2B18A

N-terminal gaf domain of transcriptional pleiotropic repressor cody.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 48
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b18A00
4G3VA 5HPIA 4YOFA 2OOLA 1F5MA 3MF0A 4O01A 2K31A 2Y79A 2W3HA 4GLQA 5K5BA 5HPFA 4LRYC 3O5YA 2LB5A 4YNRA 2QYBA 2VJWA 3S7NA 2W1TA 3R4KA 3S7PA 4IUKA 3IBJA 2VEAA 2W3EA 4R6LA 2O0YA 2O9CA 4LRXC 3MMHA 5TJJA 2O99A 4Q0HA 3DBAA 2VKSA 3E98A 4ETXA 4MDZA 1YSQA 2XROA 2M7VA 3CI6A 3TRCA 3HCYA 4O0PA 4ETZA 3S7OA 1TD5A 2K2NA 4ME4A 4EU0A 2M7UA 3EEAA 5HL6A 3CITA 3D3OA 5DFYA 3BJNA 3C2WA 4Y3IA 3ZQ5A 2XRNA 4MN7A 4ZRRA 3KSGA 3IBRA 2G7UA 3KSFA 4EUVA 4E04A 2IA2A 4O8GA 4GW9A 5AJGA 2Y8HA 1STZA 2XSSA 3NHQA 5C5KA 4MMNA 4FOFA 4Q0IA 2O9AA 4IUHA 3OOVA 4DMZA 2W3DA 2O9BA 4MCWA 4Z1WA 3RFBA 2ZMFA 3KO6A 2KOIA 3S7QA 1MKMA 2W1TB 3E0YA 3NOTC 1YKDA 3G6OA 2VZWA 4R70A 4G3KA 4RQ9A 4LRZE 2KLIA 1MC0A 4CQHA 2GX5A 3KSHA 2W3FA 3K2NA 1ZTUA 3VV4A 3OBFA 2W1RA 1YSPA 3LFVA 3KSIA 5HSQA 5L8MA 4BWIA 2W3GA 3NOPC 3NOUC 4Q0JA 5DFXA 4IJGA 3W2ZA 2B18A 4Y2FA 5LBRA 5I5LA 3MQ0A 1TF1A 4PAUA 2LB9A 4Y5FA 2HGVA 4QPRA 4G3WA 4DN0A 1VHMA
chains in the Genus database with same CATH superfamily
5AVEA 3BFGA 5FAOA 1W5DA 4GLQA 1OJ5A 3G4PA 4WZ4A 4LCLA 3RXWA 3N8LA 4GN2A 1M40A 4DXCA 2DRWA 5GHXA 1DY6A 3BFDA 4WYYA 2JHEA 1SDEA 3LICA 2WKIA 4ETZA 1S1ZA 3PBRA 4H6JA 1PI5A 4OLDA 3AGFA 3BM6A 4X68A 1L0EA 1HVBA 3OPLA 2IWBA 1W7FA 1MBLA 1OTEA 5CTNA 3FPVA 4OP8A 1K57C 1IYSA 2G7UA 5JYPA 1MZUA 4PM5A 2HDQA 3G35A 5I94A 4WM9A 1GHPA 3A0RA 4NEED 2JC7A 4OQ0A 2V20A 4UHUA 2XA7M 1Q2QA 3UO9A 3UB9A 4R70A 2W27A 2UWXA 3A0SA 4WELA 2Y2IA 5FAPA 5L07A 4R3BA 4OOLA 4OPQA 3PYPA 5JYOA 1GSVA 1OMEA 4H6JB 1IKGA 2CC1A 4X55A 4L9GA 5EVIA 5LBRA 1YLYA 1FIKA 4KZ9A 3ZGAB 2Y2KA 3BFCA 1VB6A 3KYEA 3N8RA 4MBHA 5K5BA 3Q81A 5KMWA 4P85A 3IHAA 3O5YA 5CECA 4Z9QA 5E2HA 2EWWA 3T1XA 4KZ3A 2B5RA 3C7UA 1JVJA 3LCEA 3LY4A 1PWDA 3DAVA 1XGJA 1L0FA 3G2YA 4RX2A 1UWNX 1N9BA 1PNEA 5L2FA 3IQAA 2WKEA 4X1MA 2K2NA 4HESA 4P0MA 3GRJA 3OPRA 1LI0A 2V8FA 3T4TA 1KGGA 4KG2A 3T1SA 5EVIB 5EECA 5GHZA 1TVFA 2OWHA 3SW1A 5IS1A 4C3QA 4R3AA 3V3RA 1STZA 3M6HA 1W63M 2O9AA 1TS8A 4WF0A 3E0YA 3VP2A 3BW6A 4MBKA 3GTCA 4S2MA 3CZDA 3WS0A 5GL9A 5HX9A 3L9KA 3IWIA 5HZHA 4R3JA 1ZTUA 3PBOA 3WWXA 3SZTA 5HSQA 4N92A 4E3IA 1SKFA 1ZC2A 5DF8A 4R4RA 3UE1A 3EQUA 2WGIA 5HDDA 1F9IA 4PAUA 4EEPA 4KZ6A 5HARA 3IXDA 5F5YA 4G3WA 2PU2A 1VHMA 5CHUA 1BULA 3NI9A 1AWIA 4P6ZS 4YOFA 2PD8A 5HD3A 4QU3A 2EWVA 3IX8A 4B4XA 1P0ZA 1XKZA 1FR1A 4OP5A 2W1TA 2O9CA 2Y2HA 3Q7ZA 5FQMA 2O99A 1PZOA 5FDHA 1GHMA 4NXBA 3IXHA 3MZDA 4DRTA 4S2NC 4DXBA 4JXVA 2H0YA 2DNSA 4F94A 4GDNA 4HQAA 3A3EA 3CITA 1SHVA 1Y4OA 3MJQA 1LSXA 4MBFA 4HP4A 3C2WA 4Y3IA 1P97A 4UAAA 3O3VA 4IVKA 3T1QB 5IHVA 4Q8IA 2WKHA 4EUVA 5A93A 5HAQA 4GNUA 1IYPA 3E2LA 3L7HA 4PM6A 4BD1A 1W79A 3AGEA 1S1YA 3PTEA 5TGFA 2CMNA 1CI9A 2W1TB 2PR6A 1YKDA 3ZVTA 4HNBA 5EM0A 2GX5A 5IU1A 3FZCA 3VP1A 4MN6A 1KGEA 3ZNTA 2W1RA 1DRMA 4JXGA 3D4FA 3C30A 2R9WA 4HH2A 1VETA 2QWSA 2B18A 2Z6DA 1PZPA 3WS4A 3HBRA 3DTIA 4QPRA 3ZG9B 5FATA 5HWVA 1L3LA 1JTDA 3IF5A 5DJTA 1OJGA 4DDYA 1K54C 3TOIA 4FH2A 2HP9A 4JGOA 5FEGA 1S4RA 1BUEA 2K7SA 5CERA 4U3TA 4I3AA 1ERMA 1W8YA 2PR5A 1DJCA 4IUKA 4DJ2A 4Y17A 4BMWA 1ODVA 1T1BA 2A3UA 2Z6CA 2PYPA 4EW7A 5E2EA 5F83A 1F2KA 3C4OA 2PD7A 4E6XA 2PAVP 2VGJA 3UB8A 2JE5A 3UN7A 5J8XA 3KYQA 5F69A 1YT4A 2M7UA 4N1XA 1VETB 3ZG8B 3O87A 4WN5A 1J3WA 3V50A 5FDSA 4EWFA 3TW8A 2KX6A 4Y0UA 2ZQ7A 3DW0A 5CGWA 4GW9A 1RGYA 4UQIM 2QZ6A 1FSWA 1HZOA 4WEJA 4B88A 3BLSA 4MCWA 3BYDA 4PKYA 2I9VA 2ZM0A 4U0TA 1KVLA 2Z2MB 3G6OA 3P01A 3MQOA 3GV9A 1HD8A 3FWLA 2J3TD 1CK3A 3FC7A 1OTDA 1KE4A 3KSIA 4WZ5C 4X69A 4JF6A 5HL1A 1T18A 4PM8A 1VQQA 3E2KA 4QB8A 1BYWA 2WAEA 1D7EA 4BL3A 4JXSA 1KVMA 3MR0A 1YPRA 2Z2LB 3UE3A 4LRYC 4X25A 3ZG0A 3LR4A 3VOZA 4FH4A 3QP2A 4BLMA 1BLPA 2A2LA 1K56A 2ACGA 5TJJA 4EUZA 1K54A 3LEQA 1H8YA 4HEFA 4S2LA 1ZKJA 3A0VA 3V67A 2PYRA 4K0WA 3QP4A 3IX4A 1PI4A 1ES4A 4LV2A 1XJ3A 3WS2A 2H0TA 4HP9A 1AXBA 3EEAA 3W4QA 5HL6A 2Y2QA 2JKGA 1GA0A 4BL2A 1K4EA 2RCXA 4MLLA 5FQ9A 3KSFA 5FQIA 1X0OA 3IWQA 3SS4A 1H3QA 2HP6A 1KE0A 3SS5A 4E3MA 3MBZA 1TEMA 4K0XA 2E8JA 3KX0X 1KDSA 4MEZA 1TS6A 2KOIA 3CMZA 2Y59A 4GD8A 4S2PA 3BFFA 5AVFA 2V2FF 2VGKA 4CPKA 4BJPA 4DKIA 2XEPA 2ZM2A 2ZMAA 4G3KA 3ZYTA 3MXSA 4GOGA 3SH7A 3LFVA 4ZBEA 4I39A 2Y55A 3CUEC 2PRFA 4DE0A 1TDLA 3MZFA 3S4XA 4QJGA 2VA0A 3BQAA 1RP5A 2DMWA 1Q2PA 4DN0A 4JF5A 1YMSA 3M6BA 2ZQDA 3PBTA 1N9LA 4II7A 4PMAA 1G6OA 2INWA 1XJ6A 3B33A 2A24A 3DTKA 1LLBA 2DCFA 3M2KA 4LV3A 1RGZA 2XK1A 4XT2A 1DP8A 1SCWA 3GDIA 1A0KA 2G2UA 4GZBA 5CHMA 2R78A 5FQQA 3T4JA 1ES2A 4WMCD 3OPPA 3BEBA 4KUOA 2XD5A 3HLBA 3UB6A 1LL5A 1DJAA 3BLMA 2XA7S 1G6AA 3D3OA 