2Y8HA

Structure of the first gaf domain e87g mutant of mycobacterium tuberculosis doss
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMGVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS
publication title Blockage of the Channel to Heme by the E87 Side Chain in the Gaf Domain of Mycobacterium Tuberculosis Doss Confers the Unique Sensitivity of Doss to Oxygen.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2y8hA00
1VHMA 4LRYC 2W1RA 3O5YA 4Z1WA 2W3EA 4RQ9A 4O0PA 3C2WA 5TJJA 5DFYA 4DMZA 4MCWA 3KSGA 4QPRA 1TD5A 4MDZA 5DFXA 4Q0IA 4O01A 4YOFA 3TRCA 4EUVA 1STZA 5HSQA 3LFVA 4G3VA 2GX5A 4O8GA 2XROA 2XRNA 2G7UA 4MN7A 1MKMA 4E04A 3KSFA 2VZWA 3IBRA 4R70A 2K2NA 2O9BA 4LRZE 2QYBA 3S7QA 2IA2A 4Q0HA 2KLIA 4R6LA 3E98A 2B18A 3EEAA 3VV4A 2W3GA 3NOUC 4ZRRA 2K31A 3MMHA 2OOLA 2W3HA 3E0YA 3CITA 4ME4A 3D3OA 3KO6A 1YKDA 4G3WA 2VEAA 2LB9A 4CQHA 4ETXA 3KSHA 3NOPC 4PAUA 3ZQ5A 1YSQA 3W2ZA 4IJGA 2M7VA 2Y79A 4EU0A 4FOFA 4LRXC 5C5KA 3KSIA 3MF0A 3S7OA 2W1TA 3S7NA 4MMNA 5HPFA 3NHQA 4Y5FA 2LB5A 3RFBA 5I5LA 3CI6A 2VJWA 3BJNA 4DN0A 3NOTC 2Y8HA 5L8MA 3OOVA 4Q0JA 3HCYA 2M7UA 1F5MA 3MQ0A 2KOIA 3OBFA 2W1TB 2O9CA 4G3KA 2VKSA 4IUKA 4IUHA 2O0YA 2W3DA 1YSPA 1TF1A 5HL6A 2HGVA 5AJGA 3S7PA 4GW9A 4BWIA 2O9AA 3R4KA 1MC0A 4Y3IA 2W3FA 1ZTUA 2XSSA 3DBAA 4Y2FA 4ETZA 5K5BA 4YNRA 2ZMFA 4GLQA 3IBJA 2O99A 5HPIA 5LBRA 3K2NA 3G6OA
chains in the Genus database with same CATH superfamily
3UDIA 4N1XA 2J9PA 2HDUA 2XDMA 4JXGA 4OH0A 2HF6A 4CLCC 1TD5A 3A3IA 2EWVA 3VSKA 2PU2A 3GTCA 3N8LA 1IELA 4O7DA 2WUQA 1ZG4A 4DE1A 3DWKA 3KYEA 1ES4A 4R3JA 3UMDA 4KG6A 3BFCA 4PKYA 1RP5A 4R23A 3E98A 3RJUA 5HX9A 2W3GA 5F5YA 3NI9A 3D4FA 1M6KA 5F1FA 3QP8A 4U0XA 1O07A 1S4SA 4BD0A 3HUNA 4EU0A 4HQAA 2ZQ9A 4HI4A 3IWQA 3UN7A 2XF3A 1TS0A 1P97A 4OP5A 3CPTA 2ZM8A 1ZC2A 5GLAA 3M6HA 1ESUA 3R7WA 4LV1A 4NG2A 4BD1A 5AQ7A 3QP5A 3UB9A 1V9YA 3IS2A 2OV5A 2VGLM 3C4OA 4NKPA 3LEQA 4U0TA 2H10A 1CI9A 2W3DA 3GQZA 2B5RA 4Q8IA 1V9ZA 1KOUA 5CTMA 2W3FA 4KZ8A 4YFMA 2FZ0A 2WGWB 3IXBA 4GD6A 1K57A 1ZHHB 3A3EA 2XGNA 3DTEA 4JPMA 2HJEA 1BSGA 4DDYA 1YLYA 3OPHA 5HPIA 5LBRA 3F1NA 1QMFA 3IXHA 1LT0A 4QJGA 1XP4A 3LO7A 4PM6A 2VK3A 1XXMA 1OT9A 4RQ9A 4WMCA 5DFYA 1HVBA 1GHPA 3LR5A 3DTMA 3IWOA 3MR0A 4I3JA 1XGIA 4CJNA 5DF7A 3FV7A 3PBSA 2Y2PA 4GD8A 1SHVA 4B9OA 5F82A 2O9BA 5CGXA 3ZG5A 3EEAA 4C3QA 5FI7A 3UPNA 1PZPA 4JGPA 3D3OA 3V39A 5KSHA 3BLSA 2OSUA 3CUEC 3MXSA 2Y59A 4GHIB 4WUJA 3SH9A 4AFIA 4DE3A 2XLNA 3KSIA 4NXBA 2W1TA 3QNBA 5G4ZA 4MMNA 5J3WA 1I5QA 3NHQA 3GR2A 3A0VA 1K38A 3PBTA 4DF6A 1YM1A 3QP6A 3VE3A 2XFSA 5I94A 4OP8A 3SOIA 4HBUA 1X0OA 4E3OA 1NXYA 1O7EA 2NUPC 3IT9A 4FD8A 4GZBA 2HGVA 1HTZA 3BRMA 4Y3IA 5E43A 4E6WA 4KQQA 3HLEA 3P01A 3V3SA 4ETZA 5K5BA 2WKHA 5F83A 2ZQCA 4EBPA 1DRMA 4PHTA 5GL9A 4X25A 3SH7A 4DE0A 2Y2JA 1PZOA 3OZHA 2QPNA 2W1RA 3O5YA 1WE4A 1GSWA 1FOFA 5AVEA 2CC1A 4OPYA 5DVAA 2Y2MA 2ZOHA 4E3NA 1BZAA 5GLDA 3LIEA 2PRFA 4MBHA 2ZL1B 5EOOA 2QYBA 3C38A 3MZFA 2PYPA 2KLIA 1FIKA 3MKFA 4H6JB 4RVAA 4OPRA 1ONHA 3BQAA 3P7NA 4OOLA 4XT2A 4CQHA 3AGEA 2Z2LB 2VGJA 1OJGA 4P6BA 3EOIA 5J8XA 5FDHA 3T4QA 4DJ2A 4QY5A 5HZHA 4JF5A 1JWZA 2XFTA 4OQ0A 1YLPA 4BBTA 1W7FA 5FEGA 2IWDA 3MXQA 2GZAA 1D06A 3P98A 5KZHA 3IH9A 5EVIB 1YLJA 5A90A 2PR6A 1P9RA 2Z2MB 4S2PA 3PBQA 4ZBEA 2QKPA 4OLDA 4YNRA 2FH5A 2ZMFA 4WZ5C 5FASA 4L9EA 3P09A 5F1GA 1M40A 4MNRA 4O0PA 1PWGA 3HUMA 5FEFA 4DMZA 4HH3A 4K08A 3E4PA 5HARA 4HNBA 4O01A 4YOFA 4I38A 4LCLA 2WADA 3K3CA 5CGWA 2VZWA 3I7JA 2V0UA 2BASA 2FFYA 4IBRA 1KGEA 2BTFP 3CJMA 3OPLA 3HUOA 3T4TA 4S2JA 3WS5A 1BT5A 3CITA 3KO6A 4HP9A 4I3IA 4EERA 5IT5A 5HWVA 2MJ6A 2WKQA 2OWJA 4X55A 5HDDA 4XUXA 3UB6A 2PU4A 3LUQA 3O87A 4MN5A 2GJ3A 4XUZA 3OPRA 2V1BA 5C5KA 2PT7A 4DE2A 2HPBA 3HVFA 4Y5FA 2LB5A 3BECA 5FA7A 3MSHA 3G31A 1S67L 4HHDA 1LSXA 3OOVA 3W4QA 5HDCA 2ZQ8A 4PM5A 4B88A 5FAOA 3AGDA 2KOIA 2ZMAA 2OLUA 2P9VA 4QB8A 1KVLA 1SKOB 5A91A 4BLMA 3LR3A 3LI9A 3R4KA 4CLCE 3Q07A 5HL1A 3V67A 1PNEA 3E4QA 4KQOA 3ZG8B 4E3LA 1A0KA 1S0WA 4NETA 1DP9A 3F1PA 4R1GA 1KDSA 3UMEA 5EM0A 4II7A 2ZM0A 5AQBA 4NEED 1T1BA 2VV8A 4LRYC 4GKUA 1NRJA 3FWLA 1SKFA 1XJ6A 4OPQA 1T18A 1WA9A 5CXWA 1H8MA 4HEFA 5FSRA 1JWVA 4WM9A 4E04A 3GECA 4P6ZM 1ACFA 1ALQA 4LV3A 3QP2A 3S7QA 2IA2A 2J3WA 3TJZC 4KZ9A 3PXPA 1NLYA 3SS4A 2WKRA 3ZFZA 4N9LA 2H5SA 2P7JA 3G2YA 2UV0E 1ES3A 4PAUA 3ZQ5A 4XXRA 5EVEA 3MF0A 1JVJA 4BQMA 2WGIA 4JF4A 2JN7A 3LEZA 4DDSA 4JGOA 2HDSA 1K6SA 5FATA 1W8YA 4OPZA 3PBOA 3A0SA 2Y8HA 4F3LB 4JXSA 5DF8A 1PYYA 3IX4A 3OPPA 2ZD8A 3OC2A 1UGUA 3MQQA 4HOIA 4X1LA 4Y13A 4S2NC 3IWIA 3CG5A 5HL6A 3VMAA 3IF5A 2DMWA 4GW9A 3UO9A 2O9AA 1LL9A 5GHYA 3IF6A 1NLZA 3A3FA 2B95A 3DWZA 4GCZA 4UAAA 2PD7A 2XK1A 3G6OA 3ZGAB 4GS9A 1VHMA 1K57C 1L2SA 1K6RA 1XPBA 4A5RA 4GN2A 