2B18A

N-terminal gaf domain of transcriptional pleiotropic repressor cody.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
b'MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria.
pubmed doi rcsb
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
source organism Bacillus subtilis
molecule tags Transcription
total genus 48
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b18A00
2K31A 4Q0IA 5DFXA 4O01A 3NHQA 3E98A 3S7PA 2B18A 2W1RA 5HPFA 2O9CA 2KLIA 4CQHA 3O5YA 4IJGA 3MMHA 3IBRA 4Z1WA 4ME4A 5DFYA 4ETXA 1YSQA 4IUKA 2IA2A 4MDZA 5LBRA 2O9AA 3NOTC 2O9BA 1VHMA 4R6LA 3S7NA 3C2WA 4Y5FA 3KSHA 2W3HA 4Q0HA 2G7UA 2W1TA 2ZMFA 3NOPC 2HGVA 2QYBA 4LRXC 3K2NA 3RFBA 4Y2FA 3KO6A 2O99A 3VV4A 2O0YA 4DN0A 4BWIA 1YKDA 3S7QA 1STZA 3KSGA 3G6OA 2XSSA 2W3EA 3EEAA 3DBAA 1YSPA 4GW9A 2Y8HA 3D3OA 2XROA 3CI6A 5HPIA 3OOVA 2LB5A 4R70A 2M7UA 3KSFA 3BJNA 2W3GA 4MN7A 4G3VA 4YOFA 2VJWA 4MCWA 4Y3IA 1TD5A 4G3WA 3LFVA 3NOUC 4FOFA 3MQ0A 5I5LA 4O0PA 3W2ZA 4O8GA 4ZRRA 3TRCA 4RQ9A 2K2NA 5HSQA 5TJJA 4MMNA 1ZTUA 2XRNA 3ZQ5A 2LB9A 2W3FA 3IBJA 2VKSA 5AJGA 1F5MA 2OOLA 2VZWA 1TF1A 2GX5A 3CITA 4EU0A 4LRZE 4GLQA 4QPRA 3HCYA 3OBFA 5L8MA 2M7VA 4EUVA 4DMZA 2KOIA 4G3KA 2W1TB 2VEAA 1MKMA 4IUHA 5HL6A 2Y79A 4LRYC 4E04A 2W3DA 1MC0A 3E0YA 3MF0A 3S7OA 3KSIA 4Q0JA 5C5KA 4ETZA 4PAUA 4YNRA 5K5BA 3R4KA
chains in the Genus database with same CATH superfamily
4DXBA 4N92A 2EX8A 4MEZA 1I5QA 4K0XA 3ZG8B 2JKFA 4CLCB 5GHXA 4P85A 3GV9A 3EWKA 1HLUP 5FATA 3OZHA 4JLFA 1EW0A 4OLDA 4CJNA 2J3TD 3OPLA 2QWSA 4CPKA 5CERA 3PBRA 3MS6A 4NKPA 2R9WA 4FTXA 1NXYA 2QKPA 5FQIA 5CECA 3IF6C 2VGKA 3F1NA 2V20A 2D01A 3VOYA 1XPBA 5EVIC 1BLHA 3LR4A 3T50A 1YPRA 4L9GA 2YKHA 4HEFA 4KZ3A 3NOUC 2G2WA 5AQ9A 3LEZA 4S2IA 3KX0X 4PKYA 5FQJA 2XFTA 1IYQA 1K54C 2PRFA 4HP4A 3CITA 1S1ZA 3VP2A 1ESUA 4HOIA 5AQ7A 2XGNA 3UMDA 3FPWA 4E3LA 4EWFA 4I3JA 3UB8A 1ES3A 1S67L 2J8YA 2KOIA 1PWGA 5FEGA 2WUQA 3LR5A 4E3KA 2GZAA 2OLUA 4E3JA 1LSXA 2XA7S 5KSCA 2XK1A 3G31A 4X25A 3HLDA 3HLCA 3ZG0A 2WK0A 1H8YA 3HUNA 2WZXA 1W5DA 4ZTKA 4OOMA 2X02A 3MFXA 5FQQA 5JYOA 2DCFA 3ZFZA 2O9BA 4OP5A 1KGEA 2Y4AA 3M6BA 4GKUA 2DRWA 2HZ5A 4DE0A 5IHVA 1BT5A 3PAEA 2Y59A 3H82B 1TEMA 4P6ZS 3VOZA 1BTLA 3VP4A 2PHYA 4B4XA 5HWTA 1S6RA 5DTTA 1IEMA 3E4OA 1I2SA 2PU2A 3D3OA 3V3RA 2LB5A 5HARA 3MQQA 3NDGA 3PBTA 2FZ0A 5F5YA 1RCJA 2J3WA 5L07A 5FASA 1NJ4A 2W0NA 2K2NA 2QJ5A 4MMNA 1XGIA 1ZTUA 4O7DA 3IBJA 3RTYA 4EU0A 1ZKJA 3TE8A 2EA9A 3CWFA 4PM6A 2HDSA 3UPNA 2H10A 2V1BA 1YLJA 1IOUA 4B93A 4EBPA 1TDLA 5HL6A 1BZAA 5I94A 3A3IA 3A0RA 1K6RA 3E0YA 2HDQA 3TG9A 3ICYA 3D72A 2EFUA 1F98A 3BW6A 4R3AA 1K38A 5A91A 4Q0IA 3K3DA 3LIAA 5FAOA 4U0XA 3RXWA 3ISGA 3S7PA 2UWXA 4U3TA 5U47A 4H6JA 2JKRM 4EBLA 3Q81A 2DNSA 3UB6A 4GS9B 1XJ4A 3Q7VA 1YSQA 3Q7ZA 1KE0A 4KZ9A 1KDSA 3NJAA 5KMWA 4LCMA 2JE5A 1IKGA 1YAXA 4OQIA 2WKQA 1GCEA 2ZMAA 4KQQA 4WZ4A 1S1YA 3IF5A 1W63Q 2L0WA 4KG2A 3MJQA 4DN0A 4BWIA 4QB8A 4ZJ2A 3BLSA 1C3BA 3PBSA 4BBTA 1Z09A 2JKTI 5J4EA 3IXHA 1RGYA 3ZCZA 1PRQA 5HPIA 1WE4A 3IF6A 3L7HA 1IELA 4GDNA 1DJAA 3RXXA 5IS1A 4K08A 4EESA 1OT6A 1JTGA 3LFVA 5EVIA 2NUPC 5CEDA 4O0PA 3NULA 3SS3A 2AVXA 5DF7A 4WELA 1FCOA 3UPOA 4RQ9A 4KQRA 3A3DA 2ZOIA 2JN7A 4QPRA 3CPTA 4LPZA 4KZ6A 1N9NA 3TJZC 2QJ7A 3TW8A 1KGGA 4DMZA 1SKOA 4KG6A 1K54A 2XH9A 4S2LA 1VETA 1MC0A 3OLOA 4GD8A 4BD1A 2Y2OA 5IT5A 4EERA 4S2JA 4UQIM 5FSRA 4ESPA 1D1JA 5EECA 4ZJ3A 3IXGA 4X56A 4O01A 3T4JA 1OJGA 4DF6A 2O9CA 3MZFA 1K4FA 2H0YA 4Z1WA 1G68A 3AGEA 3UDXA 1E4DA 3NOTC 5CGSA 1VHMA 5D3OA 1AWIA 2V1ZA 1J9MA 4Q0HA 1M6KA 2B95A 1RP5A 2X71A 3LCEA 3NOPC 3ZGAB 2XD5A 1W79A 1ZC2A 1VQQA 2OAQ1 4PPRA 3CHWP 2WAEA 2XSSA 1V9ZA 1UWPX 2EXAA 2Y2PA 4WLAA 1LSVA 2EWWA 2JKTM 1LI9A 3NIAA 1VB6A 1FIKA 3RH8B 1XFNA 2EX9A 3BQAA 4DXCA 3DWKA 1GSWA 3QP2A 4UA9A 4Y15A 2XDMA 3W2ZA 1XKZA 3P7NA 4HQAA 3T4OA 4HESA 5GL9A 4PMAA 4KZAA 5F6AA 3ZQ5A 1OTIA 4KUKA 1GA9A 1QMFA 1N4OA 1GSXA 1PWDA 1F2KA 1YLYA 2WKPA 1K56A 4UEYA 2W1TB 4ZBEA 4OOYA 2ZM0A 4E04A 2W3DA 2A24B 4H8RA 4Q0JA 2ZC7A 1W63M 3LIBA 5DVAA 4YNRA 4OPZA 1L0DA 3NHQA 2WGWB 4Y0UA 3N6IA 4QY6A 4RYEA 3IQAA 1N9OA 3O88A 3GVBA 3BECA 4ETXA 4MNRA 5CEBA 1TS0A 1TS8A 3BM6A 4LRXC 4PM9A 3SW1A 4CLCC 5DKLA 5CRFA 2O0YA 3T4LA 3S7QA 4EEPA 4OPYA 2I72A 1CF0A 3FYZA 3HREA 3IH9A 4N9LA 5DJTA 3U4LP 3SOIA 1ZHHB 3ZHHA 2A3UA 3B42A 4EQ1A 4Y0TA 2M7UA 4CLCE 2FFYA 5IU1A 4YOFA 4C75A 4EUZA 2IWDA 4EEUA 4WF0A 4N1HA 1W7FA 4DE2A 2P9VB 1NRFA 3UN7A 3F1NB 4IBRA 5HD5A 3MR0A 1WA9A 3F1OA 4JGOA 1YMSA 2VZWA 1PI5A 1CJFA 1D7EA 1G6OA 2BG1A 1SDNA 5HFOA 4EUVA 3C7UA 3C4PA 2Y2QA 3IWOA 4IBXA 4JF4A 1QMEA 2WGVA 3Q07A 1CEGA 2J9PA 4KQDA 3HLBA 1KVMA 2VGLM 3HBRA 5DFXA 4OPQA 3IX4A 4WBGA 4OKPA 3QNBA 1FCMA 3GMWA 3IWQA 3GDIA 4C3QA 4IJGA 4FSFA 4B88A 1HD8A 