2UV0E 3SS3A 5GLBA 2WYXA 1PWGA 3G34A 3PHYA 4L9FA 4U0XA 1ERQA 2P74A 1EI5A 2NUTC 3OOVA 3LR5A 3T4QA 2A24B 3UPNA 3S7QA 1PW8A 2IWCA 3MS6A 5DF9A 4XT2B 4NKPA 3Q1FA 2ZL1A 3KSHA 3UDFA 1JTGA 4CJNA 2C5WB 2GJ3A 2ZJ9A 1I2WA 4KZBA 1DP6A 5MC7A 3NIAA 3LI8A 2WADA 1NRFA 1IELA 3K3CA 2FZ0A 3MQ0A 5F82A 2HPBA 4E6WA 5FA7A 2JN7A 2WKQA 2XQZA 4XUZA 4BD0A 1FR6A 3PR6A 2BTFP 2Y79A 5HW3A 4OPYA 2WZXA 3IH8A 1SDNA 1YM1A 4B93A 1JWPA 3WRTA 3S7NA 4K91A 2ZOIA 1OPXA 4RYEA 2V0UA 3LUQA 3P09A 1O7EA 4OVDA 1Y54A 4ETXA 5EVID 5J3WA 2XROA 2J8YA 1H5XA 4O0PA 2WAFA 2GZAA 1RCJA 2ZL1B 3CWFA 1TD5A 3E4OA 1MPLA 1IOUA 3LY3A 3VMAA 3G32A 2ZC6B 3A3JA 3CG5A 2WUQA 2IA2A 5AQ7A 1PIOA 4OQHA 3T4KA 4ZJ3A 1YMXA 5FEFA 2Q0OA 5EOOA 1UGUA 3UB5P 4ESPA 1NJ4A 4EBNA 3ZFZA 2V9AA 2ZMVA 1ALQA 3CPTA 3V39A 3O88A 4HHDA 4O7DA 3LIAA 1L0DA 3IWOA 5CGSA 4OQIA 3LI9A 3HUMA 5L10A 4GB7A 1MY8A 1K57A 2QPNA 1ESUA 5EPHA 4HJ4A 2GDNA 5FI7A 3QHYA 1K6RA 3RXXA 5EOEA 5FASA 3ITAA 3FKVA 2VLGA 3OPHA 5DF7A 4KZ4A 2Y2OA 3CHWP 3LIFA 4I3IA 2VEAA 2O0YA 3RJUA 3MMHA 4E3JA 4Q0HA 3DBAA 3A3DA 1BLCA 1YSQA 1ZG6A 4KZ5A 2H5SA 4I38A 1XA1A 1KDWA 4OOMA 1ONHA 2JCHA 3LO7A 3CPTB 1TS0A 4HJ3A 4JBFA 3HUNA 1ZG4A 1IEMA 3B42A 3LIDA 3HL9A 5G4YA 1FCMA 2XF3A 1NZUA 3JYIA 1H8MA 2ZOHA 3NJAA 4UA7A 4RVAA 1IYQA 1P9WA 3N4IA 4E04A 1YLJA 4O8GA 3VOYA 5C5KA 1NYYA 4FD8A 2O9BA 2H28A 2Q9MA 2ZMFA 2JBFA 3SH8A 1MKMA 4L9EA 4QHCA 4M4XA 5DTSA 4GD6A 2VZWA 4S2JA 3UMEA 3W8KA 2Y2PA 3ZHHA 4QY6A 4I5SA 1NZOA 1V9ZA 2W3FA 1NXYA 2G2WA 2J9OA 3EEHA 5GLCA 3VSLA 3QP8A 2YKFA 1I2SA 1I5QA 4IJGA 4KQDA 5I5LA 3Q7VA 3TG9A 2M1CA 3N8SA 1NY0A 5EVLA 4NXEA 5A91A 4G3VA 2J3TC 2BG1A 2XFSA 4N9KA 4PM9A 4D60A 3PBNA 4OPRA 2XDMA 3H7WA 2VGLM 4OLGA 1W8QA 3HLWA 5HPFA 4JGPA 2LB5A 1XA7A 4YNRA 3VFFA 2HJEA 4NXGA 5CRFA 4PPRA 3WS5A 2EX8A 4CLCC 3LIEA 5J4EA 4EQ1A 3HVFA 3ICYA 1VEUA 4JGQA 1K4FA 3HCYA 4EERA 5HAPA 3FV7A 1YLTA 5L09A 3VP3A 1XFNA 1FCOA 4UQIS 4GJ4A 4IHQA 4X53A 2B95A 1GSWA 2V1ZA 4R0QA 3GSGA 2P9VA 2ZD8A 3UPPA 5M19A 2XH9A 2PU4A 3Q7VB 3TJZC 2VV8A 3U2AA 4HJ6A 1KOUA 1XJ4A 3IBRA 1PW1A 1T1AA 3QNBA 2ZC3B 3UE0A 2QMIA 2ZQ9A 3H7WB 3NHQA 4MMNA 4FOFA 2ZQ8A 1LL8A 2X02A 2JKTM 3H82A 4JXWA 4QD4A 2FFYA 3T1RA 2OWJA 4AFIA 2EXBA 1K38A 3FG8A 2ZC5B 4S2NA 1VEUB 1S4SA 2XR0A 1GCEA 1K6SA 2B02A 4GDBA 2X71A 4K08A 3NOPC 4Q0JA 1LSVA 2BASA 4QY5A 1TF1A 2LB9A 2P9VB 4DJ3A 3O86A 2L1MA 1N4OA 3GQZA 3P98A 5E2GA 3IS2A 1BLSA 1TS7A 1BT5A 4N9LA 3EOIA 1NLZA 1BSGA 2ZC7A 3MFXA 3K3DA 1JNUA 3C7VA 4JGRA 1FSYA 3ZG5A 4OQGA 1FOFA 4H8RA 1LI9A 2BLSA 3H82B 4Y15A 2VKSA 4JPMA 3T50A 5DVAA 2PDRA 1J9MA 1EROA 3CI6A 5A8BA 1NRJA 2Y2GA 1OT9A 3HJIA 4KQQA 3N7WA 4CLCA 2EX6A 3UDIA 3T12B 4HY8A 4ZJ2A 3U4LP 2OV5A 3ZNYA 4FUWA 2KDKA 4DE2A 3NC8A 4XXRA 2L0WA 1K56D 1T19A 2P04A 4D2OA 4R4SA 1XX2A 5AQ9A 4FSFA 3IS2B 4A5RA 2W3DA 2JKRI 1FQGA 4RQ9A 3C38A 4OONA 2HDRA 3A3IA 3OBFA 3R7WA 4OOYA 3VE3A 1S0WA 5A90A 2PT7A 5CTMA 3IT9A 3W2ZA 1C3BA 1V9YA 2PBDP 1PWCA 2EFUA 5DJUA 4CLCB 5EUAA 3BY8A 2ZC4B 2OLUA 2V1BA 3GR2A 3EQVA 3HLCA 2I72A 3UE6A 2K31A 5D3OA 1JWVA 5HDSA 4BQMA 2OAQ1 5KSHA 4GHIA 5CEDA 5FI2A 3UPOA 2GNXA 5FAQA 3SOIA 4S2KA 1O07A 4LLOB 5FI6A 5TR7A 4P6BA 5CHJA 2EXAA 1N9NA 4KZ7A 4WZ5A 1EW0A 3MXQA 4M3KA 3R7WB 3IXGA 2X01A 2EX9A 1MKIA 2WKPA 1XXMA 3BQ8A 1W63Q 1NWZA 4E3NA 3OC2A 3MQQA 2ZM8A 2W0NA 3NCKA 4ZRRA 3F1PA 4KUKA 4DE1A 2WGWA 3G30A 3M2JA 4CLCE 4BBVA 5AJGA 4NETA 2EA9A 2Y8HA 2PHYA 1XP4A 5G4ZA 1FILA 3HUOA 3KO6A 1ONGA 1K25A 4GHIB 4B4ZA 3QP6A 1VM1A 3ISGA 3MZEA 4PKYG 4X1LA 4LRZE 1KE3A 2KLIA 5EFWA 2XGNA 2FH5A 3BFEA 5HWTA 1H0MA 3HLGA 4LCMA 4OH0A 2AVXA 3Q82A 1XJ2A 3LR3A 3C8CA 2MJ6A 4E3LA 4LV0A 3LR0A 2J3WA 1ESIA 1D06A 3IH9A 1HLUP 4UA9A 3IF6C 3LIBA 5DKLA 2E8IA 3LYXA 3F1PB 2HF6A 4O01A 5M18A 2WGWB 4C75A 3RH8B 3R4KA 3S22A 2JKTI 4IBXA 4Y0TA 2W3EA 4ZJ1A 3ZG7B 3DWZA 5A92A 3HLFA 3VFHA 1LL9A 1CEFA 2V1AA 5CXWA 5U47A 3NDEA 2M7VA 3RTYA 3UB7A 4X56A 2ZLYA 3S7OA 2QKPA 3IX3A 3EWKA 3TE8A 5DTKA 3CUEA 2HZ5A 1DP9A 5AQBA 5G18A 5DFYA 1QMEA 5DTTA 1OTAA 2Y2MA 3OLOA 1L2SA 3BRMA 5E2FA 5M1AA 1CEGA 4Q0IA 1ZHHB 2Y2LA 3VE4A 2L4RA 3BWLA 4PM7A 3NOTC 5HDCA 3LGOA 2ZQCA 4GCZA 5E43A 4DF6A 3FPWA 2VV6A 1MC0A 1XPBA 1D1JA 4HBTA 4PHTA 3K2NA 1LSWA 4R23A 2J7VA 4BWIA 4X6TA 3NBLA 3ZVWA 2A49A 4Y5FA 3MKFA 3B47A 1IKIA 4WUJA 1F5MA 3EGXC 3MF0A 1Y28A 3GECA 1M6KA 2QYBA 5DKKA 1YLWA 1WYCA 1WYBA 1TDGA 1NYMA 3IF6A 1HTZA 3V3SA 4EQIA 4F3LA 4KQOA 3T4SA 3E98A 3OZHA 3QP5A 4B9OA 4DE3A 3HREA 4UA6A 4E3KA 5EVEA 3TRCA 4KQRA 3UDXA 1F98A 4P87A 3GMWA 4DDSA 1YAXA 4ARZA 1SKOA 3PAGA 1GA9A 3VP4A 1MWSA 5FQKA 4EU0A 1OT6A 2QJ5A 1YLZA 2JKRM 4HIAA 5F1FA 3AGDA 1WA9A 2V8CA 4BBUA 4MN5A 1GHIA 2XSSA 1ES5A 3E4PA 3JVVA 4HOIA 3GVBA 1P9RA 4GS9A 4Z1WA 3Q07A 2OSUA 3CLOA 2J9PA 4BBTA 2VV7A 4Y0OA 4EBPA 3V5MA 