1K25A 3T4LA 1HZOA 4PM8A 1ONGA 1F2KA 1XA1A 4HJ3A 4WL9A 4B4ZA 2HP5A 1ERMA 4R70A 1Y28A 1S6RA 3IHAA 3KYQA 4R6LA 1NY0A 5DKLA 4S2IA 1GHMA 5CX7A 1W79A 1J9MA 4LGWA 5HDSA 2W3HA 1XA7A 4ARZA 3WS1A 5CHUA 2PR5A 3VP1A 4IBXA 4NXEA 1YLZA 3NIAA 4HJ4A 3V50A 3SS5A 1MWUA 3LY4A 2VV6A 5E2GA 4BJPA 2EWWA 3DAVA 1K54C 5EOEA 5HWWA 1Y4OA 3UB5P 4EXOA 1K56A 5TFQA 2A24A 3GSGA 4KZ4A 3DTIA 3HCYA 3PBRA 2J7VA 1OTAA 1YQSA 2VKSA 3MFXA 4KZBA 3H7WA 5EVID 1MZUA 4EEUA 1ZTUA 4EEPA 3T4SA 1E25A 3B47A 2ZQ7A 4CPKA 1S1ZA 3BEBA 2O99A 1F9IA 4ID4A 3ZCZA 3EGXC 1XX2A 2ZQAA 3T50A 5EVIC 2EXBA 2Y4AA 4I39A 3VP4A 4C6YA 3C2WA 3GDIA 5TJJA 3CZDA 2EX9A 4PMAA 3H82A 5DFXA 4KENB 4YINA 2GX5A 2WZZA 3U4LP 1GSXA 2WAFA 2E8JA 2PD8A 4S2OA 3T1QB 5EFWA 2PBYA 1YKDA 2JHEA 1N9LA 3ZG0A 1TDLA 2OLVA 1TVFA 4KQRA 2Z6CA 1ERQA 3NOPC 1QMEA 3W2ZA 1J3WA 3UE0A 5DJTA 2DNSA 2XA7M 2EA9A 3IHBA 3RTYA 1ESIA 2EX2A 2D01A 2WYXA 5HD3A 3M2JA 2W0NA 4CLCA 5G4YA 1P0ZA 2JKFA 5CECA 5IHVA 3CPTB 3UPPA 2ACGA 3R7WB 1YSPA 1H0MA 1LL5A 5AJGA 2ZC6B 1L0FA 2IWBA 3S1YA 4GB7A 2J9OA 3IS2B 5FI6A 5AQ9A 3N6IA 4PM7A 4N9KA 3MQOA 4HH2A 3ZG9B 3ZHHA 1KGFA 2A49A 1Z09A 1NZUA 5MC7A 1Q2QA 3ITBA 1C3BA 1MY8A 1IEMA 3OCNA 3D9YA 4GDNA 1GSVA 3OCLA 4QPRA 4OVDA 5M18A 2RCXA 3F1NB 3Q7VA 2AVXA 4RYEA 1VM1A 1RGYA 4EETB 4D2OA 3NBLA 2P08A 5TBMA 2K7SA 3S22A 3MS6A 3WS0A 1DJBA 3Q81A 1CK3A 3NECA 3L9KA 4X6TA 2PAVP 4Y0OA 5EECA 1VQQA 4LLOB 2ZJ9A 4OONA 1BTLA 4HIAA 2Q0OA 2EX8A 1RCJA 3VSLA 5HD5A 3QNCA 4EQIA 2P74A 2M7VA 1PWDA 1K55A 3G4PA 3W4OA 3GV9A 5FL3A 2KDKA 3PBNA 3U2AA 3HL9A 4EBLA 5EVLA 2G2UA 3IH8A 1W63M 4MN6A 3BJNA 3N7WA 4LV0A 1LLBA 5FQQA 1GHIA 3Q1FA 2FFFB 2W1TB 2QWSA 4R4SA 5EPHA 1YPRA 3UE3A 4ZDXA 3UDXA 4IUHA 1EW0A 4BWIA 4NXFA 2WKEA 3ZVTA 3BQ8A 3C5AA 1TS7A 4WELA 2V8CA 4Y2FA 3B33A 3A3JA 3EQVA 4FH2A 4GLQA 3EQUA 2L4RA 3CUEA 3MZDA 4HP4A 2JE5A 3ISGA 1S1YA 1OTIA 3Q82A 2W3EA 2V0WA 1W5DA 4S2LA 1FCMA 2H0TA 1VEUA 4MCWA 1L0GA 4RX3A 1YAXA 3BFDA 5HSQA 4P85A 4KUOA 2CMNA 2BG1A 3N8RA 5AVFA 2V20A 3LICA 4WLAA 2Y91A 1LL8A 3VOZA 2OOLA 3B42A 1OMEA 3CAXA 2LB9A 4JGQA 1TS6A 1G6OA 3VE4A 3ZNTA 3G32A 1CEGA 1N4OA 4N1HA 2ZC4B 3S7OA 2EFXA 4LPZA 4XT2B 1IFQA 3E4OA 4PPRA 2V2FF 5L2FA 2WZXA 2Y2LA 4DN0A 3MBZA 4R0QA 3ZNYA 3PAEA 5HFOA 3E2KA 5D3OA 2A3UA 3TE8A 2EFUA 3UPOA 5EE8A 5CGSA 1F5MA 1GA9A 4UEYA 1XJ2A 2V8FA 2O9CA 4JKTA 4IUKA 4ESPA 2UWXA 5F68A 1G6AA 1JTDA 1ZKJA 5M1AA 4S2MA 2JCHA 3IX8A 1CI8A 1E3UD 4C75A 1W63Q 2R9WA 4N92A 3IF6C 3MXRA 1OPXA 3MFDA 1U60A 3FC7A 2JKRI 1PIOA 4NXGA 3BLMA 2L1MA 2Z6DA 2I72A 4U3TA 2D02A 3FPVA 3LI8A 3C8CA 3QP1A 3DTKA 4WEKA 1UWNX 2V1AA 3WRZA 4RA7A 1GCEA 3KSFA 1MBLA 3VOLA 1SDEA 1OTEA 1XFQA 4UA6A 5U47A 2B18A 1SDNA 2EXAA 3B3XA 1L0EA 4ZRRA 2K31A 2P04A 2Y2QA 4ME4A 2J3TC 5IS1A 4IVIA 5DF9A 4DXBA 5FQMA 2XD1A 1W8QA 3S4XA 5KIZA 3EGDC 4HESA 4IJGA 4EWFA 4UHUA 5GLCA 4S2KA 4QWOA 1KE3A 1VETA 2Y55A 1EWZA 3QP4A 1N9OA 3T4JA 3UE1A 4OOMA 3FG8A 3T1XA 3CI6A 1DP8A 2VJWA 3BFFA 5GHZA 1Y54A 1K4FA 5FAQA 1H3QA 3F1OA 3HLBA 3HBRA 1YMSA 5FI2A 1XKZA 5AQAA 5GLBA 3D72A 3NDGA 4QU3A 5FQIA 3OBFA 2Y2OA 1H8ZA 2I9VA 2Y2IA 3G30A 4ZJ1A 2RL3A 3O3VA 2J8YA 1IOUA 1NWZA 2Q9MA 4JGRA 3DBAA 3T4OA 2JKTI 1L3LA 1LI9A 1ES2A 4GNUA 3FZCA 2P9VB 3OLOA 5A93A 4GJ4A 2B02A 1KE4A 1EI5A 4BBUA 1XJ3A 4JXWA 2EX6A 3TOIA 3NDEA 1T1CA 3KX0X 1DP6A 4IEDA 4DRTA 3NCKA 2VGLS 2VA0A 3VP0A 5E2FA 1KGGA 4X53A 3F1PB 1AXBA 2HP6A 3BFGA 3LFVA 2G7UA 4GDBA 1IKGA 1NJ4A 4F94A 1DJAA 1N9NA 4X1MA 1HLUP 5DJUA 4BL3A 3UB8A 1SZVA 1T1AA 2V1ZA 5CHJA 4WMCD 3NOUC 5EV0A 3LYXA 2GNXA 5DTSA 4ZJ2A 3HJIA 1OT6A 1S66L 4ETXA 4Y0UA 3V3RA 2JC7A 1YSQA 2Y2HA 4KG5A 3SZTA 3H9WA 3TG9A 2PBDP 1PFLA 3KYZA 5CHMA 1LHYA 5TGFA 2R78A 3NJAA 3LGOA 3LIDA 2R9XA 4EQ1A 2XA7S 2Y2NA 3QHYA 3NOTC 2WGWA 4JBFA 2JKRM 3FKVA 1BUEA 1FCOA 3MQ0A 2JBFA 3IXDA 2O0YA 4LENA 4GOGA 4EV4A 2OAQ1 1SCWA 3FPWA 1DJCA 1G68A 3BY8A 4BENA 4Y7PA 3N8SA 2ZC5B 4EESA 4JXVA 4R3BA 3IF6B 2GDNA 5M19A 3A0RA 4EW7A 1OJ5A 4OOYA 3A3DA 4ZAMA 4HJ6A 4LV2A 3BWLA 4X69A 1JNUA 3KSGA 1ES5A 5FQ9A 3M2KA 1DY6A 4G3VA 4O8GA 4GS9B 4HY8A 5EUAA 4MLLA 4GHIA 2QZ6A 2XR0A 1PRQA 3ZYTA 4HBTA 4S2NA 4H8RA 3DW0A 1Q2PA 1VB6A 5GHXA 2E8IA 2Y79A 1WYBA 4FTXA 4LRXC 1E4DA 2X71A 4ARZB 2C6WB 2WGVA 3HLGA 1GA0A 4YWZA 2JKTM 3LIBA 2QMIA 1H5XA 4K0WA 3LY3A 3PAGA 3PYPA 1S4RA 1K55C 1L0DA 3LR4A 4FUWA 3LIFA 1NYYA 4K0XA 1CF0A 5JYPA 1I2SA 3TSGA 1XGJA 5FAPA 3MKEA 3RXXA 2DRWA 5CEBA 2A24B 4UQIM 1K0KA 3G35A 4FH4A 3RH8B 1EROA 3MZEA 3WS4A 5L09A 1NYMA 2PDRA 1PW1A 2QHKA 2WKPA 3H7WB 4R3AA 3O86A 2C5WB 1WYCA 3EWKA 1UWPX 2ZL1A 2ZC3B 1MWRA 2X02A 3GRJA 1JTGA 5HAPA 4QY6A 1TDGA 1K54A 4MDZA 4H6JA 1FCNA 4KZ7A 1MWTA 4UA7A 4L9GA 3W4PA 3GMWA 4BMWA 3WS2A 3H82B 3MMHA 3UNWA 4E3JA 1CJFA 2XQZA 1T19A 3JYIA 2BLSA 1ZG6A 1OTDA 3FYZA 1FR1A 4UA9A 4I5SA 1NZOA 5F6AA 4OKPA 3V5MA 