2JBFA

Structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
264
structure length
264
Chain Sequence
b'LPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPEPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TLL2115 PROTEIN
molecule tags Hydrolase
source organism Synechococcus elongatus
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
total genus 102
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jbfA01
5FQKA 4JPMA 4IBXA 2X71A 1YLPA 1DJAA 5CERA 2ZQCA 1PI4A 5CTNA 2WGWA 4MBFA 2WK0A 4X68A 1FR6A 3M6BA 5JYOA 1PZOA 5EECA 2E8IA 3O3VA 4QU3A 3W4OA 1KVMA 1ESUA 1XA1A 2EX9A 2ZC4B 1I2SA 3N8RA 3IHBA 4JKTA 5CGWA 4CJNA 3EQUA 1ERQA 3GVBA 2ZJ9A 4N1XA 5CHUA 3WS2A 4IEDA 2Y91A 3HLDA 4RA7A 1W79A 1DY6A 1ALQA 3G31A 1FR1A 3IHAA 4RVAA 3Q7VB 1JWVA 1NYYA 2PU4A 3NC8A 2V1ZA 2WGIA 4XXRA 4EV4A 4QJGA 1GHIA 1MWTA 1L0EA 3FKWA 1EWZA 3P98A 3ZVWA 4IBRA 3BLMA 5E43A 2H0YA 3FWLA 5DVAA 4PM5A 4DF6A 3MZEA 2EX6A 4GDBA 2RL3A 1W5DA 4M3KA 4WMCD 5AQAA 4S2JA 1ZG6A 3TSGA 5CGXA 1MWUA 1YLZA 3RJUA 1XGIA 3CZDA 4K0XA 1Z6FA 3UE3A 3S22A 2XD1A 4R4SA 3QNBA 4Y0OA 5IHVA 1K55C 3PBTA 5E2FA 5E2GA 3UN7A 1TDGA 4OLGA 5FSRA 2HDQA 3V39A 5DTTA 2A49A 2Y2OA 4DDYA 4QY6A 4N9LA 4E3LA 4BENA 5GHXA 3BYDA 4EBLA 4R23A 3NIAA 4KENB 4A5RA 5DTSA 3PBNA 4OQHA 5EOOA 1LLBA 5TGFA 5A93A 3UPOA 4XUZA 3GR2A 5CTMA 4P6BA 2ZM8A 3M2JA 1YLJA 2XGNA 2OLUA 4GD8A 2Y2PA 5FI7A 1CI8A 1XGJA 3N7WA 4Z9QA 4E3MA 1IYPA 2WZZA 5F82A 3UDIA 4E3NA 5CEDA 1E3UA 4BQMA 4PM6A 1QMEA 4OPQA 3ZNTA 3VP2A 5EVIC 5BOHA 3V3RA 4S2NA 2XF3A 4DXCA 4N92A 4R1GA 1FOFA 1BTLA 3PBSA 5GHZA 3IF6B 3HLFA 1ONHA 4WZ4A 3VP0A 3ZG0A 3SH9A 1KE4A 2HP6A 3IWQA 3OPPA 4JXGA 3W4PA 1E3UD 2PBYA 4HESA 2VGKA 3HLWA 1PYYA 3ZHHA 1KDWA 1I5QA 2Y55A 3SOIA 2XFTA 4KG5A 1BULA 2Y2JA 3UY6A 3A3DA 1ONGA 1QMFA 4FD8A 1G68A 2WYXA 4ZDXA 4OOYA 4QB8A 3OPHA 3G34A 4KQQA 3CMZA 1MKIA 3Q82A 3ZVTA 4C6YA 1KGFA 1O07A 1M6KA 1KGGA 1VM1A 3NDGA 4KQRA 2QZ6A 4P0MA 4ZJ2A 3BRMA 2GDNA 1XKZA 2XH9A 2IWCA 1XA7A 2WAEA 2ZQ7A 5CGSA 3AGDA 4OLDA 3HUMA 1PWGA 4D2OA 5GLAA 3IWOA 2J8YA 4K0WA 1IYQA 4OPYA 4S2IA 5HW3A 3PBRA 1K57A 3MXRA 2OSUA 2P9VB 3VP4A 2Y2HA 4ZJ1A 3Q7ZA 3AGEA 1W8YA 1J9MA 1IELA 1SKFA 2FFYA 2Y2MA 3IWIA 3TOIA 4KZ5A 3UDFA 4U0XA 2V2FF 4OQIA 3ZG5A 4KZ4A 5FQIA 1YT4A 3BLSA 4X69A 2ZC6B 5KSCA 1YLWA 2ZM0A 1YLTA 3N4IA 5M18A 2WUQA 1FQGA 4ZAMA 3ITBA 2HP5A 4WM9A 5EVLA 3Q81A 3UPPA 3VSKA 3IXBA 1PWCA 2Y2QA 1W8QA 2WGWB 3PBQA 4GDNA 4OVDA 4DE0A 4DXBA 5FQ9A 4PM8A 5EVIA 4KZ3A 1S0WA 3E2LA 1E25A 4X53A 5F1GA 5CRFA 1LL5A 1VQQA 4UAAA 3OPLA 4GNUA 4Y7PA 2JBFA 3HBRA 5FQQA 3LCEA 4EBNA 4EBPA 1K4FA 3LEZA 3PAGA 1BUEA 1IYOA 2ZC7A 2ZMAA 2XR0A 3IF6A 3NDEA 5AQ9A 4B88A 1TEMA 2DCFA 2ZQDA 4S2MA 5D3OA 5F83A 3UE0A 5DF7A 1KE0A 1FCMA 3G35A 4H8RA 3BEBA 4JF6A 3RXWA 5M19A 4Q8IA 3IF6C 1K6SA 4WZ5A 3M2KA 3BFEA 1PI5A 3PBOA 2G2WA 1N4OA 3HLEA 3NI9A 4JXSA 5EVIB 4B4ZA 5L2FA 3SS5A 3LY3A 3FKVA 4WEJA 3V5MA 4BL2A 3B3XA 1GA9A 4E6XA 3S1YA 2H0TA 5GLBA 2EFXA 2Y59A 4KZBA 4LV2A 2ZM2A 5CHJA 3C4OA 2XDMA 3WRTA 1DJBA 4DRTA 3GV9A 3ZGAB 5U47A 1K4EA 2H10A 1NYMA 3SH8A 1NY0A 1MPLA 4E3JA 4IVKA 5FA7A 4OKPA 5FI2A 3SS3A 1IKIA 1K57C 1BLSA 2PU2A 4KZ8A 5TR7A 2ZQ8A 3DWKA 4EWFA 1GHMA 4IVIA 1CK3A 2XD5A 3MZDA 1GA0A 3ZNYA 3DWZA 1K25A 2JE5A 1U60A 4FSFA 5J8XA 4S2LA 2J9PA 3BM6A 4QHCA 4BJPA 5F1FA 3O86A 4WYYA 2ZD8A 5HAPA 3HREA 5EPHA 1S6RA 1L2SA 3MXSA 4YINA 2Q9MA 3PTEA 1MWRA 4S2NC 4QY5A 1FSWA 4HBTA 1DJCA 4OQGA 4PMAA 2JC7A 3GSGA 2QMIA 3A3EA 1H8ZA 4WMCA 1BLCA 5HL1A 2VGJA 3NCKA 4OPRA 1CI9A 2UWXA 1BLHA 1FSYA 1K54C 1SDNA 4ZBEA 5GLDA 3UDXA 1GCEA 4UA7A 1PW8A 2HDRA 3ZG8B 3CG5A 3I7JA 4JLFA 3BECA 4OPZA 3WRZA 5DTKA 2JCHA 2Y2NA 4R0QA 4Y0UA 1L0GA 4PPRA 4LV1A 1YMXA 2P9VA 4NK3A 4UA9A 1BLPA 2DNSA 3VFFA 2Z2LB 1FCNA 1MWSA 4E3KA 2ZC3B 3BFCA 1MBLA 3VMAA 3MZFA 4P85A 3E2KA 2EX8A 4HBUA 3JYIA 4L0LA 5FASA 1L0DA 1RGZA 1SDEA 2G2UA 4S2KA 4RYEA 2Y2LA 5KSHA 3N8LA 4ID4A 1IYSA 3WS5A 5HX9A 4BL3A 3W8KA 3HLGA 3IQAA 4LV0A 5EOEA 2WADA 2XK1A 3HUNA 3VOYA 4DE2A 1KE3A 3OPRA 2Y2GA 2RCXA 2HP9A 3HL9A 2IWBA 4E6WA 2X02A 5KMWA 4KQOA 3GRJA 4F94A 2C6WB 3EQVA 3IXHA 2DRWA 4DE3A 4LCMA 2XFSA 1N9BA 4JXWA 3V50A 2HDSA 1IKGA 1BT5A 3HVFA 2WKHA 4UHUA 5DF8A 2XQZA 3RXXA 4JBFA 1PWDA 4HEFA 4X55A 1FCOA 5A91A 2EX2A 3BFGA 5FATA 2Y2KA 3G32A 3FV7A 3OCLA 2ZC5B 3QHYA 4JF5A 5EE8A 1GHPA 4KG6A 4MBKA 2QPNA 1NJ4A 3AGFA 5CXWA 1PZPA 3Q07A 5HAIA 4X56A 1RGYA 3IT9A 3MBZA 5AQ7A 4U3TA 5GLCA 2C5WB 5GL9A 3FYZA 4RX2A 3GQZA 3ZG9B 1ES5A 2Y2IA 1HVBA 1JWZA 2OLVA 2R9XA 3HUOA 4KZ7A 5FAQA 2WKIA 5CECA 3IH8A 4WEKA 3G2YA 4P87A 4KZ6A 2Z2MB 3HLCA 5FAOA 1BSGA 1KGEA 2P74A 3Q7VA 1KDSA 3IH9A 1JVJA 1K54A 1H8YA 5A92A 1XXMA 1YMSA 2BLSA 1O7EA 4PM9A 2IWDA 1HZOA 1K38A 2A3UA 1Q2PA 3WS0A 3C7VA 3WS1A 4DDSA 1JTDA 3PAEA 5FQMA 4MBHA 4DKIA 1Y54A 4E3IA 2FFFB 3P09A 4K91A 5FI6A 5JYPA 3D4FA 1C3BA 2ZLYA 5E2EA 3DW0A 1WE4A 4E3OA 3M6HA 4DE1A 4FCFA 1AXBA 1IEMA 3S4XA 2ZQ9A 1CEFA 1YM1A 4WELA 1ES2A 1NRFA 1NZUA 3VFHA 3V3SA 4MEZA 3ZG7B 1G6AA 1KVLA 3IF5A 5FAPA 3NY4A 5KZHA 3OZHA 4GB7A 2B5RA 1LHYA 4OH0A 5HARA 4FH4A 5CHMA 1NXYA 5GHYA 3SS4A 3MKFA 1CEGA 1HTZA 2WGVA 3QNCA 4ZTKA 3N8SA 5EVID 4EUZA 1L0FA 3G2ZA 1TVFA 2WAFA 5HFOA 1K55A 1SCWA 4GZBA 1WYBA 4RX3A 4C3QA 1ZG4A 5TFQA 2X01A 5M1AA 3VP3A 1Q2QA 1OMEA 3A3FA 4S2OA 4BLMA 1ZKJA 1ESIA 3IXGA 3BFDA 3C4PA 4OOMA 3GTCA 3IXDA 4R4RA 4LENA 1XX2A 1MXOA 1ZC2A 4U0TA 1EI5A 1W7FA 2HDUA 4JF4A 4XUXA 5AQBA 4OQ0A 3OC2A 1LL9A 3DTMA 4OOLA 3FZCA 3N6IA 2CC1A 1RP5A 3WS4A 1TDLA 3ISGA 5E2HA 1ES4A 1ES3A 1I2WA 5DF9A 3VSLA 3HLBA 3LO7A 4O7DA 3NBLA 3ZDJA 4CPKA 2Q9NA 2XLNA 4LCLA 1K6RA 1E4DA 4NETA 2WKEA 4QD4A 3ITAA 4LV3A 1LI9A 4GN2A 2EXBA 4OP5A 5A90A 3WWXA 1EROA 1ERMA 1K56D 4R3JA 3VOZA 4B4XA 3G4PA 3LY4A 4ZJ3A 3ZCZA 3UO9A 1YQSA 4N9KA 2XEPA 2BG1A 3UPNA 1WYCA 2EXAA 1H5XA 5I94A 4UA6A 4WBGA 2H5SA 3O88A 3MKEA 1K56A 4OONA 4WZ5C 3G30A 4GKUA 1XP4A 3W4QA 2OV5A 1XPBA 5CEBA 1JTGA 4PM7A 4X6TA 4EQIA 2I72A 5FDHA 1HD8A 3A3JA 2R9WA 4FH2A 4C75A 5FQJA 4N1HA 1NZOA 2J7VA 2HPBA 3BFFA 4KZAA 4YFMA 4Y0TA 3UNWA 4KG2A 4MNRA 4S2PA 4GD6A 2WZXA 3MFDA 4JXVA 2J9OA 3OCNA 3CJMA 5EUAA 1M40A 3TG9A 1SHVA 4MLLA 4GOGA 3VP1A 5G18A 1RCJA 5HAQA 1BZAA 4BD0A 2ZQAA 3GMWA 2Y4AA 1JWPA 4OP8A 2V20A 3Q1FA 3SH7A 4R3BA 4KZ9A 1LI0A 3C7UA 1YLYA 3A3IA 1MY8A 2EFUA 3UE1A 3ZFZA 1PIOA 4BD1A 3C5AA 3O87A 1PW1A
chains in the Genus database with same CATH superfamily
