2Y8HA

Structure of the first gaf domain e87g mutant of mycobacterium tuberculosis doss
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMGVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS
publication title Blockage of the Channel to Heme by the E87 Side Chain in the Gaf Domain of Mycobacterium Tuberculosis Doss Confers the Unique Sensitivity of Doss to Oxygen.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 35
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2y8hA00
2W1RA 3OBFA 2O0YA 4YOFA 2M7VA 2KOIA 2O9AA 3K2NA 3ZQ5A 3R4KA 1YSQA 3W2ZA 5LBRA 3D3OA 3IBRA 2ZMFA 2KLIA 4E04A 2W3HA 2VJWA 2GX5A 4RQ9A 4Q0IA 3VV4A 2O99A 4BWIA 4CQHA 4DN0A 3S7PA 2G7UA 2LB5A 3S7QA 2W3DA 5HPIA 2XSSA 3O5YA 4PAUA 4MN7A 4ETZA 4EUVA 2W1TA 1F5MA 2VEAA 3HCYA 3CITA 3NOTC 3MQ0A 3BJNA 3KSHA 3S7OA 2O9CA 1ZTUA 2LB9A 3IBJA 3OOVA 4FOFA 2VZWA 4O01A 1MC0A 2Y79A 3DBAA 3MMHA 3MF0A 3EEAA 2K2NA 3RFBA 2QYBA 3G6OA 3KSFA 2W3EA 5L8MA 4MMNA 1TF1A 5DFXA 4Z1WA 3TRCA 5HSQA 3E0YA 4O8GA 4IUHA 1VHMA 4Q0JA 4GW9A 2IA2A 4ME4A 2HGVA 4IJGA 4R70A 3LFVA 4QPRA 2B18A 4GLQA 3S7NA 3E98A 3NHQA 4G3KA 4LRXC 2XRNA 1YSPA 2K31A 5TJJA 2O9BA 5HL6A 3KSIA 4G3VA 4IUKA 3NOUC 1STZA 1YKDA 3CI6A 4Q0HA 3KO6A 4LRYC 3NOPC 4Y5FA 5HPFA 2W3GA 2M7UA 4ZRRA 5DFYA 5AJGA 3C2WA 4Y2FA 4ETXA 1MKMA 4DMZA 5C5KA 4R6LA 5I5LA 3KSGA 2XROA 2VKSA 4G3WA 2Y8HA 1TD5A 2W3FA 4MDZA 4Y3IA 4EU0A 2W1TB 4YNRA 5K5BA 2OOLA 4MCWA 4LRZE 4O0PA
chains in the Genus database with same CATH superfamily
4BL3A 5F68A 3BM6A 1D7EA 5CHUA 3ZQ5A 4JGOA 1L0DA 4ID4A 2Y2IA 3FKVA 4NK3A 4WN5A 1N9OA 2O99A 3S7PA 3CG5A 4PHTA 1SHVA 2Y2OA 4OQ0A 2OWHA 2QWSA 2PU4A 1Y28A 2DRWA 3BECA 3BJNA 2R9WA 3KSHA 3RXWA 4F94A 4OPZA 3A3FA 3O87A 5KSCA 2ZBBA 3UDIA 2FH5A 1SKFA 1NYYA 3VSLA 3IXHA 4ZJ2A 1ES2A 4HH3A 3JPUA 3ITAA 3VOYA 5TFQA 3FV7A 4U3TA 1IYQA 4DE2A 5HD5A 2EFUA 3G2ZA 4Q0JA 1EWZA 4GW9A 3K3DA 5HARA 5KMWA 2HV1A 3KYEA 5FSRA 4OPYA 4WBGA 3F1OB 2QHKA 2L4RA 1K6RA 4WMCD 4IUKA 4FH2A 1DP8A 1OTBA 4QY5A 1Z6FA 3MKEA 4HJ6A 3O3VA 3ZG9B 5A90A 2Y59A 2HP6A 2J3TC 5CEBA 1ODVA 4KZ4A 4NG2A 3QP2A 4WZ5C 1ZHHB 2Z6CA 5GLAA 3FPWA 4LLOB 1JWZA 1K4FA 3F1NB 3T4LA 2B5RA 2PT7A 2W1RA 3F1OA 4HBTA 3UB9A 2EA9A 3IBRA 4P87A 1HD8A 1J9MA 1PNEA 4KZ5A 2BTFP 4DXBA 3EOIA 2B02A 1P0ZA 3WWXA 2ZQ7A 2ZOIA 2PDRA 1XJ4A 3W4PA 4PAUA 2E8JA 4MN7A 3UB6A 5E2FA 3F1NA 4OPQA 3C4OA 4A5RA 3NOTC 3BFCA 3ZG5A 5HWVA 2ZM2A 1C3BA 1SDNA 2R9XA 4BQMA 2XR0A 4MMNA 1NYMA 3HLFA 5A91A 4XXRA 4BBUA 2P08A 3N8LA 2EX6A 2XRNA 3DAVA 4RX2A 2J9OA 2P7JA 3PBRA 4S2MA 3KSIA 4E3IA 1OTIA 2NUTC 1ES5A 3T12B 3HUOA 4ARZB 1ZC2A 1U60A 2EX2A 4QD4A 1DJBA 2UV0E 4Y2FA 3GVBA 3A3EA 4CLCD 2V9AA 2OWJA 4Y0UA 1J3WA 3UNWA 1DP6A 4O0PA 1TVFA 3NY4A 3QP5A 1JVJA 4C75A 4EV4A 2NUPC 4ARZA 2L0WA 2JKGA 3Q07A 1BLCA 4WLAA 2E8IA 4RQ9A 4QY6A 3BFEA 1BTLA 1XJ3A 2J8YA 3G34A 4NKPA 1I2SA 3BLSA 3S7QA 3Q81A 3RXXA 2JKRM 1VB6A 2HP5A 4M3KA 4RYEA 3T1SA 3EQVA 2R78A 3WRTA 5TBMB 1F9IA 4IVKA 4FOFA 3AGEA 4DRTA 4JKTA 1S0WA 3MF0A 3MS6A 3A3IA 3G6OA 2D02A 5HAIA 1VM1A 4BLMA 2WK0A 1LSVA 5GLDA 4GD6A 5FDSA 3T4SA 5CERA 3V67A 3NCKA 4MNRA 1QMEA 4EW7A 3VP4A 5DF7A 1T1BA 2VGLM 2ZQDA 4WMCA 5TBMA 4Y0OA 1FOFA 4FUWA 4F3LB 1L0EA 1MKIA 4DF6A 3MR0A 2ZMVA 1BLHA 5HPFA 4ZTKA 2OLVA 4Y17A 5EOOA 3JVUA 3MXQA 4EBPA 5K5BA 2OSUA 3SS5A 3BY8A 3SW1A 4HY8A 4YOFA 5KZHA 1PWGA 1XGIA 4MN6A 3W4OA 4I38A 4F3LA 3D3OA 2W3HA 3N4IA 3BYDA 1ES3A 4UA7A 4DN0A 1YT4A 3T4KA 3C5AA 2WADA 4IVIA 3U4LP 1Z09A 3LI9A 3S22A 1YM1A 1S4SA 4WUJA 1ES4A 3BFGA 3AGDA 3NULA 4E3MA 1FR1A 3DWZA 2VZWA 3LUQA 1OTAA 1T18A 2RL3A 3C30A 4JF5A 4RA7A 1K55C 2PRFA 4JGRA 1GHMA 3PBSA 5CTNA 1ZKJA 1ACFA 4CLCB 1W5DA 1KE4A 3T1XA 4O7DA 4R70A 4OLGA 4GJ4A 2G2UA 3D72A 2QZ6A 4JXWA 2RCXA 2K31A 1K57A 5E2EA 4RVAA 1P9RA 5DTSA 4WZ4A 1EROA 4LV3A 4I3JA 1YLPA 1DY6A 2VA0A 5EM0A 4B4XA 4YINA 1SCWA 5AQBA 2WKPA 4U0TA 4ZJ1A 1MKMA 3BFDA 1FILA 5CTMA 1PW8A 4CLCA 2W3FA 3QP8A 3UO9A 5HDSA 3IH8A 3UDXA 3EWKA 3MSHA 1MY8A 5JYPA 3FKWA 4ZAMA 4GNUA 5L10A 3WS2A 3OPRA 4RX3A 1Y54A 1TS7A 4K0WA 3HREA 4X25A 4OP8A 2GX5A 1O7EA 3PTEA 1PW1A 3PBNA 4GCZA 3L9KA 3E2LA 1XX2A 5A8BA 2WKRA 2ZC5B 4DE1A 4CPKA 5FDHA 1PRQA 1DP9A 4ZJ3A 5U47A 4DXCA 2WAFA 4E3LA 1QMFA 3MZDA 2QKPA 3T4OA 4HI4A 4I5SA 3Q82A 3MQOA 4B4ZA 2EWVA 1DRMA 5EECA 1GHIA 3PYPA 1LLBA 2K2NA 1GCEA 4P0MA 2Y2NA 4KZ3A 1FR6A 4MLLA 4C6YA 2J3WA 3E0YA 4OPRA 3BFFA 2Z2LB 5FATA 3E98A 1XA1A 2Y2KA 4UQIM 3G35A 1IEMA 3T1RA 1YSPA 2JKTM 2XD5A 3CMZA 1DJAA 1K56D 2UWXA 3UPPA 5E2GA 2J7VA 3KO6A 2FFFB 3E2KA 4LV2A 2WZXA 1CI8A 1PWDA 3IXDA 4FSFA 4X53A 3KSGA 2GNXA 4BBTA 1N9LA 2Y2PA 4P6BA 2C6WB 2ZOHA 1PYYA 1XGJA 1IYSA 4KZ9A 1Q2QA 1MPLA 1NZOA 2HZ5A 3R4KA 1H8MA 4GKUA 3R7WB 4JGPA 2HJEA 4LGWA 1FSWA 1K57C 4HIAA 4DJ2A 4B9OA 4Y15A 1VETB 1BLPA 3DTIA 2DNSA 2XDMA 