2B18A

N-terminal gaf domain of transcriptional pleiotropic repressor cody.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 48
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b18A00
2O99A 4ZRRA 4IUKA 4GW9A 5HL6A 2VKSA 3S7QA 4E04A 3E98A 4Y5FA 3TRCA 4Q0JA 2K2NA 4RQ9A 4O01A 4MCWA 4MDZA 2W1TB 2M7UA 3NOPC 3KSGA 3NOUC 3DBAA 2W3HA 4O0PA 2ZMFA 4G3VA 1MKMA 2O9BA 3NOTC 4BWIA 2LB9A 3NHQA 3CI6A 2QYBA 3MF0A 4R6LA 5DFXA 2K31A 4LRXC 4MN7A 2W3GA 4Y3IA 1F5MA 4CQHA 3EEAA 2M7VA 3G6OA 4PAUA 3K2NA 3D3OA 2O0YA 2W1RA 2OOLA 5C5KA 3KSFA 2O9CA 3O5YA 4FOFA 2KLIA 2W3EA 2G7UA 5DFYA 4Z1WA 2KOIA 4EU0A 1YSQA 3E0YA 4MMNA 4ME4A 2B18A 3R4KA 3OBFA 1YSPA 5HSQA 5HPIA 1YKDA 1VHMA 4IJGA 2IA2A 4GLQA 4LRZE 3S7PA 3MQ0A 2XSSA 3ZQ5A 1MC0A 2VEAA 4G3KA 2VZWA 2Y79A 2GX5A 3W2ZA 4YOFA 3IBJA 5L8MA 3MMHA 5I5LA 4DN0A 4Q0HA 2W1TA 3CITA 1ZTUA 4LRYC 2HGVA 4IUHA 2W3FA 3IBRA 1STZA 3KSIA 2W3DA 3LFVA 4Y2FA 4R70A 2XRNA 4QPRA 3S7OA 3OOVA 4EUVA 3KSHA 3KO6A 4ETZA 3HCYA 4YNRA 1TF1A 3VV4A 3BJNA 2O9AA 4G3WA 3S7NA 4DMZA 2LB5A 4Q0IA 5K5BA 2Y8HA 3C2WA 4ETXA 5TJJA 5HPFA 2VJWA 4O8GA 1TD5A 5LBRA 3RFBA 2XROA 5AJGA
chains in the Genus database with same CATH superfamily
3A3FA 2A2LA 2VKSA 5J8XA 3Q1FA 2DNSA 2K2NA 5EFWA 3T4KA 4R38A 1MWUA 4NXBA 4X68A 1L0GA 4WEJA 4BLMA 3L9KA 3NOTC 2ZQ9A 5DTKA 4I3IA 2EA9A 4GKUA 3C38A 2H28A 4RX3A 5CEDA 2ZOHA 1GHPA 4JBFA 1RCJA 3ZFZA 3A3IA 3T1XA 5GHXA 4HESA 3IF6C 1FSYA 1YSPA 5GLAA 1PW1A 4LV2A 3TE8A 1MWRA 5HX9A 5EVLA 3IH9A 4G3KA 4F94A 3Q7ZA 1BLCA 2VGLM 2ZC5B 4BD0A 3UDFA 1OTDA 4X6TA 3EOIA 4CJNA 2I9VA 4GNUA 4JGQA 2H5SA 1GSWA 5EUAA 2QKPA 3IX4A 1TS0A 2HV1A 4XT2B 3BM6A 3RJUA 3TJZC 1BTLA 4MNRA 4DXBA 2Y4AA 3N8SA 1TF1A 1S66L 5HD5A 4KZ6A 4EV4A 1H8MA 3I7JA 5CTNA 2JBFA 2PD7A 4BL3A 4AFIA 2Y2JA 1IYPA 2Y2OA 1E3UD 2WKRA 3LI8A 4UA7A 4Y15A 2W1TB 2RCXA 3EQUA 3DWKA 1CI9A 2X01A 5M19A 1TDGA 2HZ5A 4HOIA 1WA9A 3IF5A 4R4RA 2XGNA 3EEHA 1DP9A 5GHZA 5FSRA 4QHCA 4U0XA 2J3TC 4DDYA 2O0YA 3Q7VB 1K55A 2O9CA 1P97A 1XJ6A 1ZHHB 2G7UA 5G18A 1L3LA 1TVFA 1W7FA 4L9GA 3UNWA 4K0XA 5FASA 3S22A 5KZHA 3H9WA 1DY6A 3ZVWA 3HLWA 5HWVA 3OLOA 5HPIA 5CERA 1YLTA 5CGSA 2HJEA 3HUOA 2ZM2A 2P74A 1HLUP 3WS4A 2WAFA 3H82B 3ZDJA 1IEMA 2DRWA 2A24A 1Z09A 1KVMA 3IXGA 1E3UA 2WAEA 2DMWA 1VETA 1EI5A 4R70A 5G4ZA 3QP6A 5HWTA 4HBUA 1ES4A 1E25A 3UDXA 3BW6A 3WS2A 1K54C 3DAVA 4KG5A 4Q0IA 3VOLA 3GECA 3BRMA 3C2WA 3G34A 4OPYA 4DDSA 5AQAA 4IUKA 3JYIA 1X0OA 4QJGA 3UB6A 3NOUC 3MXQA 1PWCA 4CLCB 1W63M 1KVLA 4FD8A 1K6SA 4XXRA 3GR2A 3UY6A 2VA0A 1XJ3A 1TS7A 3ITBA 3E2LA 4CLCE 3MF0A 1ZC2A 1JTDA 4MN7A 3E4PA 1F5MA 3AGEA 3FPWA 1IKGA 4EUZA 4ID4A 4WUJA 2P04A 2M7VA 3LEZA 3UB7A 2XA7S 4BBTA 1S0WA 1RP5A 3KYZA 3S4XA 3HLFA 4QU3A 4WLAA 3BY9A 4H6JB 4BMWA 1T18A 3NY4A 1XFQA 2ZL1B 1CF0A 1DJBA 4PKYG 4EESA 3LR4A 1NJ4A 1Y28A 1ERQA 2HJ9C 3UE0A 4RVAA 1W8QA 1O7EA 2GZAA 4P0MA 4EERA 3GDIA 1ESIA 3OC2A 5FEFA 4WMCD 2R9WA 2GX5A 5EV0A 1J9MA 2OLVA 5U47A 3KYQA 2PHYA 4S2OA 4KZ4A 1YLWA 1I5QA 3IWIA 4NK3A 5M1AA 3HCYA 4RYEA 2QHKA 4GDNA 4G3WA 2ZMVA 2LB5A 4E3MA 4EQ1A 4ETXA 4UHUA 4Y13A 3MJQA 3RFBA 3SH8A 3UMDA 3FZCA 1OMEA 2X02A 4U0TA 4B93A 2WGWA 3GV9A 4UEYA 5FEGA 1S4RA 4JF4A 2OSUA 3PAEA 2X71A 4F3LA 4II7A 5CHMA 5GLBA 4GD8A 4K0WA 4WZ5A 4D60A 1NWZA 4P85A 1M40A 1XX2A 4P6BA 4BBUA 4HI4A 2K31A 2JN7A 3HLDA 1NY0A 3LR3A 3G6OA 3K2NA 3PBTA 3D3OA 4FOFA 1XGJA 1FILA 1PI5A 5AQ7A 3RXXA 5BOHA 2XA7M 5F5YA 1RGZA 4ME4A 4K91A 3CPTB 3U2AA 1S6RA 2WK0A 4K08A 4Y0OA 3G35A 2VK3A 4KUOA 2EFXA 3MQ0A 2IWBA 3QHYA 3GVBA 2XFTA 1JWZA 1DP6A 3A0SA 5EM0A 4GN2A 5HAPA 2EFUA 2W1TA 3PBSA 4OOMA 3ITAA 1N9OA 3IS2A 4EETB 1ESUA 2J80A 4HY8A 3VMAA 4OVDA 4UA9A 1ES2A 5EOOA 2P9VB 1G68A 1S1ZA 1ES3A 4UA6A 3S7NA 4Y0TA 1N9NA 4OONA 4ZBEA 5TJJA 4JPMA 3NECA 5AQ9A 5FA7A 5LBRA 1LL8A 1PZOA 3LY4A 5KSCA 3C4PA 3E4OA 3H7WB 2ZBBA 1ERMA 1LHYA 3E98A 4CLCD 1H8YA 3IX3A 3HLCA 3NOPC 2WYXA 4DE0A 2A49A 1P0ZA 3IXHA 1H3QA 3LUQA 3SH7A 1F98A 2W3GA 3H82A 2KX6A 1LSWA 4DE3A 5IT5A 2Y2GA 4DE2A 4S2JA 1K57A 5C5KA 3KSFA 5CGXA 3MBZA 5TR7A 1VM1A 4LGWA 1OPXA 3VE4A 2EWWA 4IJGA 3T4QA 3E4QA 4GLQA 5FQKA 4JLFA 5EVIB 4DJ3A 3T1QB 5HL1A 1GSXA 2VZWA 3C4OA 3CG5A 3M2KA 4PM9A 3T1SA 1FQGA 1YPRA 4JXSA 1MWSA 4CLCA 5CTMA 5E43A 2VX8A 4NETA 2JKFA 5FQQA 2PR5A 4P6ZS 3KSHA 3KX0X 2Y59A 3BECA 2FFYA 3ZNYA 4YNRA 3VFHA 3SS4A 4ZJ1A 4S2NA 2E8JA 1NZOA 1IKIA 4N9LA 2WZZA 3IF6B 3V67A 1K55C 1NLZA 3PBRA 1EROA 2ZL1A 5A90A 2Y2KA 2WKPA 4MBFA 3LYXA 1SCWA 3MQOA 3IT9A 4WF0A 4NXFA 3SZTA 4X25A 4U3TA 2XQZA 3N8RA 5GHYA 3OCNA 3GMWA 2PU2A 3BQ8A 4LRXC 2R78A 3EGDC 4Y3IA 4IVKA 3HLEA 3LR0A 3UDIA 3DTIA 4PAUA 1RGYA 5GLDA 3IXDA 4ARZB 2PRFA 3O88A 1TS8A 3HUNA 4X55A 5DFYA 4GJ4A 3WS0A 4LV0A 4UQIS 3R7WA 1YSQA 3E0YA 2ZQCA 3JPUA 3AGDA 3HLGA 5DF8A 1JWVA 