2PHYA 4QHCA 4RX2A 5HPFA 1NRFA 3RFBA 3CMZA 3C7VA 4B4XA 5EVIA 3NC8A 3JVUA 1IYQA 2XEPA 2M7UA 2WK0A 1MKIA 3CLOA 4MBKA 1TF1A 3S7PA 2A2LA 1LI0A 2L0WA 2VX8A 4JF6A 4CLCB 4ZJ3A 1BULA 3E2LA 3ZG7B 3SW1A 1I2WA 2HDRA 4PKYG 3T4KA 3K2NA 4LCMA 4BBVA 1MWSA 4FSFA 2QJ7A 3ZVWA 1IYSA 5L10A 1IYOA 2ZMVA 4KG2A 4MN7A 1MKMA 2ZBBA 4KZ5A 2K2NA 1AWIA 2NUTC 2XD5A 2VLGA 2HZ5A 3VV4A 4DKIA 3HLFA 4E3KA 3Q7VB 4G3WA 2VEAA 3L7HA 1FSYA 2V9AA 4M3KA 3KSHA 5TBMB 4ZTKA 1ODVA 4R4RA 1BLHA 3HREA 3C4PA 4WEJA 4OLGA 1D1JA 3IX3A 1IKIA 1FR6A 2ZQDA 1F98A 4P6ZS 5EM1A 1KDWA 5I5LA 1SKOA 2Y2GA 5DTTA 3N4IA 5CERA 1TS8A 3T12B 5E2EA 3Q7ZA 1FILA 5L8MA 1TEMA 4DJ3A 3PR6A 1K4EA 3VP3A 3VOYA 2Y2KA 3FKWA 3UDFA 4P0MA 4G3KA 3TW8A 1PI5A 2YKFA 4E3MA 1G5UA 1XJ4A 5FDSA 5J4EA 5KSCA 2OAP1 1MC0A 4FCFA 3PTEA 1D7EA 2XSSA 4Z9QA 3NY4A 1CEFA 5F69A 4WF0A 4KQDA 2QJ5A 3SS3A 4I3AA 4E6XA 4X56A 2Q9NA 4IHQA 3LR0A 1XFNA 4Z1WA 2ZM2A 2XH9A 5CRFA 4PM9A 4E3IA 1YLWA 1BLSA 4D60A 2WAEA 3BFEA 2WKIA 4Q0IA 4P87A 3TRCA 2XROA 4KZ3A 2XRNA 3IBRA 3GVBA 1PI4A 3JVVA 2ZLYA 1G28A 4Y0TA 4OQGA 5E2HA 2HDQA 1BYWA 3UE6A 3HLDA 3W8KA 1VEUB 3ZDJA 3T1SA 3MJQA 3LCEA 1N9BA 3M6BA 3NULA 2J3TD 1H8YA 2VV7A 5L07A 5BOHA 3WRTA 3CHWP 4F3LA 1CQAA 3WWXA 1PW8A 3SH8A 3HLWA 5A8BA 3S7NA 2VGKA 4JLFA 5IU1A 4WYYA 3HJKA 2IWCA 3IQAA 3EEHA 1JWPA 4WBGA 3G34A 5FQJA 3T1RA 4L9FA 5HWTA 1BLCA 5DTKA 3IXGA 4Y15A 5CTNA 4LFUA 5J7EA 4WZ5A 2X01A 2HV1A 4NK3A 1K56D 1P9WA 4MEZA 4OQIA 3BW6A 4M4XA 2ZC7A 1MPLA 3BY9A 1MXOA 5TR7A 2H28A 2JKGA 5FQKA 3K3DA 1HD8A 1YMXA 4EUZA 3BYDA 4QD4A 1KVMA 4WZ4A 2G2WA 4R38A 2H0YA 4Y17A 5HAIA 4L0LA 5DKKA 2HJ9C 4EUVA 1STZA 1BLPA 1KE0A 3BM6A 3G2ZA 1FSWA 1OTBA 4LRZE 4Q0HA 5JYOA 3VFFA 3E0YA 2KX6A 2OWHA 4KZAA 4BL2A 3LIAA 5CEDA 1YLTA 3ITAA 4X68A 4DXCA 4KUKA 1FQGA 3VFHA 1Z6FA 3PHYA 3VP2A 5KMWA 4FOFA 1LSVA 3JPUA 2J80A 3UB7A 2INWA 1YT4A 3C7UA 5A92A 2YKHA 5G18A 4IVKA 4OQHA 3O88A 1PWCA 3RXWA 2M1CA 1RGZA 3AGFA 4WN5A 5HAQA 4Q0JA 1E3UA 1LSWA 2W27A 3C30A 1VETB 2HP9A 4EBNA 2PYRA 4MBFA 4K91A 1IYPA 3CWFA 2ZOIA 3F1OB 4B93A 4CLCD 2DCFA 5HW3A 3ULFA 3ICYA 3UY6A 3IBJA 3HLCA 4KZ6A 4UQIS
chains in the Genus database with same CATH topology
3EWKA 1OTIA 2VV8A 1UWPX 4LRYC 1NRJA 2W3EA 2V0WA 2HF6A 4CLCC 1XJ6A 1T18A 1WA9A 4MCWA 1TD5A 4H6JA 2EWVA 4MDZA 1H8MA 5HSQA 1YAXA 4E04A 3GECA 4L9GA 4P6ZM 4KUOA 2CMNA 3UMDA 4PKYA 3S7QA 2IA2A 2J3WA 5AVFA 3TJZC 3E98A 3PXPA 3LICA 1NLYA 4WLAA 2W3GA 3H82B 5F5YA 4BMWA 1LL8A 2WKRA 3MMHA 2OOLA 3B42A 1T19A 3CAXA 2LB9A 2P7JA 4JGQA 1OTDA 1TS6A 1G6OA 3VE4A 4UQIS 3ZQ5A 1S4SA 4I5SA 4EU0A 5F6AA 4HQAA 4HI4A 3MF0A 3S7OA 2PHYA 4LPZA 1TS0A 1P97A 4XT2B 1IFQA 3E4OA 5HPFA 2JN7A 4JGOA 3RFBA 3R7WA 4DN0A 3PBOA 3A0SA 2Y8HA 4F3LB 3TE8A 3UB9A 3JVUA 1V9YA 3IS2A 2VGLM 2M7UA 1F5MA 3OC2A 4UEYA 1XJ2A 2O9CA 1UGUA 3MQQA 4HOIA 4IUKA 4NKPA 3CLOA 2W3DA 5F68A 1TF1A 1V9ZA 5HL6A 2DMWA 4GW9A 3S7PA 2O9AA 1KOUA 2A2LA 2W3FA 2L0WA 2VX8A 2FZ0A 4CLCB 1NLZA 1ZHHB 1W63Q 3SW1A 2HJEA 4GCZA 5HPIA 5LBRA 3F1NA 3T4KA 4PKYG 2PD7A 3K2NA 3G6OA 1OPXA 4GS9A 1LT0A 3FC7A 1VHMA 2JKRI 4NXGA 4BBVA 2L1MA 2Z6DA 1OT9A 4RQ9A 3T4LA 4FSFA 2QJ7A 2D02A 5DFYA 3FPVA 3LI8A 3LR5A 4HJ3A 3C8CA 3MR0A 4I3JA 4WEKA 4WL9A 1UWNX 2V1AA 2ZMVA 3PBSA 4MN7A 1MKMA 3KSFA 4R70A 2ZBBA 4B9OA 3VOLA 1Y28A 2K2NA 2O9BA 1OTEA 1XFQA 2NUTC 2VLGA 3KYQA 4R6LA 2B18A 3EEAA 5DKLA 3VV4A 5CX7A 4ZRRA 2K31A 5HDSA 2P04A 2W3HA 4ARZA 4JGPA 3D3OA 4ME4A 2J3TC 5KSHA 4G3WA 2VEAA 5IS1A 5DF9A 2PR5A 2V9AA 3CUEC 4NXEA 3KSHA 5KIZA 5TBMB 4GHIB 4HJ4A 1ODVA 3EGDC 4WUJA 4IJGA 4AFIA 2VV6A 4BJPA 2EWWA 3KSIA 4WEJA 4NXBA 2W1TA 5G4ZA 4MMNA 5J3WA 1N9OA 5HWWA 3NHQA 3T4JA 1F98A 4P6ZS 4OOMA 3FG8A 3A0VA 5I5LA 3CI6A 1DP8A 2VJWA 4EXOA 1TS8A 3PBTA 5L8MA 1H3QA 3F1OA 3VE3A 4DJ3A 3PR6A 2A24A 3HCYA 1X0OA 3D72A 3PBRA 3OBFA 1OTAA 4G3KA 3TW8A 2VKSA 2YKFA 2I9VA 2NUPC 3MFXA 1XJ4A 3H7WA 5J4EA 2OAP1 2HGVA 1IOUA 1MC0A 1MZUA 4Y3IA 1NWZA 4EEUA 1ZTUA 1D7EA 4EEPA 2XSSA 4JGRA 5F69A 3DBAA 3T4SA 3T4OA 3B47A 2JKTI 3P01A 4WF0A 4ETZA 5K5BA 4KQDA 2QJ5A 3OLOA 1S1ZA 4GJ4A 2O99A 1DRMA 1F9IA 2B02A 4I3AA 4PHTA 4BBUA 3EGXC 1XJ3A 1T1CA 3KX0X 1DP6A 4IHQA 3T50A 2W1RA 1XFNA 3LR0A 3O5YA 4Z1WA 4I39A 1GSWA 3C2WA 2VGLS 2VA0A 3GDIA 5AVEA 5TJJA 3H82A 2ZOHA 5DFXA 4Q0IA 3F1PB 3TRCA 3LFVA 2XROA 2GX5A 1GSXA 2G7UA 2XRNA 3IBRA 3LIEA 1N9NA 3JVVA 5DJUA 2QYBA 3C38A 3UB8A 2PYPA 2PD8A 1G28A 1T1AA 2KLIA 1BYWA 3UE6A 3NOUC 4H6JB 3LYXA 3MJQA 5EFWA 2GNXA 3BQAA 1YKDA 3P7NA 3HJIA 4OOLA 4XT2A 1OT6A 2JHEA 1N9LA 1S66L 4CQHA 4ETXA 2J3TD 2Z6CA 3NOPC 1YSQA 3W2ZA 2VV7A 4F3LA 1OJGA 3H9WA 3EOIA 5DJTA 2XA7M 3KYZA 2EA9A 2R78A 5A8BA 3NJAA 3T4QA 3S7NA 4DJ2A 5HZHA 3RTYA 2D01A 5IU1A 5HD3A 4BBTA 3LIDA 4EQ1A 3HJKA 2XA7S 3EEHA 3NOTC 2W0NA 4CLCA 3MXQA 2GZAA 5G4YA 1D06A 2JKRM 1P0ZA 3MQ0A 4L9FA 5HWTA 