1BYWA 1KGEA 1BSGA 3MXRA 3MXSA 3A0VA 3E4QA 3H9WA 4PM6A 4L0LA 4P6ZM 3MQ0A 4CLCC 1RCJA 2H0TA 5GHXA 1BLSA 3WS5A 1CI9A 1K0KA 1XXMA 3R7WA 4PM7A 1LI0A 1NXYA 1YPRA 1XJ6A 3WS1A 4GN2A 4II7A 1F98A 1VETA 2WYXA 3S1YA 4OVDA 1NRFA 4QPRA 5FEGA 1ESUA 1VEUB 3SH8A 2ZC6B 3GQZA 5G4YA 4R1GA 4DE3A 2WGVA 4GB7A 5DF8A 3FZCA 3JVVA 3QP1A 3PAGA 3VOLA 4E3NA 4X6TA 1JWPA 3MJQA 1ERMA 3LY4A 5HD3A 2VV7A 4KUOA 2VKSA 3ULFA 5F82A 2KDKA 3FPVA 4DJ3A 5DTTA 2ZQ8A 4R23A 1VEUA 3V50A 2W1TB 1KDWA 4LRZE 1LI9A 1YLWA 5EPHA 5FL3A 3LI8A 3IHBA 5EFWA 1WYCA 2JN7A 3ZG8B 4R3JA 3N8SA 4UQIS 1OPXA 2Q0OA 2BG1A 5DF9A 5DTKA 3HLWA 3TSGA 2XH9A 2W3DA 5HPIA 1NLZA 1XJ2A 4GD8A 1S4RA 5J7EA 2W1TA 2VEAA 3WS4A 3D4FA 4OOLA 5CXWA 5CGXA 3EEHA 1S6RA 1PFLA 1JNUA 3OPLA 2BASA 3MMHA 3M2KA 4BD1A 3M6HA 4CJNA 1MWUA 1HLUP 3IQAA 4Z1WA 1YLYA 1OTEA 4UA6A 4S2LA 3LFVA 4PKYA 2GDNA 3B33A 1LL9A 4EWFA 3C38A 4IBRA 3ZYTA 5JYOA 1G6OA 3HUMA 3H82B 3QP4A 1P97A 1H8ZA 2Z6DA 1T1CA 4UEYA 4Q0HA 1K56A 2Y4AA 3NOPC 5DKKA 1WYBA 4P6ZS 1JTGA 2ZQ9A 2J9PA 5AJGA 2WKIA 4HBUA 2OAP1 3SH7A 5HDDA 4DMZA 2Y2GA 4R3BA 3LIAA 4GZBA 4KG5A 1K4EA 1G5UA 1SKOB 2G2WA 3CUEC 1IELA 1XP4A 5IU1A 3T4JA 2V0WA 2H5SA 5CHJA 4YNRA 2PBYA 4U0XA 4MCWA 1MWTA 2Y91A 4JXSA 3H82A 5I94A 5M18A 3NDEA 3G32A 1KE0A 5GLBA 1FCNA 3Q1FA 3UE0A 1ONHA 5FAQA 5LBRA 1CEFA 3FG8A 3HJIA 3C7VA 4PKYG 3A3JA 3C7UA 3H7WB 3UPNA 4L9GA 1HTZA 2V0UA 4CQHA 2A49A 1W63Q 2ZLYA 3VMAA 3O5YA 1SKOA 1H0MA 3DTMA 1K55A 2A24B 3IX8A 1IKIA 1WE4A 1VQQA 4OOMA 2V8FA 4X55A 4S2PA 3D9YA 3GR2A 3GECA 2HF6A 3H7WA 3CJMA 3G30A 2QMIA 1X0OA 1T1AA 2HGVA 2Y2HA 1K54A 4BL2A 2A24A 1GSXA 1IYPA 4QU3A 1AWIA 3UDFA 2EX9A 1H8YA 5AVEA 1E3UD 1A0KA 1PIOA 1EI5A 2VV6A 4JXGA 3LIFA 1LSWA 2EWWA 3MFDA 3NOUC 2PBDP 1STZA 5FI7A 1IYOA 4JPMA 2WAEA 1RGZA 4KG2A 5EOEA 5FQQA 3ZG7B 5FQMA 4KQQA 3DWKA 4EESA 4X69A 1TDGA 4MN5A 3W8KA 3IX3A 1UGUA 5EVLA 3LIEA 1WA9A 3P98A 4IHQA 2Y2QA 4UA9A 5HWWA 2IWDA 3NC8A 2K7SA 4DE0A 1JWVA 4QB8A 2KLIA 1TS8A 3V3RA 4B93A 1PZOA 3VV4A 5GLCA 3LEQA 1MBLA 5HAPA 4R4RA 4D60A 1FCOA 1OJGA 2XSSA 4Z9QA 3S4XA 5CGSA 4ETZA 3I7JA 4X68A 4OQHA 5KIZA 3U2AA 3BEBA 4S2JA 2XQZA 4QHCA 3C8CA 3EGXC 1ZG4A 3OOVA 3WRZA 2IWCA 4R0QA 4BENA 5M19A 5FQJA 4D2OA 2Y79A 3DBAA 5FAPA 1W8QA 4AFIA 4K08A 3ZDJA 3PHYA 2AVXA 1VHMA 1NY0A 2EFXA 4FH4A 3GTCA 1YAXA 4GLQA 4KQOA 1P9WA 1KE3A 4Y0TA 3IWQA 2HDSA 3CLOA 4GOGA 4GDNA 4LRYC 2PYRA 1OTDA 4EXOA 3ICYA 2HDUA 1S67L 5C5KA 4L9EA 3Q7VB 3NIAA 4WYYA 4N9LA 4Y3IA 4C3QA 3PBTA 2OOLA 5L07A 2W0NA 4KQDA 1NJ4A 3QNCA 5CEDA 5FI2A 1K54C 3CHWP 3LR3A 3O88A 2A3UA 3BRMA 5GHZA 4X1MA 3N8RA 3TJZC 5FQ9A 2V8CA 1UWNX 1H5XA 4NXGA 2Q9NA 4JXVA 1K25A 2M1CA 2VLGA 3IF5A 3Q7VA 3TW8A 3UMDA 3C4PA 4IEDA 4EUVA 1GA0A 3SOIA 4ZDXA 3M6BA 3IBJA 3IS2B 5IT5A 1TS6A 2Z2MB 1K38A 2MJ6A 5CHMA 2EXAA 2VGLS 4LPZA 3VP2A 2P04A 1O07A 3G4PA 3GMWA 3CZDA 1KVLA 4HNBA 5L8MA 2DCFA 3VP1A 4O8GA 1BZAA 4IJGA 5FQKA 2B18A 3L7HA 3EQUA 4EUZA 3KX0X 1G6AA 2CC1A 1ONGA 2IWBA 5HL6A 1E3UA 3VP0A 2XA7M 3GV9A 3IS2A 3ZGAB 4NXBA 3ZNTA 1MWSA 1GSVA 3A3DA 5TGFA 4XUXA 1L3LA 5J8XA 3W4QA 4GHIB 4S2NA 1OMEA 3C2WA 3UMEA 5E2HA 3DTEA 3VE3A 5I5LA 3UE6A 1H3QA 3VP3A 1F2KA 3LY3A 3WS0A 1CK3A 4OOYA 2YKFA 4NETA 1KGFA 3PXPA 3P01A 4MBHA 2PAVP 1TS0A 1YSQA 4ESPA 3W2ZA 3IF6B 2ZMFA 2EX8A 4HP4A 5CRFA 4E04A 4GHIA 3MQQA 4LCLA 4BWIA 3ZCZA 2OV5A 2VV8A 2QJ7A 2LB5A 1W7FA 4I39A 5HZHA 2A2LA 3E4OA 1M40A 4E3OA 3CAXA 4IBXA 4EEUA 3IF6A 2YKHA 1CQAA 1NZUA 5CGWA 3EEAA 1FQGA 5CECA 4Y13A 3HJKA 3UPOA 1SZVA 1FIKA 1CEGA 1CF0A 4R4SA 4XUZA 2V2FF 3NHQA 3N7WA 3M2JA 4P85A 4L9FA 2ZJ9A 1IKGA 1LSXA 3QHYA 3CUEA 2WGWB 3O86A 3UY6A 4BBVA 1ERQA 1XKZA 1OJ5A 2JE5A 5DFYA 4WELA 2XD1A 1LL5A 3MZEA 2WKEA 3NDGA 4G3WA 5GHYA 1XFQA 4OQGA 1L0GA 4OKPA 5GL9A 2JCHA 2Q9MA 1LHYA 1MZUA 3ZG0A 5AVFA 1S66L 1D1JA 2KOIA 1IFQA 2ZC3B 4OQIA 3OZHA 2PYPA 2WGWA 2QJ5A 3DW0A 5DJUA 5F5YA 2XFTA 3UE3A 3LIDA 4EERA 3B42A 2XA7S 1UWPX 4E3JA 2I9VA 2HDQA 4S2NC 4MBKA 2XLNA 2P9VB 1GSWA 4HHDA 3ZVWA 3IX4A 5D3OA 2O9CA 2H10A 3V3SA 2BLSA 1BT5A 5IS1A 3P7NA 3HLGA 1MC0A 3HUNA 4LCMA 1BULA 1YMXA 4OLDA 2ZMAA 3OC2A 4WL9A 2QYBA 2L1MA 2W3EA 4FD8A 3LO7A 5DFXA 3UB8A 4KUKA 3SZTA 1FSYA 2P9VA 5FEFA 4CLCE 1SDEA 2PR6A 4G3KA 3N6IA 2V1ZA 2VGJA 3UB7A 2O9BA 4WEJA 2HJ9C 1YKDA 5FQIA 4N9KA 2ZC4B 4PMAA 4EBLA 1PI4A 2B95A 4EETB 3T4TA 1N9BA 3TOIA 4HH2A 3IF6C 3PAEA 1K6SA 2Y8HA 4UAAA 1RP5A 1YQSA 3T4QA 2Y55A 4XT2B 1I5QA 4LENA 2O0YA 1NRJA 1GHPA 1W79A 2ZQAA 1NLYA 2ACGA 4S2OA 3UB5P 4NXFA 1XPBA 2PD8A 4Q0IA 5EVID 4KZ7A 1E4DA 4HESA 4LV0A 5DVAA 2VX8A 2WKQA 2JKFA 4K0XA 3VFFA 4XT2A 3HLBA 1F5MA 3A0RA 2JKRI 3HCYA 3CITA 3CWFA 1S1YA 4R38A 4KZAA 3VFHA 2LB9A 4HEFA 2I72A 3HLEA 1M6KA 2H0YA 4JF6A 4WF0A 5EV0A 3ITBA 3IH9A 1KDSA 2DMWA 2INWA 1HVBA 2XFSA 5FI6A 3IWOA 1CJFA 5HSQA 1LL8A 3OCLA 2XGNA 3EGDC 4I3AA 1ZG6A 