3G4PA 1FQGA 2O9AA 5HWVA 3BFCA 5FAPA 3OPPA 4S2NC 3CUEC 2QYBA 4XXRA 4Y2FA 2HP5A 3KO6A 5E2GA 4UA7A 2QPNA 3FKVA 3DTIA 1STZA 4F3LA 4WM9A 2L1MA 4YINA 1Z6FA 5L10A 4DJ3A 1YLZA 2XEPA 2PYPA 1NLYA 3VFFA 2ZJ9A 5JYPA 4EBNA 2X01A 2A2LA 3S1YA 2ZQ7A 1Q2QA 4DKIA 1HZOA 1EROA 1LLBA 4OH0A 3IHAA 1YQSA 4QHCA 5E2EA 2WYXA 2VK3A 5GLBA 4HI4A 2PD7A 1ONGA 5A8BA 1PI4A 3HJKA 1NYMA 4G3KA 5HWWA 3C8CA 2V0UA 3VMAA 5HAQA 4PM7A 5EV0A 3R7WA 3UO9A 1GSVA 2IA2A 2K31A 2DMWA 2ZBBA 4LV2A 4HP9A 5EVEA 2ZQ8A 1N9BA 3D9YA 3G30A 2HF6A 2W27A 4N9KA 3MXQA 3M2JA 4QWOA 3LIEA 4IUKA 5LBRA 5CGWA 4BMWA 5CX7A 5KIZA 1DP9A 5L2FA 4M3KA 1MXOA 3VP1A 2HDRA 3WRZA 1PNEA 3BRMA 2V1AA 3OC2A 5M19A 1G6AA 1BUEA 3KSGA 4HIAA 2W3EA 4HH3A 3C4OA 4WYYA 2KX6A 2Y8HA 4MN5A 4Y0OA 1ES2A 3ZVTA 5FA7A 2OWHA 4MCWA 1AXBA 4O8GA 2E8IA 1GHIA 3BYDA 4WEKA 1L0GA 4JKTA 4P87A 5MC7A 3AGDA 1H8ZA 3SZTA 2R78A 3VFHA 3NBLA 4M4XA 4HJ6A 4NK3A 5CGXA 3HCYA 3BY9A 2WKIA 4NXFA 3E2LA 5HX9A 5CHJA 3T1SA 1CI9A 2M7VA 4GHIA 1YLWA 2Q9MA 2Y2LA 1MKMA 4LRYC 4E3IA 1P9WA 4BD0A 5EVIB 3ZNYA 3LI9A 4QD4A 2GDNA 4N1XA 4I3AA 4QU3A 4PM5A 4XT2B 1PW1A 2BASA 1XJ6A 5GLCA 3E98A 4JGQA 3S22A 3ZNTA 1HTZA 1H5XA 3MMHA 2V2FF 1VEUB 3ZG5A 4FD8A 1H3QA 3FKWA 2Y2KA 5M18A 2WKEA 1S4RA 4X1MA 3S4XA 2W3HA 3G2YA 1T19A 3SH9A 4GNUA 2QMIA 4NXGA 5HDSA 4XUZA 2HGVA 3TOIA 1YLPA 5A92A 3RFBA 4WN5A 1PIOA 4ID4A 4WZ5C 3GECA 1SHVA 3VE3A 4FUWA 4EW7A 5EVLA 2Z2LB 4AFIA 1JVJA 3EEAA 4UAAA 4S2NA 3CUEA 1LSWA 4OVDA 1BLCA 5HD3A 1MWRA 2PD8A 5CTMA 1SKFA 2PT7A 4P6BA 4HBUA 2JHEA 1K57C 4FOFA 3MQ0A 2GJ3A 1H0MA 4DDYA 5HAPA 3NI9A 3V39A 3C7VA 3LUQA 4IVIA 1FCNA 5AVFA 2V8CA 2W3FA 3DTEA 2VKSA 1F5MA 1T1AA 2Z2MB 3LGOA 4JBFA 2C6WB 5L8MA 4CLCD 5CXWA 2XA7M 4IUHA 1CQAA 2CC1A 3PBQA 1BLSA 4D2OA 5DTSA 1IYPA 3A0SA 3I7JA 4GOGA 1Q2PA 5J7EA 2VV6A 5K5BA 3HLWA 4LENA 2WKHA 3BFEA 3G32A 5TR7A 2ACGA 4Y13A 3PAGA 4S2OA 1J3WA 1NZOA 3UE0A 4OQ0A 4PHTA 3IXDA 2B02A 1ACFA 5L09A 4E6XA 2GNXA 2OSUA 4BBVA 3C2WA 4F94A 3UDIA 5TBMB 3KYZA 3ZVWA 5F83A 5HDDA 3ZDJA 1ESIA 2ZQ9A 4RVAA 4MBKA 3VV4A 1Y28A 1IYSA 3PHYA 5E2FA 4GB7A 2R9XA 3HUMA 1CI8A 2Y2MA 4R3JA 1LT0A 4GJ4A 1XJ3A 3DAVA 3HLFA 5FQKA 5DJUA 3MZEA 4KZ4A 3UE6A 3WS0A 2XQZA 4X1LA 4BBUA 1KE3A 1WYBA 3V5MA 4BQMA 4LGWA 4G3VA 4Y3IA 4GS9A 4A5RA 1Y4OA 2M1CA 3B33A 1JWPA 2Z6DA 1K55C 3TSGA 3H7WB 3QP5A 3V50A 1L0FA 1X0OA 3SH7A 4LRZE 3QP6A 4GN2A 3HLEA 1TS6A 3SH8A 2FFFB 4OLGA 3OBFA 3EEHA 1ZG4A 1ERMA 4U0TA 1ODVA 4NXBA 1T1BA 2RL3A 4WMCA 4LFUA 3FWLA 2HP9A 5TFQA 1S0WA 2Z6CA 1ES4A 3WRTA 1CEFA 4I5SA 2ZOHA 3NECA 2JKGA 4X68A 4NETA 3T4QA 3F1OB 3MKFA 2W1RA 2EFXA 4CQHA 3BY8A 3O5YA 1BYWA 1XP4A 3H9WA 3M2KA 4IVKA 4B4ZA 2ZL1A 3C30A 2QHKA 3O86A 2J9OA 2IWBA 3KSHA 3VSKA 5CTNA 5E2HA 3F1PB 1XXMA 1FOFA 2Y2HA 4JXWA 3WS5A 2XROA 3G2ZA 4HJ3A 4MBHA 4WZ5A 4KG5A 4S2MA 3GRJA 4QY5A 3WS2A 3BFDA 1TD5A 5G18A 4DRTA 2ZLYA 3LY3A 1YM1A 4GD6A 4R4RA 2VA0A 2EX2A 3IS2A 1OTAA 4PKYG 2XRNA 2OOLA 1M40A 3Q1FA 1K57A 5DTKA 4X6TA 4RX2A 2YKFA 4I3IA 4LCLA 3W4OA 4R23A 5F69A 4JXVA 3QHYA 2ZC3B 4NG2A 3S7OA 5C5KA 4R4SA 4LV1A 4Y7PA 3WS4A 4ETZA 3WWXA 1I2WA 4II7A 4KZ5A 3UE3A 4GCZA 3MKEA 2B18A 2OLVA 2UV0E 3D4FA 2V8FA 2H0TA 2JCHA 1NYYA 5HL1A 3T4KA 4WMCD 4BENA 3BLMA 2MJ6A 3S7NA 4HNBA 5AQAA 3PBOA 2W1TA 1XA7A 1RGZA 3R7WB 3K2NA 2PR6A 2O99A 3PR6A 2A24A 4Q8IA 3FPVA 2P74A 1EWZA 2ZQAA 5DF8A 3G34A 5EPHA 4LV3A 4HH2A 2ZD8A 5G4YA 3U2AA 2XF3A 1OPXA 4KZ8A 4IEDA 2ZC5B 4OQHA 4MBFA 3RJUA 4R70A 4EETB 2VJWA 3L9KA 3IX3A 2XD1A 1CK3A 4NEED 3C5AA 3LYXA 1DRMA 3SS5A 5F68A 3PXPA 4FH2A 1S66L 1JWVA 5F82A 1L3LA 3W4PA 1P0ZA 2PAVP 4ARZA 2WKRA 3A0VA 4KQOA 3V3SA 3P98A 4RA7A 2V0WA 3ZG7B 1NZUA 3Q82A 1K55A 2BTFP 4BLMA 4MN6A 1VM1A 2J80A 3T4TA 3UMEA 3ZG9B 3CLOA 5FI2A 2XR0A 5F1GA 1MWSA 1MY8A 5FQMA 5FAQA 3R4KA 3NY4A 1FSWA 3HVFA 2P9VA 3AGFA 3UB7A 3E4QA 1PZPA 3E2KA 3VSLA 3MSHA 2EXBA 2CMNA 2H28A 4GHIB 3OCNA 1LL9A 4HBTA 2ZQCA 4R6LA 1XGJA 4JF5A 1EI5A 1IYOA 4JXSA 2A49A 3HL9A 1XJ2A 3CJMA 1DJBA 2ZC6B 2ZMFA 1IKIA 3CMZA 2Y2IA 3N8SA 3ZYTA 2Y91A 2PDRA 3BQ8A 3LI8A 5HW3A 1UGUA 1NLZA 4JPMA 4L9EA 4NXEA 4IHQA 4YWZA 3CI6A 4E3NA 2KDKA 3OOVA 2PR5A 3UPPA 5G4ZA 2EWVA 2JBFA 5GHYA 3UDFA 1P9RA 2HDUA 4G3WA 1OTEA 1Y54A 2WAFA 1O7EA 3N8RA 3JVVA 1JWZA 4HJ4A 4H6JB 5GLAA 1SZVA 3LY4A 3LR0A 2JC7A 2GX5A 4KENB 3Q7VB 2OWJA 4CLCA 1YMXA 2EX6A 3N7WA 4JGRA 2JKRI 4K0WA 4S2PA 2B5RA 2INWA 3CG5A 3LIFA 1MWUA 2VV7A 3KSIA 1NY0A 2I9VA 3FV7A 3NDEA 5J3WA 4C6YA 2WZZA 4R1GA 1LHYA 1OTDA 4ZAMA 3ITAA 1DY6A 3EOIA 1ONHA 3IF6B 4UQIS 3OPRA 1BSGA 4ME4A 1L2SA 3O3VA 4MDZA 4HHDA 4EQIA 3T12B 1T1CA 2Y55A 3E4PA 3HUOA 5BOHA 2HJ9C 3NCKA 1PWCA 1W8YA 5HDCA 2ZMVA 4QJGA 1DP8A 3FZCA 1ZG6A 3CPTB 1MKIA 1K25A 2Y2NA 5EM1A 3UE1A 3BFFA 3G6OA 4R3BA 1SKOB 4GZBA 4E3MA 3IHBA 3O87A 1VETB 2J7VA 2QZ6A 3UNWA 3P01A 1W8QA 3MFDA 4JXGA 