4NXFA 3IF6B 4EBLA 4F3LB 4WLAA 2HV1A 2RL3A 4YINA 2XFTA 2VGLS 3VV4A 3S1YA 1S67L 1YSPA 5EE8A 2EFXA 5TBMA 2W3GA 4ARZB 1SKOB 3VP0A 3BY9A 5DFXA 3W4PA 1DJBA 4ID4A 2Y2JA 1MXOA 5CEBA 1PRQA 4MNRA 1FCNA 1E25A 3I7JA 2OOLA 1G68A 2QHKA 4HI4A 2W3HA 5GHYA 2FFFB 3JVUA 4IVIA 2Y91A 1E4DA 4R38A 4GKUA 4GS9B 3D72A 2OAP1 3DTEA 3PAEA 3F1NA 5KIZA 3G31A 4P6ZM 1CJFA 2NUPC 1K55C 2Q9NA 3FKWA 4S2OA 3FYZA 4OKPA 4NG2A 1L0GA 2HP5A 5TBMB 3E4QA 2XLNA 3MFDA 3BJNA 3F1OA 1IYOA 4L0LA 5J7EA 1CQAA 3G2ZA 3C5AA 2EX2A 4JLFA 2Y4AA 1S66L 4KZ8A 3IHBA 3BECA 4ZAMA 5HWWA 3DWKA 4IUHA 4OPZA 3RFBA 5KSCA 5BOHA 1UWPX 4YFMA 3T4LA 2R9XA 1T1CA 3F1NB 2IWDA 4RX3A 1PFLA 3P7NA 3ZCZA 4IEDA 2V0WA 3TSGA 2WGVA 4EXOA 3W4OA 1G28A 1KGFA 4Y2FA 1MWUA 4KZAA 4HBUA 4ZDXA 4FTXA 2HGVA 1N9OA 1Z6FA 5KZHA 1YLPA 3F1OB 2H10A 1XFQA 1G5UA 2JKFA 3ULFA 3WRZA 4E3OA 5HFOA 3DTMA 1PYYA 1GSXA 5FL3A 4KENB 4LRXC 3OCNA 1E3UA 5CX7A 4ZTKA 2P7JA 3VOLA 1E3UD 1LHYA 1OTIA 3HLEA 2ZQAA 3OCLA 3ZDJA 4C6YA 4ME4A 4LFUA 4R1GA 4WL9A 2J80A 1JWZA 2D02A 2PBYA 1WE4A 3ZQ5A 1EWZA 2XRNA 4NK3A 1K55A 1MWRA 5EV0A 1H8ZA 2WZZA 4N1HA 5EM1A 1U60A 1BZAA 1BLHA 5F68A 3NULA 1S6RA 1XGIA 4XUXA 1ES3A 3PXPA 5AQAA 3N6IA 2VK3A 4KG5A 3PBSA 2P08A 2OLVA 4LV1A 3H9WA 4CQHA 2WKRA 1OTBA 2C6WB 4JF4A 4CLCD 1NLYA 4LENA 5GLDA 4Y7PA 3ITBA 4RA7A 5CGXA 5L8MA 4BENA 2Y2NA 3MKEA 3CAXA 1Z09A 4EETB 3KYZA 5F1GA 4YWZA 4WEKA 2QJ7A 3WS1A 3LEZA 5GLAA 3HJKA 5HPIA 3QNCA 5IT5A 3UY6A 1ACFA 2XD1A 3MXRA 1IFQA 2D01A 2VJWA 1K0KA 3NY4A 4I3JA 3S7PA 3IBJA 4FCFA 1YQSA 2VX8A 4R6LA 4Y13A 4EESA 4MDZA 2ZBBA 3VSKA 4QWOA 2HDSA 4IBRA 5HD5A 5FSRA 3NECA 2YKHA 3JPUA 3EGDC 3UNWA 4WBGA 2WK0A 1SZVA 3B3XA 3NDGA 4MN7A 3KSGA 3MSHA 4LGWA 3SH9A 3PBQA 5F6AA 3CJMA 2HJ9C 1BTLA 4DMZA 3T4OA 3D9YA 5EVIC 1CI8A 1MWTA 4EV4A 2HDUA 3HLDA 3QP1A 3A3FA 4S2IA 3IXBA 5TFQA 3UMDA 4LPZA 4HH3A 1QMFA 4UEYA 1LT0A 3NOUC 3C4PA 1CF0A 5FQJA 4EEUA 4JKTA 4WMCA 4KG6A 5HAIA
chains in the Genus database with same CATH topology
4G3VA 2J3TC 5AVEA 3PBNA 3MR0A 4WUJA 1F5MA 3H7WA 3EGXC 3MF0A 3UE3A 2VGLM 4GLQA 1Y28A 5HPFA 4JGPA 4LRYC 1OJ5A 2LB5A 3GECA 4YNRA 2QYBA 5DKKA 2HJEA 4NXGA 3LR4A 2A2LA 4CLCC 3LIEA 5TJJA 4F3LA 5J4EA 4KQOA 4EQ1A 3T4SA 3E98A 3ICYA 2JHEA 4B9OA 4JGQA 3LICA 3TRCA 3HCYA 4EERA 4ETZA 3A0VA 1S1ZA 3V67A 1F98A 3PBRA 1XFNA 2PYRA 4H6JA 4UQIS 1YAXA 4ARZA 4GJ4A 4IHQA 1XJ3A 1GSWA 4EU0A 4HP9A 1OT6A 2QJ5A 3EEAA 5HL6A 1OTEA 2JKRM 4HIAA 3FPVA 3TJZC 2VV8A 3U2AA 4HJ6A 1KOUA 1XJ4A 3IBRA 1WA9A 1T1AA 2G7UA 3KSFA 1MZUA 4BBUA 1X0OA 1H3QA 4MN5A 3H7WB 3A0RA 2XSSA 4NEED 3E4PA 3NHQA 4MMNA 4FOFA 3JVVA 3KX0X 4HOIA 4GS9A 1P9RA 1LL8A 4Z1WA 1TS6A 2XA7M 2KOIA 3CLOA 4BBTA 2JKTM 3H82A 2VV7A 5AVFA 3UB9A 4BJPA 2OWJA 4NXFA 4R70A 4G3KA 2W27A 4AFIA 3ZYTA 3FG8A 4F3LB 3A0SA 4WLAA 4WELA 1S4SA 2HV1A 4OOLA 2VGLS 2B02A 3VV4A 3PYPA 1S67L 1GSVA 1YSPA 3LFVA 4K08A 5TBMA 4H6JB 2W3GA 4ARZB 3NOPC 4L9GA 3BY9A 4I39A 4Q0JA 5DFXA 3CUEC 1LSVA 5LBRA 2BASA 1TF1A 2VA0A 3BQAA 2LB9A 4DJ3A 2DMWA 4DN0A 2L1MA 1VB6A 2OOLA 3PBTA 1N9LA 2QHKA 4HI4A 4II7A 1G6OA 2INWA 5K5BA 2W3HA 3IS2A 1TS7A 1XJ6A 3O5YA 3B33A 3JVUA 2A24A 3EOIA 1NLZA 2EWWA 3MFXA 3K3DA 1JNUA 4R38A 4JGRA 4GS9B 3D72A 2OAP1 1DP8A 4XT2A 3GDIA 3F1NA 1UWNX 3H82B 5KIZA 2VKSA 4P6ZM 3T50A 2PDRA 2NUPC 2R78A 3CI6A 5A8BA 1NRJA 3T4JA 1OT9A 3HJIA 2K2NA 4KUOA 3UB6A 3T4TA 5TBMB 3E4QA 2XA7S 4CLCA 3D3OA 3BJNA 3F1OA 2OWHA 4L0LA 5J7EA 4HY8A 3SW1A 5IS1A 2KDKA 3PHYA 4L9FA 2L0WA 1S66L 4R3AA 1T19A 2P04A 1STZA 5HWWA 1W63M 2NUTC 4FSFA 2O9AA 3IS2B 3OOVA 3LR5A 4IUHA 3T4QA 1TS8A 2W3DA 2A24B 3RFBA 2JKRI 3S7QA 1UWPX 4WF0A 3E0YA 3BW6A 3T4LA 5DF9A 4XT2B 4RQ9A 3C38A 4NKPA 1T1CA 3F1NB 3KSHA 5HZHA 3P7NA 1ZTUA 3PBOA 2GJ3A 3OBFA 3R7WA 1DP6A 2V0WA 3VE3A 5MC7A 5HSQA 3LI8A 4EXOA 2PT7A 1G28A 3W2ZA 3K3CA 4Y2FA 2FZ0A 3EQUA 1V9YA 5HDDA 1F9IA 3MQ0A 4PAUA 4EEPA 2HGVA 5DJUA 1N9OA 4CLCB 5F5YA 4G3WA 3BY8A 1VHMA 2JN7A 2WKQA 3F1OB 2V1BA 4P6ZS 3EQVA 4YOFA 3PR6A 3UE6A 1XFQA 3ULFA 2K31A 2Y79A 2PD8A 5HD3A 2EWVA 5HDSA 1P0ZA 4B93A 5FL3A 1GSXA 2OAQ1 3S7NA 5KSHA 2W1TA 4GHIA 2ZOIA 2GNXA 1OPXA 2V0UA 3LUQA 2O9CA 3OCNA 4LRXC 4LLOB 2O99A 5CX7A 4NXBA 4ETXA 2P7JA 5J3WA 3VOLA 2XROA 4O0PA 1OTIA 2GZAA 1N9NA 3CWFA 3OCLA 1EW0A 1TD5A 3MXQA 3E4OA 3R7WB 1IOUA 4ME4A 4WL9A 2WKPA 4HQAA 2J80A 3BQ8A 1W63Q 1NWZA 3CITA 3MJQA 1LSXA 2D02A 4HP4A 3C2WA 4Y3IA 3OC2A 3ZQ5A 2XRNA 1P97A 3MQQA 2W0NA 4ZRRA 3F1PA 4KUKA 4EUVA 2IA2A 4CLCE 4BBVA 5AJGA 2EA9A 2Y8HA 3T4KA 1S1YA 5F68A 2PHYA 3PXPA 5G4ZA 2CMNA 3KO6A 2W1TB 1UGUA 2PR6A 4GHIB 3PBSA 2P08A 1YKDA 4PKYG 4HNBA 4LRZE 2V9AA 3H9WA 2KLIA 2ZMVA 4CQHA 2WKRA 2GX5A 1OTBA 5EFWA 4CLCD 2FH5A 5HWTA 5IU1A 1NLYA 4HHDA 4MN6A 2W1RA 1DRMA 3C30A 5L8MA 3LIAA 4HH2A 2QWSA 2B18A 2Z6DA 1XJ2A 3LR3A 3C8CA 2MJ6A 