2FZ0A 1L2SA 3LR0A 3FWLA 4Q8IA 3TG9A 4PM5A 5HX9A 4QJGA 1V9YA 2WZZA 5EVEA 1I2WA 1S1ZA 2X71A 2M7UA 3IHAA 4GS9B 2PD7A 4R6LA 5AQ9A 5F1GA 3NJAA 5M1AA 1OT6A 4BJPA 2XROA 3HL9A 1RGYA 2PHYA 3DTKA 3IWIA 4LV1A 1L0FA 1YLJA 2FFYA 1LT0A 3QP6A 5G18A 3E4PA 2C5WB 3HBRA 4JLFA 3MKFA 4EQIA 1MXOA 2VJWA 3BQAA 4GS9A 4K91A 3LEZA 3BWLA 4NXEA 5F6AA 4I3IA 4NEED 5HW3A 3PR6A 2GZAA 4OONA 1PI5A 3QNBA 2EXBA 1KVMA 1ZTUA 2J3TD 5TR7A 3FC7A 5CX7A 3GRJA 4O01A 2WUQA 1N9NA 3LIBA 1BUEA 2X02A 3CPTB 3ZFZA 3G31A 4LFUA 2XF3A 3LR4A 4ZBEA 1JTDA 3KSFA 3LICA 1YLTA 4OP5A 1N4OA 3V39A 2OAQ1 4E3KA 2GJ3A 3BLMA 2IA2A 4HP9A 5J4EA 3KYQA 1V9ZA 4LRXC 2J80A 5TJJA 4HQAA 3IT9A 4E6XA 4HOIA 2XK1A 3HVFA 3T1QB 4R3AA 2WKHA 3V5MA 3VOZA 3VE4A 5IHVA 4Y5FA 2W3GA 3CPTA 2P74A 4H6JB 1W8YA 4ETXA 4WM9A 2Y2JA 4JBFA 1PWCA 5EVIB 3Q7ZA 3OPHA 2HDRA 3IXBA 4KG6A 2WGIA 3LYXA 5KSHA 2HP9A 2OLUA 2JBFA 2M7VA 2O9AA 4EBNA 1Q2PA 4HJ3A 1G28A 2V20A 2HPBA 5HWTA 2PU2A 3SS3A 2ZC7A 4BD0A 1KOUA 1IOUA 4H6JA 4S2IA 3BY9A 5EVIA 3T50A 2ZD8A 3OCNA 4MBFA 5DJTA 1XA7A 5EUAA 4E6WA 4GDBA 2XEPA 1Y4OA 1XFNA 3MZFA 3MBZA 5F1FA 2ZL1B 2D01A 1T19A 2JC7A 4WEKA 4S2KA 2ZQCA 4EQ1A 4PM8A 3IXGA 3RH8B 3UE1A 5L09A 2ZM8A 4N1XA 3RJUA 3MFXA 4JGQA 4FTXA 5FASA 3BW6A 2Y2LA 5FA7A 1DJCA 5MC7A 3OLOA 5BOHA 3PBOA 3VSKA 4G3VA 4MEZA 2ZM0A 2JKTI 3CI6A 5HDCA 5HFOA 4JF4A 2ZL1A 5HAQA 2VK3A 3G2YA 2PR5A 1ESIA 1G68A 5A92A 1YMSA 2JHEA 3A0SA 4Y7PA 4M4XA 1TD5A 4OH0A 3BQ8A 2Y2MA 4FCFA 1E25A 4BMWA 3P09A 2V1BA 4HJ4A 3GDIA 3OPPA 3OBFA 5J3WA 1KGGA 3K2NA 3ZNYA 1OT9A 4PPRA 1TEMA 3NBLA 1MWRA 5E43A 5EM1A 4YWZA 4X1LA 4QWOA 3LCEA 3B47A 2G7UA 4DDSA 1PZPA 1W63M 4KZ6A 5G4ZA 1FCMA 3HLDA 1EW0A 5F83A 3S7OA 3AGFA 5F69A 5FAOA 5AQ7A 2CMNA 4KZ8A 4X56A 2X01A 5L2FA 3SH9A 3HLCA 1ALQA 3FYZA 4EEPA 3KYZA 4WZ5A 3LR5A 4KENB 5A93A 3RFBA 3K3CA 4PM9A 1TF1A 3TRCA 1NWZA 3PBQA 3ZHHA 4IUHA 4DDYA 4B88A 4ME4A 3NI9A 3UN7A 2V1AA 3S7NA 3ISGA 5HL1A 3F1PB 4KQRA 3RTYA 2VGKA 5EVIC 1YLZA 4YFMA 1AXBA 3SS4A 4KZBA 1GA9A 3ZVTA 2KX6A 3LGOA 4ZRRA 1HZOA 1TDLA 1D06A 2W27A 4DKIA 5EE8A 4N92A 5DKLA 2QPNA 4UHUA 3TE8A 3NECA 4MDZA 4N1HA 5AQAA 4EU0A 3F1PA 3GSGA 3B3XA 3JYIA 2H28A 4H8RA
chains in the Genus database with same CATH topology
1WA9A 2O0YA 1NRJA 5F68A 1D7EA 4IHQA 3ZQ5A 5HWWA 4JGOA 2K7SA 1TS7A 1NLYA 2KLIA 1TS8A 4B93A 2GX5A 4NXFA 2PD8A 4Q0IA 4WN5A 1N9OA 3PBNA 2O99A 4GCZA 3VV4A 3S7PA 5A8BA 1OJGA 2XSSA 2WKRA 2VX8A 2WKQA 4PHTA 4XT2A 2OWHA 4ETZA 1F5MA 3A0RA 2JKRI 2QWSA 1DP9A 5KIZA 3U2AA 3HCYA 3CITA 3CWFA 1Y28A 3BJNA 3KSHA 1S1YA 4R38A 3C8CA 2LB9A 3EGXC 2ZBBA 2QKPA 3OOVA 3T4OA 4HI4A 2FH5A 4I5SA 3MQOA 2Y79A 3DBAA 2EWVA 1DRMA 4HH3A 4WF0A 3PYPA 2K2NA 2DMWA 2INWA 4AFIA 4K08A 5HD5A 3PHYA 2J3WA 5HSQA 1LL8A 3E0YA 1VHMA 4Q0JA 4GW9A 3K3DA 3OCLA 4I3AA 3EGDC 1YAXA 4GLQA 4KQOA 2FZ0A 3E98A 4UQIM 1P9WA 2HV1A 3LR0A 1YSPA 3F1OB 2QHKA 2JKTM 2L4RA 3CLOA 4IUKA 1DP8A 1OTBA 3KO6A 4LRYC 1V9YA 4HJ6A 2PYRA 1OTDA 1S1ZA 4EXOA 2M7UA 3ICYA 4FSFA 2J3TC 1ODVA 4GS9B 2PD7A 1S67L 5C5KA 4R6LA 4L9EA 3NJAA 1OT6A 3KSGA 2GNXA 4BBTA 4BJPA 2XROA 1N9LA 1ZHHB 2Z6CA 2PHYA 3FPWA 4LLOB 4Y3IA 2ZOHA 3F1NB 3PBTA 3T4LA 2OOLA 2W0NA 4KQDA 2PT7A 2W1RA 3F1OA 1LT0A 3E4PA 3R4KA 1H8MA 3R7WB 3LR3A 3UB9A 2EA9A 4JGPA 2HJEA 3IBRA 4DJ2A 4HIAA 2VJWA 3BQAA 3TJZC 4B9OA 3EOIA 2B02A 1UWNX 1P0ZA 4GS9A 2ZOIA 3BWLA 4NXGA 4NXEA 2PDRA 1XJ4A 2M1CA 5F6AA 2VLGA 4I3IA 1BYWA 4NEED 4PAUA 3PR6A 2GZAA 3A0VA 4MN7A 3TW8A 3UB6A 3F1NA 3E4QA 3UMDA 3H9WA 4EUVA 4L0LA 4P6ZM 3NOTC 3MQ0A 4CLCC 5HWVA 1ZTUA 2J3TD 3FC7A 3IBJA 3IS2B 5CX7A 5IT5A 1TS6A 4O01A 3R7WA 2MJ6A 1N9NA 3LIBA 2VGLS 1XJ6A 4LPZA 4II7A 2P04A 3LR4A 1F98A 4HNBA 3KSFA 3LICA 5L8MA 4MMNA 2OAQ1 2GJ3A 4O8GA 2IA2A 4IJGA 4QPRA 2B18A 4BBUA 4HP9A 2P08A 3EQUA 5G4YA 3KYQA 3KX0X 5J4EA 1V9ZA 4LRXC 2XRNA 2J80A 5TJJA 2P7JA 4HQAA 3PBRA 5HL6A 4HOIA 3KSIA 1OTIA 2NUTC 2XA7M 3IS2A 4NXBA 4R3AA 3JVVA 1GSVA 3VE4A 4ARZB 3VOLA 4Y5FA 4GHIB 2W3GA 3C2WA 3UMEA 4H6JB 4Y2FA 3MJQA 4ETXA 4CLCD 5HD3A 2V9AA 2VV7A 4KUOA 3VE3A 5I5LA 2VKSA 3UE6A 1H3QA 3ULFA 2OWJA 2KDKA 3FPVA 4DJ3A 2YKFA 2W1TB 3LYXA 3PXPA 1DP6A 3P01A 4LRZE 4O0PA 5KSHA 5FL3A 3LI8A 1TS0A 2M7VA 2O9AA 5EFWA 4HJ3A 2JN7A 1YSQA 1G28A 3W2ZA 5HWTA 2NUPC 4ARZA 4UQIS 2ZMFA 1KOUA 2L0WA 4HP4A 4E04A 4GHIA 3MQQA 4WLAA 4RQ9A 4H6JA 1OPXA 1IOUA 5DF9A 4BWIA 3BY9A 1XJ3A 2VV8A 2QJ7A 4NKPA 3T50A 3OCNA 2LB5A 3S7QA 2W3DA 5DJTA 1NLZA 1XJ2A 5HPIA 2JKRM 1S4RA 4I39A 1VB6A 5J7EA 5HZHA 2W1TA 2VEAA 2A2LA 3EQVA 3E4OA 4OOLA 1XFNA 2R78A 5TBMB 1F9IA 3CAXA 4EEUA 3EEHA 4FOFA 1JNUA 2D01A 2YKHA 2BASA 1T19A 3MMHA 3MF0A 4WEKA 3EEAA 3G6OA 4EQ1A 2D02A 3HJKA 4Z1WA 3RH8B 1OTEA 1LSVA 3T4SA 3LFVA 3V67A 4PKYA 3MFXA 4JGQA 3B33A 3BW6A 3NHQA 4EW7A 5MC7A 3C38A 4L9FA 3OLOA 3ZYTA 1T1BA 3PBOA 1G6OA 2VGLM 3H82B 4G3VA 5TBMA 2JKTI 