3HL9A 2XSSA 2VEAA 4R23A 3TOIA 4KQOA 5E2EA 1VEUA 4N1HA 2ZC7A 3IBJA 3MMHA 3F1PB 4B88A 3G32A 1Y54A 3LIBA 5CX7A 2OLUA 2J9OA 3OOVA 5FI2A 4I3AA 4ETZA 4OPQA 4IBXA 2RL3A 2EX6A 3LIDA 5FL3A 5HPFA 2PT7A 4HHDA 4HEFA 3G2ZA 5J4EA 5HL6A 3GQZA 4O01A 1G5UA 5FQIA 3BFEA 2K7SA 4FUWA 4Y7PA 2ZC6B 5AVFA 1FSWA 1V9YA 3N7WA 1ALQA 4ZDXA 4GS9B 4MLLA 3B33A 3WRTA 5FQJA 5J3WA 1DP8A 1Q2PA 1O07A 4KQRA 4EXOA 3FV7A 3NI9A 2Z2LB 3VP3A 2P9VA 3QP1A 3BLMA 1BLPA 5EVID 1KDWA 5HSQA 3UE6A 3LR5A 3IQAA 5IHVA 3U4LP 1QMEA 1IELA 3F1NB 4KZ7A 2V20A 4X56A 1P9WA 1PI4A 4WEKA 2R9XA 4DXCA 3VOZA 5KSHA 1H5XA 2JE5A 4GOGA 4OPRA 2G2UA 5FDHA 4HJ4A 3DTKA 3MXSA 2WADA 2EXAA 1G6OA 4WZ5C 3HVFA 4EUVA 5J7EA 2NUPC 1PZPA 4QB8A 2Q9NA 1KGEA 1I2WA 2V1ZA 4XUXA 5HWWA 4E3IA 2ZMAA 5K5BA 1XJ2A 5CXWA 5AQBA 3T4LA 4OPZA 4WELA 4BQMA 1W5DA 2E8IA 4L9EA 3Q81A 3IH8A 3V50A 5MC7A 4YWZA 4OH0A 3KSGA 4ZTKA 2XH9A 2ZD8A 3WRZA 4O0PA 5FAPA 1TS6A 3T4JA 5TFQA 5EVIA 4BWIA 3V3SA 4KENB 3W4OA 5G4YA 2EWVA 1PYYA 3VP2A 4GB7A 3SW1A 4JXGA 4E3KA 2YKFA 3M2JA 1PFLA 5L2FA 3MZEA 1NZUA 2BLSA 1JNUA 2Y2PA 4OLGA 1KE0A 2M1CA 1N9BA 5FQMA 4EW7A 3O86A 1V9ZA 3DW0A 3S7PA 2V1BA 2HP5A 3IF6A 3UE1A 2WUQA 4FH4A 3OPHA 3QNCA 4OQGA 3W2ZA 3P7NA 4KZ5A 3QNBA 4NXEA 3LCEA 4DN0A 4GDBA 5HZHA 2HDQA 1KE4A 4S2PA 4UAAA 3MSHA 1STZA 3MXRA 1IFQA 4Y2FA 2J3TD 2XRNA 2FFFB 5DTSA 5DJUA 3EGXC 4WN5A 2JKTM 3WS1A 1GHMA 4BJPA 1CEGA 3BJNA 2O9AA 4QD4A 1OJGA 1AWIA 5EM1A 2IWDA 2PAVP 2L0WA 4ARZA 5F6AA 5AVEA 3C7UA 4GHIB 2IWCA 3CZDA 4GW9A 4C6YA 3TRCA 2B5RA 3TG9A 3G31A 4JGPA 2PBDP 1MY8A 2XR0A 4R3AA 2W3HA 3GTCA 1NLYA 4R4SA 5JYPA 1P9RA 1YLJA 2WKHA 5TBMB 2VGKA 1K38A 4XUZA 4P87A 1F2KA 4WM9A 2W3EA 4EEPA 3V5MA 3K3CA 2XLNA 1BYWA 1LLBA 4X1LA 1SDEA 1I2SA 1OTEA 4KZBA 4S2NC 3HJIA 3MZDA 3UN7A 1WYCA 4WMCA 3EWKA 3BFDA 4KZAA 1YM1A 2V0WA 2ZQDA 3IWOA 1YMXA 3BY8A 1VB6A 4KZ9A 2BASA 4XT2A 4S2LA 3ZHHA 3OPPA 3UO9A 2VV7A 4Z9QA 3CITA 1BLHA 1BULA 4JXVA 3PYPA 5E2FA 3UMEA 3UPOA 3CWFA 3IHAA 4E3LA 2C5WB 4QPRA 5GLCA 1XJ4A 4OP8A 3TSGA 1LSXA 1Z6FA 3LI9A 4GS9A 3OPRA 1VQQA 4H8RA 1W63Q 4E6XA 1DRMA 2OAP1 2PBYA 4OQIA 1GA9A 2XEPA 4EEUA 2OAQ1 4E04A 4Q8IA 4L9FA 3NC8A 3LO7A 1YQSA 1MBLA 2M7UA 3M6BA 2FZ0A 2JKTI 3TW8A 4LV3A 1W79A 3F1NA 5A8BA 2LB9A 1K4FA 2GDNA 3Q7VA 4I3JA 4CQHA 5CRFA 3CHWP 1OTIA 1OT6A 3DWZA 2YKHA 5KIZA 4B4XA 3K3DA 3VFFA 3UB8A 3T4OA 5EOEA 1JVJA 2ZQAA 3SH9A 2EX9A 1G6AA 1A0KA 4QY6A 4EU0A 4BD1A 1ZKJA 3MFXA 2WKIA 4PM7A 4HQAA 1EWZA 4LRZE 2OWJA 3ZQ5A 2JKRI 3G2YA 2Z2MB 4B4ZA 2UWXA 2L4RA 1HZOA 1WE4A 4PHTA 3FWLA 4IBRA 3CUEA 4O7DA 4JGOA 3CAXA 3VP1A 4KQDA 2PD8A 4N92A 3BFFA 3MQQA 3IBRA 3PTEA 2A24B 1BUEA 4I5SA 3LGOA 3JVUA 3KO6A 3NBLA 4JXWA 3CLOA 4N1XA 1VETB 1LL5A 2QJ7A 1LT0A 5KMWA 4KG2A 5HW3A 2V8CA 2ZC4B 4FSFA 1TD5A 2XROA 4Y0UA 3ZG5A 3GSGA 3SS3A 4MCWA 4MDZA 2WGIA 3N4IA 4X53A 3FKWA 3O87A 2P7JA 2MJ6A 3M6HA 2Y91A 2OV5A 1SKOB 4G3VA 4ZJ2A 4C3QA 2HF6A 2VGLS 5CHUA 1CI8A 4S2KA 4IEDA 2WKQA 4H6JA 1KOUA 1KGFA 1HVBA 3MKFA 1M6KA 4GCZA 3CJMA 2OOLA 1XA1A 3O5YA 1SKFA 3T4TA 1G28A 4KUKA 1S1YA 2KOIA 4FTXA 4E3NA 1BZAA 2KDKA 2QJ5A 1VHMA 4WL9A 5L09A 3ZG7B 3RH8B 3T50A 4OKPA 4ZAMA 4GHIA 1CK3A 4M4XA 1Q2QA 3Q07A 4DE1A 3LIFA 1ZTUA 4LRYC 2HGVA 1N9LA 3HJKA 3LFVA 4HH2A 5EVIC 5DF9A 4WZ4A 1HD8A 2V9AA 3T12B 3SOIA 1NRJA 3NJAA 2JCHA 5TBMA 5CGWA 3RXWA 3NIAA 1PW8A 1XP4A 3ISGA 3OZHA 4BL2A 1PIOA 2W27A 5GL9A 1GHIA 4LFUA 4R0QA 2O99A 3S7QA 4PMAA 3HBRA 3B3XA 3MKEA 4IVIA 3P09A 4IHQA 1GCEA 1PWDA 2XDMA 4DKIA 1IYOA 3BFGA 2WGWB 4NG2A 1JWPA 4RA7A 3WWXA 1PNEA 3V39A 1FR1A 1SHVA 5F1FA 4P6ZM 5HDCA 2WKEA 3T4SA 3CI6A 2QYBA 3MFDA 1S4SA 2B02A 2FH5A 3GRJA 1K4EA 4F3LB 2BTFP 4PM8A 4C75A 3UB9A 3CPTA 2EX8A 1D7EA 3OCLA 4EBNA 5HDSA 4OQHA 3G4PA 4Z1WA 5L10A 3LIEA 3HLBA 4S2MA 3MR0A 1MWTA 1K25A 1D06A 1OTBA 3C5AA 2ZOIA 2HDSA 1S67L 1XPBA 4E3JA 1EW0A 2DCFA 2Z6DA 2HPBA 2OWHA 4MEZA 3A3EA 3AGFA 2JKGA 2GJ3A 2QMIA 2QWSA 2ZJ9A 4EBLA 2V2FF 5I5LA 5FATA 2P08A 4DJ2A 5F82A 4Q0HA 1L0EA 3C8CA 4IUHA 1YT4A 3PXPA 5I94A 3FPVA 1AXBA 3VE3A 2GNXA 5EECA 1T1CA 1WYBA 3ZCZA 4UQIM 3IS2B 2AVXA 1CQAA 1LSVA 3H7WA 1NXYA 3W4QA 5FQ9A 3P98A 3EQVA 2VJWA 3PBNA 3ZNTA 2ZM8A 3DTEA 4ZRRA 2VV8A 5E2GA 2L1MA 4Y5FA 1K56D 4WBGA 1MXOA 3IX8A 3A0VA 1NYMA 2Y2NA 5A92A 1MKMA 4NEED 1ZG4A 4EQIA 2HDUA 1JTGA 3VP4A 1FCOA 4M3KA 4E6WA 4PM5A 4LV1A 4FH2A 4QY5A 3C30A 2QPNA 3NULA 1IYQA 2KLIA 3W4PA 1C3BA 3PR6A 5EE8A 4FCFA 2B18A 3QP4A 1L2SA 1YKDA 5F68A 1FCMA 2G2WA 1BLSA 3ZVTA 2XF3A 1KGGA 4LENA 1XXMA 2Y79A 1ODVA 1ZG6A 3DTMA 3VOYA 3QP8A 1K56A 2Y2MA 4RX2A 5D3OA 3L7HA 2Y2LA 3BLSA 1SKOA 5EVEA 5HARA 3JVVA 1SDNA 1YLYA 2ZQ8A 4DMZA 2Q9MA 1NYYA 4R1GA 5HD3A 1XGIA 1OJ5A 4ZJ3A 4KZ3A 4X1MA 4NXGA 5AJGA 2CC1A 3LY3A 2VV6A 5L07A 3F1OB 4RQ9A 1H0MA 1LI9A 1YLPA 4ESPA 4HNBA 1NRFA 1BSGA 