2JBFA

Structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
264
structure length
264
Chain Sequence
LPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPEPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TLL2115 PROTEIN
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 102
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jbfA01
1ZG4A 3SS5A 5FATA 3PBOA 4HEFA 3PAGA 1KE4A 4QB8A 3A3IA 2EX2A 2H0TA 1EI5A 5FAPA 2ZQ8A 3HLDA 3HLEA 2EXBA 4MNRA 4BD0A 3HLCA 1NJ4A 3GR2A 1TDGA 2Y2MA 2QZ6A 4KZ5A 3S1YA 3VFFA 4JXGA 4OPZA 3BM6A 3OCLA 4S2JA 3WWXA 2QPNA 4JXVA 2J9OA 4LV3A 4ZJ3A 1JVJA 4UA9A 4K0WA 3IT9A 4OP8A 4OPQA 2R9XA 5FI7A 2Y2KA 3P98A 2DNSA 4BJPA 4ZDXA 3ZVTA 5KSHA 3ZVWA 3BFGA 2JC7A 3OPRA 2PBYA 2WGWA 3DW0A 3M2JA 3WRZA 2BG1A 4PM7A 3GTCA 1PIOA 3G31A 3JYIA 2VGJA 3IXBA 2ZC4B 3B3XA 4KQQA 4S2PA 3Q07A 4QD4A 4BLMA 5FQ9A 1DJCA 2RCXA 4KZ4A 5FDHA 3IF6B 5TFQA 4UA7A 5A90A 4E6WA 2WKIA 4B4ZA 4YFMA 1ERMA 1LL5A 2P9VA 3MXRA 3OCNA 4OQHA 4PPRA 5A91A 4FSFA 1L0DA 4P0MA 3BYDA 3ZG7B 1MKIA 1YT4A 4EBLA 4ZJ2A 3W4OA 2ZM0A 1IKIA 4P6BA 5M18A 3BFDA 1HZOA 1LI0A 4U0TA 2IWBA 3A3DA 5EVIB 4BL2A 3OPLA 4C75A 1XA1A 2Y2JA 4E3MA 2XGNA 3FV7A 3IHAA 5CHUA 3NIAA 1W8YA 1PI5A 3MKFA 3VSKA 3OZHA 4MBKA 2WADA 3ZNTA 5A93A 3S22A 2XLNA 4IVKA 1RP5A 3G30A 4GNUA 1NXYA 3IWOA 4RYEA 4U0XA 1HTZA 4S2NC 3GQZA 4DE3A 2WGIA 3GRJA 2Y55A 2V2FF 5CEBA 1N9BA 3ZHHA 1CI8A 3N4IA 4OLDA 3GSGA 4E3IA 1NY0A 1SCWA 3NDEA 1PWCA 1XKZA 4H8RA 1IELA 2P74A 4HESA 4X53A 1FQGA 5AQBA 1RGZA 5EUAA 4RA7A 1YLPA 2H0YA 1K4EA 4GKUA 2X01A 4R0QA 1KDSA 4Z9QA 4BD1A 1KE3A 1BT5A 4GDNA 5F1FA 3FYZA 3G34A 3AGDA 3Q7VA 1H5XA 3MXSA 3IXGA 1W79A 5AQ9A 3NI9A 5EOOA 1G68A 2E8IA 2XH9A 3SH8A 5I94A 5F83A 2IWDA 4S2IA 2J7VA 5KMWA 1KE0A 3PBQA 4E3LA 1L0FA 5CHMA 3Q1FA 2OV5A 4OH0A 3M2KA 4XUZA 1K57A 4Y0OA 3HLWA 1WYCA 4FD8A 1GHPA 3WS2A 3LY4A 4CPKA 3NCKA 2GDNA 4QU3A 1WE4A 4N9KA 5CTMA 4OQGA 5GHYA 4WM9A 3UPNA 3WS1A 3E2KA 3PTEA 3RJUA 4E3KA 1SKFA 3D4FA 1RCJA 3QNCA 3ZG5A 3ISGA 3WS4A 4KQOA 4KZBA 4LV1A 4C3QA 5FQIA 2Y91A 3C7UA 3G32A 5U47A 5E2EA 4N1HA 2OLVA 4PM9A 4FCFA 3TG9A 1IYOA 2WUQA 1S6RA 3VP1A 3N7WA 1Z6FA 3OPHA 4QY5A 5HAPA 4EV4A 2WAFA 5CTNA 5E2FA 3HBRA 3WS0A 1M6KA 2EX6A 4KG6A 5KSCA 1YLJA 4K0XA 2ZQDA 4OQIA 5E43A 1NZUA 4PM8A 1K54A 5L2FA 4GN2A 1K6SA 1FCOA 1GHMA 4EWFA 4C6YA 2J8YA 3GMWA 3C5AA 4QJGA 5D3OA 4DF6A 1BTLA 1TEMA 1GA0A 2V20A 1BLSA 3AGEA 1XA7A 3BFEA 3EQUA 4GB7A 4MLLA 4JF6A 1YQSA 2ZJ9A 3V50A 1FSWA 3HVFA 4OLGA 3HLBA 1GHIA 4XXRA 2WAEA 5DTKA 1MWTA 4ZJ1A 2V1ZA 3UE1A 3BLSA 3IF5A 2B5RA 5EPHA 5FQJA 5IHVA 1ERQA 1E3UD 3BFFA 4KZ9A 4BL3A 2XD5A 4RVAA 2ZLYA 5FA7A 3PBTA 1PZPA 2Y2IA 4JPMA 2Q9NA 1I2SA 4OOLA 1ES2A 1ES4A 5EVLA 4DKIA 2Y2PA 5J8XA 1DY6A 1K57C 2XR0A 5EOEA 1ESUA 5DTTA 3HREA 4E3NA 1K55C 4N1XA 1BUEA 3BRMA 4CJNA 5HAIA 1HVBA 2G2WA 1VM1A 4D2OA 1BLCA 3ZNYA 1TVFA 5M19A 3C4OA 1LI9A 5DF9A 4PM6A 2G2UA 3TOIA 3ZG8B 1H8ZA 3FWLA 4X56A 3A3FA 4Y0TA 3UDFA 2I72A 5KZHA 3IXHA 2VGKA 4WZ5A 3N8LA 1NYMA 1IEMA 3Q81A 3BLMA 2FFYA 4R4RA 3N8SA 3I7JA 1M40A 2XK1A 3AGFA 3S4XA 4NK3A 3O88A 1XGJA 2R9WA 1W7FA 3VFHA 1MY8A 2ZC7A 5CGXA 1E3UA 1KGGA 5JYPA 1DJAA 4R3BA 2XFTA 4XUXA 1EROA 1TDLA 4KZAA 4B88A 2FFFB 3MBZA 2HDUA 3VP4A 4DRTA 2EX9A 1H8YA 2EFUA 4LCLA 3CMZA 1LL9A 2QMIA 4DDYA 1K25A 2EX8A 1DJBA 3CJMA 4R4SA 4WEJA 3G2ZA 3VP3A 3O86A 3UE3A 1I5QA 1PZOA 2C5WB 2ZC3B 3C4PA 5FI6A 3UE0A 5FASA 3W4QA 1Q2PA 2WGWB 1YLYA 4R1GA 4GOGA 4KZ6A 3DWKA 1XX2A 5DTSA 3ZDJA 1ESIA 4P87A 1FCNA 3VMAA 5FQKA 1JWZA 3IHBA 3BECA 3GVBA 2HDSA 1YLTA 1BZAA 4E6XA 1E25A 4RX3A 4UAAA 4UHUA 1Q2QA 4X68A 1HD8A 1MWUA 1VQQA 2Y2LA 4LCMA 5JYOA 1XPBA 2X02A 3HUOA 2PU4A 2P9VB 2ZC5B 1O7EA 1PWGA 5G18A 4JXWA 2WGVA 4N9LA 4ZBEA 2XFSA 3BEBA 1OMEA 4OPRA 1XGIA 4R3JA 3HL9A 2HP5A 4K91A 1QMFA 2JCHA 2HPBA 3ZFZA 2XDMA 2DCFA 3A3JA 4IEDA 1BLPA 1N4OA 1QMEA 5DVAA 3NDGA 3O87A 1NZOA 2XQZA 4B4XA 2EFXA 4O7DA 4BENA 2JBFA 2ZD8A 3LEZA 2A49A 3OPPA 5M1AA 4R23A 4WZ5C 3G35A 1L0GA 4HBUA 5EVID 4WELA 4IBRA 5DF8A 5FQMA 1K56A 5HARA 5HX9A 1G6AA 2WZZA 1NYYA 1AXBA 5F1GA 2WKEA 4P85A 5CHJA 3RXXA 3V3SA 2IWCA 3SH9A 5E2HA 1FCMA 2H10A 1MWSA 1IYSA 3VSLA 5FAQA 2ZQ7A 5EECA 3IQAA 3UN7A 4DE0A 3ITBA 3IWQA 4KZ7A 3G2YA 1PW1A 1IKGA 3MKEA 3E2LA 4RX2A 1MWRA 3HUNA 5HL1A 3A3EA 3CG5A 5CEDA 4X69A 2ZC6B 3IWIA 1FOFA 1BSGA 3IF6A 4DE2A 5CERA 5F82A 2HDQA 3HLFA 3ITAA 4FH4A 4ZTKA 3UPOA 3MFDA 4EQIA 1ONGA 2Y4AA 4WEKA 3ZG0A 3UDIA 2ZQ9A 1WYBA 5GLAA 1I2WA 4JXSA 3O3VA 2HDRA 1JTDA 4ID4A 3HUMA 4OONA 5HW3A 4L0LA 2RL3A 1Y54A 3HLGA 5AQ7A 3QHYA 5EVIA 4S2NA 1JWPA 3GV9A 1L2SA 4KZ3A 2X71A 1SDEA 4KENB 2ZMAA 4BQMA 3NBLA 3TSGA 1YMXA 3G4PA 2ZM8A 1FSYA 1YLZA 3RXWA 2PU2A 4MBFA 4WYYA 1KDWA 3PAEA 4OOMA 4S2OA 4PM5A 1BLHA 3ZCZA 3UNWA 5EE8A 4S2MA 1LHYA 3FKVA 4Y0UA 1L0EA 1EWZA 4N92A 3UY6A 3ZGAB 3WRTA 1ALQA 1C3BA 3QNBA 4GD6A 1KVMA 1ZC2A 3IXDA 3PBNA 4OOYA 1K4FA 3M6BA 3MZEA 1K38A 5GHXA 1PI4A 4JLFA 1MBLA 1SDNA 1ZG6A 1CEFA 4WBGA 5CGWA 5FAOA 4DE1A 4ZAMA 5CECA 1O07A 3DWZA 4WZ4A 1JTGA 3CZDA 2WZXA 1GCEA 2ZQAA 4Y7PA 3PBRA 1W8QA 4GDBA 1XP4A 3MZFA 4LENA 3LY3A 1PW8A 5GLBA 4JF5A 2J9PA 1IYQA 1K54C 3N6IA 2Y2NA 1NRFA 1S0WA 3M6HA 4E3OA 2Q9MA 3VOZA 3IF6C 4M3KA 5HFOA 4WMCD 1MXOA 5CGSA 5BOHA 4S2LA 2ZQCA 4GZBA 3LCEA 2BLSA 4X55A 1XXMA 4A5RA 1E4DA 2OLUA 4NETA 3UPPA 1ES3A 2A3UA 3V5MA 