3IXGA

X-ray crystal structure of the extended-spectrum ampc t70i mutant beta-lactamase with and without benzo(b)thiophene-2-boronic acid bound at 2.14 angstrom resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
358
structure length
317
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFIGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDELLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 317
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ixgA00
5DF8A 1NYMA 4IEDA 3M2KA 4P85A 2ZQDA 4WELA 3UDFA 1CI9A 4OKPA 3UDXA 2ZC4B 5EVID 3IXBA 3OCNA 5GLBA 4RA7A 2ZM0A 4X69A 1VM1A 1XPBA 5CTNA 3SH8A 2V2FF 5CXWA 1Q2PA 1PW1A 1BULA 1MWTA 3IF6A 4JXGA 3I7JA 2ZQAA 3PTEA 2P74A 3N8LA 5AQAA 1KE3A 2H5SA 4WEJA 3SOIA 4OPQA 4BJPA 3ZDJA 1SDNA 2A49A 3BRMA 1RGYA 4OQHA 4R23A 4Q8IA 5M18A 5FQJA 3AGFA 4ID4A 1DJAA 2R9XA 3BEBA 3LCEA 3SS4A 4DE2A 2EX9A 1W5DA 2XD1A 3BFGA 1AXBA 5HL1A 1MXOA 4DF6A 1E3UD 3MBZA 4GD6A 3P98A 2Y55A 5CGSA 2EX8A 4E6XA 4QJGA 3OPLA 1CK3A 4R0QA 3V3SA 5EOEA 4BENA 3C7UA 4EV4A 3C4OA 1S6RA 2QPNA 3HLEA 4M3KA 5GHYA 2IWBA 5HW3A 2ZLYA 2XDMA 4MBHA 1K6RA 4P0MA 1EWZA 3PBQA 2EXBA 1ONGA 4S2NA 5GLDA 2XF3A 3UE1A 1XKZA 3M2JA 3QHYA 2ZC3B 5M1AA 1ALQA 2ZQ7A 1ZG6A 1BTLA 5F1FA 4MBFA 4UA6A 1XA1A 1BT5A 4OONA 2XQZA 1PW8A 1K54C 3UO9A 4RVAA 3UPNA 1WYBA 2Y91A 1NXYA 4LV1A 2H10A 5HAIA 3BM6A 1WE4A 3MZEA 1SKFA 4ZJ3A 4KZAA 5JYPA 5EE8A 4B4XA 2Y2KA 4X55A 3ZG8B 3FZCA 2WADA 5A93A 3IH8A 3JYIA 2J9OA 1G6AA 3WS0A 4E6WA 4X6TA 2BLSA 4BL3A 4OPYA 2HDQA 1MPLA 1ZG4A 5EVLA 1E3UA 3GVBA 4C6YA 5HAQA 2CC1A 4P6BA 2WAEA 3MXSA 4Y7PA 1XA7A 1KGGA 3BLSA 1IEMA 2JC7A 1K56D 1MBLA 3N4IA 4K0XA 1SCWA 4HBTA 5IHVA 4ZTKA 2DNSA 1NZUA 4WZ5C 3P09A 4Y0OA 5FDHA 4IVIA 5DTTA 3N8SA 1LI9A 1N4OA 2XH9A 2Z2LB 1WYCA 2G2UA 3LY3A 2XK1A 4JF6A 4WMCD 3GQZA 4DDSA 4N1XA 1HZOA 1JVJA 4QB8A 5DTKA 5CERA 2WGWA 3BFFA 5E2FA 4OPZA 3IF6B 4OOLA 4QY6A 4PMAA 4FSFA 1FSYA 4N92A 5E2HA 5FQQA 1IYOA 3WS1A 3ZNYA 5FASA 4OP5A 4GKUA 2B5RA 1K57C 2ZQ9A 3NI9A 5FQIA 3IXDA 3V5MA 4OQ0A 4UA9A 5CGWA 5FSRA 5I94A 3G31A 1MWUA 3RXWA 4JXWA 3IWOA 4JXSA 3NC8A 4R1GA 4WYYA 4E3JA 4OH0A 4F94A 3VP3A 1LL9A 4OQGA 4QY5A 5EVIC 1K54A 1K6SA 1TDGA 3PAEA 1DY6A 4KQOA 4MLLA 2HP9A 2Y2IA 3PBRA 3IF5A 5E43A 4JXVA 5GLAA 3FV7A 1NY0A 3TOIA 1XX2A 3EQUA 1M40A 3PBTA 3IH9A 1ONHA 3NBLA 1XGJA 3E2LA 1GA9A 3HLGA 4KENB 5FQMA 3VMAA 3VP1A 1RCJA 1BLCA 4HBUA 1MKIA 3ZG5A 2FFYA 3CJMA 2Q9MA 2WGIA 1FSWA 5FAPA 2XFTA 4JPMA 1EI5A 2OLVA 3GV9A 3QNCA 4S2IA 1C3BA 1L0EA 2HPBA 1DJBA 1IYPA 3IT9A 4WZ5A 2WKIA 5BOHA 1L0DA 1YMSA 3VP2A 2DCFA 3VFHA 3S22A 1YLJA 2EXAA 2JE5A 4BL2A 1CI8A 2G2WA 2ZM2A 1K38A 3IWIA 2IWDA 2PU4A 2Y2GA 3GSGA 3ZG7B 1XXMA 1BSGA 5JYOA 5FA7A 3BYDA 2I72A 2Y2QA 2IWCA 4PM9A 2WK0A 1HD8A 4BD0A 2JCHA 1K57A 3O88A 1ES3A 2Y4AA 3UDIA 2WZZA 5TR7A 4E3KA 3W4QA 1TEMA 3LY4A 1W79A 2PBYA 5FQKA 1H8ZA 5AQBA 4WEKA 1ESIA 3G30A 4OLDA 1NZOA 2Y2MA 1H5XA 1RGZA 4IBRA 3VP0A 3UE0A 2WGWB 3IHBA 2WAFA 4JF4A 1L2SA 4RX2A 2HDRA 5EVIA 1IKGA 5CGXA 2X01A 1HTZA 4EBNA 3ZNTA 4H8RA 4X53A 3MKFA 4P87A 3ISGA 2HDUA 3MZDA 3PAGA 3C7VA 3BLMA 4FH2A 4PM7A 4X68A 5A92A 3Q81A 3Q7VA 2Y2JA 3B3XA 3UY6A 2EFXA 3A3EA 1S0WA 4XXRA 5GHXA 1U60A 4GNUA 1YMXA 3G4PA 3Q7ZA 4R3BA 3ZG0A 2C6WB 5E2EA 4N1HA 3W4PA 5TFQA 1GHMA 1LHYA 1RP5A 3Q07A 1BZAA 1LL5A 4Y0TA 2E8IA 5KZHA 5D3OA 3VOZA 4Z9QA 1MY8A 2VGKA 2UWXA 3SS5A 5M19A 3MFDA 4A5RA 1TVFA 4R4RA 1BLHA 3UN7A 5HAPA 1K4EA 3UPPA 4KZ5A 1FOFA 4E3LA 4ZDXA 5CRFA 4MEZA 2HP6A 2XD5A 4LCLA 5HARA 4GN2A 4ZJ1A 3VSLA 2EFUA 1W8YA 2PU2A 3PBNA 1ERQA 4GDBA 1GCEA 4DKIA 1JTGA 2HDSA 3GRJA 4DXCA 3V3RA 4XUXA 1Y54A 3A3FA 3HBRA 5CHMA 3IHAA 5HFOA 4E3MA 3IXGA 3UNWA 2ZQ8A 2ZQCA 1JWVA 1YM1A 2A3UA 3G35A 5EOOA 1YLPA 4PM6A 4QU3A 4N9LA 4OP8A 1YQSA 4DXBA 1VQQA 4QHCA 1JWZA 1TDLA 4NETA 5KSCA 5E2GA 3BFDA 3FKVA 3GTCA 3HLDA 3ITBA 4KG5A 3N7WA 4KZBA 4PM5A 3N6IA 3O3VA 4KZ8A 4CJNA 3HLFA 1PWCA 1IYSA 1QMEA 1YT4A 2Z2MB 5FI6A 1KGFA 3ZCZA 2HP5A 4KZ6A 3LO7A 3VSKA 1I2WA 2WUQA 4DE1A 4GZBA 1FCOA 4HEFA 4GDNA 4WM9A 1PI5A 3IWQA 2WGVA 4MNRA 2EX6A 2J8YA 1FCMA 5GLCA 3UE3A 1PZOA 2ZM8A 4YINA 1K56A 1NYYA 4FD8A 3ZGAB 3N8RA 1Z6FA 3NY4A 3BFEA 3PBOA 4L0LA 2Y2NA 4KG6A 3VFFA 3FWLA 5GL9A 5CHJA 1KVLA 3W4OA 1K4FA 4BLMA 1CEGA 2Q9NA 2WZXA 5EVIB 3CG5A 4WMCA 5CTMA 1KDWA 1YLTA 3HVFA 4LV0A 3AGDA 4EUZA 4RX3A 1NRFA 1K25A 3PBSA 1LLBA 4GD8A 4S2JA 3OPHA 4EBLA 2FFFB 3WRZA 2JBFA 3G32A 3Q7VB 2RL3A 4K0WA 4OOYA 2Y2PA 5AQ9A 5GHZA 5KSHA 4ZAMA 2EX2A 1EROA 1KVMA 4DDYA 1N9BA 3ZVTA 2Y59A 3HLCA 4D2OA 5KMWA 1CEFA 4KG2A 4DRTA 1HVBA 1PIOA 1Q2QA 2OSUA 3BFCA 5FQ9A 1YLYA 4S2PA 1W7FA 5HX9A 3VP4A 1K55C 3MZFA 4NK3A 4IBXA 1ERMA 1KDSA 3MXRA 3WS2A 1PZPA 5FAQA 4CPKA 4EWFA 2H0YA 3DW0A 4K91A 4DE0A 4X56A 4B4ZA 1ESUA 3GR2A 3RJUA 1E4DA 4PPRA 3V39A 4ZBEA 3BECA 4WZ4A 3WS4A 1PWDA 1PWGA 1FR6A 3CZDA 4KZ4A 3GMWA 3NIAA 2ZC6B 4JF5A 3TG9A 4E3IA 3HUNA 1W8QA 3IQAA 1SHVA 2ZJ9A 3A3DA 3HUOA 4EQIA 2ZC7A 4N9KA 4IVKA 1BUEA 3ZG9B 2X02A 2QZ6A 2P9VA 4JLFA 4DE3A 1MWSA 1JTDA 3WS5A 5DF7A 3LEZA 1IYQA 5U47A 2ZMAA 1PYYA 3W8KA 4KQQA 4KZ7A 2Y2LA 3M6HA 3O86A 2OLUA 2WKHA 1GHPA 1DJCA 3FYZA 1ZKJA 5DVAA 4RYEA 5F82A 4OOMA 4FCFA 1YLWA 1GHIA 2WYXA 4UAAA 1PI4A 4GOGA 5FI7A 5DTSA 1BLSA 4U0XA 1KGEA 3C5AA 3HL9A 3NDGA 1M6KA 5FAOA 3WWXA 4ZJ2A 4BD1A 5L2FA 3DWKA 4OVDA 3MKEA 4GB7A 1KE0A 2C5WB 4PM8A 1IELA 3NCKA 4JKTA 1O07A 3CMZA 1O7EA 2J7VA 4KZ3A 1YLZA 1K55A 2XFSA 4KQRA 3OC2A 1GA0A 3RXXA 4R4SA 1L0GA 1LI0A 4UHUA 3UPOA 3OPRA 2XR0A 3DWZA 4FH4A 4E3OA 4S2OA 2XGNA 5DF9A 1L0FA 5EPHA 1I2SA 1ES5A 3OPPA 2ZC5B 1G68A 4OLGA 5CEBA 4YFMA 1SDEA 2R9WA 3A3JA 3NDEA 5FI2A 3EQVA 4B88A 5F1GA 4U0TA 3V50A 3TSGA 1ES4A 3S4XA 3IF6C 2X71A 2V1ZA 5G18A 4EBPA 3HLWA 4LENA 3G2YA 3SS3A 2Y2OA 1KE4A 5CECA 1I5QA 3ZHHA 3O87A 3DTMA 3IXHA 4U3TA 4E3NA 3E2KA 3M6BA 3ITAA 1ZC2A 2ZD8A 4S2MA 4UA7A 5FATA 2XEPA 3OZHA 3HLBA 2DRWA 4C3QA 2QMIA 2Y2HA 4QD4A 3VOYA 3SH7A 1FQGA 2H0TA 3Q1FA 5EUAA 3WRTA 1FR1A 4MBKA 5EECA 2WKEA 3D4FA 4R3JA 4Y0UA 4BQMA 4LCMA 5AQ7A 4OQIA 3AGEA 4KZ9A 4LV3A 4XUZA 1QMFA 4HESA 5CHUA 4C75A 4S2LA 2P9VB 2J9PA 3G2ZA 5CEDA 3SH9A 4JBFA 1NJ4A 1JWPA 2VGJA 2GDNA 3G34A 1BLPA 3ZVWA 1IKIA 1FCNA 3HUMA 2V20A 2XLNA 4S2NC 1XGIA 4O7DA 3FKWA 5A91A 4S2KA 5TGFA 1MWRA 1OMEA 2BG1A 5F83A 3S1YA 3A3IA 5A90A 1H8YA 3C4PA 1XP4A 3OCLA 4LV2A 4WBGA 1ES2A 1E25A 5J8XA 1J9MA 3HREA 2OV5A 3Q82A 3QNBA 4OPRA 2RCXA 3ZFZA
chains in the Genus database with same CATH superfamily