2J7VA 2J3WA 2O9BA 3NHQA 1K57C 1PRQA 4KQQA 3FC7A 3FYZA 1MZUA 4R6LA 1XA7A 3CUEC 2H0TA 5DKLA 4EBPA 1OT9A 4OLDA 1L0FA 2EXBA 4X69A 3VSKA 5FI6A 4I38A 2PU4A 3QP5A 3NDGA 1FOFA 3ZYTA 4LPZA 4HBTA 3VSLA 4S2IA 2JKRM 3R7WB 1MC0A 3F1PA 1TEMA 4CLCC 1U60A 4JKTA 4HJ3A 1IYSA 3ZGAB 3D4FA 4PPRA 3BQAA 2HP6A 4YINA 2W3FA 1UWPX 1VEUB 2PDRA 3ICYA 4HP9A 4OP5A 3UB5P 4BENA 2WZXA 2NUTC 4N9KA 2XFSA 3ULFA 1W8YA 5IS1A 4EWFA 1N4OA 5M18A 1ONHA 5F69A 1T19A 2JC7A 2VLGA 3V3RA 3VV4A 4OOLA 2Y8HA 4LCLA 1ONGA 4GZBA 4L0LA 4HP4A 1YAXA 4Q0JA 4R3BA 3BYDA 2ZLYA 2I72A 3PHYA 1L0DA 3PAGA 2QZ6A 5TGFA 5HAQA 3G30A 2J9PA 3LEQA 1UWNX 2Z6CA 2ZMFA 2WGVA 3B47A 3IWQA 5DF7A 1QMFA 3QP2A 4B9OA 1TDLA 4KG6A 5JYOA 1K54A 1F9IA 1YLZA 2D02A 2H10A 5DJTA 5FI7A 4MBHA 3NDEA 1IOUA 2XK1A 1K6RA 2Y2QA 5HAIA 4HH3A 4DF6A 3D72A 2ZC3B 2Y2HA 4MMNA 3LIAA 2A3UA 2J8YA 3R4KA 3OBFA 3SS5A 4LLOB 5F83A 1GA0A 3A0RA 4A5RA 1E4DA 4HJ6A 2IA2A 1FIKA 3LICA 3RTYA 5A93A 4OOYA 3CMZA 1UGUA 4YFMA 3MS6A 1KE3A 1OTAA 3UPNA 5L8MA 4CPKA 2ACGA 1PWGA 2XD1A 3MZFA 3O3VA 5DTTA 3A3DA 4JF6A 3KSIA 3KYEA 3VP0A 2W3DA 4NKPA 5DKKA 5E2HA 1DJCA 1CEFA 5CECA 3FG8A 3E2KA 4MBKA 4OQ0A 2V1AA 4DRTA 5A91A 5DVAA 2HP9A 3C7VA 4E3OA 3NCKA 2C6WB 2PYRA 1H8ZA 1T1BA 4GD6A 3T1RA 4HIAA 2ZM0A 3P01A 4MN6A 1FCNA 2V8FA 1KDSA 2PR6A 4LCMA 3DBAA 2EX2A 1GSVA 2Q0OA 5FDSA 4WYYA 2ZQ7A 2UV0E 2HDRA 1Y4OA 5DFXA 2JHEA 3FKVA 3HREA 5CHJA 1FR6A 2CMNA 2Y2IA 3ZG9B 5EPHA 3ZG0A 3EEAA 1XFNA 5FAOA 3B42A 3D9YA 3HUMA 4JF5A 2BG1A 1DJAA 2W1RA 2H0YA 5FAQA 5IU1A 4R3JA 3IXBA 4KZ8A 3BEBA 2B95A 3PBOA 3OPLA 2VGJA 3WS5A 3A3JA 3UE3A 1BT5A 2INWA 4QWOA 4PKYA 3PBQA 1ACFA 3BWLA 5F1GA 3N8LA 1HTZA 2D01A 1T1AA 4JGRA 1K0KA 1YMSA 3BFCA 4MN5A 1J3WA 1MKIA 1ES5A 2Y55A 1LL9A 4YOFA 3F1OA 3UPPA 3N6IA 3ZG8B 3W8KA 1LI0A 1SZVA 5CEBA 2V0UA 3S7OA 1CJFA 1MPLA 5HDDA 1D1JA 5HFOA 3Q82A 4BBVA 2XD5A 4I39A 1XKZA 2W0NA 4Y17A 4O8GA 4PM6A 4D2OA 3S1YA 2PYPA 3IHBA
chains in the Genus database with same CATH topology
3H7WB 2ZBBA 4ZRRA 2A2LA 2VV8A 4GW9A 2VKSA 2L1MA 3E98A 4Y5FA 3TRCA 4CLCD 2K2NA 5EFWA 3T4KA 4R38A 4NXBA 3NOPC 4JGPA 4WEJA 3A0VA 4R3AA 2W3HA 1NLYA 1MKMA 3NOTC 4NEED 1P0ZA 1H3QA 3LUQA 4I3IA 1F98A 2EA9A 1P9RA 2W3GA 3H82A 2KX6A 5TBMB 1LSWA 5IT5A 3C38A 2H28A 3C30A 2ZOHA 5C5KA 3KSFA 2KLIA 2W3EA 4EEPA 3PR6A 3K3CA 1BYWA 1OPXA 3VE4A 2B18A 2EWWA 1YSPA 1OTEA 1YKDA 4IJGA 3HJIA 5F68A 3T4QA 3E4QA 3EWKA 4GLQA 1LL8A 3TE8A 2V0WA 4G3KA 4DJ3A 1GSXA 3BY8A 1VB6A 2VGLM 2VZWA 2Y79A 1OTDA 2BASA 4XT2A 1ODVA 3EOIA 2I9VA 4JGQA 1GSWA 2VV7A 2QKPA 3CITA 3PYPA 3UMEA 1TS0A 2HV1A 4CLCA 3CWFA 4XT2B 2VX8A 4QPRA 3TJZC 1XJ4A 2PR5A 4P6ZS 3KSHA 3KX0X 3JVVA 1LSXA 3LI9A 4YNRA 4GS9A 1TF1A 1S66L 5HD5A 4DMZA 1H8MA 1W63Q 5HD3A 1OJ5A 1DRMA 2PD7A 3V67A 2OAP1 1NLZA 4AFIA 4NXGA 5AJGA 3PBRA 4EEUA 2VV6A 2OAQ1 3F1OB 4E04A 2WKPA 4L9FA 2WKRA 3LI8A 3LYXA 4RQ9A 2W1TB 2M7UA 3MQOA 4WF0A 2FZ0A 3EQUA 2JKTI 4NXFA 4HNBA 3TW8A 2J3WA 3F1NA 2O9BA 5A8BA 4HOIA 1WA9A 2LB9A 3NHQA 3OCNA 3FC7A 3BQ8A 1MZUA 4R6LA 4LRXC 2R78A 3CUEC 3EGDC 4Y3IA 4I3JA 5DKLA 3LR0A 4CQHA 3EEHA 1OT9A 1DP9A 4PAUA 1OTIA 1OT6A 2J3TC 2YKHA 4ARZB 5KIZA 2O0YA 1TS8A 4I38A 2O9CA 3K3DA 1P97A 1XJ6A 1ZHHB 2G7UA 3UB8A 3T4OA 5DFYA 4L9GA 4GJ4A 3ZYTA 4LPZA 4UQIS 3R7WA 3H9WA 4EU0A 1YSQA 3E0YA 5HWVA 3OLOA 3MFXA 5HPIA 4HQAA 2JKRM 4LRZE 2HJEA 2OWJA 2XSSA 3ZQ5A 3R7WB 2JKRI 1MC0A 2VEAA 3F1PA 2L4RA 4KQOA 4CLCC 3H82B 4PHTA 3CUEA 2A24A 4HJ3A 4JGOA 3CAXA 3IBJA 3MMHA 4KQDA 2PD8A 3F1PB 3BQAA 3MQQA 2W3FA 1UWPX 2DMWA 3LIBA 3IBRA 2PDRA 5CX7A 3ICYA 4HP9A 4R70A 2A24B 5G4ZA 4I5SA 2NUTC 3OOVA 4I3AA 5HWTA 3ULFA 3JVUA 3KO6A 3BW6A 4ETZA 5IS1A 3CLOA 5F69A 2QJ7A 1T19A 2VLGA 3VV4A 1LT0A 3LIDA 5FL3A 4Q0IA 3VOLA 4OOLA 3GECA 2Y8HA 3C2WA 4FSFA 2PT7A 5HPFA 4HHDA 1TD5A 2XROA 4L0LA 4IUKA 5J4EA 4HP4A 5HL6A 1YAXA 4Q0JA 4O01A 4MCWA 4MDZA 3PHYA 1X0OA 3UB6A 3NOUC 3MXQA 4CLCB 1W63M 2P7JA 2K7SA 2MJ6A 1UWNX 2Z6CA 2VA0A 2ZMFA 1XJ3A 1TS7A 5AVFA 4G3VA 3B47A 1V9YA 4CLCE 2HF6A 2VGLS 3MF0A 4MN7A 4B9OA 3E4PA 1F5MA 3FPWA 2WKQA 4GS9B 4H6JA 1F9IA 1KOUA 2D02A 3B33A 4WUJA 2P04A 5DJTA 2M7VA 5J3WA 3UB7A 1DP8A 2XA7S 4GCZA 4BBTA 1IOUA 3KYZA 2OOLA 4EXOA 4WLAA 3O5YA 3BY9A 4H6JB 3T4TA 4BMWA 1T18A 1XFQA 1G28A 4KUKA 4HH3A 1S1YA 3D72A 4PKYG 2KOIA 4EESA 3LR4A 4MMNA 3LIAA 3R4KA 3OBFA 1Y28A 2KDKA 2HJ9C 2QJ5A 4LLOB 3A0RA 5HSQA 3UE6A 1VHMA 2GZAA 3LR5A 4WL9A 4HJ6A 2IA2A 3LICA 4EERA 3GDIA 3OC2A 3F1NB 3RTYA 3RH8B 3T50A 1P9WA 1UGUA 4GHIA 2GX5A 4M4XA 4WEKA 1OTAA 5L8MA 5KSHA 3KYQA 3LIFA 1ZTUA 2PHYA 2HGVA 4LRYC 4HJ4A 1N9LA 3KSIA 3HJKA 2W3DA 3LFVA 4HH2A 4NKPA 1G6OA 5DKKA 4EUVA 5DF9A 5J7EA 2NUPC 2V9AA 3FG8A 1NRJA 3HCYA 2V1AA 3NJAA 2QHKA 5TBMA 5HWWA 4G3WA 2ZMVA 2LB5A 5K5BA 1XJ2A 4EQ1A 4ETXA 2W27A 3MJQA 3RFBA 2PYRA 