2B18A

N-terminal gaf domain of transcriptional pleiotropic repressor cody.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
b'MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
molecule tags Transcription
source organism Bacillus subtilis
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria.
pubmed doi rcsb
total genus 48
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2005-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2b18A00
3R4KA 4CQHA 4Y5FA 4YOFA 2ZMFA 2W3EA 4ZRRA 2VZWA 3NOUC 4G3VA 3IBJA 4R6LA 1ZTUA 1MKMA 2W1TB 3KSGA 2W3HA 3KSIA 3KSFA 4FOFA 3VV4A 3MF0A 3O5YA 3CI6A 4Y2FA 4ETZA 2G7UA 2XSSA 5K5BA 2M7UA 2LB5A 3S7NA 3W2ZA 1STZA 3NHQA 4GLQA 4Y3IA 3EEAA 4MCWA 4O8GA 4DMZA 4QPRA 5I5LA 2W3DA 2M7VA 4LRZE 3E98A 3S7QA 1F5MA 4LRYC 2IA2A 2W1RA 2LB9A 2W3GA 3K2NA 3RFBA 1VHMA 1YSPA 3HCYA 1MC0A 3MQ0A 5C5KA 5DFYA 4Q0HA 2K2NA 3C2WA 3OBFA 2K31A 3ZQ5A 3NOPC 2XROA 4IJGA 4PAUA 2Y79A 2KLIA 4IUKA 4MN7A 4G3WA 4R70A 3IBRA 4G3KA 3E0YA 4EU0A 5DFXA 5L8MA 2GX5A 3KSHA 4O0PA 4BWIA 4DN0A 3NOTC 2O99A 3LFVA 3S7OA 4MMNA 4Q0JA 2O0YA 4ME4A 5HPIA 1YKDA 2W1TA 2VJWA 3KO6A 2OOLA 4E04A 3MMHA 4RQ9A 4MDZA 4YNRA 3OOVA 2O9AA 2O9CA 5HL6A 4IUHA 2QYBA 2O9BA 4Q0IA 4LRXC 2VKSA 4GW9A 4Z1WA 4ETXA 2W3FA 4EUVA 5TJJA 5LBRA 2XRNA 3BJNA 2B18A 3CITA 3TRCA 1YSQA 5HPFA 2Y8HA 3G6OA 2HGVA 2VEAA 3DBAA 3D3OA 1TD5A 3S7PA 2KOIA 4O01A 5AJGA 1TF1A 5HSQA
chains in the Genus database with same CATH superfamily
3VFFA 1IOUA 2HZ5A 4ZRRA 2Y2GA 4X1MA 3G2ZA 4Y2FA 3KX0X 2G2UA 5K5BA 3OCNA 1K56A 1NZUA 3DWKA 4GLQA 4UAAA 1H8MA 1OTIA 1I2WA 1FCMA 4O8GA 3ZYTA 3UE0A 2P9VB 1BZAA 4HEFA 1WA9A 5CHJA 1CEGA 3EEHA 4YFMA 1N4OA 1NRFA 3LI8A 4ZTKA 1N9BA 3GR2A 4GS9A 1ES5A 3RFBA 3M6BA 1FSWA 2VGLS 3HCYA 4PM9A 4GB7A 3GV9A 3WS4A 2R78A 3BQ8A 2EX8A 1MWRA 1DP9A 3HLBA 3E0YA 4EU0A 5FDHA 2GX5A 1OTEA 2EWWA 2IWCA 3PAGA 2Y55A 5HZHA 5EUAA 2Z6DA 3BECA 2V20A 5F69A 3PAEA 4E3JA 4BD0A 1NXYA 2A24B 2V1AA 3KO6A 3K3CA 3E2KA 1G6AA 4I39A 1EROA 4WL9A 1Q2PA 4OPQA 2Y2JA 5DKLA 3E4PA 5HL6A 3B42A 2A3UA 5KIZA 4R3AA 4OPYA 4LRXC 3QP5A 1RGZA 4DE3A 4S2KA 4EQIA 2ZQCA 4R0QA 5CEBA 2ZQAA 2PBDP 5CTNA 5HPFA 2BG1A 1XJ2A 4B4ZA 3ZDJA 1ZHHB 2J9OA 5HL1A 4KZBA 3V39A 5CTMA 3F1NA 4E6XA 3NC8A 4OLGA 4X25A 4KUOA 1XPBA 3HL9A 1JVJA 4QHCA 4L9FA 3U2AA 4FSFA 1XA7A 3C8CA 2WKQA 1ALQA 3IS2A 4HP4A 5DTTA 3W2ZA 3MZDA 3A3DA 1S1ZA 3IX4A 2V1BA 5TR7A 4E3LA 2DMWA 3GQZA 3A3IA 4L9EA 1FCNA 4KG6A 4S2PA 1LI0A 5CGSA 1K57C 2X01A 4LCLA 3VOYA 1J3WA 3G35A 1FR6A 5L2FA 4S2LA 4WZ5C 3T12B 4GD8A 4NXEA 5DF7A 4NK3A 1A0KA 2EA9A 3MMHA 1CI9A 5BOHA 4ZJ2A 3H82A 3LEZA 3BY9A 1KE4A 4QWOA 2KDKA 1ES4A 3FKVA 4GCZA 4A5RA 5EECA 4FTXA 2EXAA 1E25A 5GL9A 1ESUA 2WAEA 4I38A 2C5WB 1S66L 4FD8A 3CITA 4OPRA 2QWSA 1PZPA 5I94A 2XD1A 2HDRA 4CLCB 1OMEA 4KUKA 1KE3A 3HREA 3E4QA 3CMZA 2VZWA 5F5YA 1MKMA 5JYPA 2FZ0A 5E2GA 4C3QA 5DF8A 3SZTA 3BLSA 2M1CA 3EWKA 4MEZA 4QU3A 2ZLYA 1K55A 3NHQA 3LR3A 1BULA 3FC7A 1TS6A 3G32A 3PBTA 3C7VA 4ID4A 3HJKA 1OTAA 5EVIA 1LSWA 3PYPA 4GJ4A 4GDNA 1JWVA 3Q81A 4EW7A 4JF4A 2XFTA 4HJ3A 4K91A 3UMDA 3MFXA 2YKHA 3BFFA 2ZQ8A 3T4OA 5EVLA 3FPVA 3MQ0A 1TVFA 1EW0A 3LY4A 3F1NB 1BSGA 4PPRA 3GVBA 1ERQA 2JKFA 4F94A 1JWPA 5HDDA 3DTKA 3Q1FA 4E3NA 3PBRA 4Y7PA 3IF6C 3T1QB 5J4EA 5GLBA 3A0SA 4Y13A 3CPTA 2DNSA 4K08A 1SZVA 3ZGAB 2QMIA 4B9OA 3LIEA 3PBOA 2WGIA 2B18A 2GDNA 4S2OA 4RA7A 2VEAA 4DF6A 2XA7M 1ES3A 4UA9A 4MN5A 1L2SA 5KSHA 5MC7A 1PZOA 4RX3A 5CEDA 2ZQ7A 2HJ9C 3V3RA 5AVEA 3UB5P 2ZC7A 5FQIA 5KSCA 3T1SA 3HLDA 4ARZA 1TDLA 4R4SA 1MPLA 2Y59A 2RCXA 5HAPA 2WKEA 4FCFA 3UPPA 3WWXA 1T1CA 3R7WB 1KGFA 2AVXA 5HAIA 4HH2A 3E98A 5FAOA 2JC7A 3DTMA 1LL8A 4Q0HA 3BRMA 5GLDA 4IBRA 3NOPC 3ZVWA 1TS0A 1K4FA 2A49A 5E2HA 4B4XA 4G3KA 2P04A 1BYWA 2WZZA 5M18A 4BWIA 1D7EA 3UB7A 4UHUA 4D60A 1MY8A 4U0XA 1O07A 3FG8A 5G18A 3IXDA 1E3UD 5FI6A 1CEFA 1KE0A 1GSXA 4OOLA 3E2LA 4MDZA 4OOYA 1FOFA 2V8FA 2J9PA 3T4SA 2WUQA 2O9CA 3BM6A 1S67L 3F1PB 2O9BA 3PHYA 4Q0IA 5IU1A 4NXGA 3M6HA 5FASA 1DJAA 4M3KA 1YQSA 3CLOA 3EOIA 4QY6A 4R38A 4CLCC 2JKRM 3V50A 3DBAA 4KQDA 5FA7A 1GCEA 4JXVA 1TF1A 2J80A 4HI4A 1BT5A 1YPRA 3LICA 1PI5A 1XFQA 1Q2QA 3N4IA 5A93A 1K6RA 1VB6A 4LFUA 1S6RA 4OQHA 1NWZA 5IS1A 3UE3A 1JTDA 1IEMA 3VMAA 2PBYA 1BLSA 4KQRA 1K55C 1J9MA 2ZQDA 3IWIA 4DE1A 1K4EA 3CZDA 3LCEA 2V0WA 3TW8A 2Y2OA 4WN5A 5IT5A 4NETA 5CHMA 3OBFA 4EQ1A 4DE0A 4RYEA 1LT0A 4OQGA 3ZG8B 4L0LA 3E4OA 1SKFA 4UA7A 2JKTI 5DFXA 4GZBA 1AWIA 3CJMA 2WYXA 1SCWA 4OVDA 4UEYA 4GN2A 1LLBA 5CECA 4PKYA 3CUEA 1M40A 3ZNYA 4EXOA 4RX2A 3SS3A 4ZDXA 4R4RA 3LYXA 1S4SA 3OOVA 2VV8A 1PWCA 5DF9A 5DJTA 1DJBA 3MXSA 2E8IA 4I5SA 5EFWA 2XD5A 5JYOA 4EEPA 1N9OA 4EWFA 3WRZA 4DRTA 4GDBA 3IH9A 1K57A 3MFDA 5FI7A 3C5AA 3HUNA 3B3XA 5EE8A 5CHUA 2G7UA 4CLCD 3A3JA 2WADA 