4UHUA 1KVLA 1OT9A 2HV1A 1BULA 5GHZA 5CHMA 5FQ9A 1IFQA 3A3EA 3TRCA 3KYQA 4FCFA 3MBZA 1MBLA 3MQOA 5AJGA 3N4IA 3OCLA 4GLQA 3WS1A 2J3TC 1E3UA 3A3JA 1PFLA 1GHPA 1LL8A 2VEAA 2Y79A 2VX8A 5FI7A 1E25A 3LO7A 1NWZA 5HAIA 2HPBA 3H82A 3CZDA 1KDWA 1K0KA 3VP0A 4E6WA 3IX8A 2KLIA 2HJEA 4I38A 4LLOB 3IBRA 3JYIA 4BL2A 2IWCA 2K7SA 4KZ7A 1S4SA 1D06A 1V9YA 3T1QB 2BLSA 1GHMA 5FI6A 2G7UA 4PM8A 1WYCA 5DKKA 3LR3A 3B3XA 4ZDXA 5HZHA 4HY8A 1YKDA 5DF9A 1G28A 3DBAA 3QP4A 1YSPA 4XT2A 3QP1A 1H8MA 5A90A 2Y2GA 3NC8A 2ZL1B 4LV0A 4OONA 4P6ZM 1MWTA 2Y2JA 1DJCA 5A93A 5FDHA 1VEUA 3V67A 3IXBA 4R38A 3C38A 2XFSA 4ZRRA 5M1AA 3GSGA 2PBDP 4E3OA 2P7JA 2LB9A 3ULFA 4DDSA 1K6SA 2XLNA 4JF6A 3MXSA 1O07A 3VOLA 3HLGA 3EQUA 3T4SA 1KE4A 3QNCA 5GLDA 1LL5A 2P04A 1TDGA 4ZJ1A 3BWLA 3QP8A 3IS2B 3JVUA 4L0LA 4DE1A 5CHUA 1MPLA 1KGFA 3DWZA 3EQVA 1JNUA 3PBNA 1E3UD 2VGLS 4B9OA 5EUAA 1OMEA 3FC7A 2PBYA 4OOLA 4Y5FA 1XA1A 4RX3A 4OQGA 4L9FA 3LICA 2WGIA 2L4RA 5AQBA 2VV8A 1YLTA 3ITBA 3OPHA 4XUXA 3IWIA 2ZQDA 5J8XA 3UB5P 1L0EA 5KSHA 1XFQA 3PTEA 4EV4A 5FDSA 4GW9A 3EGDC 4YFMA 4OPRA 2P08A 1HVBA 4Y17A 4DE3A 2ZC4B 3GQZA 2W3GA 4MN7A 4WL9A 5E43A 1GA0A 5KZHA 4WUJA 5EFWA 1UWNX 5I5LA 5EVID 5TBMA 1F9IA 4MLLA 1FR6A 5HSQA 2HP6A 5TJJA 3G35A 1OTBA 3DTMA 4X55A 3MZDA 2NUTC 2C5WB 2H5SA 5AVEA 3IT9A 4R0QA 4X53A 3PYPA 3GTCA 5TGFA 3P09A 3IH8A 3FG8A 1MZUA 3VP3A 3JPUA 3GR2A 3MF0A 3T1RA 1A0KA 1G5UA 4F3LB 1N9LA 4WEJA 2D02A 4PAUA 2Q0OA 4Z9QA 2PYRA 3T1XA 1FR1A 4D60A 5FEFA 2VGJA 3UY6A 5HPFA 1LI0A 4UA6A 4ARZB 1SCWA 2RCXA 5EE8A 3H7WA 1YT4A 1NRJA 5DFYA 3A3FA 3MXRA 4KUOA 4P0MA 2G2UA 2OAP1 1OJ5A 1PW8A 1TS7A 1ALQA 2FH5A 4BJPA 3SS4A 5EOEA 1KOUA 4S2KA 3KYEA 2Q9NA 3CAXA 3HJIA 1BLPA 1FSYA 2V9AA 4EXOA 4OP8A 2ZM8A 5EOOA 1XX2A 1JTDA 3BFGA 3M6HA 5F1FA 3LIDA 1U60A 3BEBA 1PYYA 3W4QA 3KSFA 3BJNA 3LEQA 4K91A 3EGXC 3UB9A 3N8LA 1SDEA 1ERQA 4I39A 3VE4A 2VLGA 2ZM2A 4FH4A 4X69A 1DP6A 3DTKA 1P97A 2PU4A 5EM0A 1PZOA 1TF1A 2WGWA 4DJ2A 1FILA 4GDBA 5FL3A 3F1PA 3K3CA 3W8KA 2WADA 4BL3A 4JGPA 1ES5A 1K56D 1K4EA 3DW0A 1T18A 2E8JA 3B47A 2OV5A 1TVFA 4KZBA
chains in the Genus database with same CATH topology
3NHQA 1OTDA 3EOIA 4CLCB 4UQIS 3EWKA 1N9OA 4PHTA 4ME4A 1EW0A 4ETXA 4MDZA 4HHDA 2B02A 2GNXA 1T1CA 1TS0A 3E4PA 4BBVA 3C2WA 5TBMB 2J3TD 1TS8A 2QWSA 2HJ9C 3KYZA 3PBRA 5HDDA 4LRXC 4NKPA 3SW1A 5HDCA 2QKPA 3VV4A 4CLCC 2ZMVA 1DP8A 5DKLA 3F1NA 2O0YA 1Y28A 3T4LA 3PHYA 3S7QA 2D01A 4EEPA 3G6OA 5DJTA 1LT0A 4GJ4A 1XJ3A 1ZHHB 5DJUA 3UE6A 3B42A 3P01A 4BBUA 3LR4A 4EQ1A 1OT9A 2M7UA 3T50A 4CLCE 5IU1A 2HV1A 4L9GA 4G3VA 4YOFA 2YKHA 4Y3IA 4GS9A 2M1CA 4EEUA 3NOUC 4WF0A 3B33A 1IFQA 3KX0X 3TRCA 2Z6DA 3KYQA 3F1NB 4PKYA 5HD5A 3MR0A 3H7WB 3MQOA 1WA9A 3F1OA 4HP4A 4JGOA 5AJGA 3CITA 2VZWA 3OCLA 1S1ZA 1X0OA 4HOIA 4LRZE 4GLQA 2J3TC 3UMDA 3FPWA 1TS6A 1D7EA 3OBFA 1G6OA 3EEHA 4I3JA 3UB8A 1S67L 4EUVA 1LL8A 2KOIA 1ODVA 2VEAA 1T1BA 3LR5A 4NXBA 2Y79A 2Z6CA 2GZAA 2VX8A 4I5SA 2ZOHA 1LSXA 2XA7S 4KQDA 2VGLM 1NWZA 3T4QA 3F1OB 3H82A 5DFXA 2W1RA 3GDIA 2KLIA 4CQHA 4OOMA 3BY8A 2HJEA 3O5YA 4I38A 1BYWA 4IJGA 4FSFA 4LLOB 3IBRA 3MFXA 2K7SA 3H9WA 2O9AA 1S4SA 2O9BA 1D06A 3C30A 2QHKA 5HWVA 1V9YA 3KSHA 3CUEC 2G7UA 2QYBA 4Y2FA 3KO6A 5DKKA 3H82B 3LR3A 4P6ZS 3F1PB 5HZHA 4HY8A 1YKDA 5DF9A 1STZA 4F3LA 2PHYA 5HWTA 2L1MA 1G28A 3DBAA 1YSPA 3E4OA 4XT2A 4DJ3A 3D3OA 2XROA 2PYPA 1H8MA 4HJ3A 1NLYA 4P6ZM 2LB5A 3MQQA 2A2LA 1TD5A 2FZ0A 3PBTA 5F5YA 2VA0A 2J3WA 3V67A 4R38A 3C38A 3IS2A 4ZRRA 2W0NA 2K2NA 1OTAA 4PKYG 2QJ5A 4MMNA 1ZTUA 2P7JA 2XRNA 3RTYA 2LB9A 3IBJA 4EU0A 3ULFA 2OOLA 3VOLA 3TE8A 3EQUA 2EA9A 3CWFA 4HI4A 3T4SA 2PD7A 5A8BA 2V1BA 2YKFA 4I3IA 1IOUA 3HJKA 4B93A 4G3KA 2P04A 5HL6A 5F69A 3A0RA 5HWWA 3E0YA 3S7OA 3BWLA 5C5KA 3C8CA 3D72A 3ICYA 2V0UA 3IS2B 3JVUA 4ETZA 4L0LA 3R7WA 1F98A 3BW6A 1GSVA 4R3AA 2IA2A 2K31A 4II7A 4Q0IA 2DMWA 2ZBBA 3K3DA 3UE3A 3EQVA 1JNUA 3LIAA 4GCZA 3S7PA 2B18A 4HP9A 3PBNA 4H6JA 2JKRM 2VGLS 4B9OA 2HF6A 2W27A 3MXQA 3T4KA 3UB6A 4GS9B 1XJ4A 3LIEA 1YSQA 4IUKA 5LBRA 3FC7A 2MJ6A 3NJAA 4BMWA 3S7NA 4HNBA 4OOLA 1YAXA 5CX7A 2WKQA 4Y5FA 5KIZA 1DP9A 3PBOA 4L9FA 2W1TA 3LICA 3R7WB 2L4RA 3K2NA 2PR6A 1S1YA 2VV8A 2O99A 1W63Q 3PR6A 2L0WA 2V1AA 2A24A 3OC2A 3FPVA 3MJQA 4DN0A 5KSHA 4BWIA 1XFQA 3KSGA 4HIAA 2W3EA 4HH3A 4HH2A 3PBSA 4GW9A 2KX6A 4BBTA 3EGDC 2JKTI 2P08A 2Y8HA 4MN5A 5G4YA 3U2AA 5J4EA 1OPXA 5HPIA 4R70A 2W3GA 4MN7A 4WL9A 4EETB 5IS1A 4K08A 2OWHA 2VJWA 1OT6A 4MCWA 4WUJA 4EESA 5EFWA 1UWNX 3LFVA 2NUPC 5I5LA 4O0PA 4NEED 4O8GA 3LYXA 1DRMA 4WEKA 4WELA 5TBMA 1F9IA 4RQ9A 5F68A 5HSQA 5TJJA 2ZOIA 3PXPA 1OTBA 5MC7A 2JN7A 2R78A 1S66L 2NUTC 4M4XA 5AVEA 4QPRA 4HJ6A 1P0ZA 4ARZA 3HCYA 3BY9A 4NXFA 2WKRA 4LPZA 3A0VA 4KQOA 1N9NA 3TJZC 2QJ7A 2V0WA 3TW8A 2M7VA 4GHIA 3PYPA 4DMZA 1MKMA 