2O0YA 5J7EA 3R7WB 1YSPA 4R3AA 5AJGA 2HV1A 1P9WA 2OAQ1 3BW6A 2PR6A 4M4XA 3FPWA 3IS2B 1P9RA 3PBQA 3BY8A 3BY9A 2QKPA 3MQOA 4YNRA 2FH5A 2ZMFA 4HH2A 2H28A 4L9EA 3K3DA 4EESA 5MC7A 3A0RA 4EW7A 1OJ5A 3OCNA 4O0PA 4R38A 4HJ6A 4DMZA 3BWLA 4HH3A 1GSVA 4K08A 1JNUA 3E4PA 3OCLA 3KSGA 4L0LA 4HNBA 4QPRA 2HJ9C 5DKKA 4O01A 4YOFA 4EUVA 1STZA 3F1NB 4I38A 4G3VA 4O8GA 4GS9B 3K3CA 2VZWA 4EETB 4HY8A 2V0UA 2BASA 2P08A 5TBMA 2K7SA 1OTBA 4GHIA 4LRZE 4Q0HA 3ZYTA 3T4TA 3E0YA 3CITA 4LLOB 2KX6A 3KO6A 2OWHA 4HP9A 3LIAA 4HIAA 4I3IA 4EERA 5IT5A 5HWVA 2MJ6A 1VB6A 2WKQA 5HD5A 2OWJA 5HDDA 4KUKA 3PHYA 3UB6A 2M7VA 3LUQA 2Y79A 4FOFA 4LRXC 1LSVA 4MN5A 2GJ3A 2V1BA 5C5KA 2PT7A 2J80A 4ARZB 5FL3A 2KDKA 3PBNA 2INWA 3U2AA 3UB7A 4YWZA 2YKHA 4Y5FA 1W63M 2LB5A 2JKTM 3LIBA 4MN6A 3BJNA 1S67L 3PYPA 4HHDA 1S4RA 1LSXA 3LR4A 2M1CA 3LIFA 3OOVA 4WN5A 5HDCA 4Q0JA 1LSWA 2W27A 3C30A 2KOIA 2W1TB 2QWSA 3UE3A 4IUHA 2PYRA 1EW0A 4BWIA 3LR3A 4NXFA 3LI9A 3R4KA 3CWFA 4CLCE 2ZOIA 3F1OB 3V67A 2A24B 3BQ8A 3E4QA 4UQIM 4B93A 4CLCD 4KQOA 3RH8B 1TS7A 4WELA 4Y2FA 3B33A 3EQVA 1DP9A 3ULFA 2PDRA 3ICYA 3F1PA 3IBJA 4GLQA 3UMEA 2QHKA 2WKPA 4II7A 3H7WB 3EQUA 2L4RA 3CUEA 4HP4A 4NEED 4PAUA 1T1BA 1S1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHM A;  4LRY C;  2W1R A;  3O5Y A;  4Z1W A;  2W3E A;  4RQ9 A;  4O0P A;  3C2W A;  5TJJ A;  5DFY A;  4DMZ A;  4MCW A;  3KSG A;  4QPR A;  1TD5 A;  4MDZ A;  5DFX A;  4Q0I A;  4O01 A;  4YOF A;  3TRC A;  4EUV A;  1STZ A;  5HSQ A;  3LFV A;  4G3V A;  2GX5 A;  4O8G A;  2XRO A;  2XRN A;  2G7U A;  4MN7 A;  1MKM A;  4E04 A;  3KSF A;  2VZW A;  3IBR A;  4R70 A;  2K2N A;  2O9B A;  4LRZ E;  2QYB A;  3S7Q A;  2IA2 A;  4Q0H A;  2KLI A;  4R6L A;  3E98 A;  2B18 A;  3EEA A;  3VV4 A;  2W3G A;  3NOU C;  4ZRR A;  2K31 A;  3MMH A;  2OOL A;  2W3H A;  3E0Y A;  3CIT A;  4ME4 A;  3D3O A;  3KO6 A;  1YKD A;  4G3W A;  2VEA A;  2LB9 A;  4CQH A;  4ETX A;  3KSH A;  3NOP C;  4PAU A;  3ZQ5 A;  1YSQ A;  3W2Z A;  4IJG A;  2M7V A;  2Y79 A;  4EU0 A;  4FOF A;  4LRX C;  5C5K A;  3KSI A;  3MF0 A;  3S7O A;  2W1T A;  3S7N A;  4MMN A;  5HPF A;  3NHQ A;  4Y5F A;  2LB5 A;  3RFB A;  5I5L A;  3CI6 A;  2VJW A;  3BJN A;  4DN0 A;  3NOT C;  2Y8H A;  5L8M A;  3OOV A;  4Q0J A;  3HCY A;  2M7U A;  1F5M A;  3MQ0 A;  2KOI A;  3OBF A;  2W1T B;  2O9C A;  4G3K A;  2VKS A;  4IUK A;  4IUH A;  2O0Y A;  2W3D A;  1YSP A;  1TF1 A;  5HL6 A;  2HGV A;  5AJG A;  3S7P A;  4GW9 A;  4BWI A;  2O9A A;  3R4K A;  1MC0 A;  4Y3I A;  2W3F A;  1ZTU A;  2XSS A;  3DBA A;  4Y2F A;  4ETZ A;  5K5B A;  4YNR A;  2ZMF A;  4GLQ A;  3IBJ A;  2O99 A;  5HPI A;  5LBR A;  3K2N A;  3G6O A; 
#chains in the Genus database with same CATH topology
 3UDI A;  4N1X A;  2J9P A;  2HDU A;  2XDM A;  4JXG A;  4OH0 A;  2HF6 A;  4CLC C;  1TD5 A;  3A3I A;  2EWV A;  3VSK A;  2PU2 A;  3GTC A;  3N8L A;  1IEL A;  4O7D A;  2WUQ A;  1ZG4 A;  4DE1 A;  3DWK A;  3KYE A;  1ES4 A;  4R3J A;  3UMD A;  4KG6 A;  3BFC A;  4PKY A;  1RP5 A;  4R23 A;  3E98 A;  3RJU A;  5HX9 A;  2W3G A;  5F5Y A;  3NI9 A;  3D4F A;  1M6K A;  5F1F A;  3QP8 A;  4U0X A;  1O07 A;  1S4S A;  4BD0 A;  3HUN A;  4EU0 A;  4HQA A;  2ZQ9 A;  4HI4 A;  3IWQ A;  3UN7 A;  2XF3 A;  1TS0 A;  1P97 A;  4OP5 A;  3CPT A;  2ZM8 A;  1ZC2 A;  5GLA A;  3M6H A;  1ESU A;  3R7W A;  4LV1 A;  4NG2 A;  4BD1 A;  5AQ7 A;  3QP5 A;  3UB9 A;  1V9Y A;  3IS2 A;  2OV5 A;  2VGL M;  3C4O A;  4NKP A;  3LEQ A;  4U0T A;  2H10 A;  1CI9 A;  2W3D A;  3GQZ A;  2B5R A;  4Q8I A;  1V9Z A;  1KOU A;  5CTM A;  2W3F A;  4KZ8 A;  4YFM A;  2FZ0 A;  2WGW B;  3IXB A;  4GD6 A;  1K57 A;  1ZHH B;  3A3E A;  2XGN A;  3DTE A;  4JPM A;  2HJE A;  1BSG A;  4DDY A;  1YLY A;  3OPH A;  5HPI A;  5LBR A;  3F1N A;  1QMF A;  3IXH A;  1LT0 A;  4QJG A;  1XP4 A;  3LO7 A;  4PM6 A;  2VK3 A;  1XXM A;  1OT9 A;  4RQ9 A;  4WMC A;  5DFY A;  1HVB A;  1GHP A;  3LR5 A;  3DTM A;  3IWO A;  3MR0 A;  4I3J A;  1XGI A;  4CJN A;  5DF7 A;  3FV7 A;  3PBS A;  2Y2P A;  4GD8 A;  1SHV A;  4B9O A;  5F82 A;  2O9B A;  5CGX A;  3ZG5 A;  3EEA A;  4C3Q A;  5FI7 A;  3UPN A;  1PZP A;  4JGP A;  3D3O A;  3V39 A;  5KSH A;  3BLS A;  2OSU A;  3CUE C;  3MXS A;  2Y59 A;  4GHI B;  4WUJ A;  3SH9 A;  4AFI A;  4DE3 A;  2XLN A;  3KSI A;  4NXB A;  2W1T A;  3QNB A;  5G4Z A;  4MMN A;  5J3W A;  1I5Q A;  3NHQ A;  3GR2 A;  3A0V A;  1K38 A;  3PBT A;  4DF6 A;  1YM1 A;  3QP6 A;  3VE3 A;  2XFS A;  5I94 A;  4OP8 A;  3SOI A;  4HBU A;  1X0O A;  4E3O A;  1NXY A;  1O7E A;  2NUP C;  3IT9 A;  4FD8 A;  4GZB A;  2HGV A;  1HTZ A;  3BRM A;  4Y3I A;  5E43 A;  4E6W A;  4KQQ A;  3HLE A;  3P01 A;  3V3S A;  4ETZ A;  5K5B A;  2WKH A;  5F83 A;  2ZQC A;  4EBP A;  1DRM A;  4PHT A;  5GL9 A;  4X25 A;  3SH7 A;  