3CAXA 4JPMA 3C8CA 5AVEA 4EERA 5CERA 2ZQCA 5CTNA 2EWWA 2WK0A 3T50A 3RFBA 4JGPA 2EX9A 3IHBA 5CGWA 2K7SA 2PT7A 4EETB 4N1XA 2PYRA 2Y91A 1W79A 2ZOHA 1DY6A 1FR1A 1JWVA 1NYYA 2PU4A 4EV4A 3HJIA 1MWTA 3FKWA 4Y15A 5HDDA 5DVAA 2RL3A 1W5DA 5AQAA 3TSGA 3RJUA 3CZDA 1Z6FA 4I3AA 3S22A 4R4SA 5IHVA 3QNBA 5E2FA 1Y28A 5FSRA 2A49A 2W1RA 5DTSA 5EOOA 1LLBA 3LUQA 5TGFA 3GR2A 1S66L 1YLJA 4GD8A 3N7WA 4E3NA 5EM1A 2ZMVA 3ZNTA 5EVIC 5MC7A 3V3RA 2XF3A 1BTLA 1ONHA 3VP0A 3SH9A 3DTKA 4JXGA 3HLWA 4X1MA 3T4LA 3ZHHA 1BULA 1OT9A 3UY6A 4OOYA 4QB8A 3OPHA 3G34A 1L3LA 3C38A 4C6YA 1M6KA 3NDGA 3BQ8A 4KQRA 2QZ6A 3BRMA 2JN7A 2GDNA 4MN7A 2PDRA 4YWZA 5CGSA 1PFLA 3S7OA 2D01A 4XT2A 2PYPA 1P0ZA 3LIFA 1K57A 3MXRA 2P9VB 3MSHA 3Q7ZA 1S1ZA 2FFYA 3IWIA 3LICA 4GJ4A 3ZG5A 4X69A 1YLTA 5M18A 3ITBA 2V9AA 4KQDA 4WM9A 2QJ7A 4DN0A 3IXBA 2D02A 4IJGA 3PBQA 4GDNA 4DE0A 4DXBA 2IA2A 4L9GA 4WLAA 5CRFA 1VQQA 4UAAA 3OLOA 2JBFA 5FQQA 3NJAA 3LIDA 5FEFA 4EBNA 1K4FA 2ZMAA 4BBUA 5D3OA 1KE0A 1LT0A 1TF1A 1WA9A 1PI5A 3PBOA 1D06A 3QP5A 3SS5A 2VA0A 4WEJA 5EV0A 4BL2A 3GECA 3PHYA 2Q0OA 3S1YA 4E6XA 4LV2A 4ARZA 5CHJA 2VV8A 3SZTA 1NY0A 4E3JA 1F2KA 4IVKA 4OKPA 5FI2A 1GSXA 1K57C 3DWKA 5HWWA 2O9CA 1NRJA 1CK3A 2XD5A 3MZDA 3MFXA 1GA0A 1PNEA 2JE5A 3FPWA 2J9PA 3BM6A 4QHCA 4BJPA 5F1FA 1NLZA 4YINA 2Z6CA 2PHYA 4IUKA 2M7VA 3PTEA 4CLCC 1OTEA 4OQGA 5DFYA 1MKMA 2B95A 4WMCA 1CI9A 2UWXA 1FSYA 3NOUC 3UDXA 1PW8A 4ZRRA 4GS9A 3T1RA 3ZG8B 3CG5A 3BJNA 4JLFA 4WN5A 5TBMA 4R0QA 2P9VA 1BLPA 4HQAA 4E3KA 3BFCA 2WKQA 5EOEA 3VOYA 4DE2A 1KE3A 3MF0A 3OPRA 5L10A 2ZBBA 3HL9A 4KQOA 1CQAA 4MCWA 3EQVA 3B42A 4B9OA 2OWHA 4LPZA 3K3DA 2WKHA 4UHUA 5TJJA 4JBFA 4HEFA 5A91A 5L07A 2EX2A 3BFGA 2A24A 2L1MA 3QHYA 3HCYA 5EE8A 1NJ4A 3NOTC 3UB5P 4X56A 1RGYA 3IX3A 2XSSA 3LFVA 5GL9A 3GQZA 1HVBA 1JWZA 5G4ZA 1VB6A 5FAQA 3ICYA 3U2AA 3JPUA 5FAOA 1BSGA 1JVJA 1XXMA 3WS1A 4DDSA 1JTDA 5FQMA 3P09A 5FI6A 1C3BA 2ZLYA 5E2EA 3DW0A 1LSXA 1WE4A 4E3OA 4FCFA 3S4XA 1H8MA 1YM1A 3IF5A 4DMZA 4NXBA 4NG2A 4LRYC 5GHYA 1HTZA 1P97A 4EUZA 3G2ZA 1OJGA 1TVFA 2WAFA 5HFOA 1K55A 4GZBA 3UB7A 3S7PA 3VP3A 4KUKA 2JKFA 3ULFA 3LR3A 4F3LB 4OOMA 3GTCA 3IXDA 1MXOA 2QJ5A 3UMEA 4OQ0A 1LL9A 3DTMA 3FZCA 1TDLA 1LSVA 1ES4A 1I2WA 3C2WA 4EXOA 1XFNA 1MZUA 1ODVA 4ETXA 1LL8A 1E4DA 4QD4A 3ITAA 4LV3A 3LEQA 1YAXA 3WWXA 4PAUA 1EROA 1K56D 3S7QA 4Q0IA 3LY4A 4ZJ3A 1NWZA 2W3HA 2H28A 3QP6A 3UPNA 2EXAA 4R70A 4UA6A 4WBGA 5FDSA 2J3TC 3MKEA 5L8MA 4OONA 1H0MA 1XP4A 1XPBA 5CEBA 4X6TA 1HD8A 2R9WA 5J7EA 1NZOA 2HPBA 4YFMA 5AJGA 1J3WA 4S2PA 3IBJA 2J9OA 4PKYA 3TG9A 1M40A 1SHVA 4GOGA 3LIBA 5HAQA 4EQ1A 1XJ6A 3KSIA 2V20A 4WF0A 1UWPX 3UO9A 3MQQA 2ZOIA 2KOIA 2G7UA 4IBXA 2X71A 1PI4A 3F1PB 4GCZA 4X68A 5EECA 3O3VA 3P01A 4NEED 3W4OA 1KVMA 1ESUA 2ZC4B 4UEYA 4EEPA 4P6ZM 3N8RA 4UQIM 4CJNA 5HZHA 3GVBA 2ZJ9A 3NOPC 1SKOA 3G6OA 3FPVA 4Q0HA 1UGUA 4CLCB 3FWLA 2EX6A 3VV4A 1AWIA 4KUOA 4WMCD 1ZG6A 1BYWA 1XGIA 5HPFA 5KIZA 1TS7A 2XD1A 2KX6A 2XA7M 1K55C 3PBTA 1G5UA 3RTYA 2V8CA 3E98A 2OWJA 5DTTA 2Y2OA 1ZTUA 5GHXA 3BYDA 4R23A 3NIAA 3UPOA 5CTMA 4P6BA 2ZM8A 2XGNA 1CI8A 2V0UA 4LGWA 1IYPA 3A0SA 3UDIA 2B18A 1E3UA 4HY8A 4BQMA 4PM6A 4OPQA 4R1GA 2JHEA 2EA9A 1KE4A 3IS2A 2LB5A 2VGKA 3F1NB 3SOIA 4KG5A 2Y2JA 1G68A 4ARZB 3EEAA 3T4SA 4KQQA 1MKIA 3Q82A 1KGFA 4Z1WA 1XFQA 4ZJ2A 1S67L 4Y17A 3EWKA 2ZQ7A 3MS6A 4OLDA 5IS1A 4S2IA 3PBRA 1GSWA 3VP4A 2KLIA 1SKFA 3TOIA 2A24B 4KZ5A 2V2FF 3FG8A 2ZC6B 3S7NA 5KSCA 5G4YA 5HWVA 2ZM0A 2WUQA 3VSKA 1PWCA 2UV0E 1S0WA 5F1GA 3LCEA 3MQ0A 4EBPA 3PAGA 2XR0A 3IF6A 1TEMA 5F83A 3UE0A 4NXGA 5F6AA 4O01A 3G35A 4H8RA 4JF6A 3RXWA 4BBVA 3NI9A 5L2FA 2OAQ1 2PR5A 2H0TA 5GLBA 1T18A 4CQHA 4G3WA 2Y59A 4KZBA 4Y5FA 2EWVA 3WRTA 4DRTA 3GV9A 3ZGAB 4EU0A 2QHKA 2WKPA 5U47A 2H10A 1MPLA 2L0WA 3LR5A 1F98A 1BLSA 4EWFA 5TR7A 4I3IA 3H82B 2ZL1B 1GHMA 3CWFA 3ZNYA 4FSFA 5DKKA 2ZD8A 5HAPA 5EPHA 4HI4A 1L2SA 3E4PA 3PYPA 3LIAA 4QY5A 2FZ0A 3A3EA 1H8ZA 1BLCA 1TD5A 4OPRA 4ZBEA 3CPTB 4UA7A 4I5SA 4OPZA 3C30A 3WRZA 5DTKA 4HH2A 1YMXA 3P7NA 2CMNA 1FCNA 1MWSA 4HH3A 2ZC3B 1MBLA 2W27A 4YNRA 3PR6A 2EX8A 4UQIS 1RGZA 2G2UA 4RYEA 4ID4A 3WS5A 5HX9A 4BL3A 3HLGA 2WADA 3HUNA 2Y2GA 4CLCE 4E6WA 3L7HA 2DRWA 1TS0A 2XFSA 4X1LA 1BT5A 1PWDA 2ACGA 5FATA 2VX8A 3G32A 3FV7A 3OCLA 1F9IA 2DMWA 4MBKA 3QP1A 3AGFA 3U4LP 3QP4A 3IT9A 4U3TA 5FEGA 5EFWA 5FL3A 2WKIA 1KGEA 2NUPC 3Q7VA 1KDSA 3IH9A 3TE8A 1K54A 1H8YA 3D3OA 3OBFA 2XROA 4BMWA 1Q2PA 3T1QB 3WS0A 4O8GA 3KYQA 3UE6A 1XJ3A 4BWIA 1AXBA 1IEMA 2V0WA 3VFHA 1G6AA 1KVLA 2HV1A 2PR6A 3HJKA 4PKYG 2B5RA 4OH0A 4H6JB 2OAP1 4ZTKA 3N8SA 1L0FA 4I3JA 4C3QA 2X01A 4FTXA 3ZQ5A 1ZKJA 3BFDA 1OTDA 1ZC2A 2HDUA 4JF4A 4YOFA 3N6IA 1RP5A 3WS4A 3ISGA 4HIAA 1V9ZA 1P9RA 2XLNA 2VZWA 4GW9A 1H3QA 2V8FA 1LI9A 3E4QA 3MXQA 4R3JA 3MJQA 3ZCZA 1YQSA 4N9KA 2XEPA 1VEUA 5I94A 4G3KA 1X0OA 1K56A 4WZ5C 4EESA 2J80A 5EM0A 3W4QA 2OV5A 2I72A 3A3JA 4Y0TA 1S1YA 4R6LA 2GJ3A 3CI6A 2FH5A 5J4EA 4MLLA 1S4SA 2K2NA 4LLOB 2VLGA 2W3EA 4BD0A 3GMWA 2Y4AA 2QYBA 4ESPA 4JGQA 1NLYA 2HGVA 1DJAA 2YKFA 2W3GA 1KOUA 2WGWA 2VK3A 5JYOA 1PZOA 1I2SA 3L9KA 1ERQA 2PBDP 5CHUA 3WS2A 4RA7A 3G31A 3IHAA 4HJ3A 2AVXA 3NC8A 4XXRA 1L0EA 3ZVWA 1EWZA 3R7WA 3BLMA 3R4KA 2H0YA 4PM5A 3MZEA 4GDBA 4S2JA 1MWUA 3UE3A 1D7EA 4PHTA 1GSVA 5DJTA 3UN7A 5E2GA 1TDGA 3V39A 2HDQA 5CX7A 2J3TD 4QY6A 4DDYA 4E3LA 1A0KA 4BENA 4EBLA 3CUEA 4OQHA 5A93A 1OT6A 3T1SA 4QPRA 2OLUA 2VEAA 5FI7A 1XGJA 4Z9QA 4E3MA 2WZZA 5F82A 1DP8A 2LB9A 3VP2A 5BOHA 4S2NA 4DXCA 2W1TB 1FOFA 5GHZA 3IF6B 3HLFA 4WZ4A 2M1CA 3NULA 4FOFA 3W4PA 2QWSA 1E3UD 2PBYA 4HESA 5L09A 2HF6A 4I38A 1I5QA 2Y55A 3A3DA 1ONGA 1QMFA 1VEUB 1Z09A 3FC7A 3CMZA 4IUHA 3KX0X 1O07A 1KGGA 2Y79A 1ZHHB 4P0MA 3BQAA 4G3VA 1XKZA 1W63M 3KO6A 3AGDA 1PWGA 3IWOA 2J8YA 4K0WA 4Y2FA 4OPYA 2P7JA 5HW3A 2OSUA 3DTEA 2Y2HA 4ZJ1A 1W8YA 1J9MA 2P08A 4FUWA 3H9WA 4KZ4A 3K3CA 1YLWA 1TS6A 3F1OB 4NKPA 1FQGA 4Y13A 4ZAMA 5EVLA 3UPPA 5DJUA 2Y2QA 1W8QA 2WGWB 4OVDA 5FQ9A 5EVIA 3MQOA 3IX8A 4KZ3A 5IT5A 4X53A 1MC0A 3OPLA 4IHQA 3HBRA 3RH8B 1IYOA 2ZC7A 3NDEA 4EW7A 2L4RA 1FCMA 1T19A 3BEBA 3VOLA 5M19A 4Q8IA 3CITA 3M2KA 3HLEA 4B4ZA 5EVIB 4HNBA 5I5LA 4GHIA 3B3XA 1GA9A 4II7A 2EFXA 3OOVA 1N9NA 3LR4A 3BY8A 3LI9A 5FA7A 3A0VA 4KZ8A 1N9OA 3UB8A 3T4QA 2JKGA 3EEHA 3DWZA 2O9AA 3H7WA 5J8XA 3O86A 4CLCA 4GS9B 1S6RA 4HJ4A 3MXSA 4EUVA 1MWRA 4S2NC 2O99A 1FSWA 1DJCA 3GSGA 1S4RA 5A8BA 5HL1A 4Y3IA 1YSPA 1BLHA 3EOIA 5GLDA 3KYZA 3BECA 2Y2NA 4Y0UA 1L0GA 4PPRA 4DJ3A 4LV1A 4NK3A 3R7WB 2DNSA 3F1PA 3VMAA 4P85A 3E2KA 4HBUA 4Q0JA 5FASA 4S2KA 5TBMB 4LV0A 3IQAA 1T1BA 3BY9A 2HP9A 2IWBA 2I9VA 2X02A 2M7UA 3JVUA 1F5MA 2C6WB 3IXHA 3V50A 1VETA 1IFQA 1DRMA 3EGXC 4JF5A 1GHPA 2QPNA 2E8JA 4MN5A 3Q07A 5HAIA 4RX2A 3ZG9B 2R9XA 5HD5A 5CECA 4WEKA 3G2YA 4P87A 3LR0A 2P74A 5AVFA 5A92A 2BLSA 1O7EA 4PM9A 3UB6A 1HZOA 1K38A 2A3UA 3C7VA 2R78A 4MBHA 1Y54A 4E3IA 3PXPA 5JYPA 3D4FA 3VE3A 3M6HA 1ES2A 1NZUA 3V3SA 2Z6DA 5F69A 3NY4A 3OZHA 4GB7A 5HARA 5CHMA 2WGVA 3QNCA 3EGDC 2O0YA 1SCWA 3QP8A 1WYBA 4RX3A 3D9YA 1ZG4A 5M1AA 4LRZE 1D1JA 3A3FA 1T1AA 1VHMA 4S2OA 4BLMA 2NUTC 3C4PA 2JKTM 4R4RA 4LENA 2P04A 1EI5A 4XUXA 1VETB 3OC2A 2VV7A 4LRXC 5E2HA 1ES3A 2VGLS 2VV6A 3VSLA 2K31A 4ETZA 3HLBA 3LO7A 3E4OA 3ZDJA 2Q9NA 2W1TA 3F1NA 1K6RA 3T1XA 2WKEA 4GN2A 4OP5A 3KYEA 3G4PA 1WYCA 2JKRI 1G28A 1W63Q 2O9BA 3O88A 4GKUA 1JTGA 4PM7A 3CHWP 4FH2A 4C75A 2J7VA 3BFFA 4KZAA 3V67A 4MNRA 3TW8A 4GD6A 2WZXA 4O0PA 4CLCD 4JXVA 3OCNA 3CJMA 5LBRA 1RCJA 4OP8A 1JWPA 4K08A 3Q1FA 2MJ6A 4R3BA 3C7UA 3A3IA 2EFUA 4BD1A 1PIOA 