4MN6A 4LRYC 2J80A 1MZUA 3FG8A 1P9WA 1MC0A 3OLOA 3T4TA 3UMEA 3CLOA 3MF0A 5IT5A 4EERA 4F3LB 3LI9A 1N9LA 4WEJA 2D02A 4PAUA 4UQIM 4I3AA 3R4KA 2PYRA 4XT2B 4O01A 2BASA 1XJ6A 3E98A 3T4JA 1OJGA 4JGQA 5HPFA 3UB7A 3E4QA 2O9CA 4ARZB 3MMHA 3H7WA 2CMNA 4Z1WA 2H28A 4GHIB 1NRJA 3OCNA 5DFYA 1H3QA 4KUOA 3NOTC 1VHMA 1S4RA 2OAP1 4R6LA 1OJ5A 1TS7A 2W3HA 1T19A 1XJ2A 2FH5A 4Q0HA 4NXGA 5HDSA 4BJPA 2ZMFA 3NOPC 1KOUA 2HGVA 3RFBA 4WN5A 3GECA 3ZYTA 3VE3A 3CAXA 2OAQ1 2PDRA 3HJIA 4EW7A 3BQ8A 3LI8A 1UGUA 2V9AA 4EXOA 1NLZA 2XSSA 4AFIA 1V9ZA 3EEAA 4L9EA 1UWPX 4WLAA 3CUEA 1LSVA 4NXEA 1LSWA 2EWWA 4IHQA 2JKTM 3LIDA 4YWZA 5HD3A 1VB6A 3CI6A 2KDKA 3RH8B 1XFNA 2PD8A 3OOVA 3BQAA 2PT7A 2PR5A 3KSFA 3BJNA 5G4ZA 1GSWA 2EWVA 3EGXC 3UB9A 1P9RA 4G3WA 1OTEA 2JHEA 4FOFA 3MQ0A 2GJ3A 4I39A 3VE4A 3W2ZA 3P7NA 2VLGA 4HQAA 3JVVA 4HJ4A 4H6JB 3T4OA 1DP6A 3LUQA 1P97A 5AVFA 5F6AA 3ZQ5A 2W3FA 1OTIA 2VKSA 3LR0A 1F5MA 4KUKA 1TF1A 2GX5A 4DJ2A 1T1AA 2OWJA 4CLCA 5FL3A 3F1PA 3K3CA 1GSXA 4JGRA 5L8MA 4CLCD 2JKRI 2WKPA 4JGPA 4UEYA 2XA7M 2W1TB 4IUHA 2INWA 4E04A 2W3DA 2A24B 3LIFA 3PBQA 2VV7A 1T18A 3KSIA 4Q0JA 3A0SA 3B47A 1W63M 3LIBA 2I9VA 5J7EA 2VV6A 5J3WA 4YNRA 5K5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K31 A;  4Q0I A;  5DFX A;  4O01 A;  3NHQ A;  3E98 A;  3S7P A;  2B18 A;  2W1R A;  5HPF A;  2O9C A;  2KLI A;  4CQH A;  3O5Y A;  4IJG A;  3MMH A;  3IBR A;  4Z1W A;  4ME4 A;  5DFY A;  4ETX A;  1YSQ A;  4IUK A;  2IA2 A;  4MDZ A;  5LBR A;  2O9A A;  3NOT C;  2O9B A;  1VHM A;  4R6L A;  3S7N A;  3C2W A;  4Y5F A;  3KSH A;  2W3H A;  4Q0H A;  2G7U A;  2W1T A;  2ZMF A;  3NOP C;  2HGV A;  2QYB A;  4LRX C;  3K2N A;  3RFB A;  4Y2F A;  3KO6 A;  2O99 A;  3VV4 A;  2O0Y A;  4DN0 A;  4BWI A;  1YKD A;  3S7Q A;  1STZ A;  3KSG A;  3G6O A;  2XSS A;  2W3E A;  3EEA A;  3DBA A;  1YSP A;  4GW9 A;  2Y8H A;  3D3O A;  2XRO A;  3CI6 A;  5HPI A;  3OOV A;  2LB5 A;  4R70 A;  2M7U A;  3KSF A;  3BJN A;  2W3G A;  4MN7 A;  4G3V A;  4YOF A;  2VJW A;  4MCW A;  4Y3I A;  1TD5 A;  4G3W A;  3LFV A;  3NOU C;  4FOF A;  3MQ0 A;  5I5L A;  4O0P A;  3W2Z A;  4O8G A;  4ZRR A;  3TRC A;  4RQ9 A;  2K2N A;  5HSQ A;  5TJJ A;  4MMN A;  1ZTU A;  2XRN A;  3ZQ5 A;  2LB9 A;  2W3F A;  3IBJ A;  2VKS A;  5AJG A;  1F5M A;  2OOL A;  2VZW A;  1TF1 A;  2GX5 A;  3CIT A;  4EU0 A;  4LRZ E;  4GLQ A;  4QPR A;  3HCY A;  3OBF A;  5L8M A;  2M7V A;  4EUV A;  4DMZ A;  2KOI A;  4G3K A;  2W1T B;  2VEA A;  1MKM A;  4IUH A;  5HL6 A;  2Y79 A;  4LRY C;  4E04 A;  2W3D A;  1MC0 A;  3E0Y A;  3MF0 A;  3S7O A;  3KSI A;  4Q0J A;  5C5K A;  4ETZ A;  4PAU A;  4YNR A;  5K5B A;  3R4K A; 
#chains in the Genus database with same CATH topology
 4DXB A;  4N92 A;  2EX8 A;  4MEZ A;  1I5Q A;  4K0X A;  3ZG8 B;  2JKF A;  4CLC B;  5GHX A;  4P85 A;  3GV9 A;  3EWK A;  1HLU P;  5FAT A;  3OZH A;  4JLF A;  1EW0 A;  4OLD A;  4CJN A;  2J3T D;  3OPL A;  2QWS A;  4CPK A;  5CER A;  3PBR A;  3MS6 A;  4NKP A;  2R9W A;  4FTX A;  1NXY A;  2QKP A;  5FQI A;  5CEC A;  3IF6 C;  2VGK A;  3F1N A;  2V20 A;  2D01 A;  3VOY A;  1XPB A;  5EVI C;  1BLH A;  3LR4 A;  3T50 A;  1YPR A;  4L9G A;  2YKH A;  4HEF A;  4KZ3 A;  3NOU C;  2G2W A;  5AQ9 A;  3LEZ A;  4S2I A;  3KX0 X;  4PKY A;  5FQJ A;  2XFT A;  1IYQ A;  1K54 C;  2PRF A;  4HP4 A;  3CIT A;  1S1Z A;  3VP2 A;  1ESU A;  4HOI A;  5AQ7 A;  2XGN A;  3UMD A;  3FPW A;  4E3L A;  4EWF A;  4I3J A;  3UB8 A;  1ES3 A;  1S67 L;  2J8Y A;  2KOI A;  1PWG A;  5FEG A;  2WUQ A;  3LR5 A;  4E3K A;  2GZA A;  2OLU A;  4E3J A;  1LSX A;  2XA7 S;  5KSC A;  2XK1 A;  3G31 A;  4X25 A;  3HLD A;  3HLC A;  3ZG0 A;  2WK0 A;  1H8Y A;  3HUN A;  2WZX A;  1W5D A;  4ZTK A;  4OOM A;  2X02 A;  3MFX A;  5FQQ A;  5JYO A;  2DCF A;  3ZFZ A;  2O9B A;  4OP5 A;  1KGE A;  2Y4A A;  3M6B A;  4GKU A;  2DRW A;  2HZ5 A;  4DE0 A;  5IHV A;  1BT5 A;  3PAE A;  2Y59 A;  3H82 B;  1TEM A;  4P6Z S;  3VOZ A;  1BTL A;  3VP4 A;  2PHY A;  4B4X A;  5HWT A;  1S6R A;  5DTT A;  1IEM A;  3E4O A;  1I2S A;  2PU2 A;  3D3O A;  3V3R A;  2LB5 A;  5HAR A;  3MQQ A;  3NDG A;  3PBT A;  2FZ0 A;  5F5Y A;  1RCJ A;  2J3W A;  5L07 A;  5FAS A;  1NJ4 A;  2W0N A;  2K2N A;  2QJ5 A;  4MMN A;  1XGI A;  1ZTU A;  4O7D A;  3IBJ A;  3RTY A;  4EU0 A;  1ZKJ A;  3TE8 A;  2EA9 A;  3CWF A;  4PM6 A;  2HDS A;  3UPN A;  2H10 A;  2V1B A;  1YLJ A;  1IOU A;  4B93 A;  4EBP A;  1TDL A;  5HL6 A;  1BZA A;  5I94 A;  3A3I A;  3A0R A;  1K6R A;  3E0Y A;  2HDQ A;  3TG9 A;  3ICY A;  3D72 A;  2EFU A;  1F98 A;  3BW6 A;  4R3A A;  1K38 A;  5A91 A;  4Q0I A;  3K3D A;  3LIA A;  5FAO A;  4U0X A;  3RXW A;  3ISG A;  3S7P A;  2UWX A;  4U3T A;  5U47 A;  4H6J A;  2JKR M;  4EBL A;  3Q81 A;  2DNS A;  3UB6 A;  4GS9 B;  1XJ4 A;  3Q7V