2B18A

N-terminal gaf domain of transcriptional pleiotropic repressor cody.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
total genus 48
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b18A00
2W3DA 2W1TB 3OOVA 3MMHA 4Q0JA 3S7NA 4R70A 5HPIA 3HCYA 4IUHA 3E98A 1TF1A 3IBRA 2LB5A 5C5KA 2O0YA 3K2NA 3E0YA 5K5BA 4MMNA 1TD5A 3S7QA 4O0PA 4G3WA 5DFXA 2O99A 4Z1WA 4LRYC 3KSHA 4DMZA 3NOTC 2VKSA 4GLQA 4RQ9A 3S7OA 4Y3IA 4Q0HA 2VZWA 2W1TA 4O8GA 1F5MA 4QPRA 2Y8HA 3DBAA 3S7PA 2O9AA 4MN7A 4IJGA 4LRXC 4IUKA 5HSQA 4Y5FA 3IBJA 3D3OA 4ETXA 2W3FA 4MDZA 4YNRA 3OBFA 3KSFA 2W3EA 2VJWA 4MCWA 4CQHA 1YSPA 4GW9A 3EEAA 2M7VA 1STZA 3BJNA 3NOPC 3TRCA 4R6LA 5I5LA 2XROA 3MF0A 2B18A 3NHQA 2Y79A 2IA2A 3ZQ5A 3MQ0A 4YOFA 4G3KA 3LFVA 2VEAA 4Q0IA 2KLIA 3KO6A 2W3HA 2M7UA 5L8MA 5HL6A 4LRZE 4ETZA 5DFYA 2W3GA 2OOLA 4FOFA 2QYBA 2G7UA 1VHMA 4EUVA 2HGVA 5AJGA 1ZTUA 3O5YA 2K31A 3KSGA 4G3VA 3W2ZA 2O9CA 2KOIA 2GX5A 3G6OA 4DN0A 4Y2FA 3CI6A 3RFBA 3VV4A 2XSSA 2K2NA 4ME4A 4E04A 2ZMFA 2LB9A 3NOUC 4BWIA 2XRNA 4O01A 1YSQA 4PAUA 4ZRRA 2O9BA 4EU0A 3CITA 3R4KA 1MKMA 1MC0A 3KSIA 5LBRA 5HPFA 5TJJA 1YKDA 2W1RA 3C2WA
chains in the Genus database with same CATH superfamily
2C6WB 2EX6A 4NXBA 5FQMA 4HBTA 4WZ5C 5M19A 1GA9A 3P01A 1J3WA 4EV4A 2KX6A 3UDIA 1SDEA 2WGIA 2ZM0A 1G68A 1XP4A 3Q07A 1V9ZA 1YLPA 2G2UA 3V5MA 2VKSA 4OLGA 1IYOA 4S2PA 2KDKA 2WGVA 4O8GA 1E25A 1PWDA 4OONA 1HZOA 5IU1A 4GS9B 3CMZA 3LY3A 4D60A 1K38A 5DTSA 2L1MA 5D3OA 3ZHHA 4DKIA 1PFLA 1MWTA 2ZC6B 1S1ZA 3VP4A 3NY4A 4KZ7A 1LSVA 3IF6B 3T4JA 1UWNX 1OMEA 3MF0A 2WGWB 5EVLA 2Z2MB 2XA7S 3ZQ5A 3ZG0A 5IS1A 3B42A 4GS9A 4ESPA 3QP5A 3PBRA 4B9OA 3S22A 1XPBA 4DE0A 3QNBA 4EXOA 3IWOA 1SCWA 4P87A 3MKFA 5BOHA 3LR3A 3C8CA 1L0FA 4B4ZA 3VP0A 3O86A 1HD8A 4DN0A 4PM5A 3PTEA 4OLDA 3MBZA 1NXYA 1X0OA 2QKPA 4WZ4A 4MBHA 2EX2A 5F5YA 2DRWA 1YT4A 3P7NA 2W3DA 3OPLA 1FSWA 1L0DA 2H28A 4EQIA 3PHYA 3S1YA 4HY8A 3MZFA 3VSLA 1OJ5A 3MSHA 3Q7VB 4LV3A 3HJKA 3DWZA 4LV2A 1EROA 2PHYA 2PYPA 4OPZA 3WWXA 1GHIA 5M1AA 4F3LA 4DE2A 3FKWA 3G31A 3F1PB 3T4OA 3MZDA 3DAVA 2HZ5A 3AGEA 1ZHHB 3CZDA 3HBRA 1FCNA 5DF7A 2X02A 5EFWA 3SW1A 3HLFA 4QD4A 3AGFA 3Q7ZA 4Z9QA 5A90A 3ZG5A 3C30A 4GDBA 1DJAA 2Y2HA 3PBQA 1ES5A 5IT5A 3DW0A 1HLUP 1K54C 5FI7A 4S2LA 1VEUB 4D2OA 1ZKJA 3LIEA 5JYOA 3BY9A 2M7UA 2OLVA 4WELA 3LIFA 2UV0E 1VETB 3OLOA 4WMCA 5AJGA 4Y0UA 4HEFA 3HUMA 4HIAA 1T1CA 1FR1A 2I9VA 2XSSA 3WS5A 5FI6A 2PBYA 3VE3A 4DRTA 2IWDA 4MNRA 1UGUA 2CC1A 4HP4A 1DP6A 3SS4A 5F68A 2ZLYA 3IT9A 3A3EA 1YAXA 2ZL1B 3RJUA 4R4SA 2B95A 1KGGA 3BRMA 3S7NA 5HPIA 4ID4A 4EETB 3M6HA 3BLSA 3EOIA 5KMWA 2WYXA 5FQKA 3G32A 5FDSA 3KSHA 1YMXA 3R7WA 4KZ4A 1A0KA 3E2KA 3DBAA 1KOUA 1C3BA 5HSQA 1BULA 3OBFA 1S66L 3MKEA 1YMSA 2V8CA 3JVUA 4KZ6A 4X56A 4BBTA 3T4LA 4KQQA 1CI8A 4ZBEA 2GNXA 4U0TA 4R6LA 3G34A 4NETA 1F98A 1ZG4A 3BFEA 4MLLA 4GCZA 1ESIA 2INWA 2Y2QA 2B5RA 1IEMA 4WL9A 2QJ7A 3FWLA 4Q0IA 3BEBA 4XT2B 3FYZA 3NULA 5FEFA 1IKGA 4HOIA 4N9KA 3T4QA 4RX3A 4FOFA 4GD8A 2HF6A 3PXPA 3ZVWA 2ZC5B 2HGVA 1GSVA 1ESUA 3LIBA 3GR2A 2V0UA 3BQ8A 1RCJA 5HL1A 2ACGA 1G28A 2XRNA 3V67A 3LR4A 4DDSA 3CITA 1H0MA 4NXEA 4BLMA 4BJPA 4WBGA 1YKDA 4ARZA 4EERA 5IHVA 2ZQ8A 3FPWA 4X69A 3F1PA 1XJ3A 1ODVA 1XGIA 3E4QA 1OTIA 3BFGA 4NKPA 5TBMB 2Z6CA 1JWZA 1KE4A 3QP4A 4HH2A 4IVIA 2P04A 2OAQ1 4EBPA 3M2KA 4RQ9A 3FPVA 4Y3IA 1MBLA 1W79A 3GTCA 4MN7A 3C38A 4N9LA 4R38A 3F1NA 1XGJA 1LHYA 2ZMAA 2VV8A 5AQBA 3F1OB 5GHZA 2FFFB 3M6BA 4JF5A 3EEAA 1ZC2A 1ERQA 1YLJA 3IF6C 5FQ9A 4I3IA 3GSGA 5HDSA 2PAVP 3CUEC 5CGWA 5EPHA 2ZQCA 3IXBA 1YPRA 1PIOA 2HDUA 2Y2JA 5KZHA 2XH9A 1F2KA 4K91A 1ZG6A 1TVFA 3EQUA 4KQDA 4H8RA 2JKTI 4Y7PA 3WS0A 1LI9A 1VEUA 1KE3A 4E3LA 3MQQA 4E3JA 1P9WA 5TBMA 4OQIA 5FAPA 3ZNYA 1LT0A 4JXVA 1IFQA 4BL2A 1BZAA 1N9OA 3UO9A 5J4EA 1GCEA 1BT5A 1W7FA 3T4TA 4JF6A 4OPRA 2OLUA 4JF4A 3IHAA 2JN7A 1Y28A 3NDEA 3V39A 1N9BA 5DKLA 5G4YA 4PM9A 4MBFA 5GLAA 5FATA 1L0EA 2EX8A 1Y54A 2BTFP 2V8FA 4S2KA 3IBRA 5A91A 2ZL1A 3UE0A 3SOIA 1D1JA 2Y2OA 2O99A 4DMZA 2Y4AA 4GD6A 3CPTA 4HP9A 2HDRA 4EBNA 1FILA 4WUJA 4L9GA 4ETXA 3PR6A 5HAQA 2Y59A 4UA7A 1S4SA 1L0GA 5CERA 1VETA 2M7VA 1L3LA 3EWKA 1ONHA 2EWWA 2XROA 1FQGA 4OOLA 4X6TA 4EQ1A 1AXBA 2ZQDA 5A92A 5GLCA 1BLPA 3NHQA 3O3VA 3VP2A 4CLCC 1XJ2A 1WYCA 4HJ3A 4C75A 1K25A 3UB6A 5EUAA 3LIAA 3D9YA 4UA6A 2OOLA 3IH8A 3BQAA 1E3UD 5F69A 4EUVA 3IWIA 2V2FF 5CECA 2Q0OA 1ERMA 3FZCA 3N8LA 2W27A 5G4ZA 3MR0A 2JKRI 1KVLA 3WS1A 2WAFA 3CI6A 1OT9A 2K2NA 5HAIA 5CXWA 3FKVA 5F1GA 4FTXA 4H6JA 4KZ5A 3VFHA 2Q9MA 4EU0A 1FOFA 3BFFA 3R4KA 1MKMA 1Q2PA 4XUZA 4U3TA 3QNCA 2PRFA 1IYQA 1IELA 4UQIM 1MWUA 3FG8A 2QWSA 1M40A 3A3JA 5A8BA 1NZOA 3H9WA 1EW0A 3MMHA 4OKPA 4C3QA 2HV1A 4R70A 3UDXA 3NIAA 5EM0A 4C6YA 5M18A 1AWIA 1T1BA 