4IEDA 2O9AA 4P85A 2ZQDA 3IXBA 3T4OA 1F5MA 3VOLA 1WA9A 4X69A 3MMHA 3SH8A 1PW1A 1BULA 1MWTA 3T1QB 3I7JA 1CF0A 5AQAA 1CJFA 3ICYA 2FH5A 3KSIA 1RGYA 2PHYA 3BEBA 3LIFA 3BFGA 3CITA 2EWWA 5CGSA 3V3SA 4EV4A 3C4OA 1S6RA 2QPNA 2IWBA 5HW3A 1J3WA 2ZLYA 1K6RA 3FG8A 2EXBA 4S2NA 5GLDA 1H3QA 2ZC3B 2V8CA 1ALQA 1BTLA 5AVEA 5AVFA 3U2AA 2XQZA 2YKHA 4RVAA 1NXYA 1T1CA 3MZEA 5L10A 4X55A 2P04A 2WADA 2VGLS 4GLQA 3ULFA 1OTAA 4C6YA 3MXSA 1XA7A 1KGGA 2PR6A 4ZTKA 1NZUA 2XROA 4Y0OA 5FDHA 4IVIA 3SW1A 3N8SA 3T4SA 1LI9A 1N4OA 2XK1A 4JF6A 4N1XA 1NLYA 1K0KA 1D06A 3MQQA 1JVJA 4WF0A 2K31A 4OPZA 1UWNX 4FSFA 5HD5A 5FQQA 5FASA 2ZQ9A 3NI9A 3V5MA 4OQ0A 3C2WA 3LR5A 4JXWA 4JXSA 3NC8A 4F94A 3VP3A 3L7HA 3E98A 5DKLA 1LL9A 3F1OB 4MLLA 3FPWA 3PBRA 3IF5A 5E43A 4JXVA 1XX2A 1M40A 1S4RA 3IH9A 4EQ1A 5FQMA 3LIAA 1RCJA 1TS8A 2FFYA 4GS9A 3CJMA 2Q9MA 1FSWA 5FAPA 3KYEA 1EI5A 2Y79A 3QP1A 4S2IA 1L0EA 1VEUA 2HPBA 1IYPA 4II7A 2WKIA 1YMSA 3MXQA 2ZM2A 1K38A 1XXMA 4Y3IA 2Y2QA 2IWCA 2W1RA 2WK0A 3NOUC 4ZRRA 2Y4AA 3UDIA 3T1RA 1W79A 5AQBA 1ESIA 1NZOA 3VP0A 1IOUA 2WGWB 1L2SA 4RX2A 3H82A 3ZNTA 2HDUA 4Q0HA 3BLMA 2Y2JA 3B3XA 4YWZA 1S0WA 4XXRA 1YMXA 2C6WB 5HWWA 4LPZA 1LHYA 1RP5A 4Y0TA 4MCWA 5KZHA 1MC0A 1LL8A 1SKOB 2UWXA 3RH8B 4A5RA 2JKRI 3T4JA 5HAPA 5IU1A 4B93A 5CRFA 4MEZA 2HP6A 5HARA 4ZJ1A 4L9EA 1NRJA 1W8YA 3MJQA 3H7WB 2J3TD 1Y54A 1S67L 3HBRA 5HFOA 5HSQA 3IXGA 5J7EA 2A3UA 1F2KA 1YLPA 5G4ZA 4QWOA 1W63Q 2ZL1A 5E2GA 3HLDA 3GTCA 4B9OA 3UB8A 4NXGA 4Y5FA 1KGFA 1X0OA 1I2WA 2WUQA 1FCOA 4Y13A 3IWQA 3FPVA 3ZQ5A 5GLCA 2Z6CA 3N8RA 3NY4A 2VV7A 2D02A 3DAVA 1OPXA 3CG5A 4EUZA 2O0YA 1NRFA 1LLBA 2EA9A 2JBFA 4K0WA 2RL3A 2Y2PA 5GHZA 1UGUA 2M7VA 3VE3A 3MS6A 4HNBA 2M1CA 1HVBA 2OSUA 3BFCA 4X25A 4S2PA 1OJ5A 4PHTA 4EUVA 4HOIA 4UQIM 1KOUA 4YOFA 3TJZC 4K91A 1ACFA 1P97A 3GR2A 5HDCA 2O99A 4PPRA 3BECA 3WS4A 1PWGA 3B42A 4DN0A 3HUNA 1W8QA 3IQAA 1SHVA 2ZJ9A 4EQIA 4N9KA 4IVKA 4R38A 5HL6A 2QZ6A 1STZA 3LI8A 3W8KA 4KUKA 4FOFA 3O86A 4JGRA 2R78A 2WKHA 3FYZA 5DVAA 1YLWA 2J3TC 5DTSA 4CLCB 3UMDA 2VX8A 3C5AA 3NDGA 3WWXA 4ZJ2A 3DWKA 3KYQA 2PYRA 3NCKA 3QP6A 1L3LA 3HJKA 3CMZA 5AJGA 4XT2B 4KZ3A 2XFSA 1GA0A 2VZWA 4Q0JA 2ZMFA 5IT5A 2B02A 1L0FA 5EPHA 1I2SA 1ES5A 2A24A 5F1GA 1ES4A 1D7EA 2V1ZA 4Y17A 3GECA 4EBPA 1OTBA 3G2YA 4R70A 1KE4A 5CECA 4PAUA 3TW8A 3O87A 1XJ4A 1ZC2A 2QJ5A 3HLBA 2QMIA 2Y2HA 3CPTA 4EERA 1F98A 2H0TA 3Q1FA 3WRTA 4DJ3A 5HWVA 3D4FA 4Y0UA 4BQMA 4XUZA 5CEDA 3SH9A 1NJ4A 1JWPA 1FCNA 2G7UA 3HUMA 4O7DA 5TGFA 5A8BA 1XP4A 3OCLA 4LV2A 4WBGA 1E25A 1NYMA 3UDFA 1MKMA 1N9OA 1T18A 5EVID 2LB9A 3OCNA 3NULA 4RA7A 1XPBA 1XJ3A 2M7UA 2P74A 4WEJA 3SOIA 3IX3A 4OPQA 2A49A 3RTYA 4R23A 2HJ9C 5M18A 3AGFA 3UE6A 3OBFA 2XD1A 1AXBA 3MBZA 4IUHA 3S7QA 3S7OA 2EX8A 3OPLA 4P6ZM 3HLEA 2W1TA 4MMNA 3SZTA 3PBQA 3LYXA 3UE1A 1XKZA 5M1AA 2ZQ7A 5F1FA 2AVXA 1P9WA 4UA6A 1XA1A 1BT5A 3CAXA 1ZTUA 4KZAA 5JYPA 4B4XA 2Y2KA 2BTFP 3JYIA 4OPYA 1E3UA 3G6OA 5HAQA 3E4OA 4GHIA 2WAEA 1IEMA 2W3DA 3N4IA 4K0XA 4JGPA 4F3LA 2V0UA 2VJWA 2XH9A 1OJGA 1WYCA 3LY3A 4WMCD 4QB8A 1YSQA 2O9BA 3U4LP 3IF6B 3L9KA 4OOLA 4NG2A 1FSYA 5E2HA 1IYOA 1K57C 5I94A 4LRYC 2V1BA 1MWUA 4EW7A 3IWOA 5EM1A 4R1GA 1ZHHB 4WYYA 5HPFA 3R7WB 3CHWP 2OAP1 5EVIC 1TDGA 3PAEA 3T1SA 2W3FA 2Y2IA 4EXOA 4BWIA 2J80A 3NBLA 4Q0IA 5EVEA 3VMAA 3VP1A 4HBUA 1VETA 3IBRA 4DMZA 3P01A 5BOHA 3UB6A 1L0DA 2JE5A 1CI8A 2G2WA 2EWVA 3IWIA 2UV0E 3ZG7B 4ME4A 1BSGA 5JYOA 4PM9A 2INWA 1K57A 2JKRM 4JGOA 4E3KA 2WKQA 3IS2A 4WEKA 3G30A 4OLDA 2Y2MA 2WAFA 3JVVA 5EVIA 5CGXA 4EBNA 4PM7A 5A92A 3Q7VA 1G6OA 3TRCA 3ZG0A 5E2EA 2V8FA 1LL5A 2GNXA 2E8IA 3VOZA 3NJAA 4Z9QA 1H0MA 3SS5A 1S1ZA 4HP9A 3LGOA 4GW9A 4R4RA 1BLHA 3UN7A 1K4EA 3UPPA 2VGLM 4E3LA 4ZDXA 1LSXA 4LCLA 4L9GA 3PBNA 1ERQA 2JKFA 4DKIA 1HLUP 3V3RA 1Z09A 4FTXA 1YSPA 1JWVA 2V1AA 4N9LA 4QHCA 3DTKA 1EW0A 5KSCA 1GSWA 4HJ3A 3ITBA 3N7WA 4H6JB 3HLFA 1PWCA 3KYZA 1QMEA 3UMEA 1YT4A 2B18A 3OLOA 1UWPX 4HP4A 2WGVA 4MNRA 4I3IA 1FCMA 3A0VA 3UE3A 1PZOA 2ZM8A 4YINA 1NYYA 4IHQA 3F1PA 3CWFA 4KG6A 3VFFA 4MN5A 1KVLA 4BLMA 4K08A 1FIKA 3BY8A 4I5SA 1Y28A 4WMCA 3HVFA 1YLTA 4LV0A 1VHMA 3PBSA 4GD8A 4S2JA 3WRZA 3A0SA 3G32A 5AQ9A 1T1BA 2OOLA 4LRXC 4DDYA 3ZVTA 3LUQA 3MR0A 4R6LA 1SZVA 4KG2A 1Q2QA 5FQ9A 1YLYA 3KSGA 1T1AA 2W27A 1K55C 2GX5A 4KQDA 3MZFA 4NK3A 1KDSA 4EWFA 4Z1WA 3RJUA 4WZ4A 1H8MA 3TG9A 4I38A 3HUOA 2ZC7A 4BBUA 3JVUA 3QP4A 2P9VA 2KDKA 5U47A 1PYYA 3F1NB 3MSHA 4KQQA 1G5UA 2CMNA 2Y2LA 3R4KA 1GHPA 3MQ0A 2ZMVA 1ZKJA 5TBMB 5F82A 4UAAA 1PI4A 4GOGA 1BLSA 2W3GA 4U0XA 3HL9A 4BD1A 5L2FA 4BBTA 4GB7A 4PM8A 4X1LA 1O07A 4WUJA 3S7PA 5EFWA 1K55A 3RXXA 3OC2A 1PFLA 1JNUA 4R4SA 1L0GA 1CQAA 3UPOA 4Y2FA 3DWZA 4FH4A 4S2OA 3DBAA 4DJ2A 5DF9A 3BQAA 1PNEA 3PXPA 2ZC5B 1G68A 2KX6A 5CEBA 4YFMA 1SDEA 2R9WA 5EM0A 4WL9A 4B88A 4U0TA 2X71A 1G28A 4ARZB 3SS3A 3DTMA 3IXHA 4U3TA 3M6BA 1DP8A 2D01A 4E04A 3VOYA 3SH7A 2P7JA 5EECA 3W2ZA 1T19A 5AQ7A 5HZHA 3AGEA 4KZ9A 4HESA 5CHUA 4C75A 4S2LA 3K2NA 3G2ZA 3E4QA 4JBFA 5TJJA 4PKYG 2XLNA 3D3OA 1OMEA 2BG1A 5F83A 3S1YA 3LIDA 3LI9A 3LIEA 2VV6A 5HDDA 1ES2A 1J9MA 2OV5A 3QNBA 5DF8A 3C30A 1CI9A 3UDXA 2ZC4B 2H28A 4R3AA 2ZM0A 5I5LA 1VM1A 5CTNA 2V2FF 5CXWA 1Q2PA 3LR0A 4BBVA 1VB6A 4JXGA 2ZQAA 3PTEA 4X1MA 1GSXA 3N8LA 4UQIS 4BJPA 3ZDJA 3BRMA 5F5YA 5FQJA 4ID4A 1DJAA 1NLZA 3LCEA 3SS4A 4DE2A 1W5DA 5HL1A 1E3UD 3F1OA 3P98A 4E6XA 4QJGA 4R0QA 5EOEA 4BENA 3C7UA 2NUTC 4NXEA 4M3KA 5GHYA 4P0MA 4GJ4A 5G4YA 1ONGA 3QHYA 1ZG6A 4OONA 1OT9A 1PW8A 1K54C 3UO9A 1WYBA 2Y91A 2H10A 2VV8A 3BM6A 1WE4A 3LICA 1PRQA 4HIAA 3ZG8B 5A93A 3IH8A 4BL3A 2HDQA 1MPLA 1W63M 3GVBA 3PR6A 4NXFA 4P6BA 1TS7A 2PD7A 3NOTC 3BLSA 2JC7A 1K56D 1MBLA 1SCWA 4BMWA 2DNSA 1TS6A 3P09A 3BJNA 5DTTA 2GJ3A 3GQZA 4I3AA 2MJ6A 1HZOA 2WGWA 3BFFA 2HF6A 4QY6A 5FQIA 3IXDA 1OT6A 5CGWA 4UA9A 4G3KA 2XSSA 3G31A 3BQ8A 3RXWA 1P0ZA 5DKKA 5FDSA 2YKFA 2I9VA 1K54A 1SKOA 1DY6A 4KQOA 4O0PA 4RQ9A 2ZOIA 3FV7A 3LIBA 2A2LA 3BWLA 1YKDA 2WKRA 1GA9A 4KENB 3H7WA 3ZG5A 2WGIA 2XFTA 4JPMA 2OLVA 3QNCA 2QWSA 1C3BA 3IT9A 1DJBA 5K5BA 3VP2A 2DCFA 3QP2A 1YPRA 3VFHA 3S22A 2EXAA 4BL2A 2KOIA 2IWDA 2Y2GA 2I72A 4I3JA 2ACGA 2JCHA 1ES3A 2WKPA 2J3WA 3W4QA 1TEMA 4HJ4A 3LY4A 2QKPA 1H8ZA 3UE0A 3NOPC 3IHBA 2HZ5A 4JF4A 2HDRA 1HTZA 3MFXA 4H8RA 1TS0A 4X53A 3MKFA 4P87A 4MDZA 3MZDA 4FH2A 2VKSA 4P6ZS 3UY6A 2EFXA 3A3EA 4CLCC 4KUOA 1U60A 4GNUA 3G4PA 4R3BA 4N1HA 3Q07A 3CLOA 2W3HA 4D60A 2B95A 1TVFA 4FUWA 4KZ5A 1FOFA 2E8JA 4GN2A 3VSLA 2QHKA 2PU2A 2XRNA 1GCEA 3GRJA 4GS9B 5CHMA 3IHAA 3UNWA 2ZQ8A 2ZQCA 1YM1A 1MZUA 4EEUA 4QU3A 1VEUB 1YQSA 1VQQA 4NETA 4EU0A 3N6IA 2V9AA 3ZYTA 3O3VA 1LT0A 1IYSA 3T50A 2Z2MB 2PYPA 5FI6A 5F68A 5FEFA 2FZ0A 1NWZA 4GDNA 2XA7S 4AFIA 1PI5A 2EX6A 2J8YA 4CLCA 2VA0A 1K56A 4FD8A 4QPRA 3PBOA 1DP9A 4HH3A 3T12B 1S1YA 5GL9A 5FL3A 1CEGA 2WZXA 3S7NA 3H82B 5CTMA 1KDWA 3H9WA 3AGDA 4XT2A 5DFXA 3IX8A 4RX3A 5IS1A 1K25A 2FFFB 4YNRA 5KSHA 4NEED 4ZAMA 3D72A 1KVMA 2Y59A 3KO6A 4DRTA 1PIOA 5CX7A 5HX9A 3PYPA 3EWKA 1ERMA 3WS2A 1PZPA 2H0YA 5EV0A 4DE0A 4X56A 4JGQA 1N9LA 1PWDA 3LFVA 1FR6A 3CZDA 4E3IA 3GMWA 4CQHA 3A3DA 2HJEA 2X02A 3KSFA 4DE3A 2ZL1B 1JTDA 5C5KA 1XJ6A 1IYQA 4KZ7A 4LRZE 2ZOHA 5L8MA 4RYEA 3BW6A 4OOMA 1GHIA 2WYXA 4NKPA 2W3EA 4HI4A 3MKEA 1KE0A 2C5WB 3B47A 1IELA 3QP5A 4JKTA 2PR5A 4KQRA 3O5YA 3OPRA 3QP8A 2XGNA 4HJ6A 4LFUA 3OPPA 4OLGA 3A3JA 3NDEA 5FI2A 4G3VA 4Y15A 3V50A 3TSGA 3S4XA 3IF6C 5G18A 4ESPA 3HJIA 4LENA 2Y2OA 1I5QA 3CUEC 2JKTI 3ITAA 2ZD8A 5FATA 3KSHA 4C3QA 4I39A 3T4KA 1P9RA 5FEGA 3T1XA 