  4HIA A;  4H6J B;  2Z6D A;  3IS2 A;  2KDK A;  3EEA A;  1OJ5 A;  4FSF A;  2KX6 A;  4HY8 A;  1OTB A;  3VV4 A;  3GDI A;  3LYX A;  1LSX A;  2OAQ 1;  4R70 A;  4GCZ A;  3FG8 A;  4LRY C;  2JKT M;  4E04 A;  2L4R A;  2W3E A;  1OT6 A;  2VKS A;  3LIA A;  1LSW A;  3LIB A;  5DFY A;  4KQO A;  2J3W A;  2OWH A;  3E4O A;  4EUV A;  3PBT A;  4XT2 A;  1XFN A;  3K3C A;  2G7U A;  3MJQ A;  2QHK A;  3LIF A;  3LIC A;  3A0R A;  3V67 A;  1OTI A;  1BYW A;  1YKD A;  1TS8 A;  3PBS A;  3VE3 A;  2QJ5 A;  4GW9 A;  3F1P A;  3B42 A;  2OAP 1;  2B18 A;  2JHE A;  2VZW A;  3R7W A;  5DFX A;  5HDC A;  5F5Y A;  2D01 A;  3MQQ A;  2FZ0 A;  4LRZ E;  5MC7 A;  1T18 A;  2V0U A;  2WKR A;  3H9W A;  4I39 A;  4KQD A;  2IA2 A;  1X0O A;  3CIT A;  4K08 A;  1TS6 A;  2W3H A;  1XFQ A;  3T4K A;  2VA0 A;  1T1C A;  3P7N A;  3F1P B;  4CLC A;  4L9G A;  3B47 A;  4GS9 A;  1P9W A;  2KOI A;  3H7W A;  5HD3 A;  2K7S A;  3F1O A;  1H3Q A;  3RH8 B;  2VEA A;  2XRO A;  4PKY A;  3E0Y A;  2YKH A;  4MDZ A;  1OTE A;  4I3A A;  5K5B A;  3CI6 A;  2NUP C;  3KSI A;  4EXO A;  2R78 A;  1S67 L;  2INW A;  4BBT A;  4I3I A;  1YAX A;  2OWJ A;  3HCY A;  3BY9 A;  5AVF A;  2KLI A;  4M4X A;  1XJ4 A;  5TBM A;  3O5Y A;  3OCN A;  2HV1 A;  2Y79 A;  1DP9 A;  2ZBB A;  4Y5F A;  5AJG A;  1S1Y A;  3NJA A;  5HWV A;  3KO6 A;  2PHY A;  4OOM A;  5G4Y A;  4EER A;  4IUH A;  1P97 A;  4H6J A;  2ZMF A;  4CLC C;  1NRJ A;  3IBJ A;  2DMW A;  4GS9 B;  4HI4 A;  3T4J A;  4MMN A;  3H7W B;  5IU1 A;  1ODV A;  4L9F A;  2EA9 A;  4HQA A;  5HDD A;  1F98 A;  1LL8 A;  3LUQ A;  2VV7 A;  3OLO A;  2M7U A;  4PKY G;  5HWW A;  4JGP A;  1VB6 A;  2EWW A;  3T50 A;  2VGL S;  4ETZ A;  2PR5 A;  3S7P A;  5HL6 A;  3MXQ A;  4HP9 A;  2GZA A;  3B33 A;  4I38 A;  2K2N A;  3KYZ A;  4HHD A;  2V9A A;  3CLO A;  1EW0 A;  3G6O A;  4Q0J A;  4LLO B;  5AVE A;  3PYP A;  1GSW A;  4O01 A;  2VGL M;  1LSV A;  4NXE A;  2PDR A;  1N9N A;  3EOI A;  2V1B A;  2O0Y A;  4HNB A;  1LT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...