3WS0A 4F3LB 5GHYA 2WAFA 4JLFA 3Q7VB 3ZVTA 4DMZA 4QPRA 3OPRA 3UE1A 4IEDA 2LB9A 3QP4A 1JNUA 4NXFA 1KVMA 1PW1A 4CJNA 3UDIA 3N8SA 3SS5A 3HLFA 1PW8A 3QNCA 4PAUA 5FAPA 1IKGA 2ZM0A 1ZKJA 3O86A 2ZL1A 2CMNA 5AQ9A 1ESIA 3T4KA 2PD7A 3HUOA 2OV5A 2O0YA 2J3TD 1K54A 2W1TA 2Y2PA 3NECA 3NULA 4P6ZS 1DY6A 1IYQA 2PYPA 2XFSA 3NY4A 5CGXA 2VK3A 1GA9A 2OLUA 3VOZA 2IWBA 2UWXA 1YMSA 3IQAA 2W3FA 3UB8A 3HJIA 3W4OA 5TJJA 4JF5A 4E3KA 4I3IA 4X56A 2EX2A 5DTKA 3GTCA 4HH3A 3NIAA 4KZ6A 4WYYA 2W3EA 3IBJA 1F9IA 2GJ3A 3A3FA 2B02A 5M19A 3EGDC 2Q0OA 2Y91A 1STZA 4GOGA 3JYIA 2JKTM 3KYQA 3IT9A 2W27A 3IX3A 5FQKA 2YKFA 3LGOA 2K7SA 5EVEA 5KZHA 3BYDA 3UDFA 1KGGA 4IBXA 1UWNX 5DFYA 1TDGA 2XH9A 1OT6A 3ZG0A 2EX9A 3RJUA 2Y79A 4MN7A 1OTDA 4R70A 4XUZA 2V0UA 2ZBBA 1ACFA 1UWPX 4F3LA 4DN0A 3LFVA 4HY8A 3ZNTA 4Q0JA 2VGLM 4KENB 1JWZA 3LIDA 3K3DA 1FIKA 4UQIM 5F6AA 1W8YA 4S2NC 4MBKA 2ACGA 5DVAA 4QJGA 3HBRA 5FI2A 4OP8A 2QYBA 2PU2A 3AGDA 2OLVA 4NKPA 3TRCA 5EOEA 2ZM2A 1TD5A 5FQ9A 4LLOB 4CQHA 2B95A 2OAP1 3FWLA 3ZHHA 2ZC4B 2PR5A 1XX2A 4OQIA 1YM1A 3G30A 1ZTUA 3VOLA 3EQVA 4EBPA 3FYZA 5GHZA 1L0EA 5F1GA 2Q9MA 1IYOA 3MKFA 1YLYA 4NEED 4DJ3A 1MXOA 2JCHA 1PWDA 1W79A 2GZAA 1RCJA 3BFCA 1KVLA 3BEBA 5EPHA 4KZ8A 3BLMA 5F68A 4JGRA 1YLPA 3HLWA 3OLOA 5HFOA 3F1OB 3ZQ5A 5L07A 1GHPA 2KLIA 5J8XA 3QP6A 4U0TA 2PRFA 1L0GA 3H7WB 4R3JA 1XA1A 2A2LA 4YWZA 1NRJA 3UDXA 4PM6A 1P9WA 1ZC2A 2VV6A 4BL2A 3OPHA 4E04A 4OQ0A 4BD1A 4YNRA 4AFIA 3G34A 4JF6A 2INWA 1VQQA 5HD5A 1NLZA 4DE2A 4MNRA 4GW9A 4Z1WA 2C6WB 2QZ6A 5U47A 4LV3A 2X02A 4BMWA 4E3OA 4EUZA 3UB9A 3MBZA 3HUMA 2HJEA 4N1HA 5TGFA 4KZ5A 4PKYG 4PMAA 1KGEA 3FV7A 3PR6A 1YAXA 4R6LA 1FCOA 2WGVA 3KSIA 4FOFA 4S2NA 2NUPC 3D9YA 1LL5A 5FATA 1HD8A 1UGUA 4JXWA 1I2SA 1YLJA 4WF0A 1K0KA 4LPZA 2HDUA 3GDIA 2HPBA 3T1XA 3Q82A 4MCWA 2H5SA 5CXWA 2P74A 1W63Q 2XF3A 3OPPA 3BFGA 1IELA 3C4PA 3Q7ZA 3SW1A 3G2YA 5F82A 2E8JA 5EVIC 5FL3A 2FFFB 4JGPA 3C7UA 1DP8A 3KSHA 3N7WA 3GSGA 4BBTA 2ZL1B 3DAVA 5HPIA 2OOLA 4RQ9A 3BWLA 1LI9A 5A8BA 2EWVA 1MBLA 4P6BA 1NZOA 1SDNA 2ZMAA 4OH0A 1V9YA 3LR5A 4LENA 3G6OA 2HGVA 2WK0A 3NCKA 2Y2KA 1XJ4A 2R9WA 1VM1A 5G4ZA 5HWTA 4BL3A 5DKKA 2ZC3B 1L0FA 4NG2A 2ZOHA 4DXBA 3MXQA 3HVFA 1K56D 3IWQA 2VA0A 4JXGA 1BUEA 1XGJA 2L0WA 3BFEA 3UPNA 4ZJ3A 3LIBA 1YLTA 3O5YA 2Y2NA 3MR0A 3V3SA 1OT9A 3S22A 2OAQ1 1IKIA 1Z6FA 4PM7A 5A92A 1GHIA 2H10A 4JBFA 4KG2A 1W8QA 2V1ZA 5A90A 3LY3A 3BFDA 4LRYC 3PTEA 4B93A 3F1PA 1YMXA 5GLCA 1VHMA 1YSPA 5AQBA 5HWWA 5C5KA 3VP0A 3BQAA 1HZOA 1IFQA 3VFHA 1D1JA 2ZQ9A 1LHYA 3AGEA 3D4FA 4I3AA 4EEUA 4KG5A 1Z09A 5DTSA 1CK3A 2PT7A 3TG9A 4M4XA 4EETB 2Z6CA 2XGNA 5FAQA 3OPLA 3S1YA 2PR6A 2L4RA 4C6YA 2PHYA 3RH8B 3H9WA 1DP6A 1BLHA 2PYRA 2P08A 4XXRA 3SS4A 1NYMA 4JGOA 4BBVA 3TJZC 1LSVA 4QB8A 2V9AA 1M6KA 5EVID 4IUHA 2H0TA 3MSHA 2PAVP 5FSRA 4LV2A 2ZMVA 3VP1A 1W5DA 1PNEA 4NXBA 3ISGA 1MZUA 3R7WA 1BLPA 2Y8HA 1KDWA 2Y2HA 2OWHA 2Y2LA 3S7PA 1PYYA 1ZG6A 3IXHA 2ZMFA 4EBNA 3LR0A 4R3BA 3UY6A 1K54C 4GD6A 1PIOA 5FDSA 3NBLA 5GLAA 1XFNA 3KSFA 4XUXA 5D3OA 2PU4A 1EI5A 1FR1A 3CUEC 3L9KA 3H7WA 4LV0A 4UA6A 2BTFP 2XLNA 4Y0OA 3BW6A 5E2FA 3P01A 4N9KA 5FEFA 4LV1A 4FUWA 4WEJA 1F5MA 2EFUA 4I3JA 1AXBA 2IA2A 1P97A 2XR0A 1H0MA 5E2EA 3K2NA 5KMWA 4KQQA 3DTEA 1YT4A 2NUTC 3G31A 4HQAA 4X53A 2Q9NA 4YINA 2J8YA 3LUQA 1FILA 1XJ6A 1NLYA 3FZCA 4O0PA 2FFYA 1G6OA 4EV4A 3LR4A 3NI9A 2OSUA 3IS2B 1RGYA 4UQIS 3VP3A 4OPZA 5M1AA 1TS7A 1YLZA 4HHDA 1Y4OA 4KQOA 2CC1A 2H28A 2UV0E 4GKUA 4BLMA 3CWFA 2VKSA 4DXCA 2FH5A 4Y0TA 5L09A 3C4OA 4GHIB 3T4TA 3RXWA 4EERA 2DRWA 2JKGA 3GMWA 4KZ3A 3MZFA 4ARZB 1ONGA 5HSQA 2R9XA 5HDSA 4YOFA 3T4JA 3T1RA 1S0WA 1N9NA 4Y17A 3ULFA 3NOUC 4R23A 3OZHA 4WLAA 4BJPA 1HTZA 2A24A 1WYCA 4PM5A 3L7HA 3CI6A 3WS5A 3BY8A 1BTLA 2ZJ9A 1W7FA 1K6SA 3U4LP 3FPWA 1DJCA 1OJGA 1ODVA 4GNUA 5TBMB 4WEKA 2VGKA 3ZG7B 3IHBA 4R1GA 3S7QA 1S1YA 5FEGA 4BQMA 1EWZA 3M2KA 3GRJA 3N8RA 1OTBA 3ZG9B 4K0XA 3CPTB 3QNBA 3ZG5A 4Q8IA 1MC0A 3NDGA 1P9RA 1F2KA 3FKWA 2XROA 4IJGA 3A0RA 3ZCZA 2HDSA 1IYSA 1XKZA 2Y2QA 2WKPA 4JXSA 3VSKA 3RXXA 2G2WA 3HLCA 4II7A 4D2OA 1SKOA 2JKRI 3LEQA 1YLWA 3I7JA 4O7DA 1GHMA 3PXPA 1CI8A 3TOIA 2XDMA 4MBHA 3LI9A 3W4QA 3IXGA 4EBLA 1OPXA 1HLUP 1SHVA 2Y2IA 4Y0UA 5EVIB 3IWOA 2EXBA 2HP9A 2W0NA 5TBMA 3MZEA 1LSXA 3D3OA 2WZXA 3JVUA 4MBFA 2XEPA 3DWZA 2J3WA 4XT2B 3C30A 5HX9A 1Y54A 4PM8A 4E3MA 3LIAA 4G3VA 3F1OA 5CX7A 2W1TB 3KSGA 2W3HA 3OCLA 3MF0A 2VLGA 4XT2A 1PI4A 4KZAA 1SDEA 2GNXA 3CG5A 3PBNA 1GSVA 2M7UA 4DDYA 2JN7A 3P09A 1HVBA 5FQMA 4GHIA 5AQ7A 4RVAA 1VETB 3NDEA 2M7VA 2HP5A 5FQQA 2W1RA 4QY5A 3IF5A 4WM9A 4WMCA 2W3GA 1PFLA 3H82B 5AVFA 3UE6A 2K31A 4LGWA 1DRMA 3UPOA 1E3UA 2RL3A 1P0ZA 5HAQA 3Q7VA 1L0DA 1G28A 2WGWA 2Y4AA 3JPUA 3Q07A 2HV1A 4P87A 3ICYA 3QHYA 4Z9QA 4HJ4A 1YKDA 4HNBA 5E43A 5TFQA 3KYEA 