1CEGA 2WK0A 3SH7A 1K56D 5CRFA 4PMAA 3ZG9B 3NY4A 3IH8A 5EVIC 4OQ0A 4YINA 2Z2LB 3VOYA 2WKHA 1GA9A 1YMSA 2JE5A 3SOIA 2XEPA 5TR7A 1LLBA 3DTMA 4EUZA 2WYXA 1ES5A 1ONHA 4MEZA 4U3TA 1PYYA 4KZ8A 5TGFA 3SS3A 1JWVA 1CI9A 2OSUA 1YLWA 2UWXA 3IH9A 4OP5A 3UDXA 3W4PA 4F94A 3WS5A 1SHVA 1U60A 1IYPA 2C6WB 2Y2OA 3LO7A 4OPYA 1W5DA 2HP6A 3VP0A 4Q8IA 4UA6A 2CC1A 1MPLA 2Z2MB 4JBFA 4IVIA 3Q82A 4LV0A 1FR6A 3SS4A 4WMCA 4E3JA 3FZCA 4DXCA 3C7VA 3MZDA 4DXBA 3Q7ZA 1YM1A 1K6RA 4IBXA 2Y59A 4OKPA 5FI2A 3UO9A 3V39A 3FKWA 3V3RA 4KG5A 4KG2A 4OVDA 1KGEA 3NC8A 5CXWA 4EBNA 1J9MA 4X6TA 4JF4A 5A92A 3BFCA 2DRWA 2Y2GA 5FQQA 2XF3A 3VP2A 3W8KA 4QHCA 4EBPA 5GL9A 3EQVA 4LV2A 1K55A 2HP9A 4FH2A 4HBTA 1KVLA 4KQRA 5GHZA 4DDSA 2Y2HA 2Y2QA 1BULA 3P09A 3OC2A 3PBSA 2XD1A 4JKTA 4GD8A 5HAQA 5GLDA 1ZKJA 2H5SA 1RGYA 1PWDA 5DF7A 5GLCA 3Q7VB 4S2KA 4QY6A 1KGFA 2ZM2A 4MBHA 2EXAA 5FSRA 5E2GA 3N8RA 1CK3A 1FR1A 5AQAA
chains in the Genus database with same CATH superfamily
3PBOA 4EETB 2EX2A 1FILA 1LT0A 2V9AA 5I5LA 3H82A 2ZQ8A 3RTYA 3UE6A 3E4PA 4QPRA 4KZ5A 3OCLA 3PXPA 2J9OA 3V67A 5HWVA 1TS7A 5MC7A 3UMDA 4OPQA 3BWLA 5KSHA 3MFXA 3ZVTA 3R7WA 3BFGA 3OPRA 2KX6A 2WGWA 4PAUA 4HH3A 2ZC4B 3B3XA 4KZ4A 1YSPA 3IF6B 5A90A 1S4RA 4YFMA 1LL5A 3PR6A 1DP6A 3BYDA 4EBLA 4ZJ2A 3W4OA 2ZM0A 1D1JA 3BFDA 1HZOA 1VHMA 4U0TA 4BL2A 3BY9A 1PI5A 3VSKA 1XJ3A 2WADA 3S22A 4B93A 4DN0A 1PFLA 3UB7A 5CEBA 4NXBA 1CI8A 3N4IA 1NY0A 3NDEA 1XKZA 3MJQA 3UB8A 3JPUA 4EEPA 4X53A 1RGZA 4RA7A 4BMWA 4Z9QA 4KQDA 4L9GA 4GDNA 5F1FA 3Q7VA 3IXGA 2Y79A 1T1AA 2XH9A 3B42A 4R70A 2PRFA 3PBQA 1L0FA 2D02A 5CHMA 4OH0A 3M2KA 2ZL1B 1GHPA 2GDNA 5CTMA 4WM9A 2KOIA 3RJUA 1STZA 3D4FA 3EOIA 1RCJA 1V9YA 3ZG5A 2PD8A 4C3QA 4N1HA 3S7PA 4CQHA 2UV0E 4FCFA 4GW9A 3VP1A 3CITA 3N7WA 1Z6FA 4QY5A 5DFXA 2WAFA 5CTNA 5E2FA 2EX6A 3K3CA 1YLJA 2ZQDA 4PM8A 3B47A 3H9WA 4GN2A 2PDRA 4G3WA 3GMWA 4HHDA 1BTLA 4NKPA 1TEMA 2V20A 1BLSA 3BFEA 3EQUA 2ZJ9A 3LR5A 4XXRA 1GHIA 2WAEA 1MWTA 4MN7A 5EPHA 1ERQA 2B18A 4KZ9A 4BL3A 3PBTA 2PAVP 4DKIA 5J8XA 4JGOA 5HPFA 4N1XA 4CJNA 2G2WA 2HF6A 4HI4A 2G2UA 3FWLA 1LSXA 2I72A 1D7EA 3N8LA 3Q81A 3I7JA 2XK1A 3D72A 1XGJA 1MY8A 3KSFA 5CGXA 2I9VA 1X0OA 1TDLA 4NXEA 2HDUA 2J3TC 1T19A 1LL9A 2FZ0A 1XFQA 2Z6DA 3G2ZA 3KX0X 4E04A 4R1GA 1EW0A 3CUEA 4P87A 2G7UA 1JWZA 1S1YA 3LIEA 1XPBA 2PU4A 2VKSA 5G18A 3NOUC 2M7VA 5EVEA 4N9LA 1OMEA 5HD5A 3VOLA 3HL9A 3NJAA 3ZFZA 2EWVA 5DVAA 3CLOA 3O87A 2ZD8A 3LEZA 3OPPA 4WZ5C 1L0GA 4DJ2A 1K56A 5HARA 4LRYC 2WKEA 4MMNA 1IYSA 5FAQA 4NXGA 3IQAA 3BJNA 1PW1A 1IKGA 1PNEA 5HL1A 4HP4A 4X69A 3B33A 1BSGA 4ZTKA 3MFDA 4WEKA 3ZG0A 3UDIA 1I2WA 2PYPA 1JTDA 4ID4A 3HUMA 5HW3A 4L0LA 5EVIA 4S2NA 1JWPA 3GV9A 1L2SA 2ZMAA 4BQMA 2P7JA 1DP8A 3G4PA 2M1CA 3E0YA 1BLHA 3ZCZA 1LHYA 3FKVA 3IS2A 3PBNA 1PI4A 4DJ3A 5EM1A 4LLOB 2K31A 4WBGA 1O07A 4WZ4A 3VE4A 1JTGA 2PR6A 4ME4A 4GDBA 3MZFA 1PW8A 2J9PA 3C30A 5HPIA 1HLUP 1K54C 1NRFA 1S0WA 3T1SA 4EXOA 3VOZA 5HFOA 4WMCD 4S2LA 2ZQCA 3DTKA 4A5RA 3LCEA 1XXMA 2OLUA 1ES3A 2A3UA 3V5MA 1CEGA 3SH7A 2VK3A 3L7HA 5CRFA 2K7SA 2QJ7A 4OQ0A 1D06A 5TR7A 3ICYA 3KYZA 1CF0A 1S1ZA 3EEAA 4EW7A 4KZ8A 5TGFA 2UWXA 1SHVA 1IYPA 2C6WB 1W5DA 1MPLA 2OWHA 4E3JA 3MZDA 4I38A 3Q7ZA 4NG2A 3FKWA 2PD7A 4KG5A 4IUKA 1KGEA 1P9RA 4EBNA 4MCWA 3DBAA 1SKOA 3BFCA 2Y2GA 3NHQA 4II7A 4EBPA 5GL9A 5GHZA 2Y2QA 1BULA 2XD1A 4GD8A 2H5SA 1RGYA 1PWDA 5GLCA 2R78A 1OPXA 4PKYG 1KGFA 5AQAA 4EQ1A 4HEFA 3EEHA 3NOPC 2PYRA 1Y4OA 4QB8A 3BW6A 2H0TA 1EI5A 2EXBA 1NJ4A 2QZ6A 4OPZA 3WWXA 1SZVA 4ZJ3A 4UA9A 4EESA 4LGWA 2J80A 5FI7A 3ZVWA 4L9EA 4BBTA 3DW0A 3WRZA 4UQIM 3GTCA 3D9YA 5HD3A 2VGLM 3SW1A 5DJUA 3S7OA 1DJCA 3H7WB 5FDHA 5TFQA 4E6WA 2HJ9C 3OCNA 5A91A 4P0MA 1YT4A 5F69A 3U2AA 4HQAA 4E3MA 2XGNA 3W2ZA 3FV7A 3IHAA 3NIAA 3OZHA 3T12B 1OTBA 3ZNTA 1OT6A 5A8BA 4HP9A 3G30A 4IVKA 4GNUA 1NXYA 2O9AA 4X1MA 1NLYA 2V2FF 1N9BA 2A24B 1PWCA 1WA9A 3T4KA 2P74A 2KLIA 2O9CA 4HESA 5AQBA 5EUAA 4Y15A 2H0YA 4O8GA 2X01A 4R0QA 4LRZE 3LEQA 1OTIA 3AGDA 1W79A 5AQ9A 2E8IA 1H8MA 4IUHA 5F83A 2J7VA 5KMWA 3LI9A 4E3LA 2OV5A 4ESPA 1K57A 3C8CA 4FD8A 1S67L 1WE4A 3WS1A 4UQIS 3PTEA 2VGLS 2W3DA 3WS4A 2QWSA 2YKFA 5U47A 4BBVA 5AJGA 3TG9A 3OPHA 3HBRA 1M6KA 1XJ4A 4HJ6A 4OQIA 3HCYA 5E43A 4I5SA 1FCOA 2J3WA 4ARZA 2OAQ1 4C6YA 3ZYTA 1OT9A 1MC0A 1XA7A 4GB7A 4MLLA 2LB5A 4JF6A 3HVFA 2V1ZA 4GLQA 3BLSA 2NUPC 1F9IA 4H6JB 4RVAA 2ZLYA 3NOTC 1PZPA 1I2SA 4OOLA 3SZTA 4EU0A 1DY6A 3F1NB 1ESUA 5L09A 3BRMA 3LIBA 3IBJA 5TBMB 5M19A 4Q0JA 1H8ZA 4X56A 3A3FA 3UDFA 2XROA 3IX3A 3IXHA 3BLMA 1F5MA 3H82B 3AGFA 3S4XA 3O88A 3VFHA 1ODVA 3F1PA 2ZC7A 4ETZA 1KGGA 2GX5A 1DJAA 5HL6A 2XFTA 4B88A 2FFFB 2EFUA 4LCLA 2QMIA 4Z1WA 4ZRRA 4R4SA 3O86A 3R7WB 1PZOA 2ZC3B 1G28A 5FASA 1Q2PA 2WGWB 2JKTM 4KZ6A 1ESIA 4EEUA 2IA2A 5FQKA 3BECA 3GVBA 1YLTA 3NULA 1E25A 4UAAA 2Y2LA 4LCMA 2X02A 4JXWA 2WGVA 3BEBA 1XGIA 3F1OA 2HP5A 4K91A 1QMFA 4PHTA 2JCHA 3A3JA 1N9NA 1BLPA 1N4OA 4P6ZS 2PHYA 4BENA 2A49A 2NUTC 5EVID 2LB9A 1NYYA 5F1GA 2ZBBA 3V3SA 2IWCA 3SH9A 5E2HA 4Q0HA 4HY8A 2ZQ7A 3TW8A 3ITBA 3IWQA 3G2YA 3HJIA 3VE3A 3T1QB 1VETA 3HUNA 5CEDA 1YPRA 3EGXC 4X1LA 3GDIA 1FOFA 5F82A 3HLFA 2ZOHA 2H28A 3ITAA 3O5YA 4EQIA 4O01A 2QYBA 1ZTUA 4JXSA 2HDRA 3T4JA 3IX8A 3QHYA 3MSHA 4KZ3A 1SDEA 4KENB 3NBLA 1N9OA 1YMXA 3RFBA 1FSYA 3RXWA 3CPTB 3UB5P 1KDWA 