5DJTA 1FR1A 4MBKA 4R3JA 4LCMA 4OQIA 4LV3A 2J9PA 1S4SA 3ZVWA 1IKIA 3A0RA 1XGIA 3FKWA 5A91A 4S2KA 1MWRA 3A3IA 3C38A 2PRFA 3HREA 5HWTA 2L4RA 3Q82A 2RCXA 3ZFZA 1XJ2A 3M2KA 4WELA 4ETXA 2V0WA 4OKPA 4WLAA 5GLBA 2W0NA 2PD8A 3EGXC 3IF6A 1KE3A 2H5SA 3CUEA 2Z6DA 1SDNA 4OQHA 1TF1A 3D9YA 3UB9A 4Q8IA 2R9XA 5HDSA 2A24B 1V9YA 3R7WA 2EX9A 3HCYA 1MXOA 4DF6A 4GD6A 2Y55A 2QYBA 1CK3A 1N9NA 5KIZA 2XDMA 4MBHA 1EWZA 1IFQA 2XF3A 3FC7A 3M2JA 3CPTB 1XFQA 4MBFA 3UPNA 4LV1A 3LEQA 5HAIA 4PKYA 1SKFA 4ZJ3A 2Y8HA 5EE8A 3FZCA 2J9OA 1G6AA 3V67A 3WS0A 4X6TA 2BLSA 4E6WA 1ZG4A 2BASA 5EVLA 3DTEA 2CC1A 4Y7PA 2LB5A 4HBTA 5IHVA 4WZ5C 3OOVA 4LLOB 2Z2LB 4HQAA 2VK3A 2G2UA 4DDSA 3GDIA 5CERA 5DTKA 2PDRA 5E2FA 4PMAA 2QJ7A 4N92A 3K3CA 3ZNYA 3WS1A 4OP5A 4GKUA 2B5RA 5FSRA 1AWIA 1Y4OA 4EETB 4E3JA 4OH0A 4OQGA 4QY5A 1D1JA 3UB7A 1K6SA 2HP9A 4GCZA 3MF0A 2PAVP 3NHQA 5GLAA 2W1TB 2P08A 1NY0A 3TOIA 3EQUA 3E0YA 3PBTA 1ONHA 1XGJA 5HPIA 3E2LA 3HLGA 3IX4A 4UEYA 1BLCA 4NXBA 1MKIA 3GV9A 4M4XA 4WZ5A 2DMWA 1YLJA 5HD3A 3RFBA 4H6JA 2PU4A 3GSGA 4WN5A 5FA7A 1LSWA 2K7SA 3BYDA 1YAXA 2OWJA 1HD8A 4GHIB 4BD0A 3O88A 3NECA 2WZZA 5TR7A 4F3LB 3EEHA 2PBYA 5FQKA 1BYWA 1DP6A 1H5XA 1RGZA 2HV1A 4IBRA 3T4LA 3P7NA 3DTIA 1IKGA 2X01A 2Q0OA 2OWHA 3ISGA 3C8CA 3PAGA 3C7VA 4X68A 3Q81A 2JHEA 2PT7A 1V9ZA 5GHXA 3Q7ZA 3W4PA 5TFQA 1GHMA 5J4EA 1BZAA 3KX0X 5D3OA 1MY8A 2VGKA 5M19A 3MFDA 1A0KA 4CLCD 3LR4A 3EGDC 2XD5A 2EFUA 1GSVA 4GDBA 2O9CA 1JTGA 4L9FA 1VETB 2HDSA 4DXCA 4XUXA 3A3FA 4E3MA 2K2NA 3G35A 4HY8A 5EOOA 3PHYA 3T4TA 4PM6A 4OP8A 3BY9A 4DXBA 4IUKA 4IJGA 1JWZA 1TDLA 2OAQ1 2L0WA 3BFDA 3FKVA 4KZBA 3CI6A 4KG5A 4PM5A 5F6AA 4KZ8A 3F1NA 4CJNA 4MN7A 1OTIA 3K3DA 3ZCZA 2HP5A 3B33A 3LO7A 4KZ6A 3VSKA 2HGVA 5TBMA 3T4QA 3LR3A 3VV4A 3TE8A 4DE1A 4GZBA 4HEFA 4WM9A 2KLIA 2VLGA 3IS2B 3ZGAB 3VE4A 1Z6FA 4L0LA 3BFEA 2Y2NA 3EOIA 3FWLA 5CHJA 3W4OA 1K4FA 2Q9NA 5EVIB 3IBJA 3OPHA 1ODVA 4EBLA 3Q7VB 1LSVA 4OOYA 2EX2A 1EROA 4HHDA 1N9BA 3HLCA 4D2OA 3E4PA 5KMWA 1CEFA 1W7FA 3VP4A 4ARZA 4IBXA 3MXRA 4LGWA 5FAQA 4CPKA 3DW0A 4B4ZA 1ESUA 1E4DA 4G3WA 3V39A 2NUPC 4ZBEA 2GZAA 4O8GA 4KZ4A 3NIAA 4JF5A 2ZC6B 5F69A 1BUEA 5DJUA 3ZG9B 1TD5A 4JLFA 1OTEA 1MWSA 3WS5A 5DF7A 3LEZA 2ZMAA 3M6HA 2OLUA 1S66L 1DJCA 5J3WA 2VEAA 4FCFA 2PBDP 5FI7A 4CLCE 1KGEA 1XFNA 5L07A 3F1PB 1M6KA 5FAOA 2JKTM 4OVDA 1O7EA 2J7VA 1FILA 1YLZA 2L1MA 1OTDA 1LI0A 4UHUA 4EESA 2XR0A 4E3OA 4ETZA 2JKGA 3EQVA 4HH2A 5MC7A 2ZBBA 3MQOA 3UB5P 3HLWA 5LBRA 3ZHHA 4E3NA 3E2KA 4S2MA 4UA7A 2XEPA 3OZHA 2DRWA 5DFYA 2XA7M 4QD4A 1FQGA 2JN7A 5EUAA 1F9IA 2WKEA 1QMFA 2P9VB 2IA2A 2VGJA 2GDNA 3G34A 5L09A 1BLPA 4MN6A 2V20A 3EEAA 4S2NC 3JPUA 5A90A 1H8YA 4O01A 3C4PA 5J8XA 4EEPA 4OPRA 1DRMA
chains in the Genus database with same CATH topology
5DF8A 1NYMA 4IEDA 3M2KA 4P85A 2ZQDA 4WELA 3UDFA 1CI9A 4OKPA 3UDXA 2ZC4B 5EVID 3IXBA 3OCNA 5GLBA 4RA7A 2ZM0A 4X69A 1VM1A 1XPBA 5CTNA 3SH8A 2V2FF 5CXWA 1Q2PA 1PW1A 1BULA 1MWTA 3IF6A 4JXGA 3I7JA 2ZQAA 3PTEA 2P74A 3N8LA 5AQAA 1KE3A 2H5SA 4WEJA 3SOIA 4OPQA 4BJPA 3ZDJA 1SDNA 2A49A 3BRMA 1RGYA 4OQHA 4R23A 4Q8IA 5M18A 5FQJA 3AGFA 4ID4A 1DJAA 2R9XA 3BEBA 3LCEA 3SS4A 4DE2A 2EX9A 1W5DA 2XD1A 3BFGA 1AXBA 5HL1A 1MXOA 4DF6A 1E3UD 3MBZA 4GD6A 3P98A 2Y55A 5CGSA 2EX8A 4E6XA 4QJGA 3OPLA 1CK3A 4R0QA 3V3SA 5EOEA 4BENA 3C7UA 4EV4A 3C4OA 1S6RA 2QPNA 3HLEA 4M3KA 5GHYA 2IWBA 5HW3A 2ZLYA 2XDMA 4MBHA 1K6RA 4P0MA 1EWZA 3PBQA 2EXBA 1ONGA 4S2NA 5GLDA 2XF3A 3UE1A 1XKZA 3M2JA 3QHYA 2ZC3B 5M1AA 1ALQA 2ZQ7A 1ZG6A 1BTLA 5F1FA 4MBFA 4UA6A 1XA1A 1BT5A 4OONA 2XQZA 1PW8A 1K54C 3UO9A 4RVAA 3UPNA 1WYBA 2Y91A 1NXYA 4LV1A 2H10A 5HAIA 3BM6A 1WE4A 3MZEA 1SKFA 4ZJ3A 4KZAA 5JYPA 5EE8A 4B4XA 2Y2KA 4X55A 3ZG8B 3FZCA 2WADA 5A93A 3IH8A 3JYIA 2J9OA 1G6AA 3WS0A 4E6WA 4X6TA 2BLSA 4BL3A 4OPYA 2HDQA 1MPLA 1ZG4A 5EVLA 1E3UA 3GVBA 4C6YA 5HAQA 2CC1A 4P6BA 2WAEA 3MXSA 4Y7PA 1XA7A 1KGGA 3BLSA 1IEMA 2JC7A 1K56D 1MBLA 3N4IA 4K0XA 1SCWA 4HBTA 5IHVA 4ZTKA 2DNSA 1NZUA 4WZ5C 3P09A 4Y0OA 5FDHA 4IVIA 5DTTA 3N8SA 1LI9A 1N4OA 2XH9A 2Z2LB 1WYCA 2G2UA 3LY3A 2XK1A 4JF6A 4WMCD 3GQZA 4DDSA 4N1XA 1HZOA 1JVJA 4QB8A 5DTKA 5CERA 2WGWA 3BFFA 5E2FA 4OPZA 3IF6B 4OOLA 4QY6A 4PMAA 4FSFA 1FSYA 4N92A 5E2HA 5FQQA 1IYOA 3WS1A 3ZNYA 5FASA 4OP5A 4GKUA 2B5RA 1K57C 2ZQ9A 3NI9A 5FQIA 3IXDA 3V5MA 4OQ0A 4UA9A 5CGWA 5FSRA 5I94A 3G31A 1MWUA 3RXWA 4JXWA 3IWOA 4JXSA 3NC8A 4R1GA 4WYYA 4E3JA 4OH0A 4F94A 3VP3A 1LL9A 4OQGA 4QY5A 5EVIC 1K54A 1K6SA 1TDGA 3PAEA 1DY6A 4KQOA 4MLLA 2HP9A 2Y2IA 3PBRA 3IF5A 5E43A 4JXVA 5GLAA 3FV7A 1NY0A 3TOIA 1XX2A 3EQUA 1M40A 3PBTA 3IH9A 1ONHA 3NBLA 1XGJA 3E2LA 1GA9A 3HLGA 4KENB 5FQMA 3VMAA 3VP1A 1RCJA 1BLCA 4HBUA 1MKIA 3ZG5A 2FFYA 3CJMA 2Q9MA 2WGIA 1FSWA 5FAPA 2XFTA 4JPMA 1EI5A 2OLVA 3GV9A 3QNCA 4S2IA 1C3BA 1L0EA 2HPBA 1DJBA 1IYPA 3IT9A 4WZ5A 2WKIA 5BOHA 1L0DA 1YMSA 3VP2A 2DCFA 3VFHA 3S22A 1YLJA 2EXAA 2JE5A 4BL2A 1CI8A 2G2WA 2ZM2A 1K38A 3IWIA 2IWDA 2PU4A 2Y2GA 3GSGA 3ZG7B 1XXMA 1BSGA 5JYOA 5FA7A 3BYDA 2I72A 2Y2QA 2IWCA 4PM9A 2WK0A 1HD8A 4BD0A 2JCHA 1K57A 3O88A 1ES3A 2Y4AA 3UDIA 2WZZA 5TR7A 4E3KA 3W4QA 1TEMA 3LY4A 1W79A 2PBYA 5FQKA 1H8ZA 5AQBA 4WEKA 1ESIA 3G30A 4OLDA 1NZOA 2Y2MA 1H5XA 1RGZA 4IBRA 3VP0A 3UE0A 2WGWB 3IHBA 2WAFA 4JF4A 1L2SA 4RX2A 2HDRA 5EVIA 1IKGA 5CGXA 2X01A 1HTZA 4EBNA 3ZNTA 4H8RA 4X53A 3MKFA 4P87A 3ISGA 2HDUA 3MZDA 3PAGA 3C7VA 3BLMA 4FH2A 4PM7A 4X68A 5A92A 3Q81A 3Q7VA 2Y2JA 3B3XA 3UY6A 2EFXA 3A3EA 1S0WA 4XXRA 5GHXA 1U60A 4GNUA 1YMXA 3G4PA 3Q7ZA 4R3BA 3ZG0A 2C6WB 5E2EA 4N1HA 3W4PA 5TFQA 1GHMA 1LHYA 1RP5A 3Q07A 1BZAA 1LL5A 4Y0TA 2E8IA 5KZHA 5D3OA 3VOZA 4Z9QA 1MY8A 2VGKA 2UWXA 3SS5A 5M19A 3MFDA 4A5RA 1TVFA 4R4RA 1BLHA 3UN7A 5HAPA 1K4EA 3UPPA 4KZ5A 1FOFA 4E3LA 4ZDXA 5CRFA 4MEZA 2HP6A 2XD5A 4LCLA 5HARA 4GN2A 4ZJ1A 3VSLA 2EFUA 1W8YA 2PU2A 3PBNA 1ERQA 4GDBA 1GCEA 4DKIA 1JTGA 2HDSA 3GRJA 4DXCA 3V3RA 4XUXA 1Y54A 3A3FA 3HBRA 5CHMA 3IHAA 5HFOA 4E3MA 3IXGA 3UNWA 2ZQ8A 2ZQCA 1JWVA 1YM1A 2A3UA 3G35A 5EOOA 1YLPA 4PM6A 4QU3A 4N9LA 4OP8A 1YQSA 4DXBA 1VQQA 4QHCA 1JWZA 1TDLA 4NETA 5KSCA 5E2GA 3BFDA 3FKVA 3GTCA 3HLDA 3ITBA 4KG5A 3N7WA 4KZBA 4PM5A 3N6IA 3O3VA 4KZ8A 4CJNA 3HLFA 1PWCA 1IYSA 1QMEA 1YT4A 2Z2MB 5FI6A 1KGFA 3ZCZA 2HP5A 4KZ6A 3LO7A 3VSKA 1I2WA 2WUQA 4DE1A 4GZBA 1FCOA 4HEFA 4GDNA 4WM9A 1PI5A 3IWQA 2WGVA 4MNRA 2EX6A 2J8YA 1FCMA 5GLCA 3UE3A 1PZOA 2ZM8A 4YINA 1K56A 1NYYA 4FD8A 3ZGAB 3N8RA 1Z6FA 3NY4A 3BFEA 3PBOA 4L0LA 2Y2NA 4KG6A 3VFFA 3FWLA 5GL9A 5CHJA 1KVLA 3W4OA 1K4FA 4BLMA 1CEGA 2Q9NA 2WZXA 5EVIB 3CG5A 4WMCA 5CTMA 1KDWA 1YLTA 3HVFA 4LV0A 3AGDA 4EUZA 4RX3A 1NRFA 1K25A 3PBSA 1LLBA 4GD8A 4S2JA 3OPHA 4EBLA 2FFFB 3WRZA 2JBFA 3G32A 3Q7VB 2RL3A 4K0WA 4OOYA 2Y2PA 5AQ9A 5GHZA 5KSHA 4ZAMA 2EX2A 1EROA 1KVMA 4DDYA 1N9BA 3ZVTA 2Y59A 3HLCA 4D2OA 5KMWA 1CEFA 4KG2A 4DRTA 1HVBA 1PIOA 1Q2QA 2OSUA 3BFCA 5FQ9A 1YLYA 4S2PA 1W7FA 5HX9A 3VP4A 1K55C 3MZFA 4NK3A 4IBXA 1ERMA 1KDSA 3MXRA 3WS2A 1PZPA 5FAQA 4CPKA 4EWFA 