3T4LA 3UMDA 4WELA 2O99A 1T1BA 4B93A 4L9EA 3S7QA 4UEYA 4HIAA 3P01A 4MN6A 1S4RA 4IHQA 5MC7A 4YWZA 3KSGA 2PR6A 3DBAA 4O0PA 4F3LA 1TS6A 4II7A 1GSVA 3T4JA 4P6ZM 1NWZA 4BWIA 5HDCA 3T4SA 3CI6A 2QYBA 5G4YA 4BBUA 4HI4A 2EWVA 1S4SA 2JHEA 2K31A 5DFXA 2B02A 2FH5A 2JN7A 4F3LB 2CMNA 3SW1A 3EEAA 3LR3A 1XFNA 3G6OA 3K2NA 2YKFA 3PBTA 3D3OA 3B42A 3UB9A 2W1RA 4FOFA 5IU1A 1D7EA 3OCLA 1JNUA 5HDSA 4Z1WA 2XA7M 5F5YA 3LIEA 3PBOA 2M1CA 4ME4A 3MR0A 3U2AA 3UE3A 2INWA 4K08A 4EW7A 1D06A 1OTBA 1V9ZA 2ZOIA 4PKYA 3PBQA 4KUOA 3S7PA 3MQ0A 3BWLA 1S67L 2V1BA 1EW0A 2Z6DA 2D01A 1T1AA 4JGRA 2OWHA 4MN5A 1DP6A 3W2ZA 3A0SA 3P7NA 2GJ3A 4YOFA 3F1OA 2QWSA 4NXEA 5I5LA 4DN0A 2P08A 5HZHA 4DJ2A 4Q0HA 2W1TA 3PBSA 3C8CA 4IUHA 4OOMA 1N9OA 3IS2A 3PXPA 1STZA 4EETB 2J80A 4HY8A 1IFQA 3FPVA 4Y2FA 2J3TD 3VE3A 2GNXA 2V0UA 2XRNA 3S7OA 1T1CA 5DJUA 5HDDA 3EGXC 4WN5A 2JKTM 4UQIM 1S1ZA 3IS2B 1LSVA 4BJPA 4BBVA 3H7WA 3BJNA 2O9AA 3S7NA 1OJGA 4I39A 1N9NA 2W0NA 2L0WA 5TJJA 4ARZA 3EQVA 2VJWA 4O8GA 5F6AA 5AVEA 5LBRA 2PYPA 3PBNA 4GHIB 3E4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O99 A;  4ZRR A;  4IUK A;  4GW9 A;  5HL6 A;  2VKS A;  3S7Q A;  4E04 A;  3E98 A;  4Y5F A;  3TRC A;  4Q0J A;  2K2N A;  4RQ9 A;  4O01 A;  4MCW A;  4MDZ A;  2W1T B;  2M7U A;  3NOP C;  3KSG A;  3NOU C;  3DBA A;  2W3H A;  4O0P A;  2ZMF A;  4G3V A;  1MKM A;  2O9B A;  3NOT C;  4BWI A;  2LB9 A;  3NHQ A;  3CI6 A;  2QYB A;  3MF0 A;  4R6L A;  5DFX A;  2K31 A;  4LRX C;  4MN7 A;  2W3G A;  4Y3I A;  1F5M A;  4CQH A;  3EEA A;  2M7V A;  3G6O A;  4PAU A;  3K2N A;  3D3O A;  2O0Y A;  2W1R A;  2OOL A;  5C5K A;  3KSF A;  2O9C A;  3O5Y A;  4FOF A;  2KLI A;  2W3E A;  2G7U A;  5DFY A;  4Z1W A;  2KOI A;  4EU0 A;  1YSQ A;  3E0Y A;  4MMN A;  4ME4 A;  2B18 A;  3R4K A;  3OBF A;  1YSP A;  5HSQ A;  5HPI A;  1YKD A;  1VHM A;  4IJG A;  2IA2 A;  4GLQ A;  4LRZ E;  3S7P A;  3MQ0 A;  2XSS A;  3ZQ5 A;  1MC0 A;  2VEA A;  4G3K A;  2VZW A;  2Y79 A;  2GX5 A;  3W2Z A;  4YOF A;  3IBJ A;  5L8M A;  3MMH A;  5I5L A;  4DN0 A;  4Q0H A;  2W1T A;  3CIT A;  1ZTU A;  4LRY C;  2HGV A;  4IUH A;  2W3F A;  3IBR A;  1STZ A;  3KSI A;  2W3D A;  3LFV A;  4Y2F A;  4R70 A;  2XRN A;  4QPR A;  3S7O A;  3OOV A;  4EUV A;  3KSH A;  3KO6 A;  4ETZ A;  3HCY A;  4YNR A;  1TF1 A;  3VV4 A;  3BJN A;  2O9A A;  4G3W A;  3S7N A;  4DMZ A;  2LB5 A;  4Q0I A;  5K5B A;  2Y8H A;  3C2W A;  4ETX A;  5TJJ A;  5HPF A;  2VJW A;  4O8G A;  1TD5 A;  5LBR A;  3RFB A;  2XRO A;  5AJG A; 
#chains in the Genus database with same CATH topology
 3A3F A;  2A2L A;  2VKS A;  5J8X A;  3Q1F A;  2DNS A;  2K2N A;  5EFW A;  3T4K A;  4R38 A;  1MWU A;  4NXB A;  4X68 A;  1L0G A;  4WEJ A;  4BLM A;  3L9K A;  3NOT C;  2ZQ9 A;  5DTK A;  4I3I A;  2EA9 A;  4GKU A;  3C38 A;  2H28 A;  4RX3 A;  5CED A;  2ZOH A;  1GHP A;  4JBF A;  1RCJ A;  3ZFZ A;  3A3I A;  3T1X A;  5GHX A;  4HES A;  3IF6 C;  1FSY A;  1YSP A;  5GLA A;  1PW1 A;  4LV2 A;  3TE8 A;  1MWR A;  5HX9 A;  5EVL A;  3IH9 A;  4G3K A;  4F94 A;  3Q7Z A;  1BLC A;  2VGL M;  2ZC5 B;  4BD0 A;  3UDF A;  1OTD A;  4X6T A;  3EOI A;  4CJN A;  2I9V A;  4GNU A;  4JGQ A;  2H5S A;  1GSW A;  5EUA A;  2QKP A;  3IX4 A;  1TS0 A;  2HV1 A;  4XT2 B;  3BM6 A;  3RJU A;  3TJZ C;  1BTL A;  4MNR A;  4DXB A;  2Y4A A;  3N8S A;  1TF1 A;  1S66 L;  5HD5 A;  4KZ6 A;  4EV4 A;  1H8M A;  3I7J A;  5CTN A;  2JBF A;  2PD7 A;  4BL3 A;  4AFI A;  2Y2J A;  1IYP A;  2Y2O A;  1E3U D;  2WKR A;  3LI8 A;  4UA7 A;  4Y15 A;  2W1T B;  2RCX A;  3EQU A;  3DWK A;  1CI9 A;  2X01 A;  5M19 A;  1TDG A;  2HZ5 A;  4HOI A;  1WA9 A;  3IF5 A;  4R4R A;  2XGN A;  3EEH A;  1DP9 A;  5GHZ A;  5FSR A;  4QHC A;  4U0X A;  2J3T C;  4DDY A;  2O0Y A;  3Q7V B;  1K55 A;  2O9C A;  1P97 A;  1XJ6 A;  1ZHH B;  2G7U A;  5G18 A;  1L3L A;  1TVF A;  1W7F A;  4L9G A;  3UNW A;  4K0X A;  5FAS A;  3S22 A;  5KZH A;  3H9W A;  1DY6 A;  3ZVW A;  3HLW A;  5HWV A;  3OLO A;  5HPI A;  5CER A;  1YLT A;  5CGS A;  2HJE A;  3HUO A;  2ZM2 A;  2P74 A;  1HLU P;  3WS4 A;  2WAF A;  3H82 B;  3ZDJ A;  1IEM A;  2DRW A;  2A24 A;  1Z09 A;  1KVM A;  3IXG A;  1E3U A;  2WAE A;  2DMW A;  1VET A;  1EI5 A;  4R70 A;  5G4Z A;  3QP6 A;  5HWT A;  4HBU A;  1ES4 A;  1E25 A;  3UDX A;  3BW6 A;  3WS2 A;  1K54 C;  3DAV A;  4KG5 A;  4Q0I A;  3VOL A;  3GEC A;  3BRM A;  3C2W A;  3G34 A;  4OPY A;  4DDS A;  5AQA A;  4IUK A;  3JYI A;  1X0O A;  4QJG A;  3UB6 A;  3NOU C;  3MXQ A;  1PWC A;  4CLC B;  1W63 M;  1KVL A;  4FD8 A;  1K6S A;  4XXR A;  3GR2 A;  3UY6 A;  2VA0 A;  1XJ3 A;  1TS7 A;  3ITB A;  3E2L A;  4CLC E;  3MF0 A;  1ZC2 A;  1JTD A;  4MN7 A;  3E4P A;  1F5M A;  3AGE A;  3FPW A;  1IKG A;  4EUZ A;  4ID4 A;  4WUJ A;  2P04 