1P97A 1LSXA 2Z6DA 3CUEA 1T1CA 3CI6A 4UEYA 5HDCA 4F3LB 4BBVA 4Q0HA 3MR0A 3NOPC 5DKKA 1OJ5A 2ZMVA 4P6ZS 2PR5A 5HPFA 5DFYA 4WELA 5AJGA 2JHEA 2OAP1 3A0SA 5HDDA 4DMZA 4M4XA 3LIAA 3JVUA 4G3WA 1TD5A 1XFQA 3MXQA 3CUEC 3BQ8A 5IU1A 4BMWA 3T4JA 2V0WA 5K5BA 4YNRA 1MZUA 4MCWA 5AVFA 2V1BA 4HJ4A 1S66L 3BY8A 3GDIA 3SW1A 3OBFA 5J3WA 4HY8A 4YOFA 2KOIA 1IFQA 3H82A 3K2NA 4MN6A 1OT9A 2PYPA 4I38A 4F3LA 2QJ5A 5LBRA 3D3OA 3FG8A 3HJIA 5DJUA 5F5YA 4PKYG 2W3HA 3UE3A 3LIDA 4YWZA 3H7WB 4EERA 4L9GA 2V0UA 3B42A 3B47A 4CQHA 4DN0A 2G7UA 2XA7S 1UWPX 1W63Q 3T4KA 1W63M 3O5YA 5G4ZA 2I9VA 2A24B 1GSWA 4HHDA 3LI9A 1EW0A 3S7OA 2O9CA 5F69A 4OOMA 1S4SA 4WUJA 2CMNA 2VZWA 3LUQA 5IS1A 3P7NA 4EEPA 1OTAA 3KYZA 1MC0A 1T18A 3C30A 3LR5A 3GECA 4JGRA 2HF6A 3PBSA 3OC2A 3RFBA 4WL9A 2QYBA 3K3CA 3H7WA 2L1MA 2W3EA 1TF1A 5DFXA 3UB8A 1X0OA 3TRCA 4CLCB 1NWZA 4KUKA 1T1AA 3PBQA 4IUHA 4ME4A 2HGVA 4R70A 4GJ4A 3D72A 2V1AA 3S7NA 2A24A 3F1PB 4CLCE 1GSXA 3RTYA 2PR6A 4G3KA 2K31A 5AVEA 3UB7A 2O9BA 2VV6A 1P9RA 3LIFA 4WEJA 1LSWA 2EWWA 2HJ9C 3NOUC 4I3JA 1STZA 1YKDA 2VA0A 2KX6A 4ZRRA 4EETB 2WKPA 1D06A 2W27A 1MKMA 3T4TA 4HH2A 4CLCA 5DKLA 3TE8A 2Y8HA 4EESA 2W3FA 4MDZA 3T4QA 4MN5A 4XT2B 4EU0A 5HDSA 3F1PA 2H28A 1UGUA 3EWKA 3LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1R A;  3OBF A;  2O0Y A;  4YOF A;  2M7V A;  2KOI A;  2O9A A;  3K2N A;  3ZQ5 A;  3R4K A;  1YSQ A;  3W2Z A;  5LBR A;  3D3O A;  3IBR A;  2ZMF A;  2KLI A;  4E04 A;  2W3H A;  2VJW A;  2GX5 A;  4RQ9 A;  4Q0I A;  3VV4 A;  2O99 A;  4BWI A;  4CQH A;  4DN0 A;  3S7P A;  2G7U A;  2LB5 A;  3S7Q A;  2W3D A;  5HPI A;  2XSS A;  3O5Y A;  4PAU A;  4MN7 A;  4ETZ A;  4EUV A;  2W1T A;  1F5M A;  2VEA A;  3HCY A;  3CIT A;  3NOT C;  3MQ0 A;  3BJN A;  3KSH A;  3S7O A;  2O9C A;  1ZTU A;  2LB9 A;  3IBJ A;  3OOV A;  4FOF A;  2VZW A;  4O01 A;  1MC0 A;  2Y79 A;  3DBA A;  3MMH A;  3MF0 A;  3EEA A;  2K2N A;  3RFB A;  2QYB A;  3G6O A;  3KSF A;  2W3E A;  5L8M A;  4MMN A;  1TF1 A;  5DFX A;  4Z1W A;  3TRC A;  5HSQ A;  3E0Y A;  4O8G A;  4IUH A;  1VHM A;  4Q0J A;  4GW9 A;  2IA2 A;  4ME4 A;  2HGV A;  4IJG A;  4R70 A;  3LFV A;  4QPR A;  2B18 A;  4GLQ A;  3S7N A;  3E98 A;  3NHQ A;  4G3K A;  4LRX C;  2XRN A;  1YSP A;  2K31 A;  5TJJ A;  2O9B A;  5HL6 A;  3KSI A;  4G3V A;  4IUK A;  3NOU C;  1STZ A;  1YKD A;  3CI6 A;  4Q0H A;  3KO6 A;  4LRY C;  3NOP C;  4Y5F A;  5HPF A;  2W3G A;  2M7U A;  4ZRR A;  5DFY A;  5AJG A;  3C2W A;  4Y2F A;  4ETX A;  1MKM A;  4DMZ A;  5C5K A;  4R6L A;  5I5L A;  3KSG A;  2XRO A;  2VKS A;  4G3W A;  2Y8H A;  1TD5 A;  2W3F A;  4MDZ A;  4Y3I A;  4EU0 A;  2W1T B;  4YNR A;  5K5B A;  2OOL A;  4MCW A;  4LRZ E;  4O0P A; 
#chains in the Genus database with same CATH topology
 4BL3 A;  5F68 A;  3BM6 A;  1D7E A;  5CHU A;  3ZQ5 A;  4JGO A;  1L0D A;  4ID4 A;  2Y2I A;  3FKV A;  4NK3 A;  4WN5 A;  1N9O A;  2O99 A;  3S7P A;  3CG5 A;  4PHT A;  1SHV A;  2Y2O A;  4OQ0 A;  2OWH A;  2QWS A;  2PU4 A;  1Y28 A;  2DRW A;  3BEC A;  3BJN A;  2R9W A;  3KSH A;  3RXW A;  4F94 A;  4OPZ A;  3A3F A;  3O87 A;  5KSC A;  2ZBB A;  3UDI A;  2FH5 A;  1SKF A;  1NYY A;  3VSL A;  3IXH A;  4ZJ2 A;  1ES2 A;  4HH3 A;  3JPU A;  3ITA A;  3VOY A;  5TFQ A;  3FV7 A;  4U3T A;  1IYQ A;  4DE2 A;  5HD5 A;  2EFU A;  3G2Z A;  4Q0J A;  1EWZ A;  4GW9 A;  3K3D A;  5HAR A;  5KMW A;  2HV1 A;  3KYE A;  5FSR A;  4OPY A;  4WBG A;  3F1O B;  2QHK A;  2L4R A;  1K6R A;  4WMC D;  4IUK A;  4FH2 A;  1DP8 A;  1OTB A;  4QY5 A;  1Z6F A;  3MKE A;  4HJ6 A;  3O3V A;  3ZG9 B;  5A90 A;  2Y59 A;  2HP6 A;  2J3T C;  5CEB A;  1ODV A;  4KZ4 A;  4NG2 A;  3QP2 A;  4WZ5 C;  1ZHH B;  2Z6C A;  5GLA A;  3FPW A;  4LLO B;  1JWZ A;  1K4F A;  3F1N B;  3T4L A;  2B5R A;  2PT7 A;  2W1R A;  3F1O A;  4HBT A;  3UB9 A;  2EA9 A;  3IBR A;  4P87 A;  1HD8 A;  1J9M A;  1PNE A;  4KZ5 A;  2BTF P;  4DXB A;  3EOI A;  2B02 A;  1P0Z A;  3WWX A;  2ZQ7 A;  2ZOI A;  2PDR A;  1XJ4 A;  3W4P A;  4PAU A;  2E8J A;  4MN7 A;  3UB6 A;  5E2F A;  3F1N A;  4OPQ A;  3C4O A;  4A5R A;  3NOT C;  3BFC A;  3ZG5 A;  5HWV A;  2ZM2 A;  1C3B A;  1SDN A;  2R9X A;  4BQM A;  2XR0 A;  4MMN A;  1NYM A;  3HLF A;  5A91 A;  4XXR A;  4BBU A;  2P08 A;  3N8L A;  2EX6 A;  2XRN A;  3DAV A;  4RX2 A;  2J9O A;  2P7J A;  3PBR A;  4S2M A;  3KSI A;  4E3I A;  1OTI A;  2NUT C;  1ES5 A;  3T12 B;  3HUO A;  4ARZ B;  1ZC2 A;  1U60 A;  2EX2 A;  4QD4 A;  1DJB A;  2UV0 E;  4Y2F A;  3GVB A;  3A3E A;  4CLC D;  2V9A A;  2OWJ A;  4Y0U A;  1J3W A;  3UNW A;  1DP6 A;  4O0P A;  1TVF A;  3NY4 A;  3QP5 A;  1JVJ A;  4C75 A;  4EV4 A;  2NUP C;  4ARZ A;  2L0W A;  2JKG A;  3Q07 A;  1BLC A;  4WLA A;  2E8I A;  4RQ9 A;  4QY6 A;  3BFE A;  1BTL A;  1XJ3 A;  2J8Y A;  3G34 A;  4NKP A;  