3IXGA

X-ray crystal structure of the extended-spectrum ampc t70i mutant beta-lactamase with and without benzo(b)thiophene-2-boronic acid bound at 2.14 angstrom resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
358
structure length
317
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFIGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDELLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 317
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixgA00
4DF6A 4OQIA 4Z9QA 3LCEA 4JXSA 3UDIA 3JYIA 5E2FA 4KZ5A 3DW0A 1CK3A 2EX8A 1MKIA 3A3DA 2ZQAA 5TGFA 1K6RA 4U0TA 4E3NA 1KVMA 1TDGA 2ZMAA 2C5WB 3Q7VB 4EBPA 2Z2MB 5KSHA 4H8RA 4PM6A 5EVIC 3W8KA 5FASA 1FQGA 3MZDA 1BLHA 2XK1A 5M1AA 4ZTKA 2WAEA 3HUMA 1ONGA 1PWGA 3ZG0A 5EE8A 3CG5A 4LCMA 4R3BA 1N9BA 1K25A 4DRTA 4QD4A 4JF6A 2V20A 1WYCA 5TR7A 3HREA 1NYYA 4B4XA 1ESUA 1K54A 2C6WB 2Y2IA 1NJ4A 1K55C 3IQAA 1BLPA 3GQZA 3BLSA 3Q7ZA 1RGZA 1L0DA 1RGYA 3PBSA 2Y2KA 4UHUA 5D3OA 3IHAA 4KZ6A 5FQMA 3ZDJA 5JYPA 3UN7A 1IKIA 3SS3A 1K56A 3BEBA 1LL5A 1K4EA 3PBQA 5CEDA 2ZM2A 3BFDA 4A5RA 2Y91A 1ZKJA 1W8YA 2P9VB 2P74A 4WBGA 3IXGA 4KZ7A 5EVLA 2H10A 4HBTA 3S22A 4GD6A 1VQQA 4WYYA 3IH8A 1I2WA 3D4FA 1TVFA 5F1FA 4BJPA 1E4DA 1AXBA 3LO7A 4MBKA 4X6TA 2WKEA 1YLPA 2XFSA 3MXSA 1PW1A 4RYEA 3VFHA 2J9PA 5FSRA 4C3QA 4DDYA 4S2NC 3WS2A 2FFFB 2OLUA 3GMWA 1MY8A 4BD0A 1HZOA 1PI4A 1S0WA 3PAGA 5A90A 2DRWA 5FQ9A 1FR1A 4KZ3A 1VM1A 4DE3A 2XQZA 2OSUA 4M3KA 1O7EA 5CEBA 1Q2PA 5EVID 5M19A 3BFEA 3VP1A 4E3JA 5F83A 4ZAMA 4Q8IA 2ZQ8A 3SS4A 2R9XA 5AQ7A 3OCLA 2EX6A 3VFFA 2JCHA 4PMAA 4JXGA 4WZ5C 4RX2A 3QNBA 1HVBA 5CXWA 1FCMA 1G68A 1KE4A 3O87A 4N1HA 3ZG7B 1CI8A 1KGEA 5L2FA 3V39A 1HTZA 4QU3A 4CJNA 3G31A 1PI5A 1FR6A 1YMXA 3G34A 3LY4A 4P6BA 4S2PA 3Q1FA 3FWLA 1MWUA 4F94A 1ES3A 5KSCA 1ERQA 4FH4A 2WADA 1BTLA 2XD1A 2Y2GA 3DWKA 3MXRA 1PWCA 3UO9A 1BT5A 1XKZA 1L0EA 2Q9NA 3N4IA 3WS5A 3IXHA 4KG2A 4EUZA 3UE1A 3C7UA 1ESIA 1S6RA 3Q07A 2Y2MA 3MBZA 3OPPA 4N9KA 4OOMA 3V50A 2HP6A 4BLMA 2WZZA 3O3VA 3UPPA 3BYDA 4NK3A 1BUEA 3O86A 1IYSA 2X71A 4X56A 2CC1A 4R23A 4WM9A 2XD5A 3TSGA 4QJGA 3HVFA 3OZHA 4QB8A 5HARA 1K54C 3NIAA 4MLLA 1GHIA 4FH2A 2PU2A 3GRJA 1DY6A 4JLFA 4WZ4A 3ZG9B 4E6XA 1NZUA 4GD8A 3G4PA 5GLDA 1C3BA 4R1GA 5FDHA 3UNWA 3SS5A 3RXXA 5E2HA 5AQBA 2BG1A 4IBRA 2PU4A 4C6YA 4QY6A 4BL3A 5E2GA 1W7FA 3VMAA 3N6IA 2WAFA 4JBFA 4OOYA 4ZDXA 1YQSA 5HFOA 5GHZA 3IH9A 1YLWA 5JYOA 3FZCA 5AQ9A 3BECA 2ZLYA 4GKUA 2WUQA 4EV4A 3C7VA 4OONA 1MPLA 5EOEA 3GR2A 5EVIB 3NY4A 4D2OA 4N9LA 3WS0A 4N92A 2ZJ9A 4ZJ3A 2ZQ9A 1XP4A 4WEKA 4IVIA 1LI9A 2EX2A 3V5MA 1QMEA 3IHBA 3OPRA 5EOOA 2J9OA 4E3OA 2Y59A 5FAPA 1K6SA 2H0TA 2B5RA 3ZG5A 3GTCA 1BZAA 1K57A 2EFXA 1FOFA 2XGNA 2IWCA 5FAOA 4K0XA 2GDNA 3BRMA 3G32A 3AGDA 3MKEA 4KQQA 3G30A 3M2KA 4QY5A 3Q81A 5EUAA 3ZVWA 3E2LA 3HLGA 4GDBA 3IF6A 2IWDA 4EBLA 4S2JA 1YLZA 1W5DA 4OLDA 1ZG4A 4HESA 1E3UA 1FSWA 5GHYA 1NY0A 4B4ZA 4XUZA 2Z2LB 1FCNA 5J8XA 3ZVTA 5DF7A 2WGWA 2G2UA 1LI0A 2JE5A 4PM8A 1SDNA 1ONHA 3I7JA 5GLBA 1DJAA 4JPMA 4ZBEA 4GOGA 1MXOA 4MBHA 5E43A 3A3FA 1GA0A 2XFTA 1K56D 3P98A 1JTDA 2QZ6A 3W4PA 1CEFA 1LL9A 4KG5A 2ZC5B 2EX9A 1IELA 2FFYA 2EXAA 3CJMA 3MZFA 4Y0UA 1FSYA 2ZD8A 5KZHA 4KQRA 1SCWA 4WMCA 5GLCA 3VP3A 4HBUA 2RCXA 1BULA 4E3MA 5FAQA 2XF3A 5BOHA 5DTSA 1M6KA 2WKHA 3BM6A 3Q7VA 4OKPA 2QPNA 5E2EA 3PBRA 5HAQA 1L0FA 1GHPA 3GSGA 3NC8A 5FQQA 4JF5A 2HDQA 4LV1A 3UPNA 5I94A 3NDGA 4ZJ1A 4BQMA 4DXCA 4L0LA 2DCFA 3NBLA 5HAIA 3VP4A 3HLEA 1PZOA 3FV7A 4S2LA 1NYMA 4NETA 5HAPA 3IT9A 1L2SA 3SH8A 1ERMA 5FI2A 3RJUA 3W4QA 3A3IA 4YINA 1YT4A 2Y2OA 3PTEA 3ZNYA 4OPYA 5GHXA 3OCNA 2ZC6B 1PWDA 3A3JA 5A93A 4KZ9A 3VOZA 4E3LA 1LLBA 2V1ZA 2P9VA 3HLDA 5CGSA 4LCLA 4RX3A 1BSGA 1W8QA 4JF4A 4DKIA 1I2SA 1ES4A 4LV2A 4OQHA 3ITBA 1XXMA 1YMSA 2WZXA 4U0XA 4WELA 4GZBA 1E25A 4JKTA 4LV3A 4XXRA 5HX9A 3UPOA 1KE3A 3HLWA 3HLBA 3EQUA 3HUOA 3UE3A 4GN2A 4FSFA 4XUXA 1ALQA 1K57C 3N8RA 3VP0A 1RP5A 3BFCA 3ZHHA 1FCOA 5FATA 4X68A 2XEPA 2QMIA 1Q2QA 2J7VA 4OQ0A 2HPBA 4C75A 4E3KA 3WWXA 4OPZA 3IF6C 2Y2HA 3C4OA 1IYOA 3FKWA 3M6BA 4O7DA 5DTTA 1M40A 2HDSA 3GV9A 4U3TA 4KZ8A 3ZCZA 5HL1A 1DJBA 1YM1A 3W4OA 4IVKA 2ZM0A 3N8LA 1H8ZA 2X01A 3C4PA 3V3SA 4X69A 3PBTA 2VGJA 3CMZA 3WS4A 3B3XA 3N8SA 3ZFZA 3IWQA 2HP5A 4S2OA 5FQJA 1XGIA 2UWXA 3SH7A 3ZGAB 1KDSA 3P09A 4UA7A 5CTNA 2E8IA 3DWZA 2XLNA 5DF8A 3NDEA 1XA1A 5G18A 1YLJA 1EWZA 5FQIA 2ZQDA 5A91A 2ZC7A 3VOYA 4DDSA 3IWIA 3IF5A 1MBLA 3G2ZA 3OPLA 1CI9A 1W79A 5CHUA 2EXBA 4OOLA 1LHYA 3VSLA 2WGVA 2V2FF 2HP9A 3MKFA 5GLAA 4GDNA 5HW3A 1SDEA 4KZBA 1IEMA 4R4SA 5AQAA 4YFMA 5F82A 5FA7A 1KDWA 1N4OA 1JTGA 3QHYA 2IWBA 1WE4A 4QHCA 2WK0A 5F1GA 5CGWA 2Y55A 3VP2A 4FCFA 1IYQA 2HDUA 2HDRA 4UA6A 4MBFA 5GL9A 4BD1A 4OVDA 1I5QA 1KGGA 3M2JA 3Q82A 3QNCA 3S1YA 3WS1A 4DE1A 3ZNTA 3M6HA 4B88A 2ZC3B 3HLFA 4S2KA 1O07A 1ZG6A 3G35A 4OPQA 5CGXA 2Y2LA 1IYPA 3GVBA 3V3RA 3TOIA 3LY3A 1PZPA 4EWFA 1JWZA 4KZAA 2XH9A 4BL2A 4K0WA 3UE0A 3MZEA 5M18A 4S2MA 2G2WA 3IXBA 5CECA 5KMWA 3A3EA 3ISGA 1ES2A 4PM9A 4GNUA 2EFUA 2DNSA 1E3UD 1H5XA 1HD8A 1MWTA 3C5AA 5DVAA 3G2YA 5U47A 4CPKA 5EPHA 3CZDA 1KE0A 1MWRA 3BFGA 3ZG8B 4ZJ2A 1YLYA 2JC7A 1PIOA 1BLSA 3OC2A 4RVAA 4ID4A 3BLMA 4PM5A 2Y2JA 4IEDA 1NZOA 4MEZA 5EVIA 3WRTA 1XA7A 3LEZA 2XDMA 5FQKA 1TEMA 1GA9A 2Y2PA 4OH0A 2R9WA 1NRFA 3HLCA 1IKGA 3O88A 3PBNA 1DJCA 3UDXA 4R3JA 3NI9A 1WYBA 4Y0OA 5FI6A 1JVJA 2WGIA 1K38A 1KGFA 1BLCA 1PW8A 4JXWA 3TG9A 1K55A 3AGFA 2BLSA 2RL3A 3MFDA 4UAAA 4R0QA 5CTMA 1G6AA 1YLTA 2OV5A 5IHVA 4KENB 3VSKA 4OP5A 4GB7A 4WMCD 2J8YA 3E2KA 4KZ4A 5DTKA 1MWSA 4JXVA 2I72A 1QMFA 5CHJA 4X55A 4LENA 4DXBA 5A92A 4P85A 4PM7A 1K4FA 2A3UA 4OLGA 3HUNA 4RA7A 4FD8A 1CEGA 2ZC4B 2Y2NA 4UA9A 3IXDA 3N7WA 4OP8A 1SKFA 2Y2QA 1OMEA 4K91A 3DTMA 2VGKA 1KVLA 5TFQA 1JWPA 1TDLA 1EROA 2H0YA 3PBOA 2H5SA 3ITAA 3OPHA 1SHVA 1XX2A 1ZC2A 2OLVA 2PBYA 3PAEA 1RCJA 4HEFA 1Z6FA 4S2NA 2WKIA 3SH9A 1H8YA 3S4XA 1Y54A 4BENA 4EQIA 4KG6A 3FYZA 4OPRA 4DE0A 1GHMA 2JBFA 1L0GA 3IF6B 4E6WA 4WEJA 4IBXA 1PYYA 2ZM8A 2ZQ7A 4X53A 3AGEA 1XPBA 4E3IA 1GCEA 3RXWA 4Y0TA 2Q9MA 2WGWB 5FI7A 3FKVA 4P87A 2ZQCA 4WZ5A 3SOIA 4Y7PA 1XGJA 4P0MA 2X02A 4KQOA 3EQVA 3IWOA 3HBRA 3UDFA 2Y4AA 2XR0A 4DE2A 1JWVA 5CERA 3NCKA 4EBNA 2WYXA 1ES5A 3UY6A 1J9MA 5EECA 1EI5A 4R4RA 4OQGA 1NXYA 5CHMA 4PPRA 3WRZA 2A49A 3BFFA 5CRFA 4LV0A 4S2IA 4N1XA 3HL9A 4MNRA 1U60A 5DF9A
chains in the Genus database with same CATH superfamily