2H0YA 3DW0A 4K91A 4DE0A 4X56A 4B4ZA 1ESUA 3GR2A 3RJUA 1E4DA 4PPRA 3V39A 4ZBEA 3BECA 4WZ4A 3WS4A 1PWDA 1PWGA 1FR6A 3CZDA 4KZ4A 3GMWA 3NIAA 2ZC6B 4JF5A 3TG9A 4E3IA 3HUNA 1W8QA 3IQAA 1SHVA 2ZJ9A 3A3DA 3HUOA 4EQIA 2ZC7A 4N9KA 4IVKA 1BUEA 3ZG9B 2X02A 2QZ6A 2P9VA 4JLFA 4DE3A 1MWSA 1JTDA 3WS5A 5DF7A 3LEZA 1IYQA 5U47A 2ZMAA 1PYYA 3W8KA 4KQQA 4KZ7A 2Y2LA 3M6HA 3O86A 2OLUA 2WKHA 1GHPA 1DJCA 3FYZA 1ZKJA 5DVAA 4RYEA 5F82A 4OOMA 4FCFA 1YLWA 1GHIA 2WYXA 4UAAA 1PI4A 4GOGA 5FI7A 5DTSA 1BLSA 4U0XA 1KGEA 3C5AA 3HL9A 3NDGA 1M6KA 5FAOA 3WWXA 4ZJ2A 4BD1A 5L2FA 3DWKA 4OVDA 3MKEA 4GB7A 1KE0A 2C5WB 4PM8A 1IELA 3NCKA 4JKTA 1O07A 3CMZA 1O7EA 2J7VA 4KZ3A 1YLZA 1K55A 2XFSA 4KQRA 3OC2A 1GA0A 3RXXA 4R4SA 1L0GA 1LI0A 4UHUA 3UPOA 3OPRA 2XR0A 3DWZA 4FH4A 4E3OA 4S2OA 2XGNA 5DF9A 1L0FA 5EPHA 1I2SA 1ES5A 3OPPA 2ZC5B 1G68A 4OLGA 5CEBA 4YFMA 1SDEA 2R9WA 3A3JA 3NDEA 5FI2A 3EQVA 4B88A 5F1GA 4U0TA 3V50A 3TSGA 1ES4A 3S4XA 3IF6C 2X71A 2V1ZA 5G18A 4EBPA 3HLWA 4LENA 3G2YA 3SS3A 2Y2OA 1KE4A 5CECA 1I5QA 3ZHHA 3O87A 3DTMA 3IXHA 4U3TA 4E3NA 3E2KA 3M6BA 3ITAA 1ZC2A 2ZD8A 4S2MA 4UA7A 5FATA 2XEPA 3OZHA 3HLBA 2DRWA 4C3QA 2QMIA 2Y2HA 4QD4A 3VOYA 3SH7A 1FQGA 2H0TA 3Q1FA 5EUAA 3WRTA 1FR1A 4MBKA 5EECA 2WKEA 3D4FA 4R3JA 4Y0UA 4BQMA 4LCMA 5AQ7A 4OQIA 3AGEA 4KZ9A 4LV3A 4XUZA 1QMFA 4HESA 5CHUA 4C75A 4S2LA 2P9VB 2J9PA 3G2ZA 5CEDA 3SH9A 4JBFA 1NJ4A 1JWPA 2VGJA 2GDNA 3G34A 1BLPA 3ZVWA 1IKIA 1FCNA 3HUMA 2V20A 2XLNA 4S2NC 1XGIA 4O7DA 3FKWA 5A91A 4S2KA 5TGFA 1MWRA 1OMEA 2BG1A 5F83A 3S1YA 3A3IA 5A90A 1H8YA 3C4PA 1XP4A 3OCLA 4LV2A 4WBGA 1ES2A 1E25A 5J8XA 1J9MA 3HREA 2OV5A 3Q82A 3QNBA 4OPRA 2RCXA 3ZFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DF8 A;  1NYM A;  4IED A;  3M2K A;  4P85 A;  2ZQD A;  4WEL A;  3UDF A;  1CI9 A;  4OKP A;  3UDX A;  2ZC4 B;  5EVI D;  3IXB A;  3OCN A;  5GLB A;  4RA7 A;  2ZM0 A;  4X69 A;  1VM1 A;  1XPB A;  5CTN A;  3SH8 A;  2V2F F;  5CXW A;  1Q2P A;  1PW1 A;  1BUL A;  1MWT A;  3IF6 A;  4JXG A;  3I7J A;  2ZQA A;  3PTE A;  2P74 A;  3N8L A;  5AQA A;  1KE3 A;  2H5S A;  4WEJ A;  3SOI A;  4OPQ A;  4BJP A;  3ZDJ A;  1SDN A;  2A49 A;  3BRM A;  1RGY A;  4OQH A;  4R23 A;  4Q8I A;  5M18 A;  5FQJ A;  3AGF A;  4ID4 A;  1DJA A;  2R9X A;  3BEB A;  3LCE A;  3SS4 A;  4DE2 A;  2EX9 A;  1W5D A;  2XD1 A;  3BFG A;  1AXB A;  5HL1 A;  1MXO A;  4DF6 A;  1E3U D;  3MBZ A;  4GD6 A;  3P98 A;  2Y55 A;  5CGS A;  2EX8 A;  4E6X A;  4QJG A;  3OPL A;  1CK3 A;  4R0Q A;  3V3S A;  5EOE A;  4BEN A;  3C7U A;  4EV4 A;  3C4O A;  1S6R A;  2QPN A;  3HLE A;  4M3K A;  5GHY A;  2IWB A;  5HW3 A;  2ZLY A;  2XDM A;  4MBH A;  1K6R A;  4P0M A;  1EWZ A;  3PBQ A;  2EXB A;  1ONG A;  4S2N A;  5GLD A;  2XF3 A;  3UE1 A;  1XKZ A;  3M2J A;  3QHY A;  2ZC3 B;  5M1A A;  1ALQ A;  2ZQ7 A;  1ZG6 A;  1BTL A;  5F1F A;  4MBF A;  4UA6 A;  1XA1 A;  1BT5 A;  4OON A;  2XQZ A;  1PW8 A;  1K54 C;  3UO9 A;  4RVA A;  3UPN A;  1WYB A;  2Y91 A;  1NXY A;  4LV1 A;  2H10 A;  5HAI A;  3BM6 A;  1WE4 A;  3MZE A;  1SKF A;  4ZJ3 A;  4KZA A;  5JYP A;  5EE8 A;  4B4X A;  2Y2K A;  4X55 A;  3ZG8 B;  3FZC A;  2WAD A;  5A93 A;  3IH8 A;  3JYI A;  2J9O A;  1G6A A;  3WS0 A;  4E6W A;  4X6T A;  2BLS A;  4BL3 A;  4OPY A;  2HDQ A;  1MPL A;  1ZG4 A;  5EVL A;  1E3U A;  3GVB A;  4C6Y A;  5HAQ A;  2CC1 A;  4P6B A;  2WAE A;  3MXS A;  4Y7P A;  1XA7 A;  1KGG A;  3BLS A;  1IEM A;  2JC7 A;  1K56 D;  1MBL A;  3N4I A;  4K0X A;  1SCW A;  4HBT A;  5IHV A;  4ZTK A;  2DNS A;  1NZU A;  4WZ5 C;  3P09 A;  4Y0O A;  5FDH A;  4IVI A;  5DTT A;  3N8S A;  1LI9 A;  1N4O A;  2XH9 A;  2Z2L B;  1WYC A;  2G2U A;  3LY3 A;  2XK1 A;  4JF6 A;  4WMC D;  3GQZ A;  4DDS A;  4N1X A;  1HZO A;  1JVJ A;  4QB8 A;  5DTK A;  5CER A;  2WGW A;  3BFF A;  5E2F A;  4OPZ A;  3IF6 B;  4OOL A;  4QY6 A;  4PMA A;  4FSF A;  1FSY A;  4N92 A;  5E2H A;  5FQQ A;  1IYO A;  3WS1 A;  3ZNY A;  5FAS A;  4OP5 A;  4GKU A;  2B5R A;  1K57 C;  2ZQ9 A;  3NI9 A;  5FQI A;  3IXD A;  3V5M A;  4OQ0 A;  4UA9 A;  5CGW A;  5FSR A;  5I94 A;  3G31 A;  1MWU A;  3RXW A;  4JXW A;  3IWO A;  4JXS A;  3NC8 A;  4R1G A;  4WYY A;  4E3J A;  4OH0 A;  4F94 A;  3VP3 A;  1LL9 A;  4OQG A;  4QY5 A;  5EVI C;  1K54 A;  1K6S A;  1TDG A;  3PAE A;  1DY6 A;  4KQO A;  4MLL A;  2HP9 A;  2Y2I A;  3PBR A;  3IF5 A;  5E43 A;  4JXV A;  5GLA A;  3FV7 A;  1NY0 A;  3TOI A;  1XX2 A;  3EQU A;  1M40 A;  3PBT A;  3IH9 A;  1ONH A;  3NBL A;  1XGJ A;  3E2L A;  1GA9 A;  3HLG A;  4KEN B;  5FQM A;  3VMA A;  3VP1 A;  1RCJ A;  1BLC A;  4HBU A;  1MKI A;  3ZG5 A;  2FFY A;  3CJM A;  2Q9M A;  2WGI A;  1FSW A;  5FAP A;  2XFT A;  4JPM A;  1EI5 A;  2OLV A;  3GV9 A;  3QNC A;  4S2I A;  1C3B A;  1L0E A;  2HPB A;  1DJB A;  1IYP A;  3IT9 A;  4WZ5 A;  2WKI A;  5BOH A;  1L0D A;  1YMS A;  3VP2 A;  2DCF A;  3VFH A;  3S22 A;  1YLJ A;  2EXA A;  2JE5 A;  4BL2 A;  1CI8 A;  2G2W A;  2ZM2 A;  1K38 A;  3IWI A;  2IWD A;  2PU4 A;  2Y2G A;  3GSG A;  3ZG7 B;  1XXM A;  1BSG A;  5JYO A;  5FA7 A;  3BYD A;  2I72 A;  2Y2Q A;  2IWC A;  4PM9 A;  2WK0 A;  1HD8 A;  4BD0 A;  2JCH A;  1K57 A;  3O88 A;  1ES3 A;  2Y4A A;  3UDI A;  2WZZ A;  5TR7 A;  4E3K A;  3W4Q A;  1TEM A;  3LY4 A;  1W79 A;  2PBY A;  5FQK A;  1H8Z A;  5AQB A;  4WEK A;  1ESI A;  3G30 A;  4OLD A;  1NZO A;  2Y2M A;  1H5X A;  1RGZ A;  4IBR A;  3VP0 A;  3UE0 A;  2WGW B;  3IHB A;  2WAF A;  4JF4 A;  1L2S A;  4RX2 A;  2HDR A;  5EVI A;  1IKG A;  5CGX A;  2X01 A;  1HTZ A;  4EBN A;  3ZNT A;  4H8R A;  4X53 A;  3MKF A;  4P87 A;  3ISG A;  2HDU A;  3MZD A;  3PAG A;  3C7V A;  3BLM A;  4FH2 A;  4PM7 A;  4X68 A;  5A92 A;  3Q81 A;  3Q7V A;  2Y2J A;  3B3X A;  3UY6 A;  2EFX A;  3A3E A;  1S0W A;  4XXR A;  5GHX A;  1U60 A;  4GNU A;  1YMX A;  3G4P A;  3Q7Z A;  4R3B A;  3ZG0 A;  2C6W B;  5E2E A;  4N1H A;  3W4P A;  5TFQ A;  1GHM A;  1LHY A;  1RP5 A;  3Q07 A;  1BZA A;  1LL5 A;  4Y0T A;  2E8I A;  5KZH A;  5D3O A;  3VOZ A;  4Z9Q A;  1MY8 A;  2VGK A;  2UWX A;  3SS5 A;  5M19 A;  3MFD A;  4A5R A;  1TVF A;  4R4R A;  1BLH A;  3UN7 A;  5HAP A;  1K4E A;  3UPP A;  4KZ5 A;  1FOF A;  4E3L A;  4ZDX A;  5CRF A;  4MEZ A;  2HP6 A;  2XD5 A;  4LCL A;  5HAR A;  4GN2 A;  4ZJ1 A;  3VSL A;  2EFU A;  1W8Y A;  2PU2 A;  3PBN A;  1ERQ A;  4GDB A;  1GCE A;  4DKI A;  1JTG A;  2HDS A;  3GRJ A;  4DXC A;  3V3R A;  4XUX A;  1Y54 A;  3A3F A;  3HBR A;  5CHM A;  3IHA A;  5HFO A;  4E3M A;  3IXG A;  3UNW A;  2ZQ8 A;  2ZQC A;  1JWV A;  1YM1 A;  2A3U A;  3G35 A;  5EOO A;  1YLP A;  4PM6 A;  4QU3 A;  4N9L A;  4OP8 A;  1YQS A;  4DXB A;  1VQQ A;  4QHC A;  1JWZ A;  1TDL A;  4NET A;  5KSC A;  5E2G A;  3BFD A;  3FKV A;  3GTC A;  3HLD A;  3ITB A;  4KG5 A;  3N7W A;  4KZB A;  4PM5 A;  3N6I A;  3O3V A;  4KZ8 A;  4CJN A;  3HLF A;  1PWC A;  1IYS A;  1QME A;  1YT4 A;  2Z2M B;  5FI6 A;  1KGF A;  3ZCZ A;  2HP5 A;  4KZ6 A;  3LO7 A;  3VSK A;  1I2W A;  2WUQ A;  4DE1 A;  