2DCFA 1QMFA 2HDQA 3MQQA 2WKHA 4B88A 3WS1A 2X71A 1T18A 4H6JB 1MWTA 3UB6A 4JGQA 1ONHA 5HD3A 5LBRA 2P9VA 2B5RA 4WBGA 5DJUA 3TE8A 3P7NA 1T1AA 3T4LA 4O01A 5G4YA 3SH8A 2L1MA 2BASA 1Y28A 1XGIA 4OKPA 2QHKA 1F98A 4OP5A 2EX6A 3B47A 1I5QA 1XJ3A 4BBUA 4IVKA 3HLEA 2J3TC 3MS6A 4ETZA 2LB5A 3S7NA 4OLDA 4WZ5A 4E3IA 4Y3IA 3N6IA 1VEUA 3EEAA 1VETA 2HP6A 4IVIA 3MXRA 1V9ZA 1T19A 5I5LA 4S2JA 5HDCA 3IX8A 4ZBEA 1FSYA 2WKRA 3IXBA 1QMEA 2QPNA 2PD8A 4HP9A 2QJ7A 3O3VA 3B33A 4JKTA 2P7JA 5F1FA 2OWJA 4H8RA 4P85A 1L3LA 2J7VA 1ES2A 2V8CA 4ZAMA 3LO7A 3S7OA 1E4DA 1K38A 4HESA 1CF0A 4HOIA 3W8KA 4X6TA 1N9LA 2O9AA 3VE4A 4Y15A 4GS9B 1H8ZA 5EM0A 2IWDA 4EUVA 3OC2A 3JVVA 3IHAA 1MWSA 3LIFA 5CRFA 3KYZA 4K0WA 4HIAA 5J7EA 1SKOB 2KOIA 5AJGA 4IHQA 5EV0A 2HF6A 1ERMA 3R4KA 3AGFA 3V5MA 2Z2LB 3O88A 3S4XA 3ITBA 1MKIA 1ZG4A 2D02A 4ZJ1A 3WRTA 1GSWA 3UN7A 3T4QA 4DKIA 3VV4A 4PHTA 3A3EA 3MKEA 1S4RA 2XSSA 4FH4A 2PDRA 2ZD8A 4WZ4A 3IF6B 3GECA 3CAXA 1KDSA 3CHWP 3V67A 5HW3A 5L10A 1BLCA 1NYYA 3UNWA 1PRQA 4P0MA 4P6ZM 1CJFA 4KZ9A 1U60A 4MLLA 3VP2A 4KZ4A 3UO9A 1H8YA 2K2NA 4N92A 1IYPA 3DW0A 5IHVA 3SH7A 4IUKA 3IBRA 1JTGA 3SOIA 1XXMA 1WYBA 2ZC5B 4E6WA 4MMNA 1G68A 4DDSA 4X69A 2XK1A 4ME4A 4L9GA 1K25A 4BENA 1TS8A 3ZFZA 1FQGA 1NJ4A 1C3BA 2V2FF 3PBSA 3QP8A 4DJ2A 1H5XA 1GA0A 3A0VA 2QKPA 2WKIA 3DTIA 2Z2MB 3UMEA 4ETXA 4ESPA 1MWUA 1D06A 1TEMA 3N8LA 1CQAA 3SH9A 2Y2MA 3IF6A 3WS2A 3D72A 5EOOA 4H6JA 1W63M 3O87A 4CLCE 1WE4A 4Y5FA 1RP5A 2VGJA 5FQJA 4QD4A 4X1LA 5CERA 3G4PA 3VE3A 3T50A 3P98A 5GHXA 4X55A 4N9LA 2ZC6B 3M2JA 2JBFA 4WELA 2WGWB 3ITAA 5A91A 2I72A 2W3DA 4LRZE 1PWGA 2ZOIA 4WUJA 3VP4A 5CGWA 3MQOA 4S2MA 1G5UA 4S2IA 3EQUA 1LL9A 4HJ6A 2BLSA 2QJ5A 3PBQA 4JPMA 3MJQA 4X68A 3VSLA 2XA7S 3C2WA 2D01A 3NJAA 4LCMA 4N1XA 4G3WA 4HBTA 1O7EA 5L8MA 4CPKA 4OONA 4U3TA 4EESA 3NOTC 2O99A 1OJ5A 4C75A 2XQZA 2VX8A 2VJWA 4HBUA 5J3WA 3TSGA 2VV7A 2JHEA 4WMCD 5HWVA 4OOMA 2H0YA 3QP1A 1T1BA 3HLGA 4FH2A 2I9VA 1X0OA 4CLCA 2KX6A 1KOUA 3C38A 5AQAA 4KZ7A 2XRNA 2ZM8A 3BJNA 3W4PA 4MN6A 2JE5A 3EGXC 5HARA 1YSQA 5F83A 3RTYA 1VEUB 1XP4A 3IH8A 2EFXA 1NY0A 5EM1A 1H3QA 2MJ6A 3QP2A
chains in the Genus database with same CATH topology
2J3WA 3LICA 4XT2B 3C30A 4PKYG 1XFQA 1IOUA 4ZRRA 3LIAA 4G3VA 3PR6A 3F1OA 5CX7A 1VB6A 1YAXA 4R6LA 2W1TB 3KSGA 2W3HA 3KSIA 3OCLA 4FOFA 3MF0A 2VLGA 2NUPC 4Y2FA 3KX0X 4XT2A 2GNXA 5K5BA 3PBNA 1GSVA 1UGUA 1NWZA 2M7UA 3OCNA 4WF0A 5IS1A 3UE3A 4GLQA 2JN7A 4LPZA 1H8MA 3GDIA 1OTIA 4GHIA 4MCWA 4O8GA 3ZYTA 2M7VA 1WA9A 3EEHA 1W63Q 3LI8A 2W1RA 2V0WA 4GS9A 3TW8A 4WN5A 2W3GA 3RFBA 2VGLS 3HCYA 5IT5A 3H82B 5AVFA 3OBFA 3UE6A 2K31A 4EQ1A 1DRMA 3SW1A 2R78A 1P0ZA 1LT0A 3BQ8A 4L0LA 1DP9A 3E4OA 4EU0A 3E0YA 2JKTI 5DFXA 4JGPA 5FL3A 1G28A 2GX5A 1DP8A 1OTEA 3KSHA 2EWWA 4BBTA 5HZHA 4UEYA 2HV1A 2Z6DA 3ICYA 4PKYA 5F69A 3CUEA 5HPIA 4HJ4A 1YKDA 4HNBA 2A24B 2V1AA 3KO6A 4EXOA 2OOLA 3K3CA 4RQ9A 3BWLA 3LYXA 1S4SA 3OOVA 4I39A 4WL9A 2VV8A 3MQQA 5A8BA 5DKLA 3E4PA 5HL6A 1T18A 3B42A 5DF9A 4H6JB 5DJTA 5KIZA 2EWVA 4R3AA 3UB6A 4JGQA 4LRXC 4I5SA 5EFWA 1V9YA 5HD3A 5LBRA 5DJUA 4EEPA 3TE8A 3LR5A 5HPFA 3P7NA 1T1AA 3G6OA 2HGVA 1N9OA 1XJ2A 3T4LA 1XJ4A 4O01A 5G4YA 5G4ZA 1ZHHB 5HWTA 5DKKA 2L1MA 2BASA 1Y28A 2QHKA 2ZOHA 1F98A 3MXQA 3F1NA 3B47A 2VA0A 4KUOA 2L0WA 1XJ3A 4L9FA 4BBUA 3U2AA 3LIBA 2J3TC 4FSFA 3O5YA 3C8CA 2WKQA 2G7UA 4ETZA 4CLCD 3MR0A 3IS2A 1OT9A 2LB5A 3S7NA 4HP4A 3W2ZA 2OAQ1 4F3LB 4Y3IA 3EEAA 1S1ZA 1V9ZA 4DMZA 4QPRA 1T19A 5I5LA 2V1BA 5HDCA 4LRYC 4B93A 2WKRA 2DMWA 2LB9A 3F1PA 2PD8A 1JNUA 4HP9A 1VHMA 1YSPA 4NXFA 5HWWA 2QJ7A 5C5KA 3B33A 3BQAA 1IFQA 2P7JA 4L9EA 2OWJA 4I3AA 4PAUA 4EEUA 2PT7A 4M4XA 3S7OA 2CMNA 3T4KA 2Z6CA 4EETB 2PD7A 2PR6A 2O0YA 4NXEA 2L4RA 2J3TD 2PHYA 4HOIA 2W1TA 3RH8B 3H9WA 1DP6A 2PYRA 4P6ZS 2EA9A 3MMHA 2PYPA 3H82A 2P08A 4JGOA 1N9LA 2O9AA 3TJZC 1LSVA 3VE4A 4BBVA 3BY9A 2V9AA 4GS9B 4IUHA 2KDKA 2ZMVA 4GCZA 2W3FA 3UB8A 3HJIA 4EUVA 3OC2A 5TJJA 3JVVA 4I38A 4NXBA 1S66L 3CITA 3LIFA 1MZUA 3R7WA 3KYZA 2Y8HA 2QWSA 4HIAA 2OWHA 5J7EA 4I3IA 3S7PA 2KOIA 5AJGA 4CLCB 4IHQA 2HF6A 3R4KA 4HH3A 4KUKA 2ZMFA 3E4QA 3LR0A 2W3EA 2VZWA 2D02A 3IBJA 1F9IA 5F5YA 1GSWA 1MKMA 2GJ3A 1XFNA 3T4QA 2B02A 2FZ0A 3KSFA 4PHTA 3VV4A 3EGDC 1S4RA 2XSSA 2PDRA 2M1CA 3EWKA 3CUEC 1STZA 3KYQA 2JKTM 3GECA 3CAXA 3H7WA 3NHQA 2W27A 3LR3A 3V67A 3FC7A 3BW6A 3P01A 1TS6A 3PBTA 3HJKA 1OTAA 1LSWA 4WEJA 1F5MA 4P6ZM 3PYPA 4GJ4A 2YKFA 4I3JA 2IA2A 4EW7A 2K7SA 1P97A 4HJ3A 3UMDA 3MFXA 2YKHA 3K2NA 3T4OA 3FPVA 3MQ0A 1UWNX 2NUTC 5DFYA 1EW0A 2K2NA 1OT6A 4HQAA 3F1NB 2Y79A 4IUKA 4MN7A 1OTDA 4R70A 3IBRA 3LUQA 2V0UA 1XJ6A 1NLYA 2ZBBA 4O0PA 5HDDA 1UWPX 4F3LA 4DN0A 1G6OA 3PBRA 3LFVA 4HY8A 3LR4A 4MMNA 4Q0JA 2VGLM 3IS2B 3LIDA 3K3DA 4ME4A 4L9GA 4UQIM 4UQIS 5F6AA 1TS8A 5J4EA 3A0SA 