4Y3IA 1XJ6A 4S2MA 3ZGAB 4L9FA 3QNBA 5IS1A 3IXDA 4OOYA 5GHXA 1GSXA 1MBLA 5CGWA 2W3FA 4ZAMA 5CECA 3CZDA 3FG8A 4Y7PA 1XP4A 4JF5A 3M6HA 3MMHA 4E3OA 2Q9MA 4M3KA 5BOHA 1MZUA 2BLSA 2L1MA 4NETA 1T18A 3T1RA 2VV8A 3NY4A 4I39A 4YINA 5EVIC 1GA9A 1YMSA 3OLOA 1ONHA 3K3DA 4MEZA 3QP8A 3KSIA 3T4SA 3UDXA 1YKDA 3WS5A 1PRQA 2HP6A 2Z2MB 3Q82A 4LV0A 3SS4A 2OOLA 3FZCA 3C7VA 4XT2B 4F3LA 1TD5A 1K6RA 1AWIA 4IBXA 4OKPA 2ZMVA 5FI2A 3UO9A 3V39A 4CLCD 3NC8A 4X6TA 2EA9A 2DRWA 4Y13A 2JHEA 4QHCA 3EQVA 2HP9A 1K0KA 1KVLA 4KQRA 3P09A 3CWFA 3A0RA 5GLDA 5HDCA 3MF0A 5DF7A 4G3VA 2VX8A 3PHYA 4YOFA 4QY6A 2VZWA 3N8RA 3BY8A 2EXAA 5FSRA 5E2GA 5FATA 2HGVA 3PAGA 1KE4A 3A3IA 4R6LA 4R38A 4IHQA 2VEAA 3R4KA 4BD0A 5LBRA 3GR2A 3VFFA 4FUWA 4JXGA 4S2JA 2QPNA 5K5BA 1JVJA 1T1CA 1G5UA 3DAVA 2R9XA 2Y2KA 4ZDXA 4BJPA 2JC7A 4HOIA 4PM7A 1PIOA 3G31A 2W0NA 2VGJA 4S2PA 3Q07A 3LR0A 3G6OA 5FQ9A 4I3JA 4B4ZA 3FPVA 1ERMA 2P9VA 4PPRA 4FSFA 3T1XA 1VEUA 3ZG7B 1MKIA 4LFUA 2JN7A 1IKIA 4I3AA 3LIAA 4P6BA 5M18A 2IWBA 2VLGA 3A3DA 5EVIB 4C75A 1XA1A 2Y2JA 1W8YA 1Y28A 2XLNA 1RP5A 2GJ3A 4U0XA 4RYEA 3IWOA 2E8JA 1HTZA 4CLCC 2ZMFA 2WGIA 3GRJA 2Y55A 4OLDA 3GSGA 3IS2B 1SCWA 1IELA 4GHIA 5J7EA 1FQGA 2W27A 3FPWA 1YLPA 4GKUA 1F2KA 4BD1A 3BQAA 4HJ3A 3FYZA 3G34A 5J4EA 3MXSA 1G68A 3P7NA 3K2NA 1KE0A 2ACGA 3BQ8A 4XUZA 1DRMA 4Y0OA 3HLWA 1WYCA 1ZHHB 5FL3A 3LY4A 3C38A 3NCKA 4QU3A 3UPNA 2PBDP 4N9KA 4OQGA 5GHYA 3E2KA 1SKFA 5AVFA 4GS9B 3QNCA 2L0WA 2VV6A 4KZBA 2Y91A 4GCZA 3LFVA 4PM9A 2PR5A 3LICA 1P9WA 5HAPA 4EV4A 3WS0A 1GSWA 4KG6A 5KSCA 1K54A 1K6SA 4EWFA 4FTXA 3H7WA 2J8YA 3C5AA 4QJGA 5D3OA 3AGEA 4Y5FA 1YQSA 3V50A 1NLZA 1FSWA 4OLGA 4B9OA 5DTKA 4ZJ1A 1SKOB 3IF5A 2B5RA 5FQJA 4KUOA 3BFFA 2XD5A 5DFYA 4JPMA 2Y8HA 1ES2A 1ES4A 5EVLA 2Y2PA 5J3WA 1K57C 2HV1A 5EOEA 5DTTA 3QP6A 4E3NA 1K55C 1BUEA 3KSHA 3TRCA 1HVBA 2A24A 2K2NA 1VM1A 3ZNYA 3LYXA 1TVFA 3C4OA 1LI9A 5DF9A 1P0ZA 3ZG8B 4HNBA 4Y0TA 1NYMA 4CLCB 4R4RA 2W1TB 3C2WA 1W7FA 1E3UA 5F6AA 5JYPA 4R3BA 4XUXA 5DKLA 1EROA 1JNUA 4KZAA 3CHWP 3VP4A 4DRTA 1H8YA 3CMZA 1K25A 4MN5A 2EX8A 1LSWA 1DJBA 3D3OA 4G3KA 3UE3A 1I5QA 3UE0A 2B02A 3W4QA 4Y17A 3DWKA 5DTSA 2AVXA 1BYWA 1FCNA 3VMAA 3KYEA 3IHBA 5FEGA 2HDSA 1BZAA 1FIKA 4E6XA 1OJGA 1Q2QA 1HD8A 1VQQA 1W63Q 2O0YA 3HUOA 1PWGA 4ZBEA 2XFSA 3A0SA 2HPBA 4I3IA 2XDMA 4IEDA 4D60A 3LUQA 3NDGA 4Q0IA 3KYQA 4O7DA 4ETXA 4WLAA 3LR4A 5M1AA 2A2LA 4R23A 3G35A 5DF8A 5FQMA 5HX9A 1G6AA 2ZOIA 5CHJA 3T50A 3IBRA 3RXXA 3T4OA 2H10A 2V1BA 4PKYA 5EECA 1P97A 4RQ9A 3UN7A 4KZ7A 1H3QA 3MKEA 3E2LA 3A3EA 3CG5A 3IF6A 5CERA 4FH4A 1ONGA 2Y4AA 2D01A 2ZQ9A 1WYBA 5EV0A 1VB6A 4NEED 5DKKA 4OONA 3TJZC 3A0VA 1Y54A 3S7QA 3UMEA 3TSGA 4P6ZM 5C5KA 2Q0OA 1YLZA 1NWZA 2PU2A 4MBFA 4OOMA 4S2OA 2QJ5A 4PM5A 3UB6A 3UY6A 4N92A 1EWZA 2W3EA 3LI8A 3EWKA 3WRTA 3E4OA 2P08A 1KVMA 3M6BA 1K38A 1T1BA 5FAOA 2B95A 2VA0A 2WZXA 1GCEA 4ARZB 2ZQAA 1W8QA 4R3AA 4X25A 3DTIA 5GLBA 3N6IA 2QKPA 2XA7M 5IU1A 1MXOA 2ZL1A 4O0PA 2W1RA 4X55A 3E4QA 1DP9A 2WK0A 1K56D 4PMAA 3ZG9B 2W3HA 3VOYA 2Z2LB 2WKHA 2JE5A 1LLBA 4EUZA 4U3TA 3SS3A 1JWVA 4OP5A 2OSUA 1YLWA 4F94A 1S66L 5G4YA 2M7UA 1J3WA 5KIZA 2V8FA 3LO7A 4Q8IA 3VP0A 1H0MA 4HIAA 2CC1A 4IVIA 4UEYA 4YWZA 3F1PB 1Z09A 4DXBA 3V3RA 4KG2A 5CXWA 2J3TD 4JF4A 4NXFA 2O99A 5FQQA 2XF3A 3VP2A 3HJKA 5CX7A 5IT5A 4LV2A 4HBTA 5AVEA 4DDSA 3OC2A 3PBSA 3CPTA 4JKTA 3MQOA 3T4QA 4IJGA 3Q7VB 4S2KA 3LIFA 2QHKA 4MBHA 3CUEC 4WUJA 2V8CA 1FR1A 1ZG4A 3SS5A 2JKRM 2XA7S 3F1OB 1UWPX 1A0KA 4Y2FA 5FAPA 3MR0A 3HLDA 3HLEA 4MNRA 3HLCA 3S1YA 1TDGA 2Y2MA 2OAP1 3BM6A 4JXVA 2JKFA 3DTEA 4LV3A 4K0WA 3IT9A 4OP8A 4AFIA 2VV7A 3P98A 2DNSA 4QWOA 3MS6A 5HSQA 2PBYA 3OBFA 1NRJA 3M2JA 2BG1A 3JYIA 5HWTA 3IXBA 4KQQA 1VETB 4QD4A 5TJJA 4BLMA 1KOUA 4JGQA 2RCXA 4UA7A 2WKIA 3MXRA 4YNRA 4OQHA 1L0DA 3CAXA 1LI0A 3OPLA 3U4LP 5CHUA 1W63M 3MKFA 4MBKA 5A93A 3QP5A 4XT2A 4S2NC 3GQZA 4DE3A 3T4TA 3ZHHA 4E3IA 4H8RA 4EERA 4BWIA 3PYPA 5L8MA 1K4EA 1KDSA 1KE3A 1BT5A 3P01A 3NECA 1H5XA 3MXQA 1V9ZA 3NI9A 5EOOA 3SH8A 5I94A 2IWDA 4BBUA 4S2IA 4DMZA 1ACFA 3Q1FA 2W3GA 4LRXC 1OTAA 5FDSA 3WS2A 3JVVA 4CPKA 5EFWA 4E3KA 3ISGA 4KQOA 4LV1A 5FQIA 3C7UA 3G32A 5E2EA 2OLVA 1IYOA 2WUQA 1S6RA 2YKHA 1CJFA 1OJ5A 4WL9A 4K0XA 1NZUA 5L2FA 1LL8A 1GHMA 2WKRA 2V0WA 4F3LB 4DF6A 1GA0A 3HLBA 3UE1A 5IHVA 1N9LA 1E3UD 4HJ4A 5FA7A 2JKTI 2Y2IA 2HZ5A 2Q9NA 2Z6CA 2O9BA 1TS8A 2XR0A 2VJWA 2HJEA 3HREA 4GJ4A 3ULFA 3FC7A 5HAIA 4D2OA 1BLCA 4PM6A 3TOIA 2CMNA 3KO6A 5KZHA 2VGKA 4WZ5A 1IEMA 2FFYA 3N8SA 1M40A 4NK3A 3MQ0A 2R9WA 4MN6A 2FH5A 1OTDA 4WN5A 5DJTA 1L3LA 2GNXA 4EUVA 3MBZA 1F98A 2EX9A 4DDYA 3CJMA 1GSVA 4WEJA 3VP3A 2KDKA 3C4PA 1IFQA 2C5WB 5FI6A 2GZAA 1YLYA 4GOGA 3S7NA 1XX2A 3ZDJA 4LPZA 2INWA 2PT7A 3LIDA 4GS9A 3TE8A 1S4SA 3E98A 4RX3A 3JVUA 4UHUA 1UGUA 4X68A 1MWUA 5JYOA 2P9VB 2ZC5B 3LGOA 1O7EA 1VEUB 4OPRA 2JKRI 4R3JA 2DCFA 3VV4A 1QMEA 1NZOA 1UWNX 1MKMA 2XQZA 4B4XA 5HDDA 2EFXA 2JBFA 4FOFA 4HBUA 4WELA 5EM0A 2V1AA 4IBRA 2WZZA 1AXBA 4P85A 2BASA 4GHIB 1FCMA 1MWSA 3VSLA 5L10A 1G6OA 4DE0A 1TS6A 3T4LA 4RX2A 1MWRA 5F5YA 2ZC6B 3IWIA 4DE2A 3QP4A 4JGPA 2HDQA 2JKGA 2MJ6A 1XJ2A 3UPOA 2BTFP 3QP1A 1XFNA 5GLAA 3O3VA 3MQQA 2RL3A 3HLGA 5AQ7A 2OWJA 4CLCA 1TS0A 1IOUA 2X71A 3CI6A 2DMWA 2W1TA 5G4ZA 2ZM8A 4M4XA 4WYYA 3L9KA 3PAEA 3UNWA 2V0UA 5EE8A 3KSGA 4Y0UA 1L0EA 1ALQA 1C3BA 4GD6A 3UB9A 2P04A 1ZC2A 1K4FA 3IX4A 3MZEA 4JGRA 4K08A 4JLFA 5HDSA 1SDNA 1ZG6A 1CEFA 4DE1A 3RH8B 4KUKA 3DWZA 2WKQA 1YAXA 3PBRA 1LSVA 2XSSA 4CLCE 3OOVA 4LENA 2XRNA 3LY3A 3EGDC 1IYQA 3GECA 2Y2NA 2WKPA 3IF6C 5CGSA 4HH2A 4GZBA 1E4DA 3UPPA 5HZHA 5HWWA 3IH8A 3SOIA 2XEPA 3DTMA 2WYXA 1ES5A 1PYYA 3W4PA 1CI9A 3IH9A 5F68A 1U60A 3QP2A 2Y2OA 4OPYA 2L4RA 4UA6A 5L07A 4JBFA 1YSQA 1FR6A 4WMCA 4DXCA 5FEFA 1YM1A 2Y59A 4OVDA 1TF1A 3ZQ5A 1J9MA 1CQAA 5A92A 1OTEA 3LR3A 3W8KA 4H6JA 1K55A 4FH2A 2EWWA 2Y2HA 5HAQA 3F1NA 1ZKJA 4MDZA 5TBMA 2ZM2A 4WF0A 1CK3A