3CAXA 3LR0A 3LI9A 2J3WA 3KYZA 4EETB 4QPRA 4WEKA 4YWZA 1D06A 2QJ7A 5HWVA 3LIBA 5DKLA 3HJKA 4HJ4A 1OJGA 5DJTA 5HPIA 3LYXA 5IT5A 3F1PB 2HF6A 4O01A 4JGOA 1S4RA 2VLGA 2K7SA 1IFQA 2D01A 2VJWA 3RH8B 4I3AA 3R4KA 2JKTI 2PR5A 3LIFA 4I3JA 3S7PA 4IUKA 3IBJA 4DJ2A 4I3IA 4BMWA 2VEAA 2VX8A 2W3EA 4R6LA 1ODVA 2O0YA 1T1BA 2Z6CA 3MMHA 2PYPA 4Q0HA 3DBAA 4EW7A 2V1AA 4EESA 4MDZA 1YSQA 2ZBBA 2PD7A 2M7VA 3RTYA 4I38A 3UB7A 3S7OA 2QKPA 4OOMA 3UB8A 5HD5A 3KYQA 1TS0A 4HJ3A 3EWKA 5F69A 3TE8A 2YKHA 3CUEA 2M7UA 3EGDC 3B42A 3LIDA 1DP9A 5G4YA 5DFYA 4WN5A 4MN7A 3KSGA 1H8MA 1OTAA 3TW8A 2ZOHA 3NJAA 2KX6A 3OLOA 1P9WA 4E04A 4O8GA 4GW9A 3PBQA 5F6AA 4UQIM 2HJ9C 5C5KA 4WEJA 4Q0IA 1ZHHB 4DMZA 2O9BA 2H28A 4MCWA 3T4OA 2ZMFA 3VE4A 2L4RA 3BWLA 1MKMA 4PKYA 2I9VA 4L9EA 4M4XA 3NOTC 5HDCA 3G6OA 2VZWA 3P01A 4GCZA 3UMEA 3MQOA 3FPWA 2VV6A 1MC0A 4I5SA 1V9ZA 4PHTA 2W3FA 3K2NA 1LSWA 2J3TD 3FC7A 1OTDA 4LPZA 3EEHA 4HH3A 3KSIA 3UMDA 4BWIA 2YKFA 4UEYA 1LT0A 3NOUC 4IJGA 1T18A 4KQDA 5I5LA 2M1CA 4EEUA 4Y5FA 1BYWA 3B47A 1D7EA 4NXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3V A;  5HPI A;  4YOF A;  2OOL A;  1F5M A;  3MF0 A;  4O01 A;  2K31 A;  2Y79 A;  2W3H A;  4GLQ A;  5K5B A;  5HPF A;  4LRY C;  3O5Y A;  2LB5 A;  4YNR A;  2QYB A;  2VJW A;  3S7N A;  2W1T A;  3R4K A;  3S7P A;  4IUK A;  3IBJ A;  2VEA A;  2W3E A;  4R6L A;  2O0Y A;  2O9C A;  4LRX C;  3MMH A;  5TJJ A;  2O99 A;  4Q0H A;  3DBA A;  2VKS A;  3E98 A;  4ETX A;  4MDZ A;  1YSQ A;  2XRO A;  2M7V A;  3CI6 A;  3TRC A;  3HCY A;  4O0P A;  4ETZ A;  3S7O A;  1TD5 A;  2K2N A;  4ME4 A;  4EU0 A;  2M7U A;  3EEA A;  5HL6 A;  3CIT A;  3D3O A;  5DFY A;  3BJN A;  3C2W A;  4Y3I A;  3ZQ5 A;  2XRN A;  4MN7 A;  4ZRR A;  3KSG A;  3IBR A;  2G7U A;  3KSF A;  4EUV A;  4E04 A;  2IA2 A;  4O8G A;  4GW9 A;  5AJG A;  2Y8H A;  1STZ A;  2XSS A;  3NHQ A;  5C5K A;  4MMN A;  4FOF A;  4Q0I A;  2O9A A;  4IUH A;  3OOV A;  4DMZ A;  2W3D A;  2O9B A;  4MCW A;  4Z1W A;  3RFB A;  2ZMF A;  3KO6 A;  2KOI A;  3S7Q A;  1MKM A;  2W1T B;  3E0Y A;  3NOT C;  1YKD A;  3G6O A;  2VZW A;  4R70 A;  4G3K A;  4RQ9 A;  4LRZ E;  2KLI A;  1MC0 A;  4CQH A;  2GX5 A;  3KSH A;  2W3F A;  3K2N A;  1ZTU A;  3VV4 A;  3OBF A;  2W1R A;  1YSP A;  3LFV A;  3KSI A;  5HSQ A;  5L8M A;  4BWI A;  2W3G A;  3NOP C;  3NOU C;  4Q0J A;  5DFX A;  4IJG A;  3W2Z A;  2B18 A;  4Y2F A;  5LBR A;  5I5L A;  3MQ0 A;  1TF1 A;  4PAU A;  2LB9 A;  4Y5F A;  2HGV A;  4QPR A;  4G3W A;  4DN0 A;  1VHM A; 
#chains in the Genus database with same CATH topology
 5AVE A;  3BFG A;  5FAO A;  1W5D A;  4GLQ A;  1OJ5 A;  3G4P A;  4WZ4 A;  4LCL A;  3RXW A;  3N8L A;  4GN2 A;  1M40 A;  4DXC A;  2DRW A;  5GHX A;  1DY6 A;  3BFD A;  4WYY A;  2JHE A;  1SDE A;  3LIC A;  2WKI A;  4ETZ A;  1S1Z A;  3PBR A;  4H6J A;  1PI5 A;  4OLD A;  3AGF A;  3BM6 A;  4X68 A;  1L0E A;  1HVB A;  3OPL A;  2IWB A;  1W7F A;  1MBL A;  1OTE A;  5CTN A;  3FPV A;  4OP8 A;  1K57 C;  1IYS A;  2G7U A;  5JYP A;  1MZU A;  4PM5 A;  2HDQ A;  3G35 A;  5I94 A;  4WM9 A;  1GHP A;  3A0R A;  4NEE D;  2JC7 A;  4OQ0 A;  2V20 A;  4UHU A;  2XA7 M;  1Q2Q A;  3UO9 A;  3UB9 A;  4R70 A;  2W27 A;  2UWX A;  3A0S A;  4WEL A;  2Y2I A;  5FAP A;  5L07 A;  4R3B A;  4OOL A;  4OPQ A;  3PYP A;  5JYO A;  1GSV A;  1OME A;  4H6J B;  1IKG A;  2CC1 A;  4X55 A;  4L9G A;  5EVI A;  5LBR A;  1YLY A;  1FIK A;  4KZ9 A;  3ZGA B;  2Y2K A;  3BFC A;  1VB6 A;  3KYE A;  3N8R A;  4MBH A;  5K5B A;  3Q81 A;  5KMW A;  4P85 A;  3IHA A;  3O5Y A;  5CEC A;  4Z9Q A;  5E2H A;  2EWW A;  3T1X A;  4KZ3 A;  2B5R A;  3C7U A;  1JVJ A;  3LCE A;  3LY4 A;  1PWD A;  3DAV A;  1XGJ A;  1L0F A;  3G2Y A;  4RX2 A;  1UWN X;  1N9B A;  1PNE A;  5L2F A;  3IQA A;  2WKE A;  4X1M A;  2K2N A;  4HES A;  4P0M A;  3GRJ A;  3OPR A;  1LI0 A;  2V8F A;  3T4T A;  1KGG A;  4KG2 A;  3T1S A;  5EVI B;  5EEC A;  5GHZ A;  1TVF A;  2OWH A;  3SW1 A;  5IS1 A;  4C3Q A;  4R3A A;  3V3R A;  1STZ A;  3M6H A;  1W63 M;  2O9A A;  1TS8 A;  4WF0 A;  3E0Y A;  3VP2 A;  3BW6 A;  4MBK A;  3GTC A;  4S2M A;  3CZD A;  3WS0 A;  5GL9 A;  5HX9 A;  3L9K A;  3IWI A;  5HZH A;  4R3J A;  1ZTU A;  3PBO A;  3WWX A;  3SZT A;  5HSQ A;  4N92 A;  4E3I A;  1SKF A;  1ZC2 A;  5DF8 A;  4R4R A;  3UE1 A;  3EQU A;  2WGI A;  5HDD A;  1F9I A;  4PAU A;  4EEP A;  4KZ6 A;  5HAR A;  3IXD A;  5F5Y A;  4G3W A;  2PU2 A;  1VHM A;  5CHU A;  1BUL A;  3NI9 A;  1AWI A;  4P6Z S;  4YOF A;  2PD8 A;  5HD3 A;  4QU3 A;  2EWV A;  3IX8 A;  4B4X A;  1P0Z A;  1XKZ A;  1FR1 A;  4OP5 A;  2W1T A;  2O9C A;  2Y2H A;  3Q7Z A;  5FQM A;  2O99 A;  1PZO A;  5FDH A;  1GHM A;  4NXB A;  3IXH A;  3MZD A;  4DRT A;  4S2N C;  4DXB A;  4JXV A;  2H0Y A;  2DNS