1TS7A 3PBSA 4HHDA 4DJ2A 4KQOA 4K08A 2H28A 3A0VA 2QYBA 2QKPA 3CWFA 2VKSA 3UMEA 4ETXA 4B9OA 3LIEA 2FH5A 4NKPA 3PBOA 1D06A 2B18A 3TRCA 4GHIB 3T4TA 4EERA 2VEAA 1TD5A 2XA7M 4ARZB 3D72A 4H6JA 4LLOB 4MN5A 5HSQA 1W63M 4CLCE 4CQHA 2OAP1 5HDSA 4Y5FA 4YOFA 3T4JA 5KSHA 1N9NA 5MC7A 2PR5A 3ULFA 3NOUC 2HJ9C 4WLAA 5AVEA 4BJPA 1ZTUA 3VOLA 2A24A 3EQVA 3CI6A 3VE3A 3T50A 4ARZA 3BY8A 4NEED 4WELA 4DJ3A 3FPWA 1OJGA 1ODVA 5TBMB 1T1CA 4WEKA 3R7WB 2GZAA 2W3DA 4LRZE 2ZOIA 3E98A 4HH2A 4WUJA 3S7QA 1S1YA 3MQOA 1OTBA 3EQUA 4HJ6A 2QJ5A 1MC0A 5F68A 4JGRA 1P9RA 1LL8A 3MJQA 4Q0HA 3OLOA 2XA7S 3C2WA 2D01A 3F1OB 3ZQ5A 3NOPC 2XROA 4IJGA 3A0RA 1TS0A 3NJAA 2KLIA 4G3WA 4G3KA 2P04A 1BYWA 5L8MA 2WKPA 4BWIA 3H7WB 1D7EA 3UB7A 4EESA 3NOTC 2O99A 4II7A 2A2LA 3FG8A 4YWZA 1OJ5A 2JKRI 1NRJA 1P9WA 2VX8A 2VJWA 3PXPA 2VV6A 5J3WA 1GSXA 4E04A 2VV7A 4OOLA 2JHEA 4MDZA 4YNRA 3LI9A 4AFIA 5HWVA 3T4SA 4OOMA 2O9CA 1OPXA 1T1BA 2INWA 5HD5A 1NLZA 1S67L 2I9VA 3F1PB 1X0OA 2O9BA 3PHYA 4Q0IA 5IU1A 4GW9A 4NXGA 4Z1WA 4CLCA 2KX6A 1KOUA 3C38A 2XRNA 4BMWA 3BJNA 2W0NA 4MN6A 3EOIA 3CLOA 3EGXC 1YSQA 5TBMA 4R38A 4CLCC 3RTYA 2JKRM 3UB9A 1LSXA 3DBAA 3D3OA 3JVUA 4KQDA 1H3QA 2HJEA 1TF1A 2J80A 2MJ6A 4HI4A 3PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4K A;  4CQH A;  4Y5F A;  4YOF A;  2ZMF A;  2W3E A;  4ZRR A;  2VZW A;  3NOU C;  4G3V A;  3IBJ A;  4R6L A;  1ZTU A;  1MKM A;  2W1T B;  3KSG A;  2W3H A;  3KSI A;  3KSF A;  4FOF A;  3VV4 A;  3MF0 A;  3O5Y A;  3CI6 A;  4Y2F A;  4ETZ A;  2G7U A;  2XSS A;  5K5B A;  2M7U A;  2LB5 A;  3S7N A;  3W2Z A;  1STZ A;  3NHQ A;  4GLQ A;  4Y3I A;  3EEA A;  4MCW A;  4O8G A;  4DMZ A;  4QPR A;  5I5L A;  2W3D A;  2M7V A;  4LRZ E;  3E98 A;  3S7Q A;  1F5M A;  4LRY C;  2IA2 A;  2W1R A;  2LB9 A;  2W3G A;  3K2N A;  3RFB A;  1VHM A;  1YSP A;  3HCY A;  1MC0 A;  3MQ0 A;  5C5K A;  5DFY A;  4Q0H A;  2K2N A;  3C2W A;  3OBF A;  2K31 A;  3ZQ5 A;  3NOP C;  2XRO A;  4IJG A;  4PAU A;  2Y79 A;  2KLI A;  4IUK A;  4MN7 A;  4G3W A;  4R70 A;  3IBR A;  4G3K A;  3E0Y A;  4EU0 A;  5DFX A;  5L8M A;  2GX5 A;  3KSH A;  4O0P A;  4BWI A;  4DN0 A;  3NOT C;  2O99 A;  3LFV A;  3S7O A;  4MMN A;  4Q0J A;  2O0Y A;  4ME4 A;  5HPI A;  1YKD A;  2W1T A;  2VJW A;  3KO6 A;  2OOL A;  4E04 A;  3MMH A;  4RQ9 A;  4MDZ A;  4YNR A;  3OOV A;  2O9A A;  2O9C A;  5HL6 A;  4IUH A;  2QYB A;  2O9B A;  4Q0I A;  4LRX C;  2VKS A;  4GW9 A;  4Z1W A;  4ETX A;  2W3F A;  4EUV A;  5TJJ A;  5LBR A;  2XRN A;  3BJN A;  2B18 A;  3CIT A;  3TRC A;  1YSQ A;  5HPF A;  2Y8H A;  3G6O A;  2HGV A;  2VEA A;  3DBA A;  3D3O A;  1TD5 A;  3S7P A;  2KOI A;  4O01 A;  5AJG A;  1TF1 A;  5HSQ A; 
#chains in the Genus database with same CATH topology
 3VFF A;  1IOU A;  2HZ5 A;  4ZRR A;  2Y2G A;  4X1M A;  3G2Z A;  4Y2F A;  3KX0 X;  2G2U A;  5K5B A;  3OCN A;  1K56 A;  1NZU A;  3DWK A;  4GLQ A;  4UAA A;  1H8M A;  1OTI A;  1I2W A;  1FCM A;  4O8G A;  3ZYT A;  3UE0 A;  2P9V B;  1BZA A;  4HEF A;  1WA9 A;  5CHJ A;  1CEG A;  3EEH A;  4YFM A;  1N4O A;  1NRF A;  3LI8 A;  4ZTK A;  1N9B A;  3GR2 A;  4GS9 A;  1ES5 A;  3RFB A;  3M6B A;  1FSW A;  2VGL S;  3HCY A;  4PM9 A;  4GB7 A;  3GV9 A;  3WS4 A;  2R78 A;  3BQ8 A;  2EX8 A;  1MWR A;  1DP9 A;  3HLB A;  3E0Y A;  4EU0 A;  5FDH A;  2GX5 A;  1OTE A;  2EWW A;  2IWC A;  3PAG A;  2Y55 A;  5HZH A;  5EUA A;  2Z6D A;  3BEC A;  2V20 A;  5F69 A;  3PAE A;  4E3J A;  4BD0 A;  1NXY A;  2A24 B;  2V1A A;  3KO6 A;  3K3C A;  3E2K A;  1G6A A;  4I39 A;  1ERO A;  4WL9 A;  1Q2P A;  4OPQ A;  2Y2J A;  5DKL A;  3E4P A;  5HL6 A;  3B42 A;  2A3U A;  5KIZ A;  4R3A A;  4OPY A;  4LRX C;  3QP5 A;  1RGZ A;  4DE3 A;  4S2K A;  4EQI A;  2ZQC A;  4R0Q A;  5CEB A;  2ZQA A;  2PBD P;  5CTN A;  5HPF A;  2BG1 A;  1XJ2 A;  4B4Z A;  3ZDJ A;  1ZHH B;  2J9O A;  5HL1 A;  4KZB A;  3V39 A;  5CTM A;  3F1N A;  4E6X A;  3NC8 A;  4OLG A;  4X25 A;  4KUO A;  1XPB A;  3HL9 A;  1JVJ A;  4QHC A;  4L9F A;  3U2A A;  4FSF A;  1XA7 A;  3C8C A;  2WKQ A;  1ALQ A;  3IS2 A;  4HP4 A;  5DTT A;  3W2Z A;  3MZD A;  3A3D A;  1S1Z A;  3IX4 A;  2V1B A;  5TR7 A;  4E3L A;  2DMW A;  3GQZ A;  3A3I A;  4L9E A;  1FCN A;  4KG6 A;  4S2P A;  1LI0 A;  5CGS A;  1K57 C;  2X01 A;  4LCL A;  3VOY A;  1J3W A;  3G35 A;  1FR6 A;  5L2F A;  4S2L A;  4WZ5 C;  3T12 B;  4GD8 A;  4NXE A;  5DF7 A;  4NK3 A;  1A0K A;  2EA9 A;  3MMH A;  1CI9 A;  5BOH A;  4ZJ2 A;  3H82 A;  3LEZ A;  3BY9 A;  1KE4 A;  4QWO A;  2KDK A;  1ES4 A;  3FKV A;  4GCZ A;  4A5R A;  5EEC A;  4FTX A;  2EXA A;  1E25 A;  5GL9 A;  1ESU A;  2WAE A;  4I38 A;  2C5W B;  1S66 L;  4FD8 A;  3CIT A;  4OPR A;  2QWS A;  1PZP A;  5I94 A;  2XD1 A;  2HDR A;  4CLC B;  1OME A;  4KUK A;  1KE3 A;  3HRE A;  3E4Q A;  3CMZ A;  