A;  2M7V A;  3LEZ A;  3UB7 A;  2XA7 S;  4BBT A;  1S0W A;  1RP5 A;  3KYZ A;  3S4X A;  3HLF A;  4QU3 A;  4WLA A;  3BY9 A;  4H6J B;  4BMW A;  1T18 A;  3NY4 A;  1XFQ A;  2ZL1 B;  1CF0 A;  1DJB A;  4PKY G;  4EES A;  3LR4 A;  1NJ4 A;  1Y28 A;  1ERQ A;  2HJ9 C;  3UE0 A;  4RVA A;  1W8Q A;  1O7E A;  2GZA A;  4P0M A;  4EER A;  3GDI A;  1ESI A;  3OC2 A;  5FEF A;  4WMC D;  2R9W A;  2GX5 A;  5EV0 A;  1J9M A;  2OLV A;  5U47 A;  3KYQ A;  2PHY A;  4S2O A;  4KZ4 A;  1YLW A;  1I5Q A;  3IWI A;  4NK3 A;  5M1A A;  3HCY A;  4RYE A;  2QHK A;  4GDN A;  4G3W A;  2ZMV A;  2LB5 A;  4E3M A;  4EQ1 A;  4ETX A;  4UHU A;  4Y13 A;  3MJQ A;  3RFB A;  3SH8 A;  3UMD A;  3FZC A;  1OME A;  2X02 A;  4U0T A;  4B93 A;  2WGW A;  3GV9 A;  4UEY A;  5FEG A;  1S4R A;  4JF4 A;  2OSU A;  3PAE A;  2X71 A;  4F3L A;  4II7 A;  5CHM A;  5GLB A;  4GD8 A;  4K0W A;  4WZ5 A;  4D60 A;  1NWZ A;  4P85 A;  1M40 A;  1XX2 A;  4P6B A;  4BBU A;  4HI4 A;  2K31 A;  2JN7 A;  3HLD A;  1NY0 A;  3LR3 A;  3G6O A;  3K2N A;  3PBT A;  3D3O A;  4FOF A;  1XGJ A;  1FIL A;  1PI5 A;  5AQ7 A;  3RXX A;  5BOH A;  2XA7 M;  5F5Y A;  1RGZ A;  4ME4 A;  4K91 A;  3CPT B;  3U2A A;  1S6R A;  2WK0 A;  4K08 A;  4Y0O A;  3G35 A;  2VK3 A;  4KUO A;  2EFX A;  3MQ0 A;  2IWB A;  3QHY A;  3GVB A;  2XFT A;  1JWZ A;  1DP6 A;  3A0S A;  5EM0 A;  4GN2 A;  5HAP A;  2EFU A;  2W1T A;  3PBS A;  4OOM A;  3ITA A;  1N9O A;  3IS2 A;  4EET B;  1ESU A;  2J80 A;  4HY8 A;  3VMA A;  4OVD A;  4UA9 A;  1ES2 A;  5EOO A;  2P9V B;  1G68 A;  1S1Z A;  1ES3 A;  4UA6 A;  3S7N A;  4Y0T A;  1N9N A;  4OON A;  4ZBE A;  5TJJ A;  4JPM A;  3NEC A;  5AQ9 A;  5FA7 A;  5LBR A;  1LL8 A;  1PZO A;  3LY4 A;  5KSC A;  3C4P A;  3E4O A;  3H7W B;  2ZBB A;  1ERM A;  1LHY A;  3E98 A;  4CLC D;  1H8Y A;  3IX3 A;  3HLC A;  3NOP C;  2WYX A;  4DE0 A;  2A49 A;  1P0Z A;  3IXH A;  1H3Q A;  3LUQ A;  3SH7 A;  1F98 A;  2W3G A;  3H82 A;  2KX6 A;  1LSW A;  4DE3 A;  5IT5 A;  2Y2G A;  4DE2 A;  4S2J A;  1K57 A;  5C5K A;  3KSF A;  5CGX A;  3MBZ A;  5TR7 A;  1VM1 A;  4LGW A;  1OPX A;  3VE4 A;  2EWW A;  4IJG A;  3T4Q A;  3E4Q A;  4GLQ A;  5FQK A;  4JLF A;  5EVI B;  4DJ3 A;  3T1Q B;  5HL1 A;  1GSX A;  2VZW A;  3C4O A;  3CG5 A;  3M2K A;  4PM9 A;  3T1S A;  1FQG A;  1YPR A;  4JXS A;  1MWS A;  4CLC A;  5CTM A;  5E43 A;  2VX8 A;  4NET A;  2JKF A;  5FQQ A;  2PR5 A;  4P6Z S;  3KSH A;  3KX0 X;  2Y59 A;  3BEC A;  2FFY A;  3ZNY A;  4YNR A;  3VFH A;  3SS4 A;  4ZJ1 A;  4S2N A;  2E8J A;  1NZO A;  1IKI A;  4N9L A;  2WZZ A;  3IF6 B;  3V67 A;  1K55 C;  1NLZ A;  3PBR A;  1ERO A;  2ZL1 A;  5A90 A;  2Y2K A;  2WKP A;  4MBF A;  3LYX A;  1SCW A;  3MQO A;  3IT9 A;  4WF0 A;  4NXF A;  3SZT A;  4X25 A;  4U3T A;  2XQZ A;  3N8R A;  5GHY A;  3OCN A;  3GMW A;  2PU2 A;  3BQ8 A;  4LRX C;  2R78 A;  3EGD C;  4Y3I A;  4IVK A;  3HLE A;  3LR0 A;  3UDI A;  3DTI A;  4PAU A;  1RGY A;  5GLD A;  3IXD A;  4ARZ B;  2PRF A;  3O88 A;  1TS8 A;  3HUN A;  4X55 A;  5DFY A;  4GJ4 A;  3WS0 A;  4LV0 A;  4UQI S;  3R7W A;  1YSQ A;  3E0Y A;  2ZQC A;  3JPU A;  3AGD A;  3HLG A;  5DF8 A;  1JWV A;  3HL9 A;  2XSS A;  2VEA A;  4R23 A;  3TOI A;  4KQO A;  5E2E A;  1VEU A;  4N1H A;  2ZC7 A;  3IBJ A;  3MMH A;  3F1P B;  4B88 A;  3G32 A;  1Y54 A;  3LIB A;  5CX7 A;  2OLU A;  2J9O A;  3OOV A;  5FI2 A;  4I3A A;  4ETZ A;  4OPQ A;  4IBX A;  2RL3 A;  2EX6 A;  3LID A;  5FL3 A;  5HPF A;  2PT7 A;  4HHD A;  4HEF A;  3G2Z A;  5J4E A;  5HL6 A;  3GQZ A;  4O01 A;  1G5U A;  5FQI A;  3BFE A;  2K7S A;  4FUW A;  4Y7P A;  2ZC6 B;  5AVF A;  1FSW A;  1V9Y A;  3N7W A;  1ALQ A;  4ZDX A;  4GS9 B;  4MLL A;  3B33 A;  3WRT A;  5FQJ A;  5J3W A;  1DP8 A;  1Q2P A;  1O07 A;  4KQR A;  4EXO A;  3FV7 A;  3NI9 A;  2Z2L B;  3VP3 A;  2P9V A;  3QP1 A;  3BLM A;  1BLP A;  5EVI D;  1KDW A;  5HSQ A;  3UE6 A;  3LR5 A;  3IQA A;  5IHV A;  3U4L P;  1QME A;  1IEL A;  3F1N B;  4KZ7 A;  2V20 A;  4X56 A;  1P9W A;  1PI4 A;  4WEK A;  2R9X A;  4DXC A;  3VOZ A;  5KSH A;  1H5X A;  2JE5 A;  4GOG A;  4OPR A;  2G2U A;  5FDH A;  4HJ4 A;  3DTK A;  3MXS A;  2WAD A;  2EXA A;  1G6O A;  4WZ5 C;  3HVF A;  4EUV A;  5J7E A;  2NUP C;  1PZP A;  4QB8 A;  2Q9N A;  1KGE A;  1I2W A;  2V1Z A;  4XUX A;  5HWW A;  4E3I A;  2ZMA A;  5K5B A;  1XJ2 A;  5CXW A;  5AQB A;  3T4L A;  4OPZ A;  4WEL A;  4BQM A;  1W5D A;  2E8I A;  4L9E A;  3Q81 A;  3IH8 A;  3V50 A;  5MC7 A;  4YWZ A;  4OH0 A;  3KSG A;  4ZTK A;  2XH9 A;  2ZD8 A;  3WRZ A;  4O0P A;  5FAP A;  1TS6 A;  3T4J A;  5TFQ A;  5EVI A;  4BWI A;  3V3S A;  4KEN B;  3W4O A;  5G4Y A;  2EWV A;  1PYY A;  3VP2 A;  4GB7 A;  3SW1 A;  4JXG A;  4E3K A;  2YKF A;  3M2J A;  1PFL A;  5L2F A;  3MZE A;  1NZU A;  2BLS A;  