3KX0X 2HPBA 4QY5A 4ARZB 2XR0A 3E0YA 4AFIA 3CJMA 1W8QA 4E6WA 3NJAA 4OQGA 1JWVA 3JPUA 1F5MA 3UB5P 1W63Q 3IBJA 2H0TA 4KENB 4YFMA 1NLZA 1IYSA 1O07A 2JHEA 2C5WB 4R0QA 4I3JA 3H82B 5TR7A 4HBUA 1MXOA 2Y2NA 4WZ5A 2ZC3B 4CLCE 2J9PA 2YKHA 1KGEA 1OTEA 3B3XA 3E4PA 3ZG8B 3UPPA 5FAQA 2ZQ7A 4YOFA 3VE4A 3H7WB 2WKHA 2WKQA 2KLIA 4P0MA 2V1BA 4Y15A 5HDCA 2J3TC 5EECA 1LSWA 2J80A 4ZJ3A 4UAAA 5E2EA 3HLWA 4PM7A 3PBTA 5DJUA 3UE3A 1G6OA 4BBUA 5L10A 4GHIA 3KYZA 1XXMA 4OPQA 3NBLA 3ZGAB 4Y0OA 5E2GA 3NOUC 1WE4A 1TS6A 2FFYA 5G18A 2P7JA 5LBRA 2V20A 3LI9A 1PYYA 2W1RA 3D72A 3MFXA 2HP6A 1H8MA 1MWRA 4WMCD 1CI9A 1NRFA 3CPTB 4Q0JA 3IF5A 1HTZA 4BQMA 3UMDA 2V1AA 2ZOHA 3GRJA 4IUHA 1MPLA 2QZ6A 1M6KA 3ZFZA 1WYBA 3N4IA 4X1LA 5EOOA 2XK1A 3JYIA 1S1YA 4I5SA 5AVEA 2QMIA 1D06A 5HW3A 1YLWA 3QHYA 2O9AA 1EI5A 3Q1FA 4LFUA 3PYPA 4MCWA 3HLDA 4GW9A 3NOPC 4MN5A 3LI8A 3F1OA 4DE1A 2WZZA 5FASA 1NY0A 1L2SA 5F83A 3UDFA 3MQ0A 2Y2MA 1E4DA 3LFVA 3E2LA 4II7A 4HQAA 4ETZA 4R1GA 3UPOA 5L07A 2AVXA 2JKRM 1OJGA 2BLSA 2JKGA 3QP6A 1G5UA 3W2ZA 1BSGA 4KQRA 2XA7M 4Y2FA 4JPMA 2A2LA 2O9BA 4N1XA 2WKRA 2ZM2A 4GOGA 4L9EA 3ZG9B 4S2NA 5EE8A 2PBDP 3BECA 4OOMA 2E8IA 4WEJA 3A0SA 1CEGA 3IWQA 2PT7A 3U4LP 1TF1A 4HNBA 5FQIA 2O0YA 4EBLA 1NZUA 1TS8A 1LI0A 2GZAA 4Z1WA 3T4KA 3AGDA 4Q8IA 4GLQA 4K0WA 2PDRA 2I72A 1MWSA 2XF3A 4LLOB 3CHWP 1F9IA 4QY6A 2J7VA 5CHJA 2Y2IA 4GNUA 1XJ4A 3NDGA 3KSFA 2DMWA 3K3DA 2L0WA 1O7EA 3D4FA 4GHIB 4IVKA 2BASA 1Z09A 1DRMA 2JKTM 3FV7A 1FR6A 3PBNA 4JXSA 2P74A 4KG5A 2PD8A 5DJTA 5J3WA 2WGWA 5EVIC 3TSGA 2XGNA 3NCKA 4RVAA 1E3UA 4LENA 2WUQA 2G7UA 3LIDA 2R78A 1I2WA 4QB8A 3M2JA 3CUEA 3VOYA 1LL8A 2P08A 2ZMVA 3N8RA 1ES3A 4IHQA 1OTAA 1YLTA 2GX5A 2KOIA 5EV0A 1XA7A 4A5RA 2ZQAA 2FZ0A 2WADA 4CJNA 2LB9A 5DVAA 4PAUA 1GSWA 2DCFA 3IHBA 3LY4A 3V3SA 5TJJA 3SH9A 4DF6A 4EUZA 4P85A 1KDWA 3L9KA 4GN2A 3HREA 4OOYA 5HZHA 4RA7A 3BLMA 2QHKA 3TW8A 3SS5A 1OT6A 5K5BA 4MMNA 3FC7A 4B88A 2Y2GA 5EM1A 3GVBA 4MBKA 1PW1A 4XUXA 1YQSA 4ZDXA 4I3AA 3B33A 1D7EA 2WZXA 3MXQA 1XKZA 3VOLA 2JBFA 3RXWA 4EEUA 5FEGA 3LCEA 3HLEA 2ZM8A 2EXAA 2A24A 3OCNA 3V3RA 2A24B 2XEPA 3UB9A 5DTKA 2XD5A 4X1MA 1YLZA 1K55A 3G2ZA 4NG2A 4GKUA 1VB6A 4OQ0A 5HFOA 3SS3A 5HAPA 5DF9A 1T18A 2PYRA 1BTLA 5AVFA 2BG1A 1W5DA 5CRFA 2D01A 2D02A 4PHTA 1LL9A 2OWHA 4X55A 2K31A 1K56A 2Q9NA 4WF0A 4OPYA 1NLYA 4ME4A 2HP9A 4O01A 2Y2LA 5HWWA 4L9FA 4NXGA 2WK0A 1YLYA 3A3IA 2VV7A 4YINA 2ZQ9A 3DWKA 2RCXA 2VX8A 2HJ9C 4KZAA 3UMEA 2ZD8A 1PI4A 5C5KA 1P0ZA 1P9RA 2K7SA 5HX9A 4O0PA 4G3WA 4OH0A 2A3UA 5DF8A 3HLBA 5FSRA 4KZ9A 4CLCA 3OC2A 1PRQA 3LR0A 5HD5A 3W4PA 4M4XA 3R7WB 4MN6A 4CPKA 3EEHA 3D3OA 1OPXA 4JGPA 4YNRA 1PWGA 2X71A 2W3EA 3UB8A 4KG6A 3Q81A 2JKFA 3EGXC 1RP5A 3GDIA 1YSPA 3N7WA 3W8KA 5I5LA 3G4PA 3KYQA 4E3MA 2ZC4B 3T4SA 5FQJA 2JCHA 5GLDA 4IBRA 1CF0A 2VEAA 4U0XA 3V50A 3OZHA 2W3HA 3MXRA 4X25A 3H7WA 5GHYA 3KYEA 4EW7A 2QYBA 4PKYA 1GHMA 1GSXA 2XFTA 3T1XA 4HH3A 3OPPA 1SKFA 3LYXA 2GJ3A 2OV5A 1T1AA 1LLBA 5EVIB 2H5SA 1VM1A 1WA9A 1RGZA 2DNSA 5FL3A 3VV4A 5AQ9A 1NJ4A 2WKPA 3MXSA 2H0YA 5CTMA 3BY8A 4UA9A 1FIKA 3PAGA 1JVJA 1N9LA 5GL9A 1ALQA 2VGLM 3BWLA 2Y91A 3Q7VA 5FQQA 4BD1A 2V1ZA 2YKFA 3GMWA 3ISGA 3UY6A 4LV0A 3MJQA 5AQ7A 4JXGA 1OTBA 4K08A 1FCOA 2ZC7A 3VMAA 2J8YA 4Q0HA 1PZPA 2QPNA 3S7PA 3B47A 1CQAA 3DTMA 3QP1A 4I39A 3LO7A 4LRXC 3P09A 4Y5FA 2G2WA 2NUPC 3I7JA 2XD1A 4R3BA 3IXHA 4DJ2A 3HL9A 2VGKA 4IBXA 4Y17A 4ZJ2A 1PW8A 5CHMA 3BJNA 3A3DA 3ZYTA 2EX9A 1IKIA 3MS6A 4S2MA 3A3FA 4S2IA 4P6ZM 4RX2A 2VLGA 3LICA 5F82A 2RL3A 2MJ6A 1CEFA 4LRZE 5HL6A 4M3KA 5CGXA 4P6BA 3IF6A 2J9OA 4FSFA 3ZNTA 5MC7A 3O5YA 5L2FA 1MKIA 1H3QA 1K6RA 3RTYA 2HDSA 4O7DA 1PNEA 4N92A 4DXCA 2B02A 2PR5A 2EFXA 4K0XA 1S6RA 1KVMA 3L7HA 3IX3A 2IWCA 2W1TB 2J3TD 2FH5A 2EA9A 3C7UA 1XJ6A 3HCYA 1GA0A 3NI9A 1T19A 3ZDJA 3DTKA 3RH8B 3ZCZA 3WRZA 2HJEA 5A93A 1TEMA 3ZVTA 4E3IA 1BYWA 3SH8A 3HJIA 2CMNA 2Y8HA 5E2FA 4PKYG 4FUWA 2Y2PA 3P98A 5FA7A 5AQAA 4F3LB 1DP8A 2W3FA 1DY6A 5L09A 3IS2B 2HP5A 1ES2A 2VJWA 1CJFA 2Y2KA 3VP3A 4HI4A 4GB7A 4FH2A 2IA2A 5FI2A 3HLGA 1K57A 3F1NB 2OAP1 1CK3A 3W4OA 3CWFA 3RXXA 3ICYA 3G35A 1K56D 3HVFA 1JWPA 3N6IA 4HJ4A 4BL3A 1VQQA 5F1FA 3T1QB 4S2NC 1W63M 1VHMA 4JGQA 4X68A 2NUTC 1HVBA 1V9YA 3BYDA 1JTDA 1FSYA 4PM8A 2M1CA 4WN5A 3KSGA 2XFSA 2O9CA 3G6OA 4EEPA 2VGLS 3WRTA 1SHVA 2P9VB 5E2HA 1Q2QA 3PAEA 4XT2A 3WS4A 3IS2A 3VOZA 1UWPX 2Y55A 4EESA 1PZOA 3BM6A 4JGOA 3CLOA 1NRJA 3OOVA 4N1HA 1XFNA 1QMEA 1XA1A 4FCFA 4UEYA 2ZJ9A 2J3WA 3EGDC 4I38A 3NOTC 3S7OA 2VZWA 2W1TA 5TFQA 4P6ZS 4FD8A 1DJBA 1W8YA 4IJGA 1DP9A 4GDNA 4IUKA 1ACFA 1K55C 2JE5A 1SDNA 5CEDA 1BLCA 1EWZA 4FH4A 1IYPA 1STZA 1BUEA 2B18A 1S67L 2E8JA 2Y79A 2EXBA 1PI5A 2X01A 3GV9A 2UWXA 3NC8A 4JBFA 5DFYA 3UPNA 5J7EA 4L0LA 1I2SA 1GHPA 