3C5AA 3O87A 5E43A 1PW1A 4WUJA 4GLQA 5FQKA 1YLPA 2JKTI 4R38A 4ME4A 1FIKA 4MBFA 5DKLA 1FR6A 3M6BA 3VE4A 3KSFA 2E8IA 4QU3A 3IS2B 1XA1A 3E0YA 4JKTA 3EQUA 3T4TA 2BASA 2Y8HA 3T4KA 4IEDA 3HLDA 1ALQA 1YSQA 4RVAA 3Q7VB 2V1ZA 2WGIA 4QJGA 1GHIA 3BW6A 3P98A 4IBRA 1G6OA 4DF6A 2JKRM 4MDZA 4M3KA 3D72A 5CGXA 1YLZA 2GNXA 3H82A 4K0XA 2B02A 4NXFA 4Y0OA 4OLGA 1P9WA 4N9LA 2PD7A 3A0RA 5J3WA 4KENB 4HP4A 4A5RA 3PBNA 2PD8A 4XUZA 3M2JA 2Y2PA 4HJ6A 1OTIA 3MR0A 5CEDA 1QMEA 4NXEA 4N92A 4L9FA 4E04A 3PBSA 3ZG0A 2HP6A 3IWQA 3OPPA 5DFXA 3DBAA 1PYYA 3MMHA 5F68A 1KDWA 2W3FA 3JVVA 4GHIB 2XFTA 5HDSA 1OJ5A 4FD8A 4MMNA 2WYXA 3W2ZA 4ZDXA 3ZVTA 4R3AA 1N9LA 1VM1A 1JNUA 2XH9A 1DP6A 1PRQA 2IWCA 1XA7A 2WAEA 3KSHA 3HUMA 5HDCA 1XJ2A 4D2OA 5GLAA 3B33A 1IYQA 3IX4A 3AGEA 1IELA 2Y2MA 1OTAA 3LIEA 3UDFA 4U0XA 4OQIA 3DTIA 5FQIA 1YT4A 3BLSA 3N4IA 4DJ2A 2HP5A 3Q81A 1TS8A 3SW1A 3T4OA 2XRNA 4PM8A 4L9EA 3E2LA 1E25A 1LL5A 4Y7PA 4GNUA 3LGOA 1K0KA 3LEZA 2GZAA 1BUEA 4B88A 5AQ9A 2DCFA 2ZQDA 4S2MA 2VGLM 5DF7A 3IF6C 1K6SA 4WZ5A 3BFEA 2G2WA 1N4OA 4JXSA 3LY3A 3FKVA 3V5MA 1T1CA 2OOLA 3F1OA 2ZM2A 5HWTA 1V9YA 3C4OA 2XDMA 1DJBA 1K4EA 1NYMA 3SH8A 1LSWA 2GX5A 4M4XA 3SS3A 1IKIA 2PU2A 2ZQ8A 3CLOA 4IVIA 5K5BA 3O5YA 4XT2B 5IU1A 2PRFA 1K25A 1U60A 4S2LA 2V1BA 1STZA 4WYYA 2HZ5A 3HREA 3CPTA 2Q9MA 4RQ9A 3KSGA 4PMAA 4HBTA 2JC7A 2QMIA 2VGJA 3NCKA 4LFUA 1YKDA 1K54C 1SDNA 1GCEA 2HDRA 3I7JA 5C5KA 4B93A 2JCHA 4UA9A 3CUEC 3LI8A 3VFFA 2Z2LB 4MN6A 1OTBA 1XJ4A 3MZFA 2A2LA 3JYIA 4L0LA 1L0DA 1SDEA 2V1AA 2Y2LA 5KSHA 3N8LA 1IYSA 3H7WB 5HL6A 3W8KA 2XK1A 4BBTA 1FILA 2RCXA 3BWLA 1IOUA 5KMWA 2HJ9C 3GRJA 4F94A 4JGRA 4DE3A 4LCMA 4JXWA 1N9BA 1SKOB 2HDSA 1IKGA 3HVFA 5DF8A 3B47A 2XQZA 3RXXA 4X55A 1FCOA 2Y2KA 2ZC5B 4KG6A 2WKRA 4EEUA 2W0NA 2YKHA 4QWOA 2INWA 2HJEA 2BTFP 4HHDA 5CXWA 3LYXA 1PZPA 3MBZA 5AQ7A 5GLCA 2C5WB 3FYZA 1ES5A 2Y2IA 2OLVA 3HUOA 4KZ7A 3IH8A 3TJZC 4KZ6A 2Z2MB 1ACFA 3HLCA 3K2NA 1YMSA 2IWDA 1EW0A 3PAEA 4DKIA 2FFFB 4I39A 4K91A 4P6ZS 2J3WA 4HP9A 4DE1A 3UB9A 5F5YA 2ZQ9A 1CEFA 3DAVA 4WELA 1NRFA 3ZG7B 4MEZA 5FAPA 5KZHA 1LHYA 4FH4A 1CF0A 1NXYA 1DP9A 3SS4A 3MKFA 1CEGA 5EVID 3ZYTA 5EVEA 4D60A 5TFQA 3T12B 1Q2QA 1OMEA 1SZVA 3IXGA 1ESIA 3TRCA 1XX2A 4U0TA 1W7FA 2XA7S 5AQBA 3IBRA 4OOLA 5HSQA 2CC1A 2KDKA 2PAVP 4WL9A 5DF9A 3T4JA 4O7DA 3NBLA 1CJFA 4CPKA 4LCLA 3NECA 4NETA 4X25A 2EXBA 5A90A 3NHQA 1ERMA 2VKSA 3VOZA 4B4XA 2BG1A 3UMDA 2ZMFA 1H5XA 2H5SA 2VJWA 2W3DA 5HPIA 3G30A 2QKPA 4AFIA 4EQIA 4F3LA 5FDHA 1HLUP 5FQJA 4N1HA 3UNWA 4KG2A 3MFDA 5EUAA 1Y4OA 1OPXA 3QP2A 4H6JA 3VP1A 5G18A 1BZAA 4JGOA 2ZQAA 5HD3A 3SH7A 4KZ9A 2ZL1A 1LI0A 1UWNX 1YLYA 1YPRA 3GDIA 1MY8A 3UE1A 4HOIA 3ZFZA
chains in the Genus database with same CATH topology
5FQKA 4JPMA 4IBXA 2X71A 1YLPA 1DJAA 5CERA 2ZQCA 1PI4A 5CTNA 2WGWA 4MBFA 2WK0A 4X68A 1FR6A 3M6BA 5JYOA 1PZOA 5EECA 2E8IA 3O3VA 4QU3A 3W4OA 1KVMA 1ESUA 1XA1A 2EX9A 2ZC4B 1I2SA 3N8RA 3IHBA 4JKTA 5CGWA 4CJNA 3EQUA 1ERQA 3GVBA 2ZJ9A 4N1XA 5CHUA 3WS2A 4IEDA 2Y91A 3HLDA 4RA7A 1W79A 1DY6A 1ALQA 3G31A 1FR1A 3IHAA 4RVAA 3Q7VB 1JWVA 1NYYA 2PU4A 3NC8A 2V1ZA 2WGIA 4XXRA 4EV4A 4QJGA 1GHIA 1MWTA 1L0EA 3FKWA 1EWZA 3P98A 3ZVWA 4IBRA 3BLMA 5E43A 2H0YA 3FWLA 5DVAA 4PM5A 4DF6A 3MZEA 2EX6A 4GDBA 2RL3A 1W5DA 4M3KA 4WMCD 5AQAA 4S2JA 1ZG6A 3TSGA 5CGXA 1MWUA 1YLZA 3RJUA 1XGIA 3CZDA 4K0XA 1Z6FA 3UE3A 3S22A 2XD1A 4R4SA 3QNBA 4Y0OA 5IHVA 1K55C 3PBTA 5E2FA 5E2GA 3UN7A 1TDGA 4OLGA 5FSRA 2HDQA 3V39A 5DTTA 2A49A 2Y2OA 4DDYA 4QY6A 4N9LA 4E3LA 4BENA 5GHXA 3BYDA 4EBLA 4R23A 3NIAA 4KENB 4A5RA 5DTSA 3PBNA 4OQHA 5EOOA 1LLBA 5TGFA 5A93A 3UPOA 4XUZA 3GR2A 5CTMA 4P6BA 2ZM8A 3M2JA 1YLJA 2XGNA 2OLUA 4GD8A 2Y2PA 5FI7A 1CI8A 1XGJA 3N7WA 4Z9QA 4E3MA 1IYPA 2WZZA 5F82A 3UDIA 4E3NA 5CEDA 1E3UA 4BQMA 4PM6A 1QMEA 4OPQA 3ZNTA 3VP2A 5EVIC 5BOHA 3V3RA 4S2NA 2XF3A 4DXCA 4N92A 4R1GA 1FOFA 1BTLA 3PBSA 5GHZA 3IF6B 3HLFA 1ONHA 4WZ4A 3VP0A 3ZG0A 3SH9A 1KE4A 2HP6A 3IWQA 3OPPA 4JXGA 3W4PA 1E3UD 2PBYA 4HESA 2VGKA 3HLWA 1PYYA 3ZHHA 1KDWA 1I5QA 2Y55A 3SOIA 2XFTA 4KG5A 1BULA 2Y2JA 3UY6A 3A3DA 1ONGA 1QMFA 4FD8A 1G68A 2WYXA 4ZDXA 4OOYA 4QB8A 3OPHA 3G34A 4KQQA 3CMZA 1MKIA 3Q82A 3ZVTA 4C6YA 1KGFA 1O07A 1M6KA 1KGGA 1VM1A 3NDGA 4KQRA 2QZ6A 4P0MA 4ZJ2A 3BRMA 2GDNA 1XKZA 2XH9A 2IWCA 1XA7A 2WAEA 2ZQ7A 5CGSA 3AGDA 4OLDA 3HUMA 1PWGA 4D2OA 5GLAA 3IWOA 2J8YA 4K0WA 1IYQA 4OPYA 4S2IA 5HW3A 3PBRA 1K57A 3MXRA 2OSUA 2P9VB 3VP4A 2Y2HA 4ZJ1A 3Q7ZA 3AGEA 1W8YA 1J9MA 1IELA 1SKFA 2FFYA 2Y2MA 3IWIA 3TOIA 4KZ5A 3UDFA 4U0XA 2V2FF 4OQIA 3ZG5A 4KZ4A 5FQIA 1YT4A 3BLSA 4X69A 2ZC6B 5KSCA 1YLWA 2ZM0A 1YLTA 3N4IA 5M18A 2WUQA 1FQGA 4ZAMA 3ITBA 2HP5A 4WM9A 5EVLA 3Q81A 3UPPA 3VSKA 3IXBA 1PWCA 2Y2QA 1W8QA 2WGWB 3PBQA 4GDNA 4OVDA 4DE0A 4DXBA 5FQ9A 4PM8A 5EVIA 4KZ3A 1S0WA 3E2LA 1E25A 4X53A 5F1GA 5CRFA 1LL5A 1VQQA 4UAAA 3OPLA 4GNUA 4Y7PA 2JBFA 3HBRA 5FQQA 3LCEA 4EBNA 4EBPA 1K4FA 3LEZA 3PAGA 1BUEA 1IYOA 2ZC7A 2ZMAA 2XR0A 3IF6A 3NDEA 5AQ9A 4B88A 1TEMA 2DCFA 2ZQDA 4S2MA 5D3OA 5F83A 3UE0A 5DF7A 1KE0A 1FCMA 3G35A 4H8RA 3BEBA 4JF6A 3RXWA 5M19A 4Q8IA 3IF6C 1K6SA 4WZ5A 3M2KA 3BFEA 1PI5A 3PBOA 2G2WA 1N4OA 3HLEA 3NI9A 4JXSA 5EVIB 4B4ZA 5L2FA 3SS5A 3LY3A 3FKVA 4WEJA 3V5MA 4BL2A 3B3XA 1GA9A 4E6XA 3S1YA 2H0TA 5GLBA 2EFXA 2Y59A 4KZBA 4LV2A 2ZM2A 5CHJA 3C4OA 2XDMA 3WRTA 1DJBA 4DRTA 3GV9A 3ZGAB 5U47A 1K4EA 2H10A 1NYMA 3SH8A 1NY0A 1MPLA 4E3JA 4IVKA 5FA7A 4OKPA 5FI2A 3SS3A 1IKIA 1K57C 1BLSA 2PU2A 4KZ8A 5TR7A 2ZQ8A 3DWKA 4EWFA 1GHMA 4IVIA 1CK3A 2XD5A 3MZDA 1GA0A 3ZNYA 3DWZA 1K25A 2JE5A 1U60A 4FSFA 5J8XA 4S2LA 2J9PA 3BM6A 4QHCA 4BJPA 5F1FA 3O86A 4WYYA 2ZD8A 5HAPA 3HREA 5EPHA 1S6RA 1L2SA 3MXSA 4YINA 2Q9MA 3PTEA 1MWRA 4S2NC 4QY5A 1FSWA 4HBTA 1DJCA 4OQGA 4PMAA 2JC7A 3GSGA 2QMIA 3A3EA 1H8ZA 4WMCA 1BLCA 5HL1A 2VGJA 3NCKA 4OPRA 1CI9A 2UWXA 1BLHA 1FSYA 1K54C 1SDNA 4ZBEA 5GLDA 3UDXA 1GCEA 4UA7A 1PW8A 2HDRA 3ZG8B 3CG5A 3I7JA 4JLFA 3BECA 4OPZA 3WRZA 5DTKA 2JCHA 2Y2NA 4R0QA 4Y0UA 1L0GA 4PPRA 4LV1A 1YMXA 2P9VA 4NK3A 4UA9A 1BLPA 2DNSA 3VFFA 2Z2LB 1FCNA 1MWSA 4E3KA 2ZC3B 3BFCA 1MBLA 3VMAA 3MZFA 4P85A 3E2KA 2EX8A 4HBUA 3JYIA 4L0LA 5FASA 1L0DA 1RGZA 1SDEA 2G2UA 4S2KA 4RYEA 2Y2LA 5KSHA 3N8LA 4ID4A 1IYSA 3WS5A 5HX9A 4BL3A 3W8KA 3HLGA 3IQAA 4LV0A 5EOEA 2WADA 2XK1A 3HUNA 3VOYA 4DE2A 1KE3A 3OPRA 2Y2GA 2RCXA 2HP9A 3HL9A 2IWBA 4E6WA 2X02A 5KMWA 4KQOA 3GRJA 4F94A 2C6WB 3EQVA 3IXHA 2DRWA 4DE3A 4LCMA 2XFSA 1N9BA 4JXWA 3V50A 2HDSA 1IKGA 1BT5A 3HVFA 2WKHA 4UHUA 5DF8A 2XQZA 3RXXA 4JBFA 1PWDA 4HEFA 4X55A 1FCOA 5A91A 2EX2A 3BFGA 5FATA 2Y2KA 3G32A 3FV7A 3OCLA 2ZC5B 3QHYA 4JF5A 5EE8A 1GHPA 4KG6A 4MBKA 2QPNA 1NJ4A 3AGFA 5CXWA 1PZPA 3Q07A 5HAIA 4X56A 1RGYA 3IT9A 3MBZA 5AQ7A 4U3TA 5GLCA 2C5WB 5GL9A 3FYZA 4RX2A 3GQZA 3ZG9B 1ES5A 2Y2IA 1HVBA 1JWZA 2OLVA 2R9XA 3HUOA 4KZ7A 5FAQA 2WKIA 5CECA 3IH8A 4WEKA 3G2YA 4P87A 4KZ6A 2Z2MB 3HLCA 5FAOA 1BSGA 1KGEA 2P74A 3Q7VA 1KDSA 3IH9A 1JVJA 1K54A 1H8YA 5A92A 1XXMA 