chains in the Genus database with same CATH topology
1ZG4A 3SS5A 5FATA 3PBOA 4HEFA 3PAGA 1KE4A 4QB8A 3A3IA 2EX2A 2H0TA 1EI5A 5FAPA 2ZQ8A 3HLDA 3HLEA 2EXBA 4MNRA 4BD0A 3HLCA 1NJ4A 3GR2A 1TDGA 2Y2MA 2QZ6A 4KZ5A 3S1YA 3VFFA 4JXGA 4OPZA 3BM6A 3OCLA 4S2JA 3WWXA 2QPNA 4JXVA 2J9OA 4LV3A 4ZJ3A 1JVJA 4UA9A 4K0WA 3IT9A 4OP8A 4OPQA 2R9XA 5FI7A 2Y2KA 3P98A 2DNSA 4BJPA 4ZDXA 3ZVTA 5KSHA 3ZVWA 3BFGA 2JC7A 3OPRA 2PBYA 2WGWA 3DW0A 3M2JA 3WRZA 2BG1A 4PM7A 3GTCA 1PIOA 3G31A 3JYIA 2VGJA 3IXBA 2ZC4B 3B3XA 4KQQA 4S2PA 3Q07A 4QD4A 4BLMA 5FQ9A 1DJCA 2RCXA 4KZ4A 5FDHA 3IF6B 5TFQA 4UA7A 5A90A 4E6WA 2WKIA 4B4ZA 4YFMA 1ERMA 1LL5A 2P9VA 3MXRA 3OCNA 4OQHA 4PPRA 5A91A 4FSFA 1L0DA 4P0MA 3BYDA 3ZG7B 1MKIA 1YT4A 4EBLA 4ZJ2A 3W4OA 2ZM0A 1IKIA 4P6BA 5M18A 3BFDA 1HZOA 1LI0A 4U0TA 2IWBA 3A3DA 5EVIB 4BL2A 3OPLA 4C75A 1XA1A 2Y2JA 4E3MA 2XGNA 3FV7A 3IHAA 5CHUA 3NIAA 1W8YA 1PI5A 3MKFA 3VSKA 3OZHA 4MBKA 2WADA 3ZNTA 5A93A 3S22A 2XLNA 4IVKA 1RP5A 3G30A 4GNUA 1NXYA 3IWOA 4RYEA 4U0XA 1HTZA 4S2NC 3GQZA 4DE3A 2WGIA 3GRJA 2Y55A 2V2FF 5CEBA 1N9BA 3ZHHA 1CI8A 3N4IA 4OLDA 3GSGA 4E3IA 1NY0A 1SCWA 3NDEA 1PWCA 1XKZA 4H8RA 1IELA 2P74A 4HESA 4X53A 1FQGA 5AQBA 1RGZA 5EUAA 4RA7A 1YLPA 2H0YA 1K4EA 4GKUA 2X01A 4R0QA 1KDSA 4Z9QA 4BD1A 1KE3A 1BT5A 4GDNA 5F1FA 3FYZA 3G34A 3AGDA 3Q7VA 1H5XA 3MXSA 3IXGA 1W79A 5AQ9A 3NI9A 5EOOA 1G68A 2E8IA 2XH9A 3SH8A 5I94A 5F83A 2IWDA 4S2IA 2J7VA 5KMWA 1KE0A 3PBQA 4E3LA 1L0FA 5CHMA 3Q1FA 2OV5A 4OH0A 3M2KA 4XUZA 1K57A 4Y0OA 3HLWA 1WYCA 4FD8A 1GHPA 3WS2A 3LY4A 4CPKA 3NCKA 2GDNA 4QU3A 1WE4A 4N9KA 5CTMA 4OQGA 5GHYA 4WM9A 3UPNA 3WS1A 3E2KA 3PTEA 3RJUA 4E3KA 1SKFA 3D4FA 1RCJA 3QNCA 3ZG5A 3ISGA 3WS4A 4KQOA 4KZBA 4LV1A 4C3QA 5FQIA 2Y91A 3C7UA 3G32A 5U47A 5E2EA 4N1HA 2OLVA 4PM9A 4FCFA 3TG9A 1IYOA 2WUQA 1S6RA 3VP1A 3N7WA 1Z6FA 3OPHA 4QY5A 5HAPA 4EV4A 2WAFA 5CTNA 5E2FA 3HBRA 3WS0A 1M6KA 2EX6A 4KG6A 5KSCA 1YLJA 4K0XA 2ZQDA 4OQIA 5E43A 1NZUA 4PM8A 1K54A 5L2FA 4GN2A 1K6SA 1FCOA 1GHMA 4EWFA 4C6YA 2J8YA 3GMWA 3C5AA 4QJGA 5D3OA 4DF6A 1BTLA 1TEMA 1GA0A 2V20A 1BLSA 3AGEA 1XA7A 3BFEA 3EQUA 4GB7A 4MLLA 4JF6A 1YQSA 2ZJ9A 3V50A 1FSWA 3HVFA 4OLGA 3HLBA 1GHIA 4XXRA 2WAEA 5DTKA 1MWTA 4ZJ1A 2V1ZA 3UE1A 3BLSA 3IF5A 2B5RA 5EPHA 5FQJA 5IHVA 1ERQA 1E3UD 3BFFA 4KZ9A 4BL3A 2XD5A 4RVAA 2ZLYA 5FA7A 3PBTA 1PZPA 2Y2IA 4JPMA 2Q9NA 1I2SA 4OOLA 1ES2A 1ES4A 5EVLA 4DKIA 2Y2PA 5J8XA 1DY6A 1K57C 2XR0A 5EOEA 1ESUA 5DTTA 3HREA 4E3NA 1K55C 4N1XA 1BUEA 3BRMA 4CJNA 5HAIA 1HVBA 2G2WA 1VM1A 4D2OA 1BLCA 3ZNYA 1TVFA 5M19A 3C4OA 1LI9A 5DF9A 4PM6A 2G2UA 3TOIA 3ZG8B 1H8ZA 3FWLA 4X56A 3A3FA 4Y0TA 3UDFA 2I72A 5KZHA 3IXHA 2VGKA 4WZ5A 3N8LA 1NYMA 1IEMA 3Q81A 3BLMA 2FFYA 4R4RA 3N8SA 3I7JA 1M40A 2XK1A 3AGFA 3S4XA 4NK3A 3O88A 1XGJA 2R9WA 1W7FA 3VFHA 1MY8A 2ZC7A 5CGXA 1E3UA 1KGGA 5JYPA 1DJAA 4R3BA 2XFTA 4XUXA 1EROA 1TDLA 4KZAA 4B88A 2FFFB 3MBZA 2HDUA 3VP4A 4DRTA 2EX9A 1H8YA 2EFUA 4LCLA 3CMZA 1LL9A 2QMIA 4DDYA 1K25A 2EX8A 1DJBA 3CJMA 4R4SA 4WEJA 3G2ZA 3VP3A 3O86A 3UE3A 1I5QA 1PZOA 2C5WB 2ZC3B 3C4PA 5FI6A 3UE0A 5FASA 3W4QA 1Q2PA 2WGWB 1YLYA 4R1GA 4GOGA 4KZ6A 3DWKA 1XX2A 5DTSA 3ZDJA 1ESIA 4P87A 1FCNA 3VMAA 5FQKA 1JWZA 3IHBA 3BECA 3GVBA 2HDSA 1YLTA 1BZAA 4E6XA 1E25A 4RX3A 4UAAA 4UHUA 1Q2QA 4X68A 1HD8A 1MWUA 1VQQA 2Y2LA 4LCMA 5JYOA 1XPBA 2X02A 3HUOA 2PU4A 2P9VB 2ZC5B 1O7EA 1PWGA 5G18A 4JXWA 2WGVA 4N9LA 4ZBEA 2XFSA 3BEBA 1OMEA 4OPRA 1XGIA 4R3JA 3HL9A 2HP5A 4K91A 1QMFA 2JCHA 2HPBA 3ZFZA 2XDMA 2DCFA 3A3JA 4IEDA 1BLPA 1N4OA 1QMEA 5DVAA 3NDGA 3O87A 1NZOA 2XQZA 4B4XA 2EFXA 4O7DA 4BENA 2JBFA 2ZD8A 3LEZA 2A49A 3OPPA 5M1AA 4R23A 4WZ5C 3G35A 1L0GA 4HBUA 5EVID 4WELA 4IBRA 5DF8A 5FQMA 1K56A 5HARA 5HX9A 1G6AA 2WZZA 1NYYA 1AXBA 5F1GA 2WKEA 4P85A 5CHJA 3RXXA 3V3SA 2IWCA 3SH9A 5E2HA 1FCMA 2H10A 1MWSA 1IYSA 3VSLA 5FAQA 2ZQ7A 5EECA 3IQAA 3UN7A 4DE0A 3ITBA 3IWQA 4KZ7A 3G2YA 1PW1A 1IKGA 3MKEA 3E2LA 4RX2A 1MWRA 3HUNA 5HL1A 3A3EA 3CG5A 5CEDA 4X69A 2ZC6B 3IWIA 1FOFA 1BSGA 3IF6A 4DE2A 5CERA 5F82A 2HDQA 3HLFA 3ITAA 4FH4A 4ZTKA 3UPOA 3MFDA 4EQIA 1ONGA 2Y4AA 4WEKA 3ZG0A 3UDIA 2ZQ9A 1WYBA 5GLAA 1I2WA 4JXSA 3O3VA 2HDRA 1JTDA 4ID4A 3HUMA 4OONA 5HW3A 4L0LA 2RL3A 1Y54A 3HLGA 5AQ7A 3QHYA 5EVIA 4S2NA 1JWPA 3GV9A 1L2SA 4KZ3A 2X71A 1SDEA 4KENB 2ZMAA 4BQMA 3NBLA 3TSGA 1YMXA 3G4PA 2ZM8A 1FSYA 1YLZA 3RXWA 2PU2A 4MBFA 4WYYA 1KDWA 3PAEA 4OOMA 4S2OA 4PM5A 1BLHA 3ZCZA 3UNWA 5EE8A 4S2MA 1LHYA 3FKVA 4Y0UA 1L0EA 1EWZA 4N92A 3UY6A 3ZGAB 3WRTA 1ALQA 1C3BA 3QNBA 4GD6A 1KVMA 1ZC2A 3IXDA 3PBNA 4OOYA 1K4FA 3M6BA 3MZEA 1K38A 5GHXA 1PI4A 4JLFA 1MBLA 1SDNA 1ZG6A 1CEFA 4WBGA 5CGWA 5FAOA 4DE1A 4ZAMA 5CECA 1O07A 3DWZA 4WZ4A 1JTGA 3CZDA 2WZXA 1GCEA 2ZQAA 4Y7PA 3PBRA 