4GZB A;  1FCO A;  4HEF A;  4GDN A;  4WM9 A;  1PI5 A;  3IWQ A;  2WGV A;  4MNR A;  2EX6 A;  2J8Y A;  1FCM A;  5GLC A;  3UE3 A;  1PZO A;  2ZM8 A;  4YIN A;  1K56 A;  1NYY A;  4FD8 A;  3ZGA B;  3N8R A;  1Z6F A;  3NY4 A;  3BFE A;  3PBO A;  4L0L A;  2Y2N A;  4KG6 A;  3VFF A;  3FWL A;  5GL9 A;  5CHJ A;  1KVL A;  3W4O A;  1K4F A;  4BLM A;  1CEG A;  2Q9N A;  2WZX A;  5EVI B;  3CG5 A;  4WMC A;  5CTM A;  1KDW A;  1YLT A;  3HVF A;  4LV0 A;  3AGD A;  4EUZ A;  4RX3 A;  1NRF A;  1K25 A;  3PBS A;  1LLB A;  4GD8 A;  4S2J A;  3OPH A;  4EBL A;  2FFF B;  3WRZ A;  2JBF A;  3G32 A;  3Q7V B;  2RL3 A;  4K0W A;  4OOY A;  2Y2P A;  5AQ9 A;  5GHZ A;  5KSH A;  4ZAM A;  2EX2 A;  1ERO A;  1KVM A;  4DDY A;  1N9B A;  3ZVT A;  2Y59 A;  3HLC A;  4D2O A;  5KMW A;  1CEF A;  4KG2 A;  4DRT A;  1HVB A;  1PIO A;  1Q2Q A;  2OSU A;  3BFC A;  5FQ9 A;  1YLY A;  4S2P A;  1W7F A;  5HX9 A;  3VP4 A;  1K55 C;  3MZF A;  4NK3 A;  4IBX A;  1ERM A;  1KDS A;  3MXR A;  3WS2 A;  1PZP A;  5FAQ A;  4CPK A;  4EWF A;  2H0Y A;  3DW0 A;  4K91 A;  4DE0 A;  4X56 A;  4B4Z A;  1ESU A;  3GR2 A;  3RJU A;  1E4D A;  4PPR A;  3V39 A;  4ZBE A;  3BEC A;  4WZ4 A;  3WS4 A;  1PWD A;  1PWG A;  1FR6 A;  3CZD A;  4KZ4 A;  3GMW A;  3NIA A;  2ZC6 B;  4JF5 A;  3TG9 A;  4E3I A;  3HUN A;  1W8Q A;  3IQA A;  1SHV A;  2ZJ9 A;  3A3D A;  3HUO A;  4EQI A;  2ZC7 A;  4N9K A;  4IVK A;  1BUE A;  3ZG9 B;  2X02 A;  2QZ6 A;  2P9V A;  4JLF A;  4DE3 A;  1MWS A;  1JTD A;  3WS5 A;  5DF7 A;  3LEZ A;  1IYQ A;  5U47 A;  2ZMA A;  1PYY A;  3W8K A;  4KQQ A;  4KZ7 A;  2Y2L A;  3M6H A;  3O86 A;  2OLU A;  2WKH A;  1GHP A;  1DJC A;  3FYZ A;  1ZKJ A;  5DVA A;  4RYE A;  5F82 A;  4OOM A;  4FCF A;  1YLW A;  1GHI A;  2WYX A;  4UAA A;  1PI4 A;  4GOG A;  5FI7 A;  5DTS A;  1BLS A;  4U0X A;  1KGE A;  3C5A A;  3HL9 A;  3NDG A;  1M6K A;  5FAO A;  3WWX A;  4ZJ2 A;  4BD1 A;  5L2F A;  3DWK A;  4OVD A;  3MKE A;  4GB7 A;  1KE0 A;  2C5W B;  4PM8 A;  1IEL A;  3NCK A;  4JKT A;  1O07 A;  3CMZ A;  1O7E A;  2J7V A;  4KZ3 A;  1YLZ A;  1K55 A;  2XFS A;  4KQR A;  3OC2 A;  1GA0 A;  3RXX A;  4R4S A;  1L0G A;  1LI0 A;  4UHU A;  3UPO A;  3OPR A;  2XR0 A;  3DWZ A;  4FH4 A;  4E3O A;  4S2O A;  2XGN A;  5DF9 A;  1L0F A;  5EPH A;  1I2S A;  1ES5 A;  3OPP A;  2ZC5 B;  1G68 A;  4OLG A;  5CEB A;  4YFM A;  1SDE A;  2R9W A;  3A3J A;  3NDE A;  5FI2 A;  3EQV A;  4B88 A;  5F1G A;  4U0T A;  3V50 A;  3TSG A;  1ES4 A;  3S4X A;  3IF6 C;  2X71 A;  2V1Z A;  5G18 A;  4EBP A;  3HLW A;  4LEN A;  3G2Y A;  3SS3 A;  2Y2O A;  1KE4 A;  5CEC A;  1I5Q A;  3ZHH A;  3O87 A;  3DTM A;  3IXH A;  4U3T A;  4E3N A;  3E2K A;  3M6B A;  3ITA A;  1ZC2 A;  2ZD8 A;  4S2M A;  4UA7 A;  5FAT A;  2XEP A;  3OZH A;  3HLB A;  2DRW A;  4C3Q A;  2QMI A;  2Y2H A;  4QD4 A;  3VOY A;  3SH7 A;  1FQG A;  2H0T A;  3Q1F A;  5EUA A;  3WRT A;  1FR1 A;  4MBK A;  5EEC A;  2WKE A;  3D4F A;  4R3J A;  4Y0U A;  4BQM A;  4LCM A;  5AQ7 A;  4OQI A;  3AGE A;  4KZ9 A;  4LV3 A;  4XUZ A;  1QMF A;  4HES A;  5CHU A;  4C75 A;  4S2L A;  2P9V B;  2J9P A;  3G2Z A;  5CED A;  3SH9 A;  4JBF A;  1NJ4 A;  1JWP A;  2VGJ A;  2GDN A;  3G34 A;  1BLP A;  3ZVW A;  1IKI A;  1FCN A;  3HUM A;  2V20 A;  2XLN A;  4S2N C;  1XGI A;  4O7D A;  3FKW A;  5A91 A;  4S2K A;  5TGF A;  1MWR A;  1OME A;  2BG1 A;  5F83 A;  3S1Y A;  3A3I A;  5A90 A;  1H8Y A;  3C4P A;  1XP4 A;  3OCL A;  4LV2 A;  4WBG A;  1ES2 A;  1E25 A;  5J8X A;  1J9M A;  3HRE A;  2OV5 A;  3Q82 A;  3QNB A;  4OPR A;  2RCX A;  3ZFZ A; 
#chains in the Genus database with same CATH topology
 4IED A;  2O9A A;  4P85 A;  2ZQD A;  3IXB A;  3T4O A;  1F5M A;  3VOL A;  1WA9 A;  4X69 A;  3MMH A;  3SH8 A;  1PW1 A;  1BUL A;  1MWT A;  3T1Q B;  3I7J A;  1CF0 A;  5AQA A;  1CJF A;  3ICY A;  2FH5 A;  3KSI A;  1RGY A;  2PHY A;  3BEB A;  3LIF A;  3BFG A;  3CIT A;  2EWW A;  5CGS A;  3V3S A;  4EV4 A;  3C4O A;  1S6R A;  2QPN A;  2IWB A;  5HW3 A;  1J3W A;  2ZLY A;  1K6R A;  3FG8 A;  2EXB A;  4S2N A;  5GLD A;  1H3Q A;  2ZC3 B;  2V8C A;  1ALQ A;  1BTL A;  5AVE A;  5AVF A;  3U2A A;  2XQZ A;  2YKH A;  4RVA A;  1NXY A;  1T1C A;  3MZE A;  5L10 A;  4X55 A;  2P04 A;  2WAD A;  2VGL S;  4GLQ A;  3ULF A;  1OTA A;  4C6Y A;  3MXS A;  1XA7 A;  1KGG A;  2PR6 A;  4ZTK A;  1NZU A;  2XRO A;  4Y0O A;  5FDH A;  4IVI A;  3SW1 A;  3N8S A;  3T4S A;  1LI9 A;  1N4O A;  2XK1 A;  4JF6 A;  4N1X A;  1NLY A;  1K0K A;  1D06 A;  3MQQ A;  1JVJ A;  4WF0 A;  2K31 A;  4OPZ A;  1UWN X;  4FSF A;  5HD5 A;  5FQQ A;  5FAS A;  2ZQ9 A;  3NI9 A;  3V5M A;  4OQ0 A;  3C2W A;  3LR5 A;  4JXW A;  4JXS A;  3NC8 A;  4F94 A;  3VP3 A;  3L7H A;  3E98 A;  5DKL A;  1LL9 A;  3F1O B;  4MLL A;  3FPW A;  3PBR A;  3IF5 A;  5E43 A;  4JXV A;  1XX2 A;  1M40 A;  1S4R A;  3IH9 A;  4EQ1 A;  5FQM A;  3LIA A;  1RCJ A;  1TS8 A;  2FFY A;  4GS9 A;  3CJM A;  2Q9M A;  1FSW A;  5FAP A;  3KYE A;  1EI5 A;  2Y79 A;  3QP1 A;  4S2I A;  1L0E A;  1VEU A;  2HPB A;  1IYP A;  4II7 A;  2WKI A;  1YMS A;  3MXQ A;  2ZM2 A;  1K38 A;  1XXM A;  4Y3I A;  2Y2Q A;  2IWC A;  2W1R A;  2WK0 A;  3NOU C;  4ZRR A;  2Y4A A;  3UDI A;  3T1R A;  1W79 A;  5AQB A;  1ESI A;  1NZO A;  3VP0 A;  1IOU A;  2WGW B;  1L2S A;  4RX2 A;  3H82 A;  3ZNT A;  2HDU A;  4Q0H A;  3BLM A;  2Y2J A;  3B3X A;  4YWZ A;  1S0W A;  4XXR A;  1YMX A;  2C6W B;  5HWW A;  4LPZ A;  1LHY A;  1RP5 A;  4Y0T A;  4MCW A;  5KZH A;  1MC0 A;  1LL8 A;  1SKO B;  2UWX A;  3RH8 B;  4A5R A;  2JKR I;  3T4J A;  5HAP A;  5IU1 A;  4B93 A;  5CRF A;  4MEZ A;  2HP6 A;  5HAR A;  4ZJ1 A;  4L9E A;  1NRJ A;  1W8Y A;  3MJQ A;  3H7W B;  2J3T D;  1Y54 A;  1S67 L;  3HBR A;  5HFO A;  5HSQ A;  3IXG A;  5J7E A;  2A3U A;  1F2K A;  1YLP A;  5G4Z A;  4QWO A;  1W63 Q;  2ZL1 A;  5E2G A;  3HLD A;  3GTC A;  4B9O A;  3UB8 A;  4NXG A;  4Y5F A;  1KGF A;  1X0O A;  1I2W A;  2WUQ A;  1FCO A;  4Y13 A;  3IWQ A;  3FPV A;  3ZQ5 A;  5GLC A;  2Z6C A;  3N8R A;  3NY4 A;  2VV7 A;  2D02 A;  3DAV A;  1OPX A;  3CG5 A;  4EUZ A;  2O0Y A;  1NRF A;  1LLB A;  2EA9 A;  2JBF A;  4K0W A;  2RL3 A;  2Y2P A;  5GHZ A;  1UGU A;  2M7V A;  3VE3 A;  3MS6 A;  4HNB A;  2M1C A;  1HVB A;  2OSU A;  3BFC A;  4X25 A;  4S2P A;  1OJ5 A;  4PHT A;  4EUV A;  4HOI A;  4UQI M;  1KOU A;  4YOF A;  3TJZ C;  4K91 A;  1ACF A;  1P97 A;  3GR2 A;  5HDC A;  2O99 A;  4PPR A;  3BEC A;  3WS4 A;  1PWG A;  3B42 A;  4DN0 A;  3HUN A;  1W8Q A;  3IQA A;  1SHV A;  2ZJ9 A;  4EQI A;  4N9K A;  4IVK A;  4R38 A;  5HL6 A;  2QZ6 A;  1STZ A;  3LI8 A;  3W8K A;  4KUK A;  4FOF A;  3O86 A;  4JGR A;  2R78 A;  2WKH A;  3FYZ A;  5DVA A;  1YLW A;  2J3T C;  5DTS A;  4CLC B;  3UMD A;  2VX8 A;  3C5A A;  3NDG A;  3WWX A;  4ZJ2 A;  3DWK A;  3KYQ A;  2PYR A;  3NCK A;  3QP6 A;  1L3L A;  3HJK A;  3CMZ A;  5AJG A;  4XT2 B;  4KZ3 A;  2XFS A;  1GA0 A;  2VZW A;  4Q0J A;  2ZMF A;  5IT5 A;  2B02 A;  1L0F A;  5EPH A;  1I2S A;  1ES5 A;  