A;  4F94 A;  4GDN A;  4HQA A;  3A3E A;  3CIT A;  1SHV A;  1Y4O A;  3MJQ A;  1LSX A;  4MBF A;  4HP4 A;  3C2W A;  4Y3I A;  1P97 A;  4UAA A;  3O3V A;  4IVK A;  3T1Q B;  5IHV A;  4Q8I A;  2WKH A;  4EUV A;  5A93 A;  5HAQ A;  4GNU A;  1IYP A;  3E2L A;  3L7H A;  4PM6 A;  4BD1 A;  1W79 A;  3AGE A;  1S1Y A;  3PTE A;  5TGF A;  2CMN A;  1CI9 A;  2W1T B;  2PR6 A;  1YKD A;  3ZVT A;  4HNB A;  5EM0 A;  2GX5 A;  5IU1 A;  3FZC A;  3VP1 A;  4MN6 A;  1KGE A;  3ZNT A;  2W1R A;  1DRM A;  4JXG A;  3D4F A;  3C30 A;  2R9W A;  4HH2 A;  1VET A;  2QWS A;  2B18 A;  2Z6D A;  1PZP A;  3WS4 A;  3HBR A;  3DTI A;  4QPR A;  3ZG9 B;  5FAT A;  5HWV A;  1L3L A;  1JTD A;  3IF5 A;  5DJT A;  1OJG A;  4DDY A;  1K54 C;  3TOI A;  4FH2 A;  2HP9 A;  4JGO A;  5FEG A;  1S4R A;  1BUE A;  2K7S A;  5CER A;  4U3T A;  4I3A A;  1ERM A;  1W8Y A;  2PR5 A;  1DJC A;  4IUK A;  4DJ2 A;  4Y17 A;  4BMW A;  1ODV A;  1T1B A;  2A3U A;  2Z6C A;  2PYP A;  4EW7 A;  5E2E A;  5F83 A;  1F2K A;  3C4O A;  2PD7 A;  4E6X A;  2PAV P;  2VGJ A;  3UB8 A;  2JE5 A;  3UN7 A;  5J8X A;  3KYQ A;  5F69 A;  1YT4 A;  2M7U A;  4N1X A;  1VET B;  3ZG8 B;  3O87 A;  4WN5 A;  1J3W A;  3V50 A;  5FDS A;  4EWF A;  3TW8 A;  2KX6 A;  4Y0U A;  2ZQ7 A;  3DW0 A;  5CGW A;  4GW9 A;  1RGY A;  4UQI M;  2QZ6 A;  1FSW A;  1HZO A;  4WEJ A;  4B88 A;  3BLS A;  4MCW A;  3BYD A;  4PKY A;  2I9V A;  2ZM0 A;  4U0T A;  1KVL A;  2Z2M B;  3G6O A;  3P01 A;  3MQO A;  3GV9 A;  1HD8 A;  3FWL A;  2J3T D;  1CK3 A;  3FC7 A;  1OTD A;  1KE4 A;  3KSI A;  4WZ5 C;  4X69 A;  4JF6 A;  5HL1 A;  1T18 A;  4PM8 A;  1VQQ A;  3E2K A;  4QB8 A;  1BYW A;  2WAE A;  1D7E A;  4BL3 A;  4JXS A;  1KVM A;  3MR0 A;  1YPR A;  2Z2L B;  3UE3 A;  4LRY C;  4X25 A;  3ZG0 A;  3LR4 A;  3VOZ A;  4FH4 A;  3QP2 A;  4BLM A;  1BLP A;  2A2L A;  1K56 A;  2ACG A;  5TJJ A;  4EUZ A;  1K54 A;  3LEQ A;  1H8Y A;  4HEF A;  4S2L A;  1ZKJ A;  3A0V A;  3V67 A;  2PYR A;  4K0W A;  3QP4 A;  3IX4 A;  1PI4 A;  1ES4 A;  4LV2 A;  1XJ3 A;  3WS2 A;  2H0T A;  4HP9 A;  1AXB A;  3EEA A;  3W4Q A;  5HL6 A;  2Y2Q A;  2JKG A;  1GA0 A;  4BL2 A;  1K4E A;  2RCX A;  4MLL A;  5FQ9 A;  3KSF A;  5FQI A;  1X0O A;  3IWQ A;  3SS4 A;  1H3Q A;  2HP6 A;  1KE0 A;  3SS5 A;  4E3M A;  3MBZ A;  1TEM A;  4K0X A;  2E8J A;  3KX0 X;  1KDS A;  4MEZ A;  1TS6 A;  2KOI A;  3CMZ A;  2Y59 A;  4GD8 A;  4S2P A;  3BFF A;  5AVF A;  2V2F F;  2VGK A;  4CPK A;  4BJP A;  4DKI A;  2XEP A;  2ZM2 A;  2ZMA A;  4G3K A;  3ZYT A;  3MXS A;  4GOG A;  3SH7 A;  3LFV A;  4ZBE A;  4I39 A;  2Y55 A;  3CUE C;  2PRF A;  4DE0 A;  1TDL A;  3MZF A;  3S4X A;  4QJG A;  2VA0 A;  3BQA A;  1RP5 A;  2DMW A;  1Q2P A;  4DN0 A;  4JF5 A;  1YMS A;  3M6B A;  2ZQD A;  3PBT A;  1N9L A;  4II7 A;  4PMA A;  1G6O A;  2INW A;  1XJ6 A;  3B33 A;  2A24 A;  3DTK A;  1LLB A;  2DCF A;  3M2K A;  4LV3 A;  1RGZ A;  2XK1 A;  4XT2 A;  1DP8 A;  1SCW A;  3GDI A;  1A0K A;  2G2U A;  4GZB A;  5CHM A;  2R78 A;  5FQQ A;  3T4J A;  1ES2 A;  4WMC D;  3OPP A;  3BEB A;  4KUO A;  2XD5 A;  3HLB A;  3UB6 A;  1LL5 A;  1DJA A;  3BLM A;  2XA7 S;  1G6A A;  3D3O A;  2UV0 E;  3SS3 A;  5GLB A;  2WYX A;  1PWG A;  3G34 A;  3PHY A;  4L9F A;  4U0X A;  1ERQ A;  2P74 A;  1EI5 A;  2NUT C;  3OOV A;  3LR5 A;  3T4Q A;  2A24 B;  3UPN A;  3S7Q A;  1PW8 A;  2IWC A;  3MS6 A;  5DF9 A;  4XT2 B;  4NKP A;  3Q1F A;  2ZL1 A;  3KSH A;  3UDF A;  1JTG A;  4CJN A;  2C5W B;  2GJ3 A;  2ZJ9 A;  1I2W A;  4KZB A;  1DP6 A;  5MC7 A;  3NIA A;  3LI8 A;  2WAD A;  1NRF A;  1IEL A;  3K3C A;  2FZ0 A;  3MQ0 A;  5F82 A;  2HPB A;  4E6W A;  5FA7 A;  2JN7 A;  2WKQ A;  2XQZ A;  4XUZ A;  4BD0 A;  1FR6 A;  3PR6 A;  2BTF P;  2Y79 A;  5HW3 A;  4OPY A;  2WZX A;  3IH8 A;  1SDN A;  1YM1 A;  4B93 A;  1JWP A;  3WRT A;  3S7N A;  4K91 A;  2ZOI A;  1OPX A;  4RYE A;  2V0U A;  3LUQ A;  3P09 A;  1O7E A;  4OVD A;  1Y54 A;  4ETX A;  5EVI D;  5J3W A;  2XRO A;  2J8Y A;  1H5X A;  4O0P A;  2WAF A;  2GZA A;  1RCJ A;  2ZL1 B;  3CWF A;  1TD5 A;  3E4O A;  1MPL A;  1IOU A;  3LY3 A;  3VMA A;  3G32 A;  2ZC6 B;  3A3J A;  3CG5 A;  2WUQ A;  2IA2 A;  5AQ7 A;  1PIO A;  4OQH A;  3T4K A;  4ZJ3 A;  1YMX A;  5FEF A;  2Q0O A;  5EOO A;  1UGU A;  3UB5 P;  4ESP A;  1NJ4 A;  4EBN A;  3ZFZ A;  2V9A A;  2ZMV A;  1ALQ A;  3CPT A;  3V39 A;  3O88 A;  4HHD A;  4O7D A;  3LIA A;  1L0D A;  3IWO A;  5CGS A;  4OQI A;  3LI9 A;  3HUM A;  5L10 A;  4GB7 A;  1MY8 A;  1K57 A;  2QPN A;  1ESU A;  5EPH A;  4HJ4 A;  2GDN A;  5FI7 A;  3QHY A;  1K6R A;  3RXX A;  5EOE A;  5FAS A;  3ITA A;  3FKV A;  2VLG A;  3OPH A;  5DF7 A;  4KZ4 A;  2Y2O A;  3CHW P;  3LIF A;  4I3I A;  2VEA A;  2O0Y A;  3RJU A;  3MMH A;  4E3J A;  4Q0H A;  3DBA A;  3A3D A;  