1W8QA 4GDBA 1XP4A 3MZFA 4LENA 3LY3A 1PW8A 5GLBA 4JF5A 2J9PA 1IYQA 1K54C 3N6IA 2Y2NA 1NRFA 1S0WA 3M6HA 4E3OA 2Q9MA 3VOZA 3IF6C 4M3KA 5HFOA 4WMCD 1MXOA 5CGSA 5BOHA 4S2LA 2ZQCA 4GZBA 3LCEA 2BLSA 4X55A 1XXMA 4A5RA 1E4DA 2OLUA 4NETA 3UPPA 1ES3A 2A3UA 3V5MA 1CEGA 2WK0A 3SH7A 1K56D 5CRFA 4PMAA 3ZG9B 3NY4A 3IH8A 5EVIC 4OQ0A 4YINA 2Z2LB 3VOYA 2WKHA 1GA9A 1YMSA 2JE5A 3SOIA 2XEPA 5TR7A 1LLBA 3DTMA 4EUZA 2WYXA 1ES5A 1ONHA 4MEZA 4U3TA 1PYYA 4KZ8A 5TGFA 3SS3A 1JWVA 1CI9A 2OSUA 1YLWA 2UWXA 3IH9A 4OP5A 3UDXA 3W4PA 4F94A 3WS5A 1SHVA 1U60A 1IYPA 2C6WB 2Y2OA 3LO7A 4OPYA 1W5DA 2HP6A 3VP0A 4Q8IA 4UA6A 2CC1A 1MPLA 2Z2MB 4JBFA 4IVIA 3Q82A 4LV0A 1FR6A 3SS4A 4WMCA 4E3JA 3FZCA 4DXCA 3C7VA 3MZDA 4DXBA 3Q7ZA 1YM1A 1K6RA 4IBXA 2Y59A 4OKPA 5FI2A 3UO9A 3V39A 3FKWA 3V3RA 4KG5A 4KG2A 4OVDA 1KGEA 3NC8A 5CXWA 4EBNA 1J9MA 4X6TA 4JF4A 5A92A 3BFCA 2DRWA 2Y2GA 5FQQA 2XF3A 3VP2A 3W8KA 4QHCA 4EBPA 5GL9A 3EQVA 4LV2A 1K55A 2HP9A 4FH2A 4HBTA 1KVLA 4KQRA 5GHZA 4DDSA 2Y2HA 2Y2QA 1BULA 3P09A 3OC2A 3PBSA 2XD1A 4JKTA 4GD8A 5HAQA 5GLDA 1ZKJA 2H5SA 1RGYA 1PWDA 5DF7A 5GLCA 3Q7VB 4S2KA 4QY6A 1KGFA 2ZM2A 4MBHA 2EXAA 5FSRA 5E2GA 3N8RA 1CK3A 1FR1A 5AQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZG4 A;  3SS5 A;  5FAT A;  3PBO A;  4HEF A;  3PAG A;  1KE4 A;  4QB8 A;  3A3I A;  2EX2 A;  2H0T A;  1EI5 A;  5FAP A;  2ZQ8 A;  3HLD A;  3HLE A;  2EXB A;  4MNR A;  4BD0 A;  3HLC A;  1NJ4 A;  3GR2 A;  1TDG A;  2Y2M A;  2QZ6 A;  4KZ5 A;  3S1Y A;  3VFF A;  4JXG A;  4OPZ A;  3BM6 A;  3OCL A;  4S2J A;  3WWX A;  2QPN A;  4JXV A;  2J9O A;  4LV3 A;  4ZJ3 A;  1JVJ A;  4UA9 A;  4K0W A;  3IT9 A;  4OP8 A;  4OPQ A;  2R9X A;  5FI7 A;  2Y2K A;  3P98 A;  2DNS A;  4BJP A;  4ZDX A;  3ZVT A;  5KSH A;  3ZVW A;  3BFG A;  2JC7 A;  3OPR A;  2PBY A;  2WGW A;  3DW0 A;  3M2J A;  3WRZ A;  2BG1 A;  4PM7 A;  3GTC A;  1PIO A;  3G31 A;  3JYI A;  2VGJ A;  3IXB A;  2ZC4 B;  3B3X A;  4KQQ A;  4S2P A;  3Q07 A;  4QD4 A;  4BLM A;  5FQ9 A;  1DJC A;  2RCX A;  4KZ4 A;  5FDH A;  3IF6 B;  5TFQ A;  4UA7 A;  5A90 A;  4E6W A;  2WKI A;  4B4Z A;  4YFM A;  1ERM A;  1LL5 A;  2P9V A;  3MXR A;  3OCN A;  4OQH A;  4PPR A;  5A91 A;  4FSF A;  1L0D A;  4P0M A;  3BYD A;  3ZG7 B;  1MKI A;  1YT4 A;  4EBL A;  4ZJ2 A;  3W4O A;  2ZM0 A;  1IKI A;  4P6B A;  5M18 A;  3BFD A;  1HZO A;  1LI0 A;  4U0T A;  2IWB A;  3A3D A;  5EVI B;  4BL2 A;  3OPL A;  4C75 A;  1XA1 A;  2Y2J A;  4E3M A;  2XGN A;  3FV7 A;  3IHA A;  5CHU A;  3NIA A;  1W8Y A;  1PI5 A;  3MKF A;  3VSK A;  3OZH A;  4MBK A;  2WAD A;  3ZNT A;  5A93 A;  3S22 A;  2XLN A;  4IVK A;  1RP5 A;  3G30 A;  4GNU A;  1NXY A;  3IWO A;  4RYE A;  4U0X A;  1HTZ A;  4S2N C;  3GQZ A;  4DE3 A;  2WGI A;  3GRJ A;  2Y55 A;  2V2F F;  5CEB A;  1N9B A;  3ZHH A;  1CI8 A;  3N4I A;  4OLD A;  3GSG A;  4E3I A;  1NY0 A;  1SCW A;  3NDE A;  1PWC A;  1XKZ A;  4H8R A;  1IEL A;  2P74 A;  4HES A;  4X53 A;  1FQG A;  5AQB A;  1RGZ A;  5EUA A;  4RA7 A;  1YLP A;  2H0Y A;  1K4E A;  4GKU A;  2X01 A;  4R0Q A;  1KDS A;  4Z9Q A;  4BD1 A;  1KE3 A;  1BT5 A;  4GDN A;  5F1F A;  3FYZ A;  3G34 A;  3AGD A;  3Q7V A;  1H5X A;  3MXS A;  3IXG A;  1W79 A;  5AQ9 A;  3NI9 A;  5EOO A;  1G68 A;  2E8I A;  2XH9 A;  3SH8 A;  5I94 A;  5F83 A;  2IWD A;  4S2I A;  2J7V A;  5KMW A;  1KE0 A;  3PBQ A;  4E3L A;  1L0F A;  5CHM A;  3Q1F A;  2OV5 A;  4OH0 A;  3M2K A;  4XUZ A;  1K57 A;  4Y0O A;  3HLW A;  1WYC A;  4FD8 A;  1GHP A;  3WS2 A;  3LY4 A;  4CPK A;  3NCK A;  2GDN A;  4QU3 A;  1WE4 A;  4N9K A;  5CTM A;  4OQG A;  5GHY A;  4WM9 A;  3UPN A;  3WS1 A;  3E2K A;  3PTE A;  3RJU A;  4E3K A;  1SKF A;  3D4F A;  1RCJ A;  3QNC A;  3ZG5 A;  3ISG A;  3WS4 A;  4KQO A;  4KZB A;  4LV1 A;  4C3Q A;  5FQI A;  2Y91 A;  3C7U A;  3G32 A;  5U47 A;  5E2E A;  4N1H A;  2OLV A;  4PM9 A;  4FCF A;  3TG9 A;  1IYO A;  2WUQ A;  1S6R A;  3VP1 A;  3N7W A;  1Z6F A;  3OPH A;  4QY5 A;  5HAP A;  4EV4 A;  2WAF A;  5CTN A;  5E2F A;  3HBR A;  3WS0 A;  1M6K A;  2EX6 A;  4KG6 A;  5KSC A;  1YLJ A;  4K0X A;  2ZQD A;  4OQI A;  5E43 A;  1NZU A;  4PM8 A;  1K54 A;  5L2F A;  4GN2 A;  1K6S A;  1FCO A;  1GHM A;  4EWF A;  4C6Y A;  2J8Y A;  3GMW A;  3C5A A;  4QJG A;  5D3O A;  4DF6 A;  1BTL A;  1TEM A;  1GA0 A;  2V20 A;  1BLS A;  3AGE A;  1XA7 A;  3BFE A;  3EQU A;  4GB7 A;  4MLL A;  4JF6 A;  1YQS A;  2ZJ9 A;  3V50 A;  1FSW A;  3HVF A;  4OLG A;  3HLB A;  1GHI A;  4XXR A;  2WAE A;  5DTK A;  1MWT A;  4ZJ1 A;  2V1Z A;  3UE1 A;  3BLS A;  3IF5 A;  2B5R A;  5EPH A;  5FQJ A;  5IHV A;  1ERQ A;  1E3U D;  3BFF A;  4KZ9 A;  4BL3 A;  2XD5 A;  4RVA A;  2ZLY A;  5FA7 A;  3PBT A;  1PZP A;  2Y2I A;  4JPM A;  2Q9N A;  1I2S A;  4OOL A;  1ES2 A;  1ES4 A;  5EVL A;  4DKI A;  2Y2P A;  5J8X A;  1DY6 A;  1K57 C;  2XR0 A;  5EOE A;  1ESU A;  5DTT A;  3HRE A;  4E3N A;  1K55 C;  4N1X A;  1BUE A;  3BRM A;  4CJN A;  5HAI A;  1HVB A;  2G2W A;  1VM1 A;  4D2O A;  1BLC A;  3ZNY A;  1TVF A;  5M19 A;  3C4O A;  1LI9 A;  5DF9 A;  4PM6 A;  2G2U A;  3TOI A;  3ZG8 B;  1H8Z A;  3FWL A;  4X56 A;  3A3F A;  4Y0T A;  3UDF A;  2I72 A;  5KZH A;  3IXH A;  2VGK A;  4WZ5 A;  3N8L A;  1NYM A;  1IEM A;  3Q81 A;  3BLM A;  2FFY A;  4R4R A;  3N8S A;  3I7J A;  1M40 A;  2XK1 A;  3AGF A;  3S4X A;  4NK3 