2A24 A;  5F1G A;  1ES4 A;  1D7E A;  2V1Z A;  4Y17 A;  3GEC A;  4EBP A;  1OTB A;  3G2Y A;  4R70 A;  1KE4 A;  5CEC A;  4PAU A;  3TW8 A;  3O87 A;  1XJ4 A;  1ZC2 A;  2QJ5 A;  3HLB A;  2QMI A;  2Y2H A;  3CPT A;  4EER A;  1F98 A;  2H0T A;  3Q1F A;  3WRT A;  4DJ3 A;  5HWV A;  3D4F A;  4Y0U A;  4BQM A;  4XUZ A;  5CED A;  3SH9 A;  1NJ4 A;  1JWP A;  1FCN A;  2G7U A;  3HUM A;  4O7D A;  5TGF A;  5A8B A;  1XP4 A;  3OCL A;  4LV2 A;  4WBG A;  1E25 A;  1NYM A;  3UDF A;  1MKM A;  1N9O A;  1T18 A;  5EVI D;  2LB9 A;  3OCN A;  3NUL A;  4RA7 A;  1XPB A;  1XJ3 A;  2M7U A;  2P74 A;  4WEJ A;  3SOI A;  3IX3 A;  4OPQ A;  2A49 A;  3RTY A;  4R23 A;  2HJ9 C;  5M18 A;  3AGF A;  3UE6 A;  3OBF A;  2XD1 A;  1AXB A;  3MBZ A;  4IUH A;  3S7Q A;  3S7O A;  2EX8 A;  3OPL A;  4P6Z M;  3HLE A;  2W1T A;  4MMN A;  3SZT A;  3PBQ A;  3LYX A;  3UE1 A;  1XKZ A;  5M1A A;  2ZQ7 A;  5F1F A;  2AVX A;  1P9W A;  4UA6 A;  1XA1 A;  1BT5 A;  3CAX A;  1ZTU A;  4KZA A;  5JYP A;  4B4X A;  2Y2K A;  2BTF P;  3JYI A;  4OPY A;  1E3U A;  3G6O A;  5HAQ A;  3E4O A;  4GHI A;  2WAE A;  1IEM A;  2W3D A;  3N4I A;  4K0X A;  4JGP A;  4F3L A;  2V0U A;  2VJW A;  2XH9 A;  1OJG A;  1WYC A;  3LY3 A;  4WMC D;  4QB8 A;  1YSQ A;  2O9B A;  3U4L P;  3IF6 B;  3L9K A;  4OOL A;  4NG2 A;  1FSY A;  5E2H A;  1IYO A;  1K57 C;  5I94 A;  4LRY C;  2V1B A;  1MWU A;  4EW7 A;  3IWO A;  5EM1 A;  4R1G A;  1ZHH B;  4WYY A;  5HPF A;  3R7W B;  3CHW P;  2OAP 1;  5EVI C;  1TDG A;  3PAE A;  3T1S A;  2W3F A;  2Y2I A;  4EXO A;  4BWI A;  2J80 A;  3NBL A;  4Q0I A;  5EVE A;  3VMA A;  3VP1 A;  4HBU A;  1VET A;  3IBR A;  4DMZ A;  3P01 A;  5BOH A;  3UB6 A;  1L0D A;  2JE5 A;  1CI8 A;  2G2W A;  2EWV A;  3IWI A;  2UV0 E;  3ZG7 B;  4ME4 A;  1BSG A;  5JYO A;  4PM9 A;  2INW A;  1K57 A;  2JKR M;  4JGO A;  4E3K A;  2WKQ A;  3IS2 A;  4WEK A;  3G30 A;  4OLD A;  2Y2M A;  2WAF A;  3JVV A;  5EVI A;  5CGX A;  4EBN A;  4PM7 A;  5A92 A;  3Q7V A;  1G6O A;  3TRC A;  3ZG0 A;  5E2E A;  2V8F A;  1LL5 A;  2GNX A;  2E8I A;  3VOZ A;  3NJA A;  4Z9Q A;  1H0M A;  3SS5 A;  1S1Z A;  4HP9 A;  3LGO A;  4GW9 A;  4R4R A;  1BLH A;  3UN7 A;  1K4E A;  3UPP A;  2VGL M;  4E3L A;  4ZDX A;  1LSX A;  4LCL A;  4L9G A;  3PBN A;  1ERQ A;  2JKF A;  4DKI A;  1HLU P;  3V3R A;  1Z09 A;  4FTX A;  1YSP A;  1JWV A;  2V1A A;  4N9L A;  4QHC A;  3DTK A;  1EW0 A;  5KSC A;  1GSW A;  4HJ3 A;  3ITB A;  3N7W A;  4H6J B;  3HLF A;  1PWC A;  3KYZ A;  1QME A;  3UME A;  1YT4 A;  2B18 A;  3OLO A;  1UWP X;  4HP4 A;  2WGV A;  4MNR A;  4I3I A;  1FCM A;  3A0V A;  3UE3 A;  1PZO A;  2ZM8 A;  4YIN A;  1NYY A;  4IHQ A;  3F1P A;  3CWF A;  4KG6 A;  3VFF A;  4MN5 A;  1KVL A;  4BLM A;  4K08 A;  1FIK A;  3BY8 A;  4I5S A;  1Y28 A;  4WMC A;  3HVF A;  1YLT A;  4LV0 A;  1VHM A;  3PBS A;  4GD8 A;  4S2J A;  3WRZ A;  3A0S A;  3G32 A;  5AQ9 A;  1T1B A;  2OOL A;  4LRX C;  4DDY A;  3ZVT A;  3LUQ A;  3MR0 A;  4R6L A;  1SZV A;  4KG2 A;  1Q2Q A;  5FQ9 A;  1YLY A;  3KSG A;  1T1A A;  2W27 A;  1K55 C;  2GX5 A;  4KQD A;  3MZF A;  4NK3 A;  1KDS A;  4EWF A;  4Z1W A;  3RJU A;  4WZ4 A;  1H8M A;  3TG9 A;  4I38 A;  3HUO A;  2ZC7 A;  4BBU A;  3JVU A;  3QP4 A;  2P9V A;  2KDK A;  5U47 A;  1PYY A;  3F1N B;  3MSH A;  4KQQ A;  1G5U A;  2CMN A;  2Y2L A;  3R4K A;  1GHP A;  3MQ0 A;  2ZMV A;  1ZKJ A;  5TBM B;  5F82 A;  4UAA A;  1PI4 A;  4GOG A;  1BLS A;  2W3G A;  4U0X A;  3HL9 A;  4BD1 A;  5L2F A;  4BBT A;  4GB7 A;  4PM8 A;  4X1L A;  1O07 A;  4WUJ A;  3S7P A;  5EFW A;  1K55 A;  3RXX A;  3OC2 A;  1PFL A;  1JNU A;  4R4S A;  1L0G A;  1CQA A;  3UPO A;  4Y2F A;  3DWZ A;  4FH4 A;  4S2O A;  3DBA A;  4DJ2 A;  5DF9 A;  3BQA A;  1PNE A;  3PXP A;  2ZC5 B;  1G68 A;  2KX6 A;  5CEB A;  4YFM A;  1SDE A;  2R9W A;  5EM0 A;  4WL9 A;  4B88 A;  4U0T A;  2X71 A;  1G28 A;  4ARZ B;  3SS3 A;  3DTM A;  3IXH A;  4U3T A;  3M6B A;  1DP8 A;  2D01 A;  4E04 A;  3VOY A;  3SH7 A;  2P7J A;  5EEC A;  3W2Z A;  1T19 A;  5AQ7 A;  5HZH A;  3AGE A;  4KZ9 A;  4HES A;  5CHU A;  4C75 A;  4S2L A;  3K2N A;  3G2Z A;  3E4Q A;  4JBF A;  5TJJ A;  4PKY G;  2XLN A;  3D3O A;  1OME A;  2BG1 A;  5F83 A;  3S1Y A;  3LID A;  3LI9 A;  3LIE A;  2VV6 A;  5HDD A;  1ES2 A;  1J9M A;  2OV5 A;  3QNB A;  5DF8 A;  3C30 A;  1CI9 A;  3UDX A;  2ZC4 B;  2H28 A;  4R3A A;  2ZM0 A;  5I5L A;  1VM1 A;  5CTN A;  2V2F F;  5CXW A;  1Q2P A;  3LR0 A;  4BBV A;  1VB6 A;  4JXG A;  2ZQA A;  3PTE A;  4X1M A;  1GSX A;  3N8L A;  4UQI S;  4BJP A;  3ZDJ A;  3BRM A;  5F5Y A;  5FQJ A;  4ID4 A;  1DJA A;  1NLZ A;  3LCE A;  3SS4 A;  4DE2 A;  1W5D A;  5HL1 A;  1E3U D;  3F1O A;  3P98 A;  4E6X A;  4QJG A;  4R0Q A;  5EOE A;  4BEN A;  3C7U A;  2NUT C;  4NXE A;  4M3K A;  5GHY A;  4P0M A;  4GJ4 A;  5G4Y A;  1ONG A;  3QHY A;  1ZG6 A;  4OON A;  1OT9 A;  1PW8 A;  1K54 C;  3UO9 A;  1WYB A;  2Y91 A;  2H10 A;  2VV8 A;  3BM6 A;  1WE4 A;  3LIC A;  1PRQ A;  4HIA A;  3ZG8 B;  5A93 A;  3IH8 A;  4BL3 A;  2HDQ A;  1MPL A;  1W63 M;  3GVB A;  3PR6 A;  4NXF A;  4P6B A;  1TS7 A;  2PD7 A;  3NOT C;  3BLS A;  2JC7 A;  1K56 D;  1MBL A;  1SCW A;  4BMW A;  2DNS A;  1TS6 A;  3P09 A;  3BJN A;  5DTT A;  2GJ3 A;  3GQZ A;  4I3A A;  2MJ6 A;  1HZO A;  2WGW A;  3BFF A;  2HF6 A;  4QY6 A;  5FQI A;  3IXD A;  1OT6 A;  5CGW A;  4UA9 A;  4G3K A;  2XSS A;  3G31 A;  3BQ8 A;  3RXW A;  1P0Z A;  5DKK A;  5FDS A;  2YKF A;  2I9V A;  1K54 A;  1SKO A;  1DY6 A;  4KQO A;  4O0P A;  4RQ9 A;  2ZOI A;  3FV7 A;  3LIB A;  2A2L A;  3BWL A;  1YKD A;  2WKR A;  1GA9 A;  4KEN B;  3H7W A;  3ZG5 A;  2WGI A;  2XFT A;  4JPM A;  2OLV A;  3QNC A;  2QWS A;  1C3B A;  3IT9 A;  1DJB A;  5K5B A;  3VP2 A;  2DCF A;  3QP2 A;  1YPR A;  3VFH A;  3S22 A;  2EXA A;  4BL2 A;  2KOI A;  2IWD A;  2Y2G A;  2I72 A;  4I3J A;  2ACG A;  2JCH A;  1ES3 A;  2WKP A;  2J3W A;  3W4Q A;  1TEM A;  4HJ4 A;  3LY4 A;  2QKP A;  1H8Z A;  3UE0 A;  3NOP C;  3IHB A;  2HZ5 A;  4JF4 A;  2HDR A;  1HTZ A;  3MFX A;  4H8R A;  1TS0 A;  4X53 A;  3MKF A;  4P87 A;  4MDZ A;  3MZD A;  4FH2 A;  2VKS A;  4P6Z S;  3UY6 A;  2EFX A;  3A3E A;  4CLC C;  4KUO A;  1U60 A;  4GNU A;  3G4P A;  4R3B A;  4N1H A;  3Q07 A;  3CLO A;  2W3H A;  4D60 A;  2B95 A;  1TVF A;  4FUW A;  4KZ5 A;  1FOF A;  2E8J A;  4GN2 A;  3VSL A;  2QHK A;  2PU2 A;  2XRN A;  1GCE A;  3GRJ A;  4GS9 B;  5CHM A;  3IHA A;  3UNW A;  2ZQ8 A;  2ZQC A;  1YM1 A;  1MZU A;  4EEU A;  4QU3 A;  1VEU B;  1YQS A;  1VQQ A;  4NET A;  4EU0 A;  3N6I A;  2V9A A;  3ZYT A;  3O3V A;  1LT0 A;  1IYS A;  3T50 A;  2Z2M B;  2PYP A;  5FI6 A;  5F68 A;  5FEF A;  2FZ0 A;  1NWZ A;  4GDN A;  2XA7 S;  4AFI A;  1PI5 A;  2EX6 A;  2J8Y A;  4CLC A;  2VA0 A;  1K56 A;  4FD8 A;  4QPR A;  3PBO A;  1DP9 A;  4HH3 A;  3T12 B;  1S1Y A;  5GL9 A;  5FL3 A;  1CEG A;  2WZX A;  3S7N A;  3H82 B;  5CTM A;  1KDW A;  3H9W A;  3AGD A;  4XT2 A;  5DFX A;  3IX8 A;  4RX3 A;  5IS1 A;  1K25 