A;  1YSQ A;  3Q7Z A;  1KE0 A;  4KZ9 A;  1KDS A;  3NJA A;  5KMW A;  4LCM A;  2JE5 A;  1IKG A;  1YAX A;  4OQI A;  2WKQ A;  1GCE A;  2ZMA A;  4KQQ A;  4WZ4 A;  1S1Y A;  3IF5 A;  1W63 Q;  2L0W A;  4KG2 A;  3MJQ A;  4DN0 A;  4BWI A;  4QB8 A;  4ZJ2 A;  3BLS A;  1C3B A;  3PBS A;  4BBT A;  1Z09 A;  2JKT I;  5J4E A;  3IXH A;  1RGY A;  3ZCZ A;  1PRQ A;  5HPI A;  1WE4 A;  3IF6 A;  3L7H A;  1IEL A;  4GDN A;  1DJA A;  3RXX A;  5IS1 A;  4K08 A;  4EES A;  1OT6 A;  1JTG A;  3LFV A;  5EVI A;  2NUP C;  5CED A;  4O0P A;  3NUL A;  3SS3 A;  2AVX A;  5DF7 A;  4WEL A;  1FCO A;  3UPO A;  4RQ9 A;  4KQR A;  3A3D A;  2ZOI A;  2JN7 A;  4QPR A;  3CPT A;  4LPZ A;  4KZ6 A;  1N9N A;  3TJZ C;  2QJ7 A;  3TW8 A;  1KGG A;  4DMZ A;  1SKO A;  4KG6 A;  1K54 A;  2XH9 A;  4S2L A;  1VET A;  1MC0 A;  3OLO A;  4GD8 A;  4BD1 A;  2Y2O A;  5IT5 A;  4EER A;  4S2J A;  4UQI M;  5FSR A;  4ESP A;  1D1J A;  5EEC A;  4ZJ3 A;  3IXG A;  4X56 A;  4O01 A;  3T4J A;  1OJG A;  4DF6 A;  2O9C A;  3MZF A;  1K4F A;  2H0Y A;  4Z1W A;  1G68 A;  3AGE A;  3UDX A;  1E4D A;  3NOT C;  5CGS A;  1VHM A;  5D3O A;  1AWI A;  2V1Z A;  1J9M A;  4Q0H A;  1M6K A;  2B95 A;  1RP5 A;  2X71 A;  3LCE A;  3NOP C;  3ZGA B;  2XD5 A;  1W79 A;  1ZC2 A;  1VQQ A;  2OAQ 1;  4PPR A;  3CHW P;  2WAE A;  2XSS A;  1V9Z A;  1UWP X;  2EXA A;  2Y2P A;  4WLA A;  1LSV A;  2EWW A;  2JKT M;  1LI9 A;  3NIA A;  1VB6 A;  1FIK A;  3RH8 B;  1XFN A;  2EX9 A;  3BQA A;  4DXC A;  3DWK A;  1GSW A;  3QP2 A;  4UA9 A;  4Y15 A;  2XDM A;  3W2Z A;  1XKZ A;  3P7N A;  4HQA A;  3T4O A;  4HES A;  5GL9 A;  4PMA A;  4KZA A;  5F6A A;  3ZQ5 A;  1OTI A;  4KUK A;  1GA9 A;  1QMF A;  1N4O A;  1GSX A;  1PWD A;  1F2K A;  1YLY A;  2WKP A;  1K56 A;  4UEY A;  2W1T B;  4ZBE A;  4OOY A;  2ZM0 A;  4E04 A;  2W3D A;  2A24 B;  4H8R A;  4Q0J A;  2ZC7 A;  1W63 M;  3LIB A;  5DVA A;  4YNR A;  4OPZ A;  1L0D A;  3NHQ A;  2WGW B;  4Y0U A;  3N6I A;  4QY6 A;  4RYE A;  3IQA A;  1N9O A;  3O88 A;  3GVB A;  3BEC A;  4ETX A;  4MNR A;  5CEB A;  1TS0 A;  1TS8 A;  3BM6 A;  4LRX C;  4PM9 A;  3SW1 A;  4CLC C;  5DKL A;  5CRF A;  2O0Y A;  3T4L A;  3S7Q A;  4EEP A;  4OPY A;  2I72 A;  1CF0 A;  3FYZ A;  3HRE A;  3IH9 A;  4N9L A;  5DJT A;  3U4L P;  3SOI A;  1ZHH B;  3ZHH A;  2A3U A;  3B42 A;  4EQ1 A;  4Y0T A;  2M7U A;  4CLC E;  2FFY A;  5IU1 A;  4YOF A;  4C75 A;  4EUZ A;  2IWD A;  4EEU A;  4WF0 A;  4N1H A;  1W7F A;  4DE2 A;  2P9V B;  1NRF A;  3UN7 A;  3F1N B;  4IBR A;  5HD5 A;  3MR0 A;  1WA9 A;  3F1O A;  4JGO A;  1YMS A;  2VZW A;  1PI5 A;  1CJF A;  1D7E A;  1G6O A;  2BG1 A;  1SDN A;  5HFO A;  4EUV A;  3C7U A;  3C4P A;  2Y2Q A;  3IWO A;  4IBX A;  4JF4 A;  1QME A;  2WGV A;  3Q07 A;  1CEG A;  2J9P A;  4KQD A;  3HLB A;  1KVM A;  2VGL M;  3HBR A;  5DFX A;  4OPQ A;  3IX4 A;  4WBG A;  4OKP A;  3QNB A;  1FCM A;  3GMW A;  3IWQ A;  3GDI A;  4C3Q A;  4IJG A;  4FSF A;  4B88 A;  1HD8 A;  3G4P A;  1FQG A;  2O9A A;  5HWV A;  3BFC A;  5FAP A;  3OPP A;  4S2N C;  3CUE C;  2QYB A;  4XXR A;  4Y2F A;  2HP5 A;  3KO6 A;  5E2G A;  4UA7 A;  2QPN A;  3FKV A;  3DTI A;  1STZ A;  4F3L A;  4WM9 A;  2L1M A;  4YIN A;  1Z6F A;  5L10 A;  4DJ3 A;  1YLZ A;  2XEP A;  2PYP A;  1NLY A;  3VFF A;  2ZJ9 A;  5JYP A;  4EBN A;  2X01 A;  2A2L A;  3S1Y A;  2ZQ7 A;  1Q2Q A;  4DKI A;  1HZO A;  1ERO A;  1LLB A;  4OH0 A;  3IHA A;  1YQS A;  4QHC A;  5E2E A;  2WYX A;  2VK3 A;  5GLB A;  4HI4 A;  2PD7 A;  1ONG A;  5A8B A;  1PI4 A;  3HJK A;  1NYM A;  4G3K A;  5HWW A;  3C8C A;  2V0U A;  3VMA A;  5HAQ A;  4PM7 A;  5EV0 A;  3R7W A;  3UO9 A;  1GSV A;  2IA2 A;  2K31 A;  2DMW A;  2ZBB A;  4LV2 A;  4HP9 A;  5EVE A;  2ZQ8 A;  1N9B A;  3D9Y A;  3G30 A;  2HF6 A;  2W27 A;  4N9K A;  3MXQ A;  3M2J A;  4QWO A;  3LIE A;  4IUK A;  5LBR A;  5CGW A;  4BMW A;  5CX7 A;  5KIZ A;  1DP9 A;  5L2F A;  4M3K A;  1MXO A;  3VP1 A;  2HDR A;  3WRZ A;  1PNE A;  3BRM A;  2V1A A;  3OC2 A;  5M19 A;  1G6A A;  1BUE A;  3KSG A;  4HIA A;  2W3E A;  4HH3 A;  3C4O A;  4WYY A;  2KX6 A;  2Y8H A;  4MN5 A;  4Y0O A;  1ES2 A;  3ZVT A;  5FA7 A;  2OWH A;  4MCW A;  1AXB A;  4O8G A;  2E8I A;  1GHI A;  3BYD A;  4WEK A;  1L0G A;  4JKT A;  4P87 A;  5MC7 A;  3AGD A;  1H8Z A;  3SZT A;  2R78 A;  3VFH A;  3NBL A;  4M4X A;  4HJ6 A;  4NK3 A;  5CGX A;  3HCY A;  3BY9 A;  2WKI A;  4NXF A;  3E2L A;  5HX9 A;  5CHJ A;  3T1S A;  1CI9 A;  2M7V A;  4GHI A;  1YLW A;  2Q9M A;  2Y2L A;  1MKM A;  4LRY C;  4E3I A;  1P9W A;  4BD0 A;  5EVI B;  3ZNY A;  3LI9 A;  4QD4 A;  2GDN A;  4N1X A;  4I3A A;  4QU3 A;  4PM5 A;  4XT2 B;  1PW1 A;  2BAS A;  1XJ6 A;  5GLC A;  3E98 A;  4JGQ A;  3S22 A;  3ZNT A;  1HTZ A;  1H5X A;  3MMH A;  2V2F F;  1VEU B;  3ZG5 A;  4FD8 A;  1H3Q