1BLC A;  1YSQ A;  1ZG6 A;  4KZ5 A;  2H5S A;  4I38 A;  1XA1 A;  1KDW A;  4OOM A;  1ONH A;  2JCH A;  3LO7 A;  3CPT B;  1TS0 A;  4HJ3 A;  4JBF A;  3HUN A;  1ZG4 A;  1IEM A;  3B42 A;  3LID A;  3HL9 A;  5G4Y A;  1FCM A;  2XF3 A;  1NZU A;  3JYI A;  1H8M A;  2ZOH A;  3NJA A;  4UA7 A;  4RVA A;  1IYQ A;  1P9W A;  3N4I A;  4E04 A;  1YLJ A;  4O8G A;  3VOY A;  5C5K A;  1NYY A;  4FD8 A;  2O9B A;  2H28 A;  2Q9M A;  2ZMF A;  2JBF A;  3SH8 A;  1MKM A;  4L9E A;  4QHC A;  4M4X A;  5DTS A;  4GD6 A;  2VZW A;  4S2J A;  3UME A;  3W8K A;  2Y2P A;  3ZHH A;  4QY6 A;  4I5S A;  1NZO A;  1V9Z A;  2W3F A;  1NXY A;  2G2W A;  2J9O A;  3EEH A;  5GLC A;  3VSL A;  3QP8 A;  2YKF A;  1I2S A;  1I5Q A;  4IJG A;  4KQD A;  5I5L A;  3Q7V A;  3TG9 A;  2M1C A;  3N8S A;  1NY0 A;  5EVL A;  4NXE A;  5A91 A;  4G3V A;  2J3T C;  2BG1 A;  2XFS A;  4N9K A;  4PM9 A;  4D60 A;  3PBN A;  4OPR A;  2XDM A;  3H7W A;  2VGL M;  4OLG A;  1W8Q A;  3HLW A;  5HPF A;  4JGP A;  2LB5 A;  1XA7 A;  4YNR A;  3VFF A;  2HJE A;  4NXG A;  5CRF A;  4PPR A;  3WS5 A;  2EX8 A;  4CLC C;  3LIE A;  5J4E A;  4EQ1 A;  3HVF A;  3ICY A;  1VEU A;  4JGQ A;  1K4F A;  3HCY A;  4EER A;  5HAP A;  3FV7 A;  1YLT A;  5L09 A;  3VP3 A;  1XFN A;  1FCO A;  4UQI S;  4GJ4 A;  4IHQ A;  4X53 A;  2B95 A;  1GSW A;  2V1Z A;  4R0Q A;  3GSG A;  2P9V A;  2ZD8 A;  3UPP A;  5M19 A;  2XH9 A;  2PU4 A;  3Q7V B;  3TJZ C;  2VV8 A;  3U2A A;  4HJ6 A;  1KOU A;  1XJ4 A;  3IBR A;  1PW1 A;  1T1A A;  3QNB A;  2ZC3 B;  3UE0 A;  2QMI A;  2ZQ9 A;  3H7W B;  3NHQ A;  4MMN A;  4FOF A;  2ZQ8 A;  1LL8 A;  2X02 A;  2JKT M;  3H82 A;  4JXW A;  4QD4 A;  2FFY A;  3T1R A;  2OWJ A;  4AFI A;  2EXB A;  1K38 A;  3FG8 A;  2ZC5 B;  4S2N A;  1VEU B;  1S4S A;  2XR0 A;  1GCE A;  1K6S A;  2B02 A;  4GDB A;  2X71 A;  4K08 A;  3NOP C;  4Q0J A;  1LSV A;  2BAS A;  4QY5 A;  1TF1 A;  2LB9 A;  2P9V B;  4DJ3 A;  3O86 A;  2L1M A;  1N4O A;  3GQZ A;  3P98 A;  5E2G A;  3IS2 A;  1BLS A;  1TS7 A;  1BT5 A;  4N9L A;  3EOI A;  1NLZ A;  1BSG A;  2ZC7 A;  3MFX A;  3K3D A;  1JNU A;  3C7V A;  4JGR A;  1FSY A;  3ZG5 A;  4OQG A;  1FOF A;  4H8R A;  1LI9 A;  2BLS A;  3H82 B;  4Y15 A;  2VKS A;  4JPM A;  3T50 A;  5DVA A;  2PDR A;  1J9M A;  1ERO A;  3CI6 A;  5A8B A;  1NRJ A;  2Y2G A;  1OT9 A;  3HJI A;  4KQQ A;  3N7W A;  4CLC A;  2EX6 A;  3UDI A;  3T12 B;  4HY8 A;  4ZJ2 A;  3U4L P;  2OV5 A;  3ZNY A;  4FUW A;  2KDK A;  4DE2 A;  3NC8 A;  4XXR A;  2L0W A;  1K56 D;  1T19 A;  2P04 A;  4D2O A;  4R4S A;  1XX2 A;  5AQ9 A;  4FSF A;  3IS2 B;  4A5R A;  2W3D A;  2JKR I;  1FQG A;  4RQ9 A;  3C38 A;  4OON A;  2HDR A;  3A3I A;  3OBF A;  3R7W A;  4OOY A;  3VE3 A;  1S0W A;  5A90 A;  2PT7 A;  5CTM A;  3IT9 A;  3W2Z A;  1C3B A;  1V9Y A;  2PBD P;  1PWC A;  2EFU A;  5DJU A;  4CLC B;  5EUA A;  3BY8 A;  2ZC4 B;  2OLU A;  2V1B A;  3GR2 A;  3EQV A;  3HLC A;  2I72 A;  3UE6 A;  2K31 A;  5D3O A;  1JWV A;  5HDS A;  4BQM A;  2OAQ 1;  5KSH A;  4GHI A;  5CED A;  5FI2 A;  3UPO A;  2GNX A;  5FAQ A;  3SOI A;  4S2K A;  1O07 A;  4LLO B;  5FI6 A;  5TR7 A;  4P6B A;  5CHJ A;  2EXA A;  1N9N A;  4KZ7 A;  4WZ5 A;  1EW0 A;  3MXQ A;  4M3K A;  3R7W B;  3IXG A;  2X01 A;  2EX9 A;  1MKI A;  2WKP A;  1XXM A;  3BQ8 A;  1W63 Q;  1NWZ A;  4E3N A;  3OC2 A;  3MQQ A;  2ZM8 A;  2W0N A;  3NCK A;  4ZRR A;  3F1P A;  4KUK A;  4DE1 A;  2WGW A;  3G30 A;  3M2J A;  4CLC E;  4BBV A;  5AJG A;  4NET A;  2EA9 A;  2Y8H A;  2PHY A;  1XP4 A;  5G4Z A;  1FIL A;  3HUO A;  3KO6 A;  1ONG A;  1K25 A;  4GHI B;  4B4Z A;  3QP6 A;  1VM1 A;  3ISG A;  3MZE A;  4PKY G;  4X1L A;  4LRZ E;  1KE3 A;  2KLI A;  5EFW A;  2XGN A;  2FH5 A;  3BFE A;  5HWT A;  1H0M A;  3HLG A;  4LCM A;  4OH0 A;  2AVX A;  3Q82 A;  1XJ2 A;  3LR3 A;  3C8C A;  2MJ6 A;  4E3L A;  4LV0 A;  3LR0 A;  2J3W A;  1ESI A;  1D06 A;  3IH9 A;  1HLU P;  4UA9 A;  3IF6 C;  3LIB A;  5DKL A;  2E8I A;  3LYX A;  3F1P B;  2HF6 A;  4O01 A;  5M18 A;  2WGW B;  4C75 A;  3RH8 B;  3R4K A;  3S22 A;  2JKT I;  4IBX A;  4Y0T A;  2W3E A;  4ZJ1 A;  3ZG7 B;  3DWZ A;  5A92 A;  3HLF A;  3VFH A;  1LL9 A;  1CEF A;  2V1A A;  5CXW A;  5U47 A;  3NDE A;  2M7V A;  3RTY A;  3UB7 A;  4X56 A;  2ZLY A;  3S7O A;  2QKP A;  3IX3 A;  3EWK A;  3TE8 A;  5DTK A;  3CUE A;  2HZ5 A;  1DP9 A;  5AQB A;  5G18 A;  5DFY A;  1QME A;  5DTT A;  1OTA A;  2Y2M A;  3OLO A;  1L2S A;  3BRM A;  5E2F A;  5M1A A;  1CEG A;  4Q0I A;  1ZHH B;  2Y2L A;  3VE4 A;  2L4R A;  3BWL A;  4PM7 A;  3NOT C;  5HDC A;  3LGO A;  2ZQC A;  4GCZ A;  5E43 A;  4DF6 A;  3FPW A;  2VV6 A;  1MC0 A;  1XPB A;  1D1J A;  4HBT A;  4PHT A;  3K2N A;  1LSW A;  4R23 A;  2J7V A;  4BWI A;  4X6T A;  3NBL A;  3ZVW A;  2A49 A;  4Y5F A;  