2PR6A 2NUPC 2QKPA 1VETA 4XT2A 1CK3A 5TGFA 4U0TA 2VZWA 3Q7VB 5G4ZA 5KSHA 2D01A 2INWA 4CLCC 3CWFA 3ZG0A 5TR7A 2EWWA 3HREA 1OTBA 1ESUA 1K54A 1K55C 3K2NA 4EEPA 5D3OA 1L0DA 2Y2KA 3IHAA 4KZ6A 5JYPA 3UN7A 4HJ3A 3UMDA 3LI8A 2P9VB 2P74A 3MQOA 3IXGA 3T1QB 5EVLA 2GZAA 3P01A 4II7A 5F1FA 4BJPA 3KX0X 4MBKA 4X6TA 1F2KA 3E98A 2XFSA 3MXSA 1X0OA 1VB6A 5FSRA 3WS2A 3NJAA 4M3KA 5CEBA 5F83A 2ZQ8A 4CLCD 3SS4A 3OCLA 3VFFA 3FPWA 2OAP1 3QNBA 1FCMA 1G68A 5L2FA 3V39A 4QU3A 1H8MA 4P6BA 4S2PA 1BTLA 3DWKA 2EA9A 1L0EA 2Q9NA 1S6RA 4OOMA 2HP6A 3ULFA 2WZZA 3O3VA 3UPPA 4NK3A 2A24B 3S7PA 2QJ5A 4QB8A 5HARA 4X1LA 3NIAA 4MLLA 1GHIA 4FH2A 3GECA 3GRJA 5FEFA 3ZG9B 5GLDA 3UNWA 1C3BA 4R1GA 3T1SA 3LR5A 5AQBA 4C6YA 4BL3A 5E2GA 3VMAA 5JYOA 2B18A 3FZCA 3KYQA 3BECA 4ESPA 3C7VA 4OONA 5EOEA 3GR2A 3UB8A 4N9LA 4CLCB 3WS0A 4EW7A 3ZYTA 1NRJA 1OJGA 4IVIA 1LI9A 5EOOA 2J9OA 3OBFA 4LLOB 4E3OA 3C30A 4YOFA 3G30A 5IS1A 2JKRM 5EUAA 3ZVWA 4HQAA 3HLGA 2V8CA 4P6ZS 4EBLA 4PKYA 1W5DA 3B33A 1E3UA 5L09A 4NG2A 4PM8A 5L07A 5GLBA 4JPMA 1MXOA 3G6OA 2XFTA 1K56D 3P98A 4G3WA 4Q0HA 3MS6A 2FFYA 3CJMA 2XA7M 2VEAA 1FSYA 1OTEA 4HBUA 1BULA 4LRXC 5DTSA 2PR5A 3BM6A 3Q7VA 3PBRA 1FILA 5HAQA 1GHPA 2P7JA 3GSGA 5FQQA 3OLOA 1F5MA 2V0WA 3UPNA 1P9WA 4GCZA 3L9KA 2G7UA 2OAQ1 3A0VA 4DN0A 3IX3A 4GS9B 3IT9A 1TD5A 1L2SA 4Z1WA 5FI2A 3RJUA 1YT4A 4OPYA 5A93A 2Y8HA 5FEGA 2P9VA 1W8QA 2Q0OA 1I2SA 1XXMA 4U0XA 4WELA 4LV3A 2QHKA 4XXRA 1KE3A 3HLWA 4XUXA 1K57C 3T4JA 5L10A 1XFQA 2LB9A 4BBTA 5FATA 2QMIA 4C75A 5HDCA 3T4SA 3NOTC 3PHYA 3IF6C 2Y2HA 1M40A 1SZVA 1YM1A 1S4RA 1DP9A 2J80A 2X01A 1T1AA 3ICYA 3CLOA 3C4PA 3B3XA 4S2OA 3SH7A 1KDSA 5CTNA 4UA7A 5DF8A 1YLJA 3D3OA 3VSLA 3TW8A 1PFLA 1W79A 2EXBA 1LHYA 1YSQA 2HP9A 5GLAA 5HW3A 4KZBA 5AQAA 4R4SA 4KQDA 3QP4A 5F82A 1Z09A 1KDWA 1V9ZA 2ZBBA 3QHYA 5F1GA 5CGWA 2Y55A 1DP8A 1I5QA 1KGGA 3Q82A 2W3HA 3S1YA 3WS1A 4DE1A 3M6HA 4IUHA 2A24A 3HLFA 3MQQA 4OPQA 5CGXA 4NXEA 3SW1A 1PZPA 2G2WA 5C5KA 5KMWA 1DP6A 3MR0A 4PM9A 2DNSA 1HD8A 5U47A 1OTAA 2JC7A 3LGOA 5LBRA 3OC2A 4RVAA 1GSWA 4IEDA 1NZOA 1Y4OA 4MEZA 1LSWA 4CLCA 4QPRA 2CMNA 1GA9A 3HLCA 1KGFA 4JXWA 1S1YA 3TG9A 1D06A 1K55A 5EV0A 4BBVA 4ZRRA 5IU1A 3BWLA 2BTFP 5CHJA 3UB7A 4X55A 3MSHA 2AVXA 3LR3A 4P85A 2A3UA 3LIAA 4R38A 3K3CA 5HWVA 1XJ4A 2H0YA 3ITAA 1YSPA 1ZC2A 2OLVA 1RCJA 3LEQA 2WKIA 3FPVA 1Y54A 3PR6A 4EQIA 4KG6A 3IBRA 3IF6B 4E6WA 4IBXA 2ZM8A 4YNRA 2JKRI 3HJIA 4Y0TA 2Q9MA 2WGWB 5FI7A 1UGUA 3S7OA 2PYRA 1OT6A 2X02A 1MKMA 4B93A 3NCKA 1STZA 1ZHHB 3UY6A 5F6AA 1EI5A 4R4RA 3T4QA 2A49A 4KUOA 5HSQA 3HL9A 4HY8A 1U60A 4GS9A 4DF6A 4Z9QA 5E2FA 2EX8A 4Y13A 2ZQAA 4HP4A 1KVMA 2C5WB 4GHIB 4PM6A 5EVIC 3W8KA 4ZTKA 3HUMA 3HCYA 1WYCA 1TS0A 5IT5A 4BMWA 3TJZC 3IQAA 3Q7ZA 4MCWA 1RGYA 1VEUB 1K56A 3BFDA 4A5RA 3KYEA 1W8YA 4WBGA 4HBTA 5HWTA 3S22A 1VQQA 1ACFA 4WYYA 1TVFA 3LO7A 2QWSA 1S67L 1XFNA 1PW1A 2J9PA 4C3QA 4BD0A 5TJJA 1HZOA 1ODVA 3PAGA 1FR1A 1VM1A 4DE3A 2XQZA 5EVID 3BFEA 5HL6A 2HZ5A 2O9AA 4JXGA 4WZ5C 5CXWA 3DBAA 2I9VA 1NWZA 1HTZA 4CJNA 3G31A 1PI5A 5DKLA 3G34A 4CQHA 1ES3A 4HP9A 2XD1A 2Y2GA 3MXRA 4KG2A 4EUZA 3UE1A 2Y2MA 3MBZA 4N9KA 3V50A 3UB6A 3BYDA 1BUEA 1OTIA 1S1ZA 2X71A 2WKPA 1DRMA 2CC1A 4R23A 3HVFA 1LT0A 1T19A 1KOUA 4E6XA 5HDSA 3BW6A 5HPFA 3RXXA 4I38A 2BG1A 4UQIS 3N6IA 2WAFA 4ZDXA 5HFOA 5GHZA 1YLWA 4GKUA 2WUQA 4EV4A 5EVIB 3NY4A 2J3TC 4HNBA 4QWOA 4ZJ3A 3MJQA 4WEKA 3V5MA 2Y59A 1K6SA 2EWVA 1BZAA 1K57A 2EFXA 2XGNA 2IWCA 1P97A 4K0XA 2GDNA 3G32A 4KQQA 5HWWA 3M2KA 5TBMB 2Z6DA 4EEUA 2W3GA 3IF6A 2ZMFA 1CF0A 4XUZA 5J8XA 1LSVA 3ZVTA 2WGWA 2G2UA 3LIBA 4ZBEA 3A3FA 1D1JA 2J3WA 5KZHA 3IS2B 3QP8A 3VP3A 5GLCA 2J3TD 2RCXA 4O01A 2XF3A 1M6KA 4GHIA 1L0FA 3NC8A 4JF5A 3W2ZA 4LV1A 4ETZA 5I94A 4ZJ1A 4DXCA 1CQAA 2DCFA 2ACGA 4R3AA 3NBLA 2YKHA 3T1XA 3HLEA 3FV7A 4S2LA 4NETA 5HAPA 4K08A 3W4QA 3A3IA 4YINA 3PTEA 1VEUA 2ZC6B 2O99A 1PWDA 1NLZA 4KZ9A 1OPXA 3QP6A 3HLDA 4HI4A 3MF0A 3ZQ5A 1BSGA 1W63M 1ES4A 5MC7A 2XRNA 2ZMVA 1ALQA 3N8RA 2VJWA 3ZHHA 4X68A 2UV0E 1Q2QA 4OQ0A 4E3KA 1TS8A 3C4OA 1MC0A 1Y28A 2HDSA 2HV1A 1L3LA 3W4OA 4HOIA 2ZM0A 3BJNA 3V3SA 5F5YA 1CJFA 3CMZA 3ZFZA 2HP5A 5FQJA 2UWXA 2E8IA 1FIKA 3U2AA 3A0RA 1XA1A 1EWZA 3MMHA 4DDSA 1T18A 3VOYA 2O9CA 1CI9A 5CHUA 4OOLA 1TF1A 2WGVA 3MKFA 3NULA 4GDNA 2FH5A 5CX7A 1IEMA 2W0NA 4HH3A 4QHCA 1AWIA 2V9AA 4BD1A 4MBFA 3QNCA 2V0UA 1P0ZA 1ZG6A 2VA0A 3JVVA 4CLCE 2Y2LA 3GVBA 3LY3A 4JGQA 4KZAA 3UE0A 2PT7A 2VV7A 3MZEA 3IXBA 1ES2A 3CAXA 2EFUA 1EW0A 2ZL1A 4KUKA 5DJUA 5DVAA 5EPHA 3BFGA 1MWRA 3IX8A 4L9FA 4EERA 1PIOA 1BLSA 3EGDC 4PM5A 5EVIA 3WRTA 1XA7A 3EGXC 2JHEA 2W1RA 1TEMA 4WL9A 1NRFA 2PHYA 4D60A 3PBNA 3JPUA 2JKTM 4Y0OA 1WYBA 5FI6A 1K38A 2VGLM 2BLSA 3MFDA 4UAAA 4R0QA 5CTMA 1G6AA 5IHVA 4KENB 4WMCD 4MN5A 2J8YA 4KZ4A 2I72A 1YKDA 2VV6A 3D72A 5TBMA 2QYBA 3IBJA 3MQ0A 3DAVA 4PM7A 1K4FA 1CEGA 2Y2NA 4UA9A 3E4QA 4OP8A 1SKFA 2Y2QA 5EM1A 3VOLA 3KSIA 3VE3A 2H5SA 1SHVA 1XX2A 3E4OA 4ETXA 2PBYA 4HEFA 3SH9A 1LSXA 3S4XA 3FYZA 3K3DA 4OPRA 4DE0A 2V1BA 1L0GA 3IS2A 2ZQ7A 1MZUA 2M1CA 4NEED 1GCEA 1WA9A 4P87A 2Z6CA 4WZ5A 3SOIA 3OOVA 4Y7PA 4P0MA 3FG8A 4DE2A 1JWVA 4Y15A 4JGOA 1ES5A 5EECA 2HJEA 1H3QA 3BFFA 4LV0A 4S2IA 4N1XA 4MNRA 5AQ7A 4OQIA 3LCEA 3UDIA 4IJGA 3DW0A 2DMWA 2O9BA 1MKIA 2Z2MB 4H8RA 4B9OA 5FASA 1FQGA 2VLGA 3A0SA 3MZDA 2XK1A 5J3WA 1ONGA 5EE8A 4LCMA 4R3BA 1K25A 4JF6A 4NXFA 4B4XA 4R6LA 2NUTC 2GJ3A 2C6WB 3H82B 2Y2IA 1NJ4A 4WLAA 3GQZA 3NOUC 1RGZA 4UHUA 5FQMA 3ZDJA 1IKIA 3SS3A 3C2WA 3BEBA 3F1NB 1LL5A 1G28A 2ZM2A 3P7NA 3BQAA 4KZ7A 2WKRA 2H10A 4GD6A 3RTYA 1I2WA 4UQIM 4NXBA 4RYEA 2FFFB 2OLUA 1PI4A 4PKYG 1S0WA 1TS6A 5A90A 4DJ2A 2DRWA 5FQ9A 3LR0A 2OSUA 1O7EA 5M19A 2VV8A 4E3JA 4JGPA 3T1RA 2EX6A 2JCHA 4PMAA 2VK3A 3QP5A 1HVBA 1KE4A 1F98A 3HJKA 3PYPA 1YMXA 3LY4A 3Q1FA 3FWLA 1MWUA 4F94A 5KSCA 4FH4A 3LIDA 1BT5A 2W27A 1YAXA 1TS7A 3OPPA 2P08A 2PAVP 3O86A 3SZTA 3MFXA 2XD5A 4QJGA 4Q0JA 2PU2A 4JLFA 1DY6A 4WZ4A 4GD8A 5E2HA 2L1MA 4IBRA 2PU4A 3V67A 4QY6A 4UEYA 1W7FA 4JBFA 1YQSA 3IH9A 5F69A 4EETB 2JKGA 4N92A 2ZJ9A 1XP4A 3OPRA 2HGVA 5G4YA 5FAPA 2H0TA 3ZG5A 3DTIA 3GTCA 2BASA 4PAUA 5FAOA 2JKTI 2WKQA 3MKEA 3E2LA 4GDBA 1YLZA 4OLDA 1ZG4A 5GHYA 1NY0A 4B4ZA 2Z2LB 2W3FA 3LFVA 5DF7A 1LI0A 2JE5A 3I7JA 2ZOHA 1DJAA 2GX5A 4GOGA 4MBHA 5E43A 1D7EA 1GSVA 1GA0A 3LR4A 5HPIA 5HDDA 1JTDA 3W4PA 1CEFA 4KG5A 5J7EA 2L4RA 2EX9A 1IELA 4Y0UA 4ARZB 4GJ4A 5HD3A 4WMCA 4Y17A 3H7WB 4E3MA 5BOHA 2QPNA 3L7HA 4FOFA 3CITA 4BQMA 3EEHA 5HAIA 3H82A 3VP4A 4G3KA 1GSXA 3ZNYA 4P6ZM 3OCNA 3A3JA 3F1NA 3VOZA 1S66L 4I3JA 5DJTA 5AVEA 4JGRA 4LCLA 4RX3A 4DKIA 4LV2A 1YMSA 2WZXA 4GZBA 1E25A 3UPOA 3EQUA 3F1PB 3HUOA 2PBDP 4FSFA 1RP5A 2JN7A 2HPBA 1SKOA 2ZL1B 3FKWA 4F3LB 4WN5A 3GV9A 4KZ8A 3CUEC 4LPZA 1DJBA 4M4XA 3TE8A 2KLIA 1XJ3A 5A8BA 3PBTA 2VGJA 3WS4A 3N8SA 5DFXA 1XGIA 3ZGAB 3T4OA 4I5SA 2XLNA 3S7NA 1F9IA 3GDIA 2ZQDA 5A91A 3IF5A 1MBLA 1OJ5A 2HF6A 5KIZA 1SDEA 4WF0A 5FDSA 5FA7A 4Y5FA 2V8FA 2IWBA 4FCFA 2HDUA 2HDRA 5GL9A 3CPTB 4OVDA 3TRCA 3ZNTA 3LI9A 4B88A 1N9LA 4L9GA 4S2KA 3RH8B 1O07A 1IYPA 2B02A 4EWFA 1JWZA 4BL2A 2XH9A 4K0WA 5M18A 4I39A 4S2MA 1IOUA 2PD8A 3ISGA 1IFQA 2R78A 4GNUA 1MWTA 2V1AA 3G2YA 1KE0A 4HJ6A 3E0YA 3BLMA 2Y2JA 3BY9A 5FQKA 3UE6A 4DMZA 2R9WA 5AVFA 2W3EA 4R3JA 3NI9A 3NOPC 1JVJA 2WGIA 1BLCA 1PW8A 2RL3A 3PXPA 4FTXA 3LYXA 1YLTA 3VSKA 4OP5A 4GB7A 3QP2A 1MWSA 4JXVA 2E8JA 5HD5A 5DFYA 4E04A 5A92A 3H9WA 3HUNA 4RA7A 2MJ6A 2ZC4B 1XJ6A 1OMEA 2VGKA 3KSFA 1KVLA 3NECA 5TFQA 1JWPA 1TDLA 4RQ9A 3UB5P 1P9RA 