A;  3FKW A;  2Y2K A;  5M18 A;  2WKE A;  1S4R A;  4X1M A;  3S4X A;  2W3H A;  3G2Y A;  1T19 A;  3SH9 A;  4GNU A;  2QMI A;  4NXG A;  5HDS A;  4XUZ A;  2HGV A;  3TOI A;  1YLP A;  5A92 A;  3RFB A;  4WN5 A;  1PIO A;  4ID4 A;  4WZ5 C;  3GEC A;  1SHV A;  3VE3 A;  4FUW A;  4EW7 A;  5EVL A;  2Z2L B;  4AFI A;  1JVJ A;  3EEA A;  4UAA A;  4S2N A;  3CUE A;  1LSW A;  4OVD A;  1BLC A;  5HD3 A;  1MWR A;  2PD8 A;  5CTM A;  1SKF A;  2PT7 A;  4P6B A;  4HBU A;  2JHE A;  1K57 C;  4FOF A;  3MQ0 A;  2GJ3 A;  1H0M A;  4DDY A;  5HAP A;  3NI9 A;  3V39 A;  3C7V A;  3LUQ A;  4IVI A;  1FCN A;  5AVF A;  2V8C A;  2W3F A;  3DTE A;  2VKS A;  1F5M A;  1T1A A;  2Z2M B;  3LGO A;  4JBF A;  2C6W B;  5L8M A;  4CLC D;  5CXW A;  2XA7 M;  4IUH A;  1CQA A;  2CC1 A;  3PBQ A;  1BLS A;  4D2O A;  5DTS A;  1IYP A;  3A0S A;  3I7J A;  4GOG A;  1Q2P A;  5J7E A;  2VV6 A;  5K5B A;  3HLW A;  4LEN A;  2WKH A;  3BFE A;  3G32 A;  5TR7 A;  2ACG A;  4Y13 A;  3PAG A;  4S2O A;  1J3W A;  1NZO A;  3UE0 A;  4OQ0 A;  4PHT A;  3IXD A;  2B02 A;  1ACF A;  5L09 A;  4E6X A;  2GNX A;  2OSU A;  4BBV A;  3C2W A;  4F94 A;  3UDI A;  5TBM B;  3KYZ A;  3ZVW A;  5F83 A;  5HDD A;  3ZDJ A;  1ESI A;  2ZQ9 A;  4RVA A;  4MBK A;  3VV4 A;  1Y28 A;  1IYS A;  3PHY A;  5E2F A;  4GB7 A;  2R9X A;  3HUM A;  1CI8 A;  2Y2M A;  4R3J A;  1LT0 A;  4GJ4 A;  1XJ3 A;  3DAV A;  3HLF A;  5FQK A;  5DJU A;  3MZE A;  4KZ4 A;  3UE6 A;  3WS0 A;  2XQZ A;  4X1L A;  4BBU A;  1KE3 A;  1WYB A;  3V5M A;  4BQM A;  4LGW A;  4G3V A;  4Y3I A;  4GS9 A;  4A5R A;  1Y4O A;  2M1C A;  3B33 A;  1JWP A;  2Z6D A;  1K55 C;  3TSG A;  3H7W B;  3QP5 A;  3V50 A;  1L0F A;  1X0O A;  3SH7 A;  4LRZ E;  3QP6 A;  4GN2 A;  3HLE A;  1TS6 A;  3SH8 A;  2FFF B;  4OLG A;  3OBF A;  3EEH A;  1ZG4 A;  1ERM A;  4U0T A;  1ODV A;  4NXB A;  1T1B A;  2RL3 A;  4WMC A;  4LFU A;  3FWL A;  2HP9 A;  5TFQ A;  1S0W A;  2Z6C A;  1ES4 A;  3WRT A;  1CEF A;  4I5S A;  2ZOH A;  3NEC A;  2JKG A;  4X68 A;  4NET A;  3T4Q A;  3F1O B;  3MKF A;  2W1R A;  2EFX A;  4CQH A;  3BY8 A;  3O5Y A;  1BYW A;  1XP4 A;  3H9W A;  3M2K A;  4IVK A;  4B4Z A;  2ZL1 A;  3C30 A;  2QHK A;  3O86 A;  2J9O A;  2IWB A;  3KSH A;  3VSK A;  5CTN A;  5E2H A;  3F1P B;  1XXM A;  1FOF A;  2Y2H A;  4JXW A;  3WS5 A;  2XRO A;  3G2Z A;  4HJ3 A;  4MBH A;  4WZ5 A;  4KG5 A;  4S2M A;  3GRJ A;  4QY5 A;  3WS2 A;  3BFD A;  1TD5 A;  5G18 A;  4DRT A;  2ZLY A;  3LY3 A;  1YM1 A;  4GD6 A;  4R4R A;  2VA0 A;  2EX2 A;  3IS2 A;  1OTA A;  4PKY G;  2XRN A;  2OOL A;  1M40 A;  3Q1F A;  1K57 A;  5DTK A;  4X6T A;  4RX2 A;  2YKF A;  4I3I A;  4LCL A;  3W4O A;  4R23 A;  5F69 A;  4JXV A;  3QHY A;  2ZC3 B;  4NG2 A;  3S7O A;  5C5K A;  4R4S A;  4LV1 A;  4Y7P A;  3WS4 A;  4ETZ A;  3WWX A;  1I2W A;  4II7 A;  4KZ5 A;  3UE3 A;  4GCZ A;  3MKE A;  2B18 A;  2OLV A;  2UV0 E;  3D4F A;  2V8F A;  2H0T A;  2JCH A;  1NYY A;  5HL1 A;  3T4K A;  4WMC D;  4BEN A;  3BLM A;  2MJ6 A;  3S7N A;  4HNB A;  5AQA A;  3PBO A;  2W1T A;  1XA7 A;  1RGZ A;  3R7W B;  3K2N A;  2PR6 A;  2O99 A;  3PR6 A;  2A24 A;  4Q8I A;  3FPV A;  2P74 A;  1EWZ A;  2ZQA A;  5DF8 A;  3G34 A;  5EPH A;  4LV3 A;  4HH2 A;  2ZD8 A;  5G4Y A;  3U2A A;  2XF3 A;  1OPX A;  4KZ8 A;  4IED A;  2ZC5 B;  4OQH A;  4MBF A;  3RJU A;  4R70 A;  4EET B;  2VJW A;  3L9K A;  3IX3 A;  2XD1 A;  1CK3 A;  4NEE D;  3C5A A;  3LYX A;  1DRM A;  3SS5 A;  5F68 A;  3PXP A;  4FH2 A;  1S66 L;  1JWV A;  5F82 A;  1L3L A;  3W4P A;  1P0Z A;  2PAV P;  4ARZ A;  2WKR A;  3A0V A;  4KQO A;  3V3S A;  3P98 A;  4RA7 A;  2V0W A;  3ZG7 B;  1NZU A;  3Q82 A;  1K55 A;  2BTF P;  4BLM A;  4MN6 A;  1VM1 A;  2J80 A;  3T4T A;  3UME A;  3ZG9 B;  3CLO A;  5FI2 A;  2XR0 A;  5F1G A;  1MWS A;  1MY8 A;  5FQM A;  5FAQ A;  3R4K A;  3NY4 A;  1FSW A;  3HVF A;  2P9V A;  3AGF A;  3UB7 A;  3E4Q A;  1PZP A;  3E2K A;  3VSL A;  3MSH A;  2EXB A;  2CMN A;  2H28 A;  4GHI B;  3OCN A;  1LL9 A;  4HBT A;  2ZQC A;  4R6L A;  1XGJ A;  4JF5 A;  1EI5 A;  1IYO A;  4JXS A;  2A49 A;  3HL9 A;  1XJ2 A;  3CJM A;  1DJB A;  2ZC6 B;  2ZMF A;  1IKI A;  3CMZ A;  2Y2I A;  3N8S A;  3ZYT A;  2Y91 A;  2PDR A;  3BQ8 A;  3LI8 A;  5HW3 A;  1UGU A;  1NLZ A;  4JPM A;  4L9E A;  4NXE A;  4IHQ A;  4YWZ A;  3CI6 A;  4E3N A;  2KDK A;  3OOV A;  2PR5 A;  3UPP A;  5G4Z A;  2EWV A;  2JBF A;  5GHY A;  3UDF A;  1P9R A;  2HDU A;  4G3W A;  1OTE A;  1Y54 A;  2WAF A;  1O7E A;  3N8R A;  3JVV A;  1JWZ A;  4HJ4 A;  4H6J B;  5GLA A;  1SZV A;  3LY4 A;  3LR0 A;  2JC7 A;  2GX5 A;  4KEN B;  3Q7V B;  2OWJ A;  4CLC A;  1YMX A;  2EX6 A;  3N7W A;  4JGR A;  2JKR I;  4K0W A;  4S2P A;  2B5R A;  2INW A;  3CG5 A;  3LIF A;  1MWU A;  2VV7 A;  3KSI A;  1NY0 A;  2I9V A;  3FV7 A;  3NDE