2VZW A;  5F5Y A;  1MKM A;  5JYP A;  2FZ0 A;  5E2G A;  4C3Q A;  5DF8 A;  3SZT A;  3BLS A;  2M1C A;  3EWK A;  4MEZ A;  4QU3 A;  2ZLY A;  1K55 A;  3NHQ A;  3LR3 A;  1BUL A;  3FC7 A;  1TS6 A;  3G32 A;  3PBT A;  3C7V A;  4ID4 A;  3HJK A;  1OTA A;  5EVI A;  1LSW A;  3PYP A;  4GJ4 A;  4GDN A;  1JWV A;  3Q81 A;  4EW7 A;  4JF4 A;  2XFT A;  4HJ3 A;  4K91 A;  3UMD A;  3MFX A;  2YKH A;  3BFF A;  2ZQ8 A;  3T4O A;  5EVL A;  3FPV A;  3MQ0 A;  1TVF A;  1EW0 A;  3LY4 A;  3F1N B;  1BSG A;  4PPR A;  3GVB A;  1ERQ A;  2JKF A;  4F94 A;  1JWP A;  5HDD A;  3DTK A;  3Q1F A;  4E3N A;  3PBR A;  4Y7P A;  3IF6 C;  3T1Q B;  5J4E A;  5GLB A;  3A0S A;  4Y13 A;  3CPT A;  2DNS A;  4K08 A;  1SZV A;  3ZGA B;  2QMI A;  4B9O A;  3LIE A;  3PBO A;  2WGI A;  2B18 A;  2GDN A;  4S2O A;  4RA7 A;  2VEA A;  4DF6 A;  2XA7 M;  1ES3 A;  4UA9 A;  4MN5 A;  1L2S A;  5KSH A;  5MC7 A;  1PZO A;  4RX3 A;  5CED A;  2ZQ7 A;  2HJ9 C;  3V3R A;  5AVE A;  3UB5 P;  2ZC7 A;  5FQI A;  5KSC A;  3T1S A;  3HLD A;  4ARZ A;  1TDL A;  4R4S A;  1MPL A;  2Y59 A;  2RCX A;  5HAP A;  2WKE A;  4FCF A;  3UPP A;  3WWX A;  1T1C A;  3R7W B;  1KGF A;  2AVX A;  5HAI A;  4HH2 A;  3E98 A;  5FAO A;  2JC7 A;  3DTM A;  1LL8 A;  4Q0H A;  3BRM A;  5GLD A;  4IBR A;  3NOP C;  3ZVW A;  1TS0 A;  1K4F A;  2A49 A;  5E2H A;  4B4X A;  4G3K A;  2P04 A;  1BYW A;  2WZZ A;  5M18 A;  4BWI A;  1D7E A;  3UB7 A;  4UHU A;  4D60 A;  1MY8 A;  4U0X A;  1O07 A;  3FG8 A;  5G18 A;  3IXD A;  1E3U D;  5FI6 A;  1CEF A;  1KE0 A;  1GSX A;  4OOL A;  3E2L A;  4MDZ A;  4OOY A;  1FOF A;  2V8F A;  2J9P A;  3T4S A;  2WUQ A;  2O9C A;  3BM6 A;  1S67 L;  3F1P B;  2O9B A;  3PHY A;  4Q0I A;  5IU1 A;  4NXG A;  3M6H A;  5FAS A;  1DJA A;  4M3K A;  1YQS A;  3CLO A;  3EOI A;  4QY6 A;  4R38 A;  4CLC C;  2JKR M;  3V50 A;  3DBA A;  4KQD A;  5FA7 A;  1GCE A;  4JXV A;  1TF1 A;  2J80 A;  4HI4 A;  1BT5 A;  1YPR A;  3LIC A;  1PI5 A;  1XFQ A;  1Q2Q A;  3N4I A;  5A93 A;  1K6R A;  1VB6 A;  4LFU A;  1S6R A;  4OQH A;  1NWZ A;  5IS1 A;  3UE3 A;  1JTD A;  1IEM A;  3VMA A;  2PBY A;  1BLS A;  4KQR A;  1K55 C;  1J9M A;  2ZQD A;  3IWI A;  4DE1 A;  1K4E A;  3CZD A;  3LCE A;  2V0W A;  3TW8 A;  2Y2O A;  4WN5 A;  5IT5 A;  4NET A;  5CHM A;  3OBF A;  4EQ1 A;  4DE0 A;  4RYE A;  1LT0 A;  4OQG A;  3ZG8 B;  4L0L A;  3E4O A;  1SKF A;  4UA7 A;  2JKT I;  5DFX A;  4GZB A;  1AWI A;  3CJM A;  2WYX A;  1SCW A;  4OVD A;  4UEY A;  4GN2 A;  1LLB A;  5CEC A;  4PKY A;  3CUE A;  1M40 A;  3ZNY A;  4EXO A;  4RX2 A;  3SS3 A;  4ZDX A;  4R4R A;  3LYX A;  1S4S A;  3OOV A;  2VV8 A;  1PWC A;  5DF9 A;  5DJT A;  1DJB A;  3MXS A;  2E8I A;  4I5S A;  5EFW A;  2XD5 A;  5JYO A;  4EEP A;  1N9O A;  4EWF A;  3WRZ A;  4DRT A;  4GDB A;  3IH9 A;  1K57 A;  3MFD A;  5FI7 A;  3C5A A;  3HUN A;  3B3X A;  5EE8 A;  5CHU A;  2G7U A;  4CLC D;  3A3J A;  2WAD A;  3WS0 A;  4F3L B;  5GHY A;  2WAF A;  4JLF A;  3Q7V B;  3ZVT A;  4DMZ A;  4QPR A;  3OPR A;  3UE1 A;  4IED A;  2LB9 A;  3QP4 A;  1JNU A;  4NXF A;  1KVM A;  1PW1 A;  4CJN A;  3UDI A;  3N8S A;  3SS5 A;  3HLF A;  1PW8 A;  3QNC A;  4PAU A;  5FAP A;  1IKG A;  2ZM0 A;  1ZKJ A;  3O86 A;  2ZL1 A;  2CMN A;  5AQ9 A;  1ESI A;  3T4K A;  2PD7 A;  3HUO A;  2OV5 A;  2O0Y A;  2J3T D;  1K54 A;  2W1T A;  2Y2P A;  3NEC A;  3NUL A;  4P6Z S;  1DY6 A;  1IYQ A;  2PYP A;  2XFS A;  3NY4 A;  5CGX A;  2VK3 A;  1GA9 A;  2OLU A;  3VOZ A;  2IWB A;  2UWX A;  1YMS A;  3IQA A;  2W3F A;  3UB8 A;  3HJI A;  3W4O A;  5TJJ A;  4JF5 A;  4E3K A;  4I3I A;  4X56 A;  2EX2 A;  5DTK A;  3GTC A;  4HH3 A;  3NIA A;  4KZ6 A;  4WYY A;  2W3E A;  3IBJ A;  1F9I A;  2GJ3 A;  3A3F A;  2B02 A;  5M19 A;  3EGD C;  2Q0O A;  2Y91 A;  1STZ A;  4GOG A;  3JYI A;  2JKT M;  3KYQ A;  3IT9 A;  2W27 A;  3IX3 A;  5FQK A;  2YKF A;  3LGO A;  2K7S A;  5EVE A;  5KZH A;  3BYD A;  3UDF A;  1KGG A;  4IBX A;  1UWN X;  5DFY A;  1TDG A;  2XH9 A;  1OT6 A;  3ZG0 A;  2EX9 A;  3RJU A;  2Y79 A;  4MN7 A;  1OTD A;  4R70 A;  4XUZ A;  2V0U A;  2ZBB A;  1ACF A;  1UWP X;  4F3L A;  4DN0 A;  3LFV A;  4HY8 A;  3ZNT A;  4Q0J A;  2VGL M;  4KEN B;  1JWZ A;  3LID A;  3K3D A;  1FIK A;  4UQI M;  5F6A A;  1W8Y A;  4S2N C;  4MBK A;  2ACG A;  5DVA A;  4QJG A;  3HBR A;  5FI2 A;  4OP8 A;  2QYB A;  2PU2 A;  3AGD A;  2OLV A;  4NKP A;  3TRC A;  5EOE A;  2ZM2 A;  1TD5 A;  5FQ9 A;  4LLO B;  4CQH A;  2B95 A;  2OAP 1;  3FWL A;  3ZHH A;  2ZC4 B;  2PR5 A;  1XX2 A;  4OQI A;  1YM1 A;  3G30 A;  1ZTU A;  3VOL A;  3EQV A;  4EBP A;  3FYZ A;  5GHZ A;  1L0E A;  5F1G A;  2Q9M A;  1IYO A;  3MKF A;  1YLY A;  4NEE D;  4DJ3 A;  1MXO A;  2JCH A;  1PWD A;  1W79 A;  2GZA A;  1RCJ A;  3BFC A;  1KVL A;  3BEB A;  5EPH A;  4KZ8 A;  3BLM A;  5F68 A;  