1EROA 3PAEA 1Z6FA 2JKFA 2LB5A 3KSGA 3R7WB 4BENA 2QJ7A 4I3IA 4ARZA 4MN6A 5L8MA 3H7WA 1XPBA 4I3AA 3UDFA 4KQOA 3HBRA 2Y4AA 4EBNA 2PDRA 3LIEA 2WYXA 4OQGA 3O5YA 5CHMA 4PPRA 1G5UA 5CRFA 2FZ0A 2M7VA 5DF9A 4JXSA 3JYIA 4KZ5A 4Q0IA 3A3DA 1K6RA 4E3NA 1TDGA 2ZMAA 4EBPA 3C8CA 1BLHA 2A2LA 5M1AA 2WAEA 3T50A 1PWGA 3CG5A 1N9BA 3R4KA 4DRTA 4QD4A 2V20A 1HLUP 1NYYA 4EXOA 2W1TB 3F1PA 1BLPA 3BLSA 1V9YA 3VP2A 3PBSA 5J4EA 2HJ9C 1T1CA 1T1BA 1VHMA 1K4EA 3PBQA 4LGWA 5CEDA 4HH2A 2Y91A 4PHTA 1ZKJA 4F3LA 3KO6A 4O8GA 4EESA 3IH8A 3D4FA 3IX4A 5I5LA 1E4DA 1AXBA 2WKEA 1YLPA 3VFHA 4DDYA 4S2NC 3GMWA 1MY8A 4HIAA 4R70A 3UMEA 4KZ3A 4L9EA 3JVUA 2YKFA 1Q2PA 4Q8IA 3VP1A 3MXQA 4ZAMA 2R9XA 3CPTA 4RX2A 3O87A 4N1HA 3ZG7B 1CI8A 4IHQA 1KGEA 3VE4A 4HHDA 4BBUA 1FR6A 3B47A 3CI6A 3D9YA 4ME4A 4NKPA 1ERQA 2WADA 3UO9A 1PWCA 1UWPX 1XKZA 2KX6A 3WS5A 3N4IA 2O0YA 3IXHA 4IUKA 3C7UA 1ESIA 3Q07A 4AFIA 4BLMA 1W63Q 4X25A 1IYSA 4X56A 1ZTUA 3F1OB 4WM9A 3TSGA 3OZHA 1K54C 5HZHA 1NZUA 3G4PA 2IA2A 5FDHA 3SS5A 5K5BA 4OOYA 4G3VA 1LL8A 2VKSA 5AQ9A 1JNUA 2ZLYA 1YPRA 1MPLA 4D2OA 2ZQ9A 1K0KA 2B95A 2EX2A 1QMEA 3IHBA 3KSHA 3VV4A 2B5RA 1FOFA 2XROA 2W3DA 3BRMA 3AGDA 4EU0A 4QY5A 2K2NA 3R7WA 3BY8A 3Q81A 4H6JB 3EWKA 3T4KA 4EUVA 2IWDA 1XJ2A 4GLQA 4HJ4A 4LRZE 4S2JA 4HESA 1FSWA 3CUEA 1FCNA 3U4LP 1J3WA 1SDNA 1ONHA 2ZOIA 3KYZA 3T12B 2GNXA 2QZ6A 1LL9A 2ZC5B 2K7SA 3MZFA 2EXAA 1SKOB 2ZD8A 4KQRA 1SCWA 1UWNX 5FAQA 2WKHA 3LICA 4OKPA 5E2EA 3EEAA 4LRYC 4MN7A 2HDQA 3NDGA 2PD7A 3BQ8A 4L0LA 2W1TA 5EFWA 1N9OA 1PZOA 2VX8A 4Y3IA 1NYMA 3LIFA 3UB9A 3SH8A 1ERMA 5EVEA 1VETB 2Y2OA 4XT2B 5GHXA 4EQ1A 4E3LA 1LLBA 2V1ZA 5CGSA 2L0WA 1OT9A 4JF4A 4OQHA 3ITBA 5HX9A 4JKTA 4MDZA 3HLBA 4DJ3A 3UE3A 4GN2A 4O0PA 2Y79A 3VP0A 2OWJA 3BFCA 1FCOA 3RFBA 2XEPA 2J7VA 3WWXA 4OPZA 3NHQA 3DTEA 1IYOA 4O7DA 3M6BA 5DTTA 5EM0A 5HL1A 4U3TA 3ZCZA 3QP1A 2XA7S 2XSSA 4IVKA 3N8LA 1H8ZA 1OTDA 4X69A 1N9NA 3IWQA 3CHWP 3P09A 3DWZA 3NDEA 4MMNA 3LUQA 5G18A 5FQIA 2ZC7A 3IWIA 3G2ZA 3OPLA 2VGLS 2M7UA 2V2FF 4YFMA 1N4OA 1JTGA 1WE4A 2WK0A 2OOLA 1IYQA 4UA6A 3M2JA 5AJGA 2ZC3B 3F1OA 3G35A 3V3RA 3T4LA 3TOIA 5FL3A 2K31A 5CECA 3A3EA 1NLYA 1E3UD 1H5XA 3C5AA 4CPKA 3CZDA 3ZG8B 4ZJ2A 1YLYA 4X1MA 3B42A 4ID4A 1PRQA 4YWZA 3LEZA 2XDMA 4FUWA 2Y2PA 4OH0A 1IKGA 1G6OA 2PYPA 3O88A 2P04A 1DJCA 3UDXA 2H28A 2D02A 3EOIA 3AGFA 2OV5A 5DTKA 3E2KA 3C38A 1QMFA 1S4SA 4H6JA 3S7QA 2PRFA 4LENA 4DXBA 4OLGA 4FD8A 4GW9A 3IXDA 3N7WA 4K91A 3DTMA 5F68A 2KOIA 1BYWA 4WUJA 3PBOA 3OPHA 1H0MA 1A0KA 3T4TA 4S2NA 3E4PA 1H8YA 3DTKA 1GHMA 3FC7A 2JBFA 4WEJA 2KDKA 1PYYA 4X53A 1PNEA 3AGEA 4E3IA 3RXWA 3FKVA 4NXGA 2ZQCA 1XGJA 4LFUA 2OWHA 3EQVA 3IWOA 2XR0A 5CERA 5DKKA 1J9MA 4BWIA 1NXYA 4Y2FA 3WRZA
chains in the Genus database with same CATH topology
4DF6A 4OQIA 4Z9QA 3LCEA 4JXSA 3UDIA 3JYIA 5E2FA 4KZ5A 3DW0A 1CK3A 2EX8A 1MKIA 3A3DA 2ZQAA 5TGFA 1K6RA 4U0TA 4E3NA 1KVMA 1TDGA 2ZMAA 2C5WB 3Q7VB 4EBPA 2Z2MB 5KSHA 4H8RA 4PM6A 5EVIC 3W8KA 5FASA 1FQGA 3MZDA 1BLHA 2XK1A 5M1AA 4ZTKA 2WAEA 3HUMA 1ONGA 1PWGA 3ZG0A 5EE8A 3CG5A 4LCMA 4R3BA 1N9BA 1K25A 4DRTA 4QD4A 4JF6A 2V20A 1WYCA 5TR7A 3HREA 1NYYA 4B4XA 1ESUA 1K54A 2C6WB 2Y2IA 1NJ4A 1K55C 3IQAA 1BLPA 3GQZA 3BLSA 3Q7ZA 1RGZA 1L0DA 1RGYA 3PBSA 2Y2KA 4UHUA 5D3OA 3IHAA 4KZ6A 5FQMA 3ZDJA 5JYPA 3UN7A 1IKIA 3SS3A 1K56A 3BEBA 1LL5A 1K4EA 3PBQA 5CEDA 2ZM2A 3BFDA 4A5RA 2Y91A 1ZKJA 1W8YA 2P9VB 2P74A 4WBGA 3IXGA 4KZ7A 5EVLA 2H10A 4HBTA 3S22A 4GD6A 1VQQA 4WYYA 3IH8A 1I2WA 3D4FA 1TVFA 5F1FA 4BJPA 1E4DA 1AXBA 3LO7A 4MBKA 4X6TA 2WKEA 1YLPA 2XFSA 3MXSA 1PW1A 4RYEA 3VFHA 2J9PA 5FSRA 4C3QA 4DDYA 4S2NC 3WS2A 2FFFB 2OLUA 3GMWA 1MY8A 4BD0A 1HZOA 1PI4A 1S0WA 3PAGA 5A90A 2DRWA 5FQ9A 1FR1A 4KZ3A 1VM1A 4DE3A 2XQZA 2OSUA 4M3KA 1O7EA 5CEBA 1Q2PA 5EVID 5M19A 3BFEA 3VP1A 4E3JA 5F83A 4ZAMA 4Q8IA 2ZQ8A 3SS4A 2R9XA 5AQ7A 3OCLA 2EX6A 3VFFA 2JCHA 4PMAA 4JXGA 4WZ5C 4RX2A 3QNBA 1HVBA 5CXWA 1FCMA 1G68A 1KE4A 3O87A 4N1HA 3ZG7B 1CI8A 1KGEA 5L2FA 3V39A 1HTZA 4QU3A 4CJNA 3G31A 1PI5A 1FR6A 1YMXA 3G34A 3LY4A 4P6BA 4S2PA 3Q1FA 3FWLA 1MWUA 4F94A 1ES3A 5KSCA 1ERQA 4FH4A 2WADA 1BTLA 2XD1A 2Y2GA 3DWKA 3MXRA 1PWCA 3UO9A 1BT5A 1XKZA 1L0EA 2Q9NA 3N4IA 3WS5A 3IXHA 4KG2A 4EUZA 3UE1A 3C7UA 1ESIA 1S6RA 3Q07A 2Y2MA 3MBZA 3OPPA 4N9KA 4OOMA 3V50A 2HP6A 4BLMA 2WZZA 3O3VA 3UPPA 3BYDA 4NK3A 1BUEA 3O86A 1IYSA 2X71A 4X56A 2CC1A 4R23A 4WM9A 2XD5A 3TSGA 4QJGA 3HVFA 3OZHA 4QB8A 5HARA 1K54C 3NIAA 4MLLA 1GHIA 4FH2A 2PU2A 3GRJA 1DY6A 4JLFA 4WZ4A 3ZG9B 4E6XA 1NZUA 4GD8A 3G4PA 5GLDA 1C3BA 4R1GA 5FDHA 3UNWA 3SS5A 3RXXA 5E2HA 5AQBA 2BG1A 4IBRA 2PU4A 4C6YA 4QY6A 4BL3A 5E2GA 1W7FA 3VMAA 3N6IA 2WAFA 4JBFA 4OOYA 4ZDXA 1YQSA 5HFOA 5GHZA 3IH9A 1YLWA 5JYOA 3FZCA 5AQ9A 3BECA 2ZLYA 4GKUA 2WUQA 4EV4A 3C7VA 4OONA 1MPLA 5EOEA 3GR2A 5EVIB 3NY4A 4D2OA 4N9LA 3WS0A 4N92A 2ZJ9A 4ZJ3A 2ZQ9A 1XP4A 4WEKA 4IVIA 1LI9A 2EX2A 3V5MA 1QMEA 3IHBA 3OPRA 5EOOA 2J9OA 4E3OA 2Y59A 5FAPA 1K6SA 2H0TA 2B5RA 3ZG5A 3GTCA 1BZAA 1K57A 2EFXA 1FOFA 2XGNA 2IWCA 5FAOA 4K0XA 2GDNA 3BRMA 3G32A 3AGDA 3MKEA 4KQQA 3G30A 3M2KA 4QY5A 3Q81A 5EUAA 3ZVWA 3E2LA 3HLGA 4GDBA 3IF6A 2IWDA 4EBLA 4S2JA 1YLZA 1W5DA 4OLDA 1ZG4A 4HESA 1E3UA 1FSWA 5GHYA 1NY0A 4B4ZA 4XUZA 2Z2LB 1FCNA 5J8XA 3ZVTA 5DF7A 2WGWA 2G2UA 1LI0A 2JE5A 4PM8A 1SDNA 1ONHA 3I7JA 5GLBA 1DJAA 4JPMA 4ZBEA 4GOGA 1MXOA 4MBHA 5E43A 3A3FA 1GA0A 2XFTA 1K56D 3P98A 1JTDA 2QZ6A 3W4PA 1CEFA 1LL9A 4KG5A 2ZC5B 2EX9A 1IELA 2FFYA 2EXAA 3CJMA 3MZFA 4Y0UA 1FSYA 2ZD8A 5KZHA 4KQRA 1SCWA 4WMCA 5GLCA 3VP3A 4HBUA 2RCXA 1BULA 4E3MA 5FAQA 2XF3A 5BOHA 5DTSA 1M6KA 2WKHA 3BM6A 3Q7VA 4OKPA 2QPNA 5E2EA 3PBRA 5HAQA 1L0FA 1GHPA 3GSGA 3NC8A 5FQQA 4JF5A 2HDQA 4LV1A 3UPNA 5I94A 3NDGA 4ZJ1A 4BQMA 4DXCA 4L0LA 2DCFA 3NBLA 5HAIA 3VP4A 3HLEA 1PZOA 3FV7A 4S2LA 1NYMA 4NETA 5HAPA 3IT9A 1L2SA 3SH8A 1ERMA 5FI2A 3RJUA 3W4QA 3A3IA 4YINA 1YT4A 2Y2OA 3PTEA 3ZNYA 4OPYA 5GHXA 3OCNA 2ZC6B 1PWDA 3A3JA 5A93A 4KZ9A 3VOZA 4E3LA 1LLBA 2V1ZA 2P9VA 3HLDA 5CGSA 4LCLA 4RX3A 1BSGA 1W8QA 4JF4A 4DKIA 1I2SA 1ES4A 4LV2A 4OQHA 3ITBA 1XXMA 1YMSA 2WZXA 4U0XA 4WELA 4GZBA 1E25A 4JKTA 4LV3A 4XXRA 5HX9A 3UPOA 1KE3A 3HLWA 3HLBA 3EQUA 3HUOA 3UE3A 4GN2A 4FSFA 4XUXA 1ALQA 1K57C 3N8RA 3VP0A 1RP5A 3BFCA 3ZHHA 1FCOA 5FATA 4X68A 2XEPA 2QMIA 1Q2QA 2J7VA 4OQ0A 2HPBA 4C75A 4E3KA 3WWXA 4OPZA 3IF6C 2Y2HA 3C4OA 1IYOA 3FKWA 3M6BA 4O7DA 5DTTA 1M40A 2HDSA 3GV9A 4U3TA 4KZ8A 3ZCZA 5HL1A 1DJBA 1YM1A 3W4OA 4IVKA 2ZM0A 3N8LA 1H8ZA 2X01A 3C4PA 3V3SA 4X69A 3PBTA 2VGJA 3CMZA 3WS4A 3B3XA 3N8SA 3ZFZA 3IWQA 2HP5A 4S2OA 5FQJA 1XGIA 2UWXA 3SH7A 3ZGAB 1KDSA 3P09A 4UA7A 5CTNA 2E8IA 3DWZA 2XLNA 5DF8A 3NDEA 1XA1A 5G18A 1YLJA 1EWZA 5FQIA 2ZQDA 5A91A 2ZC7A 3VOYA 4DDSA 3IWIA 3IF5A 1MBLA 3G2ZA 3OPLA 1CI9A 1W79A 5CHUA 2EXBA 4OOLA 1LHYA 3VSLA 2WGVA 2V2FF 2HP9A 3MKFA 5GLAA 4GDNA 5HW3A 1SDEA 4KZBA 1IEMA 4R4SA 5AQAA 4YFMA 5F82A 5FA7A 1KDWA 1N4OA 1JTGA 3QHYA 2IWBA 1WE4A 4QHCA 2WK0A 5F1GA 5CGWA 2Y55A 3VP2A 4FCFA 