1JNU A;  2Y2P A;  4OLG A;  1KE0 A;  2M1C A;  1N9B A;  5FQM A;  4EW7 A;  3O86 A;  1V9Z A;  3DW0 A;  3S7P A;  2V1B A;  2HP5 A;  3IF6 A;  3UE1 A;  2WUQ A;  4FH4 A;  3OPH A;  3QNC A;  4OQG A;  3W2Z A;  3P7N A;  4KZ5 A;  3QNB A;  4NXE A;  3LCE A;  4DN0 A;  4GDB A;  5HZH A;  2HDQ A;  1KE4 A;  4S2P A;  4UAA A;  3MSH A;  1STZ A;  3MXR A;  1IFQ A;  4Y2F A;  2J3T D;  2XRN A;  2FFF B;  5DTS A;  5DJU A;  3EGX C;  4WN5 A;  2JKT M;  3WS1 A;  1GHM A;  4BJP A;  1CEG A;  3BJN A;  2O9A A;  4QD4 A;  1OJG A;  1AWI A;  5EM1 A;  2IWD A;  2PAV P;  2L0W A;  4ARZ A;  5F6A A;  5AVE A;  3C7U A;  4GHI B;  2IWC A;  3CZD A;  4GW9 A;  4C6Y A;  3TRC A;  2B5R A;  3TG9 A;  3G31 A;  4JGP A;  2PBD P;  1MY8 A;  2XR0 A;  4R3A A;  2W3H A;  3GTC A;  1NLY A;  4R4S A;  5JYP A;  1P9R A;  1YLJ A;  2WKH A;  5TBM B;  2VGK A;  1K38 A;  4XUZ A;  4P87 A;  1F2K A;  4WM9 A;  2W3E A;  4EEP A;  3V5M A;  3K3C A;  2XLN A;  1BYW A;  1LLB A;  4X1L A;  1SDE A;  1I2S A;  1OTE A;  4KZB A;  4S2N C;  3HJI A;  3MZD A;  3UN7 A;  1WYC A;  4WMC A;  3EWK A;  3BFD A;  4KZA A;  1YM1 A;  2V0W A;  2ZQD A;  3IWO A;  1YMX A;  3BY8 A;  1VB6 A;  4KZ9 A;  2BAS A;  4XT2 A;  4S2L A;  3ZHH A;  3OPP A;  3UO9 A;  2VV7 A;  4Z9Q A;  3CIT A;  1BLH A;  1BUL A;  4JXV A;  3PYP A;  5E2F A;  3UME A;  3UPO A;  3CWF A;  3IHA A;  4E3L A;  2C5W B;  4QPR A;  5GLC A;  1XJ4 A;  4OP8 A;  3TSG A;  1LSX A;  1Z6F A;  3LI9 A;  4GS9 A;  3OPR A;  1VQQ A;  4H8R A;  1W63 Q;  4E6X A;  1DRM A;  2OAP 1;  2PBY A;  4OQI A;  1GA9 A;  2XEP A;  4EEU A;  2OAQ 1;  4E04 A;  4Q8I A;  4L9F A;  3NC8 A;  3LO7 A;  1YQS A;  1MBL A;  2M7U A;  3M6B A;  2FZ0 A;  2JKT I;  3TW8 A;  4LV3 A;  1W79 A;  3F1N A;  5A8B A;  2LB9 A;  1K4F A;  2GDN A;  3Q7V A;  4I3J A;  4CQH A;  5CRF A;  3CHW P;  1OTI A;  1OT6 A;  3DWZ A;  2YKH A;  5KIZ A;  4B4X A;  3K3D A;  3VFF A;  3UB8 A;  3T4O A;  5EOE A;  1JVJ A;  2ZQA A;  3SH9 A;  2EX9 A;  1G6A A;  1A0K A;  4QY6 A;  4EU0 A;  4BD1 A;  1ZKJ A;  3MFX A;  2WKI A;  4PM7 A;  4HQA A;  1EWZ A;  4LRZ E;  2OWJ A;  3ZQ5 A;  2JKR I;  3G2Y A;  2Z2M B;  4B4Z A;  2UWX A;  2L4R A;  1HZO A;  1WE4 A;  4PHT A;  3FWL A;  4IBR A;  3CUE A;  4O7D A;  4JGO A;  3CAX A;  3VP1 A;  4KQD A;  2PD8 A;  4N92 A;  3BFF A;  3MQQ A;  3IBR A;  3PTE A;  2A24 B;  1BUE A;  4I5S A;  3LGO A;  3JVU A;  3KO6 A;  3NBL A;  4JXW A;  3CLO A;  4N1X A;  1VET B;  1LL5 A;  2QJ7 A;  1LT0 A;  5KMW A;  4KG2 A;  5HW3 A;  2V8C A;  2ZC4 B;  4FSF A;  1TD5 A;  2XRO A;  4Y0U A;  3ZG5 A;  3GSG A;  3SS3 A;  4MCW A;  4MDZ A;  2WGI A;  3N4I A;  4X53 A;  3FKW A;  3O87 A;  2P7J A;  2MJ6 A;  3M6H A;  2Y91 A;  2OV5 A;  1SKO B;  4G3V A;  4ZJ2 A;  4C3Q A;  2HF6 A;  2VGL S;  5CHU A;  1CI8 A;  4S2K A;  4IED A;  2WKQ A;  4H6J A;  1KOU A;  1KGF A;  1HVB A;  3MKF A;  1M6K A;  4GCZ A;  3CJM A;  2OOL A;  1XA1 A;  3O5Y A;  1SKF A;  3T4T A;  1G28 A;  4KUK A;  1S1Y A;  2KOI A;  4FTX A;  4E3N A;  1BZA A;  2KDK A;  2QJ5 A;  1VHM A;  4WL9 A;  5L09 A;  3ZG7 B;  3RH8 B;  3T50 A;  4OKP A;  4ZAM A;  4GHI A;  1CK3 A;  4M4X A;  1Q2Q A;  3Q07 A;  4DE1 A;  3LIF A;  1ZTU A;  4LRY C;  2HGV A;  1N9L A;  3HJK A;  3LFV A;  4HH2 A;  5EVI C;  5DF9 A;  4WZ4 A;  1HD8 A;  2V9A A;  3T12 B;  3SOI A;  1NRJ A;  3NJA A;  2JCH A;  5TBM A;  5CGW A;  3RXW A;  3NIA A;  1PW8 A;  1XP4 A;  3ISG A;  3OZH A;  4BL2 A;  1PIO A;  2W27 A;  5GL9 A;  1GHI A;  4LFU A;  4R0Q A;  2O99 A;  3S7Q A;  4PMA A;  3HBR A;  3B3X A;  3MKE A;  4IVI A;  3P09 A;  4IHQ A;  1GCE A;  1PWD A;  2XDM A;  4DKI A;  1IYO A;  3BFG A;  2WGW B;  4NG2 A;  1JWP A;  4RA7 A;  3WWX A;  1PNE A;  3V39 A;  1FR1 A;  1SHV A;  5F1F A;  4P6Z M;  5HDC A;  2WKE A;  3T4S A;  3CI6 A;  2QYB A;  3MFD A;  1S4S A;  2B02 A;  2FH5 A;  3GRJ A;  1K4E A;  4F3L B;  2BTF P;  4PM8 A;  4C75 A;  3UB9 A;  3CPT A;  2EX8 A;  1D7E A;  3OCL A;  4EBN A;  5HDS A;  4OQH A;  3G4P A;  4Z1W A;  5L10 A;  3LIE A;  3HLB A;  4S2M A;  3MR0 A;  1MWT A;  1K25 A;  1D06 A;  1OTB A;  3C5A A;  2ZOI A;  2HDS A;  1S67 L;  1XPB A;  4E3J A;  1EW0 A;  2DCF A;  2Z6D A;  2HPB A;  2OWH A;  4MEZ A;  3A3E A;  3AGF A;  2JKG A;  2GJ3 A;  2QMI A;  2QWS A;  2ZJ9 A;  4EBL A;  2V2F F;  5I5L A;  5FAT A;  2P08 A;  4DJ2 A;  5F82 A;  4Q0H A;  1L0E A;  3C8C A;  4IUH A;  1YT4 A;  3PXP A;  5I94 A;  3FPV A;  1AXB A;  3VE3 A;  2GNX A;  5EEC A;  1T1C A;  1WYB A;  3ZCZ A;  4UQI M;  3IS2 B;  2AVX A;  1CQA A;  1LSV A;  3H7W A;  1NXY A;  3W4Q A;  5FQ9 A;  3P98 A;  3EQV A;  2VJW A;  3PBN A;  3ZNT A;  2ZM8 A;  3DTE A;  4ZRR A;  2VV8 A;  5E2G A;  2L1M A;  4Y5F A;  1K56 D;  4WBG A;  1MXO A;  3IX8 A;  3A0V A;  1NYM A;  2Y2N A;  5A92 A;  1MKM A;  4NEE D;  1ZG4 A;  