4OP5A 3TE8A 3C4PA 3O87A 3ITAA 3VSKA 1TDGA 4ZJ1A 5TGFA 5DKKA 4G3VA 3SH7A 3UE6A 5CHUA 3NECA 4QWOA 3HLCA 4E04A 4NK3A 3A0VA 5FDHA 5HDDA 3IH9A 4CLCB 3TJZC 2JC7A 4GZBA 5DTTA 3PBSA 4OVDA 3LR5A 4QU3A 2GDNA 4B4XA 2WAEA 1P97A 3OPHA 4LGWA 3QP2A 2VK3A 1IOUA 4LCLA 3K2NA 2Z6DA 5HARA 4NXFA 5DFXA 5KSHA 4LV1A 4DJ3A 4JXWA 2A49A 4B93A 3VFFA 1K0KA 4JGRA 1NYYA 4WLAA 2HDQA 4MDZA 1G6AA 4S2OA 1BLHA 4KZBA 1KE0A 1H5XA 3S4XA 4CQHA 3MQOA 1MY8A 4KZ8A 2PR6A 1JNUA 3BW6A 2QJ5A 4E3OA 2VV6A 1ONGA 1U60A 5EOEA 5U47A 2W0NA 3DTEA 3IX4A 5KIZA 4S2JA 3G30A 4G3KA 4GJ4A 3LEZA 5EVID 4IEDA 5L8MA 1DJCA 5GHXA 3IQAA 3HUNA 3VP1A 3T1RA 4E3KA 4KUOA 3DTIA 1K54A 1ZTUA 3IXDA 1NWZA 2ZBBA 2VA0A 1K4FA 3JVVA 2Z2LB 3G2YA 3EQVA 4PPRA 3OPRA 3CG5A 1S4RA 4KG2A 1J9MA 1SZVA 4JKTA 4XXRA 5HPFA 4X53A 2XQZA 4OQHA 3C2WA 3IX8A 4JLFA 4NEED 4BENA 2VGJA 2P9VA 2PU4A 2R9WA 2PD7A 5JYPA 3O88A 3UN7A 4HHDA 3E98A 3TOIA 1I5QA 1K57C 1TD5A 4QHCA 1LSXA 2ZOIA 3BFDA 4F94A 4Y0TA 2OWJA 3BFCA 2PU2A 4E3NA 4LCMA 3T50A 4KUKA 3K3CA 3E4OA 3IXGA 2H10A 4BBVA 2V9AA 3C5AA 3ITBA 5KSCA 4KZ3A 4PM6A 5GLBA 1XX2A 5HWVA 4WM9A 4CLCD 4UHUA 2OSUA 5J8XA 2WKIA 2R9XA 3CAXA 4H6JB 3TG9A 2W3GA 5CEBA 1KGFA 2XDMA 3Q82A 3UE1A 4OP8A 3LEQA 4DE3A 3C4OA 4KQOA 5EVEA 1MZUA 5HD3A 2ZMFA 1RGYA 4Y13A 4BWIA 4WEKA 1ES4A 1YSQA 3UNWA 3ZG7B 1SKOB 4R4RA 5CTNA 1MC0A 1N9NA 1K6SA 4MEZA 1JTGA 1BLSA 1YM1A 3A0RA 3UB7A 3QP8A 5EVIA 3C7VA 4QJGA 4LPZA 1OTDA 4PMAA 1H8YA 1TS7A 1XFQA 2LB5A 3GQZA 2IWBA 3GECA 3S7QA 2WKEA 4LRYC 3PBOA 2XLNA 3T1SA 3OCLA 3W4QA 2V0WA 4BMWA 2L4RA 4QPRA 3T12B 4DDYA 1TS0A 4EWFA 5HWTA 3WS2A 2EFUA 2EWVA 4R23A 1KDSA 4R3JA 3TRCA 5CX7A 4BD0A 1S0WA 1NYMA 3HUOA 4RYEA 1Y4OA 3ULFA 3LUQA 1SKOA 5I94A 1H8ZA 4HESA 3MZEA 3KO6A 4ZTKA 1K4EA 3U2AA 5E43A 4ZAMA 4E6XA 3N8SA 4R3AA 5FAOA 4WYYA 4YWZA 1N4OA 3LGOA 4UQIS 1PWCA 5F6AA 3RFBA 3H82A 1Z6FA 4HJ6A 4ZRRA 3SZTA 3MFDA 3KSIA 1FCMA 1QMFA 5CGSA 4DXBA 1TDLA 1LL5A
chains in the Genus database with same CATH topology
4NXBA 3CLOA 5G4YA 1NRJA 3OOVA 1XFNA 3P01A 5HZHA 2KX6A 2QHKA 3TW8A 3IBRA 1OT6A 4UEYA 5K5BA 4MMNA 3FC7A 1V9ZA 2J3WA 2O99A 3EGDC 4I38A 4DMZA 3NOTC 2VKSA 3S7OA 2KDKA 2VZWA 2W1TA 4HP9A 4P6ZS 4O8GA 4I3AA 3B33A 1D7EA 5IU1A 4IJGA 1DP9A 4GS9B 4IUKA 4WUJA 3MXQA 4L9GA 4ETXA 3PR6A 2L1MA 1S4SA 3VOLA 4EEUA 1S1ZA 2A24A 3OCNA 1LSVA 2M7VA 1STZA 3EWKA 2A24B 2EWWA 3T4JA 1UWNX 3UB9A 2XROA 3MF0A 4OOLA 2B18A 4EQ1A 1S67L 3NHQA 2Y79A 2XA7S 3ZQ5A 5IS1A 4CLCC 3B42A 4GS9A 1VB6A 1XJ2A 3PBRA 4B9OA 4HJ3A 5DF9A 3UB6A 3LIAA 1T18A 5DFYA 5J7EA 4L0LA 2PYRA 2OOLA 5AVFA 3BQAA 4EXOA 2D01A 5F69A 4EUVA 3TE8A 3LR3A 2D02A 3C8CA 4PHTA 2W27A 2OWHA 2K31A 5DKKA 5G4ZA 4G3VA 3MR0A 2JKRI 3UE6A 4WF0A 4DN0A 3CI6A 1OT9A 2K2NA 1NLYA 4ME4A 4E04A 4H6JA 3A0VA 5HDDA 4O01A 4CLCB 2QKPA 1X0OA 3TJZC 5HWWA 4EU0A 5F5YA 3R4KA 1MKMA 4L9FA 4NXGA 3PBSA 2VV7A 4UQIM 3LR5A 2VX8A 3P7NA 2W3DA 3FG8A 2HJ9C 2QWSA 2H28A 5A8BA 3H9WA 3PHYA 1EW0A 3MMHA 3UMEA 2HV1A 4HY8A 4R70A 1OJ5A 1P97A 3HJKA 1T1BA 3KX0X 5C5KA 1P0ZA 1IOUA 1P9RA 2PHYA 2PYPA 3K2NA 2K7SA 4ARZB 3E0YA 4AFIA 2Z6DA 4O0PA 4NXFA 4G3WA 5DFXA 4F3LA 5KSHA 4CLCA 3F1PB 3T4OA 3NJAA 3OC2A 1ZHHB 3LR0A 1F5MA 5HD5A 4DJ3A 4M4XA 4B93A 1W63Q 3R7WB 4MN6A 4JGRA 3IBJA 4WLAA 3EEHA 3D3OA 5EFWA 1OPXA 3SW1A 4MDZA 4JGPA 4YNRA 2W3EA 1NLZA 2JHEA 3UB8A 4CQHA 3MQOA 4I3JA 3EGXC 3H82B 3C30A 3GDIA 1YSPA 2PR6A 1JNUA 3BW6A 3PBQA 4CLCE 2QJ5A 5I5LA 2YKHA 2VV6A 5IT5A 3KYQA 1OTEA 3T4SA 2W0NA 3E4PA 5KIZA 4YOFA 4G3KA 4GJ4A 3LIEA 3VE4A 2VEAA 3BY9A 3H7WB 2WKQA 2KLIA 2W3HA 2M7UA 5L8MA 2V1BA 3H7WA 5HDCA 2J3TC 4WELA 4EW7A 2QYBA 3LIFA 4PKYA 1LSWA 1GSXA 2J80A 4KUOA 3OLOA 4HH3A 5AJGA 1ZTUA 3PBTA 3LYXA 5DJUA 1NWZA 1T1CA 2GJ3A 1G6OA 2ZBBA 4HIAA 3UE3A 4BBUA 1T1AA 2VA0A 4GHIA 1WA9A 3JVVA 3KYZA 2I9VA 3VV4A 2XSSA 5FL3A 3EQVA 3VE3A 2WKPA 1S4RA 1UGUA 3NOUC 3BY8A 4HP4A 1DP6A 5F68A 1TS6A 1YAXA 2P7JA 5LBRA 3LI9A 5HPFA 2W1RA 3D72A 1N9LA 3MFXA 3C2WA 1H8MA 4NEED 2VGLM 3BWLA 2PD7A 4Q0JA 3S7NA 5HPIA 4EETB 3UMDA 2V1AA 3EOIA 2ZOHA 2YKFA 4IUHA 4HHDA 3E98A 3MJQA 1TD5A 1LSXA 2ZOIA 3KSHA 1OTBA 4K08A 3R7WA 1S1YA 4I5SA 5AVEA 4Q0HA 1D06A 2OWJA 3DBAA 3S7PA 3B47A 2O9AA 1KOUA 4I39A 4LRXC 3T50A 4KUKA 3K3CA 3E4OA 4Y5FA 5HSQA 2NUPC 3OBFA 4BBVA 2V9AA 1S66L 3PYPA 4MCWA 4DJ2A 3JVUA 4BBTA 3T4LA 4GW9A 3BJNA 3NOPC 2GNXA 3ZYTA 4R6LA 4MN5A 3LI8A 3F1OA 1F98A 5HWVA 4P6ZM 4GCZA 4CLCD 2INWA 2VLGA 3MQ0A 3LICA 4WL9A 2QJ7A 3LFVA 4Q0IA 4II7A 4XT2B 2MJ6A 4HQAA 3CAXA 4H6JB 4LRZE 5HL6A 4ETZA 4HOIA 3T4QA 2W3GA 2JKRM 4FOFA 1OJGA 2HF6A 3PXPA 4FSFA 2HGVA 5MC7A 3O5YA 1GSVA 3W2ZA 4KQOA 2XA7M 1H3QA 1MZUA 5HD3A 4Y2FA 3RTYA 3LIBA 2V0UA 3BQ8A 2ZMFA 4BWIA 1G28A 2XRNA 4WEKA 2A2LA 3V67A 1YSQA 2O9BA 3LR4A 3CITA 2B02A 2PR5A 2WKRA 1MC0A 1N9NA 4NXEA 