4DE0 A;  2Y2J A;  1PZO A;  3OZH A;  2QPN A;  2W1R A;  3O5Y A;  1WE4 A;  1GSW A;  1FOF A;  5AVE A;  2CC1 A;  4OPY A;  5DVA A;  2Y2M A;  2ZOH A;  4E3N A;  1BZA A;  5GLD A;  3LIE A;  2PRF A;  4MBH A;  2ZL1 B;  5EOO A;  2QYB A;  3C38 A;  3MZF A;  2PYP A;  2KLI A;  1FIK A;  3MKF A;  4H6J B;  4RVA A;  4OPR A;  1ONH A;  3BQA A;  3P7N A;  4OOL A;  4XT2 A;  4CQH A;  3AGE A;  2Z2L B;  2VGJ A;  1OJG A;  4P6B A;  3EOI A;  5J8X A;  5FDH A;  3T4Q A;  4DJ2 A;  4QY5 A;  5HZH A;  4JF5 A;  1JWZ A;  2XFT A;  4OQ0 A;  1YLP A;  4BBT A;  1W7F A;  5FEG A;  2IWD A;  3MXQ A;  2GZA A;  1D06 A;  3P98 A;  5KZH A;  3IH9 A;  5EVI B;  1YLJ A;  5A90 A;  2PR6 A;  1P9R A;  2Z2M B;  4S2P A;  3PBQ A;  4ZBE A;  2QKP A;  4OLD A;  4YNR A;  2FH5 A;  2ZMF A;  4WZ5 C;  5FAS A;  4L9E A;  3P09 A;  5F1G A;  1M40 A;  4MNR A;  4O0P A;  1PWG A;  3HUM A;  5FEF A;  4DMZ A;  4HH3 A;  4K08 A;  3E4P A;  5HAR A;  4HNB A;  4O01 A;  4YOF A;  4I38 A;  4LCL A;  2WAD A;  3K3C A;  5CGW A;  2VZW A;  3I7J A;  2V0U A;  2BAS A;  2FFY A;  4IBR A;  1KGE A;  2BTF P;  3CJM A;  3OPL A;  3HUO A;  3T4T A;  4S2J A;  3WS5 A;  1BT5 A;  3CIT A;  3KO6 A;  4HP9 A;  4I3I A;  4EER A;  5IT5 A;  5HWV A;  2MJ6 A;  2WKQ A;  2OWJ A;  4X55 A;  5HDD A;  4XUX A;  3UB6 A;  2PU4 A;  3LUQ A;  3O87 A;  4MN5 A;  2GJ3 A;  4XUZ A;  3OPR A;  2V1B A;  5C5K A;  2PT7 A;  4DE2 A;  2HPB A;  3HVF A;  4Y5F A;  2LB5 A;  3BEC A;  5FA7 A;  3MSH A;  3G31 A;  1S67 L;  4HHD A;  1LSX A;  3OOV A;  3W4Q A;  5HDC A;  2ZQ8 A;  4PM5 A;  4B88 A;  5FAO A;  3AGD A;  2KOI A;  2ZMA A;  2OLU A;  2P9V A;  4QB8 A;  1KVL A;  1SKO B;  5A91 A;  4BLM A;  3LR3 A;  3LI9 A;  3R4K A;  4CLC E;  3Q07 A;  5HL1 A;  3V67 A;  1PNE A;  3E4Q A;  4KQO A;  3ZG8 B;  4E3L A;  1A0K A;  1S0W A;  4NET A;  1DP9 A;  3F1P A;  4R1G A;  1KDS A;  3UME A;  5EM0 A;  4II7 A;  2ZM0 A;  5AQB A;  4NEE D;  1T1B A;  2VV8 A;  4LRY C;  4GKU A;  1NRJ A;  3FWL A;  1SKF A;  1XJ6 A;  4OPQ A;  1T18 A;  1WA9 A;  5CXW A;  1H8M A;  4HEF A;  5FSR A;  1JWV A;  4WM9 A;  4E04 A;  3GEC A;  4P6Z M;  1ACF A;  1ALQ A;  4LV3 A;  3QP2 A;  3S7Q A;  2IA2 A;  2J3W A;  3TJZ C;  4KZ9 A;  3PXP A;  1NLY A;  3SS4 A;  2WKR A;  3ZFZ A;  4N9L A;  2H5S A;  2P7J A;  3G2Y A;  2UV0 E;  1ES3 A;  4PAU A;  3ZQ5 A;  4XXR A;  5EVE A;  3MF0 A;  1JVJ A;  4BQM A;  2WGI A;  4JF4 A;  2JN7 A;  3LEZ A;  4DDS A;  4JGO A;  2HDS A;  1K6S A;  5FAT A;  1W8Y A;  4OPZ A;  3PBO A;  3A0S A;  2Y8H A;  4F3L B;  4JXS A;  5DF8 A;  1PYY A;  3IX4 A;  3OPP A;  2ZD8 A;  3OC2 A;  1UGU A;  3MQQ A;  4HOI A;  4X1L A;  4Y13 A;  4S2N C;  3IWI A;  3CG5 A;  5HL6 A;  3VMA A;  3IF5 A;  2DMW A;  4GW9 A;  3UO9 A;  2O9A A;  1LL9 A;  5GHY A;  3IF6 A;  1NLZ A;  3A3F A;  2B95 A;  3DWZ A;  4GCZ A;  4UAA A;  2PD7 A;  2XK1 A;  3G6O A;  3ZGA B;  4GS9 A;  1VHM A;  1K57 C;  1L2S A;  1K6R A;  1XPB A;  4A5R A;  4GN2 A;  1K25 A;  3T4L A;  1HZO A;  4PM8 A;  1ONG A;  1F2K A;  1XA1 A;  4HJ3 A;  4WL9 A;  4B4Z A;  2HP5 A;  1ERM A;  4R70 A;  1Y28 A;  1S6R A;  3IHA A;  3KYQ A;  4R6L A;  1NY0 A;  5DKL A;  4S2I A;  1GHM A;  5CX7 A;  1W79 A;  1J9M A;  4LGW A;  5HDS A;  2W3H A;  1XA7 A;  4ARZ A;  3WS1 A;  5CHU A;  2PR5 A;  3VP1 A;  4IBX A;  4NXE A;  1YLZ A;  3NIA A;  4HJ4 A;  3V50 A;  3SS5 A;  1MWU A;  3LY4 A;  2VV6 A;  5E2G A;  4BJP A;  2EWW A;  3DAV A;  1K54 C;  5EOE A;  5HWW A;  1Y4O A;  3UB5 P;  4EXO A;  1K56 A;  5TFQ A;  2A24 A;  3GSG A;  4KZ4 A;  3DTI A;  3HCY A;  3PBR A;  2J7V A;  1OTA A;  1YQS A;  2VKS A;  3MFX A;  4KZB A;  3H7W A;  5EVI D;  1MZU A;  4EEU A;  1ZTU A;  4EEP A;  3T4S A;  1E25 A;  3B47 A;  2ZQ7 A;  4CPK A;  1S1Z A;  3BEB A;  2O99 A;  1F9I A;  4ID4 A;  3ZCZ A;  3EGX C;  1XX2 A;  2ZQA A;  3T50 A;  5EVI C;  2EXB A;  2Y4A A;  4I39 A;  3VP4 A;  4C6Y A;  3C2W A;  3GDI A;  5TJJ A;  3CZD A;  2EX9 A;  4PMA A;  3H82 A;  5DFX A;  4KEN B;  4YIN A;  2GX5 A;  2WZZ A;  3U4L P;  1GSX A;  2WAF A;  2E8J A;  2PD8 A;  4S2O A;  3T1Q B;  5EFW A;  2PBY A;  1YKD A;  2JHE A;  1N9L A;  3ZG0 A;  1TDL A;  2OLV A;  1TVF A;  4KQR A;  2Z6C A;  1ERQ A;  3NOP C;  1QME A;  3W2Z A;  1J3W A;  3UE0 A;  5DJT A;  2DNS A;  2XA7 M;  2EA9 A;  3IHB A;  3RTY A;  1ESI A;  2EX2 A;  2D01 A;  2WYX A;  5HD3 A;  3M2J A;  2W0N A;  4CLC A;  5G4Y A;  1P0Z A;  2JKF A;  5CEC A;  5IHV A;  3CPT B;  3UPP A;  2ACG A;  3R7W B;  1YSP A;  1H0M A;  1LL5 A;  5AJG A;  2ZC6 B;  1L0F A;  2IWB A;  3S1Y A;  4GB7 A;  2J9O A;  3IS2 B;  5FI6 A;  5AQ9 A;  3N6I A;  4PM7 A;  4N9K A;  3MQO A;  4HH2 A;  3ZG9 B;  3ZHH A;  1KGF A;  2A49 A;  1Z09 A;  1NZU A;  5MC7 A;  1Q2Q A;  3ITB A;  1C3B A;  1MY8 A;  1IEM A;  3OCN A;  3D9Y A;  4GDN A;  1GSV A;  3OCL A;  4QPR A;  4OVD A;  5M18 A;  