A;  2FFF B;  4YNR A;  5KSH A;  4NEE D;  4ZAM A;  3D72 A;  1KVM A;  2Y59 A;  3KO6 A;  4DRT A;  1PIO A;  5CX7 A;  5HX9 A;  3PYP A;  3EWK A;  1ERM A;  3WS2 A;  1PZP A;  2H0Y A;  5EV0 A;  4DE0 A;  4X56 A;  4JGQ A;  1N9L A;  1PWD A;  3LFV A;  1FR6 A;  3CZD A;  4E3I A;  3GMW A;  4CQH A;  3A3D A;  2HJE A;  2X02 A;  3KSF A;  4DE3 A;  2ZL1 B;  1JTD A;  5C5K A;  1XJ6 A;  1IYQ A;  4KZ7 A;  4LRZ E;  2ZOH A;  5L8M A;  4RYE A;  3BW6 A;  4OOM A;  1GHI A;  2WYX A;  4NKP A;  2W3E A;  4HI4 A;  3MKE A;  1KE0 A;  2C5W B;  3B47 A;  1IEL A;  3QP5 A;  4JKT A;  2PR5 A;  4KQR A;  3O5Y A;  3OPR A;  3QP8 A;  2XGN A;  4HJ6 A;  4LFU A;  3OPP A;  4OLG A;  3A3J A;  3NDE A;  5FI2 A;  4G3V A;  4Y15 A;  3V50 A;  3TSG A;  3S4X A;  3IF6 C;  5G18 A;  4ESP A;  3HJI A;  4LEN A;  2Y2O A;  1I5Q A;  3CUE C;  2JKT I;  3ITA A;  2ZD8 A;  5FAT A;  3KSH A;  4C3Q A;  4I39 A;  3T4K A;  1P9R A;  5FEG A;  3T1X A;  5DJT A;  1FR1 A;  4MBK A;  4R3J A;  4LCM A;  4OQI A;  4LV3 A;  2J9P A;  1S4S A;  3ZVW A;  1IKI A;  3A0R A;  1XGI A;  3FKW A;  5A91 A;  4S2K A;  1MWR A;  3A3I A;  3C38 A;  2PRF A;  3HRE A;  5HWT A;  2L4R A;  3Q82 A;  2RCX A;  3ZFZ A;  1XJ2 A;  3M2K A;  4WEL A;  4ETX A;  2V0W A;  4OKP A;  4WLA A;  5GLB A;  2W0N A;  2PD8 A;  3EGX C;  3IF6 A;  1KE3 A;  2H5S A;  3CUE A;  2Z6D A;  1SDN A;  4OQH A;  1TF1 A;  3D9Y A;  3UB9 A;  4Q8I A;  2R9X A;  5HDS A;  2A24 B;  1V9Y A;  3R7W A;  2EX9 A;  3HCY A;  1MXO A;  4DF6 A;  4GD6 A;  2Y55 A;  2QYB A;  1CK3 A;  1N9N A;  5KIZ A;  2XDM A;  4MBH A;  1EWZ A;  1IFQ A;  2XF3 A;  3FC7 A;  3M2J A;  3CPT B;  1XFQ A;  4MBF A;  3UPN A;  4LV1 A;  3LEQ A;  5HAI A;  4PKY A;  1SKF A;  4ZJ3 A;  2Y8H A;  5EE8 A;  3FZC A;  2J9O A;  1G6A A;  3V67 A;  3WS0 A;  4X6T A;  2BLS A;  4E6W A;  1ZG4 A;  2BAS A;  5EVL A;  3DTE A;  2CC1 A;  4Y7P A;  2LB5 A;  4HBT A;  5IHV A;  4WZ5 C;  3OOV A;  4LLO B;  2Z2L B;  4HQA A;  2VK3 A;  2G2U A;  4DDS A;  3GDI A;  5CER A;  5DTK A;  2PDR A;  5E2F A;  4PMA A;  2QJ7 A;  4N92 A;  3K3C A;  3ZNY A;  3WS1 A;  4OP5 A;  4GKU A;  2B5R A;  5FSR A;  1AWI A;  1Y4O A;  4EET B;  4E3J A;  4OH0 A;  4OQG A;  4QY5 A;  1D1J A;  3UB7 A;  1K6S A;  2HP9 A;  4GCZ A;  3MF0 A;  2PAV P;  3NHQ A;  5GLA A;  2W1T B;  2P08 A;  1NY0 A;  3TOI A;  3EQU A;  3E0Y A;  3PBT A;  1ONH A;  1XGJ A;  5HPI A;  3E2L A;  3HLG A;  3IX4 A;  4UEY A;  1BLC A;  4NXB A;  1MKI A;  3GV9 A;  4M4X A;  4WZ5 A;  2DMW A;  1YLJ A;  5HD3 A;  3RFB A;  4H6J A;  2PU4 A;  3GSG A;  4WN5 A;  5FA7 A;  1LSW A;  2K7S A;  3BYD A;  1YAX A;  2OWJ A;  1HD8 A;  4GHI B;  4BD0 A;  3O88 A;  3NEC A;  2WZZ A;  5TR7 A;  4F3L B;  3EEH A;  2PBY A;  5FQK A;  1BYW A;  1DP6 A;  1H5X A;  1RGZ A;  2HV1 A;  4IBR A;  3T4L A;  3P7N A;  3DTI A;  1IKG A;  2X01 A;  2Q0O A;  2OWH A;  3ISG A;  3C8C A;  3PAG A;  3C7V A;  4X68 A;  3Q81 A;  2JHE A;  2PT7 A;  1V9Z A;  5GHX A;  3Q7Z A;  3W4P A;  5TFQ A;  1GHM A;  5J4E A;  1BZA A;  3KX0 X;  5D3O A;  1MY8 A;  2VGK A;  5M19 A;  3MFD A;  1A0K A;  4CLC D;  3LR4 A;  3EGD C;  2XD5 A;  2EFU A;  1GSV A;  4GDB A;  2O9C A;  1JTG A;  4L9F A;  1VET B;  2HDS A;  4DXC A;  4XUX A;  3A3F A;  4E3M A;  2K2N A;  3G35 A;  4HY8 A;  5EOO A;  3PHY A;  3T4T A;  4PM6 A;  4OP8 A;  3BY9 A;  4DXB A;  4IUK A;  4IJG A;  1JWZ A;  1TDL A;  2OAQ 1;  2L0W A;  3BFD A;  3FKV A;  4KZB A;  3CI6 A;  4KG5 A;  4PM5 A;  5F6A A;  4KZ8 A;  3F1N A;  4CJN A;  4MN7 A;  1OTI A;  3K3D A;  3ZCZ A;  2HP5 A;  3B33 A;  3LO7 A;  4KZ6 A;  3VSK A;  2HGV A;  5TBM A;  3T4Q A;  3LR3 A;  3VV4 A;  3TE8 A;  4DE1 A;  4GZB A;  4HEF A;  4WM9 A;  2KLI A;  2VLG A;  3IS2 B;  3ZGA B;  3VE4 A;  1Z6F A;  4L0L A;  3BFE A;  2Y2N A;  3EOI A;  3FWL A;  5CHJ A;  3W4O A;  1K4F A;  2Q9N A;  5EVI B;  3IBJ A;  3OPH A;  1ODV A;  4EBL A;  3Q7V B;  1LSV A;  4OOY A;  2EX2 A;  1ERO A;  4HHD A;  1N9B A;  3HLC A;  4D2O A;  3E4P A;  5KMW A;  1CEF A;  1W7F A;  3VP4 A;  4ARZ A;  4IBX A;  3MXR A;  4LGW A;  5FAQ A;  4CPK A;  3DW0 A;  4B4Z A;  1ESU A;  1E4D A;  4G3W A;  3V39 A;  2NUP C;  4ZBE A;  2GZA A;  4O8G A;  4KZ4 A;  3NIA A;  4JF5 A;  2ZC6 B;  5F69 A;  1BUE A;  5DJU A;  3ZG9 B;  1TD5 A;  4JLF A;  1OTE A;  1MWS A;  3WS5 A;  5DF7 A;  3LEZ A;  2ZMA A;  3M6H A;  2OLU A;  1S66 L;  1DJC A;  5J3W A;  2VEA A;  4FCF A;  2PBD P;  5FI7 A;  4CLC E;  1KGE A;  1XFN A;  5L07 A;  3F1P B;  1M6K A;  5FAO A;  2JKT M;  4OVD A;  1O7E A;  2J7V A;  1FIL A;  1YLZ A;  2L1M A;  1OTD A;  1LI0 A;  4UHU A;  4EES A;  2XR0 A;  4E3O A;  4ETZ A;  2JKG A;  3EQV A;  4HH2 A;  5MC7 A;  2ZBB A;  3MQO A;  3UB5 P;  3HLW A;  5LBR A;  3ZHH A;  4E3N A;  3E2K A;  4S2M A;  4UA7 A;  2XEP A;  3OZH A;  2DRW A;  5DFY A;  2XA7 M;  4QD4 A;  1FQG A;  2JN7 A;  5EUA A;  1F9I A;  2WKE A;  1QMF A;  2P9V B;  2IA2 A;  2VGJ A;  2GDN A;  3G34 A;  5L09 A;  1BLP A;  4MN6 A;  2V20 A;  3EEA A;  4S2N C;  3JPU A;  5A90 A;  1H8Y A;  4O01 A;  3C4P A;  5J8X A;  4EEP A;  4OPR A;  1DRM A; 
#chains in the Genus database with same CATH homology
 5DF8 A;  1NYM A;  4IED A;  3M2K A;  4P85 A;  2ZQD A;  4WEL A;  3UDF A;  1CI9 A;  4OKP A;  3UDX A;  2ZC4 B;  5EVI D;  3IXB A;  3OCN A;  5GLB A;  4RA7 A;  2ZM0 A;  4X69 A;  1VM1 A;  1XPB A;  5CTN A;  3SH8 A;  2V2F F;  5CXW A;  1Q2P A;  1PW1 A;  1BUL A;  1MWT A;  3IF6 A;  4JXG A;  3I7J A;  2ZQA A;  3PTE A;  2P74 A;  3N8L A;  5AQA A;  1KE3 A;  2H5S A;  4WEJ A;  3SOI A;  4OPQ A;  4BJP A;  3ZDJ A;  1SDN A;  2A49 A;  3BRM A;  1RGY A;  4OQH A;  4R23 A;  4Q8I A;  5M18 A;  5FQJ A;  3AGF A;  4ID4 A;  1DJA A;  2R9X A;  3BEB A;  3LCE A;  3SS4 A;  4DE2 A;  2EX9 A;  1W5D A;  2XD1 A;  3BFG A;  1AXB A;  5HL1 A;  1MXO A;  4DF6 A;  1E3U D;  3MBZ A;  4GD6 A;  3P98 A;  2Y55 A;  5CGS A;  2EX8 A;  4E6X A;  4QJG A;  3OPL A;  1CK3 A;  4R0Q A;  3V3S A;  5EOE A;  4BEN A;  3C7U A;  4EV4 A;  3C4O A;  1S6R A;  2QPN A;  3HLE A;  4M3K A;  5GHY A;  2IWB A;  5HW3 A;  2ZLY A;  2XDM A;  4MBH A;  1K6R A;  4P0M A;  1EWZ A;  3PBQ A;  2EXB A;  1ONG A;  4S2N A;  5GLD A;  2XF3 A;  3UE1 A;  1XKZ A;  3M2J A;  3QHY A;  2ZC3 B;  5M1A A;  1ALQ A;  2ZQ7 A;  1ZG6 A;  1BTL A;  5F1F A;  4MBF A;  4UA6 A;  1XA1 A;  1BT5 A;  4OON A;  2XQZ A;  1PW8 A;  1K54 C;  3UO9 A;  4RVA A;  3UPN A;  1WYB A;  2Y91 A;  1NXY A;  4LV1 A;  2H10 A;  5HAI A;  3BM6 A;  1WE4 A;  3MZE A;  1SKF A;  4ZJ3 A;  4KZA A;  5JYP A;  5EE8 A;  4B4X A;  2Y2K A;  4X55 A;  3ZG8 B;  3FZC A;  2WAD A;  5A93 A;  3IH8 A;  3JYI A;  2J9O A;  1G6A A;  3WS0 A;  4E6W A;  4X6T A;  2BLS A;  4BL3 A;  4OPY A;  2HDQ A;  1MPL A;  1ZG4 A;  5EVL A;  1E3U A;  3GVB A;  4C6Y A;  5HAQ A;  2CC1 A;  4P6B A;  2WAE A;  3MXS A;  4Y7P A;  1XA7 A;  1KGG A;  3BLS A;  1IEM A;  2JC7 A;  1K56 D;  1MBL A;  3N4I A;  4K0X A;  1SCW A;  4HBT A;  5IHV A;  4ZTK A;  2DNS A;  1NZU A;  4WZ5 C;  3P09 A;  4Y0O A;  5FDH A;  4IVI A;  5DTT A;  3N8S A;  1LI9 