1YMSA 2BLSA 1O7EA 4PM9A 2IWDA 1HZOA 1K38A 2A3UA 1Q2PA 3WS0A 3C7VA 3WS1A 4DDSA 1JTDA 3PAEA 5FQMA 4MBHA 4DKIA 1Y54A 4E3IA 2FFFB 3P09A 4K91A 5FI6A 5JYPA 3D4FA 1C3BA 2ZLYA 5E2EA 3DW0A 1WE4A 4E3OA 3M6HA 4DE1A 4FCFA 1AXBA 1IEMA 3S4XA 2ZQ9A 1CEFA 1YM1A 4WELA 1ES2A 1NRFA 1NZUA 3VFHA 3V3SA 4MEZA 3ZG7B 1G6AA 1KVLA 3IF5A 5FAPA 3NY4A 5KZHA 3OZHA 4GB7A 2B5RA 1LHYA 4OH0A 5HARA 4FH4A 5CHMA 1NXYA 5GHYA 3SS4A 3MKFA 1CEGA 1HTZA 2WGVA 3QNCA 4ZTKA 3N8SA 5EVID 4EUZA 1L0FA 3G2ZA 1TVFA 2WAFA 5HFOA 1K55A 1SCWA 4GZBA 1WYBA 4RX3A 4C3QA 1ZG4A 5TFQA 2X01A 5M1AA 3VP3A 1Q2QA 1OMEA 3A3FA 4S2OA 4BLMA 1ZKJA 1ESIA 3IXGA 3BFDA 3C4PA 4OOMA 3GTCA 3IXDA 4R4RA 4LENA 1XX2A 1MXOA 1ZC2A 4U0TA 1EI5A 1W7FA 2HDUA 4JF4A 4XUXA 5AQBA 4OQ0A 3OC2A 1LL9A 3DTMA 4OOLA 3FZCA 3N6IA 2CC1A 1RP5A 3WS4A 1TDLA 3ISGA 5E2HA 1ES4A 1ES3A 1I2WA 5DF9A 3VSLA 3HLBA 3LO7A 4O7DA 3NBLA 3ZDJA 4CPKA 2Q9NA 2XLNA 4LCLA 1K6RA 1E4DA 4NETA 2WKEA 4QD4A 3ITAA 4LV3A 1LI9A 4GN2A 2EXBA 4OP5A 5A90A 3WWXA 1EROA 1ERMA 1K56D 4R3JA 3VOZA 4B4XA 3G4PA 3LY4A 4ZJ3A 3ZCZA 3UO9A 1YQSA 4N9KA 2XEPA 2BG1A 3UPNA 1WYCA 2EXAA 1H5XA 5I94A 4UA6A 4WBGA 2H5SA 3O88A 3MKEA 1K56A 4OONA 4WZ5C 3G30A 4GKUA 1XP4A 3W4QA 2OV5A 1XPBA 5CEBA 1JTGA 4PM7A 4X6TA 4EQIA 2I72A 5FDHA 1HD8A 3A3JA 2R9WA 4FH2A 4C75A 5FQJA 4N1HA 1NZOA 2J7VA 2HPBA 3BFFA 4KZAA 4YFMA 4Y0TA 3UNWA 4KG2A 4MNRA 4S2PA 4GD6A 2WZXA 3MFDA 4JXVA 2J9OA 3OCNA 3CJMA 5EUAA 1M40A 3TG9A 1SHVA 4MLLA 4GOGA 3VP1A 5G18A 1RCJA 5HAQA 1BZAA 4BD0A 2ZQAA 3GMWA 2Y4AA 1JWPA 4OP8A 2V20A 3Q1FA 3SH7A 4R3BA 4KZ9A 1LI0A 3C7UA 1YLYA 3A3IA 1MY8A 2EFUA 3UE1A 3ZFZA 1PIOA 4BD1A 3C5AA 3O87A 1PW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQK A;  4JPM A;  4IBX A;  2X71 A;  1YLP A;  1DJA A;  5CER A;  2ZQC A;  1PI4 A;  5CTN A;  2WGW A;  4MBF A;  2WK0 A;  4X68 A;  1FR6 A;  3M6B A;  5JYO A;  1PZO A;  5EEC A;  2E8I A;  3O3V A;  4QU3 A;  3W4O A;  1KVM A;  1ESU A;  1XA1 A;  2EX9 A;  2ZC4 B;  1I2S A;  3N8R A;  3IHB A;  4JKT A;  5CGW A;  4CJN A;  3EQU A;  1ERQ A;  3GVB A;  2ZJ9 A;  4N1X A;  5CHU A;  3WS2 A;  4IED A;  2Y91 A;  3HLD A;  4RA7 A;  1W79 A;  1DY6 A;  1ALQ A;  3G31 A;  1FR1 A;  3IHA A;  4RVA A;  3Q7V B;  1JWV A;  1NYY A;  2PU4 A;  3NC8 A;  2V1Z A;  2WGI A;  4XXR A;  4EV4 A;  4QJG A;  1GHI A;  1MWT A;  1L0E A;  3FKW A;  1EWZ A;  3P98 A;  3ZVW A;  4IBR A;  3BLM A;  5E43 A;  2H0Y A;  3FWL A;  5DVA A;  4PM5 A;  4DF6 A;  3MZE A;  2EX6 A;  4GDB A;  2RL3 A;  1W5D A;  4M3K A;  4WMC D;  5AQA A;  4S2J A;  1ZG6 A;  3TSG A;  5CGX A;  1MWU A;  1YLZ A;  3RJU A;  1XGI A;  3CZD A;  4K0X A;  1Z6F A;  3UE3 A;  3S22 A;  2XD1 A;  4R4S A;  3QNB A;  4Y0O A;  5IHV A;  1K55 C;  3PBT A;  5E2F A;  5E2G A;  3UN7 A;  1TDG A;  4OLG A;  5FSR A;  2HDQ A;  3V39 A;  5DTT A;  2A49 A;  2Y2O A;  4DDY A;  4QY6 A;  4N9L A;  4E3L A;  4BEN A;  5GHX A;  3BYD A;  4EBL A;  4R23 A;  3NIA A;  4KEN B;  4A5R A;  5DTS A;  3PBN A;  4OQH A;  5EOO A;  1LLB A;  5TGF A;  5A93 A;  3UPO A;  4XUZ A;  3GR2 A;  5CTM A;  4P6B A;  2ZM8 A;  3M2J A;  1YLJ A;  2XGN A;  2OLU A;  4GD8 A;  2Y2P A;  5FI7 A;  1CI8 A;  1XGJ A;  3N7W A;  4Z9Q A;  4E3M A;  1IYP A;  2WZZ A;  5F82 A;  3UDI A;  4E3N A;  5CED A;  1E3U A;  4BQM A;  4PM6 A;  1QME A;  4OPQ A;  3ZNT A;  3VP2 A;  5EVI C;  5BOH A;  3V3R A;  4S2N A;  2XF3 A;  4DXC A;  4N92 A;  4R1G A;  1FOF A;  1BTL A;  3PBS A;  5GHZ A;  3IF6 B;  3HLF A;  1ONH A;  4WZ4 A;  3VP0 A;  3ZG0 A;  3SH9 A;  1KE4 A;  2HP6 A;  3IWQ A;  3OPP A;  4JXG A;  3W4P A;  1E3U D;  2PBY A;  4HES A;  2VGK A;  3HLW A;  1PYY A;  3ZHH A;  1KDW A;  1I5Q A;  2Y55 A;  3SOI A;  2XFT A;  4KG5 A;  1BUL A;  2Y2J A;  3UY6 A;  3A3D A;  1ONG A;  1QMF A;  4FD8 A;  1G68 A;  2WYX A;  4ZDX A;  4OOY A;  4QB8 A;  3OPH A;  3G34 A;  4KQQ A;  3CMZ A;  1MKI A;  3Q82 A;  3ZVT A;  4C6Y A;  1KGF A;  1O07 A;  1M6K A;  1KGG A;  1VM1 A;  3NDG A;  4KQR A;  2QZ6 A;  4P0M A;  4ZJ2 A;  3BRM A;  2GDN A;  1XKZ A;  2XH9 A;  2IWC A;  1XA7 A;  2WAE A;  2ZQ7 A;  5CGS A;  3AGD A;  4OLD A;  3HUM A;  1PWG A;  4D2O A;  5GLA A;  3IWO A;  2J8Y A;  4K0W A;  1IYQ A;  4OPY A;  4S2I A;  5HW3 A;  3PBR A;  1K57 A;  3MXR A;  2OSU A;  2P9V B;  3VP4 A;  2Y2H A;  4ZJ1 A;  3Q7Z A;  3AGE A;  1W8Y A;  1J9M A;  1IEL A;  1SKF A;  2FFY A;  2Y2M A;  3IWI A;  3TOI A;  4KZ5 A;  3UDF A;  4U0X A;  2V2F F;  4OQI A;  3ZG5 A;  4KZ4 A;  5FQI A;  1YT4 A;  3BLS A;  4X69 A;  2ZC6 B;  5KSC A;  1YLW A;  2ZM0 A;  1YLT A;  3N4I A;  5M18 A;  2WUQ A;  1FQG A;  4ZAM A;  3ITB A;  2HP5 A;  4WM9 A;  5EVL A;  3Q81 A;  3UPP A;  3VSK A;  3IXB A;  1PWC A;  2Y2Q A;  1W8Q A;  2WGW B;  3PBQ A;  4GDN A;  4OVD A;  4DE0 A;  4DXB A;  5FQ9 A;  4PM8 A;  5EVI A;  4KZ3 A;  1S0W A;  3E2L A;  1E25 A;  4X53 A;  5F1G A;  5CRF A;  1LL5 A;  1VQQ A;  4UAA A;  3OPL A;  4GNU A;  4Y7P A;  2JBF A;  3HBR A;  5FQQ A;  3LCE A;  4EBN A;  4EBP A;  1K4F A;  3LEZ A;  3PAG A;  1BUE A;  1IYO A;  2ZC7 A;  2ZMA A;  2XR0 A;  3IF6 A;  3NDE A;  5AQ9 A;  4B88 A;  1TEM A;  2DCF A;  2ZQD A;  4S2M A;  5D3O A;  5F83 A;  3UE0 A;  5DF7 A;  1KE0 A;  1FCM A;  3G35 A;  4H8R A;  3BEB A;  4JF6 A;  3RXW A;  5M19 A;  4Q8I A;  3IF6 C;  1K6S A;  4WZ5 A;  3M2K A;  3BFE A;  1PI5 A;  3PBO A;  2G2W A;  1N4O A;  3HLE A;  3NI9 A;  4JXS A;  5EVI B;  4B4Z A;  5L2F A;  3SS5 A;  3LY3 A;  3FKV A;  4WEJ A;  3V5M A;  4BL2 A;  3B3X A;  1GA9 A;  4E6X A;  3S1Y A;  2H0T A;  5GLB A;  2EFX A;  2Y59 A;  4KZB A;  4LV2 A;  2ZM2 A;  5CHJ A;  3C4O A;  2XDM A;  3WRT A;  1DJB A;  4DRT A;  3GV9 A;  3ZGA B;  5U47 A;  1K4E A;  2H10 A;  1NYM A;  3SH8 A;  1NY0 A;  1MPL A;  4E3J A;  4IVK A;  5FA7 A;  4OKP A;  5FI2 A;  3SS3 A;  1IKI A;  1K57 C;  1BLS A;  2PU2 A;  4KZ8 A;  5TR7 A;  2ZQ8 A;  3DWK A;  4EWF A;  1GHM A;  4IVI A;  1CK3 A;  2XD5 A;  3MZD A;  1GA0 A;  3ZNY A;  3DWZ A;  1K25 A;  2JE5 A;  1U60 A;  4FSF A;  5J8X A;  4S2L A;  2J9P A;  3BM6 A;  4QHC A;  4BJP A;  5F1F A;  3O86 A;  4WYY A;  2ZD8 A;  5HAP A;  3HRE A;  5EPH A;  1S6R A;  1L2S A;  3MXS A;  4YIN A;  2Q9M A;  3PTE A;  1MWR A;  4S2N C;  4QY5 A;  1FSW A;  4HBT A;  1DJC A;  4OQG A;  4PMA A;  2JC7 A;  3GSG A;  2QMI A;  3A3E A;  1H8Z A;  4WMC A;  1BLC A;  5HL1 A;  2VGJ A;  3NCK A;  4OPR A;  1CI9 A;  2UWX A;  1BLH A;  1FSY A;  1K54 C;  1SDN A;  4ZBE A;  5GLD A;  3UDX A;  1GCE A;  4UA7 A;  1PW8 A;  2HDR A;  3ZG8 B;  3CG5 A;  3I7J A;  4JLF A;  3BEC A;  4OPZ A;  3WRZ A;  5DTK A;  2JCH A;  2Y2N A;  4R0Q A;  4Y0U A;  1L0G A;  4PPR A;  4LV1 A;  1YMX A;  2P9V A;  4NK3 A;  4UA9 A;  1BLP A;  2DNS A;  3VFF A;  2Z2L B;  1FCN A;  1MWS A;  4E3K A;  2ZC3 B;  3BFC A;  1MBL A;  3VMA A;  3MZF A;  4P85 A;  3E2K A;  2EX8 A;  4HBU A;  3JYI A;  4L0L A;  5FAS A;  1L0D A;  1RGZ A;  1SDE A;  2G2U A;  4S2K A;  4RYE A;  2Y2L A;  5KSH A;  3N8L A;  4ID4 A;  1IYS A;  3WS5 A;  5HX9 A;  4BL3 A;  3W8K A;  3HLG A;  3IQA