1IYQA 2HDUA 2HDRA 4UA6A 4MBFA 5GL9A 4BD1A 4OVDA 1I5QA 1KGGA 3M2JA 3Q82A 3QNCA 3S1YA 3WS1A 4DE1A 3ZNTA 3M6HA 4B88A 2ZC3B 3HLFA 4S2KA 1O07A 1ZG6A 3G35A 4OPQA 5CGXA 2Y2LA 1IYPA 3GVBA 3V3RA 3TOIA 3LY3A 1PZPA 4EWFA 1JWZA 4KZAA 2XH9A 4BL2A 4K0WA 3UE0A 3MZEA 5M18A 4S2MA 2G2WA 3IXBA 5CECA 5KMWA 3A3EA 3ISGA 1ES2A 4PM9A 4GNUA 2EFUA 2DNSA 1E3UD 1H5XA 1HD8A 1MWTA 3C5AA 5DVAA 3G2YA 5U47A 4CPKA 5EPHA 3CZDA 1KE0A 1MWRA 3BFGA 3ZG8B 4ZJ2A 1YLYA 2JC7A 1PIOA 1BLSA 3OC2A 4RVAA 4ID4A 3BLMA 4PM5A 2Y2JA 4IEDA 1NZOA 4MEZA 5EVIA 3WRTA 1XA7A 3LEZA 2XDMA 5FQKA 1TEMA 1GA9A 2Y2PA 4OH0A 2R9WA 1NRFA 3HLCA 1IKGA 3O88A 3PBNA 1DJCA 3UDXA 4R3JA 3NI9A 1WYBA 4Y0OA 5FI6A 1JVJA 2WGIA 1K38A 1KGFA 1BLCA 1PW8A 4JXWA 3TG9A 1K55A 3AGFA 2BLSA 2RL3A 3MFDA 4UAAA 4R0QA 5CTMA 1G6AA 1YLTA 2OV5A 5IHVA 4KENB 3VSKA 4OP5A 4GB7A 4WMCD 2J8YA 3E2KA 4KZ4A 5DTKA 1MWSA 4JXVA 2I72A 1QMFA 5CHJA 4X55A 4LENA 4DXBA 5A92A 4P85A 4PM7A 1K4FA 2A3UA 4OLGA 3HUNA 4RA7A 4FD8A 1CEGA 2ZC4B 2Y2NA 4UA9A 3IXDA 3N7WA 4OP8A 1SKFA 2Y2QA 1OMEA 4K91A 3DTMA 2VGKA 1KVLA 5TFQA 1JWPA 1TDLA 1EROA 2H0YA 3PBOA 2H5SA 3ITAA 3OPHA 1SHVA 1XX2A 1ZC2A 2OLVA 2PBYA 3PAEA 1RCJA 4HEFA 1Z6FA 4S2NA 2WKIA 3SH9A 1H8YA 3S4XA 1Y54A 4BENA 4EQIA 4KG6A 3FYZA 4OPRA 4DE0A 1GHMA 2JBFA 1L0GA 3IF6B 4E6WA 4WEJA 4IBXA 1PYYA 2ZM8A 2ZQ7A 4X53A 3AGEA 1XPBA 4E3IA 1GCEA 3RXWA 4Y0TA 2Q9MA 2WGWB 5FI7A 3FKVA 4P87A 2ZQCA 4WZ5A 3SOIA 4Y7PA 1XGJA 4P0MA 2X02A 4KQOA 3EQVA 3IWOA 3HBRA 3UDFA 2Y4AA 2XR0A 4DE2A 1JWVA 5CERA 3NCKA 4EBNA 2WYXA 1ES5A 3UY6A 1J9MA 5EECA 1EI5A 4R4RA 4OQGA 1NXYA 5CHMA 4PPRA 3WRZA 2A49A 3BFFA 5CRFA 4LV0A 4S2IA 4N1XA 3HL9A 4MNRA 1U60A 5DF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF6 A;  4OQI A;  4Z9Q A;  3LCE A;  4JXS A;  3UDI A;  3JYI A;  5E2F A;  4KZ5 A;  3DW0 A;  1CK3 A;  2EX8 A;  1MKI A;  3A3D A;  2ZQA A;  5TGF A;  1K6R A;  4U0T A;  4E3N A;  1KVM A;  1TDG A;  2ZMA A;  2C5W B;  3Q7V B;  4EBP A;  2Z2M B;  5KSH A;  4H8R A;  4PM6 A;  5EVI C;  3W8K A;  5FAS A;  1FQG A;  3MZD A;  1BLH A;  2XK1 A;  5M1A A;  4ZTK A;  2WAE A;  3HUM A;  1ONG A;  1PWG A;  3ZG0 A;  5EE8 A;  3CG5 A;  4LCM A;  4R3B A;  1N9B A;  1K25 A;  4DRT A;  4QD4 A;  4JF6 A;  2V20 A;  1WYC A;  5TR7 A;  3HRE A;  1NYY A;  4B4X A;  1ESU A;  1K54 A;  2C6W B;  2Y2I A;  1NJ4 A;  1K55 C;  3IQA A;  1BLP A;  3GQZ A;  3BLS A;  3Q7Z A;  1RGZ A;  1L0D A;  1RGY A;  3PBS A;  2Y2K A;  4UHU A;  5D3O A;  3IHA A;  4KZ6 A;  5FQM A;  3ZDJ A;  5JYP A;  3UN7 A;  1IKI A;  3SS3 A;  1K56 A;  3BEB A;  1LL5 A;  1K4E A;  3PBQ A;  5CED A;  2ZM2 A;  3BFD A;  4A5R A;  2Y91 A;  1ZKJ A;  1W8Y A;  2P9V B;  2P74 A;  4WBG A;  3IXG A;  4KZ7 A;  5EVL A;  2H10 A;  4HBT A;  3S22 A;  4GD6 A;  1VQQ A;  4WYY A;  3IH8 A;  1I2W A;  3D4F A;  1TVF A;  5F1F A;  4BJP A;  1E4D A;  1AXB A;  3LO7 A;  4MBK A;  4X6T A;  2WKE A;  1YLP A;  2XFS A;  3MXS A;  1PW1 A;  4RYE A;  3VFH A;  2J9P A;  5FSR A;  4C3Q A;  4DDY A;  4S2N C;  3WS2 A;  2FFF B;  2OLU A;  3GMW A;  1MY8 A;  4BD0 A;  1HZO A;  1PI4 A;  1S0W A;  3PAG A;  5A90 A;  2DRW A;  5FQ9 A;  1FR1 A;  4KZ3 A;  1VM1 A;  4DE3 A;  2XQZ A;  2OSU A;  4M3K A;  1O7E A;  5CEB A;  1Q2P A;  5EVI D;  5M19 A;  3BFE A;  3VP1 A;  4E3J A;  5F83 A;  4ZAM A;  4Q8I A;  2ZQ8 A;  3SS4 A;  2R9X A;  5AQ7 A;  3OCL A;  2EX6 A;  3VFF A;  2JCH A;  4PMA A;  4JXG A;  4WZ5 C;  4RX2 A;  3QNB A;  1HVB A;  5CXW A;  1FCM A;  1G68 A;  1KE4 A;  3O87 A;  4N1H A;  3ZG7 B;  1CI8 A;  1KGE A;  5L2F A;  3V39 A;  1HTZ A;  4QU3 A;  4CJN A;  3G31 A;  1PI5 A;  1FR6 A;  1YMX A;  3G34 A;  3LY4 A;  4P6B A;  4S2P A;  3Q1F A;  3FWL A;  1MWU A;  4F94 A;  1ES3 A;  5KSC A;  1ERQ A;  4FH4 A;  2WAD A;  1BTL A;  2XD1 A;  2Y2G A;  3DWK A;  3MXR A;  1PWC A;  3UO9 A;  1BT5 A;  1XKZ A;  1L0E A;  2Q9N A;  3N4I A;  3WS5 A;  3IXH A;  4KG2 A;  4EUZ A;  3UE1 A;  3C7U A;  1ESI A;  1S6R A;  3Q07 A;  2Y2M A;  3MBZ A;  3OPP A;  4N9K A;  4OOM A;  3V50 A;  2HP6 A;  4BLM A;  2WZZ A;  3O3V A;  3UPP A;  3BYD A;  4NK3 A;  1BUE A;  3O86 A;  1IYS A;  2X71 A;  4X56 A;  2CC1 A;  4R23 A;  4WM9 A;  2XD5 A;  3TSG A;  4QJG A;  3HVF A;  3OZH A;  4QB8 A;  5HAR A;  1K54 C;  3NIA A;  4MLL A;  1GHI A;  4FH2 A;  2PU2 A;  3GRJ A;  1DY6 A;  4JLF A;  4WZ4 A;  3ZG9 B;  4E6X A;  1NZU A;  4GD8 A;  3G4P A;  5GLD A;  1C3B A;  4R1G A;  5FDH A;  3UNW A;  3SS5 A;  3RXX A;  5E2H A;  5AQB A;  2BG1 A;  4IBR A;  2PU4 A;  4C6Y A;  4QY6 A;  4BL3 A;  5E2G A;  1W7F A;  3VMA A;  3N6I A;  2WAF A;  4JBF A;  4OOY A;  4ZDX A;  1YQS A;  5HFO A;  5GHZ A;  3IH9 A;  1YLW A;  5JYO A;  3FZC A;  5AQ9 A;  3BEC A;  2ZLY A;  4GKU A;  2WUQ A;  4EV4 A;  3C7V A;  4OON A;  1MPL A;  5EOE A;  3GR2 A;  5EVI B;  3NY4 A;  4D2O A;  4N9L A;  3WS0 A;  4N92 A;  2ZJ9 A;  4ZJ3 A;  2ZQ9 A;  1XP4 A;  4WEK A;  4IVI A;  1LI9 A;  2EX2 A;  3V5M A;  1QME A;  3IHB A;  3OPR A;  5EOO A;  2J9O A;  4E3O A;  2Y59 A;  5FAP A;  1K6S A;  2H0T A;  2B5R A;  3ZG5 A;  3GTC A;  1BZA A;  1K57 A;  2EFX A;  1FOF A;  2XGN A;  2IWC A;  5FAO A;  4K0X A;  2GDN A;  3BRM A;  3G32 A;  3AGD A;  3MKE A;  4KQQ A;  3G30 A;  3M2K A;  4QY5 A;  3Q81 A;  5EUA A;  3ZVW A;  3E2L A;  3HLG A;  4GDB A;  3IF6 A;  2IWD A;  4EBL A;  4S2J A;  1YLZ A;  1W5D A;  4OLD A;  1ZG4 A;  4HES A;  1E3U A;  1FSW A;  5GHY A;  1NY0 A;  4B4Z A;  4XUZ A;  2Z2L B;  1FCN A;  5J8X A;  3ZVT A;  5DF7 A;  2WGW A;  2G2U A;  1LI0 A;  2JE5 A;  4PM8 A;  1SDN A;  1ONH A;  3I7J A;  5GLB A;  1DJA A;  4JPM A;  4ZBE A;  4GOG A;  1MXO A;  4MBH A;  5E43 A;  3A3F A;  1GA0 A;  2XFT A;  1K56 D;  3P98 A;  1JTD A;  2QZ6 A;  3W4P A;  1CEF A;  1LL9 A;  4KG5 A;  2ZC5 B;  2EX9 A;  1IEL A;  2FFY A;  2EXA A;  3CJM A;  3MZF A;  4Y0U A;  1FSY A;  2ZD8 A;  5KZH A;  4KQR A;  1SCW A;  4WMC A;  5GLC A;  3VP3 A;  4HBU A;  2RCX A;  1BUL A;  4E3M A;  5FAQ A;  2XF3 A;  5BOH A;  5DTS A;  1M6K A;  2WKH A;  3BM6 A;  3Q7V A;  4OKP A;  2QPN A;  5E2E A;  3PBR A;  5HAQ A;  1L0F A;  1GHP A;  3GSG A;  3NC8 A;  5FQQ A;  4JF5 A;  2HDQ A;  4LV1 A;  3UPN A;  5I94 A;  3NDG A;  4ZJ1 A;  4BQM A;  4DXC A;  4L0L A;  2DCF A;  3NBL A;  5HAI A;  3VP4 A;  3HLE A;  1PZO A;  3FV7 A;  4S2L A;  1NYM A;  4NET A;  5HAP A;  3IT9 A;  1L2S A;  3SH8 A;  1ERM A;  5FI2 A;  3RJU A;  3W4Q A;  3A3I A;  4YIN A;  1YT4 A;  2Y2O A;  3PTE A;  3ZNY A;  4OPY A;  5GHX A;  3OCN A;  2ZC6 B;  1PWD A;  3A3J A;  5A93 A;  4KZ9 A;  3VOZ A;  4E3L A;  1LLB A;  2V1Z A;  2P9V A;  3HLD A;  5CGS A;  4LCL A;  4RX3 A;  1BSG A;  1W8Q A;  4JF4 A;  4DKI A;  1I2S A;  1ES4 A;  4LV2 A;  4OQH A;  3ITB A;  1XXM A;  1YMS A;  2WZX A;  4U0X A;  4WEL A;  4GZB A;  1E25 A;  4JKT A;  4LV3 A;  4XXR A;  5HX9 A;  3UPO A;  1KE3 A;  3HLW A;  3HLB A;  3EQU A;  3HUO A;  3UE3 A;  4GN2 A;  4FSF A;  4XUX A;  1ALQ A;  1K57 C;  3N8R A;  3VP0 A;  1RP5 A;  3BFC A;  3ZHH A;  1FCO A;  5FAT A;  4X68 A;  2XEP A;  2QMI A;  