A;  1N4O A;  2XH9 A;  2Z2L B;  1WYC A;  2G2U A;  3LY3 A;  2XK1 A;  4JF6 A;  4WMC D;  3GQZ A;  4DDS A;  4N1X A;  1HZO A;  1JVJ A;  4QB8 A;  5DTK A;  5CER A;  2WGW A;  3BFF A;  5E2F A;  4OPZ A;  3IF6 B;  4OOL A;  4QY6 A;  4PMA A;  4FSF A;  1FSY A;  4N92 A;  5E2H A;  5FQQ A;  1IYO A;  3WS1 A;  3ZNY A;  5FAS A;  4OP5 A;  4GKU A;  2B5R A;  1K57 C;  2ZQ9 A;  3NI9 A;  5FQI A;  3IXD A;  3V5M A;  4OQ0 A;  4UA9 A;  5CGW A;  5FSR A;  5I94 A;  3G31 A;  1MWU A;  3RXW A;  4JXW A;  3IWO A;  4JXS A;  3NC8 A;  4R1G A;  4WYY A;  4E3J A;  4OH0 A;  4F94 A;  3VP3 A;  1LL9 A;  4OQG A;  4QY5 A;  5EVI C;  1K54 A;  1K6S A;  1TDG A;  3PAE A;  1DY6 A;  4KQO A;  4MLL A;  2HP9 A;  2Y2I A;  3PBR A;  3IF5 A;  5E43 A;  4JXV A;  5GLA A;  3FV7 A;  1NY0 A;  3TOI A;  1XX2 A;  3EQU A;  1M40 A;  3PBT A;  3IH9 A;  1ONH A;  3NBL A;  1XGJ A;  3E2L A;  1GA9 A;  3HLG A;  4KEN B;  5FQM A;  3VMA A;  3VP1 A;  1RCJ A;  1BLC A;  4HBU A;  1MKI A;  3ZG5 A;  2FFY A;  3CJM A;  2Q9M A;  2WGI A;  1FSW A;  5FAP A;  2XFT A;  4JPM A;  1EI5 A;  2OLV A;  3GV9 A;  3QNC A;  4S2I A;  1C3B A;  1L0E A;  2HPB A;  1DJB A;  1IYP A;  3IT9 A;  4WZ5 A;  2WKI A;  5BOH A;  1L0D A;  1YMS A;  3VP2 A;  2DCF A;  3VFH A;  3S22 A;  1YLJ A;  2EXA A;  2JE5 A;  4BL2 A;  1CI8 A;  2G2W A;  2ZM2 A;  1K38 A;  3IWI A;  2IWD A;  2PU4 A;  2Y2G A;  3GSG A;  3ZG7 B;  1XXM A;  1BSG A;  5JYO A;  5FA7 A;  3BYD A;  2I72 A;  2Y2Q A;  2IWC A;  4PM9 A;  2WK0 A;  1HD8 A;  4BD0 A;  2JCH A;  1K57 A;  3O88 A;  1ES3 A;  2Y4A A;  3UDI A;  2WZZ A;  5TR7 A;  4E3K A;  3W4Q A;  1TEM A;  3LY4 A;  1W79 A;  2PBY A;  5FQK A;  1H8Z A;  5AQB A;  4WEK A;  1ESI A;  3G30 A;  4OLD A;  1NZO A;  2Y2M A;  1H5X A;  1RGZ A;  4IBR A;  3VP0 A;  3UE0 A;  2WGW B;  3IHB A;  2WAF A;  4JF4 A;  1L2S A;  4RX2 A;  2HDR A;  5EVI A;  1IKG A;  5CGX A;  2X01 A;  1HTZ A;  4EBN A;  3ZNT A;  4H8R A;  4X53 A;  3MKF A;  4P87 A;  3ISG A;  2HDU A;  3MZD A;  3PAG A;  3C7V A;  3BLM A;  4FH2 A;  4PM7 A;  4X68 A;  5A92 A;  3Q81 A;  3Q7V A;  2Y2J A;  3B3X A;  3UY6 A;  2EFX A;  3A3E A;  1S0W A;  4XXR A;  5GHX A;  1U60 A;  4GNU A;  1YMX A;  3G4P A;  3Q7Z A;  4R3B A;  3ZG0 A;  2C6W B;  5E2E A;  4N1H A;  3W4P A;  5TFQ A;  1GHM A;  1LHY A;  1RP5 A;  3Q07 A;  1BZA A;  1LL5 A;  4Y0T A;  2E8I A;  5KZH A;  5D3O A;  3VOZ A;  4Z9Q A;  1MY8 A;  2VGK A;  2UWX A;  3SS5 A;  5M19 A;  3MFD A;  4A5R A;  1TVF A;  4R4R A;  1BLH A;  3UN7 A;  5HAP A;  1K4E A;  3UPP A;  4KZ5 A;  1FOF A;  4E3L A;  4ZDX A;  5CRF A;  4MEZ A;  2HP6 A;  2XD5 A;  4LCL A;  5HAR A;  4GN2 A;  4ZJ1 A;  3VSL A;  2EFU A;  1W8Y A;  2PU2 A;  3PBN A;  1ERQ A;  4GDB A;  1GCE A;  4DKI A;  1JTG A;  2HDS A;  3GRJ A;  4DXC A;  3V3R A;  4XUX A;  1Y54 A;  3A3F A;  3HBR A;  5CHM A;  3IHA A;  5HFO A;  4E3M A;  3IXG A;  3UNW A;  2ZQ8 A;  2ZQC A;  1JWV A;  1YM1 A;  2A3U A;  3G35 A;  5EOO A;  1YLP A;  4PM6 A;  4QU3 A;  4N9L A;  4OP8 A;  1YQS A;  4DXB A;  1VQQ A;  4QHC A;  1JWZ A;  1TDL A;  4NET A;  5KSC A;  5E2G A;  3BFD A;  3FKV A;  3GTC A;  3HLD A;  3ITB A;  4KG5 A;  3N7W A;  4KZB A;  4PM5 A;  3N6I A;  3O3V A;  4KZ8 A;  4CJN A;  3HLF A;  1PWC A;  1IYS A;  1QME A;  1YT4 A;  2Z2M B;  5FI6 A;  1KGF A;  3ZCZ A;  2HP5 A;  4KZ6 A;  3LO7 A;  3VSK A;  1I2W A;  2WUQ A;  4DE1 A;  4GZB A;  1FCO A;  4HEF A;  4GDN A;  4WM9 A;  1PI5 A;  3IWQ A;  2WGV A;  4MNR A;  2EX6 A;  2J8Y A;  1FCM A;  5GLC A;  3UE3 A;  1PZO A;  2ZM8 A;  4YIN A;  1K56 A;  1NYY A;  4FD8 A;  3ZGA B;  3N8R A;  1Z6F A;  3NY4 A;  3BFE A;  3PBO A;  4L0L A;  2Y2N A;  4KG6 A;  3VFF A;  3FWL A;  5GL9 A;  5CHJ A;  1KVL A;  3W4O A;  1K4F A;  4BLM A;  1CEG A;  2Q9N A;  2WZX A;  5EVI B;  3CG5 A;  4WMC A;  5CTM A;  1KDW A;  1YLT A;  3HVF A;  4LV0 A;  3AGD A;  4EUZ A;  4RX3 A;  1NRF A;  1K25 A;  3PBS A;  1LLB A;  4GD8 A;  4S2J A;  3OPH A;  4EBL A;  2FFF B;  3WRZ A;  2JBF A;  3G32 A;  3Q7V B;  2RL3 A;  4K0W A;  4OOY A;  2Y2P A;  5AQ9 A;  5GHZ A;  5KSH A;  4ZAM A;  2EX2 A;  1ERO A;  1KVM A;  4DDY A;  1N9B A;  3ZVT A;  2Y59 A;  3HLC A;  4D2O A;  5KMW A;  1CEF A;  4KG2 A;  4DRT A;  1HVB A;  1PIO A;  1Q2Q A;  2OSU A;  3BFC A;  5FQ9 A;  1YLY A;  4S2P A;  1W7F A;  5HX9 A;  3VP4 A;  1K55 C;  3MZF A;  4NK3 A;  4IBX A;  1ERM A;  1KDS A;  3MXR A;  3WS2 A;  1PZP A;  5FAQ A;  4CPK A;  4EWF A;  2H0Y A;  3DW0 A;  4K91 A;  4DE0 A;  4X56 A;  4B4Z A;  1ESU A;  3GR2 A;  3RJU A;  1E4D A;  4PPR A;  3V39 A;  4ZBE A;  3BEC A;  4WZ4 A;  3WS4 A;  1PWD A;  1PWG A;  1FR6 A;  3CZD A;  4KZ4 A;  3GMW A;  3NIA A;  2ZC6 B;  4JF5 A;  3TG9 A;  4E3I A;  3HUN A;  1W8Q A;  3IQA A;  1SHV A;  2ZJ9 A;  3A3D A;  3HUO A;  4EQI A;  2ZC7 A;  4N9K A;  4IVK A;  1BUE A;  3ZG9 B;  2X02 A;  2QZ6 A;  2P9V A;  4JLF A;  4DE3 A;  1MWS A;  1JTD A;  3WS5 A;  5DF7 A;  3LEZ A;  1IYQ A;  5U47 A;  2ZMA A;  1PYY A;  3W8K A;  4KQQ A;  4KZ7 A;  2Y2L A;  3M6H A;  3O86 A;  2OLU A;  2WKH A;  1GHP A;  1DJC A;  3FYZ A;  1ZKJ A;  5DVA A;  4RYE A;  5F82 A;  4OOM A;  4FCF A;  1YLW A;  1GHI A;  2WYX A;  4UAA A;  1PI4 A;  4GOG A;  5FI7 A;  5DTS A;  1BLS A;  4U0X A;  1KGE A;  3C5A A;  3HL9 A;  3NDG A;  1M6K A;  5FAO A;  3WWX A;  4ZJ2 A;  4BD1 A;  5L2F A;  3DWK A;  4OVD A;  3MKE A;  4GB7 A;  1KE0 A;  2C5W B;  4PM8 A;  1IEL A;  3NCK A;  4JKT A;  1O07 A;  3CMZ A;  1O7E A;  2J7V A;  4KZ3 A;  1YLZ A;  1K55 A;  2XFS A;  4KQR A;  3OC2 A;  1GA0 A;  3RXX A;  4R4S A;  1L0G A;  1LI0 A;  4UHU A;  3UPO A;  3OPR A;  2XR0 A;  3DWZ A;  4FH4 A;  4E3O A;  4S2O A;  2XGN A;  5DF9 A;  1L0F A;  5EPH A;  1I2S A;  1ES5 A;  3OPP A;  2ZC5 B;  1G68 A;  4OLG A;  5CEB A;  4YFM A;  1SDE A;  2R9W A;  3A3J A;  3NDE A;  5FI2 A;  3EQV A;  4B88 A;  5F1G A;  4U0T A;  3V50 A;  3TSG A;  1ES4 A;  3S4X A;  3IF6 C;  2X71 A;  2V1Z A;  5G18 A;  4EBP A;  3HLW A;  4LEN A;  3G2Y A;  3SS3 A;  2Y2O A;  1KE4 A;  5CEC A;  1I5Q A;  3ZHH A;  3O87 A;  3DTM A;  3IXH A;  4U3T A;  4E3N A;  3E2K A;  3M6B A;  3ITA A;  1ZC2 A;  2ZD8 A;  4S2M A;  4UA7 A;  5FAT A;  2XEP A;  3OZH A;  3HLB A;  2DRW A;  4C3Q A;  2QMI A;  2Y2H A;  4QD4 A;  3VOY A;  3SH7 A;  1FQG A;  2H0T A;  3Q1F A;  5EUA A;  3WRT A;  1FR1 A;  4MBK A;  5EEC A;  2WKE A;  3D4F A;  4R3J A;  4Y0U A;  4BQM A;  4LCM A;  5AQ7 A;  4OQI A;  3AGE A;  4KZ9 A;  4LV3 A;  4XUZ A;  1QMF A;  4HES A;  5CHU A;  4C75 A;  4S2L A;  2P9V B;  2J9P A;  3G2Z A;  5CED A;  3SH9 A;  4JBF A;  1NJ4 A;  1JWP A;  2VGJ A;  2GDN A;  3G34 A;  1BLP A;  3ZVW A;  1IKI A;  1FCN A;  3HUM A;  2V20 A;  2XLN A;  4S2N C;  1XGI A;  4O7D A;  3FKW A;  5A91 A;  4S2K A;  5TGF A;  1MWR A;  1OME A;  2BG1 A;  5F83 A;  3S1Y A;  3A3I A;  5A90 A;  1H8Y A;  3C4P A;  1XP4 A;  3OCL A;  4LV2 A;  4WBG A;  1ES2 A;  1E25 A;  5J8X A;  1J9M A;  3HRE A;  2OV5 A;  3Q82 A;  3QNB A;  4OPR A;  2RCX A;  3ZFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...