A;  4LV0 A;  5EOE A;  2WAD A;  2XK1 A;  3HUN A;  3VOY A;  4DE2 A;  1KE3 A;  3OPR A;  2Y2G A;  2RCX A;  2HP9 A;  3HL9 A;  2IWB A;  4E6W A;  2X02 A;  5KMW A;  4KQO A;  3GRJ A;  4F94 A;  2C6W B;  3EQV A;  3IXH A;  2DRW A;  4DE3 A;  4LCM A;  2XFS A;  1N9B A;  4JXW A;  3V50 A;  2HDS A;  1IKG A;  1BT5 A;  3HVF A;  2WKH A;  4UHU A;  5DF8 A;  2XQZ A;  3RXX A;  4JBF A;  1PWD A;  4HEF A;  4X55 A;  1FCO A;  5A91 A;  2EX2 A;  3BFG A;  5FAT A;  2Y2K A;  3G32 A;  3FV7 A;  3OCL A;  2ZC5 B;  3QHY A;  4JF5 A;  5EE8 A;  1GHP A;  4KG6 A;  4MBK A;  2QPN A;  1NJ4 A;  3AGF A;  5CXW A;  1PZP A;  3Q07 A;  5HAI A;  4X56 A;  1RGY A;  3IT9 A;  3MBZ A;  5AQ7 A;  4U3T A;  5GLC A;  2C5W B;  5GL9 A;  3FYZ A;  4RX2 A;  3GQZ A;  3ZG9 B;  1ES5 A;  2Y2I A;  1HVB A;  1JWZ A;  2OLV A;  2R9X A;  3HUO A;  4KZ7 A;  5FAQ A;  2WKI A;  5CEC A;  3IH8 A;  4WEK A;  3G2Y A;  4P87 A;  4KZ6 A;  2Z2M B;  3HLC A;  5FAO A;  1BSG A;  1KGE A;  2P74 A;  3Q7V A;  1KDS A;  3IH9 A;  1JVJ A;  1K54 A;  1H8Y A;  5A92 A;  1XXM A;  1YMS A;  2BLS A;  1O7E A;  4PM9 A;  2IWD A;  1HZO A;  1K38 A;  2A3U A;  1Q2P A;  3WS0 A;  3C7V A;  3WS1 A;  4DDS A;  1JTD A;  3PAE A;  5FQM A;  4MBH A;  4DKI A;  1Y54 A;  4E3I A;  2FFF B;  3P09 A;  4K91 A;  5FI6 A;  5JYP A;  3D4F A;  1C3B A;  2ZLY A;  5E2E A;  3DW0 A;  1WE4 A;  4E3O A;  3M6H A;  4DE1 A;  4FCF A;  1AXB A;  1IEM A;  3S4X A;  2ZQ9 A;  1CEF A;  1YM1 A;  4WEL A;  1ES2 A;  1NRF A;  1NZU A;  3VFH A;  3V3S A;  4MEZ A;  3ZG7 B;  1G6A A;  1KVL A;  3IF5 A;  5FAP A;  3NY4 A;  5KZH A;  3OZH A;  4GB7 A;  2B5R A;  1LHY A;  4OH0 A;  5HAR A;  4FH4 A;  5CHM A;  1NXY A;  5GHY A;  3SS4 A;  3MKF A;  1CEG A;  1HTZ A;  2WGV A;  3QNC A;  4ZTK A;  3N8S A;  5EVI D;  4EUZ A;  1L0F A;  3G2Z A;  1TVF A;  2WAF A;  5HFO A;  1K55 A;  1SCW A;  4GZB A;  1WYB A;  4RX3 A;  4C3Q A;  1ZG4 A;  5TFQ A;  2X01 A;  5M1A A;  3VP3 A;  1Q2Q A;  1OME A;  3A3F A;  4S2O A;  4BLM A;  1ZKJ A;  1ESI A;  3IXG A;  3BFD A;  3C4P A;  4OOM A;  3GTC A;  3IXD A;  4R4R A;  4LEN A;  1XX2 A;  1MXO A;  1ZC2 A;  4U0T A;  1EI5 A;  1W7F A;  2HDU A;  4JF4 A;  4XUX A;  5AQB A;  4OQ0 A;  3OC2 A;  1LL9 A;  3DTM A;  4OOL A;  3FZC A;  3N6I A;  2CC1 A;  1RP5 A;  3WS4 A;  1TDL A;  3ISG A;  5E2H A;  1ES4 A;  1ES3 A;  1I2W A;  5DF9 A;  3VSL A;  3HLB A;  3LO7 A;  4O7D A;  3NBL A;  3ZDJ A;  4CPK A;  2Q9N A;  2XLN A;  4LCL A;  1K6R A;  1E4D A;  4NET A;  2WKE A;  4QD4 A;  3ITA A;  4LV3 A;  1LI9 A;  4GN2 A;  2EXB A;  4OP5 A;  5A90 A;  3WWX A;  1ERO A;  1ERM A;  1K56 D;  4R3J A;  3VOZ A;  4B4X A;  3G4P A;  3LY4 A;  4ZJ3 A;  3ZCZ A;  3UO9 A;  1YQS A;  4N9K A;  2XEP A;  2BG1 A;  3UPN A;  1WYC A;  2EXA A;  1H5X A;  5I94 A;  4UA6 A;  4WBG A;  2H5S A;  3O88 A;  3MKE A;  1K56 A;  4OON A;  4WZ5 C;  3G30 A;  4GKU A;  1XP4 A;  3W4Q A;  2OV5 A;  1XPB A;  5CEB A;  1JTG A;  4PM7 A;  4X6T A;  4EQI A;  2I72 A;  5FDH A;  1HD8 A;  3A3J A;  2R9W A;  4FH2 A;  4C75 A;  5FQJ A;  4N1H A;  1NZO A;  2J7V A;  2HPB A;  3BFF A;  4KZA A;  4YFM A;  4Y0T A;  3UNW A;  4KG2 A;  4MNR A;  4S2P A;  4GD6 A;  2WZX A;  3MFD A;  4JXV A;  2J9O A;  3OCN A;  3CJM A;  5EUA A;  1M40 A;  3TG9 A;  1SHV A;  4MLL A;  4GOG A;  3VP1 A;  5G18 A;  1RCJ A;  5HAQ A;  1BZA A;  4BD0 A;  2ZQA A;  3GMW A;  2Y4A A;  1JWP A;  4OP8 A;  2V20 A;  3Q1F A;  3SH7 A;  4R3B A;  4KZ9 A;  1LI0 A;  3C7U A;  1YLY A;  3A3I A;  1MY8 A;  2EFU A;  3UE1 A;  3ZFZ A;  1PIO A;  4BD1 A;  3C5A A;  3O87 A;  1PW1 A; 
#chains in the Genus database with same CATH topology
 3CAX A;  4JPM A;  3C8C A;  5AVE A;  4EER A;  5CER A;  2ZQC A;  5CTN A;  2EWW A;  2WK0 A;  3T50 A;  3RFB A;  4JGP A;  2EX9 A;  3IHB A;  5CGW A;  2K7S A;  2PT7 A;  4EET B;  4N1X A;  2PYR A;  2Y91 A;  1W79 A;  2ZOH A;  1DY6 A;  1FR1 A;  1JWV A;  1NYY A;  2PU4 A;  4EV4 A;  3HJI A;  1MWT A;  3FKW A;  4Y15 A;  5HDD A;  5DVA A;  2RL3 A;  1W5D A;  5AQA A;  3TSG A;  3RJU A;  3CZD A;  1Z6F A;  4I3A A;  3S22 A;  4R4S A;  5IHV A;  3QNB A;  5E2F A;  1Y28 A;  5FSR A;  2A49 A;  2W1R A;  5DTS A;  5EOO A;  1LLB A;  3LUQ A;  5TGF A;  3GR2 A;  1S66 L;  1YLJ A;  4GD8 A;  3N7W A;  4E3N A;  5EM1 A;  2ZMV A;  3ZNT A;  5EVI C;  5MC7 A;  3V3R A;  2XF3 A;  1BTL A;  1ONH A;  3VP0 A;  3SH9 A;  3DTK A;  4JXG A;  3HLW A;  4X1M A;  3T4L A;  3ZHH A;  1BUL A;  1OT9 A;  3UY6 A;  4OOY A;  4QB8 A;  3OPH A;  3G34 A;  1L3L A;  3C38 A;  4C6Y A;  1M6K A;  3NDG A;  3BQ8 A;  4KQR A;  2QZ6 A;  3BRM A;  2JN7 A;  2GDN A;  4MN7 A;  2PDR A;  4YWZ A;  5CGS A;  1PFL A;  3S7O A;  2D01 A;  4XT2 A;  2PYP A;  1P0Z A;  3LIF A;  1K57 A;  3MXR A;  2P9V B;  3MSH A;  3Q7Z A;  1S1Z A;  2FFY A;  3IWI A;  3LIC A;  4GJ4 A;  3ZG5 A;  4X69 A;  1YLT A;  5M18 A;  3ITB A;  2V9A A;  4KQD A;  4WM9 A;  2QJ7 A;  4DN0 A;  3IXB A;  2D02 A;  4IJG A;  3PBQ A;  4GDN A;  4DE0 A;  4DXB A;  2IA2 A;  4L9G A;  4WLA A;  5CRF A;  1VQQ A;  4UAA A;  3OLO A;  2JBF A;  5FQQ A;  3NJA A;  3LID A;  5FEF A;  4EBN A;  1K4F A;  2ZMA A;  4BBU A;  5D3O A;  1KE0 A;  1LT0 A;  1TF1 A;  1WA9 A;  1PI5 A;  3PBO A;  1D06 A;  3QP5 A;  3SS5 A;  2VA0 A;  4WEJ A;  5EV0 A;  4BL2 A;  3GEC A;  3PHY A;  2Q0O A;  3S1Y A;  4E6X A;  4LV2 A;  4ARZ A;  5CHJ A;  2VV8 A;  3SZT A;  1NY0 A;  4E3J A;  1F2K A;  4IVK A;  4OKP A;  5FI2 A;  1GSX A;  1K57 C;  3DWK A;  5HWW A;  2O9C A;  1NRJ A;  1CK3 A;  2XD5 A;  3MZD A;  3MFX A;  1GA0 A;  1PNE A;  2JE5 A;  3FPW A;  2J9P A;  3BM6 A;  4QHC A;  4BJP A;  5F1F A;  1NLZ A;  4YIN A;  2Z6C A;  2PHY A;  4IUK A;  2M7V A;  3PTE A;  4CLC C;  1OTE A;  4OQG A;  5DFY A;  1MKM A;  2B95 A;  4WMC A;  1CI9 A;  2UWX A;  1FSY A;  3NOU C;  3UDX A;  1PW8 A;  4ZRR A;  4GS9 A;  3T1R A;  3ZG8 B;  3CG5 A;  3BJN A;  4JLF A;  4WN5 A;  5TBM A;  4R0Q A;  2P9V A;  1BLP A;  4HQA A;  4E3K A;  3BFC A;  2WKQ A;  5EOE A;  3VOY A;  4DE2 A;  1KE3 A;  3MF0 A;  3OPR A;  5L10 A;  2ZBB A;  3HL9 A;  4KQO A;  1CQA A;  4MCW A;  3EQV A;  3B42 A;  4B9O A;  2OWH A;  4LPZ A;  3K3D A;  2WKH A;  4UHU A;  5TJJ A;  4JBF A;  4HEF A;  5A91 A;  5L07 A;  2EX2 A;  3BFG A;  2A24 A;  2L1M A;  3QHY A;  3HCY A;  5EE8 A;  1NJ4 A;  3NOT C;  3UB5 P;  4X56 A;  1RGY A;  3IX3 A;  2XSS A;  3LFV A;  5GL9 A;  3GQZ A;  1HVB A;  1JWZ A;  5G4Z A;  1VB6 A;  5FAQ A;  3ICY A;  3U2A A;  3JPU A;  5FAO A;  1BSG A;  1JVJ A;  1XXM A;  3WS1 A;  4DDS A;  1JTD A;  5FQM A;  3P09 A;  5FI6 A;  1C3B A;  2ZLY A;  5E2E A;  3DW0 A;  1LSX A;  1WE4 A;  4E3O A;  4FCF A;  3S4X A;  1H8M A;  1YM1 A;  3IF5 A;  4DMZ A;  4NXB A;  4NG2 A;  4LRY C;  5GHY A;  1HTZ A;  1P97 A;  4EUZ A;  3G2Z A;  1OJG A;  1TVF A;  2WAF A;  5HFO A;  1K55 A;  4GZB A;  3UB7 A;  3S7P A;  3VP3 A;  4KUK A;  2JKF A;  3ULF A;  3LR3 A;  4F3L B;  4OOM A;  3GTC A;  3IXD A;  1MXO A;  2QJ5 A;  3UME A;  4OQ0 A;  1LL9 A;  3DTM A;  3FZC A;  1TDL A;  1LSV A;  1ES4 A;  1I2W A;  