A;  5J3W A;  4C6Y A;  2WZZ A;  4R1G A;  1LHY A;  1OTD A;  4ZAM A;  3ITA A;  1DY6 A;  3EOI A;  1ONH A;  3IF6 B;  4UQI S;  3OPR A;  1BSG A;  4ME4 A;  1L2S A;  3O3V A;  4MDZ A;  4HHD A;  4EQI A;  3T12 B;  1T1C A;  2Y55 A;  3E4P A;  3HUO A;  5BOH A;  2HJ9 C;  3NCK A;  1PWC A;  1W8Y A;  5HDC A;  2ZMV A;  4QJG A;  1DP8 A;  3FZC A;  1ZG6 A;  3CPT B;  1MKI A;  1K25 A;  2Y2N A;  5EM1 A;  3UE1 A;  3BFF A;  3G6O A;  4R3B A;  1SKO B;  4GZB A;  4E3M A;  3IHB A;  3O87 A;  1VET B;  2J7V A;  2QZ6 A;  3UNW A;  3P01 A;  1W8Q A;  3MFD A;  4JXG A;  4UHU A;  1KVL A;  1OT9 A;  2HV1 A;  1BUL A;  5GHZ A;  5CHM A;  5FQ9 A;  1IFQ A;  3A3E A;  3TRC A;  3KYQ A;  4FCF A;  3MBZ A;  1MBL A;  3MQO A;  5AJG A;  3N4I A;  3OCL A;  4GLQ A;  3WS1 A;  2J3T C;  1E3U A;  3A3J A;  1PFL A;  1GHP A;  1LL8 A;  2VEA A;  2Y79 A;  2VX8 A;  5FI7 A;  1E25 A;  3LO7 A;  1NWZ A;  5HAI A;  2HPB A;  3H82 A;  3CZD A;  1KDW A;  1K0K A;  3VP0 A;  4E6W A;  3IX8 A;  2KLI A;  2HJE A;  4I38 A;  4LLO B;  3IBR A;  3JYI A;  4BL2 A;  2IWC A;  2K7S A;  4KZ7 A;  1S4S A;  1D06 A;  1V9Y A;  3T1Q B;  2BLS A;  1GHM A;  5FI6 A;  2G7U A;  4PM8 A;  1WYC A;  5DKK A;  3LR3 A;  3B3X A;  4ZDX A;  5HZH A;  4HY8 A;  1YKD A;  5DF9 A;  1G28 A;  3DBA A;  3QP4 A;  1YSP A;  4XT2 A;  3QP1 A;  1H8M A;  5A90 A;  2Y2G A;  3NC8 A;  2ZL1 B;  4LV0 A;  4OON A;  4P6Z M;  1MWT A;  2Y2J A;  1DJC A;  5A93 A;  5FDH A;  1VEU A;  3V67 A;  3IXB A;  4R38 A;  3C38 A;  2XFS A;  4ZRR A;  5M1A A;  3GSG A;  2PBD P;  4E3O A;  2P7J A;  2LB9 A;  3ULF A;  4DDS A;  1K6S A;  2XLN A;  4JF6 A;  3MXS A;  1O07 A;  3VOL A;  3HLG A;  3EQU A;  3T4S A;  1KE4 A;  3QNC A;  5GLD A;  1LL5 A;  2P04 A;  1TDG A;  4ZJ1 A;  3BWL A;  3QP8 A;  3IS2 B;  3JVU A;  4L0L A;  4DE1 A;  5CHU A;  1MPL A;  1KGF A;  3DWZ A;  3EQV A;  1JNU A;  3PBN A;  1E3U D;  2VGL S;  4B9O A;  5EUA A;  1OME A;  3FC7 A;  2PBY A;  4OOL A;  4Y5F A;  1XA1 A;  4RX3 A;  4OQG A;  4L9F A;  3LIC A;  2WGI A;  2L4R A;  5AQB A;  2VV8 A;  1YLT A;  3ITB A;  3OPH A;  4XUX A;  3IWI A;  2ZQD A;  5J8X A;  3UB5 P;  1L0E A;  5KSH A;  1XFQ A;  3PTE A;  4EV4 A;  5FDS A;  4GW9 A;  3EGD C;  4YFM A;  4OPR A;  2P08 A;  1HVB A;  4Y17 A;  4DE3 A;  2ZC4 B;  3GQZ A;  2W3G A;  4MN7 A;  4WL9 A;  5E43 A;  1GA0 A;  5KZH A;  4WUJ A;  5EFW A;  1UWN X;  5I5L A;  5EVI D;  5TBM A;  1F9I A;  4MLL A;  1FR6 A;  5HSQ A;  2HP6 A;  5TJJ A;  3G35 A;  1OTB A;  3DTM A;  4X55 A;  3MZD A;  2NUT C;  2C5W B;  2H5S A;  5AVE A;  3IT9 A;  4R0Q A;  4X53 A;  3PYP A;  3GTC A;  5TGF A;  3P09 A;  3IH8 A;  3FG8 A;  1MZU A;  3VP3 A;  3JPU A;  3GR2 A;  3MF0 A;  3T1R A;  1A0K A;  1G5U A;  4F3L B;  1N9L A;  4WEJ A;  2D02 A;  4PAU A;  2Q0O A;  4Z9Q A;  2PYR A;  3T1X A;  1FR1 A;  4D60 A;  5FEF A;  2VGJ A;  3UY6 A;  5HPF A;  1LI0 A;  4UA6 A;  4ARZ B;  1SCW A;  2RCX A;  5EE8 A;  3H7W A;  1YT4 A;  1NRJ A;  5DFY A;  3A3F A;  3MXR A;  4KUO A;  4P0M A;  2G2U A;  2OAP 1;  1OJ5 A;  1PW8 A;  1TS7 A;  1ALQ A;  2FH5 A;  4BJP A;  3SS4 A;  5EOE A;  1KOU A;  4S2K A;  3KYE A;  2Q9N A;  3CAX A;  3HJI A;  1BLP A;  1FSY A;  2V9A A;  4EXO A;  4OP8 A;  2ZM8 A;  5EOO A;  1XX2 A;  1JTD A;  3BFG A;  3M6H A;  5F1F A;  3LID A;  1U60 A;  3BEB A;  1PYY A;  3W4Q A;  3KSF A;  3BJN A;  3LEQ A;  4K91 A;  3EGX C;  3UB9 A;  3N8L A;  1SDE A;  1ERQ A;  4I39 A;  3VE4 A;  2VLG A;  2ZM2 A;  4FH4 A;  4X69 A;  1DP6 A;  3DTK A;  1P97 A;  2PU4 A;  5EM0 A;  1PZO A;  1TF1 A;  2WGW A;  4DJ2 A;  1FIL A;  4GDB A;  5FL3 A;  3F1P A;  3K3C A;  3W8K A;  2WAD A;  4BL3 A;  4JGP A;  1ES5 A;  1K56 D;  1K4E A;  3DW0 A;  1T18 A;  2E8J A;  3B47 A;  2OV5 A;  1TVF A;  4KZB A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  1OTD A;  3EOI A;  4CLC B;  4UQI S;  3EWK A;  1N9O A;  4PHT A;  4ME4 A;  1EW0 A;  4ETX A;  4MDZ A;  4HHD A;  2B02 A;  2GNX A;  1T1C A;  1TS0 A;  3E4P A;  4BBV A;  3C2W A;  5TBM B;  2J3T D;  1TS8 A;  2QWS A;  2HJ9 C;  3KYZ A;  3PBR A;  5HDD A;  4LRX C;  4NKP A;  3SW1 A;  5HDC A;  2QKP A;  3VV4 A;  4CLC C;  2ZMV A;  1DP8 A;  5DKL A;  3F1N A;  2O0Y A;  1Y28 A;  3T4L A;  3PHY A;  3S7Q A;  2D01 A;  4EEP A;  3G6O A;  5DJT A;  1LT0 A;  4GJ4 A;  1XJ3 A;  1ZHH B;  5DJU A;  3UE6 A;  3B42 A;  3P01 A;  4BBU A;  3LR4 A;  4EQ1 A;  1OT9 A;  2M7U A;  3T50 A;  4CLC E;  5IU1 A;  2HV1 A;  4L9G A;  4G3V A;  4YOF A;  2YKH A;  4Y3I A;  4GS9 A;  2M1C A;  4EEU A;  3NOU C;  4WF0 A;  3B33 A;  1IFQ A;  3KX0 X;  3TRC A;  2Z6D A;  3KYQ A;  3F1N B;  4PKY A;  5HD5 A;  3MR0 A;  3H7W B;  3MQO A;  1WA9 A;  3F1O A;  4HP4 A;  4JGO A;  5AJG A;  3CIT A;  2VZW A;  3OCL A;  1S1Z A;  1X0O A;  4HOI A;  4LRZ E;  4GLQ A;  2J3T C;  3UMD A;  3FPW A;  1TS6 A;  1D7E