1I2S A;  3BLS A;  3S7Q A;  3Q81 A;  3RXX A;  2JKR M;  1VB6 A;  2HP5 A;  4M3K A;  4RYE A;  3T1S A;  3EQV A;  2R78 A;  3WRT A;  5TBM B;  1F9I A;  4IVK A;  4FOF A;  3AGE A;  4DRT A;  4JKT A;  1S0W A;  3MF0 A;  3MS6 A;  3A3I A;  3G6O A;  2D02 A;  5HAI A;  1VM1 A;  4BLM A;  2WK0 A;  1LSV A;  5GLD A;  4GD6 A;  5FDS A;  3T4S A;  5CER A;  3V67 A;  3NCK A;  4MNR A;  1QME A;  4EW7 A;  3VP4 A;  5DF7 A;  1T1B A;  2VGL M;  2ZQD A;  4WMC A;  5TBM A;  4Y0O A;  1FOF A;  4FUW A;  4F3L B;  1L0E A;  1MKI A;  4DF6 A;  3MR0 A;  2ZMV A;  1BLH A;  5HPF A;  4ZTK A;  2OLV A;  4Y17 A;  5EOO A;  3JVU A;  3MXQ A;  4EBP A;  5K5B A;  2OSU A;  3SS5 A;  3BY8 A;  3SW1 A;  4HY8 A;  4YOF A;  5KZH A;  1PWG A;  1XGI A;  4MN6 A;  3W4O A;  4I38 A;  4F3L A;  3D3O A;  2W3H A;  3N4I A;  3BYD A;  1ES3 A;  4UA7 A;  4DN0 A;  1YT4 A;  3T4K A;  3C5A A;  2WAD A;  4IVI A;  3U4L P;  1Z09 A;  3LI9 A;  3S22 A;  1YM1 A;  1S4S A;  4WUJ A;  1ES4 A;  3BFG A;  3AGD A;  3NUL A;  4E3M A;  1FR1 A;  3DWZ A;  2VZW A;  3LUQ A;  1OTA A;  1T18 A;  2RL3 A;  3C30 A;  4JF5 A;  4RA7 A;  1K55 C;  2PRF A;  4JGR A;  1GHM A;  3PBS A;  5CTN A;  1ZKJ A;  1ACF A;  4CLC B;  1W5D A;  1KE4 A;  3T1X A;  4O7D A;  4R70 A;  4OLG A;  4GJ4 A;  2G2U A;  3D72 A;  2QZ6 A;  4JXW A;  2RCX A;  2K31 A;  1K57 A;  5E2E A;  4RVA A;  1P9R A;  5DTS A;  4WZ4 A;  1ERO A;  4LV3 A;  4I3J A;  1YLP A;  1DY6 A;  2VA0 A;  5EM0 A;  4B4X A;  4YIN A;  1SCW A;  5AQB A;  2WKP A;  4U0T A;  4ZJ1 A;  1MKM A;  3BFD A;  1FIL A;  5CTM A;  1PW8 A;  4CLC A;  2W3F A;  3QP8 A;  3UO9 A;  5HDS A;  3IH8 A;  3UDX A;  3EWK A;  3MSH A;  1MY8 A;  5JYP A;  3FKW A;  4ZAM A;  4GNU A;  5L10 A;  3WS2 A;  3OPR A;  4RX3 A;  1Y54 A;  1TS7 A;  4K0W A;  3HRE A;  4X25 A;  4OP8 A;  2GX5 A;  1O7E A;  3PTE A;  1PW1 A;  3PBN A;  4GCZ A;  3L9K A;  3E2L A;  1XX2 A;  5A8B A;  2WKR A;  2ZC5 B;  4DE1 A;  4CPK A;  5FDH A;  1PRQ A;  1DP9 A;  4ZJ3 A;  5U47 A;  4DXC A;  2WAF A;  4E3L A;  1QMF A;  3MZD A;  2QKP A;  3T4O A;  4HI4 A;  4I5S A;  3Q82 A;  3MQO A;  4B4Z A;  2EWV A;  1DRM A;  5EEC A;  1GHI A;  3PYP A;  1LLB A;  2K2N A;  1GCE A;  4P0M A;  2Y2N A;  4KZ3 A;  1FR6 A;  4MLL A;  4C6Y A;  2J3W A;  3E0Y A;  4OPR A;  3BFF A;  2Z2L B;  5FAT A;  3E98 A;  1XA1 A;  2Y2K A;  4UQI M;  3G35 A;  1IEM A;  3T1R A;  1YSP A;  2JKT M;  2XD5 A;  3CMZ A;  1DJA A;  1K56 D;  2UWX A;  3UPP A;  5E2G A;  2J7V A;  3KO6 A;  2FFF B;  3E2K A;  4LV2 A;  2WZX A;  1CI8 A;  1PWD A;  3IXD A;  4FSF A;  4X53 A;  3KSG A;  2GNX A;  4BBT A;  1N9L A;  2Y2P A;  4P6B A;  2C6W B;  2ZOH A;  1PYY A;  1XGJ A;  1IYS A;  4KZ9 A;  1Q2Q A;  1MPL A;  1NZO A;  2HZ5 A;  3R4K A;  1H8M A;  4GKU A;  3R7W B;  4JGP A;  2HJE A;  4LGW A;  1FSW A;  1K57 C;  4HIA A;  4DJ2 A;  4B9O A;  4Y15 A;  1VET B;  1BLP A;  3DTI A;  2DNS A;  2XDM A;  1BYW A;  1KGE A;  1BSG A;  3MXR A;  3MXS A;  3A0V A;  3E4Q A;  3H9W A;  4PM6 A;  4L0L A;  4P6Z M;  3MQ0 A;  4CLC C;  1RCJ A;  2H0T A;  5GHX A;  1BLS A;  3WS5 A;  1CI9 A;  1K0K A;  1XXM A;  3R7W A;  4PM7 A;  1LI0 A;  1NXY A;  1YPR A;  1XJ6 A;  3WS1 A;  4GN2 A;  4II7 A;  1F98 A;  1VET A;  2WYX A;  3S1Y A;  4OVD A;  1NRF A;  4QPR A;  5FEG A;  1ESU A;  1VEU B;  3SH8 A;  2ZC6 B;  3GQZ A;  5G4Y A;  4R1G A;  4DE3 A;  2WGV A;  4GB7 A;  5DF8 A;  3FZC A;  3JVV A;  3QP1 A;  3PAG A;  3VOL A;  4E3N A;  4X6T A;  1JWP A;  3MJQ A;  1ERM A;  3LY4 A;  5HD3 A;  2VV7 A;  4KUO A;  2VKS A;  3ULF A;  5F82 A;  2KDK A;  3FPV A;  4DJ3 A;  5DTT A;  2ZQ8 A;  4R23 A;  1VEU A;  3V50 A;  2W1T B;  1KDW A;  4LRZ E;  1LI9 A;  1YLW A;  5EPH A;  5FL3 A;  3LI8 A;  3IHB A;  5EFW A;  1WYC A;  2JN7 A;  3ZG8 B;  4R3J A;  3N8S A;  4UQI S;  1OPX A;  2Q0O A;  2BG1 A;  5DF9 A;  5DTK A;  3HLW A;  3TSG A;  2XH9 A;  2W3D A;  5HPI A;  1NLZ A;  1XJ2 A;  4GD8 A;  1S4R A;  5J7E A;  2W1T A;  2VEA A;  3WS4 A;  3D4F A;  4OOL A;  5CXW A;  5CGX A;  3EEH A;  1S6R A;  1PFL A;  1JNU A;  3OPL A;  2BAS A;  3MMH A;  3M2K A;  4BD1 A;  3M6H A;  4CJN A;  1MWU A;  1HLU P;  3IQA A;  4Z1W A;  1YLY A;  1OTE A;  4UA6 A;  4S2L A;  3LFV A;  4PKY A;  2GDN A;  3B33 A;  1LL9 A;  4EWF A;  3C38 A;  4IBR A;  3ZYT A;  5JYO A;  1G6O A;  3HUM A;  3H82 B;  3QP4 A;  1P97 A;  1H8Z A;  2Z6D A;  1T1C A;  4UEY A;  4Q0H A;  1K56 A;  2Y4A A;  3NOP C;  5DKK A;  1WYB A;  4P6Z S;  1JTG A;  2ZQ9 A;  2J9P A;  5AJG A;  2WKI A;  4HBU A;  2OAP 1;  3SH7 A;  5HDD A;  4DMZ A;  2Y2G A;  4R3B A;  3LIA A;  4GZB A;  4KG5 A;  1K4E A;  1G5U A;  1SKO B;  2G2W A;  3CUE C;  1IEL A;  1XP4 A;  5IU1 A;  3T4J A;  2V0W A;  2H5S A;  5CHJ A;  4YNR A;  2PBY A;  4U0X A;  4MCW A;  1MWT A;  2Y91 A;  4JXS A;  3H82 A;  5I94 A;  5M18 A;  3NDE A;  3G32 A;  1KE0 A;  5GLB