3C2W A;  4EXO A;  1XFN A;  1MZU A;  1ODV A;  4ETX A;  1LL8 A;  1E4D A;  4QD4 A;  3ITA A;  4LV3 A;  3LEQ A;  1YAX A;  3WWX A;  4PAU A;  1ERO A;  1K56 D;  3S7Q A;  4Q0I A;  3LY4 A;  4ZJ3 A;  1NWZ A;  2W3H A;  2H28 A;  3QP6 A;  3UPN A;  2EXA A;  4R70 A;  4UA6 A;  4WBG A;  5FDS A;  2J3T C;  3MKE A;  5L8M A;  4OON A;  1H0M A;  1XP4 A;  1XPB A;  5CEB A;  4X6T A;  1HD8 A;  2R9W A;  5J7E A;  1NZO A;  2HPB A;  4YFM A;  5AJG A;  1J3W A;  4S2P A;  3IBJ A;  2J9O A;  4PKY A;  3TG9 A;  1M40 A;  1SHV A;  4GOG A;  3LIB A;  5HAQ A;  4EQ1 A;  1XJ6 A;  3KSI A;  2V20 A;  4WF0 A;  1UWP X;  3UO9 A;  3MQQ A;  2ZOI A;  2KOI A;  2G7U A;  4IBX A;  2X71 A;  1PI4 A;  3F1P B;  4GCZ A;  4X68 A;  5EEC A;  3O3V A;  3P01 A;  4NEE D;  3W4O A;  1KVM A;  1ESU A;  2ZC4 B;  4UEY A;  4EEP A;  4P6Z M;  3N8R A;  4UQI M;  4CJN A;  5HZH A;  3GVB A;  2ZJ9 A;  3NOP C;  1SKO A;  3G6O A;  3FPV A;  4Q0H A;  1UGU A;  4CLC B;  3FWL A;  2EX6 A;  3VV4 A;  1AWI A;  4KUO A;  4WMC D;  1ZG6 A;  1BYW A;  1XGI A;  5HPF A;  5KIZ A;  1TS7 A;  2XD1 A;  2KX6 A;  2XA7 M;  1K55 C;  3PBT A;  1G5U A;  3RTY A;  2V8C A;  3E98 A;  2OWJ A;  5DTT A;  2Y2O A;  1ZTU A;  5GHX A;  3BYD A;  4R23 A;  3NIA A;  3UPO A;  5CTM A;  4P6B A;  2ZM8 A;  2XGN A;  1CI8 A;  2V0U A;  4LGW A;  1IYP A;  3A0S A;  3UDI A;  2B18 A;  1E3U A;  4HY8 A;  4BQM A;  4PM6 A;  4OPQ A;  4R1G A;  2JHE A;  2EA9 A;  1KE4 A;  3IS2 A;  2LB5 A;  2VGK A;  3F1N B;  3SOI A;  4KG5 A;  2Y2J A;  1G68 A;  4ARZ B;  3EEA A;  3T4S A;  4KQQ A;  1MKI A;  3Q82 A;  1KGF A;  4Z1W A;  1XFQ A;  4ZJ2 A;  1S67 L;  4Y17 A;  3EWK A;  2ZQ7 A;  3MS6 A;  4OLD A;  5IS1 A;  4S2I A;  3PBR A;  1GSW A;  3VP4 A;  2KLI A;  1SKF A;  3TOI A;  2A24 B;  4KZ5 A;  2V2F F;  3FG8 A;  2ZC6 B;  3S7N A;  5KSC A;  5G4Y A;  5HWV A;  2ZM0 A;  2WUQ A;  3VSK A;  1PWC A;  2UV0 E;  1S0W A;  5F1G A;  3LCE A;  3MQ0 A;  4EBP A;  3PAG A;  2XR0 A;  3IF6 A;  1TEM A;  5F83 A;  3UE0 A;  4NXG A;  5F6A A;  4O01 A;  3G35 A;  4H8R A;  4JF6 A;  3RXW A;  4BBV A;  3NI9 A;  5L2F A;  2OAQ 1;  2PR5 A;  2H0T A;  5GLB A;  1T18 A;  4CQH A;  4G3W A;  2Y59 A;  4KZB A;  4Y5F A;  2EWV A;  3WRT A;  4DRT A;  3GV9 A;  3ZGA B;  4EU0 A;  2QHK A;  2WKP A;  5U47 A;  2H10 A;  1MPL A;  2L0W A;  3LR5 A;  1F98 A;  1BLS A;  4EWF A;  5TR7 A;  4I3I A;  3H82 B;  2ZL1 B;  1GHM A;  3CWF A;  3ZNY A;  4FSF A;  5DKK A;  2ZD8 A;  5HAP A;  5EPH A;  4HI4 A;  1L2S A;  3E4P A;  3PYP A;  3LIA A;  4QY5 A;  2FZ0 A;  3A3E A;  1H8Z A;  1BLC A;  1TD5 A;  4OPR A;  4ZBE A;  3CPT B;  4UA7 A;  4I5S A;  4OPZ A;  3C30 A;  3WRZ A;  5DTK A;  4HH2 A;  1YMX A;  3P7N A;  2CMN A;  1FCN A;  1MWS A;  4HH3 A;  2ZC3 B;  1MBL A;  2W27 A;  4YNR A;  3PR6 A;  2EX8 A;  4UQI S;  1RGZ A;  2G2U A;  4RYE A;  4ID4 A;  3WS5 A;  5HX9 A;  4BL3 A;  3HLG A;  2WAD A;  3HUN A;  2Y2G A;  4CLC E;  4E6W A;  3L7H A;  2DRW A;  1TS0 A;  2XFS A;  4X1L A;  1BT5 A;  1PWD A;  2ACG A;  5FAT A;  2VX8 A;  3G32 A;  3FV7 A;  3OCL A;  1F9I A;  2DMW A;  4MBK A;  3QP1 A;  3AGF A;  3U4L P;  3QP4 A;  3IT9 A;  4U3T A;  5FEG A;  5EFW A;  5FL3 A;  2WKI A;  1KGE A;  2NUP C;  3Q7V A;  1KDS A;  3IH9 A;  3TE8 A;  1K54 A;  1H8Y A;  3D3O A;  3OBF A;  2XRO A;  4BMW A;  1Q2P A;  3T1Q B;  3WS0 A;  4O8G A;  3KYQ A;  3UE6 A;  1XJ3 A;  4BWI A;  1AXB A;  1IEM A;  2V0W A;  3VFH A;  1G6A A;  1KVL A;  2HV1 A;  2PR6 A;  3HJK A;  4PKY G;  2B5R A;  4OH0 A;  4H6J B;  2OAP 1;  4ZTK A;  3N8S A;  1L0F A;  4I3J A;  4C3Q A;  2X01 A;  4FTX A;  3ZQ5 A;  1ZKJ A;  3BFD A;  1OTD A;  1ZC2 A;  2HDU A;  4JF4 A;  4YOF A;  3N6I A;  1RP5 A;  3WS4 A;  3ISG A;  4HIA A;  1V9Z A;  1P9R A;  2XLN A;  2VZW A;  4GW9 A;  1H3Q A;  2V8F A;  1LI9 A;  3E4Q A;  3MXQ A;  4R3J A;  3MJQ A;  3ZCZ A;  1YQS A;  4N9K A;  2XEP A;  1VEU A;  5I94 A;  4G3K A;  1X0O A;  1K56 A;  4WZ5 C;  4EES A;  2J80 A;  5EM0 A;  3W4Q A;  2OV5 A;  2I72 A;  3A3J A;  4Y0T A;  1S1Y A;  4R6L A;  2GJ3 A;  3CI6 A;  2FH5 A;  5J4E A;  4MLL A;  1S4S A;  2K2N A;  4LLO B;  2VLG A;  2W3E A;  4BD0 A;  3GMW A;  2Y4A A;  2QYB A;  4ESP A;  4JGQ A;  1NLY A;  2HGV A;  1DJA A;  2YKF A;  2W3G A;  1KOU A;  2WGW A;  2VK3 A;  5JYO A;  1PZO A;  1I2S A;  3L9K A;  1ERQ A;  2PBD P;  5CHU A;  3WS2 A;  4RA7 A;  3G31 A;  3IHA A;  4HJ3 A;  2AVX A;  3NC8 A;  4XXR A;  1L0E A;  3ZVW A;  1EWZ A;  3R7W A;  3BLM A;  3R4K A;  2H0Y A;  4PM5 A;  3MZE A;  4GDB A;  4S2J A;  1MWU A;  3UE3 A;  1D7E A;  4PHT A;  1GSV A;  5DJT A;  3UN7 A;  5E2G A;  1TDG A;  3V39 A;  2HDQ A;  5CX7 A;  2J3T D;  4QY6 A;  4DDY A;  4E3L A;  1A0K A;  4BEN A;  4EBL A;  3CUE A;  4OQH A;  5A93 A;  1OT6 A;  3T1S A;  4QPR A;  2OLU A;  2VEA A;  5FI7 A;  1XGJ A;  4Z9Q A;  4E3M A;  2WZZ A;  5F82 A;  1DP8 A;  2LB9 A;  3VP2 A;  5BOH A;  4S2N A;  4DXC A;  2W1T B;  1FOF A;  5GHZ A;  3IF6 B;  3HLF A;  4WZ4 A;  2M1C A;  3NUL A;  4FOF A;  3W4P A;  2QWS A;  1E3U D;  2PBY A;  4HES A;  5L09 A;  2HF6 A;  4I38 A;  1I5Q A;  2Y55 A;  3A3D A;  1ONG A;  1QMF A;  1VEU B;  1Z09 A;  3FC7 A;  3CMZ A;  4IUH A;  3KX0 X;  1O07 A;  1KGG A;  2Y79 A;  1ZHH B;  4P0M A;  3BQA A;  4G3V A;  1XKZ A;  1W63 M;  3KO6 A;  3AGD A;  1PWG A;  3IWO A;  2J8Y A;  4K0W A;  4Y2F A;  4OPY A;  2P7J A;  5HW3 A;  2OSU A;  3DTE A;  2Y2H A;  4ZJ1 A;  1W8Y A;  1J9M A;  2P08 A;  4FUW A;  3H9W A;  4KZ4 A;  3K3C A;  1YLW A;  1TS6 A;  3F1O B;  4NKP A;  1FQG A;  4Y13 A;  4ZAM A;  5EVL A;  3UPP A;  5DJU A;  2Y2Q A;  1W8Q A;  2WGW B;  4OVD A;  5FQ9 A;  5EVI A;  3MQO A;  3IX8 A;  4KZ3 A;  5IT5 A;  4X53 A;  1MC0 A;  3OPL A;  4IHQ A;  3HBR A;  3RH8 B;  1IYO A;  2ZC7 A;  3NDE A;  4EW7 A;  2L4R A;  1FCM A;  1T19 A;  3BEB A;  3VOL A;  5M19 A;  4Q8I A;  3CIT A;  3M2K A;  3HLE A;  4B4Z A;  5EVI B;  4HNB A;  5I5L A;  4GHI A;  3B3X A;  1GA9 A;  4II7 A;  2EFX A;  3OOV A;  1N9N A;  3LR4 A;  3BY8 A;  3LI9 A;  5FA7 A;  3A0V A;  4KZ8 A;  1N9O A;  3UB8 A;  3T4Q A;  2JKG A;  3EEH A;  3DWZ A;  2O9A A;  3H7W A;  5J8X A;  3O86 A;  4CLC A;  4GS9 B;  1S6R A;  4HJ4 A;  3MXS A;  4EUV A;  1MWR A;  4S2N C;  2O99 A;  1FSW A;  1DJC A;  3GSG A;  1S4R A;  5A8B A;  5HL1 A;  4Y3I A;  1YSP A;  1BLH A;  3EOI A;  5GLD A;  3KYZ A;  3BEC A;  2Y2N A;  4Y0U A;  1L0G A;  4PPR A;  4DJ3 A;  4LV1 A;  4NK3 A;  3R7W B;  2DNS A;  3F1P A;  3VMA A;  4P85 A;  3E2K A;  4HBU A;  4Q0J A;  5FAS A;  4S2K A;  5TBM B;  4LV0 A;  3IQA A;  1T1B A;  3BY9 A;  2HP9 A;  2IWB A;  2I9V A;  2X02 A;  2M7U A;  3JVU A;  1F5M A;  2C6W B;  3IXH A;  3V50 A;  1VET A;  1IFQ A;  1DRM A;  3EGX C;  4JF5 A;  1GHP A;  2QPN A;  2E8J A;  4MN5 A;  3Q07 A;  5HAI A;  4RX2 A;  3ZG9 B;  2R9X A;  5HD5 A;  5CEC A;  4WEK A;  3G2Y A;  4P87 A;  3LR0 A;  2P74 A;  5AVF A;  5A92 A;  2BLS A;  1O7E A;  4PM9 A;  3UB6 A;  1HZO A;  1K38 A;  2A3U A;  3C7V A;  2R78 A;  4MBH A;  1Y54 A;  4E3I A;  3PXP A;  5JYP A;  3D4F A;  