4BJPA 4ARZA 1YKDA 4EERA 4L9EA 3A0RA 2W1TB 3FPWA 2J3TD 3UB7A 2FH5A 3F1PA 4OOMA 1XJ3A 1ODVA 2EA9A 4WEJA 1XJ6A 4LPZA 3E4QA 3HCYA 1OTDA 3A0SA 1OTIA 1T19A 4NKPA 1TS7A 1XFQA 2PT7A 5TBMB 3RH8B 1TF1A 2Z6CA 2LB5A 4HNBA 2HJEA 4HH2A 2O0YA 2P04A 3GECA 1TS8A 3S7QA 2GZAA 4Z1WA 3T4KA 4LRYC 3PBOA 4GLQA 2OAQ1 1BYWA 3HJIA 4RQ9A 3FPVA 4Y3IA 2CMNA 2PDRA 3OCLA 4BMWA 2V0WA 2L4RA 4QPRA 2Y8HA 4PKYG 4LLOB 4MN7A 3C38A 4R38A 1TS0A 3F1NA 1F9IA 4F3LB 5HWTA 1DP8A 2W3FA 1XJ4A 2VV8A 3IS2B 3KSFA 2DMWA 2VJWA 3F1OB 2L0WA 3K3DA 2EWVA 4GHIB 3EEAA 3TRCA 5CX7A 4HI4A 4I3IA 5HDSA 2BASA 3CUEC 1DRMA 3ULFA 2JKTM 2IA2A 3LUQA 3PBNA 3F1NB 2OAP1 2PD8A 3CWFA 5DJTA 5J3WA 3ICYA 3KO6A 4HJ4A 3EQUA 4KQDA 2JKTI 3U2AA 2G7UA 1W63M 1VHMA 2R78A 3LIDA 4JGQA 3CUEA 4R3AA 2NUTC 3MQQA 1LL8A 2P08A 2ZMVA 1V9YA 1P9WA 5TBMA 4YWZA 1LT0A 4WN5A 2M1CA 4IHQA 3KSGA 1OTAA 1IFQA 2O9CA 2KOIA 2GX5A 4UQIS 3G6OA 5F6AA 1N9OA 3RFBA 2VGLS 4EEPA 3H82A 5J4EA 2FZ0A 3T4TA 4HJ6A 2LB9A 4XT2A 3IS2A 4PAUA 4ZRRA 2JN7A 1GSWA 1UWPX 3KSIA 4EESA 1Y28A 5TJJA 4JGOA 5DKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3D A;  2W1T B;  3OOV A;  3MMH A;  4Q0J A;  3S7N A;  4R70 A;  5HPI A;  3HCY A;  4IUH A;  3E98 A;  1TF1 A;  3IBR A;  2LB5 A;  5C5K A;  2O0Y A;  3K2N A;  3E0Y A;  5K5B A;  4MMN A;  1TD5 A;  3S7Q A;  4O0P A;  4G3W A;  5DFX A;  2O99 A;  4Z1W A;  4LRY C;  3KSH A;  4DMZ A;  3NOT C;  2VKS A;  4GLQ A;  4RQ9 A;  3S7O A;  4Y3I A;  4Q0H A;  2VZW A;  2W1T A;  4O8G A;  1F5M A;  4QPR A;  2Y8H A;  3DBA A;  3S7P A;  2O9A A;  4MN7 A;  4IJG A;  4LRX C;  4IUK A;  5HSQ A;  4Y5F A;  3IBJ A;  3D3O A;  4ETX A;  2W3F A;  4MDZ A;  4YNR A;  3OBF A;  3KSF A;  2W3E A;  2VJW A;  4MCW A;  4CQH A;  1YSP A;  4GW9 A;  3EEA A;  2M7V A;  1STZ A;  3BJN A;  3NOP C;  3TRC A;  4R6L A;  5I5L A;  2XRO A;  3MF0 A;  2B18 A;  3NHQ A;  2Y79 A;  2IA2 A;  3ZQ5 A;  3MQ0 A;  4YOF A;  4G3K A;  3LFV A;  2VEA A;  4Q0I A;  2KLI A;  3KO6 A;  2W3H A;  2M7U A;  5L8M A;  5HL6 A;  4LRZ E;  4ETZ A;  5DFY A;  2W3G A;  2OOL A;  4FOF A;  2QYB A;  2G7U A;  1VHM A;  4EUV A;  2HGV A;  5AJG A;  1ZTU A;  3O5Y A;  2K31 A;  3KSG A;  4G3V A;  3W2Z A;  2O9C A;  2KOI A;  2GX5 A;  3G6O A;  4DN0 A;  4Y2F A;  3CI6 A;  3RFB A;  3VV4 A;  2XSS A;  2K2N A;  4ME4 A;  4E04 A;  2ZMF A;  2LB9 A;  3NOU C;  4BWI A;  2XRN A;  4O01 A;  1YSQ A;  4PAU A;  4ZRR A;  2O9B A;  4EU0 A;  3CIT A;  3R4K A;  1MKM A;  1MC0 A;  3KSI A;  5LBR A;  5HPF A;  5TJJ A;  1YKD A;  2W1R A;  3C2W A; 
#chains in the Genus database with same CATH topology
 2C6W B;  2EX6 A;  4NXB A;  5FQM A;  4HBT A;  4WZ5 C;  5M19 A;  1GA9 A;  3P01 A;  1J3W A;  4EV4 A;  2KX6 A;  3UDI A;  1SDE A;  2WGI A;  2ZM0 A;  1G68 A;  1XP4 A;  3Q07 A;  1V9Z A;  1YLP A;  2G2U A;  3V5M A;  2VKS A;  4OLG A;  1IYO A;  4S2P A;  2KDK A;  2WGV A;  4O8G A;  1E25 A;  1PWD A;  4OON A;  1HZO A;  5IU1 A;  4GS9 B;  3CMZ A;  3LY3 A;  4D60 A;  1K38 A;  5DTS A;  2L1M A;  5D3O A;  3ZHH A;  4DKI A;  1PFL A;  1MWT A;  2ZC6 B;  1S1Z A;  3VP4 A;  3NY4 A;  4KZ7 A;  1LSV A;  3IF6 B;  3T4J A;  1UWN X;  1OME A;  3MF0 A;  2WGW B;  5EVL A;  2Z2M B;  2XA7 S;  3ZQ5 A;  3ZG0 A;  5IS1 A;  3B42 A;  4GS9 A;  4ESP A;  3QP5 A;  3PBR A;  4B9O A;  3S22 A;  1XPB A;  4DE0 A;  3QNB A;  4EXO A;  3IWO A;  1SCW A;  4P87 A;  3MKF A;  5BOH A;  3LR3 A;  3C8C A;  1L0F A;  4B4Z A;  3VP0 A;  3O86 A;  1HD8 A;  4DN0 A;  4PM5 A;  3PTE A;  4OLD A;  3MBZ A;  1NXY A;  1X0O A;  2QKP A;  4WZ4 A;  4MBH A;  2EX2 A;  5F5Y A;  2DRW A;  1YT4 A;  3P7N A;  2W3D A;  3OPL A;  1FSW A;  1L0D A;  2H28 A;  4EQI A;  3PHY A;  3S1Y A;  4HY8 A;  3MZF A;  3VSL A;  1OJ5 A;  3MSH A;  3Q7V B;  4LV3 A;  3HJK A;  3DWZ A;  4LV2 A;  1ERO A;  2PHY A;  2PYP A;  4OPZ A;  3WWX A;  1GHI A;  5M1A A;  4F3L A;  4DE2 A;  3FKW A;  3G31 A;  3F1P B;  3T4O A;  3MZD A;  3DAV A;  2HZ5 A;  3AGE A;  1ZHH B;  3CZD A;  3HBR A;  1FCN A;  5DF7 A;  2X02 A;  5EFW A;  3SW1 A;  3HLF A;  4QD4 A;  3AGF A;  3Q7Z A;  4Z9Q A;  5A90 A;  3ZG5 A;  3C30 A;  4GDB A;  1DJA A;  2Y2H A;  3PBQ A;  1ES5 A;  5IT5 A;  3DW0 A;  1HLU P;  1K54 C;  5FI7 A;  4S2L A;  1VEU B;  4D2O A;  1ZKJ A;  3LIE A;  5JYO A;  3BY9 A;  2M7U A;  2OLV A;  4WEL A;  3LIF A;  2UV0 E;  1VET B;  3OLO A;  4WMC A;  5AJG A;  4Y0U A;  4HEF A;  3HUM A;  4HIA A;  1T1C A;  1FR1 A;  2I9V A;  2XSS A;  3WS5 A;  5FI6 A;  2PBY A;  3VE3 A;  4DRT A;  2IWD A;  4MNR A;  1UGU A;  2CC1 A;  4HP4 A;  1DP6 A;  3SS4 A;  5F68 A;  2ZLY A;  3IT9 A;  3A3E A;  1YAX A;  2ZL1 B;  3RJU A;  4R4S A;  2B95 A;  1KGG A;  3BRM A;  3S7N A;  5HPI A;  4ID4 A;  4EET B;  3M6H A;  3BLS A;  3EOI A;  5KMW A;  2WYX A;  5FQK A;  3G32 A;  5FDS A;  3KSH A;  