2RCX A;  3F1N B;  3Q7V A;  2AVX A;  4RYE A;  1VM1 A;  1RGY A;  4EET B;  4D2O A;  3NBL A;  2P08 A;  5TBM A;  2K7S A;  3S22 A;  3MS6 A;  3WS0 A;  1DJB A;  3Q81 A;  1CK3 A;  3NEC A;  3L9K A;  4X6T A;  2PAV P;  4Y0O A;  5EEC A;  1VQQ A;  4LLO B;  2ZJ9 A;  4OON A;  1BTL A;  4HIA A;  2Q0O A;  2EX8 A;  1RCJ A;  3VSL A;  5HD5 A;  3QNC A;  4EQI A;  2P74 A;  2M7V A;  1PWD A;  1K55 A;  3G4P A;  3W4O A;  3GV9 A;  5FL3 A;  2KDK A;  3PBN A;  3U2A A;  3HL9 A;  4EBL A;  5EVL A;  2G2U A;  3IH8 A;  1W63 M;  4MN6 A;  3BJN A;  3N7W A;  4LV0 A;  1LLB A;  5FQQ A;  1GHI A;  3Q1F A;  2FFF B;  2W1T B;  2QWS A;  4R4S A;  5EPH A;  1YPR A;  3UE3 A;  4ZDX A;  3UDX A;  4IUH A;  1EW0 A;  4BWI A;  4NXF A;  2WKE A;  3ZVT A;  3BQ8 A;  3C5A A;  1TS7 A;  4WEL A;  2V8C A;  4Y2F A;  3B33 A;  3A3J A;  3EQV A;  4FH2 A;  4GLQ A;  3EQU A;  2L4R A;  3CUE A;  3MZD A;  4HP4 A;  2JE5 A;  3ISG A;  1S1Y A;  1OTI A;  3Q82 A;  2W3E A;  2V0W A;  1W5D A;  4S2L A;  1FCM A;  2H0T A;  1VEU A;  4MCW A;  1L0G A;  4RX3 A;  1YAX A;  3BFD A;  5HSQ A;  4P85 A;  4KUO A;  2CMN A;  2BG1 A;  3N8R A;  5AVF A;  2V20 A;  3LIC A;  4WLA A;  2Y91 A;  1LL8 A;  3VOZ A;  2OOL A;  3B42 A;  1OME A;  3CAX A;  2LB9 A;  4JGQ A;  1TS6 A;  1G6O A;  3VE4 A;  3ZNT A;  3G32 A;  1CEG A;  1N4O A;  4N1H A;  2ZC4 B;  3S7O A;  2EFX A;  4LPZ A;  4XT2 B;  1IFQ A;  3E4O A;  4PPR A;  2V2F F;  5L2F A;  2WZX A;  2Y2L A;  4DN0 A;  3MBZ A;  4R0Q A;  3ZNY A;  3PAE A;  5HFO A;  3E2K A;  5D3O A;  2A3U A;  3TE8 A;  2EFU A;  3UPO A;  5EE8 A;  5CGS A;  1F5M A;  1GA9 A;  4UEY A;  1XJ2 A;  2V8F A;  2O9C A;  4JKT A;  4IUK A;  4ESP A;  2UWX A;  5F68 A;  1G6A A;  1JTD A;  1ZKJ A;  5M1A A;  4S2M A;  2JCH A;  3IX8 A;  1CI8 A;  1E3U D;  4C75 A;  1W63 Q;  2R9W A;  4N92 A;  3IF6 C;  3MXR A;  1OPX A;  3MFD A;  1U60 A;  3FC7 A;  2JKR I;  1PIO A;  4NXG A;  3BLM A;  2L1M A;  2Z6D A;  2I72 A;  4U3T A;  2D02 A;  3FPV A;  3LI8 A;  3C8C A;  3QP1 A;  3DTK A;  4WEK A;  1UWN X;  2V1A A;  3WRZ A;  4RA7 A;  1GCE A;  3KSF A;  1MBL A;  3VOL A;  1SDE A;  1OTE A;  1XFQ A;  4UA6 A;  5U47 A;  2B18 A;  1SDN A;  2EXA A;  3B3X A;  1L0E A;  4ZRR A;  2K31 A;  2P04 A;  2Y2Q A;  4ME4 A;  2J3T C;  5IS1 A;  4IVI A;  5DF9 A;  4DXB A;  5FQM A;  2XD1 A;  1W8Q A;  3S4X A;  5KIZ A;  3EGD C;  4HES A;  4IJG A;  4EWF A;  4UHU A;  5GLC A;  4S2K A;  4QWO A;  1KE3 A;  1VET A;  2Y55 A;  1EWZ A;  3QP4 A;  1N9O A;  3T4J A;  3UE1 A;  4OOM A;  3FG8 A;  3T1X A;  3CI6 A;  1DP8 A;  2VJW A;  3BFF A;  5GHZ A;  1Y54 A;  1K4F A;  5FAQ A;  1H3Q A;  3F1O A;  3HLB A;  3HBR A;  1YMS A;  5FI2 A;  1XKZ A;  5AQA A;  5GLB A;  3D72 A;  3NDG A;  4QU3 A;  5FQI A;  3OBF A;  2Y2O A;  1H8Z A;  2I9V A;  2Y2I A;  3G30 A;  4ZJ1 A;  2RL3 A;  3O3V A;  2J8Y A;  1IOU A;  1NWZ A;  2Q9M A;  4JGR A;  3DBA A;  3T4O A;  2JKT I;  1L3L A;  1LI9 A;  1ES2 A;  4GNU A;  3FZC A;  2P9V B;  3OLO A;  5A93 A;  4GJ4 A;  2B02 A;  1KE4 A;  1EI5 A;  4BBU A;  1XJ3 A;  4JXW A;  2EX6 A;  3TOI A;  3NDE A;  1T1C A;  3KX0 X;  1DP6 A;  4IED A;  4DRT A;  3NCK A;  2VGL S;  2VA0 A;  3VP0 A;  5E2F A;  1KGG A;  4X53 A;  3F1P B;  1AXB A;  2HP6 A;  3BFG A;  3LFV A;  2G7U A;  4GDB A;  1IKG A;  1NJ4 A;  4F94 A;  1DJA A;  1N9N A;  4X1M A;  1HLU P;  5DJU A;  4BL3 A;  3UB8 A;  1SZV A;  1T1A A;  2V1Z A;  5CHJ A;  4WMC D;  3NOU C;  5EV0 A;  3LYX A;  2GNX A;  5DTS A;  4ZJ2 A;  3HJI A;  1OT6 A;  1S66 L;  4ETX A;  4Y0U A;  3V3R A;  2JC7 A;  1YSQ A;  2Y2H A;  4KG5 A;  3SZT A;  3H9W A;  3TG9 A;  2PBD P;  1PFL A;  3KYZ A;  5CHM A;  1LHY A;  5TGF A;  2R78 A;  3NJA A;  3LGO A;  3LID A;  2R9X A;  4EQ1 A;  2XA7 S;  2Y2N A;  3QHY A;  3NOT C;  2WGW A;  4JBF A;  2JKR M;  3FKV A;  1BUE A;  1FCO A;  3MQ0 A;  2JBF A;  3IXD A;  2O0Y A;  4LEN A;  4GOG A;  4EV4 A;  2OAQ 1;  1SCW A;  3FPW A;  1DJC A;  1G68 A;  3BY8 A;  4BEN A;  4Y7P A;  3N8S A;  2ZC5 B;  4EES A;  4JXV A;  4R3B A;  3IF6 B;  2GDN A;  5M19 A;  3A0R A;  4EW7 A;  1OJ5 A;  4OOY A;  3A3D A;  4ZAM A;  4HJ6 A;  4LV2 A;  3BWL A;  4X69 A;  1JNU A;  3KSG A;  1ES5 A;  5FQ9 A;  3M2K A;  1DY6 A;  4G3V A;  4O8G A;  4GS9 B;  4HY8 A;  5EUA A;  4MLL A;  4GHI A;  2QZ6 A;  2XR0 A;  1PRQ A;  3ZYT A;  4HBT A;  4S2N A;  4H8R A;  3DW0 A;  1Q2P A;  1VB6 A;  5GHX A;  2E8I A;  2Y79 A;  1WYB A;  4FTX A;  4LRX C;  1E4D A;  2X71 A;  4ARZ B;  2C6W B;  2WGV A;  3HLG A;  1GA0 A;  4YWZ A;  2JKT M;  3LIB A;  2QMI A;  1H5X A;  4K0W A;  3LY3 A;  3PAG A;  3PYP A;  1S4R A;  1K55 C;  1L0D A;  3LR4 A;  4FUW A;  3LIF A;  1NYY A;  4K0X A;  1CF0 A;  5JYP A;  1I2S A;  3TSG A;  1XGJ A;  5FAP A;  3MKE A;  3RXX A;  2DRW A;  5CEB A;  2A24 B;  4UQI M;  1K0K A;  3G35 A;  4FH4 A;  3RH8 B;  1ERO