3VE3 A;  3M6H A;  1ES2 A;  1NZU A;  3V3S A;  2Z6D A;  5F69 A;  3NY4 A;  3OZH A;  4GB7 A;  5HAR A;  5CHM A;  2WGV A;  3QNC A;  3EGD C;  2O0Y A;  1SCW A;  3QP8 A;  1WYB A;  4RX3 A;  3D9Y A;  1ZG4 A;  5M1A A;  4LRZ E;  1D1J A;  3A3F A;  1T1A A;  1VHM A;  4S2O A;  4BLM A;  2NUT C;  3C4P A;  2JKT M;  4R4R A;  4LEN A;  2P04 A;  1EI5 A;  4XUX A;  1VET B;  3OC2 A;  2VV7 A;  4LRX C;  5E2H A;  1ES3 A;  2VGL S;  2VV6 A;  3VSL A;  2K31 A;  4ETZ A;  3HLB A;  3LO7 A;  3E4O A;  3ZDJ A;  2Q9N A;  2W1T A;  3F1N A;  1K6R A;  3T1X A;  2WKE A;  4GN2 A;  4OP5 A;  3KYE A;  3G4P A;  1WYC A;  2JKR I;  1G28 A;  1W63 Q;  2O9B A;  3O88 A;  4GKU A;  1JTG A;  4PM7 A;  3CHW P;  4FH2 A;  4C75 A;  2J7V A;  3BFF A;  4KZA A;  3V67 A;  4MNR A;  3TW8 A;  4GD6 A;  2WZX A;  4O0P A;  4CLC D;  4JXV A;  3OCN A;  3CJM A;  5LBR A;  1RCJ A;  4OP8 A;  1JWP A;  4K08 A;  3Q1F A;  2MJ6 A;  4R3B A;  3C7U A;  3A3I A;  2EFU A;  4BD1 A;  1PIO A;  3C5A A;  3O87 A;  5E43 A;  1PW1 A;  4WUJ A;  4GLQ A;  5FQK A;  1YLP A;  2JKT I;  4R38 A;  4ME4 A;  1FIK A;  4MBF A;  5DKL A;  1FR6 A;  3M6B A;  3VE4 A;  3KSF A;  2E8I A;  4QU3 A;  3IS2 B;  1XA1 A;  3E0Y A;  4JKT A;  3EQU A;  3T4T A;  2BAS A;  2Y8H A;  3T4K A;  4IED A;  3HLD A;  1ALQ A;  1YSQ A;  4RVA A;  3Q7V B;  2V1Z A;  2WGI A;  4QJG A;  1GHI A;  3BW6 A;  3P98 A;  4IBR A;  1G6O A;  4DF6 A;  2JKR M;  4MDZ A;  4M3K A;  3D72 A;  5CGX A;  1YLZ A;  2GNX A;  3H82 A;  4K0X A;  2B02 A;  4NXF A;  4Y0O A;  4OLG A;  1P9W A;  4N9L A;  2PD7 A;  3A0R A;  5J3W A;  4KEN B;  4HP4 A;  4A5R A;  3PBN A;  2PD8 A;  4XUZ A;  3M2J A;  2Y2P A;  4HJ6 A;  1OTI A;  3MR0 A;  5CED A;  1QME A;  4NXE A;  4N92 A;  4L9F A;  4E04 A;  3PBS A;  3ZG0 A;  2HP6 A;  3IWQ A;  3OPP A;  5DFX A;  3DBA A;  1PYY A;  3MMH A;  5F68 A;  1KDW A;  2W3F A;  3JVV A;  4GHI B;  2XFT A;  5HDS A;  1OJ5 A;  4FD8 A;  4MMN A;  2WYX A;  3W2Z A;  4ZDX A;  3ZVT A;  4R3A A;  1N9L A;  1VM1 A;  1JNU A;  2XH9 A;  1DP6 A;  1PRQ A;  2IWC A;  1XA7 A;  2WAE A;  3KSH A;  3HUM A;  5HDC A;  1XJ2 A;  4D2O A;  5GLA A;  3B33 A;  1IYQ A;  3IX4 A;  3AGE A;  1IEL A;  2Y2M A;  1OTA A;  3LIE A;  3UDF A;  4U0X A;  4OQI A;  3DTI A;  5FQI A;  1YT4 A;  3BLS A;  3N4I A;  4DJ2 A;  2HP5 A;  3Q81 A;  1TS8 A;  3SW1 A;  3T4O A;  2XRN A;  4PM8 A;  4L9E A;  3E2L A;  1E25 A;  1LL5 A;  4Y7P A;  4GNU A;  3LGO A;  1K0K A;  3LEZ A;  2GZA A;  1BUE A;  4B88 A;  5AQ9 A;  2DCF A;  2ZQD A;  4S2M A;  2VGL M;  5DF7 A;  3IF6 C;  1K6S A;  4WZ5 A;  3BFE A;  2G2W A;  1N4O A;  4JXS A;  3LY3 A;  3FKV A;  3V5M A;  1T1C A;  2OOL A;  3F1O A;  2ZM2 A;  5HWT A;  1V9Y A;  3C4O A;  2XDM A;  1DJB A;  1K4E A;  1NYM A;  3SH8 A;  1LSW A;  2GX5 A;  4M4X A;  3SS3 A;  1IKI A;  2PU2 A;  2ZQ8 A;  3CLO A;  4IVI A;  5K5B A;  3O5Y A;  4XT2 B;  5IU1 A;  2PRF A;  1K25 A;  1U60 A;  4S2L A;  2V1B A;  1STZ A;  4WYY A;  2HZ5 A;  3HRE A;  3CPT A;  2Q9M A;  4RQ9 A;  3KSG A;  4PMA A;  4HBT A;  2JC7 A;  2QMI A;  2VGJ A;  3NCK A;  4LFU A;  1YKD A;  1K54 C;  1SDN A;  1GCE A;  2HDR A;  3I7J A;  5C5K A;  4B93 A;  2JCH A;  4UA9 A;  3CUE C;  3LI8 A;  3VFF A;  2Z2L B;  4MN6 A;  1OTB A;  1XJ4 A;  3MZF A;  2A2L A;  3JYI A;  4L0L A;  1L0D A;  1SDE A;  2V1A A;  2Y2L A;  5KSH A;  3N8L A;  1IYS A;  3H7W B;  5HL6 A;  3W8K A;  2XK1 A;  4BBT A;  1FIL A;  2RCX A;  3BWL A;  1IOU A;  5KMW A;  2HJ9 C;  3GRJ A;  4F94 A;  4JGR A;  4DE3 A;  4LCM A;  4JXW A;  1N9B A;  1SKO B;  2HDS A;  1IKG A;  3HVF A;  5DF8 A;  3B47 A;  2XQZ A;  3RXX A;  4X55 A;  1FCO A;  2Y2K A;  2ZC5 B;  4KG6 A;  2WKR A;  4EEU A;  2W0N A;  2YKH A;  4QWO A;  2INW A;  2HJE A;  2BTF P;  4HHD A;  5CXW A;  3LYX A;  1PZP A;  3MBZ A;  5AQ7 A;  5GLC A;  2C5W B;  3FYZ A;  1ES5 A;  2Y2I A;  2OLV A;  3HUO A;  4KZ7 A;  3IH8 A;  3TJZ C;  4KZ6 A;  2Z2M B;  1ACF A;  3HLC A;  3K2N A;  1YMS A;  2IWD A;  1EW0 A;  3PAE A;  4DKI A;  2FFF B;  4I39 A;  4K91 A;  4P6Z S;  2J3W A;  4HP9 A;  4DE1 A;  3UB9 A;  5F5Y A;  2ZQ9 A;  1CEF A;  3DAV A;  4WEL A;  1NRF A;  3ZG7 B;  4MEZ A;  5FAP A;  5KZH A;  1LHY A;  4FH4 A;  1CF0 A;  1NXY A;  1DP9 A;  3SS4 A;  3MKF A;  1CEG A;  5EVI D;  3ZYT A;  5EVE A;  4D60 A;  5TFQ A;  3T12 B;  1Q2Q A;  1OME A;  1SZV A;  3IXG A;  1ESI A;  3TRC A;  1XX2 A;  4U0T A;  1W7F A;  2XA7 S;  5AQB A;  3IBR A;  4OOL A;  5HSQ A;  2CC1 A;  2KDK A;  2PAV P;  4WL9 A;  5DF9 A;  3T4J A;  4O7D A;  3NBL A;  1CJF A;  4CPK A;  4LCL A;  3NEC A;  4NET A;  4X25 A;  2EXB A;  5A90 A;  3NHQ A;  1ERM A;  2VKS A;  3VOZ A;  4B4X A;  2BG1 A;  3UMD A;  2ZMF A;  1H5X A;  2H5S A;  2VJW A;  2W3D A;  5HPI A;  3G30 A;  2QKP A;  4AFI A;  4EQI A;  4F3L A;  5FDH A;  1HLU P;  5FQJ A;  4N1H A;  3UNW A;  4KG2 A;  3MFD A;  5EUA A;  1Y4O A;  1OPX A;  3QP2 A;  4H6J A;  3VP1 A;  5G18 A;  1BZA A;  4JGO A;  2ZQA A;  5HD3 A;  3SH7 A;  4KZ9 A;  2ZL1 A;  1LI0 A;  1UWN X;  1YLY A;  1YPR A;  3GDI A;  1MY8 A;  3UE1 A;  4HOI A;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 5FQK A;  4JPM A;  4IBX A;  2X71 A;  1YLP A;  1DJA A;  5CER A;  2ZQC A;  1PI4 A;  5CTN A;  2WGW A;  4MBF A;  2WK0 A;  4X68 A;  1FR6 A;  3M6B A;  5JYO A;  1PZO A;  5EEC A;  2E8I A;  3O3V A;  4QU3 A;  3W4O A;  1KVM A;  1ESU A;  1XA1 A;  2EX9 A;  2ZC4 B;  1I2S A;  3N8R A;  3IHB A;  4JKT A;  5CGW A;  4CJN A;  3EQU A;  1ERQ A;  3GVB A;  2ZJ9 A;  4N1X A;  5CHU A;  3WS2 A;  4IED A;  2Y91 A;  3HLD A;  4RA7 A;  1W79 A;  1DY6 A;  1ALQ A;  3G31 A;  1FR1 A;  3IHA A;  4RVA A;  3Q7V B;  1JWV A;  1NYY A;  2PU4 A;  3NC8 A;  2V1Z A;  2WGI A;  4XXR A;  4EV4 A;  4QJG A;  1GHI A;  1MWT A;  1L0E A;  3FKW A;  1EWZ A;  3P98 A;  3ZVW A;  4IBR A;  3BLM A;  5E43 A;  2H0Y A;  3FWL A;  5DVA A;  4PM5 A;  4DF6 A;  3MZE A;  2EX6 A;  4GDB A;  2RL3 A;  1W5D A;  4M3K A;  4WMC D;  5AQA A;  4S2J A;  1ZG6 A;  3TSG A;  5CGX A;  1MWU A;  1YLZ A;  3RJU A;  1XGI A;  3CZD A;  4K0X A;  1Z6F A;  3UE3 A;  3S22 A;  2XD1 A;  4R4S A;  3QNB A;  4Y0O A;  5IHV A;  1K55 C;  3PBT A;  5E2F A;  5E2G A;  3UN7 A;  1TDG A;  4OLG A;  5FSR A;  2HDQ A;  3V39 A;  5DTT A;  2A49 A;  2Y2O A;  4DDY A;  4QY6 A;  4N9L A;  4E3L A;  4BEN A;  5GHX A;  3BYD A;  4EBL A;  4R23 A;  3NIA A;  4KEN B;  4A5R A;  5DTS A;  3PBN A;  4OQH A;  5EOO A;  1LLB A;  5TGF A;  5A93 A;  3UPO A;  4XUZ A;  3GR2 A;  5CTM A;  4P6B A;  2ZM8 A;  3M2J A;  1YLJ A;  2XGN A;  2OLU A;  4GD8 A;  2Y2P A;  5FI7 A;  1CI8 A;  1XGJ A;  3N7W A;  4Z9Q A;  4E3M A;  1IYP A;  2WZZ A;  5F82 A;  3UDI A;  4E3N A;  5CED A;  1E3U A;  4BQM A;  4PM6 A;  1QME A;  4OPQ A;  3ZNT A;  3VP2 A;  5EVI C;  5BOH A;  3V3R A;  4S2N A;  2XF3 A;  4DXC A;  4N92 A;  4R1G A;  1FOF A;  1BTL A;  3PBS A;  5GHZ A;  3IF6 B;  3HLF A;  1ONH A;  4WZ4 A;  3VP0 A;  3ZG0 A;  3SH9 A;  1KE4 A;  2HP6 A;  3IWQ A;  3OPP A;  4JXG A;  3W4P A;  1E3U D;  2PBY A;  4HES A;  2VGK A;  3HLW