1YMX A;  3R7W A;  4KZ4 A;  1A0K A;  3E2K A;  3DBA A;  1KOU A;  1C3B A;  5HSQ A;  1BUL A;  3OBF A;  1S66 L;  3MKE A;  1YMS A;  2V8C A;  3JVU A;  4KZ6 A;  4X56 A;  4BBT A;  3T4L A;  4KQQ A;  1CI8 A;  4ZBE A;  2GNX A;  4U0T A;  4R6L A;  3G34 A;  4NET A;  1F98 A;  1ZG4 A;  3BFE A;  4MLL A;  4GCZ A;  1ESI A;  2INW A;  2Y2Q A;  2B5R A;  1IEM A;  4WL9 A;  2QJ7 A;  3FWL A;  4Q0I A;  3BEB A;  4XT2 B;  3FYZ A;  3NUL A;  5FEF A;  1IKG A;  4HOI A;  4N9K A;  3T4Q A;  4RX3 A;  4FOF A;  4GD8 A;  2HF6 A;  3PXP A;  3ZVW A;  2ZC5 B;  2HGV A;  1GSV A;  1ESU A;  3LIB A;  3GR2 A;  2V0U A;  3BQ8 A;  1RCJ A;  5HL1 A;  2ACG A;  1G28 A;  2XRN A;  3V67 A;  3LR4 A;  4DDS A;  3CIT A;  1H0M A;  4NXE A;  4BLM A;  4BJP A;  4WBG A;  1YKD A;  4ARZ A;  4EER A;  5IHV A;  2ZQ8 A;  3FPW A;  4X69 A;  3F1P A;  1XJ3 A;  1ODV A;  1XGI A;  3E4Q A;  1OTI A;  3BFG A;  4NKP A;  5TBM B;  2Z6C A;  1JWZ A;  1KE4 A;  3QP4 A;  4HH2 A;  4IVI A;  2P04 A;  2OAQ 1;  4EBP A;  3M2K A;  4RQ9 A;  3FPV A;  4Y3I A;  1MBL A;  1W79 A;  3GTC A;  4MN7 A;  3C38 A;  4N9L A;  4R38 A;  3F1N A;  1XGJ A;  1LHY A;  2ZMA A;  2VV8 A;  5AQB A;  3F1O B;  5GHZ A;  2FFF B;  3M6B A;  4JF5 A;  3EEA A;  1ZC2 A;  1ERQ A;  1YLJ A;  3IF6 C;  5FQ9 A;  4I3I A;  3GSG A;  5HDS A;  2PAV P;  3CUE C;  5CGW A;  5EPH A;  2ZQC A;  3IXB A;  1YPR A;  1PIO A;  2HDU A;  2Y2J A;  5KZH A;  2XH9 A;  1F2K A;  4K91 A;  1ZG6 A;  1TVF A;  3EQU A;  4KQD A;  4H8R A;  2JKT I;  4Y7P A;  3WS0 A;  1LI9 A;  1VEU A;  1KE3 A;  4E3L A;  3MQQ A;  4E3J A;  1P9W A;  5TBM A;  4OQI A;  5FAP A;  3ZNY A;  1LT0 A;  4JXV A;  1IFQ A;  4BL2 A;  1BZA A;  1N9O A;  3UO9 A;  5J4E A;  1GCE A;  1BT5 A;  1W7F A;  3T4T A;  4JF6 A;  4OPR A;  2OLU A;  4JF4 A;  3IHA A;  2JN7 A;  1Y28 A;  3NDE A;  3V39 A;  1N9B A;  5DKL A;  5G4Y A;  4PM9 A;  4MBF A;  5GLA A;  5FAT A;  1L0E A;  2EX8 A;  1Y54 A;  2BTF P;  2V8F A;  4S2K A;  3IBR A;  5A91 A;  2ZL1 A;  3UE0 A;  3SOI A;  1D1J A;  2Y2O A;  2O99 A;  4DMZ A;  2Y4A A;  4GD6 A;  3CPT A;  4HP9 A;  2HDR A;  4EBN A;  1FIL A;  4WUJ A;  4L9G A;  4ETX A;  3PR6 A;  5HAQ A;  2Y59 A;  4UA7 A;  1S4S A;  1L0G A;  5CER A;  1VET A;  2M7V A;  1L3L A;  3EWK A;  1ONH A;  2EWW A;  2XRO A;  1FQG A;  4OOL A;  4X6T A;  4EQ1 A;  1AXB A;  2ZQD A;  5A92 A;  5GLC A;  1BLP A;  3NHQ A;  3O3V A;  3VP2 A;  4CLC C;  1XJ2 A;  1WYC A;  4HJ3 A;  4C75 A;  1K25 A;  3UB6 A;  5EUA A;  3LIA A;  3D9Y A;  4UA6 A;  2OOL A;  3IH8 A;  3BQA A;  1E3U D;  5F69 A;  4EUV A;  3IWI A;  2V2F F;  5CEC A;  2Q0O A;  1ERM A;  3FZC A;  3N8L A;  2W27 A;  5G4Z A;  3MR0 A;  2JKR I;  1KVL A;  3WS1 A;  2WAF A;  3CI6 A;  1OT9 A;  2K2N A;  5HAI A;  5CXW A;  3FKV A;  5F1G A;  4FTX A;  4H6J A;  4KZ5 A;  3VFH A;  2Q9M A;  4EU0 A;  1FOF A;  3BFF A;  3R4K A;  1MKM A;  1Q2P A;  4XUZ A;  4U3T A;  3QNC A;  2PRF A;  1IYQ A;  1IEL A;  4UQI M;  1MWU A;  3FG8 A;  2QWS A;  1M40 A;  3A3J A;  5A8B A;  1NZO A;  3H9W A;  1EW0 A;  3MMH A;  4OKP A;  4C3Q A;  2HV1 A;  4R70 A;  3UDX A;  3NIA A;  5EM0 A;  4C6Y A;  5M18 A;  1AWI A;  1T1B A;  3KX0 X;  2HPB A;  4QY5 A;  4ARZ B;  2XR0 A;  3E0Y A;  4AFI A;  3CJM A;  1W8Q A;  4E6W A;  3NJA A;  4OQG A;  1JWV A;  3JPU A;  1F5M A;  3UB5 P;  1W63 Q;  3IBJ A;  2H0T A;  4KEN B;  4YFM A;  1NLZ A;  1IYS A;  1O07 A;  2JHE A;  2C5W B;  4R0Q A;  4I3J A;  3H82 B;  5TR7 A;  4HBU A;  1MXO A;  2Y2N A;  4WZ5 A;  2ZC3 B;  4CLC E;  2J9P A;  2YKH A;  1KGE A;  1OTE A;  3B3X A;  3E4P A;  3ZG8 B;  3UPP A;  5FAQ A;  2ZQ7 A;  4YOF A;  3VE4 A;  3H7W B;  2WKH A;  2WKQ A;  2KLI A;  4P0M A;  2V1B A;  4Y15 A;  5HDC A;  2J3T C;  5EEC A;  1LSW A;  2J80 A;  4ZJ3 A;  4UAA A;  5E2E A;  3HLW A;  4PM7 A;  3PBT A;  5DJU A;  3UE3 A;  1G6O A;  4BBU A;  5L10 A;  4GHI A;  3KYZ A;  1XXM A;  4OPQ A;  3NBL A;  3ZGA B;  4Y0O A;  5E2G A;  3NOU C;  1WE4 A;  1TS6 A;  2FFY A;  5G18 A;  2P7J A;  5LBR A;  2V20 A;  3LI9 A;  1PYY A;  2W1R A;  3D72 A;  3MFX A;  2HP6 A;  1H8M A;  1MWR A;  4WMC D;  1CI9 A;  1NRF A;  3CPT B;  4Q0J A;  3IF5 A;  1HTZ A;  4BQM A;  3UMD A;  2V1A A;  2ZOH A;  3GRJ A;  4IUH A;  1MPL A;  2QZ6 A;  1M6K A;  3ZFZ A;  1WYB A;  3N4I A;  4X1L A;  5EOO A;  2XK1 A;  3JYI A;  1S1Y A;  4I5S A;  5AVE A;  2QMI A;  1D06 A;  5HW3 A;  1YLW A;  3QHY A;  2O9A A;  1EI5 A;  3Q1F A;  4LFU A;  3PYP A;  4MCW A;  3HLD A;  4GW9 A;  3NOP C;  4MN5 A;  3LI8 A;  3F1O A;  4DE1 A;  2WZZ A;  5FAS A;  1NY0 A;  1L2S A;  5F83 A;  3UDF A;  3MQ0 A;  2Y2M A;  1E4D A;  3LFV A;  3E2L A;  4II7 A;  4HQA A;  4ETZ A;  4R1G A;  3UPO A;  5L07 A;  2AVX A;  2JKR M;  1OJG A;  2BLS A;  2JKG A;  3QP6 A;  1G5U A;  3W2Z A;  1BSG A;  4KQR A;  2XA7 M;  4Y2F