4EQI A;  2HDU A;  1JTG A;  3VP4 A;  1FCO A;  4M3K A;  4E6W A;  4PM5 A;  4LV1 A;  4FH2 A;  4QY5 A;  3C30 A;  2QPN A;  3NUL A;  1IYQ A;  2KLI A;  3W4P A;  1C3B A;  3PR6 A;  5EE8 A;  4FCF A;  2B18 A;  3QP4 A;  1L2S A;  1YKD A;  5F68 A;  1FCM A;  2G2W A;  1BLS A;  3ZVT A;  2XF3 A;  1KGG A;  4LEN A;  1XXM A;  2Y79 A;  1ODV A;  1ZG6 A;  3DTM A;  3VOY A;  3QP8 A;  1K56 A;  2Y2M A;  4RX2 A;  5D3O A;  3L7H A;  2Y2L A;  3BLS A;  1SKO A;  5EVE A;  5HAR A;  3JVV A;  1SDN A;  1YLY A;  2ZQ8 A;  4DMZ A;  2Q9M A;  1NYY A;  4R1G A;  5HD3 A;  1XGI A;  1OJ5 A;  4ZJ3 A;  4KZ3 A;  4X1M A;  4NXG A;  5AJG A;  2CC1 A;  3LY3 A;  2VV6 A;  5L07 A;  3F1O B;  4RQ9 A;  1H0M A;  1LI9 A;  1YLP A;  4ESP A;  4HNB A;  1NRF A;  1BSG A;  2J7V A;  2J3W A;  2O9B A;  3NHQ A;  1K57 C;  1PRQ A;  4KQQ A;  3FC7 A;  3FYZ A;  1MZU A;  4R6L A;  1XA7 A;  3CUE C;  2H0T A;  5DKL A;  4EBP A;  1OT9 A;  4OLD A;  1L0F A;  2EXB A;  4X69 A;  3VSK A;  5FI6 A;  4I38 A;  2PU4 A;  3QP5 A;  3NDG A;  1FOF A;  3ZYT A;  4LPZ A;  4HBT A;  3VSL A;  4S2I A;  2JKR M;  3R7W B;  1MC0 A;  3F1P A;  1TEM A;  4CLC C;  1U60 A;  4JKT A;  4HJ3 A;  1IYS A;  3ZGA B;  3D4F A;  4PPR A;  3BQA A;  2HP6 A;  4YIN A;  2W3F A;  1UWP X;  1VEU B;  2PDR A;  3ICY A;  4HP9 A;  4OP5 A;  3UB5 P;  4BEN A;  2WZX A;  2NUT C;  4N9K A;  2XFS A;  3ULF A;  1W8Y A;  5IS1 A;  4EWF A;  1N4O A;  5M18 A;  1ONH A;  5F69 A;  1T19 A;  2JC7 A;  2VLG A;  3V3R A;  3VV4 A;  4OOL A;  2Y8H A;  4LCL A;  1ONG A;  4GZB A;  4L0L A;  4HP4 A;  1YAX A;  4Q0J A;  4R3B A;  3BYD A;  2ZLY A;  2I72 A;  3PHY A;  1L0D A;  3PAG A;  2QZ6 A;  5TGF A;  5HAQ A;  3G30 A;  2J9P A;  3LEQ A;  1UWN X;  2Z6C A;  2ZMF A;  2WGV A;  3B47 A;  3IWQ A;  5DF7 A;  1QMF A;  3QP2 A;  4B9O A;  1TDL A;  4KG6 A;  5JYO A;  1K54 A;  1F9I A;  1YLZ A;  2D02 A;  2H10 A;  5DJT A;  5FI7 A;  4MBH A;  3NDE A;  1IOU A;  2XK1 A;  1K6R A;  2Y2Q A;  5HAI A;  4HH3 A;  4DF6 A;  3D72 A;  2ZC3 B;  2Y2H A;  4MMN A;  3LIA A;  2A3U A;  2J8Y A;  3R4K A;  3OBF A;  3SS5 A;  4LLO B;  5F83 A;  1GA0 A;  3A0R A;  4A5R A;  1E4D A;  4HJ6 A;  2IA2 A;  1FIK A;  3LIC A;  3RTY A;  5A93 A;  4OOY A;  3CMZ A;  1UGU A;  4YFM A;  3MS6 A;  1KE3 A;  1OTA A;  3UPN A;  5L8M A;  4CPK A;  2ACG A;  1PWG A;  2XD1 A;  3MZF A;  3O3V A;  5DTT A;  3A3D A;  4JF6 A;  3KSI A;  3KYE A;  3VP0 A;  2W3D A;  4NKP A;  5DKK A;  5E2H A;  1DJC A;  1CEF A;  5CEC A;  3FG8 A;  3E2K A;  4MBK A;  4OQ0 A;  2V1A A;  4DRT A;  5A91 A;  5DVA A;  2HP9 A;  3C7V A;  4E3O A;  3NCK A;  2C6W B;  2PYR A;  1H8Z A;  1T1B A;  4GD6 A;  3T1R A;  4HIA A;  2ZM0 A;  3P01 A;  4MN6 A;  1FCN A;  2V8F A;  1KDS A;  2PR6 A;  4LCM A;  3DBA A;  2EX2 A;  1GSV A;  2Q0O A;  5FDS A;  4WYY A;  2ZQ7 A;  2UV0 E;  2HDR A;  1Y4O A;  5DFX A;  2JHE A;  3FKV A;  3HRE A;  5CHJ A;  1FR6 A;  2CMN A;  2Y2I A;  3ZG9 B;  5EPH A;  3ZG0 A;  3EEA A;  1XFN A;  5FAO A;  3B42 A;  3D9Y A;  3HUM A;  4JF5 A;  2BG1 A;  1DJA A;  2W1R A;  2H0Y A;  5FAQ A;  5IU1 A;  4R3J A;  3IXB A;  4KZ8 A;  3BEB A;  2B95 A;  3PBO A;  3OPL A;  2VGJ A;  3WS5 A;  3A3J A;  3UE3 A;  1BT5 A;  2INW A;  4QWO A;  4PKY A;  3PBQ A;  1ACF A;  3BWL A;  5F1G A;  3N8L A;  1HTZ A;  2D01 A;  1T1A A;  4JGR A;  1K0K A;  1YMS A;  3BFC A;  4MN5 A;  1J3W A;  1MKI A;  1ES5 A;  2Y55 A;  1LL9 A;  4YOF A;  3F1O A;  3UPP A;  3N6I A;  3ZG8 B;  3W8K A;  1LI0 A;  1SZV A;  5CEB A;  2V0U A;  3S7O A;  1CJF A;  1MPL A;  5HDD A;  1D1J A;  5HFO A;  3Q82 A;  4BBV A;  2XD5 A;  4I39 A;  1XKZ A;  2W0N A;  4Y17 A;  4O8G A;  4PM6 A;  4D2O A;  3S1Y A;  2PYP A;  3IHB A; 
#chains in the Genus database with same CATH homology
 3H7W B;  2ZBB A;  4ZRR A;  2A2L A;  2VV8 A;  4GW9 A;  2VKS A;  2L1M A;  3E98 A;  4Y5F A;  3TRC A;  4CLC D;  2K2N A;  5EFW A;  3T4K A;  4R38 A;  4NXB A;  3NOP C;  4JGP A;  4WEJ A;  3A0V A;  4R3A A;  2W3H A;  1NLY A;  1MKM A;  3NOT C;  4NEE D;  1P0Z A;  1H3Q A;  3LUQ A;  4I3I A;  1F98 A;  2EA9 A;  1P9R A;  2W3G A;  3H82 A;  2KX6 A;  5TBM B;  1LSW A;  5IT5 A;  3C38 A;  2H28 A;  3C30 A;  2ZOH A;  5C5K A;  3KSF A;  2KLI A;  2W3E A;  4EEP A;  3PR6 A;  3K3C A;  1BYW A;  1OPX A;  3VE4 A;  2B18 A;  2EWW A;  1YSP A;  1OTE A;  1YKD A;  4IJG A;  3HJI A;  5F68 A;  3T4Q A;  3E4Q A;  3EWK A;  4GLQ A;  1LL8 A;  3TE8 A;  2V0W A;  4G3K A;  4DJ3 A;  1GSX A;  3BY8 A;  1VB6 A;  2VGL M;  2VZW A;  2Y79 A;  1OTD A;  2BAS A;  4XT2 A;  1ODV A;  3EOI A;  2I9V A;  4JGQ A;  1GSW A;  2VV7 A;  2QKP A;  3CIT A;  3PYP A;  3UME A;  1TS0 A;  2HV1 A;  4CLC A;  3CWF A;  4XT2 B;  2VX8 A;  4QPR A;  3TJZ C;  1XJ4 A;  2PR5 A;  4P6Z S;  3KSH A;  3KX0 X;  3JVV A;  1LSX A;  3LI9 A;  4YNR A;  4GS9 