A;  1PYY A;  3ZHH A;  1KDW A;  1I5Q A;  2Y55 A;  3SOI A;  2XFT A;  4KG5 A;  1BUL A;  2Y2J A;  3UY6 A;  3A3D A;  1ONG A;  1QMF A;  4FD8 A;  1G68 A;  2WYX A;  4ZDX A;  4OOY A;  4QB8 A;  3OPH A;  3G34 A;  4KQQ A;  3CMZ A;  1MKI A;  3Q82 A;  3ZVT A;  4C6Y A;  1KGF A;  1O07 A;  1M6K A;  1KGG A;  1VM1 A;  3NDG A;  4KQR A;  2QZ6 A;  4P0M A;  4ZJ2 A;  3BRM A;  2GDN A;  1XKZ A;  2XH9 A;  2IWC A;  1XA7 A;  2WAE A;  2ZQ7 A;  5CGS A;  3AGD A;  4OLD A;  3HUM A;  1PWG A;  4D2O A;  5GLA A;  3IWO A;  2J8Y A;  4K0W A;  1IYQ A;  4OPY A;  4S2I A;  5HW3 A;  3PBR A;  1K57 A;  3MXR A;  2OSU A;  2P9V B;  3VP4 A;  2Y2H A;  4ZJ1 A;  3Q7Z A;  3AGE A;  1W8Y A;  1J9M A;  1IEL A;  1SKF A;  2FFY A;  2Y2M A;  3IWI A;  3TOI A;  4KZ5 A;  3UDF A;  4U0X A;  2V2F F;  4OQI A;  3ZG5 A;  4KZ4 A;  5FQI A;  1YT4 A;  3BLS A;  4X69 A;  2ZC6 B;  5KSC A;  1YLW A;  2ZM0 A;  1YLT A;  3N4I A;  5M18 A;  2WUQ A;  1FQG A;  4ZAM A;  3ITB A;  2HP5 A;  4WM9 A;  5EVL A;  3Q81 A;  3UPP A;  3VSK A;  3IXB A;  1PWC A;  2Y2Q A;  1W8Q A;  2WGW B;  3PBQ A;  4GDN A;  4OVD A;  4DE0 A;  4DXB A;  5FQ9 A;  4PM8 A;  5EVI A;  4KZ3 A;  1S0W A;  3E2L A;  1E25 A;  4X53 A;  5F1G A;  5CRF A;  1LL5 A;  1VQQ A;  4UAA A;  3OPL A;  4GNU A;  4Y7P A;  2JBF A;  3HBR A;  5FQQ A;  3LCE A;  4EBN A;  4EBP A;  1K4F A;  3LEZ A;  3PAG A;  1BUE A;  1IYO A;  2ZC7 A;  2ZMA A;  2XR0 A;  3IF6 A;  3NDE A;  5AQ9 A;  4B88 A;  1TEM A;  2DCF A;  2ZQD A;  4S2M A;  5D3O A;  5F83 A;  3UE0 A;  5DF7 A;  1KE0 A;  1FCM A;  3G35 A;  4H8R A;  3BEB A;  4JF6 A;  3RXW A;  5M19 A;  4Q8I A;  3IF6 C;  1K6S A;  4WZ5 A;  3M2K A;  3BFE A;  1PI5 A;  3PBO A;  2G2W A;  1N4O A;  3HLE A;  3NI9 A;  4JXS A;  5EVI B;  4B4Z A;  5L2F A;  3SS5 A;  3LY3 A;  3FKV A;  4WEJ A;  3V5M A;  4BL2 A;  3B3X A;  1GA9 A;  4E6X A;  3S1Y A;  2H0T A;  5GLB A;  2EFX A;  2Y59 A;  4KZB A;  4LV2 A;  2ZM2 A;  5CHJ A;  3C4O A;  2XDM A;  3WRT A;  1DJB A;  4DRT A;  3GV9 A;  3ZGA B;  5U47 A;  1K4E A;  2H10 A;  1NYM A;  3SH8 A;  1NY0 A;  1MPL A;  4E3J A;  4IVK A;  5FA7 A;  4OKP A;  5FI2 A;  3SS3 A;  1IKI A;  1K57 C;  1BLS A;  2PU2 A;  4KZ8 A;  5TR7 A;  2ZQ8 A;  3DWK A;  4EWF A;  1GHM A;  4IVI A;  1CK3 A;  2XD5 A;  3MZD A;  1GA0 A;  3ZNY A;  3DWZ A;  1K25 A;  2JE5 A;  1U60 A;  4FSF A;  5J8X A;  4S2L A;  2J9P A;  3BM6 A;  4QHC A;  4BJP A;  5F1F A;  3O86 A;  4WYY A;  2ZD8 A;  5HAP A;  3HRE A;  5EPH A;  1S6R A;  1L2S A;  3MXS A;  4YIN A;  2Q9M A;  3PTE A;  1MWR A;  4S2N C;  4QY5 A;  1FSW A;  4HBT A;  1DJC A;  4OQG A;  4PMA A;  2JC7 A;  3GSG A;  2QMI A;  3A3E A;  1H8Z A;  4WMC A;  1BLC A;  5HL1 A;  2VGJ A;  3NCK A;  4OPR A;  1CI9 A;  2UWX A;  1BLH A;  1FSY A;  1K54 C;  1SDN A;  4ZBE A;  5GLD A;  3UDX A;  1GCE A;  4UA7 A;  1PW8 A;  2HDR A;  3ZG8 B;  3CG5 A;  3I7J A;  4JLF A;  3BEC A;  4OPZ A;  3WRZ A;  5DTK A;  2JCH A;  2Y2N A;  4R0Q A;  4Y0U A;  1L0G A;  4PPR A;  4LV1 A;  1YMX A;  2P9V A;  4NK3 A;  4UA9 A;  1BLP A;  2DNS A;  3VFF A;  2Z2L B;  1FCN A;  1MWS A;  4E3K A;  2ZC3 B;  3BFC A;  1MBL A;  3VMA A;  3MZF A;  4P85 A;  3E2K A;  2EX8 A;  4HBU A;  3JYI A;  4L0L A;  5FAS A;  1L0D A;  1RGZ A;  1SDE A;  2G2U A;  4S2K A;  4RYE A;  2Y2L A;  5KSH A;  3N8L A;  4ID4 A;  1IYS A;  3WS5 A;  5HX9 A;  4BL3 A;  3W8K A;  3HLG A;  3IQA A;  4LV0 A;  5EOE A;  2WAD A;  2XK1 A;  3HUN A;  3VOY A;  4DE2 A;  1KE3 A;  3OPR A;  2Y2G A;  2RCX A;  2HP9 A;  3HL9 A;  2IWB A;  4E6W A;  2X02 A;  5KMW A;  4KQO A;  3GRJ A;  4F94 A;  2C6W B;  3EQV A;  3IXH A;  2DRW A;  4DE3 A;  4LCM A;  2XFS A;  1N9B A;  4JXW A;  3V50 A;  2HDS A;  1IKG A;  1BT5 A;  3HVF A;  2WKH A;  4UHU A;  5DF8 A;  2XQZ A;  3RXX A;  4JBF A;  1PWD A;  4HEF A;  4X55 A;  1FCO A;  5A91 A;  2EX2 A;  3BFG A;  5FAT A;  2Y2K A;  3G32 A;  3FV7 A;  3OCL A;  2ZC5 B;  3QHY A;  4JF5 A;  5EE8 A;  1GHP A;  4KG6 A;  4MBK A;  2QPN A;  1NJ4 A;  3AGF A;  5CXW A;  1PZP A;  3Q07 A;  5HAI A;  4X56 A;  1RGY A;  3IT9 A;  3MBZ A;  5AQ7 A;  4U3T A;  5GLC A;  2C5W B;  5GL9 A;  3FYZ A;  4RX2 A;  3GQZ A;  3ZG9 B;  1ES5 A;  2Y2I A;  1HVB A;  1JWZ A;  2OLV A;  2R9X A;  3HUO A;  4KZ7 A;  5FAQ A;  2WKI A;  5CEC A;  3IH8 A;  4WEK A;  3G2Y A;  4P87 A;  4KZ6 A;  2Z2M B;  3HLC A;  5FAO A;  1BSG A;  1KGE A;  2P74 A;  3Q7V A;  1KDS A;  3IH9 A;  1JVJ A;  1K54 A;  1H8Y A;  5A92 A;  1XXM A;  1YMS A;  2BLS A;  1O7E A;  4PM9 A;  2IWD A;  1HZO A;  1K38 A;  2A3U A;  1Q2P A;  3WS0 A;  3C7V A;  3WS1 A;  4DDS A;  1JTD A;  3PAE A;  5FQM A;  4MBH A;  4DKI A;  1Y54 A;  4E3I A;  2FFF B;  3P09 A;  4K91 A;  5FI6 A;  5JYP A;  3D4F A;  1C3B A;  2ZLY A;  5E2E A;  3DW0 A;  1WE4 A;  4E3O A;  3M6H A;  4DE1 A;  4FCF A;  1AXB A;  1IEM A;  3S4X A;  2ZQ9 A;  1CEF A;  1YM1 A;  4WEL A;  1ES2 A;  1NRF A;  1NZU A;  3VFH A;  3V3S A;  4MEZ A;  3ZG7 B;  1G6A A;  1KVL A;  3IF5 A;  5FAP A;  3NY4 A;  5KZH A;  3OZH A;  4GB7 A;  2B5R A;  1LHY A;  4OH0 A;  5HAR A;  4FH4 A;  5CHM A;  1NXY A;  5GHY A;  3SS4 A;  3MKF A;  1CEG A;  1HTZ A;  2WGV A;  3QNC A;  4ZTK A;  3N8S A;  5EVI D;  4EUZ A;  1L0F A;  3G2Z A;  1TVF A;  2WAF A;  5HFO A;  1K55 A;  1SCW A;  4GZB A;  1WYB A;  4RX3 A;  4C3Q A;  1ZG4 A;  5TFQ A;  2X01 A;  5M1A A;  3VP3 A;  1Q2Q A;  1OME A;  3A3F A;  4S2O A;  4BLM A;  1ZKJ A;  1ESI A;  3IXG A;  3BFD A;  3C4P A;  4OOM A;  3GTC A;  3IXD A;  4R4R A;  4LEN A;  1XX2 A;  1MXO A;  1ZC2 A;  4U0T A;  1EI5 A;  1W7F A;  2HDU A;  4JF4 A;  4XUX A;  5AQB A;  4OQ0 A;  3OC2 A;  1LL9 A;  3DTM A;  4OOL A;  3FZC A;  3N6I A;  2CC1 A;  1RP5 A;  3WS4 A;  1TDL A;  3ISG A;  5E2H A;  1ES4 A;  1ES3 A;  1I2W A;  5DF9 A;  3VSL A;  3HLB A;  3LO7 A;  4O7D A;  3NBL A;  3ZDJ A;  4CPK A;  2Q9N A;  2XLN A;  4LCL A;  1K6R A;  1E4D A;  4NET A;  2WKE A;  4QD4 A;  3ITA A;  4LV3 A;  1LI9 A;  4GN2 A;  2EXB A;  4OP5 A;  5A90 A;  3WWX A;  1ERO A;  1ERM A;  1K56 D;  4R3J A;  3VOZ A;  4B4X A;  3G4P A;  3LY4 A;  4ZJ3 A;  3ZCZ A;  3UO9 A;  1YQS A;  4N9K A;  2XEP A;  2BG1 A;  3UPN A;  1WYC A;  2EXA A;  1H5X A;  5I94 A;  4UA6 A;  4WBG A;  2H5S A;  3O88 A;  3MKE A;  1K56 A;  4OON A;  4WZ5 C;  3G30 A;  4GKU A;  1XP4 A;  3W4Q A;  2OV5 A;  1XPB A;  5CEB A;  1JTG A;  4PM7 A;  4X6T A;  4EQI A;  2I72 A;  5FDH A;  1HD8 A;  3A3J A;  2R9W A;  4FH2 A;  4C75 A;  5FQJ A;  4N1H A;  1NZO A;  2J7V A;  2HPB A;  3BFF A;  4KZA A;  4YFM A;  4Y0T A;  3UNW A;  4KG2 A;  4MNR A;  4S2P A;  4GD6 A;  2WZX A;  3MFD A;  4JXV A;  2J9O A;  3OCN A;  3CJM A;  5EUA A;  1M40 A;  3TG9 A;  1SHV A;  4MLL A;  4GOG A;  3VP1 A;  5G18 A;  1RCJ A;  5HAQ A;  1BZA A;  4BD0 A;  2ZQA A;  3GMW A;  2Y4A A;  1JWP A;  4OP8 A;  2V20 A;  3Q1F A;  3SH7 A;  4R3B A;  4KZ9 A;  1LI0 A;  3C7U A;  1YLY A;  3A3I A;  1MY8 A;  2EFU A;  3UE1 A;  3ZFZ A;  1PIO A;  4BD1 A;  3C5A A;  3O87 A;  1PW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...