1Q2Q A;  2J7V A;  4OQ0 A;  2HPB A;  4C75 A;  4E3K A;  3WWX A;  4OPZ A;  3IF6 C;  2Y2H A;  3C4O A;  1IYO A;  3FKW A;  3M6B A;  4O7D A;  5DTT A;  1M40 A;  2HDS A;  3GV9 A;  4U3T A;  4KZ8 A;  3ZCZ A;  5HL1 A;  1DJB A;  1YM1 A;  3W4O A;  4IVK A;  2ZM0 A;  3N8L A;  1H8Z A;  2X01 A;  3C4P A;  3V3S A;  4X69 A;  3PBT A;  2VGJ A;  3CMZ A;  3WS4 A;  3B3X A;  3N8S A;  3ZFZ A;  3IWQ A;  2HP5 A;  4S2O A;  5FQJ A;  1XGI A;  2UWX A;  3SH7 A;  3ZGA B;  1KDS A;  3P09 A;  4UA7 A;  5CTN A;  2E8I A;  3DWZ A;  2XLN A;  5DF8 A;  3NDE A;  1XA1 A;  5G18 A;  1YLJ A;  1EWZ A;  5FQI A;  2ZQD A;  5A91 A;  2ZC7 A;  3VOY A;  4DDS A;  3IWI A;  3IF5 A;  1MBL A;  3G2Z A;  3OPL A;  1CI9 A;  1W79 A;  5CHU A;  2EXB A;  4OOL A;  1LHY A;  3VSL A;  2WGV A;  2V2F F;  2HP9 A;  3MKF A;  5GLA A;  4GDN A;  5HW3 A;  1SDE A;  4KZB A;  1IEM A;  4R4S A;  5AQA A;  4YFM A;  5F82 A;  5FA7 A;  1KDW A;  1N4O A;  1JTG A;  3QHY A;  2IWB A;  1WE4 A;  4QHC A;  2WK0 A;  5F1G A;  5CGW A;  2Y55 A;  3VP2 A;  4FCF A;  1IYQ A;  2HDU A;  2HDR A;  4UA6 A;  4MBF A;  5GL9 A;  4BD1 A;  4OVD A;  1I5Q A;  1KGG A;  3M2J A;  3Q82 A;  3QNC A;  3S1Y A;  3WS1 A;  4DE1 A;  3ZNT A;  3M6H A;  4B88 A;  2ZC3 B;  3HLF A;  4S2K A;  1O07 A;  1ZG6 A;  3G35 A;  4OPQ A;  5CGX A;  2Y2L A;  1IYP A;  3GVB A;  3V3R A;  3TOI A;  3LY3 A;  1PZP A;  4EWF A;  1JWZ A;  4KZA A;  2XH9 A;  4BL2 A;  4K0W A;  3UE0 A;  3MZE A;  5M18 A;  4S2M A;  2G2W A;  3IXB A;  5CEC A;  5KMW A;  3A3E A;  3ISG A;  1ES2 A;  4PM9 A;  4GNU A;  2EFU A;  2DNS A;  1E3U D;  1H5X A;  1HD8 A;  1MWT A;  3C5A A;  5DVA A;  3G2Y A;  5U47 A;  4CPK A;  5EPH A;  3CZD A;  1KE0 A;  1MWR A;  3BFG A;  3ZG8 B;  4ZJ2 A;  1YLY A;  2JC7 A;  1PIO A;  1BLS A;  3OC2 A;  4RVA A;  4ID4 A;  3BLM A;  4PM5 A;  2Y2J A;  4IED A;  1NZO A;  4MEZ A;  5EVI A;  3WRT A;  1XA7 A;  3LEZ A;  2XDM A;  5FQK A;  1TEM A;  1GA9 A;  2Y2P A;  4OH0 A;  2R9W A;  1NRF A;  3HLC A;  1IKG A;  3O88 A;  3PBN A;  1DJC A;  3UDX A;  4R3J A;  3NI9 A;  1WYB A;  4Y0O A;  5FI6 A;  1JVJ A;  2WGI A;  1K38 A;  1KGF A;  1BLC A;  1PW8 A;  4JXW A;  3TG9 A;  1K55 A;  3AGF A;  2BLS A;  2RL3 A;  3MFD A;  4UAA A;  4R0Q A;  5CTM A;  1G6A A;  1YLT A;  2OV5 A;  5IHV A;  4KEN B;  3VSK A;  4OP5 A;  4GB7 A;  4WMC D;  2J8Y A;  3E2K A;  4KZ4 A;  5DTK A;  1MWS A;  4JXV A;  2I72 A;  1QMF A;  5CHJ A;  4X55 A;  4LEN A;  4DXB A;  5A92 A;  4P85 A;  4PM7 A;  1K4F A;  2A3U A;  4OLG A;  3HUN A;  4RA7 A;  4FD8 A;  1CEG A;  2ZC4 B;  2Y2N A;  4UA9 A;  3IXD A;  3N7W A;  4OP8 A;  1SKF A;  2Y2Q A;  1OME A;  4K91 A;  3DTM A;  2VGK A;  1KVL A;  5TFQ A;  1JWP A;  1TDL A;  1ERO A;  2H0Y A;  3PBO A;  2H5S A;  3ITA A;  3OPH A;  1SHV A;  1XX2 A;  1ZC2 A;  2OLV A;  2PBY A;  3PAE A;  1RCJ A;  4HEF A;  1Z6F A;  4S2N A;  2WKI A;  3SH9 A;  1H8Y A;  3S4X A;  1Y54 A;  4BEN A;  4EQI A;  4KG6 A;  3FYZ A;  4OPR A;  4DE0 A;  1GHM A;  2JBF A;  1L0G A;  3IF6 B;  4E6W A;  4WEJ A;  4IBX A;  1PYY A;  2ZM8 A;  2ZQ7 A;  4X53 A;  3AGE A;  1XPB A;  4E3I A;  1GCE A;  3RXW A;  4Y0T A;  2Q9M A;  2WGW B;  5FI7 A;  3FKV A;  4P87 A;  2ZQC A;  4WZ5 A;  3SOI A;  4Y7P A;  1XGJ A;  4P0M A;  2X02 A;  4KQO A;  3EQV A;  3IWO A;  3HBR A;  3UDF A;  2Y4A A;  2XR0 A;  4DE2 A;  1JWV A;  5CER A;  3NCK A;  4EBN A;  2WYX A;  1ES5 A;  3UY6 A;  1J9M A;  5EEC A;  1EI5 A;  4R4R A;  4OQG A;  1NXY A;  5CHM A;  4PPR A;  3WRZ A;  2A49 A;  3BFF A;  5CRF A;  4LV0 A;  4S2I A;  4N1X A;  3HL9 A;  4MNR A;  1U60 A;  5DF9 A; 
#chains in the Genus database with same CATH topology
 2PR6 A;  2NUP C;  2QKP A;  1VET A;  4XT2 A;  1CK3 A;  5TGF A;  4U0T A;  2VZW A;  3Q7V B;  5G4Z A;  5KSH A;  2D01 A;  2INW A;  4CLC C;  3CWF A;  3ZG0 A;  5TR7 A;  2EWW A;  3HRE A;  1OTB A;  1ESU A;  1K54 A;  1K55 C;  3K2N A;  4EEP A;  5D3O A;  1L0D A;  2Y2K A;  3IHA A;  4KZ6 A;  5JYP A;  3UN7 A;  4HJ3 A;  3UMD A;  3LI8 A;  2P9V B;  2P74 A;  3MQO A;  3IXG A;  3T1Q B;  5EVL A;  2GZA A;  3P01 A;  4II7 A;  5F1F A;  4BJP A;  3KX0 X;  4MBK A;  4X6T A;  1F2K A;  3E98 A;  2XFS A;  3MXS A;  1X0O A;  1VB6 A;  5FSR A;  3WS2 A;  3NJA A;  4M3K A;  5CEB A;  5F83 A;  2ZQ8 A;  4CLC D;  3SS4 A;  3OCL A;  3VFF A;  3FPW A;  2OAP 1;  3QNB A;  1FCM A;  1G68 A;  5L2F A;  3V39 A;  4QU3 A;  1H8M A;  4P6B A;  4S2P A;  1BTL A;  3DWK A;  2EA9 A;  1L0E A;  2Q9N A;  1S6R A;  4OOM A;  2HP6 A;  3ULF A;  2WZZ A;  3O3V A;  3UPP A;  4NK3 A;  2A24 B;  3S7P A;  2QJ5 A;  4QB8 A;  5HAR A;  4X1L A;  3NIA A;  4MLL A;  1GHI A;  4FH2 A;  3GEC A;  3GRJ A;  5FEF A;  3ZG9 B;  5GLD A;  3UNW A;  1C3B A;  4R1G A;  3T1S A;  3LR5 A;  5AQB A;  4C6Y A;  4BL3 A;  5E2G A;  3VMA A;  5JYO A;  2B18 A;  3FZC A;  3KYQ A;  3BEC A;  4ESP A;  3C7V A;  4OON A;  5EOE A;  3GR2 A;  3UB8 A;  4N9L A;  4CLC B;  3WS0 A;  4EW7 A;  3ZYT A;  1NRJ A;  1OJG A;  4IVI A;  1LI9 A;  5EOO A;  2J9O A;  3OBF A;  4LLO B;  4E3O A;  3C30 A;  4YOF A;  3G30 A;  5IS1 A;  2JKR M;  5EUA A;  3ZVW A;  4HQA A;  3HLG A;  2V8C A;  4P6Z S;  4EBL A;  4PKY A;  1W5D A;  3B33 A;  1E3U A;  5L09 A;  4NG2 A;  4PM8 A;  5L07 A;  5GLB A;  4JPM A;  1MXO A;  3G6O A;  2XFT A;  1K56 D;  3P98 A;  4G3W A;  4Q0H A;  3MS6 A;  2FFY A;  3CJM A;  2XA7 M;  2VEA A;  1FSY A;  1OTE A;  4HBU A;  1BUL A;  4LRX C;  5DTS A;  2PR5 A;  3BM6 A;  3Q7V A;  3PBR A;  1FIL A;  5HAQ A;  1GHP A;  2P7J A;  3GSG A;  5FQQ A;  3OLO A;  1F5M A;  2V0W A;  3UPN A;  1P9W A;  4GCZ A;  3L9K A;  2G7U A;  2OAQ 1;  3A0V A;  4DN0 A;  3IX3 A;  4GS9 B;  3IT9 A;  1TD5 A;  1L2S A;  4Z1W A;  5FI2 A;  3RJU A;  1YT4 A;  4OPY A;  5A93 A;  2Y8H A;  5FEG A;  2P9V A;  1W8Q A;  2Q0O A;  1I2S A;  1XXM A;  4U0X A;  4WEL A;  4LV3 A;  2QHK A;  4XXR A;  1KE3 A;  3HLW A;  4XUX A;  1K57 C;  3T4J A;  5L10 A;  1XFQ A;  2LB9 A;  4BBT A;  5FAT A;  2QMI A;  4C75 A;  5HDC A;  3T4S A;  3NOT C;  3PHY A;  3IF6 C;  2Y2H A;  1M40 A;  1SZV A;  1YM1 A;  1S4R A;  1DP9 A;  2J80 A;  2X01 A;  1T1A A;  3ICY A;  3CLO A;  3C4P A;  3B3X A;  4S2O A;  3SH7 A;  1KDS A;  5CTN A;  4UA7 A;  5DF8 A;  1YLJ A;  3D3O A;  3VSL A;  3TW8 A;  1PFL A;  1W79 A;  2EXB A;  1LHY A;  1YSQ A;  2HP9 A;  5GLA A;  5HW3 A;  4KZB A;  5AQA A;  4R4S A;  4KQD A;  3QP4 A;  5F82 A;  1Z09 A;  1KDW A;  1V9Z A;  2ZBB A;  3QHY A;  5F1G A;  5CGW A;  2Y55 A;  1DP8 A;  1I5Q A;  1KGG A;  3Q82 A;  2W3H A;  3S1Y A;  3WS1 A;  4DE1 A;  3M6H A;  4IUH A;  2A24 A;  3HLF A;  3MQQ A;  4OPQ A;  5CGX A;  4NXE A;  3SW1 A;  1PZP A;  2G2W A;  5C5K A;  5KMW A;  1DP6 A;  3MR0 A;  4PM9 A;  2DNS A;  1HD8 A;  5U47 A;  1OTA A;  2JC7 A;  3LGO A;  5LBR A;  3OC2 A;  4RVA A;  1GSW A;  4IED A;  1NZO A;  1Y4O A;  4MEZ A;  1LSW A;  4CLC A;  4QPR A;  2CMN A;  1GA9 A;  3HLC A;  1KGF A;  4JXW A;  1S1Y A;  3TG9 A;  1D06 A;  1K55 A;  5EV0 A;  4BBV A;  4ZRR A;  5IU1 A;  3BWL A;  2BTF P;  5CHJ A;  3UB7 A;  4X55 A;  