A;  4JPM A;  2A2L A;  2O9B A;  4N1X A;  2WKR A;  2ZM2 A;  4GOG A;  4L9E A;  3ZG9 B;  4S2N A;  5EE8 A;  2PBD P;  3BEC A;  4OOM A;  2E8I A;  4WEJ A;  3A0S A;  1CEG A;  3IWQ A;  2PT7 A;  3U4L P;  1TF1 A;  4HNB A;  5FQI A;  2O0Y A;  4EBL A;  1NZU A;  1TS8 A;  1LI0 A;  2GZA A;  4Z1W A;  3T4K A;  3AGD A;  4Q8I A;  4GLQ A;  4K0W A;  2PDR A;  2I72 A;  1MWS A;  2XF3 A;  4LLO B;  3CHW P;  1F9I A;  4QY6 A;  2J7V A;  5CHJ A;  2Y2I A;  4GNU A;  1XJ4 A;  3NDG A;  3KSF A;  2DMW A;  3K3D A;  2L0W A;  1O7E A;  3D4F A;  4GHI B;  4IVK A;  2BAS A;  1Z09 A;  1DRM A;  2JKT M;  3FV7 A;  1FR6 A;  3PBN A;  4JXS A;  2P74 A;  4KG5 A;  2PD8 A;  5DJT A;  5J3W A;  2WGW A;  5EVI C;  3TSG A;  2XGN A;  3NCK A;  4RVA A;  1E3U A;  4LEN A;  2WUQ A;  2G7U A;  3LID A;  2R78 A;  1I2W A;  4QB8 A;  3M2J A;  3CUE A;  3VOY A;  1LL8 A;  2P08 A;  2ZMV A;  3N8R A;  1ES3 A;  4IHQ A;  1OTA A;  1YLT A;  2GX5 A;  2KOI A;  5EV0 A;  1XA7 A;  4A5R A;  2ZQA A;  2FZ0 A;  2WAD A;  4CJN A;  2LB9 A;  5DVA A;  4PAU A;  1GSW A;  2DCF A;  3IHB A;  3LY4 A;  3V3S A;  5TJJ A;  3SH9 A;  4DF6 A;  4EUZ A;  4P85 A;  1KDW A;  3L9K A;  4GN2 A;  3HRE A;  4OOY A;  5HZH A;  4RA7 A;  3BLM A;  2QHK A;  3TW8 A;  3SS5 A;  1OT6 A;  5K5B A;  4MMN A;  3FC7 A;  4B88 A;  2Y2G A;  5EM1 A;  3GVB A;  4MBK A;  1PW1 A;  4XUX A;  1YQS A;  4ZDX A;  4I3A A;  3B33 A;  1D7E A;  2WZX A;  3MXQ A;  1XKZ A;  3VOL A;  2JBF A;  3RXW A;  4EEU A;  5FEG A;  3LCE A;  3HLE A;  2ZM8 A;  2EXA A;  2A24 A;  3OCN A;  3V3R A;  2A24 B;  2XEP A;  3UB9 A;  5DTK A;  2XD5 A;  4X1M A;  1YLZ A;  1K55 A;  3G2Z A;  4NG2 A;  4GKU A;  1VB6 A;  4OQ0 A;  5HFO A;  3SS3 A;  5HAP A;  5DF9 A;  1T18 A;  2PYR A;  1BTL A;  5AVF A;  2BG1 A;  1W5D A;  5CRF A;  2D01 A;  2D02 A;  4PHT A;  1LL9 A;  2OWH A;  4X55 A;  2K31 A;  1K56 A;  2Q9N A;  4WF0 A;  4OPY A;  1NLY A;  4ME4 A;  2HP9 A;  4O01 A;  2Y2L A;  5HWW A;  4L9F A;  4NXG A;  2WK0 A;  1YLY A;  3A3I A;  2VV7 A;  4YIN A;  2ZQ9 A;  3DWK A;  2RCX A;  2VX8 A;  2HJ9 C;  4KZA A;  3UME A;  2ZD8 A;  1PI4 A;  5C5K A;  1P0Z A;  1P9R A;  2K7S A;  5HX9 A;  4O0P A;  4G3W A;  4OH0 A;  2A3U A;  5DF8 A;  3HLB A;  5FSR A;  4KZ9 A;  4CLC A;  3OC2 A;  1PRQ A;  3LR0 A;  5HD5 A;  3W4P A;  4M4X A;  3R7W B;  4MN6 A;  4CPK A;  3EEH A;  3D3O A;  1OPX A;  4JGP A;  4YNR A;  1PWG A;  2X71 A;  2W3E A;  3UB8 A;  4KG6 A;  3Q81 A;  2JKF A;  3EGX C;  1RP5 A;  3GDI A;  1YSP A;  3N7W A;  3W8K A;  5I5L A;  3G4P A;  3KYQ A;  4E3M A;  2ZC4 B;  3T4S A;  5FQJ A;  2JCH A;  5GLD A;  4IBR A;  1CF0 A;  2VEA A;  4U0X A;  3V50 A;  3OZH A;  2W3H A;  3MXR A;  4X25 A;  3H7W A;  5GHY A;  3KYE A;  4EW7 A;  2QYB A;  4PKY A;  1GHM A;  1GSX A;  2XFT A;  3T1X A;  4HH3 A;  3OPP A;  1SKF A;  3LYX A;  2GJ3 A;  2OV5 A;  1T1A A;  1LLB A;  5EVI B;  2H5S A;  1VM1 A;  1WA9 A;  1RGZ A;  2DNS A;  5FL3 A;  3VV4 A;  5AQ9 A;  1NJ4 A;  2WKP A;  3MXS A;  2H0Y A;  5CTM A;  3BY8 A;  4UA9 A;  1FIK A;  3PAG A;  1JVJ A;  1N9L A;  5GL9 A;  1ALQ A;  2VGL M;  3BWL A;  2Y91 A;  3Q7V A;  5FQQ A;  4BD1 A;  2V1Z A;  2YKF A;  3GMW A;  3ISG A;  3UY6 A;  4LV0 A;  3MJQ A;  5AQ7 A;  4JXG A;  1OTB A;  4K08 A;  1FCO A;  2ZC7 A;  3VMA A;  2J8Y A;  4Q0H A;  1PZP A;  2QPN A;  3S7P A;  3B47 A;  1CQA A;  3DTM A;  3QP1 A;  4I39 A;  3LO7 A;  4LRX C;  3P09 A;  4Y5F A;  2G2W A;  2NUP C;  3I7J A;  2XD1 A;  4R3B A;  3IXH A;  4DJ2 A;  3HL9 A;  2VGK A;  4IBX A;  4Y17 A;  4ZJ2 A;  1PW8 A;  5CHM A;  3BJN A;  3A3D A;  3ZYT A;  2EX9 A;  1IKI A;  3MS6 A;  4S2M A;  3A3F A;  4S2I A;  4P6Z M;  4RX2 A;  2VLG A;  3LIC A;  5F82 A;  2RL3 A;  2MJ6 A;  1CEF A;  4LRZ E;  5HL6 A;  4M3K A;  5CGX A;  4P6B A;  3IF6 A;  2J9O A;  4FSF A;  3ZNT A;  5MC7 A;  3O5Y A;  5L2F A;  1MKI A;  1H3Q A;  1K6R A;  3RTY A;  2HDS A;  4O7D A;  1PNE A;  4N92 A;  4DXC A;  2B02 A;  2PR5 A;  2EFX A;  4K0X A;  1S6R A;  1KVM A;  3L7H A;  3IX3 A;  2IWC A;  2W1T B;  2J3T D;  2FH5 A;  2EA9 A;  3C7U A;  1XJ6 A;  3HCY A;  1GA0 A;  3NI9 A;  1T19 A;  3ZDJ A;  3DTK A;  3RH8 B;  3ZCZ A;  3WRZ A;  2HJE A;  5A93 A;  1TEM A;  3ZVT A;  4E3I A;  1BYW A;  3SH8 A;  3HJI A;  2CMN A;  2Y8H A;  5E2F A;  4PKY G;  4FUW A;  2Y2P A;  3P98 A;  5FA7 A;  5AQA A;  4F3L B;  1DP8 A;  2W3F A;  1DY6 A;  5L09 A;  3IS2 B;  2HP5 A;  1ES2 A;  2VJW A;  1CJF A;  2Y2K A;  3VP3 A;  4HI4 A;  4GB7 A;  4FH2 A;  2IA2 A;  5FI2 A;  3HLG A;  1K57 A;  3F1N B;  2OAP 1;  1CK3 A;  3W4O A;  3CWF A;  3RXX A;  3ICY A;  3G35 A;  1K56 D;  3HVF A;  1JWP A;  3N6I A;  4HJ4 A;  4BL3 A;  1VQQ A;  5F1F A;  3T1Q B;  4S2N C;  1W63 M;  1VHM A;  4JGQ A;  4X68 A;  2NUT C;  1HVB A;  1V9Y A;  3BYD A;  1JTD A;  1FSY A;  4PM8 A;  