A;  1FCN A;  3Q1F A;  3UE0 A;  1ONH A;  5FAQ A;  5LBR A;  1CEF A;  3FG8 A;  3HJI A;  3C7V A;  4PKY G;  3A3J A;  3C7U A;  3H7W B;  3UPN A;  4L9G A;  1HTZ A;  2V0U A;  4CQH A;  2A49 A;  1W63 Q;  2ZLY A;  3VMA A;  3O5Y A;  1SKO A;  1H0M A;  3DTM A;  1K55 A;  2A24 B;  3IX8 A;  1IKI A;  1WE4 A;  1VQQ A;  4OOM A;  2V8F A;  4X55 A;  4S2P A;  3D9Y A;  3GR2 A;  3GEC A;  2HF6 A;  3H7W A;  3CJM A;  3G30 A;  2QMI A;  1X0O A;  1T1A A;  2HGV A;  2Y2H A;  1K54 A;  4BL2 A;  2A24 A;  1GSX A;  1IYP A;  4QU3 A;  1AWI A;  3UDF A;  2EX9 A;  1H8Y A;  5AVE A;  1E3U D;  1A0K A;  1PIO A;  1EI5 A;  2VV6 A;  4JXG A;  3LIF A;  1LSW A;  2EWW A;  3MFD A;  3NOU C;  2PBD P;  1STZ A;  5FI7 A;  1IYO A;  4JPM A;  2WAE A;  1RGZ A;  4KG2 A;  5EOE A;  5FQQ A;  3ZG7 B;  5FQM A;  4KQQ A;  3DWK A;  4EES A;  4X69 A;  1TDG A;  4MN5 A;  3W8K A;  3IX3 A;  1UGU A;  5EVL A;  3LIE A;  1WA9 A;  3P98 A;  4IHQ A;  2Y2Q A;  4UA9 A;  5HWW A;  2IWD A;  3NC8 A;  2K7S A;  4DE0 A;  1JWV A;  4QB8 A;  2KLI A;  1TS8 A;  3V3R A;  4B93 A;  1PZO A;  3VV4 A;  5GLC A;  3LEQ A;  1MBL A;  5HAP A;  4R4R A;  4D60 A;  1FCO A;  1OJG A;  2XSS A;  4Z9Q A;  3S4X A;  5CGS A;  4ETZ A;  3I7J A;  4X68 A;  4OQH A;  5KIZ A;  3U2A A;  3BEB A;  4S2J A;  2XQZ A;  4QHC A;  3C8C A;  3EGX C;  1ZG4 A;  3OOV A;  3WRZ A;  2IWC A;  4R0Q A;  4BEN A;  5M19 A;  5FQJ A;  4D2O A;  2Y79 A;  3DBA A;  5FAP A;  1W8Q A;  4AFI A;  4K08 A;  3ZDJ A;  3PHY A;  2AVX A;  1VHM A;  1NY0 A;  2EFX A;  4FH4 A;  3GTC A;  1YAX A;  4GLQ A;  4KQO A;  1P9W A;  1KE3 A;  4Y0T A;  3IWQ A;  2HDS A;  3CLO A;  4GOG A;  4GDN A;  4LRY C;  2PYR A;  1OTD A;  4EXO A;  3ICY A;  2HDU A;  1S67 L;  5C5K A;  4L9E A;  3Q7V B;  3NIA A;  4WYY A;  4N9L A;  4Y3I A;  4C3Q A;  3PBT A;  2OOL A;  5L07 A;  2W0N A;  4KQD A;  1NJ4 A;  3QNC A;  5CED A;  5FI2 A;  1K54 C;  3CHW P;  3LR3 A;  3O88 A;  2A3U A;  3BRM A;  5GHZ A;  4X1M A;  3N8R A;  3TJZ C;  5FQ9 A;  2V8C A;  1UWN X;  1H5X A;  4NXG A;  2Q9N A;  4JXV A;  1K25 A;  2M1C A;  2VLG A;  3IF5 A;  3Q7V A;  3TW8 A;  3UMD A;  3C4P A;  4IED A;  4EUV A;  1GA0 A;  3SOI A;  4ZDX A;  3M6B A;  3IBJ A;  3IS2 B;  5IT5 A;  1TS6 A;  2Z2M B;  1K38 A;  2MJ6 A;  5CHM A;  2EXA A;  2VGL S;  4LPZ A;  3VP2 A;  2P04 A;  1O07 A;  3G4P A;  3GMW A;  3CZD A;  1KVL A;  4HNB A;  5L8M A;  2DCF A;  3VP1 A;  4O8G A;  1BZA A;  4IJG A;  5FQK A;  2B18 A;  3L7H A;  3EQU A;  4EUZ A;  3KX0 X;  1G6A A;  2CC1 A;  1ONG A;  2IWB A;  5HL6 A;  1E3U A;  3VP0 A;  2XA7 M;  3GV9 A;  3IS2 A;  3ZGA B;  4NXB A;  3ZNT A;  1MWS A;  1GSV A;  3A3D A;  5TGF A;  4XUX A;  1L3L A;  5J8X A;  3W4Q A;  4GHI B;  4S2N A;  1OME A;  3C2W A;  3UME A;  5E2H A;  3DTE A;  3VE3 A;  5I5L A;  3UE6 A;  1H3Q A;  3VP3 A;  1F2K A;  3LY3 A;  3WS0 A;  1CK3 A;  4OOY A;  2YKF A;  4NET A;  1KGF A;  3PXP A;  3P01 A;  4MBH A;  2PAV P;  1TS0 A;  1YSQ A;  4ESP A;  3W2Z A;  3IF6 B;  2ZMF A;  2EX8 A;  4HP4 A;  5CRF A;  4E04 A;  4GHI A;  3MQQ A;  4LCL A;  4BWI A;  3ZCZ A;  2OV5 A;  2VV8 A;  2QJ7 A;  2LB5 A;  1W7F A;  4I39 A;  5HZH A;  2A2L A;  3E4O A;  1M40 A;  4E3O A;  3CAX A;  4IBX A;  4EEU A;  3IF6 A;  2YKH A;  1CQA A;  1NZU A;  5CGW A;  3EEA A;  1FQG A;  5CEC A;  4Y13 A;  3HJK A;  3UPO A;  1SZV A;  1FIK A;  1CEG A;  1CF0 A;  4R4S A;  4XUZ A;  2V2F F;  3NHQ A;  3N7W A;  3M2J A;  4P85 A;  4L9F A;  2ZJ9 A;  1IKG A;  1LSX A;  3QHY A;  3CUE A;  2WGW B;  3O86 A;  3UY6 A;  4BBV A;  1ERQ A;  1XKZ A;  1OJ5 A;  2JE5 A;  5DFY A;  4WEL A;  2XD1 A;  1LL5 A;  3MZE A;  2WKE A;  3NDG A;  4G3W A;  5GHY A;  1XFQ A;  4OQG A;  1L0G A;  4OKP A;  5GL9 A;  2JCH A;  2Q9M A;  1LHY A;  1MZU A;  3ZG0 A;  5AVF A;  1S66 L;  1D1J A;  2KOI A;  1IFQ A;  2ZC3 B;  4OQI A;  3OZH A;  2PYP A;  2WGW A;  2QJ5 A;  3DW0 A;  5DJU A;  5F5Y A;  2XFT A;  3UE3 A;  3LID A;  4EER A;  3B42 A;  2XA7 S;  1UWP X;  4E3J A;  2I9V A;  2HDQ A;  4S2N C;  4MBK A;  2XLN A;  2P9V B;  1GSW A;  4HHD A;  3ZVW A;  3IX4 A;  5D3O A;  2O9C A;  2H10 A;  3V3S A;  2BLS A;  1BT5 A;  5IS1 A;  3P7N A;  3HLG A;  1MC0 A;  3HUN A;  4LCM A;  1BUL A;  1YMX A;  4OLD A;  2ZMA A;  3OC2 A;  4WL9 A;  2QYB A;  2L1M A;  2W3E A;  4FD8 A;  3LO7 A;  5DFX A;  3UB8 A;  4KUK A;  3SZT A;  1FSY A;  2P9V A;  5FEF A;  4CLC E;  1SDE A;  2PR6 A;  4G3K A;  3N6I A;  2V1Z A;  2VGJ A;  3UB7 A;  2O9B A;  4WEJ A;  2HJ9 C;  1YKD A;  5FQI A;  4N9K A;  2ZC4 B;  4PMA A;  4EBL A;  1PI4 A;  2B95 A;  4EET B;  3T4T A;  1N9B A;  3TOI A;  4HH2 A;  3IF6 C;  3PAE A;  1K6S A;  2Y8H A;  4UAA A;  1RP5 A;  1YQS A;  3T4Q A;  2Y55 A;  4XT2 B;  1I5Q A;  4LEN A;  2O0Y A;  1NRJ A;  1GHP A;  1W79 A;  2ZQA A;  1NLY A;  2ACG A;  4S2O A;  3UB5 P;  4NXF A;  1XPB A;  2PD8 A;  