3MSH A;  2AVX A;  3LR3 A;  4P85 A;  2A3U A;  3LIA A;  4R38 A;  3K3C A;  5HWV A;  1XJ4 A;  2H0Y A;  3ITA A;  1YSP A;  1ZC2 A;  2OLV A;  1RCJ A;  3LEQ A;  2WKI A;  3FPV A;  1Y54 A;  3PR6 A;  4EQI A;  4KG6 A;  3IBR A;  3IF6 B;  4E6W A;  4IBX A;  2ZM8 A;  4YNR A;  2JKR I;  3HJI A;  4Y0T A;  2Q9M A;  2WGW B;  5FI7 A;  1UGU A;  3S7O A;  2PYR A;  1OT6 A;  2X02 A;  1MKM A;  4B93 A;  3NCK A;  1STZ A;  1ZHH B;  3UY6 A;  5F6A A;  1EI5 A;  4R4R A;  3T4Q A;  2A49 A;  4KUO A;  5HSQ A;  3HL9 A;  4HY8 A;  1U60 A;  4GS9 A;  4DF6 A;  4Z9Q A;  5E2F A;  2EX8 A;  4Y13 A;  2ZQA A;  4HP4 A;  1KVM A;  2C5W B;  4GHI B;  4PM6 A;  5EVI C;  3W8K A;  4ZTK A;  3HUM A;  3HCY A;  1WYC A;  1TS0 A;  5IT5 A;  4BMW A;  3TJZ C;  3IQA A;  3Q7Z A;  4MCW A;  1RGY A;  1VEU B;  1K56 A;  3BFD A;  4A5R A;  3KYE A;  1W8Y A;  4WBG A;  4HBT A;  5HWT A;  3S22 A;  1VQQ A;  1ACF A;  4WYY A;  1TVF A;  3LO7 A;  2QWS A;  1S67 L;  1XFN A;  1PW1 A;  2J9P A;  4C3Q A;  4BD0 A;  5TJJ A;  1HZO A;  1ODV A;  3PAG A;  1FR1 A;  1VM1 A;  4DE3 A;  2XQZ A;  5EVI D;  3BFE A;  5HL6 A;  2HZ5 A;  2O9A A;  4JXG A;  4WZ5 C;  5CXW A;  3DBA A;  2I9V A;  1NWZ A;  1HTZ A;  4CJN A;  3G31 A;  1PI5 A;  5DKL A;  3G34 A;  4CQH A;  1ES3 A;  4HP9 A;  2XD1 A;  2Y2G A;  3MXR A;  4KG2 A;  4EUZ A;  3UE1 A;  2Y2M A;  3MBZ A;  4N9K A;  3V50 A;  3UB6 A;  3BYD A;  1BUE A;  1OTI A;  1S1Z A;  2X71 A;  2WKP A;  1DRM A;  2CC1 A;  4R23 A;  3HVF A;  1LT0 A;  1T19 A;  1KOU A;  4E6X A;  5HDS A;  3BW6 A;  5HPF A;  3RXX A;  4I38 A;  2BG1 A;  4UQI S;  3N6I A;  2WAF A;  4ZDX A;  5HFO A;  5GHZ A;  1YLW A;  4GKU A;  2WUQ A;  4EV4 A;  5EVI B;  3NY4 A;  2J3T C;  4HNB A;  4QWO A;  4ZJ3 A;  3MJQ A;  4WEK A;  3V5M A;  2Y59 A;  1K6S A;  2EWV A;  1BZA A;  1K57 A;  2EFX A;  2XGN A;  2IWC A;  1P97 A;  4K0X A;  2GDN A;  3G32 A;  4KQQ A;  5HWW A;  3M2K A;  5TBM B;  2Z6D A;  4EEU A;  2W3G A;  3IF6 A;  2ZMF A;  1CF0 A;  4XUZ A;  5J8X A;  1LSV A;  3ZVT A;  2WGW A;  2G2U A;  3LIB A;  4ZBE A;  3A3F A;  1D1J A;  2J3W A;  5KZH A;  3IS2 B;  3QP8 A;  3VP3 A;  5GLC A;  2J3T D;  2RCX A;  4O01 A;  2XF3 A;  1M6K A;  4GHI A;  1L0F A;  3NC8 A;  4JF5 A;  3W2Z A;  4LV1 A;  4ETZ A;  5I94 A;  4ZJ1 A;  4DXC A;  1CQA A;  2DCF A;  2ACG A;  4R3A A;  3NBL A;  2YKH A;  3T1X A;  3HLE A;  3FV7 A;  4S2L A;  4NET A;  5HAP A;  4K08 A;  3W4Q A;  3A3I A;  4YIN A;  3PTE A;  1VEU A;  2ZC6 B;  2O99 A;  1PWD A;  1NLZ A;  4KZ9 A;  1OPX A;  3QP6 A;  3HLD A;  4HI4 A;  3MF0 A;  3ZQ5 A;  1BSG A;  1W63 M;  1ES4 A;  5MC7 A;  2XRN A;  2ZMV A;  1ALQ A;  3N8R A;  2VJW A;  3ZHH A;  4X68 A;  2UV0 E;  1Q2Q A;  4OQ0 A;  4E3K A;  1TS8 A;  3C4O A;  1MC0 A;  1Y28 A;  2HDS A;  2HV1 A;  1L3L A;  3W4O A;  4HOI A;  2ZM0 A;  3BJN A;  3V3S A;  5F5Y A;  1CJF A;  3CMZ A;  3ZFZ A;  2HP5 A;  5FQJ A;  2UWX A;  2E8I A;  1FIK A;  3U2A A;  3A0R A;  1XA1 A;  1EWZ A;  3MMH A;  4DDS A;  1T18 A;  3VOY A;  2O9C A;  1CI9 A;  5CHU A;  4OOL A;  1TF1 A;  2WGV A;  3MKF A;  3NUL A;  4GDN A;  2FH5 A;  5CX7 A;  1IEM A;  2W0N A;  4HH3 A;  4QHC A;  1AWI A;  2V9A A;  4BD1 A;  4MBF A;  3QNC A;  2V0U A;  1P0Z A;  1ZG6 A;  2VA0 A;  3JVV A;  4CLC E;  2Y2L A;  3GVB A;  3LY3 A;  4JGQ A;  4KZA A;  3UE0 A;  2PT7 A;  2VV7 A;  3MZE A;  3IXB A;  1ES2 A;  3CAX A;  2EFU A;  1EW0 A;  2ZL1 A;  4KUK A;  5DJU A;  5DVA A;  5EPH A;  3BFG A;  1MWR A;  3IX8 A;  4L9F A;  4EER A;  1PIO A;  1BLS A;  3EGD C;  4PM5 A;  5EVI A;  3WRT A;  1XA7 A;  3EGX C;  2JHE A;  2W1R A;  1TEM A;  4WL9 A;  1NRF A;  2PHY A;  4D60 A;  3PBN A;  3JPU A;  2JKT M;  4Y0O A;  1WYB A;  5FI6 A;  1K38 A;  2VGL M;  2BLS A;  3MFD A;  4UAA A;  4R0Q A;  5CTM A;  1G6A A;  5IHV A;  4KEN B;  4WMC D;  4MN5 A;  2J8Y A;  4KZ4 A;  2I72 A;  1YKD A;  2VV6 A;  3D72 A;  5TBM A;  2QYB A;  3IBJ A;  3MQ0 A;  3DAV A;  4PM7 A;  1K4F A;  1CEG A;  2Y2N A;  4UA9 A;  3E4Q A;  4OP8 A;  1SKF A;  2Y2Q A;  5EM1 A;  3VOL A;  3KSI A;  3VE3 A;  2H5S A;  1SHV A;  1XX2 A;  3E4O A;  4ETX A;  2PBY A;  4HEF A;  3SH9 A;  1LSX A;  3S4X A;  3FYZ A;  3K3D A;  4OPR A;  4DE0 A;  2V1B A;  1L0G A;  3IS2 A;  2ZQ7 A;  1MZU A;  2M1C A;  4NEE D;  1GCE A;  1WA9 A;  4P87 A;  2Z6C A;  4WZ5 A;  3SOI A;  3OOV A;  4Y7P A;  4P0M A;  3FG8 A;  4DE2 A;  1JWV A;  4Y15 A;  4JGO A;  1ES5 A;  5EEC A;  2HJE A;  1H3Q A;  3BFF A;  4LV0 A;  4S2I A;  4N1X A;  4MNR A;  5AQ7 A;  4OQI A;  3LCE A;  3UDI A;  4IJG A;  3DW0 A;  2DMW A;  2O9B A;  1MKI A;  2Z2M B;  4H8R A;  4B9O A;  5FAS A;  1FQG A;  2VLG A;  3A0S A;  3MZD A;  2XK1 A;  5J3W A;  1ONG A;  5EE8 A;  4LCM A;  4R3B A;  1K25 A;  4JF6 A;  4NXF A;  4B4X A;  4R6L A;  2NUT C;  2GJ3 A;  2C6W B;  3H82 B;  2Y2I A;  1NJ4 A;  4WLA A;  3GQZ A;  3NOU C;  1RGZ A;  4UHU A;  5FQM A;  3ZDJ A;  1IKI A;  3SS3 A;  3C2W A;  3BEB A;  3F1N B;  1LL5 A;  1G28 A;  2ZM2 A;  3P7N A;  3BQA A;  4KZ7 A;  2WKR A;  2H10 A;  4GD6 A;  3RTY A;  1I2W A;  4UQI M;  4NXB A;  4RYE A;  2FFF B;  2OLU A;  1PI4 A;  4PKY G;  1S0W A;  1TS6 A;  5A90 A;  4DJ2 A;  2DRW A;  5FQ9 A;  3LR0 A;  2OSU A;  1O7E A;  5M19 A;  2VV8 A;  4E3J A;  4JGP A;  3T1R A;  2EX6 A;  2JCH A;  4PMA A;  2VK3 A;  3QP5 A;  1HVB A;  1KE4 A;  1F98 A;  3HJK A;  3PYP A;  1YMX A;  3LY4 A;  3Q1F A;  3FWL A;  1MWU A;  4F94 A;  5KSC A;  4FH4 A;  3LID A;  1BT5 A;  2W27 A;  1YAX A;  1TS7 A;  3OPP A;  2P08 A;  2PAV P;  3O86 A;  3SZT A;  3MFX A;  2XD5 A;  4QJG A;  4Q0J A;  2PU2 A;  4JLF A;  1DY6 A;  4WZ4 A;  4GD8 A;  5E2H A;  2L1M A;  4IBR A;  2PU4 A;  3V67 A;  4QY6 A;  4UEY A;  1W7F A;  4JBF A;  1YQS A;  3IH9 A;  5F69 A;  4EET B;  2JKG A;  4N92 A;  2ZJ9 A;  1XP4 A;  3OPR A;  2HGV A;  5G4Y A;  5FAP A;  2H0T A;  3ZG5 A;  3DTI A;  3GTC A;  2BAS A;  4PAU A;  5FAO A;  2JKT I;  2WKQ A;  3MKE A;  3E2L A;  4GDB A;  1YLZ A;  4OLD A;  1ZG4 A;  5GHY A;  1NY0 A;  4B4Z A;  2Z2L B;  2W3F A;  3LFV A;  5DF7 A;  1LI0 A;  2JE5 A;  3I7J A;  2ZOH A;  1DJA A;  2GX5 A;  4GOG A;  4MBH A;  5E43 A;  1D7E A;  1GSV A;  1GA0 A;  3LR4 A;  5HPI A;  5HDD A;  1JTD A;  3W4P A;  1CEF A;  4KG5 A;  5J7E A;  2L4R A;  2EX9 A;  1IEL A;  4Y0U A;  4ARZ B;  4GJ4 A;  5HD3 A;  4WMC A;  4Y17 A;  3H7W B;  4E3M A;  5BOH A;  2QPN A;  3L7H A;  4FOF A;  3CIT A;  4BQM A;  3EEH A;  5HAI A;  3H82 A;  3VP4 A;  4G3K A;  1GSX A;  3ZNY A;  4P6Z M;  3OCN A;  3A3J A;  3F1N A;  3VOZ A;  1S66 L;  4I3J A;  5DJT A;  5AVE A;  4JGR A;  4LCL A;  4RX3 A;  4DKI A;  4LV2 A;  1YMS A;  2WZX A;  4GZB A;  1E25 A;  3UPO A;  3EQU A;  3F1P B;  3HUO A;  2PBD P;  4FSF A;  1RP5 A;  2JN7 A;  2HPB A;  1SKO A;  2ZL1 B;  3FKW A;  4F3L B;  4WN5 A;  3GV9 A;  4KZ8 A;  3CUE C;  4LPZ A;  1DJB A;  4M4X A;  3TE8 A;  2KLI A;  1XJ3 A;  5A8B A;  3PBT A;  2VGJ A;  3WS4 A;  3N8S A;  5DFX A;  1XGI A;  3ZGA B;  3T4O A;  4I5S A;  2XLN A;  3S7N A;  1F9I A;  3GDI A;  2ZQD A;  5A91 A;  3IF5 A;  1MBL