A;  1TF1 A;  1S66 L;  5HD5 A;  4DMZ A;  1H8M A;  1W63 Q;  5HD3 A;  1OJ5 A;  1DRM A;  2PD7 A;  3V67 A;  2OAP 1;  1NLZ A;  4AFI A;  4NXG A;  5AJG A;  3PBR A;  4EEU A;  2VV6 A;  2OAQ 1;  3F1O B;  4E04 A;  2WKP A;  4L9F A;  2WKR A;  3LI8 A;  3LYX A;  4RQ9 A;  2W1T B;  2M7U A;  3MQO A;  4WF0 A;  2FZ0 A;  3EQU A;  2JKT I;  4NXF A;  4HNB A;  3TW8 A;  2J3W A;  3F1N A;  2O9B A;  5A8B A;  4HOI A;  1WA9 A;  2LB9 A;  3NHQ A;  3OCN A;  3FC7 A;  3BQ8 A;  1MZU A;  4R6L A;  4LRX C;  2R78 A;  3CUE C;  3EGD C;  4Y3I A;  4I3J A;  5DKL A;  3LR0 A;  4CQH A;  3EEH A;  1OT9 A;  1DP9 A;  4PAU A;  1OTI A;  1OT6 A;  2J3T C;  2YKH A;  4ARZ B;  5KIZ A;  2O0Y A;  1TS8 A;  4I38 A;  2O9C A;  3K3D A;  1P97 A;  1XJ6 A;  1ZHH B;  2G7U A;  3UB8 A;  3T4O A;  5DFY A;  4L9G A;  4GJ4 A;  3ZYT A;  4LPZ A;  4UQI S;  3R7W A;  3H9W A;  4EU0 A;  1YSQ A;  3E0Y A;  5HWV A;  3OLO A;  3MFX A;  5HPI A;  4HQA A;  2JKR M;  4LRZ E;  2HJE A;  2OWJ A;  2XSS A;  3ZQ5 A;  3R7W B;  2JKR I;  1MC0 A;  2VEA A;  3F1P A;  2L4R A;  4KQO A;  4CLC C;  3H82 B;  4PHT A;  3CUE A;  2A24 A;  4HJ3 A;  4JGO A;  3CAX A;  3IBJ A;  3MMH A;  4KQD A;  2PD8 A;  3F1P B;  3BQA A;  3MQQ A;  2W3F A;  1UWP X;  2DMW A;  3LIB A;  3IBR A;  2PDR A;  5CX7 A;  3ICY A;  4HP9 A;  4R70 A;  2A24 B;  5G4Z A;  4I5S A;  2NUT C;  3OOV A;  4I3A A;  5HWT A;  3ULF A;  3JVU A;  3KO6 A;  3BW6 A;  4ETZ A;  5IS1 A;  3CLO A;  5F69 A;  2QJ7 A;  1T19 A;  2VLG A;  3VV4 A;  1LT0 A;  3LID A;  5FL3 A;  4Q0I A;  3VOL A;  4OOL A;  3GEC A;  2Y8H A;  3C2W A;  4FSF A;  2PT7 A;  5HPF A;  4HHD A;  1TD5 A;  2XRO A;  4L0L A;  4IUK A;  5J4E A;  4HP4 A;  5HL6 A;  1YAX A;  4Q0J A;  4O01 A;  4MCW A;  4MDZ A;  3PHY A;  1X0O A;  3UB6 A;  3NOU C;  3MXQ A;  4CLC B;  1W63 M;  2P7J A;  2K7S A;  2MJ6 A;  1UWN X;  2Z6C A;  2VA0 A;  2ZMF A;  1XJ3 A;  1TS7 A;  5AVF A;  4G3V A;  3B47 A;  1V9Y A;  4CLC E;  2HF6 A;  2VGL S;  3MF0 A;  4MN7 A;  4B9O A;  3E4P A;  1F5M A;  3FPW A;  2WKQ A;  4GS9 B;  4H6J A;  1F9I A;  1KOU A;  2D02 A;  3B33 A;  4WUJ A;  2P04 A;  5DJT A;  2M7V A;  5J3W A;  3UB7 A;  1DP8 A;  2XA7 S;  4GCZ A;  4BBT A;  1IOU A;  3KYZ A;  2OOL A;  4EXO A;  4WLA A;  3O5Y A;  3BY9 A;  4H6J B;  3T4T A;  4BMW A;  1T18 A;  1XFQ A;  1G28 A;  4KUK A;  4HH3 A;  1S1Y A;  3D72 A;  4PKY G;  2KOI A;  4EES A;  3LR4 A;  4MMN A;  3LIA A;  3R4K A;  3OBF A;  1Y28 A;  2KDK A;  2HJ9 C;  2QJ5 A;  4LLO B;  3A0R A;  5HSQ A;  3UE6 A;  1VHM A;  2GZA A;  3LR5 A;  4WL9 A;  4HJ6 A;  2IA2 A;  3LIC A;  4EER A;  3GDI A;  3OC2 A;  3F1N B;  3RTY A;  3RH8 B;  3T50 A;  1P9W A;  1UGU A;  4GHI A;  2GX5 A;  4M4X A;  4WEK A;  1OTA A;  5L8M A;  5KSH A;  3KYQ A;  3LIF A;  1ZTU A;  2PHY A;  2HGV A;  4LRY C;  4HJ4 A;  1N9L A;  3KSI A;  3HJK A;  2W3D A;  3LFV A;  4HH2 A;  4NKP A;  1G6O A;  5DKK A;  4EUV A;  5DF9 A;  5J7E A;  2NUP C;  2V9A A;  3FG8 A;  1NRJ A;  3HCY A;  2V1A A;  3NJA A;  2QHK A;  5TBM A;  5HWW A;  4G3W A;  2ZMV A;  2LB5 A;  5K5B A;  1XJ2 A;  4EQ1 A;  4ETX A;  2W27 A;  3MJQ A;  3RFB A;  2PYR A;  3T4L A;  3UMD A;  4WEL A;  2O99 A;  1T1B A;  4B93 A;  4L9E A;  3S7Q A;  4UEY A;  4HIA A;  3P01 A;  4MN6 A;  1S4R A;  4IHQ A;  5MC7 A;  4YWZ A;  3KSG A;  2PR6 A;  3DBA A;  4O0P A;  4F3L A;  1TS6 A;  4II7 A;  1GSV A;  3T4J A;  4P6Z M;  1NWZ A;  4BWI A;  5HDC A;  3T4S A;  3CI6 A;  2QYB A;  5G4Y A;  4BBU A;  4HI4 A;  2EWV A;  1S4S A;  2JHE A;  2K31 A;  5DFX A;  2B02 A;  2FH5 A;  2JN7 A;  4F3L B;  2CMN A;  3SW1 A;  3EEA A;  3LR3 A;  1XFN A;  3G6O A;  3K2N A;  2YKF A;  3PBT A;  3D3O A;  3B42 A;  3UB9 A;  2W1R A;  4FOF A;  5IU1 A;  1D7E A;  3OCL A;  1JNU A;  5HDS A;  4Z1W A;  2XA7 M;  5F5Y A;  3LIE A;  3PBO A;  2M1C A;  4ME4 A;  3MR0 A;  3U2A A;  3UE3 A;  2INW A;  4K08 A;  4EW7 A;  1D06 A;  1OTB A;  1V9Z A;  2ZOI A;  4PKY A;  3PBQ A;  4KUO A;  3S7P A;  3MQ0 A;  3BWL A;  1S67 L;  2V1B A;  1EW0 A;  2Z6D A;  2D01 A;  1T1A A;  4JGR A;  2OWH A;  4MN5 A;  1DP6 A;  3W2Z A;  3A0S A;  3P7N A;  2GJ3 A;  4YOF A;  3F1O A;  2QWS A;  4NXE A;  5I5L A;  4DN0 A;  2P08 A;  5HZH A;  4DJ2 A;  4Q0H A;  2W1T A;  3PBS A;  3C8C A;  4IUH A;  4OOM A;  1N9O A;  3IS2 A;  3PXP A;  1STZ A;  4EET B;  2J80 A;  4HY8 A;  1IFQ A;  3FPV A;  4Y2F A;  2J3T D;  3VE3 A;  2GNX A;  2V0U A;  2XRN A;  3S7O A;  1T1C A;  5DJU A;  5HDD A;  3EGX C;  4WN5 A;  2JKT M;  4UQI M;  1S1Z A;  3IS2 B;  1LSV A;  4BJP A;  4BBV A;  3H7W A;  3BJN A;  2O9A A;  3S7N A;  1OJG A;  4I39 A;  1N9N A;  2W0N A;  2L0W A;  5TJJ A;  4ARZ A;  3EQV A;  2VJW A;  4O8G A;  5F6A A;  5AVE A;  5LBR A;  2PYP A;  3PBN A;  4GHI B;  3E4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...