A;  3OBF A;  1G6O A;  3EEH A;  4I3J A;  3UB8 A;  1S67 L;  4EUV A;  1LL8 A;  2KOI A;  1ODV A;  2VEA A;  1T1B A;  3LR5 A;  4NXB A;  2Y79 A;  2Z6C A;  2GZA A;  2VX8 A;  4I5S A;  2ZOH A;  1LSX A;  2XA7 S;  4KQD A;  2VGL M;  1NWZ A;  3T4Q A;  3F1O B;  3H82 A;  5DFX A;  2W1R A;  3GDI A;  2KLI A;  4CQH A;  4OOM A;  3BY8 A;  2HJE A;  3O5Y A;  4I38 A;  1BYW A;  4IJG A;  4FSF A;  4LLO B;  3IBR A;  3MFX A;  2K7S A;  3H9W A;  2O9A A;  1S4S A;  2O9B A;  1D06 A;  3C30 A;  2QHK A;  5HWV A;  1V9Y A;  3KSH A;  3CUE C;  2G7U A;  2QYB A;  4Y2F A;  3KO6 A;  5DKK A;  3H82 B;  3LR3 A;  4P6Z S;  3F1P B;  5HZH A;  4HY8 A;  1YKD A;  5DF9 A;  1STZ A;  4F3L A;  2PHY A;  5HWT A;  2L1M A;  1G28 A;  3DBA A;  1YSP A;  3E4O A;  4XT2 A;  4DJ3 A;  3D3O A;  2XRO A;  2PYP A;  1H8M A;  4HJ3 A;  1NLY A;  4P6Z M;  2LB5 A;  3MQQ A;  2A2L A;  1TD5 A;  2FZ0 A;  3PBT A;  5F5Y A;  2VA0 A;  2J3W A;  3V67 A;  4R38 A;  3C38 A;  3IS2 A;  4ZRR A;  2W0N A;  2K2N A;  1OTA A;  4PKY G;  2QJ5 A;  4MMN A;  1ZTU A;  2P7J A;  2XRN A;  3RTY A;  2LB9 A;  3IBJ A;  4EU0 A;  3ULF A;  2OOL A;  3VOL A;  3TE8 A;  3EQU A;  2EA9 A;  3CWF A;  4HI4 A;  3T4S A;  2PD7 A;  5A8B A;  2V1B A;  2YKF A;  4I3I A;  1IOU A;  3HJK A;  4B93 A;  4G3K A;  2P04 A;  5HL6 A;  5F69 A;  3A0R A;  5HWW A;  3E0Y A;  3S7O A;  3BWL A;  5C5K A;  3C8C A;  3D72 A;  3ICY A;  2V0U A;  3IS2 B;  3JVU A;  4ETZ A;  4L0L A;  3R7W A;  1F98 A;  3BW6 A;  1GSV A;  4R3A A;  2IA2 A;  2K31 A;  4II7 A;  4Q0I A;  2DMW A;  2ZBB A;  3K3D A;  3UE3 A;  3EQV A;  1JNU A;  3LIA A;  4GCZ A;  3S7P A;  2B18 A;  4HP9 A;  3PBN A;  4H6J A;  2JKR M;  2VGL S;  4B9O A;  2HF6 A;  2W27 A;  3MXQ A;  3T4K A;  3UB6 A;  4GS9 B;  1XJ4 A;  3LIE A;  1YSQ A;  4IUK A;  5LBR A;  3FC7 A;  2MJ6 A;  3NJA A;  4BMW A;  3S7N A;  4HNB A;  4OOL A;  1YAX A;  5CX7 A;  2WKQ A;  4Y5F A;  5KIZ A;  1DP9 A;  3PBO A;  4L9F A;  2W1T A;  3LIC A;  3R7W B;  2L4R A;  3K2N A;  2PR6 A;  1S1Y A;  2VV8 A;  2O99 A;  1W63 Q;  3PR6 A;  2L0W A;  2V1A A;  2A24 A;  3OC2 A;  3FPV A;  3MJQ A;  4DN0 A;  5KSH A;  4BWI A;  1XFQ A;  3KSG A;  4HIA A;  2W3E A;  4HH3 A;  4HH2 A;  3PBS A;  4GW9 A;  2KX6 A;  4BBT A;  3EGD C;  2JKT I;  2P08 A;  2Y8H A;  4MN5 A;  5G4Y A;  3U2A A;  5J4E A;  1OPX A;  5HPI A;  4R70 A;  2W3G A;  4MN7 A;  4WL9 A;  4EET B;  5IS1 A;  4K08 A;  2OWH A;  2VJW A;  1OT6 A;  4MCW A;  4WUJ A;  4EES A;  5EFW A;  1UWN X;  3LFV A;  2NUP C;  5I5L A;  4O0P A;  4NEE D;  4O8G A;  3LYX A;  1DRM A;  4WEK A;  4WEL A;  5TBM A;  1F9I A;  4RQ9 A;  5F68 A;  5HSQ A;  5TJJ A;  2ZOI A;  3PXP A;  1OTB A;  5MC7 A;  2JN7 A;  2R78 A;  1S66 L;  2NUT C;  4M4X A;  5AVE A;  4QPR A;  4HJ6 A;  1P0Z A;  4ARZ A;  3HCY A;  3BY9 A;  4NXF A;  2WKR A;  4LPZ A;  3A0V A;  4KQO A;  1N9N A;  3TJZ C;  2QJ7 A;  2V0W A;  3TW8 A;  2M7V A;  4GHI A;  3PYP A;  4DMZ A;  1MKM A;  4MN6 A;  4LRY C;  2J80 A;  1MZU A;  3FG8 A;  1P9W A;  1MC0 A;  3OLO A;  3T4T A;  3UME A;  3CLO A;  3MF0 A;  5IT5 A;  4EER A;  4F3L B;  3LI9 A;  1N9L A;  4WEJ A;  2D02 A;  4PAU A;  4UQI M;  4I3A A;  3R4K A;  2PYR A;  4XT2 B;  4O01 A;  2BAS A;  1XJ6 A;  3E98 A;  3T4J A;  1OJG A;  4JGQ A;  5HPF A;  3UB7 A;  3E4Q A;  2O9C A;  4ARZ B;  3MMH A;  3H7W A;  2CMN A;  4Z1W A;  2H28 A;  4GHI B;  1NRJ A;  3OCN A;  5DFY A;  1H3Q A;  4KUO A;  3NOT C;  1VHM A;  1S4R A;  2OAP 1;  4R6L A;  1OJ5 A;  1TS7 A;  2W3H A;  1T19 A;  1XJ2 A;  2FH5 A;  4Q0H A;  4NXG A;  5HDS A;  4BJP A;  2ZMF A;  3NOP C;  1KOU A;  2HGV A;  3RFB A;  4WN5 A;  3GEC A;  3ZYT A;  3VE3 A;  3CAX A;  2OAQ 1;  2PDR A;  3HJI A;  4EW7 A;  3BQ8 A;  3LI8 A;  1UGU A;  2V9A A;  4EXO A;  1NLZ A;  2XSS A;  4AFI A;  1V9Z A;  3EEA A;  4L9E A;  1UWP X;  4WLA A;  3CUE A;  1LSV A;  4NXE A;  1LSW A;  2EWW A;  4IHQ A;  2JKT M;  3LID A;  4YWZ A;  5HD3 A;  1VB6 A;  3CI6 A;  2KDK A;  3RH8 B;  1XFN A;  2PD8 A;  3OOV A;  3BQA A;  2PT7 A;  2PR5 A;  3KSF A;  3BJN A;  5G4Z A;  1GSW A;  2EWV A;  3EGX C;  3UB9 A;  1P9R A;  4G3W A;  1OTE A;  2JHE A;  4FOF A;  3MQ0 A;  2GJ3 A;  4I39 A;  3VE4 A;  3W2Z A;  3P7N A;  2VLG A;  4HQA A;  3JVV A;  4HJ4 A;  4H6J B;  3T4O A;  1DP6 A;  3LUQ A;  1P97 A;  5AVF A;  5F6A A;  3ZQ5 A;  2W3F A;  1OTI A;  2VKS A;  3LR0 A;  1F5M A;  4KUK A;  1TF1 A;  2GX5 A;  4DJ2 A;  1T1A A;  2OWJ A;  4CLC A;  5FL3 A;  3F1P A;  3K3C A;  1GSX A;  4JGR A;  5L8M A;  4CLC D;  2JKR I;  2WKP A;  4JGP A;  4UEY A;  2XA7 M;  2W1T B;  4IUH A;  2INW A;  4E04 A;  2W3D A;  2A24 B;  3LIF A;  3PBQ A;  2VV7 A;  1T18 A;  3KSI A;  4Q0J A;  3A0S A;  3B47 A;  1W63 M;  3LIB A;  2I9V A;  5J7E A;  2VV6 A;  5J3W A;  4YNR A;  5K5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...