2M1C A;  4WN5 A;  3KSG A;  2XFS A;  2O9C A;  3G6O A;  4EEP A;  2VGL S;  3WRT A;  1SHV A;  2P9V B;  5E2H A;  1Q2Q A;  3PAE A;  4XT2 A;  3WS4 A;  3IS2 A;  3VOZ A;  1UWP X;  2Y55 A;  4EES A;  1PZO A;  3BM6 A;  4JGO A;  3CLO A;  1NRJ A;  3OOV A;  4N1H A;  1XFN A;  1QME A;  1XA1 A;  4FCF A;  4UEY A;  2ZJ9 A;  2J3W A;  3EGD C;  4I38 A;  3NOT C;  3S7O A;  2VZW A;  2W1T A;  5TFQ A;  4P6Z S;  4FD8 A;  1DJB A;  1W8Y A;  4IJG A;  1DP9 A;  4GDN A;  4IUK A;  1ACF A;  1K55 C;  2JE5 A;  1SDN A;  5CED A;  1BLC A;  1EWZ A;  4FH4 A;  1IYP A;  1STZ A;  1BUE A;  2B18 A;  1S67 L;  2E8J A;  2Y79 A;  2EXB A;  1PI5 A;  2X01 A;  3GV9 A;  2UWX A;  3NC8 A;  4JBF A;  5DFY A;  3UPN A;  5J7E A;  4L0L A;  1I2S A;  1GHP A;  4OP5 A;  3TE8 A;  3C4P A;  3O87 A;  3ITA A;  3VSK A;  1TDG A;  4ZJ1 A;  5TGF A;  5DKK A;  4G3V A;  3SH7 A;  3UE6 A;  5CHU A;  3NEC A;  4QWO A;  3HLC A;  4E04 A;  4NK3 A;  3A0V A;  5FDH A;  5HDD A;  3IH9 A;  4CLC B;  3TJZ C;  2JC7 A;  4GZB A;  5DTT A;  3PBS A;  4OVD A;  3LR5 A;  4QU3 A;  2GDN A;  4B4X A;  2WAE A;  1P97 A;  3OPH A;  4LGW A;  3QP2 A;  2VK3 A;  1IOU A;  4LCL A;  3K2N A;  2Z6D A;  5HAR A;  4NXF A;  5DFX A;  5KSH A;  4LV1 A;  4DJ3 A;  4JXW A;  2A49 A;  4B93 A;  3VFF A;  1K0K A;  4JGR A;  1NYY A;  4WLA A;  2HDQ A;  4MDZ A;  1G6A A;  4S2O A;  1BLH A;  4KZB A;  1KE0 A;  1H5X A;  3S4X A;  4CQH A;  3MQO A;  1MY8 A;  4KZ8 A;  2PR6 A;  1JNU A;  3BW6 A;  2QJ5 A;  4E3O A;  2VV6 A;  1ONG A;  1U60 A;  5EOE A;  5U47 A;  2W0N A;  3DTE A;  3IX4 A;  5KIZ A;  4S2J A;  3G30 A;  4G3K A;  4GJ4 A;  3LEZ A;  5EVI D;  4IED A;  5L8M A;  1DJC A;  5GHX A;  3IQA A;  3HUN A;  3VP1 A;  3T1R A;  4E3K A;  4KUO A;  3DTI A;  1K54 A;  1ZTU A;  3IXD A;  1NWZ A;  2ZBB A;  2VA0 A;  1K4F A;  3JVV A;  2Z2L B;  3G2Y A;  3EQV A;  4PPR A;  3OPR A;  3CG5 A;  1S4R A;  4KG2 A;  1J9M A;  1SZV A;  4JKT A;  4XXR A;  5HPF A;  4X53 A;  2XQZ A;  4OQH A;  3C2W A;  3IX8 A;  4JLF A;  4NEE D;  4BEN A;  2VGJ A;  2P9V A;  2PU4 A;  2R9W A;  2PD7 A;  5JYP A;  3O88 A;  3UN7 A;  4HHD A;  3E98 A;  3TOI A;  1I5Q A;  1K57 C;  1TD5 A;  4QHC A;  1LSX A;  2ZOI A;  3BFD A;  4F94 A;  4Y0T A;  2OWJ A;  3BFC A;  2PU2 A;  4E3N A;  4LCM A;  3T50 A;  4KUK A;  3K3C A;  3E4O A;  3IXG A;  2H10 A;  4BBV A;  2V9A A;  3C5A A;  3ITB A;  5KSC A;  4KZ3 A;  4PM6 A;  5GLB A;  1XX2 A;  5HWV A;  4WM9 A;  4CLC D;  4UHU A;  2OSU A;  5J8X A;  2WKI A;  2R9X A;  3CAX A;  4H6J B;  3TG9 A;  2W3G A;  5CEB A;  1KGF A;  2XDM A;  3Q82 A;  3UE1 A;  4OP8 A;  3LEQ A;  4DE3 A;  3C4O A;  4KQO A;  5EVE A;  1MZU A;  5HD3 A;  2ZMF A;  1RGY A;  4Y13 A;  4BWI A;  4WEK A;  1ES4 A;  1YSQ A;  3UNW A;  3ZG7 B;  1SKO B;  4R4R A;  5CTN A;  1MC0 A;  1N9N A;  1K6S A;  4MEZ A;  1JTG A;  1BLS A;  1YM1 A;  3A0R A;  3UB7 A;  3QP8 A;  5EVI A;  3C7V A;  4QJG A;  4LPZ A;  1OTD A;  4PMA A;  1H8Y A;  1TS7 A;  1XFQ A;  2LB5 A;  3GQZ A;  2IWB A;  3GEC A;  3S7Q A;  2WKE A;  4LRY C;  3PBO A;  2XLN A;  3T1S A;  3OCL A;  3W4Q A;  2V0W A;  4BMW A;  2L4R A;  4QPR A;  3T12 B;  4DDY A;  1TS0 A;  4EWF A;  5HWT A;  3WS2 A;  2EFU A;  2EWV A;  4R23 A;  1KDS A;  4R3J A;  3TRC A;  5CX7 A;  4BD0 A;  1S0W A;  1NYM A;  3HUO A;  4RYE A;  1Y4O A;  3ULF A;  3LUQ A;  1SKO A;  5I94 A;  1H8Z A;  4HES A;  3MZE A;  3KO6 A;  4ZTK A;  1K4E A;  3U2A A;  5E43 A;  4ZAM A;  4E6X A;  3N8S A;  4R3A A;  5FAO A;  4WYY A;  4YWZ A;  1N4O A;  3LGO A;  4UQI S;  1PWC A;  5F6A A;  3RFB A;  3H82 A;  1Z6F A;  4HJ6 A;  4ZRR A;  3SZT A;  3MFD A;  3KSI A;  1FCM A;  1QMF A;  5CGS A;  4DXB A;  1TDL A;  1LL5 A; 
#chains in the Genus database with same CATH homology
 4NXB A;  3CLO A;  5G4Y A;  1NRJ A;  3OOV A;  1XFN A;  3P01 A;  5HZH A;  2KX6 A;  2QHK A;  3TW8 A;  3IBR A;  1OT6 A;  4UEY A;  5K5B A;  4MMN A;  3FC7 A;  1V9Z A;  2J3W A;  2O99 A;  3EGD C;  4I38 A;  4DMZ A;  3NOT C;  2VKS A;  3S7O A;  2KDK A;  2VZW A;  2W1T A;  4HP9 A;  4P6Z S;  4O8G A;  4I3A A;  3B33 A;  1D7E A;  5IU1 A;  4IJG A;  1DP9 A;  4GS9 B;  4IUK A;  4WUJ A;  3MXQ A;  4L9G A;  4ETX A;  3PR6 A;  2L1M A;  1S4S A;  3VOL A;  4EEU A;  1S1Z A;  2A24 A;  3OCN A;  1LSV A;  2M7V A;  1STZ A;  3EWK A;  2A24 B;  2EWW A;  3T4J A;  1UWN X;  3UB9 A;  2XRO A;  3MF0 A;  4OOL A;  2B18 A;  4EQ1 A;  1S67 L;  3NHQ A;  2Y79 A;  2XA7 S;  3ZQ5 A;  5IS1 A;  4CLC C;  3B42 A;  4GS9 A;  1VB6 A;  1XJ2 A;  3PBR A;  4B9O A;  4HJ3 A;  5DF9 A;  3UB6 A;  3LIA A;  1T18 A;  5DFY A;  5J7E A;  4L0L A;  2PYR A;  2OOL A;  5AVF A;  3BQA A;  4EXO A;  2D01 A;  5F69 A;  4EUV A;  3TE8 A;  3LR3 A;  2D02 A;  3C8C A;  4PHT A;  2W27 A;  2OWH A;  2K31 A;  5DKK A;  5G4Z A;  4G3V A;  3MR0 A;  