3MKF A;  3B47 A;  1IKI A;  4WUJ A;  1F5M A;  3EGX C;  3MF0 A;  1Y28 A;  3GEC A;  1M6K A;  2QYB A;  5DKK A;  1YLW A;  1WYC A;  1WYB A;  1TDG A;  1NYM A;  3IF6 A;  1HTZ A;  3V3S A;  4EQI A;  4F3L A;  4KQO A;  3T4S A;  3E98 A;  3OZH A;  3QP5 A;  4B9O A;  4DE3 A;  3HRE A;  4UA6 A;  4E3K A;  5EVE A;  3TRC A;  4KQR A;  3UDX A;  1F98 A;  4P87 A;  3GMW A;  4DDS A;  1YAX A;  4ARZ A;  1SKO A;  3PAG A;  1GA9 A;  3VP4 A;  1MWS A;  5FQK A;  4EU0 A;  1OT6 A;  2QJ5 A;  1YLZ A;  2JKR M;  4HIA A;  5F1F A;  3AGD A;  1WA9 A;  2V8C A;  4BBU A;  4MN5 A;  1GHI A;  2XSS A;  1ES5 A;  3E4P A;  3JVV A;  4HOI A;  3GVB A;  1P9R A;  4GS9 A;  4Z1W A;  3Q07 A;  2OSU A;  3CLO A;  2J9P A;  4BBT A;  2VV7 A;  4Y0O A;  4EBP A;  3V5M A;  4NXF A;  3IF6 B;  4EBL A;  4F3L B;  4WLA A;  2HV1 A;  2RL3 A;  4YIN A;  2XFT A;  2VGL S;  3VV4 A;  3S1Y A;  1S67 L;  1YSP A;  5EE8 A;  2EFX A;  5TBM A;  2W3G A;  4ARZ B;  1SKO B;  3VP0 A;  3BY9 A;  5DFX A;  3W4P A;  1DJB A;  4ID4 A;  2Y2J A;  1MXO A;  5CEB A;  1PRQ A;  4MNR A;  1FCN A;  1E25 A;  3I7J A;  2OOL A;  1G68 A;  2QHK A;  4HI4 A;  2W3H A;  5GHY A;  2FFF B;  3JVU A;  4IVI A;  2Y91 A;  1E4D A;  4R38 A;  4GKU A;  4GS9 B;  3D72 A;  2OAP 1;  3DTE A;  3PAE A;  3F1N A;  5KIZ A;  3G31 A;  4P6Z M;  1CJF A;  2NUP C;  1K55 C;  2Q9N A;  3FKW A;  4S2O A;  3FYZ A;  4OKP A;  4NG2 A;  1L0G A;  2HP5 A;  5TBM B;  3E4Q A;  2XLN A;  3MFD A;  3BJN A;  3F1O A;  1IYO A;  4L0L A;  5J7E A;  1CQA A;  3G2Z A;  3C5A A;  2EX2 A;  4JLF A;  2Y4A A;  1S66 L;  4KZ8 A;  3IHB A;  3BEC A;  4ZAM A;  5HWW A;  3DWK A;  4IUH A;  4OPZ A;  3RFB A;  5KSC A;  5BOH A;  1UWP X;  4YFM A;  3T4L A;  2R9X A;  1T1C A;  3F1N B;  2IWD A;  4RX3 A;  1PFL A;  3P7N A;  3ZCZ A;  4IED A;  2V0W A;  3TSG A;  2WGV A;  4EXO A;  3W4O A;  1G28 A;  1KGF A;  4Y2F A;  1MWU A;  4KZA A;  4HBU A;  4ZDX A;  4FTX A;  2HGV A;  1N9O A;  1Z6F A;  5KZH A;  1YLP A;  3F1O B;  2H10 A;  1XFQ A;  1G5U A;  2JKF A;  3ULF A;  3WRZ A;  4E3O A;  5HFO A;  3DTM A;  1PYY A;  1GSX A;  5FL3 A;  4KEN B;  4LRX C;  3OCN A;  1E3U A;  5CX7 A;  4ZTK A;  2P7J A;  3VOL A;  1E3U D;  1LHY A;  1OTI A;  3HLE A;  2ZQA A;  3OCL A;  3ZDJ A;  4C6Y A;  4ME4 A;  4LFU A;  4R1G A;  4WL9 A;  2J80 A;  1JWZ A;  2D02 A;  2PBY A;  1WE4 A;  3ZQ5 A;  1EWZ A;  2XRN A;  4NK3 A;  1K55 A;  1MWR A;  5EV0 A;  1H8Z A;  2WZZ A;  4N1H A;  5EM1 A;  1U60 A;  1BZA A;  1BLH A;  5F68 A;  3NUL A;  1S6R A;  1XGI A;  4XUX A;  1ES3 A;  3PXP A;  5AQA A;  3N6I A;  2VK3 A;  4KG5 A;  3PBS A;  2P08 A;  2OLV A;  4LV1 A;  3H9W A;  4CQH A;  2WKR A;  1OTB A;  2C6W B;  4JF4 A;  4CLC D;  1NLY A;  4LEN A;  5GLD A;  4Y7P A;  3ITB A;  4RA7 A;  5CGX A;  5L8M A;  4BEN A;  2Y2N A;  3MKE A;  3CAX A;  1Z09 A;  4EET B;  3KYZ A;  5F1G A;  4YWZ A;  4WEK A;  2QJ7 A;  3WS1 A;  3LEZ A;  5GLA A;  3HJK A;  5HPI A;  3QNC A;  5IT5 A;  3UY6 A;  1ACF A;  2XD1 A;  3MXR A;  1IFQ A;  2D01 A;  2VJW A;  1K0K A;  3NY4 A;  4I3J A;  3S7P A;  3IBJ A;  4FCF A;  1YQS A;  2VX8 A;  4R6L A;  4Y13 A;  4EES A;  4MDZ A;  2ZBB A;  3VSK A;  4QWO A;  2HDS A;  4IBR A;  5HD5 A;  5FSR A;  3NEC A;  2YKH A;  3JPU A;  3EGD C;  3UNW A;  4WBG A;  2WK0 A;  1SZV A;  3B3X A;  3NDG A;  4MN7 A;  3KSG A;  3MSH A;  4LGW A;  3SH9 A;  3PBQ A;  5F6A A;  3CJM A;  2HJ9 C;  1BTL A;  4DMZ A;  3T4O A;  3D9Y A;  5EVI C;  1CI8 A;  1MWT A;  4EV4 A;  2HDU A;  3HLD A;  3QP1 A;  3A3F A;  4S2I A;  3IXB A;  5TFQ A;  3UMD A;  4LPZ A;  4HH3 A;  1QMF A;  4UEY A;  1LT0 A;  3NOU C;  3C4P A;  1CF0 A;  5FQJ A;  4EEU A;  4JKT A;  4WMC A;  4KG6 A;  5HAI A; 
#chains in the Genus database with same CATH homology
 4G3V A;  2J3T C;  5AVE A;  3PBN A;  3MR0 A;  4WUJ A;  1F5M A;  3H7W A;  3EGX C;  3MF0 A;  3UE3 A;  2VGL M;  4GLQ A;  1Y28 A;  5HPF A;  4JGP A;  4LRY C;  1OJ5 A;  2LB5 A;  3GEC A;  4YNR A;  2QYB A;  5DKK A;  2HJE A;  4NXG A;  3LR4 A;  2A2L A;  4CLC C;  3LIE A;  5TJJ A;  4F3L A;  5J4E A;  4KQO A;  4EQ1 A;  3T4S A;  3E98 A;  3ICY A;  2JHE A;  4B9O A;  4JGQ A;  3LIC A;  3TRC A;  3HCY A;  4EER A;  4ETZ A;  3A0V A;  1S1Z A;  3V67 A;  1F98 A;  3PBR A;  1XFN A;  2PYR A;  4H6J A;  4UQI S;  1YAX A;  4ARZ A;  4GJ4 A;  4IHQ A;  1XJ3 A;  1GSW A;  4EU0 A;  4HP9 A;  1OT6 A;  2QJ5 A;  3EEA A;  5HL6 A;  1OTE A;  2JKR M;  4HIA A;  3FPV A;  3TJZ C;  2VV8 A;  3U2A A;  4HJ6 A;  1KOU A;  1XJ4 A;  3IBR A;  1WA9 A;  1T1A A;  2G7U A;  3KSF A;  1MZU A;  4BBU A;  1X0O A;  1H3Q A;  4MN5 A;  3H7W B;  3A0R A;  2XSS A;  4NEE D;  3E4P A;  3NHQ A;  4MMN A;  4FOF A;  3JVV A;  3KX0 X;  4HOI A;  4GS9 A;  1P9R A;  1LL8 A;  4Z1W A;  1TS6 A;  2XA7 M;  2KOI A;  3CLO A;  4BBT A;  2JKT M;  3H82 