A;  3MZE A;  3WS4 A;  5L09 A;  1NYM A;  2PDR A;  1PW1 A;  2QHK A;  2WKP A;  3H7W B;  4R3A A;  3O86 A;  2C5W B;  1WYC A;  3EWK A;  1UWP X;  2ZL1 A;  2ZC3 B;  1MWR A;  2X02 A;  3GRJ A;  1JTG A;  5HAP A;  4QY6 A;  1TDG A;  1K54 A;  4MDZ A;  4H6J A;  1FCN A;  4KZ7 A;  1MWT A;  4UA7 A;  4L9G A;  3W4P A;  3GMW A;  4BMW A;  3WS2 A;  3H82 B;  3MMH A;  3UNW A;  4E3J A;  1CJF A;  2XQZ A;  1T19 A;  3JYI A;  2BLS A;  1ZG6 A;  1OTD A;  3FYZ A;  1FR1 A;  4UA9 A;  4I5S A;  1NZO A;  5F6A A;  4OKP A;  3V5M A;  2PHY A;  4QHC A;  4RX2 A;  5HPF A;  1NRF A;  3RFB A;  3CMZ A;  3C7V A;  4B4X A;  5EVI A;  3NC8 A;  3JVU A;  1IYQ A;  2XEP A;  2M7U A;  2WK0 A;  1MKI A;  3CLO A;  4MBK A;  1TF1 A;  3S7P A;  2A2L A;  1LI0 A;  2L0W A;  2VX8 A;  4JF6 A;  4CLC B;  4ZJ3 A;  1BUL A;  3E2L A;  3ZG7 B;  3SW1 A;  1I2W A;  2HDR A;  4PKY G;  3T4K A;  3K2N A;  4LCM A;  4BBV A;  1MWS A;  4FSF A;  2QJ7 A;  3ZVW A;  1IYS A;  5L10 A;  1IYO A;  2ZMV A;  4KG2 A;  4MN7 A;  1MKM A;  2ZBB A;  4KZ5 A;  2K2N A;  1AWI A;  2NUT C;  2XD5 A;  2VLG A;  2HZ5 A;  3VV4 A;  4DKI A;  3HLF A;  4E3K A;  3Q7V B;  4G3W A;  2VEA A;  3L7H A;  1FSY A;  2V9A A;  4M3K A;  3KSH A;  5TBM B;  4ZTK A;  1ODV A;  4R4R A;  1BLH A;  3HRE A;  3C4P A;  4WEJ A;  4OLG A;  1D1J A;  3IX3 A;  1IKI A;  1FR6 A;  2ZQD A;  1F98 A;  4P6Z S;  5EM1 A;  1KDW A;  5I5L A;  1SKO A;  2Y2G A;  5DTT A;  3N4I A;  5CER A;  1TS8 A;  3T12 B;  5E2E A;  3Q7Z A;  1FIL A;  5L8M A;  1TEM A;  4DJ3 A;  3PR6 A;  1K4E A;  3VP3 A;  3VOY A;  2Y2K A;  3FKW A;  3UDF A;  4P0M A;  4G3K A;  3TW8 A;  1PI5 A;  2YKF A;  4E3M A;  1G5U A;  1XJ4 A;  5FDS A;  5J4E A;  5KSC A;  2OAP 1;  1MC0 A;  4FCF A;  3PTE A;  1D7E A;  2XSS A;  4Z9Q A;  3NY4 A;  1CEF A;  5F69 A;  4WF0 A;  4KQD A;  2QJ5 A;  3SS3 A;  4I3A A;  4E6X A;  4X56 A;  2Q9N A;  4IHQ A;  3LR0 A;  1XFN A;  4Z1W A;  2ZM2 A;  2XH9 A;  5CRF A;  4PM9 A;  4E3I A;  1YLW A;  1BLS A;  4D60 A;  2WAE A;  3BFE A;  2WKI A;  4Q0I A;  4P87 A;  3TRC A;  2XRO A;  4KZ3 A;  2XRN A;  3IBR A;  3GVB A;  1PI4 A;  3JVV A;  2ZLY A;  1G28 A;  4Y0T A;  4OQG A;  5E2H A;  2HDQ A;  1BYW A;  3UE6 A;  3HLD A;  3W8K A;  1VEU B;  3ZDJ A;  3T1S A;  3MJQ A;  3LCE A;  1N9B A;  3M6B A;  3NUL A;  2J3T D;  1H8Y A;  2VV7 A;  5L07 A;  5BOH A;  3WRT A;  3CHW P;  4F3L A;  1CQA A;  3WWX A;  1PW8 A;  3SH8 A;  3HLW A;  5A8B A;  3S7N A;  2VGK A;  4JLF A;  5IU1 A;  4WYY A;  3HJK A;  2IWC A;  3IQA A;  3EEH A;  1JWP A;  4WBG A;  3G34 A;  5FQJ A;  3T1R A;  4L9F A;  5HWT A;  1BLC A;  5DTK A;  3IXG A;  4Y15 A;  5CTN A;  4LFU A;  5J7E A;  4WZ5 A;  2X01 A;  2HV1 A;  4NK3 A;  1K56 D;  1P9W A;  4MEZ A;  4OQI A;  3BW6 A;  4M4X A;  2ZC7 A;  1MPL A;  3BY9 A;  1MXO A;  5TR7 A;  2H28 A;  2JKG A;  5FQK A;  3K3D A;  1HD8 A;  1YMX A;  4EUZ A;  3BYD A;  4QD4 A;  1KVM A;  4WZ4 A;  2G2W A;  4R38 A;  2H0Y A;  4Y17 A;  5HAI A;  4L0L A;  5DKK A;  2HJ9 C;  4EUV A;  1STZ A;  1BLP A;  1KE0 A;  3BM6 A;  3G2Z A;  1FSW A;  1OTB A;  4LRZ E;  4Q0H A;  5JYO A;  3VFF A;  3E0Y A;  2KX6 A;  2OWH A;  4KZA A;  4BL2 A;  3LIA A;  5CED A;  1YLT A;  3ITA A;  4X68 A;  4DXC A;  4KUK A;  1FQG A;  3VFH A;  1Z6F A;  3PHY A;  3VP2 A;  5KMW A;  4FOF A;  1LSV A;  3JPU A;  2J80 A;  3UB7 A;  2INW A;  1YT4 A;  3C7U A;  5A92 A;  2YKH A;  5G18 A;  4IVK A;  4OQH A;  3O88 A;  1PWC A;  3RXW A;  2M1C A;  1RGZ A;  3AGF A;  4WN5 A;  5HAQ A;  4Q0J A;  1E3U A;  1LSW A;  2W27 A;  3C30 A;  1VET B;  2HP9 A;  4EBN A;  2PYR A;  4MBF A;  4K91 A;  1IYP A;  3CWF A;  2ZOI A;  3F1O B;  4B93 A;  4CLC D;  2DCF A;  5HW3 A;  3ULF A;  3ICY A;  3UY6 A;  3IBJ A;  3HLC A;  4KZ6 A;  4UQI S; 
#chains in the Genus database with same CATH homology
 3EWK A;  1OTI A;  2VV8 A;  1UWP X;  4LRY C;  1NRJ A;  2W3E A;  2V0W A;  2HF6 A;  4CLC C;  1XJ6 A;  1T18 A;  1WA9 A;  4MCW A;  1TD5 A;  4H6J A;  2EWV A;  4MDZ A;  1H8M A;  5HSQ A;  1YAX A;  4E04 A;  3GEC A;  4L9G A;  4P6Z M;  4KUO A;  2CMN A;  3UMD A;  4PKY A;  3S7Q A;  2IA2 A;  2J3W A;  5AVF A;  3TJZ C;  3E98 A;  3PXP A;  3LIC A;  1NLY A;  4WLA A;  2W3G A;  3H82 B;  5F5Y A;  4BMW A;  1LL8 A;  2WKR A;  3MMH A;  2OOL A;  3B42 A;  1T19 A;  3CAX A;  2LB9 A;  2P7J A;  4JGQ A;  1OTD A;  1TS6 A;  1G6O A;  3VE4 A;  4UQI S;  3ZQ5 A;  1S4S A;  4I5S A;  4EU0 A;  5F6A A;  4HQA A;  4HI4 A;  3MF0 A;  3S7O A;  2PHY A;  4LPZ A;  1TS0 A;  1P97 A;  4XT2 B;  1IFQ A;  3E4O A;  5HPF A;  2JN7 A;  4JGO A;  3RFB A;  3R7W A;  4DN0 A;  3PBO A;  3A0S A;  2Y8H A;  4F3L B;  3TE8 A;  3UB9 A;  3JVU A;  1V9Y A;  3IS2 A;  2VGL M;  2M7U A;  1F5M A;  3OC2 A;  4UEY A;  1XJ2 A;  2O9C A;  1UGU A;  3MQQ A;  4HOI A;  4IUK A;  4NKP A;  3CLO A;  2W3D A;  5F68 A;  