A;  1OJ5 A;  2HF6 A;  5KIZ A;  1SDE A;  4WF0 A;  5FDS A;  5FA7 A;  4Y5F A;  2V8F A;  2IWB A;  4FCF A;  2HDU A;  2HDR A;  5GL9 A;  3CPT B;  4OVD A;  3TRC A;  3ZNT A;  3LI9 A;  4B88 A;  1N9L A;  4L9G A;  4S2K A;  3RH8 B;  1O07 A;  1IYP A;  2B02 A;  4EWF A;  1JWZ A;  4BL2 A;  2XH9 A;  4K0W A;  5M18 A;  4I39 A;  4S2M A;  1IOU A;  2PD8 A;  3ISG A;  1IFQ A;  2R78 A;  4GNU A;  1MWT A;  2V1A A;  3G2Y A;  1KE0 A;  4HJ6 A;  3E0Y A;  3BLM A;  2Y2J A;  3BY9 A;  5FQK A;  3UE6 A;  4DMZ A;  2R9W A;  5AVF A;  2W3E A;  4R3J A;  3NI9 A;  3NOP C;  1JVJ A;  2WGI A;  1BLC A;  1PW8 A;  2RL3 A;  3PXP A;  4FTX A;  3LYX A;  1YLT A;  3VSK A;  4OP5 A;  4GB7 A;  3QP2 A;  1MWS A;  4JXV A;  2E8J A;  5HD5 A;  5DFY A;  4E04 A;  5A92 A;  3H9W A;  3HUN A;  4RA7 A;  2MJ6 A;  2ZC4 B;  1XJ6 A;  1OME A;  2VGK A;  3KSF A;  1KVL A;  3NEC A;  5TFQ A;  1JWP A;  1TDL A;  4RQ9 A;  3UB5 P;  1P9R A;  1ERO A;  3PAE A;  1Z6F A;  2JKF A;  2LB5 A;  3KSG A;  3R7W B;  4BEN A;  2QJ7 A;  4I3I A;  4ARZ A;  4MN6 A;  5L8M A;  3H7W A;  1XPB A;  4I3A A;  3UDF A;  4KQO A;  3HBR A;  2Y4A A;  4EBN A;  2PDR A;  3LIE A;  2WYX A;  4OQG A;  3O5Y A;  5CHM A;  4PPR A;  1G5U A;  5CRF A;  2FZ0 A;  2M7V A;  5DF9 A;  4JXS A;  3JYI A;  4KZ5 A;  4Q0I A;  3A3D A;  1K6R A;  4E3N A;  1TDG A;  2ZMA A;  4EBP A;  3C8C A;  1BLH A;  2A2L A;  5M1A A;  2WAE A;  3T50 A;  1PWG A;  3CG5 A;  1N9B A;  3R4K A;  4DRT A;  4QD4 A;  2V20 A;  1HLU P;  1NYY A;  4EXO A;  2W1T B;  3F1P A;  1BLP A;  3BLS A;  1V9Y A;  3VP2 A;  3PBS A;  5J4E A;  2HJ9 C;  1T1C A;  1T1B A;  1VHM A;  1K4E A;  3PBQ A;  4LGW A;  5CED A;  4HH2 A;  2Y91 A;  4PHT A;  1ZKJ A;  4F3L A;  3KO6 A;  4O8G A;  4EES A;  3IH8 A;  3D4F A;  3IX4 A;  5I5L A;  1E4D A;  1AXB A;  2WKE A;  1YLP A;  3VFH A;  4DDY A;  4S2N C;  3GMW A;  1MY8 A;  4HIA A;  4R70 A;  3UME A;  4KZ3 A;  4L9E A;  3JVU A;  2YKF A;  1Q2P A;  4Q8I A;  3VP1 A;  3MXQ A;  4ZAM A;  2R9X A;  3CPT A;  4RX2 A;  3O87 A;  4N1H A;  3ZG7 B;  1CI8 A;  4IHQ A;  1KGE A;  3VE4 A;  4HHD A;  4BBU A;  1FR6 A;  3B47 A;  3CI6 A;  3D9Y A;  4ME4 A;  4NKP A;  1ERQ A;  2WAD A;  3UO9 A;  1PWC A;  1UWP X;  1XKZ A;  2KX6 A;  3WS5 A;  3N4I A;  2O0Y A;  3IXH A;  4IUK A;  3C7U A;  1ESI A;  3Q07 A;  4AFI A;  4BLM A;  1W63 Q;  4X25 A;  1IYS A;  4X56 A;  1ZTU A;  3F1O B;  4WM9 A;  3TSG A;  3OZH A;  1K54 C;  5HZH A;  1NZU A;  3G4P A;  2IA2 A;  5FDH A;  3SS5 A;  5K5B A;  4OOY A;  4G3V A;  1LL8 A;  2VKS A;  5AQ9 A;  1JNU A;  2ZLY A;  1YPR A;  1MPL A;  4D2O A;  2ZQ9 A;  1K0K A;  2B95 A;  2EX2 A;  1QME A;  3IHB A;  3KSH A;  3VV4 A;  2B5R A;  1FOF A;  2XRO A;  2W3D A;  3BRM A;  3AGD A;  4EU0 A;  4QY5 A;  2K2N A;  3R7W A;  3BY8 A;  3Q81 A;  4H6J B;  3EWK A;  3T4K A;  4EUV A;  2IWD A;  1XJ2 A;  4GLQ A;  4HJ4 A;  4LRZ E;  4S2J A;  4HES A;  1FSW A;  3CUE A;  1FCN A;  3U4L P;  1J3W A;  1SDN A;  1ONH A;  2ZOI A;  3KYZ A;  3T12 B;  2GNX A;  2QZ6 A;  1LL9 A;  2ZC5 B;  2K7S A;  3MZF A;  2EXA A;  1SKO B;  2ZD8 A;  4KQR A;  1SCW A;  1UWN X;  5FAQ A;  2WKH A;  3LIC A;  4OKP A;  5E2E A;  3EEA A;  4LRY C;  4MN7 A;  2HDQ A;  3NDG A;  2PD7 A;  3BQ8 A;  4L0L A;  2W1T A;  5EFW A;  1N9O A;  1PZO A;  2VX8 A;  4Y3I A;  1NYM A;  3LIF A;  3UB9 A;  3SH8 A;  1ERM A;  5EVE A;  1VET B;  2Y2O A;  4XT2 B;  5GHX A;  4EQ1 A;  4E3L A;  1LLB A;  2V1Z A;  5CGS A;  2L0W A;  1OT9 A;  4JF4 A;  4OQH A;  3ITB A;  5HX9 A;  4JKT A;  4MDZ A;  3HLB A;  4DJ3 A;  3UE3 A;  4GN2 A;  4O0P A;  2Y79 A;  3VP0 A;  2OWJ A;  3BFC A;  1FCO A;  3RFB A;  2XEP A;  2J7V A;  3WWX A;  4OPZ A;  3NHQ A;  3DTE A;  1IYO A;  4O7D A;  3M6B A;  5DTT A;  5EM0 A;  5HL1 A;  4U3T A;  3ZCZ A;  3QP1 A;  2XA7 S;  2XSS A;  4IVK A;  3N8L A;  1H8Z A;  1OTD A;  4X69 A;  1N9N A;  3IWQ A;  3CHW P;  3P09 A;  3DWZ A;  3NDE A;  4MMN A;  3LUQ A;  5G18 A;  5FQI A;  2ZC7 A;  3IWI A;  3G2Z A;  3OPL A;  2VGL S;  2M7U A;  2V2F F;  4YFM A;  1N4O A;  1JTG A;  1WE4 A;  2WK0 A;  2OOL A;  1IYQ A;  4UA6 A;  3M2J A;  5AJG A;  2ZC3 B;  3F1O A;  3G35 A;  3V3R A;  3T4L A;  3TOI A;  5FL3 A;  2K31 A;  5CEC A;  3A3E A;  1NLY A;  1E3U D;  1H5X A;  3C5A A;  4CPK A;  3CZD A;  3ZG8 B;  4ZJ2 A;  1YLY A;  4X1M A;  3B42 A;  4ID4 A;  1PRQ A;  4YWZ A;  3LEZ A;  2XDM A;  4FUW A;  2Y2P A;  4OH0 A;  1IKG A;  1G6O A;  2PYP A;  3O88 A;  2P04 A;  1DJC A;  3UDX A;  2H28 A;  2D02 A;  3EOI A;  3AGF A;  2OV5 A;  5DTK A;  3E2K A;  3C38 A;  1QMF A;  1S4S A;  4H6J A;  3S7Q A;  2PRF A;  4LEN A;  4DXB A;  4OLG A;  4FD8 A;  4GW9 A;  3IXD A;  3N7W A;  4K91 A;  3DTM A;  5F68 A;  2KOI A;  1BYW A;  4WUJ A;  3PBO A;  3OPH A;  1H0M A;  1A0K A;  3T4T A;  4S2N A;  3E4P A;  1H8Y A;  3DTK A;  1GHM A;  3FC7 A;  2JBF A;  4WEJ A;  2KDK A;  1PYY A;  4X53 A;  1PNE A;  3AGE A;  4E3I A;  3RXW A;  3FKV A;  4NXG A;  2ZQC A;  1XGJ A;  4LFU A;  2OWH A;  3EQV A;  3IWO A;  2XR0 A;  5CER A;  5DKK A;  1J9M A;  4BWI A;  1NXY A;  4Y2F A;  3WRZ A; 
#chains in the Genus database with same CATH homology
 4DF6 A;  4OQI A;  4Z9Q A;  3LCE A;  4JXS A;  3UDI A;  3JYI A;  5E2F A;  4KZ5 A;  3DW0 A;  1CK3 A;  2EX8 A;  1MKI A;  3A3D A;  2ZQA A;  5TGF A;  1K6R A;  4U0T A;  4E3N A;  1KVM A;  1TDG A;  2ZMA A;  2C5W B;  3Q7V B;  4EBP A;  2Z2M B;  5KSH A;  4H8R A;  4PM6 A;  5EVI C;  3W8K A;  5FAS A;  1FQG A;  3MZD A;  1BLH A;  2XK1 A;  5M1A A;  4ZTK A;  2WAE A;  3HUM A;  1ONG A;  1PWG A;  3ZG0 A;  5EE8 A;  3CG5 A;  4LCM A;  4R3B A;  1N9B A;  1K25 A;  4DRT A;  4QD4 A;  4JF6 A;  2V20 A;  1WYC A;  5TR7 A;  3HRE A;  1NYY A;  4B4X A;  1ESU A;  1K54 A;  2C6W B;  2Y2I A;  1NJ4 A;  1K55 C;  3IQA A;  1BLP A;  3GQZ A;  3BLS A;  3Q7Z A;  1RGZ A;  1L0D A;  1RGY A;  3PBS A;  2Y2K A;  4UHU A;  5D3O A;  3IHA A;  4KZ6 A;  5FQM A;  3ZDJ A;  5JYP A;  3UN7 A;  1IKI A;  3SS3 A;  1K56 A;  3BEB A;  1LL5 A;  1K4E A;  3PBQ A;  5CED A;  2ZM2 A;  3BFD A;  4A5R A;  2Y91 A;  1ZKJ A;  1W8Y A;  2P9V B;  2P74 A;  4WBG A;  3IXG A;  4KZ7 A;  5EVL A;  2H10 A;  4HBT A;  3S22 A;  4GD6 A;  1VQQ A;  4WYY A;  3IH8 A;  1I2W A;  3D4F A;  1TVF A;  5F1F A;  4BJP A;  1E4D A;  1AXB A;  3LO7 A;  4MBK A;  4X6T A;  2WKE A;  1YLP A;  2XFS A;  3MXS A;  1PW1 A;  4RYE A;  3VFH A;  2J9P A;  5FSR A;  4C3Q A;  4DDY A;  4S2N C;  3WS2 A;  2FFF B;  2OLU A;  3GMW A;  1MY8 A;  4BD0 A;  1HZO A;  1PI4 A;  1S0W A;  3PAG A;  5A90 A;  2DRW A;  5FQ9 A;  1FR1 A;  4KZ3 A;  1VM1 A;  4DE3 A;  2XQZ A;  2OSU A;  4M3K A;  1O7E A;  5CEB A;  1Q2P A;  5EVI D;  5M19 A;  3BFE A;  3VP1 A;  4E3J A;  5F83 A;  4ZAM A;  4Q8I A;  2ZQ8 A;  3SS4 A;  2R9X A;  5AQ7 A;  3OCL A;  2EX6 A;  3VFF A;  2JCH A;  4PMA A;  4JXG A;  4WZ5 C;  4RX2 A;  3QNB A;  1HVB A;  5CXW A;  1FCM A;  1G68 A;  1KE4 A;  3O87 A;  4N1H A;  3ZG7 B;  1CI8 A;  1KGE A;  5L2F A;  3V39 A;  1HTZ A;  4QU3 A;  4CJN A;  3G31 A;  1PI5 A;  1FR6 A;  1YMX A;  3G34 