4JGR A;  1YLP A;  3HLW A;  3OLO A;  5HFO A;  3F1O B;  3ZQ5 A;  5L07 A;  1GHP A;  2KLI A;  5J8X A;  3QP6 A;  4U0T A;  2PRF A;  1L0G A;  3H7W B;  4R3J A;  1XA1 A;  2A2L A;  4YWZ A;  1NRJ A;  3UDX A;  4PM6 A;  1P9W A;  1ZC2 A;  2VV6 A;  4BL2 A;  3OPH A;  4E04 A;  4OQ0 A;  4BD1 A;  4YNR A;  4AFI A;  3G34 A;  4JF6 A;  2INW A;  1VQQ A;  5HD5 A;  1NLZ A;  4DE2 A;  4MNR A;  4GW9 A;  4Z1W A;  2C6W B;  2QZ6 A;  5U47 A;  4LV3 A;  2X02 A;  4BMW A;  4E3O A;  4EUZ A;  3UB9 A;  3MBZ A;  3HUM A;  2HJE A;  4N1H A;  5TGF A;  4KZ5 A;  4PKY G;  4PMA A;  1KGE A;  3FV7 A;  3PR6 A;  1YAX A;  4R6L A;  1FCO A;  2WGV A;  3KSI A;  4FOF A;  4S2N A;  2NUP C;  3D9Y A;  1LL5 A;  5FAT A;  1HD8 A;  1UGU A;  4JXW A;  1I2S A;  1YLJ A;  4WF0 A;  1K0K A;  4LPZ A;  2HDU A;  3GDI A;  2HPB A;  3T1X A;  3Q82 A;  4MCW A;  2H5S A;  5CXW A;  2P74 A;  1W63 Q;  2XF3 A;  3OPP A;  3BFG A;  1IEL A;  3C4P A;  3Q7Z A;  3SW1 A;  3G2Y A;  5F82 A;  2E8J A;  5EVI C;  5FL3 A;  2FFF B;  4JGP A;  3C7U A;  1DP8 A;  3KSH A;  3N7W A;  3GSG A;  4BBT A;  2ZL1 B;  3DAV A;  5HPI A;  2OOL A;  4RQ9 A;  3BWL A;  1LI9 A;  5A8B A;  2EWV A;  1MBL A;  4P6B A;  1NZO A;  1SDN A;  2ZMA A;  4OH0 A;  1V9Y A;  3LR5 A;  4LEN A;  3G6O A;  2HGV A;  2WK0 A;  3NCK A;  2Y2K A;  1XJ4 A;  2R9W A;  1VM1 A;  5G4Z A;  5HWT A;  4BL3 A;  5DKK A;  2ZC3 B;  1L0F A;  4NG2 A;  2ZOH A;  4DXB A;  3MXQ A;  3HVF A;  1K56 D;  3IWQ A;  2VA0 A;  4JXG A;  1BUE A;  1XGJ A;  2L0W A;  3BFE A;  3UPN A;  4ZJ3 A;  3LIB A;  1YLT A;  3O5Y A;  2Y2N A;  3MR0 A;  3V3S A;  1OT9 A;  3S22 A;  2OAQ 1;  1IKI A;  1Z6F A;  4PM7 A;  5A92 A;  1GHI A;  2H10 A;  4JBF A;  4KG2 A;  1W8Q A;  2V1Z A;  5A90 A;  3LY3 A;  3BFD A;  4LRY C;  3PTE A;  4B93 A;  3F1P A;  1YMX A;  5GLC A;  1VHM A;  1YSP A;  5AQB A;  5HWW A;  5C5K A;  3VP0 A;  3BQA A;  1HZO A;  1IFQ A;  3VFH A;  1D1J A;  2ZQ9 A;  1LHY A;  3AGE A;  3D4F A;  4I3A A;  4EEU A;  4KG5 A;  1Z09 A;  5DTS A;  1CK3 A;  2PT7 A;  3TG9 A;  4M4X A;  4EET B;  2Z6C A;  2XGN A;  5FAQ A;  3OPL A;  3S1Y A;  2PR6 A;  2L4R A;  4C6Y A;  2PHY A;  3RH8 B;  3H9W A;  1DP6 A;  1BLH A;  2PYR A;  2P08 A;  4XXR A;  3SS4 A;  1NYM A;  4JGO A;  4BBV A;  3TJZ C;  1LSV A;  4QB8 A;  2V9A A;  1M6K A;  5EVI D;  4IUH A;  2H0T A;  3MSH A;  2PAV P;  5FSR A;  4LV2 A;  2ZMV A;  3VP1 A;  1W5D A;  1PNE A;  4NXB A;  3ISG A;  1MZU A;  3R7W A;  1BLP A;  2Y8H A;  1KDW A;  2Y2H A;  2OWH A;  2Y2L A;  3S7P A;  1PYY A;  1ZG6 A;  3IXH A;  2ZMF A;  4EBN A;  3LR0 A;  4R3B A;  3UY6 A;  1K54 C;  4GD6 A;  1PIO A;  5FDS A;  3NBL A;  5GLA A;  1XFN A;  3KSF A;  4XUX A;  5D3O A;  2PU4 A;  1EI5 A;  1FR1 A;  3CUE C;  3L9K A;  3H7W A;  4LV0 A;  4UA6 A;  2BTF P;  2XLN A;  4Y0O A;  3BW6 A;  5E2F A;  3P01 A;  4N9K A;  5FEF A;  4LV1 A;  4FUW A;  4WEJ A;  1F5M A;  2EFU A;  4I3J A;  1AXB A;  2IA2 A;  1P97 A;  2XR0 A;  1H0M A;  5E2E A;  3K2N A;  5KMW A;  4KQQ A;  3DTE A;  1YT4 A;  2NUT C;  3G31 A;  4HQA A;  4X53 A;  2Q9N A;  4YIN A;  2J8Y A;  3LUQ A;  1FIL A;  1XJ6 A;  1NLY A;  3FZC A;  4O0P A;  2FFY A;  1G6O A;  4EV4 A;  3LR4 A;  3NI9 A;  2OSU A;  3IS2 B;  1RGY A;  4UQI S;  3VP3 A;  4OPZ A;  5M1A A;  1TS7 A;  1YLZ A;  4HHD A;  1Y4O A;  4KQO A;  2CC1 A;  2H28 A;  2UV0 E;  4GKU A;  4BLM A;  3CWF A;  2VKS A;  4DXC A;  2FH5 A;  4Y0T A;  5L09 A;  3C4O A;  4GHI B;  3T4T A;  3RXW A;  4EER A;  2DRW A;  2JKG A;  3GMW A;  4KZ3 A;  3MZF A;  4ARZ B;  1ONG A;  5HSQ A;  2R9X A;  5HDS A;  4YOF A;  3T4J A;  3T1R A;  1S0W A;  1N9N A;  4Y17 A;  3ULF A;  3NOU C;  4R23 A;  3OZH A;  4WLA A;  4BJP A;  1HTZ A;  2A24 A;  1WYC A;  4PM5 A;  3L7H A;  3CI6 A;  3WS5 A;  3BY8 A;  1BTL A;  2ZJ9 A;  1W7F A;  1K6S A;  3U4L P;  3FPW A;  1DJC A;  1OJG A;  1ODV A;  4GNU A;  5TBM B;  4WEK A;  2VGK A;  3ZG7 B;  3IHB A;  4R1G A;  3S7Q A;  1S1Y A;  5FEG A;  4BQM A;  1EWZ A;  3M2K A;  3GRJ A;  3N8R A;  1OTB A;  3ZG9 B;  4K0X A;  3CPT B;  3QNB A;  3ZG5 A;  4Q8I A;  1MC0 A;  3NDG A;  1P9R A;  1F2K A;  3FKW A;  2XRO A;  4IJG A;  3A0R A;  3ZCZ A;  2HDS A;  1IYS A;  1XKZ A;  2Y2Q A;  2WKP A;  4JXS A;  3VSK A;  3RXX A;  2G2W A;  3HLC A;  4II7 A;  4D2O A;  1SKO A;  2JKR I;  3LEQ A;  1YLW A;  3I7J A;  4O7D A;  1GHM A;  3PXP A;  1CI8 A;  3TOI A;  2XDM A;  4MBH A;  3LI9 A;  3W4Q A;  3IXG A;  4EBL A;  1OPX A;  1HLU P;  1SHV A;  2Y2I A;  4Y0U A;  5EVI B;  3IWO A;  2EXB A;  2HP9 A;  2W0N A;  5TBM A;  3MZE A;  1LSX A;  3D3O A;  2WZX A;  3JVU A;  4MBF A;  2XEP A;  3DWZ A;  2J3W A;  4XT2 B;  3C30 A;  5HX9 A;  1Y54 A;  4PM8 A;  4E3M A;  3LIA A;  4G3V A;  3F1O A;  5CX7 A;  2W1T B;  3KSG A;  2W3H A;  3OCL A;  3MF0 A;  2VLG A;  4XT2 A;  1PI4 A;  4KZA A;  1SDE A;  2GNX A;  