A;  3O88 A;  1XGJ A;  2R9W A;  1W7F A;  3VFH A;  1MY8 A;  2ZC7 A;  5CGX A;  1E3U A;  1KGG A;  5JYP A;  1DJA A;  4R3B A;  2XFT A;  4XUX A;  1ERO A;  1TDL A;  4KZA A;  4B88 A;  2FFF B;  3MBZ A;  2HDU A;  3VP4 A;  4DRT A;  2EX9 A;  1H8Y A;  2EFU A;  4LCL A;  3CMZ A;  1LL9 A;  2QMI A;  4DDY A;  1K25 A;  2EX8 A;  1DJB A;  3CJM A;  4R4S A;  4WEJ A;  3G2Z A;  3VP3 A;  3O86 A;  3UE3 A;  1I5Q A;  1PZO A;  2C5W B;  2ZC3 B;  3C4P A;  5FI6 A;  3UE0 A;  5FAS A;  3W4Q A;  1Q2P A;  2WGW B;  1YLY A;  4R1G A;  4GOG A;  4KZ6 A;  3DWK A;  1XX2 A;  5DTS A;  3ZDJ A;  1ESI A;  4P87 A;  1FCN A;  3VMA A;  5FQK A;  1JWZ A;  3IHB A;  3BEC A;  3GVB A;  2HDS A;  1YLT A;  1BZA A;  4E6X A;  1E25 A;  4RX3 A;  4UAA A;  4UHU A;  1Q2Q A;  4X68 A;  1HD8 A;  1MWU A;  1VQQ A;  2Y2L A;  4LCM A;  5JYO A;  1XPB A;  2X02 A;  3HUO A;  2PU4 A;  2P9V B;  2ZC5 B;  1O7E A;  1PWG A;  5G18 A;  4JXW A;  2WGV A;  4N9L A;  4ZBE A;  2XFS A;  3BEB A;  1OME A;  4OPR A;  1XGI A;  4R3J A;  3HL9 A;  2HP5 A;  4K91 A;  1QMF A;  2JCH A;  2HPB A;  3ZFZ A;  2XDM A;  2DCF A;  3A3J A;  4IED A;  1BLP A;  1N4O A;  1QME A;  5DVA A;  3NDG A;  3O87 A;  1NZO A;  2XQZ A;  4B4X A;  2EFX A;  4O7D A;  4BEN A;  2JBF A;  2ZD8 A;  3LEZ A;  2A49 A;  3OPP A;  5M1A A;  4R23 A;  4WZ5 C;  3G35 A;  1L0G A;  4HBU A;  5EVI D;  4WEL A;  4IBR A;  5DF8 A;  5FQM A;  1K56 A;  5HAR A;  5HX9 A;  1G6A A;  2WZZ A;  1NYY A;  1AXB A;  5F1G A;  2WKE A;  4P85 A;  5CHJ A;  3RXX A;  3V3S A;  2IWC A;  3SH9 A;  5E2H A;  1FCM A;  2H10 A;  1MWS A;  1IYS A;  3VSL A;  5FAQ A;  2ZQ7 A;  5EEC A;  3IQA A;  3UN7 A;  4DE0 A;  3ITB A;  3IWQ A;  4KZ7 A;  3G2Y A;  1PW1 A;  1IKG A;  3MKE A;  3E2L A;  4RX2 A;  1MWR A;  3HUN A;  5HL1 A;  3A3E A;  3CG5 A;  5CED A;  4X69 A;  2ZC6 B;  3IWI A;  1FOF A;  1BSG A;  3IF6 A;  4DE2 A;  5CER A;  5F82 A;  2HDQ A;  3HLF A;  3ITA A;  4FH4 A;  4ZTK A;  3UPO A;  3MFD A;  4EQI A;  1ONG A;  2Y4A A;  4WEK A;  3ZG0 A;  3UDI A;  2ZQ9 A;  1WYB A;  5GLA A;  1I2W A;  4JXS A;  3O3V A;  2HDR A;  1JTD A;  4ID4 A;  3HUM A;  4OON A;  5HW3 A;  4L0L A;  2RL3 A;  1Y54 A;  3HLG A;  5AQ7 A;  3QHY A;  5EVI A;  4S2N A;  1JWP A;  3GV9 A;  1L2S A;  4KZ3 A;  2X71 A;  1SDE A;  4KEN B;  2ZMA A;  4BQM A;  3NBL A;  3TSG A;  1YMX A;  3G4P A;  2ZM8 A;  1FSY A;  1YLZ A;  3RXW A;  2PU2 A;  4MBF A;  4WYY A;  1KDW A;  3PAE A;  4OOM A;  4S2O A;  4PM5 A;  1BLH A;  3ZCZ A;  3UNW A;  5EE8 A;  4S2M A;  1LHY A;  3FKV A;  4Y0U A;  1L0E A;  1EWZ A;  4N92 A;  3UY6 A;  3ZGA B;  3WRT A;  1ALQ A;  1C3B A;  3QNB A;  4GD6 A;  1KVM A;  1ZC2 A;  3IXD A;  3PBN A;  4OOY A;  1K4F A;  3M6B A;  3MZE A;  1K38 A;  5GHX A;  1PI4 A;  4JLF A;  1MBL A;  1SDN A;  1ZG6 A;  1CEF A;  4WBG A;  5CGW A;  5FAO A;  4DE1 A;  4ZAM A;  5CEC A;  1O07 A;  3DWZ A;  4WZ4 A;  1JTG A;  3CZD A;  2WZX A;  1GCE A;  2ZQA A;  4Y7P A;  3PBR A;  1W8Q A;  4GDB A;  1XP4 A;  3MZF A;  4LEN A;  3LY3 A;  1PW8 A;  5GLB A;  4JF5 A;  2J9P A;  1IYQ A;  1K54 C;  3N6I A;  2Y2N A;  1NRF A;  1S0W A;  3M6H A;  4E3O A;  2Q9M A;  3VOZ A;  3IF6 C;  4M3K A;  5HFO A;  4WMC D;  1MXO A;  5CGS A;  5BOH A;  4S2L A;  2ZQC A;  4GZB A;  3LCE A;  2BLS A;  4X55 A;  1XXM A;  4A5R A;  1E4D A;  2OLU A;  4NET A;  3UPP A;  1ES3 A;  2A3U A;  3V5M A;  1CEG A;  2WK0 A;  3SH7 A;  1K56 D;  5CRF A;  4PMA A;  3ZG9 B;  3NY4 A;  3IH8 A;  5EVI C;  4OQ0 A;  4YIN A;  2Z2L B;  3VOY A;  2WKH A;  1GA9 A;  1YMS A;  2JE5 A;  3SOI A;  2XEP A;  5TR7 A;  1LLB A;  3DTM A;  4EUZ A;  2WYX A;  1ES5 A;  1ONH A;  4MEZ A;  4U3T A;  1PYY A;  4KZ8 A;  5TGF A;  3SS3 A;  1JWV A;  1CI9 A;  2OSU A;  1YLW A;  2UWX A;  3IH9 A;  4OP5 A;  3UDX A;  3W4P A;  4F94 A;  3WS5 A;  1SHV A;  1U60 A;  1IYP A;  2C6W B;  2Y2O A;  3LO7 A;  4OPY A;  1W5D A;  2HP6 A;  3VP0 A;  4Q8I A;  4UA6 A;  2CC1 A;  1MPL A;  2Z2M B;  4JBF A;  4IVI A;  3Q82 A;  4LV0 A;  1FR6 A;  3SS4 A;  4WMC A;  4E3J A;  3FZC A;  4DXC A;  3C7V A;  3MZD A;  4DXB A;  3Q7Z A;  1YM1 A;  1K6R A;  4IBX A;  2Y59 A;  4OKP A;  5FI2 A;  3UO9 A;  3V39 A;  3FKW A;  3V3R A;  4KG5 A;  4KG2 A;  4OVD A;  1KGE A;  3NC8 A;  5CXW A;  4EBN A;  1J9M A;  4X6T A;  4JF4 A;  5A92 A;  3BFC A;  2DRW A;  2Y2G A;  5FQQ A;  2XF3 A;  3VP2 A;  3W8K A;  4QHC A;  4EBP A;  5GL9 A;  3EQV A;  4LV2 A;  1K55 A;  2HP9 A;  4FH2 A;  4HBT A;  1KVL A;  4KQR A;  5GHZ A;  4DDS A;  2Y2H A;  2Y2Q A;  1BUL A;  3P09 A;  3OC2 A;  3PBS A;  2XD1 A;  4JKT A;  4GD8 A;  5HAQ A;  5GLD A;  1ZKJ A;  2H5S A;  1RGY A;  1PWD A;  5DF7 A;  5GLC A;  3Q7V B;  4S2K A;  4QY6 A;  1KGF A;  2ZM2 A;  4MBH A;  2EXA A;  5FSR A;  5E2G A;  3N8R A;  1CK3 A;  1FR1 A;  5AQA A; 
#chains in the Genus database with same CATH topology