A;  2VV7 A;  5AVF A;  3UB9 A;  4BJP A;  2OWJ A;  4NXF A;  4R70 A;  4G3K A;  2W27 A;  4AFI A;  3ZYT A;  3FG8 A;  4F3L B;  3A0S A;  4WLA A;  4WEL A;  1S4S A;  2HV1 A;  4OOL A;  2VGL S;  2B02 A;  3VV4 A;  3PYP A;  1S67 L;  1GSV A;  1YSP A;  3LFV A;  4K08 A;  5TBM A;  4H6J B;  2W3G A;  4ARZ B;  3NOP C;  4L9G A;  3BY9 A;  4I39 A;  4Q0J A;  5DFX A;  3CUE C;  1LSV A;  5LBR A;  2BAS A;  1TF1 A;  2VA0 A;  3BQA A;  2LB9 A;  4DJ3 A;  2DMW A;  4DN0 A;  2L1M A;  1VB6 A;  2OOL A;  3PBT A;  1N9L A;  2QHK A;  4HI4 A;  4II7 A;  1G6O A;  2INW A;  5K5B A;  2W3H A;  3IS2 A;  1TS7 A;  1XJ6 A;  3O5Y A;  3B33 A;  3JVU A;  2A24 A;  3EOI A;  1NLZ A;  2EWW A;  3MFX A;  3K3D A;  1JNU A;  4R38 A;  4JGR A;  4GS9 B;  3D72 A;  2OAP 1;  1DP8 A;  4XT2 A;  3GDI A;  3F1N A;  1UWN X;  3H82 B;  5KIZ A;  2VKS A;  4P6Z M;  3T50 A;  2PDR A;  2NUP C;  2R78 A;  3CI6 A;  5A8B A;  1NRJ A;  3T4J A;  1OT9 A;  3HJI A;  2K2N A;  4KUO A;  3UB6 A;  3T4T A;  5TBM B;  3E4Q A;  2XA7 S;  4CLC A;  3D3O A;  3BJN A;  3F1O A;  2OWH A;  4L0L A;  5J7E A;  4HY8 A;  3SW1 A;  5IS1 A;  2KDK A;  3PHY A;  4L9F A;  2L0W A;  1S66 L;  4R3A A;  1T19 A;  2P04 A;  1STZ A;  5HWW A;  1W63 M;  2NUT C;  4FSF A;  2O9A A;  3IS2 B;  3OOV A;  3LR5 A;  4IUH A;  3T4Q A;  1TS8 A;  2W3D A;  2A24 B;  3RFB A;  2JKR I;  3S7Q A;  1UWP X;  4WF0 A;  3E0Y A;  3BW6 A;  3T4L A;  5DF9 A;  4XT2 B;  4RQ9 A;  3C38 A;  4NKP A;  1T1C A;  3F1N B;  3KSH A;  5HZH A;  3P7N A;  1ZTU A;  3PBO A;  2GJ3 A;  3OBF A;  3R7W A;  1DP6 A;  2V0W A;  3VE3 A;  5MC7 A;  5HSQ A;  3LI8 A;  4EXO A;  2PT7 A;  1G28 A;  3W2Z A;  3K3C A;  4Y2F A;  2FZ0 A;  3EQU A;  1V9Y A;  5HDD A;  1F9I A;  3MQ0 A;  4PAU A;  4EEP A;  2HGV A;  5DJU A;  1N9O A;  4CLC B;  5F5Y A;  4G3W A;  3BY8 A;  1VHM A;  2JN7 A;  2WKQ A;  3F1O B;  2V1B A;  4P6Z S;  3EQV A;  4YOF A;  3PR6 A;  3UE6 A;  1XFQ A;  3ULF A;  2K31 A;  2Y79 A;  2PD8 A;  5HD3 A;  2EWV A;  5HDS A;  1P0Z A;  4B93 A;  5FL3 A;  1GSX A;  2OAQ 1;  3S7N A;  5KSH A;  2W1T A;  4GHI A;  2ZOI A;  2GNX A;  1OPX A;  2V0U A;  3LUQ A;  2O9C A;  3OCN A;  4LRX C;  4LLO B;  2O99 A;  5CX7 A;  4NXB A;  4ETX A;  2P7J A;  5J3W A;  3VOL A;  2XRO A;  4O0P A;  1OTI A;  2GZA A;  1N9N A;  3CWF A;  3OCL A;  1EW0 A;  1TD5 A;  3MXQ A;  3E4O A;  3R7W B;  1IOU A;  4ME4 A;  4WL9 A;  2WKP A;  4HQA A;  2J80 A;  3BQ8 A;  1W63 Q;  1NWZ A;  3CIT A;  3MJQ A;  1LSX A;  2D02 A;  4HP4 A;  3C2W A;  4Y3I A;  3OC2 A;  3ZQ5 A;  2XRN A;  1P97 A;  3MQQ A;  2W0N A;  4ZRR A;  3F1P A;  4KUK A;  4EUV A;  2IA2 A;  4CLC E;  4BBV A;  5AJG A;  2EA9 A;  2Y8H A;  3T4K A;  1S1Y A;  5F68 A;  2PHY A;  3PXP A;  5G4Z A;  2CMN A;  3KO6 A;  2W1T B;  1UGU A;  2PR6 A;  4GHI B;  3PBS A;  2P08 A;  1YKD A;  4PKY G;  4HNB A;  4LRZ E;  2V9A A;  3H9W A;  2KLI A;  2ZMV A;  4CQH A;  2WKR A;  2GX5 A;  1OTB A;  5EFW A;  4CLC D;  2FH5 A;  5HWT A;  5IU1 A;  1NLY A;  4HHD A;  4MN6 A;  2W1R A;  1DRM A;  3C30 A;  5L8M A;  3LIA A;  4HH2 A;  2QWS A;  2B18 A;  2Z6D A;  1XJ2 A;  3LR3 A;  3C8C A;  2MJ6 A;  3CAX A;  3LR0 A;  3LI9 A;  2J3W A;  3KYZ A;  4EET B;  4QPR A;  4WEK A;  4YWZ A;  1D06 A;  2QJ7 A;  5HWV A;  3LIB A;  5DKL A;  3HJK A;  4HJ4 A;  1OJG A;  5DJT A;  5HPI A;  3LYX A;  5IT5 A;  3F1P B;  2HF6 A;  4O01 A;  4JGO A;  1S4R A;  2VLG A;  2K7S A;  1IFQ A;  2D01 A;  2VJW A;  3RH8 B;  4I3A A;  3R4K A;  2JKT I;  2PR5 A;  3LIF A;  4I3J A;  3S7P A;  4IUK A;  3IBJ A;  4DJ2 A;  4I3I A;  4BMW A;  2VEA A;  2VX8 A;  2W3E A;  4R6L A;  1ODV A;  2O0Y A;  1T1B A;  2Z6C A;  3MMH A;  2PYP A;  4Q0H A;  3DBA A;  4EW7 A;  2V1A A;  4EES A;  4MDZ A;  1YSQ A;  2ZBB A;  2PD7 A;  2M7V A;  3RTY A;  4I38 A;  3UB7 A;  3S7O A;  2QKP A;  4OOM A;  3UB8 A;  5HD5 A;  3KYQ A;  1TS0 A;  4HJ3 A;  3EWK A;  5F69 A;  3TE8 A;  2YKH A;  3CUE A;  2M7U A;  3EGD C;  3B42 A;  3LID A;  1DP9 A;  5G4Y A;  5DFY A;  4WN5 A;  4MN7 A;  3KSG A;  1H8M A;  1OTA A;  3TW8 A;  2ZOH A;  3NJA A;  2KX6 A;  3OLO A;  1P9W A;  4E04 A;  4O8G A;  4GW9 A;  3PBQ A;  5F6A A;  4UQI M;  2HJ9 C;  5C5K A;  4WEJ A;  4Q0I A;  1ZHH B;  4DMZ A;  2O9B A;  2H28 A;  4MCW A;  3T4O A;  2ZMF A;  3VE4 A;  2L4R A;  3BWL A;  1MKM A;  4PKY A;  2I9V A;  4L9E A;  4M4X A;  3NOT C;  5HDC A;  3G6O A;  2VZW A;  3P01 A;  4GCZ A;  3UME A;  3MQO A;  3FPW A;  2VV6 A;  1MC0 A;  4I5S A;  1V9Z A;  4PHT A;  2W3F A;  3K2N A;  1LSW A;  2J3T D;  3FC7 A;  1OTD A;  4LPZ A;  3EEH A;  4HH3 A;  3KSI A;  3UMD A;  4BWI A;  2YKF A;  4UEY A;  1LT0 A;  3NOU C;  4IJG A;  1T18 A;  4KQD A;  5I5L A;  2M1C A;  4EEU A;  4Y5F A;  1BYW A;  3B47 A;  1D7E A;  4NXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...