3CG5 A;  3PBN A;  1GSV A;  2M7U A;  4DDY A;  2JN7 A;  3P09 A;  1HVB A;  5FQM A;  4GHI A;  5AQ7 A;  4RVA A;  1VET B;  3NDE A;  2M7V A;  2HP5 A;  5FQQ A;  2W1R A;  4QY5 A;  3IF5 A;  4WM9 A;  4WMC A;  2W3G A;  1PFL A;  3H82 B;  5AVF A;  3UE6 A;  2K31 A;  4LGW A;  1DRM A;  3UPO A;  1E3U A;  2RL3 A;  1P0Z A;  5HAQ A;  3Q7V A;  1L0D A;  1G28 A;  2WGW A;  2Y4A A;  3JPU A;  3Q07 A;  2HV1 A;  4P87 A;  3ICY A;  3QHY A;  4Z9Q A;  4HJ4 A;  1YKD A;  4HNB A;  5E43 A;  5TFQ A;  3KYE A;  2DCF A;  1QMF A;  2HDQ A;  3MQQ A;  2WKH A;  4B88 A;  3WS1 A;  2X71 A;  1T18 A;  4H6J B;  1MWT A;  3UB6 A;  4JGQ A;  1ONH A;  5HD3 A;  5LBR A;  2P9V A;  2B5R A;  4WBG A;  5DJU A;  3TE8 A;  3P7N A;  1T1A A;  3T4L A;  4O01 A;  5G4Y A;  3SH8 A;  2L1M A;  2BAS A;  1Y28 A;  1XGI A;  4OKP A;  2QHK A;  1F98 A;  4OP5 A;  2EX6 A;  3B47 A;  1I5Q A;  1XJ3 A;  4BBU A;  4IVK A;  3HLE A;  2J3T C;  3MS6 A;  4ETZ A;  2LB5 A;  3S7N A;  4OLD A;  4WZ5 A;  4E3I A;  4Y3I A;  3N6I A;  1VEU A;  3EEA A;  1VET A;  2HP6 A;  4IVI A;  3MXR A;  1V9Z A;  1T19 A;  5I5L A;  4S2J A;  5HDC A;  3IX8 A;  4ZBE A;  1FSY A;  2WKR A;  3IXB A;  1QME A;  2QPN A;  2PD8 A;  4HP9 A;  2QJ7 A;  3O3V A;  3B33 A;  4JKT A;  2P7J A;  5F1F A;  2OWJ A;  4H8R A;  4P85 A;  1L3L A;  2J7V A;  1ES2 A;  2V8C A;  4ZAM A;  3LO7 A;  3S7O A;  1E4D A;  1K38 A;  4HES A;  1CF0 A;  4HOI A;  3W8K A;  4X6T A;  1N9L A;  2O9A A;  3VE4 A;  4Y15 A;  4GS9 B;  1H8Z A;  5EM0 A;  2IWD A;  4EUV A;  3OC2 A;  3JVV A;  3IHA A;  1MWS A;  3LIF A;  5CRF A;  3KYZ A;  4K0W A;  4HIA A;  5J7E A;  1SKO B;  2KOI A;  5AJG A;  4IHQ A;  5EV0 A;  2HF6 A;  1ERM A;  3R4K A;  3AGF A;  3V5M A;  2Z2L B;  3O88 A;  3S4X A;  3ITB A;  1MKI A;  1ZG4 A;  2D02 A;  4ZJ1 A;  3WRT A;  1GSW A;  3UN7 A;  3T4Q A;  4DKI A;  3VV4 A;  4PHT A;  3A3E A;  3MKE A;  1S4R A;  2XSS A;  4FH4 A;  2PDR A;  2ZD8 A;  4WZ4 A;  3IF6 B;  3GEC A;  3CAX A;  1KDS A;  3CHW P;  3V67 A;  5HW3 A;  5L10 A;  1BLC A;  1NYY A;  3UNW A;  1PRQ A;  4P0M A;  4P6Z M;  1CJF A;  4KZ9 A;  1U60 A;  4MLL A;  3VP2 A;  4KZ4 A;  3UO9 A;  1H8Y A;  2K2N A;  4N92 A;  1IYP A;  3DW0 A;  5IHV A;  3SH7 A;  4IUK A;  3IBR A;  1JTG A;  3SOI A;  1XXM A;  1WYB A;  2ZC5 B;  4E6W A;  4MMN A;  1G68 A;  4DDS A;  4X69 A;  2XK1 A;  4ME4 A;  4L9G A;  1K25 A;  4BEN A;  1TS8 A;  3ZFZ A;  1FQG A;  1NJ4 A;  1C3B A;  2V2F F;  3PBS A;  3QP8 A;  4DJ2 A;  1H5X A;  1GA0 A;  3A0V A;  2QKP A;  2WKI A;  3DTI A;  2Z2M B;  3UME A;  4ETX A;  4ESP A;  1MWU A;  1D06 A;  1TEM A;  3N8L A;  1CQA A;  3SH9 A;  2Y2M A;  3IF6 A;  3WS2 A;  3D72 A;  5EOO A;  4H6J A;  1W63 M;  3O87 A;  4CLC E;  1WE4 A;  4Y5F A;  1RP5 A;  2VGJ A;  5FQJ A;  4QD4 A;  4X1L A;  5CER A;  3G4P A;  3VE3 A;  3T50 A;  3P98 A;  5GHX A;  4X55 A;  4N9L A;  2ZC6 B;  3M2J A;  2JBF A;  4WEL A;  2WGW B;  3ITA A;  5A91 A;  2I72 A;  2W3D A;  4LRZ E;  1PWG A;  2ZOI A;  4WUJ A;  3VP4 A;  5CGW A;  3MQO A;  4S2M A;  1G5U A;  4S2I A;  3EQU A;  1LL9 A;  4HJ6 A;  2BLS A;  2QJ5 A;  3PBQ A;  4JPM A;  3MJQ A;  4X68 A;  3VSL A;  2XA7 S;  3C2W A;  2D01 A;  3NJA A;  4LCM A;  4N1X A;  4G3W A;  4HBT A;  1O7E A;  5L8M A;  4CPK A;  4OON A;  4U3T A;  4EES A;  3NOT C;  2O99 A;  1OJ5 A;  4C75 A;  2XQZ A;  2VX8 A;  2VJW A;  4HBU A;  5J3W A;  3TSG A;  2VV7 A;  2JHE A;  4WMC D;  5HWV A;  4OOM A;  2H0Y A;  3QP1 A;  1T1B A;  3HLG A;  4FH2 A;  2I9V A;  1X0O A;  4CLC A;  2KX6 A;  1KOU A;  3C38 A;  5AQA A;  4KZ7 A;  2XRN A;  2ZM8 A;  3BJN A;  3W4P A;  4MN6 A;  2JE5 A;  3EGX C;  5HAR A;  1YSQ A;  5F83 A;  3RTY A;  1VEU B;  1XP4 A;  3IH8 A;  2EFX A;  1NY0 A;  5EM1 A;  1H3Q A;  2MJ6 A;  3QP2 A; 
#chains in the Genus database with same CATH homology
 2J3W A;  3LIC A;  4XT2 B;  3C30 A;  4PKY G;  1XFQ A;  1IOU A;  4ZRR A;  3LIA A;  4G3V A;  3PR6 A;  3F1O A;  5CX7 A;  1VB6 A;  1YAX A;  4R6L A;  2W1T B;  3KSG A;  2W3H A;  3KSI A;  3OCL A;  4FOF A;  3MF0 A;  2VLG A;  2NUP C;  4Y2F A;  3KX0 X;  4XT2 A;  2GNX A;  5K5B A;  3PBN A;  1GSV A;  1UGU A;  1NWZ A;  2M7U A;  3OCN A;  4WF0 A;  5IS1 A;  3UE3 A;  4GLQ A;  2JN7 A;  4LPZ A;  1H8M A;  3GDI A;  1OTI A;  4GHI A;  4MCW A;  4O8G A;  3ZYT A;  2M7V A;  1WA9 A;  3EEH A;  1W63 Q;  3LI8 A;  2W1R A;  2V0W A;  4GS9 A;  3TW8 A;  4WN5 A;  2W3G A;  3RFB A;  2VGL S;  3HCY A;  5IT5 A;  3H82 B;  5AVF A;  3OBF A;  3UE6 A;  2K31 A;  4EQ1 A;  1DRM A;  3SW1 A;  2R78 A;  1P0Z A;  1LT0 A;  3BQ8 A;  4L0L A;  1DP9 A;  3E4O A;  4EU0 A;  3E0Y A;  2JKT I;  5DFX A;  4JGP A;  5FL3 A;  1G28 A;  2GX5 A;  1DP8 A;  1OTE A;  3KSH A;  2EWW A;  4BBT A;  5HZH A;  4UEY A;  2HV1 A;  2Z6D A;  3ICY A;  4PKY A;  5F69 A;  3CUE A;  5HPI A;  4HJ4 A;  1YKD A;  4HNB