 3PBO A;  4EET B;  2EX2 A;  1FIL A;  1LT0 A;  2V9A A;  5I5L A;  3H82 A;  2ZQ8 A;  3RTY A;  3UE6 A;  3E4P A;  4QPR A;  4KZ5 A;  3OCL A;  3PXP A;  2J9O A;  3V67 A;  5HWV A;  1TS7 A;  5MC7 A;  3UMD A;  4OPQ A;  3BWL A;  5KSH A;  3MFX A;  3ZVT A;  3R7W A;  3BFG A;  3OPR A;  2KX6 A;  2WGW A;  4PAU A;  4HH3 A;  2ZC4 B;  3B3X A;  4KZ4 A;  1YSP A;  3IF6 B;  5A90 A;  1S4R A;  4YFM A;  1LL5 A;  3PR6 A;  1DP6 A;  3BYD A;  4EBL A;  4ZJ2 A;  3W4O A;  2ZM0 A;  1D1J A;  3BFD A;  1HZO A;  1VHM A;  4U0T A;  4BL2 A;  3BY9 A;  1PI5 A;  3VSK A;  1XJ3 A;  2WAD A;  3S22 A;  4B93 A;  4DN0 A;  1PFL A;  3UB7 A;  5CEB A;  4NXB A;  1CI8 A;  3N4I A;  1NY0 A;  3NDE A;  1XKZ A;  3MJQ A;  3UB8 A;  3JPU A;  4EEP A;  4X53 A;  1RGZ A;  4RA7 A;  4BMW A;  4Z9Q A;  4KQD A;  4L9G A;  4GDN A;  5F1F A;  3Q7V A;  3IXG A;  2Y79 A;  1T1A A;  2XH9 A;  3B42 A;  4R70 A;  2PRF A;  3PBQ A;  1L0F A;  2D02 A;  5CHM A;  4OH0 A;  3M2K A;  2ZL1 B;  1GHP A;  2GDN A;  5CTM A;  4WM9 A;  2KOI A;  3RJU A;  1STZ A;  3D4F A;  3EOI A;  1RCJ A;  1V9Y A;  3ZG5 A;  2PD8 A;  4C3Q A;  4N1H A;  3S7P A;  4CQH A;  2UV0 E;  4FCF A;  4GW9 A;  3VP1 A;  3CIT A;  3N7W A;  1Z6F A;  4QY5 A;  5DFX A;  2WAF A;  5CTN A;  5E2F A;  2EX6 A;  3K3C A;  1YLJ A;  2ZQD A;  4PM8 A;  3B47 A;  3H9W A;  4GN2 A;  2PDR A;  4G3W A;  3GMW A;  4HHD A;  1BTL A;  4NKP A;  1TEM A;  2V20 A;  1BLS A;  3BFE A;  3EQU A;  2ZJ9 A;  3LR5 A;  4XXR A;  1GHI A;  2WAE A;  1MWT A;  4MN7 A;  5EPH A;  1ERQ A;  2B18 A;  4KZ9 A;  4BL3 A;  3PBT A;  2PAV P;  4DKI A;  5J8X A;  4JGO A;  5HPF A;  4N1X A;  4CJN A;  2G2W A;  2HF6 A;  4HI4 A;  2G2U A;  3FWL A;  1LSX A;  2I72 A;  1D7E A;  3N8L A;  3Q81 A;  3I7J A;  2XK1 A;  3D72 A;  1XGJ A;  1MY8 A;  3KSF A;  5CGX A;  2I9V A;  1X0O A;  1TDL A;  4NXE A;  2HDU A;  2J3T C;  1T19 A;  1LL9 A;  2FZ0 A;  1XFQ A;  2Z6D A;  3G2Z A;  3KX0 X;  4E04 A;  4R1G A;  1EW0 A;  3CUE A;  4P87 A;  2G7U A;  1JWZ A;  1S1Y A;  3LIE A;  1XPB A;  2PU4 A;  2VKS A;  5G18 A;  3NOU C;  2M7V A;  5EVE A;  4N9L A;  1OME A;  5HD5 A;  3VOL A;  3HL9 A;  3NJA A;  3ZFZ A;  2EWV A;  5DVA A;  3CLO A;  3O87 A;  2ZD8 A;  3LEZ A;  3OPP A;  4WZ5 C;  1L0G A;  4DJ2 A;  1K56 A;  5HAR A;  4LRY C;  2WKE A;  4MMN A;  1IYS A;  5FAQ A;  4NXG A;  3IQA A;  3BJN A;  1PW1 A;  1IKG A;  1PNE A;  5HL1 A;  4HP4 A;  4X69 A;  3B33 A;  1BSG A;  4ZTK A;  3MFD A;  4WEK A;  3ZG0 A;  3UDI A;  1I2W A;  2PYP A;  1JTD A;  4ID4 A;  3HUM A;  5HW3 A;  4L0L A;  5EVI A;  4S2N A;  1JWP A;  3GV9 A;  1L2S A;  2ZMA A;  4BQM A;  2P7J A;  1DP8 A;  3G4P A;  2M1C A;  3E0Y A;  1BLH A;  3ZCZ A;  1LHY A;  3FKV A;  3IS2 A;  3PBN A;  1PI4 A;  4DJ3 A;  5EM1 A;  4LLO B;  2K31 A;  4WBG A;  1O07 A;  4WZ4 A;  3VE4 A;  1JTG A;  2PR6 A;  4ME4 A;  4GDB A;  3MZF A;  1PW8 A;  2J9P A;  3C30 A;  5HPI A;  1HLU P;  1K54 C;  1NRF A;  1S0W A;  3T1S A;  4EXO A;  3VOZ A;  5HFO A;  4WMC D;  4S2L A;  2ZQC A;  3DTK A;  4A5R A;  3LCE A;  1XXM A;  2OLU A;  1ES3 A;  2A3U A;  3V5M A;  1CEG A;  3SH7 A;  2VK3 A;  3L7H A;  5CRF A;  2K7S A;  2QJ7 A;  4OQ0 A;  1D06 A;  5TR7 A;  3ICY A;  3KYZ A;  1CF0 A;  1S1Z A;  3EEA A;  4EW7 A;  4KZ8 A;  5TGF A;  2UWX A;  1SHV A;  1IYP A;  2C6W B;  1W5D A;  1MPL A;  2OWH A;  4E3J A;  3MZD A;  4I38 A;  3Q7Z A;  4NG2 A;  3FKW A;  2PD7 A;  4KG5 A;  4IUK A;  1KGE A;  1P9R A;  4EBN A;  4MCW A;  3DBA A;  1SKO A;  3BFC A;  2Y2G A;  3NHQ A;  4II7 A;  4EBP A;  5GL9 A;  5GHZ A;  2Y2Q A;  1BUL A;  2XD1 A;  4GD8 A;  2H5S A;  1RGY A;  1PWD A;  5GLC A;  2R78 A;  1OPX A;  4PKY G;  1KGF A;  5AQA A;  4EQ1 A;  4HEF A;  3EEH A;  3NOP C;  2PYR A;  1Y4O A;  4QB8 A;  3BW6 A;  2H0T A;  1EI5 A;  2EXB A;  1NJ4 A;  2QZ6 A;  4OPZ A;  3WWX A;  1SZV A;  4ZJ3 A;  4UA9 A;  4EES A;  4LGW A;  2J80 A;  5FI7 A;  3ZVW A;  4L9E A;  4BBT A;  3DW0 A;  3WRZ A;  4UQI M;  3GTC A;  3D9Y A;  5HD3 A;  2VGL M;  3SW1 A;  5DJU A;  3S7O A;  1DJC A;  3H7W B;  5FDH A;  5TFQ A;  4E6W A;  2HJ9 C;  3OCN A;  5A91 A;  4P0M A;  1YT4 A;  5F69 A;  3U2A A;  4HQA A;  4E3M A;  2XGN A;  3W2Z A;  3FV7 A;  3IHA A;  3NIA A;  3OZH A;  3T12 B;  1OTB A;  3ZNT A;  1OT6 A;  5A8B A;  4HP9 A;  3G30 A;  4IVK A;  4GNU A;  1NXY A;  2O9A A;  4X1M A;  1NLY A;  2V2F F;  1N9B A;  2A24 B;  1PWC A;  1WA9 A;  3T4K A;  2P74 A;  2KLI A;  2O9C A;  4HES A;  5AQB A;  5EUA A;  4Y15 A;  2H0Y A;  4O8G A;  2X01 A;  4R0Q A;  4LRZ E;  3LEQ A;  1OTI A;  3AGD A;  1W79 A;  5AQ9 A;  2E8I A;  1H8M A;  4IUH A;  5F83 A;  2J7V A;  5KMW A;  3LI9 A;  4E3L A;  2OV5 A;  4ESP A;  1K57 A;  3C8C A;  4FD8 A;  1S67 L;  1WE4 A;  3WS1 A;  4UQI S;  3PTE A;  2VGL S;  2W3D A;  3WS4 A;  2QWS A;  2YKF A;  5U47 A;  4BBV A;  5AJG A;  3TG9 A;  3OPH A;  3HBR A;  1M6K A;  1XJ4 A;  4HJ6 A;  4OQI A;  3HCY A;  5E43 A;  4I5S A;  1FCO A;  2J3W A;  4ARZ A;  2OAQ 1;  4C6Y A;  3ZYT A;  1OT9 A;  1MC0 A;  1XA7 A;  4GB7 A;  4MLL A;  2LB5 A;  4JF6 A;  3HVF A;  2V1Z A;  4GLQ A;  3BLS A;  2NUP C;  1F9I A;  4H6J B;  4RVA A;  2ZLY A;  3NOT C;  1PZP A;  1I2S A;  4OOL A;  3SZT A;  4EU0 A;  1DY6 A;  3F1N B;  1ESU A;  5L09 A;  3BRM A;  3LIB A;  3IBJ A;  5TBM B;  5M19 A;  4Q0J A;  1H8Z A;  4X56 A;  3A3F A;  3UDF A;  2XRO A;  3IX3 A;  3IXH A;  3BLM A;  1F5M A;  3H82 B;  3AGF A;  3S4X A;  3O88 A;  3VFH A;  1ODV A;  3F1P A;  2ZC7 A;  4ETZ A;  1KGG A;  2GX5 A;  1DJA A;  5HL6 A;  2XFT A;  4B88 A;  2FFF B;  2EFU A;  4LCL A;  2QMI A;  4Z1W A;  4ZRR A;  4R4S A;  3O86 A;  3R7W B;  1PZO A;  2ZC3 B;  1G28 A;  5FAS A;  1Q2P A;  2WGW B;  2JKT M;  4KZ6 A;  1ESI A;  4EEU A;  2IA2 A;  5FQK A;  3BEC A;  3GVB A;  1YLT A;  3NUL A;  1E25 A;  4UAA A;  2Y2L A;  4LCM A;  2X02 A;  4JXW A;  2WGV A;  3BEB A;  1XGI A;  3F1O A;  2HP5 A;  4K91 