1TF1 A;  1V9Z A;  5HL6 A;  2DMW A;  4GW9 A;  3S7P A;  2O9A A;  1KOU A;  2A2L A;  2W3F A;  2L0W A;  2VX8 A;  2FZ0 A;  4CLC B;  1NLZ A;  1ZHH B;  1W63 Q;  3SW1 A;  2HJE A;  4GCZ A;  5HPI A;  5LBR A;  3F1N A;  3T4K A;  4PKY G;  2PD7 A;  3K2N A;  3G6O A;  1OPX A;  4GS9 A;  1LT0 A;  3FC7 A;  1VHM A;  2JKR I;  4NXG A;  4BBV A;  2L1M A;  2Z6D A;  1OT9 A;  4RQ9 A;  3T4L A;  4FSF A;  2QJ7 A;  2D02 A;  5DFY A;  3FPV A;  3LI8 A;  3LR5 A;  4HJ3 A;  3C8C A;  3MR0 A;  4I3J A;  4WEK A;  4WL9 A;  1UWN X;  2V1A A;  2ZMV A;  3PBS A;  4MN7 A;  1MKM A;  3KSF A;  4R70 A;  2ZBB A;  4B9O A;  3VOL A;  1Y28 A;  2K2N A;  2O9B A;  1OTE A;  1XFQ A;  2NUT C;  2VLG A;  3KYQ A;  4R6L A;  2B18 A;  3EEA A;  5DKL A;  3VV4 A;  5CX7 A;  4ZRR A;  2K31 A;  5HDS A;  2P04 A;  2W3H A;  4ARZ A;  4JGP A;  3D3O A;  4ME4 A;  2J3T C;  5KSH A;  4G3W A;  2VEA A;  5IS1 A;  5DF9 A;  2PR5 A;  2V9A A;  3CUE C;  4NXE A;  3KSH A;  5KIZ A;  5TBM B;  4GHI B;  4HJ4 A;  1ODV A;  3EGD C;  4WUJ A;  4IJG A;  4AFI A;  2VV6 A;  4BJP A;  2EWW A;  3KSI A;  4WEJ A;  4NXB A;  2W1T A;  5G4Z A;  4MMN A;  5J3W A;  1N9O A;  5HWW A;  3NHQ A;  3T4J A;  1F98 A;  4P6Z S;  4OOM A;  3FG8 A;  3A0V A;  5I5L A;  3CI6 A;  1DP8 A;  2VJW A;  4EXO A;  1TS8 A;  3PBT A;  5L8M A;  1H3Q A;  3F1O A;  3VE3 A;  4DJ3 A;  3PR6 A;  2A24 A;  3HCY A;  1X0O A;  3D72 A;  3PBR A;  3OBF A;  1OTA A;  4G3K A;  3TW8 A;  2VKS A;  2YKF A;  2I9V A;  2NUP C;  3MFX A;  1XJ4 A;  3H7W A;  5J4E A;  2OAP 1;  2HGV A;  1IOU A;  1MC0 A;  1MZU A;  4Y3I A;  1NWZ A;  4EEU A;  1ZTU A;  1D7E A;  4EEP A;  2XSS A;  4JGR A;  5F69 A;  3DBA A;  3T4S A;  3T4O A;  3B47 A;  2JKT I;  3P01 A;  4WF0 A;  4ETZ A;  5K5B A;  4KQD A;  2QJ5 A;  3OLO A;  1S1Z A;  4GJ4 A;  2O99 A;  1DRM A;  1F9I A;  2B02 A;  4I3A A;  4PHT A;  4BBU A;  3EGX C;  1XJ3 A;  1T1C A;  3KX0 X;  1DP6 A;  4IHQ A;  3T50 A;  2W1R A;  1XFN A;  3LR0 A;  3O5Y A;  4Z1W A;  4I39 A;  1GSW A;  3C2W A;  2VGL S;  2VA0 A;  3GDI A;  5AVE A;  5TJJ A;  3H82 A;  2ZOH A;  5DFX A;  4Q0I A;  3F1P B;  3TRC A;  3LFV A;  2XRO A;  2GX5 A;  1GSX A;  2G7U A;  2XRN A;  3IBR A;  3LIE A;  1N9N A;  3JVV A;  5DJU A;  2QYB A;  3C38 A;  3UB8 A;  2PYP A;  2PD8 A;  1G28 A;  1T1A A;  2KLI A;  1BYW A;  3UE6 A;  3NOU C;  4H6J B;  3LYX A;  3MJQ A;  5EFW A;  2GNX A;  3BQA A;  1YKD A;  3P7N A;  3HJI A;  4OOL A;  4XT2 A;  1OT6 A;  2JHE A;  1N9L A;  1S66 L;  4CQH A;  4ETX A;  2J3T D;  2Z6C A;  3NOP C;  1YSQ A;  3W2Z A;  2VV7 A;  4F3L A;  1OJG A;  3H9W A;  3EOI A;  5DJT A;  2XA7 M;  3KYZ A;  2EA9 A;  2R78 A;  5A8B A;  3NJA A;  3T4Q A;  3S7N A;  4DJ2 A;  5HZH A;  3RTY A;  2D01 A;  5IU1 A;  5HD3 A;  4BBT A;  3LID A;  4EQ1 A;  3HJK A;  2XA7 S;  3EEH A;  3NOT C;  2W0N A;  4CLC A;  3MXQ A;  2GZA A;  5G4Y A;  1D06 A;  2JKR M;  1P0Z A;  3MQ0 A;  4L9F A;  5HWT A;  2O0Y A;  5J7E A;  3R7W B;  1YSP A;  4R3A A;  5AJG A;  2HV1 A;  1P9W A;  2OAQ 1;  3BW6 A;  2PR6 A;  4M4X A;  3FPW A;  3IS2 B;  1P9R A;  3PBQ A;  3BY8 A;  3BY9 A;  2QKP A;  3MQO A;  4YNR A;  2FH5 A;  2ZMF A;  4HH2 A;  2H28 A;  4L9E A;  3K3D A;  4EES A;  5MC7 A;  3A0R A;  4EW7 A;  1OJ5 A;  3OCN A;  4O0P A;  4R38 A;  4HJ6 A;  4DMZ A;  3BWL A;  4HH3 A;  1GSV A;  4K08 A;  1JNU A;  3E4P A;  3OCL A;  3KSG A;  4L0L A;  4HNB A;  4QPR A;  2HJ9 C;  5DKK A;  4O01 A;  4YOF A;  4EUV A;  1STZ A;  3F1N B;  4I38 A;  4G3V A;  4O8G A;  4GS9 B;  3K3C A;  2VZW A;  4EET B;  4HY8 A;  2V0U A;  2BAS A;  2P08 A;  5TBM A;  2K7S A;  1OTB A;  4GHI A;  4LRZ E;  4Q0H A;  3ZYT A;  3T4T A;  3E0Y A;  3CIT A;  4LLO B;  2KX6 A;  3KO6 A;  2OWH A;  4HP9 A;  3LIA A;  4HIA A;  4I3I A;  4EER A;  5IT5 A;  5HWV A;  2MJ6 A;  1VB6 A;  2WKQ A;  5HD5 A;  2OWJ A;  5HDD A;  4KUK A;  3PHY A;  3UB6 A;  2M7V A;  3LUQ A;  2Y79 A;  4FOF A;  4LRX C;  1LSV A;  4MN5 A;  2GJ3 A;  2V1B A;  5C5K A;  2PT7 A;  2J80 A;  4ARZ B;  5FL3 A;  2KDK A;  3PBN A;  2INW A;  3U2A A;  3UB7 A;  4YWZ A;  2YKH A;  4Y5F A;  1W63 M;  2LB5 A;  2JKT M;  3LIB A;  4MN6 A;  3BJN A;  1S67 L;  3PYP A;  4HHD A;  1S4R A;  1LSX A;  3LR4 A;  2M1C A;  3LIF A;  3OOV A;  4WN5 A;  5HDC A;  4Q0J A;  1LSW A;  2W27 A;  3C30 A;  2KOI A;  2W1T B;  2QWS A;  3UE3 A;  4IUH A;  2PYR A;  1EW0 A;  4BWI A;  3LR3 A;  4NXF A;  3LI9 A;  3R4K A;  3CWF A;  4CLC E;  2ZOI A;  3F1O B;  3V67 A;  2A24 B;  3BQ8 A;  3E4Q A;  4UQI M;  4B93 A;  4CLC D;  4KQO A;  3RH8 B;  1TS7 A;  4WEL A;  4Y2F A;  3B33 A;  3EQV A;  1DP9 A;  3ULF A;  2PDR A;  3ICY A;  3F1P A;  3IBJ A;  4GLQ A;  3UME A;  2QHK A;  2WKP A;  4II7 A;  3H7W B;  3EQU A;  2L4R A;  3CUE A;  4HP4 A;  4NEE D;  4PAU A;  1T1B A;  1S1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...