2JKR I;  3UE6 A;  4WF0 A;  4DN0 A;  3CI6 A;  1OT9 A;  2K2N A;  1NLY A;  4ME4 A;  4E04 A;  4H6J A;  3A0V A;  5HDD A;  4O01 A;  4CLC B;  2QKP A;  1X0O A;  3TJZ C;  5HWW A;  4EU0 A;  5F5Y A;  3R4K A;  1MKM A;  4L9F A;  4NXG A;  3PBS A;  2VV7 A;  4UQI M;  3LR5 A;  2VX8 A;  3P7N A;  2W3D A;  3FG8 A;  2HJ9 C;  2QWS A;  2H28 A;  5A8B A;  3H9W A;  3PHY A;  1EW0 A;  3MMH A;  3UME A;  2HV1 A;  4HY8 A;  4R70 A;  1OJ5 A;  1P97 A;  3HJK A;  1T1B A;  3KX0 X;  5C5K A;  1P0Z A;  1IOU A;  1P9R A;  2PHY A;  2PYP A;  3K2N A;  2K7S A;  4ARZ B;  3E0Y A;  4AFI A;  2Z6D A;  4O0P A;  4NXF A;  4G3W A;  5DFX A;  4F3L A;  5KSH A;  4CLC A;  3F1P B;  3T4O A;  3NJA A;  3OC2 A;  1ZHH B;  3LR0 A;  1F5M A;  5HD5 A;  4DJ3 A;  4M4X A;  4B93 A;  1W63 Q;  3R7W B;  4MN6 A;  4JGR A;  3IBJ A;  4WLA A;  3EEH A;  3D3O A;  5EFW A;  1OPX A;  3SW1 A;  4MDZ A;  4JGP A;  4YNR A;  2W3E A;  1NLZ A;  2JHE A;  3UB8 A;  4CQH A;  3MQO A;  4I3J A;  3EGX C;  3H82 B;  3C30 A;  3GDI A;  1YSP A;  2PR6 A;  1JNU A;  3BW6 A;  3PBQ A;  4CLC E;  2QJ5 A;  5I5L A;  2YKH A;  2VV6 A;  5IT5 A;  3KYQ A;  1OTE A;  3T4S A;  2W0N A;  3E4P A;  5KIZ A;  4YOF A;  4G3K A;  4GJ4 A;  3LIE A;  3VE4 A;  2VEA A;  3BY9 A;  3H7W B;  2WKQ A;  2KLI A;  2W3H A;  2M7U A;  5L8M A;  2V1B A;  3H7W A;  5HDC A;  2J3T C;  4WEL A;  4EW7 A;  2QYB A;  3LIF A;  4PKY A;  1LSW A;  1GSX A;  2J80 A;  4KUO A;  3OLO A;  4HH3 A;  5AJG A;  1ZTU A;  3PBT A;  3LYX A;  5DJU A;  1NWZ A;  1T1C A;  2GJ3 A;  1G6O A;  2ZBB A;  4HIA A;  3UE3 A;  4BBU A;  1T1A A;  2VA0 A;  4GHI A;  1WA9 A;  3JVV A;  3KYZ A;  2I9V A;  3VV4 A;  2XSS A;  5FL3 A;  3EQV A;  3VE3 A;  2WKP A;  1S4R A;  1UGU A;  3NOU C;  3BY8 A;  4HP4 A;  1DP6 A;  5F68 A;  1TS6 A;  1YAX A;  2P7J A;  5LBR A;  3LI9 A;  5HPF A;  2W1R A;  3D72 A;  1N9L A;  3MFX A;  3C2W A;  1H8M A;  4NEE D;  2VGL M;  3BWL A;  2PD7 A;  4Q0J A;  3S7N A;  5HPI A;  4EET B;  3UMD A;  2V1A A;  3EOI A;  2ZOH A;  2YKF A;  4IUH A;  4HHD A;  3E98 A;  3MJQ A;  1TD5 A;  1LSX A;  2ZOI A;  3KSH A;  1OTB A;  4K08 A;  3R7W A;  1S1Y A;  4I5S A;  5AVE A;  4Q0H A;  1D06 A;  2OWJ A;  3DBA A;  3S7P A;  3B47 A;  2O9A A;  1KOU A;  4I39 A;  4LRX C;  3T50 A;  4KUK A;  3K3C A;  3E4O A;  4Y5F A;  5HSQ A;  2NUP C;  3OBF A;  4BBV A;  2V9A A;  1S66 L;  3PYP A;  4MCW A;  4DJ2 A;  3JVU A;  4BBT A;  3T4L A;  4GW9 A;  3BJN A;  3NOP C;  2GNX A;  3ZYT A;  4R6L A;  4MN5 A;  3LI8 A;  3F1O A;  1F98 A;  5HWV A;  4P6Z M;  4GCZ A;  4CLC D;  2INW A;  2VLG A;  3MQ0 A;  3LIC A;  4WL9 A;  2QJ7 A;  3LFV A;  4Q0I A;  4II7 A;  4XT2 B;  2MJ6 A;  4HQA A;  3CAX A;  4H6J B;  4LRZ E;  5HL6 A;  4ETZ A;  4HOI A;  3T4Q A;  2W3G A;  2JKR M;  4FOF A;  1OJG A;  2HF6 A;  3PXP A;  4FSF A;  2HGV A;  5MC7 A;  3O5Y A;  1GSV A;  3W2Z A;  4KQO A;  2XA7 M;  1H3Q A;  1MZU A;  5HD3 A;  4Y2F A;  3RTY A;  3LIB A;  2V0U A;  3BQ8 A;  2ZMF A;  4BWI A;  1G28 A;  2XRN A;  4WEK A;  2A2L A;  3V67 A;  1YSQ A;  2O9B A;  3LR4 A;  3CIT A;  2B02 A;  2PR5 A;  2WKR A;  1MC0 A;  1N9N A;  4NXE A;  4BJP A;  4ARZ A;  1YKD A;  4EER A;  4L9E A;  3A0R A;  2W1T B;  3FPW A;  2J3T D;  3UB7 A;  2FH5 A;  3F1P A;  4OOM A;  1XJ3 A;  1ODV A;  2EA9 A;  4WEJ A;  1XJ6 A;  4LPZ A;  3E4Q A;  3HCY A;  1OTD A;  3A0S A;  1OTI A;  1T19 A;  4NKP A;  1TS7 A;  1XFQ A;  2PT7 A;  5TBM B;  3RH8 B;  1TF1 A;  2Z6C A;  2LB5 A;  4HNB A;  2HJE A;  4HH2 A;  2O0Y A;  2P04 A;  3GEC A;  1TS8 A;  3S7Q A;  2GZA A;  4Z1W A;  3T4K A;  4LRY C;  3PBO A;  4GLQ A;  2OAQ 1;  1BYW A;  3HJI A;  4RQ9 A;  3FPV A;  4Y3I A;  2CMN A;  2PDR A;  3OCL A;  4BMW A;  2V0W A;  2L4R A;  4QPR A;  2Y8H A;  4PKY G;  4LLO B;  4MN7 A;  3C38 A;  4R38 A;  1TS0 A;  3F1N A;  1F9I A;  4F3L B;  5HWT A;  1DP8 A;  2W3F A;  1XJ4 A;  2VV8 A;  3IS2 B;  3KSF A;  2DMW A;  2VJW A;  3F1O B;  2L0W A;  3K3D A;  2EWV A;  4GHI B;  3EEA A;  3TRC A;  5CX7 A;  4HI4 A;  4I3I A;  5HDS A;  2BAS A;  3CUE C;  1DRM A;  3ULF A;  2JKT M;  2IA2 A;  3LUQ A;  3PBN A;  3F1N B;  2OAP 1;  2PD8 A;  3CWF A;  5DJT A;  5J3W A;  3ICY A;  3KO6 A;  4HJ4 A;  3EQU A;  4KQD A;  2JKT I;  3U2A A;  2G7U A;  1W63 M;  1VHM A;  2R78 A;  3LID A;  4JGQ A;  3CUE A;  4R3A A;  2NUT C;  3MQQ A;  1LL8 A;  2P08 A;  2ZMV A;  1V9Y A;  1P9W A;  5TBM A;  4YWZ A;  1LT0 A;  4WN5 A;  2M1C A;  4IHQ A;  3KSG A;  1OTA A;  1IFQ A;  2O9C A;  2KOI A;  2GX5 A;  4UQI S;  3G6O A;  5F6A A;  1N9O A;  3RFB A;  2VGL S;  4EEP A;  3H82 A;  5J4E A;  2FZ0 A;  3T4T A;  4HJ6 A;  2LB9 A;  4XT2 A;  3IS2 A;  4PAU A;  4ZRR A;  2JN7 A;  1GSW A;  1UWP X;  3KSI A;  4EES A;  1Y28 A;  5TJJ A;  4JGO A;  5DKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...