A;  2A24 B;  2V1A A;  3KO6 A;  4EXO A;  2OOL A;  3K3C A;  4RQ9 A;  3BWL A;  3LYX A;  1S4S A;  3OOV A;  4I39 A;  4WL9 A;  2VV8 A;  3MQQ A;  5A8B A;  5DKL A;  3E4P A;  5HL6 A;  1T18 A;  3B42 A;  5DF9 A;  4H6J B;  5DJT A;  5KIZ A;  2EWV A;  4R3A A;  3UB6 A;  4JGQ A;  4LRX C;  4I5S A;  5EFW A;  1V9Y A;  5HD3 A;  5LBR A;  5DJU A;  4EEP A;  3TE8 A;  3LR5 A;  5HPF A;  3P7N A;  1T1A A;  3G6O A;  2HGV A;  1N9O A;  1XJ2 A;  3T4L A;  1XJ4 A;  4O01 A;  5G4Y A;  5G4Z A;  1ZHH B;  5HWT A;  5DKK A;  2L1M A;  2BAS A;  1Y28 A;  2QHK A;  2ZOH A;  1F98 A;  3MXQ A;  3F1N A;  3B47 A;  2VA0 A;  4KUO A;  2L0W A;  1XJ3 A;  4L9F A;  4BBU A;  3U2A A;  3LIB A;  2J3T C;  4FSF A;  3O5Y A;  3C8C A;  2WKQ A;  2G7U A;  4ETZ A;  4CLC D;  3MR0 A;  3IS2 A;  1OT9 A;  2LB5 A;  3S7N A;  4HP4 A;  3W2Z A;  2OAQ 1;  4F3L B;  4Y3I A;  3EEA A;  1S1Z A;  1V9Z A;  4DMZ A;  4QPR A;  1T19 A;  5I5L A;  2V1B A;  5HDC A;  4LRY C;  4B93 A;  2WKR A;  2DMW A;  2LB9 A;  3F1P A;  2PD8 A;  1JNU A;  4HP9 A;  1VHM A;  1YSP A;  4NXF A;  5HWW A;  2QJ7 A;  5C5K A;  3B33 A;  3BQA A;  1IFQ A;  2P7J A;  4L9E A;  2OWJ A;  4I3A A;  4PAU A;  4EEU A;  2PT7 A;  4M4X A;  3S7O A;  2CMN A;  3T4K A;  2Z6C A;  4EET B;  2PD7 A;  2PR6 A;  2O0Y A;  4NXE A;  2L4R A;  2J3T D;  2PHY A;  4HOI A;  2W1T A;  3RH8 B;  3H9W A;  1DP6 A;  2PYR A;  4P6Z S;  2EA9 A;  3MMH A;  2PYP A;  3H82 A;  2P08 A;  4JGO A;  1N9L A;  2O9A A;  3TJZ C;  1LSV A;  3VE4 A;  4BBV A;  3BY9 A;  2V9A A;  4GS9 B;  4IUH A;  2KDK A;  2ZMV A;  4GCZ A;  2W3F A;  3UB8 A;  3HJI A;  4EUV A;  3OC2 A;  5TJJ A;  3JVV A;  4I38 A;  4NXB A;  1S66 L;  3CIT A;  3LIF A;  1MZU A;  3R7W A;  3KYZ A;  2Y8H A;  2QWS A;  4HIA A;  2OWH A;  5J7E A;  4I3I A;  3S7P A;  2KOI A;  5AJG A;  4CLC B;  4IHQ A;  2HF6 A;  3R4K A;  4HH3 A;  4KUK A;  2ZMF A;  3E4Q A;  3LR0 A;  2W3E A;  2VZW A;  2D02 A;  3IBJ A;  1F9I A;  5F5Y A;  1GSW A;  1MKM A;  2GJ3 A;  1XFN A;  3T4Q A;  2B02 A;  2FZ0 A;  3KSF A;  4PHT A;  3VV4 A;  3EGD C;  1S4R A;  2XSS A;  2PDR A;  2M1C A;  3EWK A;  3CUE C;  1STZ A;  3KYQ A;  2JKT M;  3GEC A;  3CAX A;  3H7W A;  3NHQ A;  2W27 A;  3LR3 A;  3V67 A;  3FC7 A;  3BW6 A;  3P01 A;  1TS6 A;  3PBT A;  3HJK A;  1OTA A;  1LSW A;  4WEJ A;  1F5M A;  4P6Z M;  3PYP A;  4GJ4 A;  2YKF A;  4I3J A;  2IA2 A;  4EW7 A;  2K7S A;  1P97 A;  4HJ3 A;  3UMD A;  3MFX A;  2YKH A;  3K2N A;  3T4O A;  3FPV A;  3MQ0 A;  1UWN X;  2NUT C;  5DFY A;  1EW0 A;  2K2N A;  1OT6 A;  4HQA A;  3F1N B;  2Y79 A;  4IUK A;  4MN7 A;  1OTD A;  4R70 A;  3IBR A;  3LUQ A;  2V0U A;  1XJ6 A;  1NLY A;  2ZBB A;  4O0P A;  5HDD A;  1UWP X;  4F3L A;  4DN0 A;  1G6O A;  3PBR A;  3LFV A;  4HY8 A;  3LR4 A;  4MMN A;  4Q0J A;  2VGL M;  3IS2 B;  3LID A;  3K3D A;  4ME4 A;  4L9G A;  4UQI M;  4UQI S;  5F6A A;  1TS8 A;  5J4E A;  3A0S A;  1TS7 A;  3PBS A;  4HHD A;  4DJ2 A;  4KQO A;  4K08 A;  2H28 A;  3A0V A;  2QYB A;  2QKP A;  3CWF A;  2VKS A;  3UME A;  4ETX A;  4B9O A;  3LIE A;  2FH5 A;  4NKP A;  3PBO A;  1D06 A;  2B18 A;  3TRC A;  4GHI B;  3T4T A;  4EER A;  2VEA A;  1TD5 A;  2XA7 M;  4ARZ B;  3D72 A;  4H6J A;  4LLO B;  4MN5 A;  5HSQ A;  1W63 M;  4CLC E;  4CQH A;  2OAP 1;  5HDS A;  4Y5F A;  4YOF A;  3T4J A;  5KSH A;  1N9N A;  5MC7 A;  2PR5 A;  3ULF A;  3NOU C;  2HJ9 C;  4WLA A;  5AVE A;  4BJP A;  1ZTU A;  3VOL A;  2A24 A;  3EQV A;  3CI6 A;  3VE3 A;  3T50 A;  4ARZ A;  3BY8 A;  4NEE D;  4WEL A;  4DJ3 A;  3FPW A;  1OJG A;  1ODV A;  5TBM B;  1T1C A;  4WEK A;  3R7W B;  2GZA A;  2W3D A;  4LRZ E;  2ZOI A;  3E98 A;  4HH2 A;  4WUJ A;  3S7Q A;  1S1Y A;  3MQO A;  1OTB A;  3EQU A;  4HJ6 A;  2QJ5 A;  1MC0 A;  5F68 A;  4JGR A;  1P9R A;  1LL8 A;  3MJQ A;  4Q0H A;  3OLO A;  2XA7 S;  3C2W A;  2D01 A;  3F1O B;  3ZQ5 A;  3NOP C;  2XRO A;  4IJG A;  3A0R A;  1TS0 A;  3NJA A;  2KLI A;  4G3W A;  4G3K A;  2P04 A;  1BYW A;  5L8M A;  2WKP A;  4BWI A;  3H7W B;  1D7E A;  3UB7 A;  4EES A;  3NOT C;  2O99 A;  4II7 A;  2A2L A;  3FG8 A;  4YWZ A;  1OJ5 A;  2JKR I;  1NRJ A;  1P9W A;  2VX8 A;  2VJW A;  3PXP A;  2VV6 A;  5J3W A;  1GSX A;  4E04 A;  2VV7 A;  4OOL A;  2JHE A;  4MDZ A;  4YNR A;  3LI9 A;  4AFI A;  5HWV A;  3T4S A;  4OOM A;  2O9C A;  1OPX A;  1T1B A;  2INW A;  5HD5 A;  1NLZ A;  1S67 L;  2I9V A;  3F1P B;  1X0O A;  2O9B A;  3PHY A;  4Q0I A;  5IU1 A;  4GW9 A;  4NXG A;  4Z1W A;  4CLC A;  2KX6 A;  1KOU A;  3C38 A;  2XRN A;  4BMW A;  3BJN A;  2W0N A;  4MN6 A;  3EOI A;  3CLO A;  3EGX C;  1YSQ A;  5TBM A;  4R38 A;  4CLC C;  3RTY A;  2JKR M;  3UB9 A;  1LSX A;  3DBA A;  3D3O A;  3JVU A;  4KQD A;  1H3Q A;  2HJE A;  1TF1 A;  2J80 A;  2MJ6 A;  4HI4 A;  3PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...