4Q0I A;  5EVI D;  4KZ7 A;  1E4D A;  4HES A;  4LV0 A;  5DVA A;  2VX8 A;  2WKQ A;  2JKF A;  4K0X A;  3VFF A;  4XT2 A;  3HLB A;  1F5M A;  3A0R A;  2JKR I;  3HCY A;  3CIT A;  3CWF A;  1S1Y A;  4R38 A;  4KZA A;  3VFH A;  2LB9 A;  4HEF A;  2I72 A;  3HLE A;  1M6K A;  2H0Y A;  4JF6 A;  4WF0 A;  5EV0 A;  3ITB A;  3IH9 A;  1KDS A;  2DMW A;  2INW A;  1HVB A;  2XFS A;  5FI6 A;  3IWO A;  1CJF A;  5HSQ A;  1LL8 A;  3OCL A;  2XGN A;  3EGD C;  4I3A A;  1ZG6 A;  2FZ0 A;  1L2S A;  3LR0 A;  3FWL A;  4Q8I A;  3TG9 A;  4PM5 A;  5HX9 A;  4QJG A;  1V9Y A;  2WZZ A;  5EVE A;  1I2W A;  1S1Z A;  2X71 A;  2M7U A;  3IHA A;  4GS9 B;  2PD7 A;  4R6L A;  5AQ9 A;  5F1G A;  3NJA A;  5M1A A;  1OT6 A;  4BJP A;  2XRO A;  3HL9 A;  1RGY A;  2PHY A;  3DTK A;  3IWI A;  4LV1 A;  1L0F A;  1YLJ A;  2FFY A;  1LT0 A;  3QP6 A;  5G18 A;  3E4P A;  2C5W B;  3HBR A;  4JLF A;  3MKF A;  4EQI A;  1MXO A;  2VJW A;  3BQA A;  4GS9 A;  4K91 A;  3LEZ A;  3BWL A;  4NXE A;  5F6A A;  4I3I A;  4NEE D;  5HW3 A;  3PR6 A;  2GZA A;  4OON A;  1PI5 A;  3QNB A;  2EXB A;  1KVM A;  1ZTU A;  2J3T D;  5TR7 A;  3FC7 A;  5CX7 A;  3GRJ A;  4O01 A;  2WUQ A;  1N9N A;  3LIB A;  1BUE A;  2X02 A;  3CPT B;  3ZFZ A;  3G31 A;  4LFU A;  2XF3 A;  3LR4 A;  4ZBE A;  1JTD A;  3KSF A;  3LIC A;  1YLT A;  4OP5 A;  1N4O A;  3V39 A;  2OAQ 1;  4E3K A;  2GJ3 A;  3BLM A;  2IA2 A;  4HP9 A;  5J4E A;  3KYQ A;  1V9Z A;  4LRX C;  2J80 A;  5TJJ A;  4HQA A;  3IT9 A;  4E6X A;  4HOI A;  2XK1 A;  3HVF A;  3T1Q B;  4R3A A;  2WKH A;  3V5M A;  3VOZ A;  3VE4 A;  5IHV A;  4Y5F A;  2W3G A;  3CPT A;  2P74 A;  4H6J B;  1W8Y A;  4ETX A;  4WM9 A;  2Y2J A;  4JBF A;  1PWC A;  5EVI B;  3Q7Z A;  3OPH A;  2HDR A;  3IXB A;  4KG6 A;  2WGI A;  3LYX A;  5KSH A;  2HP9 A;  2OLU A;  2JBF A;  2M7V A;  2O9A A;  4EBN A;  1Q2P A;  4HJ3 A;  1G28 A;  2V20 A;  2HPB A;  5HWT A;  2PU2 A;  3SS3 A;  2ZC7 A;  4BD0 A;  1KOU A;  1IOU A;  4H6J A;  4S2I A;  3BY9 A;  5EVI A;  3T50 A;  2ZD8 A;  3OCN A;  4MBF A;  5DJT A;  1XA7 A;  5EUA A;  4E6W A;  4GDB A;  2XEP A;  1Y4O A;  1XFN A;  3MZF A;  3MBZ A;  5F1F A;  2ZL1 B;  2D01 A;  1T19 A;  2JC7 A;  4WEK A;  4S2K A;  2ZQC A;  4EQ1 A;  4PM8 A;  3IXG A;  3RH8 B;  3UE1 A;  5L09 A;  2ZM8 A;  4N1X A;  3RJU A;  3MFX A;  4JGQ A;  4FTX A;  5FAS A;  3BW6 A;  2Y2L A;  5FA7 A;  1DJC A;  5MC7 A;  3OLO A;  5BOH A;  3PBO A;  3VSK A;  4G3V A;  4MEZ A;  2ZM0 A;  2JKT I;  3CI6 A;  5HDC A;  5HFO A;  4JF4 A;  2ZL1 A;  5HAQ A;  2VK3 A;  3G2Y A;  2PR5 A;  1ESI A;  1G68 A;  5A92 A;  1YMS A;  2JHE A;  3A0S A;  4Y7P A;  4M4X A;  1TD5 A;  4OH0 A;  3BQ8 A;  2Y2M A;  4FCF A;  1E25 A;  4BMW A;  3P09 A;  2V1B A;  4HJ4 A;  3GDI A;  3OPP A;  3OBF A;  5J3W A;  1KGG A;  3K2N A;  3ZNY A;  1OT9 A;  4PPR A;  1TEM A;  3NBL A;  1MWR A;  5E43 A;  5EM1 A;  4YWZ A;  4X1L A;  4QWO A;  3LCE A;  3B47 A;  2G7U A;  4DDS A;  1PZP A;  1W63 M;  4KZ6 A;  5G4Z A;  1FCM A;  3HLD A;  1EW0 A;  5F83 A;  3S7O A;  3AGF A;  5F69 A;  5FAO A;  5AQ7 A;  2CMN A;  4KZ8 A;  4X56 A;  2X01 A;  5L2F A;  3SH9 A;  3HLC A;  1ALQ A;  3FYZ A;  4EEP A;  3KYZ A;  4WZ5 A;  3LR5 A;  4KEN B;  5A93 A;  3RFB A;  3K3C A;  4PM9 A;  1TF1 A;  3TRC A;  1NWZ A;  3PBQ A;  3ZHH A;  4IUH A;  4DDY A;  4B88 A;  4ME4 A;  3NI9 A;  3UN7 A;  2V1A A;  3S7N A;  3ISG A;  5HL1 A;  3F1P B;  4KQR A;  3RTY A;  2VGK A;  5EVI C;  1YLZ A;  4YFM A;  1AXB A;  3SS4 A;  4KZB A;  1GA9 A;  3ZVT A;  2KX6 A;  3LGO A;  4ZRR A;  1HZO A;  1TDL A;  1D06 A;  2W27 A;  4DKI A;  5EE8 A;  4N92 A;  5DKL A;  2QPN A;  4UHU A;  3TE8 A;  3NEC A;  4MDZ A;  4N1H A;  5AQA A;  4EU0 A;  3F1P A;  3GSG A;  3B3X A;  3JYI A;  2H28 A;  4H8R A; 
#chains in the Genus database with same CATH homology
 1WA9 A;  2O0Y A;  1NRJ A;  5F68 A;  1D7E A;  4IHQ A;  3ZQ5 A;  5HWW A;  4JGO A;  2K7S A;  1TS7 A;  1NLY A;  2KLI A;  1TS8 A;  4B93 A;  2GX5 A;  4NXF A;  2PD8 A;  4Q0I A;  4WN5 A;  1N9O A;  3PBN A;  2O99 A;  4GCZ A;  3VV4 A;  3S7P A;  5A8B A;  1OJG A;  2XSS A;  2WKR A;  2VX8 A;  2WKQ A;  4PHT A;  4XT2 A;  2OWH A;  4ETZ A;  1F5M A;  3A0R A;  2JKR I;  2QWS A;  1DP9 A;  5KIZ A;  3U2A A;  3HCY A;  3CIT A;  3CWF A;  1Y28 A;  3BJN A;  3KSH A;  1S1Y A;  4R38 A;  3C8C A;  2LB9 A;  3EGX C;  2ZBB A;  2QKP A;  3OOV A;  3T4O A;  4HI4 A;  2FH5 A;  4I5S A;  3MQO A;  2Y79 A;  3DBA A;  2EWV A;  1DRM A;  4HH3 A;  4WF0 A;  3PYP A;  2K2N A;  2DMW A;  2INW A;  4AFI A;  4K08 A;  5HD5 A;  3PHY A;  2J3W A;  5HSQ A;  1LL8 A;  3E0Y A;  1VHM A;  4Q0J A;  4GW9 A;  3K3D A;  3OCL A;  4I3A A;  3EGD C;  1YAX A;  4GLQ A;  4KQO A;  2FZ0 A;  3E98 A;  4UQI M;  1P9W A;  2HV1 A;  3LR0 A;  1YSP A;  3F1O B;  2QHK A;  2JKT M;  2L4R A;  3CLO A;  4IUK A;  