A;  3LY4 A;  4P6B A;  4S2P A;  3Q1F A;  3FWL A;  1MWU A;  4F94 A;  1ES3 A;  5KSC A;  1ERQ A;  4FH4 A;  2WAD A;  1BTL A;  2XD1 A;  2Y2G A;  3DWK A;  3MXR A;  1PWC A;  3UO9 A;  1BT5 A;  1XKZ A;  1L0E A;  2Q9N A;  3N4I A;  3WS5 A;  3IXH A;  4KG2 A;  4EUZ A;  3UE1 A;  3C7U A;  1ESI A;  1S6R A;  3Q07 A;  2Y2M A;  3MBZ A;  3OPP A;  4N9K A;  4OOM A;  3V50 A;  2HP6 A;  4BLM A;  2WZZ A;  3O3V A;  3UPP A;  3BYD A;  4NK3 A;  1BUE A;  3O86 A;  1IYS A;  2X71 A;  4X56 A;  2CC1 A;  4R23 A;  4WM9 A;  2XD5 A;  3TSG A;  4QJG A;  3HVF A;  3OZH A;  4QB8 A;  5HAR A;  1K54 C;  3NIA A;  4MLL A;  1GHI A;  4FH2 A;  2PU2 A;  3GRJ A;  1DY6 A;  4JLF A;  4WZ4 A;  3ZG9 B;  4E6X A;  1NZU A;  4GD8 A;  3G4P A;  5GLD A;  1C3B A;  4R1G A;  5FDH A;  3UNW A;  3SS5 A;  3RXX A;  5E2H A;  5AQB A;  2BG1 A;  4IBR A;  2PU4 A;  4C6Y A;  4QY6 A;  4BL3 A;  5E2G A;  1W7F A;  3VMA A;  3N6I A;  2WAF A;  4JBF A;  4OOY A;  4ZDX A;  1YQS A;  5HFO A;  5GHZ A;  3IH9 A;  1YLW A;  5JYO A;  3FZC A;  5AQ9 A;  3BEC A;  2ZLY A;  4GKU A;  2WUQ A;  4EV4 A;  3C7V A;  4OON A;  1MPL A;  5EOE A;  3GR2 A;  5EVI B;  3NY4 A;  4D2O A;  4N9L A;  3WS0 A;  4N92 A;  2ZJ9 A;  4ZJ3 A;  2ZQ9 A;  1XP4 A;  4WEK A;  4IVI A;  1LI9 A;  2EX2 A;  3V5M A;  1QME A;  3IHB A;  3OPR A;  5EOO A;  2J9O A;  4E3O A;  2Y59 A;  5FAP A;  1K6S A;  2H0T A;  2B5R A;  3ZG5 A;  3GTC A;  1BZA A;  1K57 A;  2EFX A;  1FOF A;  2XGN A;  2IWC A;  5FAO A;  4K0X A;  2GDN A;  3BRM A;  3G32 A;  3AGD A;  3MKE A;  4KQQ A;  3G30 A;  3M2K A;  4QY5 A;  3Q81 A;  5EUA A;  3ZVW A;  3E2L A;  3HLG A;  4GDB A;  3IF6 A;  2IWD A;  4EBL A;  4S2J A;  1YLZ A;  1W5D A;  4OLD A;  1ZG4 A;  4HES A;  1E3U A;  1FSW A;  5GHY A;  1NY0 A;  4B4Z A;  4XUZ A;  2Z2L B;  1FCN A;  5J8X A;  3ZVT A;  5DF7 A;  2WGW A;  2G2U A;  1LI0 A;  2JE5 A;  4PM8 A;  1SDN A;  1ONH A;  3I7J A;  5GLB A;  1DJA A;  4JPM A;  4ZBE A;  4GOG A;  1MXO A;  4MBH A;  5E43 A;  3A3F A;  1GA0 A;  2XFT A;  1K56 D;  3P98 A;  1JTD A;  2QZ6 A;  3W4P A;  1CEF A;  1LL9 A;  4KG5 A;  2ZC5 B;  2EX9 A;  1IEL A;  2FFY A;  2EXA A;  3CJM A;  3MZF A;  4Y0U A;  1FSY A;  2ZD8 A;  5KZH A;  4KQR A;  1SCW A;  4WMC A;  5GLC A;  3VP3 A;  4HBU A;  2RCX A;  1BUL A;  4E3M A;  5FAQ A;  2XF3 A;  5BOH A;  5DTS A;  1M6K A;  2WKH A;  3BM6 A;  3Q7V A;  4OKP A;  2QPN A;  5E2E A;  3PBR A;  5HAQ A;  1L0F A;  1GHP A;  3GSG A;  3NC8 A;  5FQQ A;  4JF5 A;  2HDQ A;  4LV1 A;  3UPN A;  5I94 A;  3NDG A;  4ZJ1 A;  4BQM A;  4DXC A;  4L0L A;  2DCF A;  3NBL A;  5HAI A;  3VP4 A;  3HLE A;  1PZO A;  3FV7 A;  4S2L A;  1NYM A;  4NET A;  5HAP A;  3IT9 A;  1L2S A;  3SH8 A;  1ERM A;  5FI2 A;  3RJU A;  3W4Q A;  3A3I A;  4YIN A;  1YT4 A;  2Y2O A;  3PTE A;  3ZNY A;  4OPY A;  5GHX A;  3OCN A;  2ZC6 B;  1PWD A;  3A3J A;  5A93 A;  4KZ9 A;  3VOZ A;  4E3L A;  1LLB A;  2V1Z A;  2P9V A;  3HLD A;  5CGS A;  4LCL A;  4RX3 A;  1BSG A;  1W8Q A;  4JF4 A;  4DKI A;  1I2S A;  1ES4 A;  4LV2 A;  4OQH A;  3ITB A;  1XXM A;  1YMS A;  2WZX A;  4U0X A;  4WEL A;  4GZB A;  1E25 A;  4JKT A;  4LV3 A;  4XXR A;  5HX9 A;  3UPO A;  1KE3 A;  3HLW A;  3HLB A;  3EQU A;  3HUO A;  3UE3 A;  4GN2 A;  4FSF A;  4XUX A;  1ALQ A;  1K57 C;  3N8R A;  3VP0 A;  1RP5 A;  3BFC A;  3ZHH A;  1FCO A;  5FAT A;  4X68 A;  2XEP A;  2QMI A;  1Q2Q A;  2J7V A;  4OQ0 A;  2HPB A;  4C75 A;  4E3K A;  3WWX A;  4OPZ A;  3IF6 C;  2Y2H A;  3C4O A;  1IYO A;  3FKW A;  3M6B A;  4O7D A;  5DTT A;  1M40 A;  2HDS A;  3GV9 A;  4U3T A;  4KZ8 A;  3ZCZ A;  5HL1 A;  1DJB A;  1YM1 A;  3W4O A;  4IVK A;  2ZM0 A;  3N8L A;  1H8Z A;  2X01 A;  3C4P A;  3V3S A;  4X69 A;  3PBT A;  2VGJ A;  3CMZ A;  3WS4 A;  3B3X A;  3N8S A;  3ZFZ A;  3IWQ A;  2HP5 A;  4S2O A;  5FQJ A;  1XGI A;  2UWX A;  3SH7 A;  3ZGA B;  1KDS A;  3P09 A;  4UA7 A;  5CTN A;  2E8I A;  3DWZ A;  2XLN A;  5DF8 A;  3NDE A;  1XA1 A;  5G18 A;  1YLJ A;  1EWZ A;  5FQI A;  2ZQD A;  5A91 A;  2ZC7 A;  3VOY A;  4DDS A;  3IWI A;  3IF5 A;  1MBL A;  3G2Z A;  3OPL A;  1CI9 A;  1W79 A;  5CHU A;  2EXB A;  4OOL A;  1LHY A;  3VSL A;  2WGV A;  2V2F F;  2HP9 A;  3MKF A;  5GLA A;  4GDN A;  5HW3 A;  1SDE A;  4KZB A;  1IEM A;  4R4S A;  5AQA A;  4YFM A;  5F82 A;  5FA7 A;  1KDW A;  1N4O A;  1JTG A;  3QHY A;  2IWB A;  1WE4 A;  4QHC A;  2WK0 A;  5F1G A;  5CGW A;  2Y55 A;  3VP2 A;  4FCF A;  1IYQ A;  2HDU A;  2HDR A;  4UA6 A;  4MBF A;  5GL9 A;  4BD1 A;  4OVD A;  1I5Q A;  1KGG A;  3M2J A;  3Q82 A;  3QNC A;  3S1Y A;  3WS1 A;  4DE1 A;  3ZNT A;  3M6H A;  4B88 A;  2ZC3 B;  3HLF A;  4S2K A;  1O07 A;  1ZG6 A;  3G35 A;  4OPQ A;  5CGX A;  2Y2L A;  1IYP A;  3GVB A;  3V3R A;  3TOI A;  3LY3 A;  1PZP A;  4EWF A;  1JWZ A;  4KZA A;  2XH9 A;  4BL2 A;  4K0W A;  3UE0 A;  3MZE A;  5M18 A;  4S2M A;  2G2W A;  3IXB A;  5CEC A;  5KMW A;  3A3E A;  3ISG A;  1ES2 A;  4PM9 A;  4GNU A;  2EFU A;  2DNS A;  1E3U D;  1H5X A;  1HD8 A;  1MWT A;  3C5A A;  5DVA A;  3G2Y A;  5U47 A;  4CPK A;  5EPH A;  3CZD A;  1KE0 A;  1MWR A;  3BFG A;  3ZG8 B;  4ZJ2 A;  1YLY A;  2JC7 A;  1PIO A;  1BLS A;  3OC2 A;  4RVA A;  4ID4 A;  3BLM A;  4PM5 A;  2Y2J A;  4IED A;  1NZO A;  4MEZ A;  5EVI A;  3WRT A;  1XA7 A;  3LEZ A;  2XDM A;  5FQK A;  1TEM A;  1GA9 A;  2Y2P A;  4OH0 A;  2R9W A;  1NRF A;  3HLC A;  1IKG A;  3O88 A;  3PBN A;  1DJC A;  3UDX A;  4R3J A;  3NI9 A;  1WYB A;  4Y0O A;  5FI6 A;  1JVJ A;  2WGI A;  1K38 A;  1KGF A;  1BLC A;  1PW8 A;  4JXW A;  3TG9 A;  1K55 A;  3AGF A;  2BLS A;  2RL3 A;  3MFD A;  4UAA A;  4R0Q A;  5CTM A;  1G6A A;  1YLT A;  2OV5 A;  5IHV A;  4KEN B;  3VSK A;  4OP5 A;  4GB7 A;  4WMC D;  2J8Y A;  3E2K A;  4KZ4 A;  5DTK A;  1MWS A;  4JXV A;  2I72 A;  1QMF A;  5CHJ A;  4X55 A;  4LEN A;  4DXB A;  5A92 A;  4P85 A;  4PM7 A;  1K4F A;  2A3U A;  4OLG A;  3HUN A;  4RA7 A;  4FD8 A;  1CEG A;  2ZC4 B;  2Y2N A;  4UA9 A;  3IXD A;  3N7W A;  4OP8 A;  1SKF A;  2Y2Q A;  1OME A;  4K91 A;  3DTM A;  2VGK A;  1KVL A;  5TFQ A;  1JWP A;  1TDL A;  1ERO A;  2H0Y A;  3PBO A;  2H5S A;  3ITA A;  3OPH A;  1SHV A;  1XX2 A;  1ZC2 A;  2OLV A;  2PBY A;  3PAE A;  1RCJ A;  4HEF A;  1Z6F A;  4S2N A;  2WKI A;  3SH9 A;  1H8Y A;  3S4X A;  1Y54 A;  4BEN A;  4EQI A;  4KG6 A;  3FYZ A;  4OPR A;  4DE0 A;  1GHM A;  2JBF A;  1L0G A;  3IF6 B;  4E6W A;  4WEJ A;  4IBX A;  1PYY A;  2ZM8 A;  2ZQ7 A;  4X53 A;  3AGE A;  1XPB A;  4E3I A;  1GCE A;  3RXW A;  4Y0T A;  2Q9M A;  2WGW B;  5FI7 A;  3FKV A;  4P87 A;  2ZQC A;  4WZ5 A;  3SOI A;  4Y7P A;  1XGJ A;  4P0M A;  2X02 A;  4KQO A;  3EQV A;  3IWO A;  3HBR A;  3UDF A;  2Y4A A;  2XR0 A;  4DE2 A;  1JWV A;  5CER A;  3NCK A;  4EBN A;  2WYX A;  1ES5 A;  3UY6 A;  1J9M A;  5EEC A;  1EI5 A;  4R4R A;  4OQG A;  1NXY A;  5CHM A;  4PPR A;  3WRZ A;  2A49 A;  3BFF A;  5CRF A;  4LV0 A;  4S2I A;  4N1X A;  3HL9 A;  4MNR A;  1U60 A;  5DF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...