1DP8 A;  1OTB A;  3KO6 A;  4LRY C;  1V9Y A;  4HJ6 A;  2PYR A;  1OTD A;  1S1Z A;  4EXO A;  2M7U A;  3ICY A;  4FSF A;  2J3T C;  1ODV A;  4GS9 B;  2PD7 A;  1S67 L;  5C5K A;  4R6L A;  4L9E A;  3NJA A;  1OT6 A;  3KSG A;  2GNX A;  4BBT A;  4BJP A;  2XRO A;  1N9L A;  1ZHH B;  2Z6C A;  2PHY A;  3FPW A;  4LLO B;  4Y3I A;  2ZOH A;  3F1N B;  3PBT A;  3T4L A;  2OOL A;  2W0N A;  4KQD A;  2PT7 A;  2W1R A;  3F1O A;  1LT0 A;  3E4P A;  3R4K A;  1H8M A;  3R7W B;  3LR3 A;  3UB9 A;  2EA9 A;  4JGP A;  2HJE A;  3IBR A;  4DJ2 A;  4HIA A;  2VJW A;  3BQA A;  3TJZ C;  4B9O A;  3EOI A;  2B02 A;  1UWN X;  1P0Z A;  4GS9 A;  2ZOI A;  3BWL A;  4NXG A;  4NXE A;  2PDR A;  1XJ4 A;  2M1C A;  5F6A A;  2VLG A;  4I3I A;  1BYW A;  4NEE D;  4PAU A;  3PR6 A;  2GZA A;  3A0V A;  4MN7 A;  3TW8 A;  3UB6 A;  3F1N A;  3E4Q A;  3UMD A;  3H9W A;  4EUV A;  4L0L A;  4P6Z M;  3NOT C;  3MQ0 A;  4CLC C;  5HWV A;  1ZTU A;  2J3T D;  3FC7 A;  3IBJ A;  3IS2 B;  5CX7 A;  5IT5 A;  1TS6 A;  4O01 A;  3R7W A;  2MJ6 A;  1N9N A;  3LIB A;  2VGL S;  1XJ6 A;  4LPZ A;  4II7 A;  2P04 A;  3LR4 A;  1F98 A;  4HNB A;  3KSF A;  3LIC A;  5L8M A;  4MMN A;  2OAQ 1;  2GJ3 A;  4O8G A;  2IA2 A;  4IJG A;  4QPR A;  2B18 A;  4BBU A;  4HP9 A;  2P08 A;  3EQU A;  5G4Y A;  3KYQ A;  3KX0 X;  5J4E A;  1V9Z A;  4LRX C;  2XRN A;  2J80 A;  5TJJ A;  2P7J A;  4HQA A;  3PBR A;  5HL6 A;  4HOI A;  3KSI A;  1OTI A;  2NUT C;  2XA7 M;  3IS2 A;  4NXB A;  4R3A A;  3JVV A;  1GSV A;  3VE4 A;  4ARZ B;  3VOL A;  4Y5F A;  4GHI B;  2W3G A;  3C2W A;  3UME A;  4H6J B;  4Y2F A;  3MJQ A;  4ETX A;  4CLC D;  5HD3 A;  2V9A A;  2VV7 A;  4KUO A;  3VE3 A;  5I5L A;  2VKS A;  3UE6 A;  1H3Q A;  3ULF A;  2OWJ A;  2KDK A;  3FPV A;  4DJ3 A;  2YKF A;  2W1T B;  3LYX A;  3PXP A;  1DP6 A;  3P01 A;  4LRZ E;  4O0P A;  5KSH A;  5FL3 A;  3LI8 A;  1TS0 A;  2M7V A;  2O9A A;  5EFW A;  4HJ3 A;  2JN7 A;  1YSQ A;  1G28 A;  3W2Z A;  5HWT A;  2NUP C;  4ARZ A;  4UQI S;  2ZMF A;  1KOU A;  2L0W A;  4HP4 A;  4E04 A;  4GHI A;  3MQQ A;  4WLA A;  4RQ9 A;  4H6J A;  1OPX A;  1IOU A;  5DF9 A;  4BWI A;  3BY9 A;  1XJ3 A;  2VV8 A;  2QJ7 A;  4NKP A;  3T50 A;  3OCN A;  2LB5 A;  3S7Q A;  2W3D A;  5DJT A;  1NLZ A;  1XJ2 A;  5HPI A;  2JKR M;  1S4R A;  4I39 A;  1VB6 A;  5J7E A;  5HZH A;  2W1T A;  2VEA A;  2A2L A;  3EQV A;  3E4O A;  4OOL A;  1XFN A;  2R78 A;  5TBM B;  1F9I A;  3CAX A;  4EEU A;  3EEH A;  4FOF A;  1JNU A;  2D01 A;  2YKH A;  2BAS A;  1T19 A;  3MMH A;  3MF0 A;  4WEK A;  3EEA A;  3G6O A;  4EQ1 A;  2D02 A;  3HJK A;  4Z1W A;  3RH8 B;  1OTE A;  1LSV A;  3T4S A;  3LFV A;  3V67 A;  4PKY A;  3MFX A;  4JGQ A;  3B33 A;  3BW6 A;  3NHQ A;  4EW7 A;  5MC7 A;  3C38 A;  4L9F A;  3OLO A;  3ZYT A;  1T1B A;  3PBO A;  1G6O A;  2VGL M;  3H82 B;  4G3V A;  5TBM A;  2JKT I;  1P97 A;  1LSX A;  2Z6D A;  3CUE A;  1T1C A;  3CI6 A;  4UEY A;  5HDC A;  4F3L B;  4BBV A;  4Q0H A;  3MR0 A;  3NOP C;  5DKK A;  1OJ5 A;  2ZMV A;  4P6Z S;  2PR5 A;  5HPF A;  5DFY A;  4WEL A;  5AJG A;  2JHE A;  2OAP 1;  3A0S A;  5HDD A;  4DMZ A;  4M4X A;  3LIA A;  3JVU A;  4G3W A;  1TD5 A;  1XFQ A;  3MXQ A;  3CUE C;  3BQ8 A;  5IU1 A;  4BMW A;  3T4J A;  2V0W A;  5K5B A;  4YNR A;  1MZU A;  4MCW A;  5AVF A;  2V1B A;  4HJ4 A;  1S66 L;  3BY8 A;  3GDI A;  3SW1 A;  3OBF A;  5J3W A;  4HY8 A;  4YOF A;  2KOI A;  1IFQ A;  3H82 A;  3K2N A;  4MN6 A;  1OT9 A;  2PYP A;  4I38 A;  4F3L A;  2QJ5 A;  5LBR A;  3D3O A;  3FG8 A;  3HJI A;  5DJU A;  5F5Y A;  4PKY G;  2W3H A;  3UE3 A;  3LID A;  4YWZ A;  3H7W B;  4EER A;  4L9G A;  2V0U A;  3B42 A;  3B47 A;  4CQH A;  4DN0 A;  2G7U A;  2XA7 S;  1UWP X;  1W63 Q;  3T4K A;  1W63 M;  3O5Y A;  5G4Z A;  2I9V A;  2A24 B;  1GSW A;  4HHD A;  3LI9 A;  1EW0 A;  3S7O A;  2O9C A;  5F69 A;  4OOM A;  1S4S A;  4WUJ A;  2CMN A;  2VZW A;  3LUQ A;  5IS1 A;  3P7N A;  4EEP A;  1OTA A;  3KYZ A;  1MC0 A;  1T18 A;  3C30 A;  3LR5 A;  3GEC A;  4JGR A;  2HF6 A;  3PBS A;  3OC2 A;  3RFB A;  4WL9 A;  2QYB A;  3K3C A;  3H7W A;  2L1M A;  2W3E A;  1TF1 A;  5DFX A;  3UB8 A;  1X0O A;  3TRC A;  4CLC B;  1NWZ A;  4KUK A;  1T1A A;  3PBQ A;  4IUH A;  4ME4 A;  2HGV A;  4R70 A;  4GJ4 A;  3D72 A;  2V1A A;  3S7N A;  2A24 A;  3F1P B;  4CLC E;  1GSX A;  3RTY A;  2PR6 A;  4G3K A;  2K31 A;  5AVE A;  3UB7 A;  2O9B A;  2VV6 A;  1P9R A;  3LIF A;  4WEJ A;  1LSW A;  2EWW A;  2HJ9 C;  3NOU C;  4I3J A;  1STZ A;  1YKD A;  2VA0 A;  2KX6 A;  4ZRR A;  4EET B;  2WKP A;  1D06 A;  2W27 A;  1MKM A;  3T4T A;  4HH2 A;  4CLC A;  5DKL A;  3TE8 A;  2Y8H A;  4EES A;  2W3F A;  4MDZ A;  3T4Q A;  4MN5 A;  4XT2 B;  4EU0 A;  5HDS A;  3F1P A;  2H28 A;  1UGU A;  3EWK A;  3LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...