A;  1QMF A;  4PHT A;  2JCH A;  3A3J A;  1N9N A;  1BLP A;  1N4O A;  4P6Z S;  2PHY A;  4BEN A;  2A49 A;  2NUT C;  5EVI D;  2LB9 A;  1NYY A;  5F1G A;  2ZBB A;  3V3S A;  2IWC A;  3SH9 A;  5E2H A;  4Q0H A;  4HY8 A;  2ZQ7 A;  3TW8 A;  3ITB A;  3IWQ A;  3G2Y A;  3HJI A;  3VE3 A;  3T1Q B;  1VET A;  3HUN A;  5CED A;  1YPR A;  3EGX C;  4X1L A;  3GDI A;  1FOF A;  5F82 A;  3HLF A;  2ZOH A;  2H28 A;  3ITA A;  3O5Y A;  4EQI A;  4O01 A;  2QYB A;  1ZTU A;  4JXS A;  2HDR A;  3T4J A;  3IX8 A;  3QHY A;  3MSH A;  4KZ3 A;  1SDE A;  4KEN B;  3NBL A;  1N9O A;  1YMX A;  3RFB A;  1FSY A;  3RXW A;  3CPT B;  3UB5 P;  1KDW A;  4Y3I A;  1XJ6 A;  4S2M A;  3ZGA B;  4L9F A;  3QNB A;  5IS1 A;  3IXD A;  4OOY A;  5GHX A;  1GSX A;  1MBL A;  5CGW A;  2W3F A;  4ZAM A;  5CEC A;  3CZD A;  3FG8 A;  4Y7P A;  1XP4 A;  4JF5 A;  3M6H A;  3MMH A;  4E3O A;  2Q9M A;  4M3K A;  5BOH A;  1MZU A;  2BLS A;  2L1M A;  4NET A;  1T18 A;  3T1R A;  2VV8 A;  3NY4 A;  4I39 A;  4YIN A;  5EVI C;  1GA9 A;  1YMS A;  3OLO A;  1ONH A;  3K3D A;  4MEZ A;  3QP8 A;  3KSI A;  3T4S A;  3UDX A;  1YKD A;  3WS5 A;  1PRQ A;  2HP6 A;  2Z2M B;  3Q82 A;  4LV0 A;  3SS4 A;  2OOL A;  3FZC A;  3C7V A;  4XT2 B;  4F3L A;  1TD5 A;  1K6R A;  1AWI A;  4IBX A;  4OKP A;  2ZMV A;  5FI2 A;  3UO9 A;  3V39 A;  4CLC D;  3NC8 A;  4X6T A;  2EA9 A;  2DRW A;  4Y13 A;  2JHE A;  4QHC A;  3EQV A;  2HP9 A;  1K0K A;  1KVL A;  4KQR A;  3P09 A;  3CWF A;  3A0R A;  5GLD A;  5HDC A;  3MF0 A;  5DF7 A;  4G3V A;  2VX8 A;  3PHY A;  4YOF A;  4QY6 A;  2VZW A;  3N8R A;  3BY8 A;  2EXA A;  5FSR A;  5E2G A;  5FAT A;  2HGV A;  3PAG A;  1KE4 A;  3A3I A;  4R6L A;  4R38 A;  4IHQ A;  2VEA A;  3R4K A;  4BD0 A;  5LBR A;  3GR2 A;  3VFF A;  4FUW A;  4JXG A;  4S2J A;  2QPN A;  5K5B A;  1JVJ A;  1T1C A;  1G5U A;  3DAV A;  2R9X A;  2Y2K A;  4ZDX A;  4BJP A;  2JC7 A;  4HOI A;  4PM7 A;  1PIO A;  3G31 A;  2W0N A;  2VGJ A;  4S2P A;  3Q07 A;  3LR0 A;  3G6O A;  5FQ9 A;  4I3J A;  4B4Z A;  3FPV A;  1ERM A;  2P9V A;  4PPR A;  4FSF A;  3T1X A;  1VEU A;  3ZG7 B;  1MKI A;  4LFU A;  2JN7 A;  1IKI A;  4I3A A;  3LIA A;  4P6B A;  5M18 A;  2IWB A;  2VLG A;  3A3D A;  5EVI B;  4C75 A;  1XA1 A;  2Y2J A;  1W8Y A;  1Y28 A;  2XLN A;  1RP5 A;  2GJ3 A;  4U0X A;  4RYE A;  3IWO A;  2E8J A;  1HTZ A;  4CLC C;  2ZMF A;  2WGI A;  3GRJ A;  2Y55 A;  4OLD A;  3GSG A;  3IS2 B;  1SCW A;  1IEL A;  4GHI A;  5J7E A;  1FQG A;  2W27 A;  3FPW A;  1YLP A;  4GKU A;  1F2K A;  4BD1 A;  3BQA A;  4HJ3 A;  3FYZ A;  3G34 A;  5J4E A;  3MXS A;  1G68 A;  3P7N A;  3K2N A;  1KE0 A;  2ACG A;  3BQ8 A;  4XUZ A;  1DRM A;  4Y0O A;  3HLW A;  1WYC A;  1ZHH B;  5FL3 A;  3LY4 A;  3C38 A;  3NCK A;  4QU3 A;  3UPN A;  2PBD P;  4N9K A;  4OQG A;  5GHY A;  3E2K A;  1SKF A;  5AVF A;  4GS9 B;  3QNC A;  2L0W A;  2VV6 A;  4KZB A;  2Y91 A;  4GCZ A;  3LFV A;  4PM9 A;  2PR5 A;  3LIC A;  1P9W A;  5HAP A;  4EV4 A;  3WS0 A;  1GSW A;  4KG6 A;  5KSC A;  1K54 A;  1K6S A;  4EWF A;  4FTX A;  3H7W A;  2J8Y A;  3C5A A;  4QJG A;  5D3O A;  3AGE A;  4Y5F A;  1YQS A;  3V50 A;  1NLZ A;  1FSW A;  4OLG A;  4B9O A;  5DTK A;  4ZJ1 A;  1SKO B;  3IF5 A;  2B5R A;  5FQJ A;  4KUO A;  3BFF A;  2XD5 A;  5DFY A;  4JPM A;  2Y8H A;  1ES2 A;  1ES4 A;  5EVL A;  2Y2P A;  5J3W A;  1K57 C;  2HV1 A;  5EOE A;  5DTT A;  3QP6 A;  4E3N A;  1K55 C;  1BUE A;  3KSH A;  3TRC A;  1HVB A;  2A24 A;  2K2N A;  1VM1 A;  3ZNY A;  3LYX A;  1TVF A;  3C4O A;  1LI9 A;  5DF9 A;  1P0Z A;  3ZG8 B;  4HNB A;  4Y0T A;  1NYM A;  4CLC B;  4R4R A;  2W1T B;  3C2W A;  1W7F A;  1E3U A;  5F6A A;  5JYP A;  4R3B A;  4XUX A;  5DKL A;  1ERO A;  1JNU A;  4KZA A;  3CHW P;  3VP4 A;  4DRT A;  1H8Y A;  3CMZ A;  1K25 A;  4MN5 A;  2EX8 A;  1LSW A;  1DJB A;  3D3O A;  4G3K A;  3UE3 A;  1I5Q A;  3UE0 A;  2B02 A;  3W4Q A;  4Y17 A;  3DWK A;  5DTS A;  2AVX A;  1BYW A;  1FCN A;  3VMA A;  3KYE A;  3IHB A;  5FEG A;  2HDS A;  1BZA A;  1FIK A;  4E6X A;  1OJG A;  1Q2Q A;  1HD8 A;  1VQQ A;  1W63 Q;  2O0Y A;  3HUO A;  1PWG A;  4ZBE A;  2XFS A;  3A0S A;  2HPB A;  4I3I A;  2XDM A;  4IED A;  4D60 A;  3LUQ A;  3NDG A;  4Q0I A;  3KYQ A;  4O7D A;  4ETX A;  4WLA A;  3LR4 A;  5M1A A;  2A2L A;  4R23 A;  3G35 A;  5DF8 A;  5FQM A;  5HX9 A;  1G6A A;  2ZOI A;  5CHJ A;  3T50 A;  3IBR A;  3RXX A;  3T4O A;  2H10 A;  2V1B A;  4PKY A;  5EEC A;  1P97 A;  4RQ9 A;  3UN7 A;  4KZ7 A;  1H3Q A;  3MKE A;  3E2L A;  3A3E A;  3CG5 A;  3IF6 A;  5CER A;  4FH4 A;  1ONG A;  2Y4A A;  2D01 A;  2ZQ9 A;  1WYB A;  5EV0 A;  1VB6 A;  4NEE D;  5DKK A;  4OON A;  3TJZ C;  3A0V A;  1Y54 A;  3S7Q A;  3UME A;  3TSG A;  4P6Z M;  5C5K A;  2Q0O A;  1YLZ A;  1NWZ A;  2PU2 A;  4MBF A;  4OOM A;  4S2O A;  2QJ5 A;  4PM5 A;  3UB6 A;  3UY6 A;  4N92 A;  1EWZ A;  2W3E A;  3LI8 A;  3EWK A;  3WRT A;  3E4O A;  2P08 A;  1KVM A;  3M6B A;  1K38 A;  1T1B A;  5FAO A;  2B95 A;  2VA0 A;  2WZX A;  1GCE A;  4ARZ B;  2ZQA A;  1W8Q A;  4R3A A;  4X25 A;  3DTI A;  5GLB A;  3N6I A;  2QKP A;  2XA7 M;  5IU1 A;  1MXO A;  2ZL1 A;  4O0P A;  2W1R A;  4X55 A;  3E4Q A;  1DP9 A;  2WK0 A;  1K56 D;  4PMA A;  3ZG9 B;  2W3H A;  3VOY A;  2Z2L B;  2WKH A;  2JE5 A;  1LLB A;  4EUZ A;  4U3T A;  3SS3 A;  1JWV A;  4OP5 A;  2OSU A;  1YLW A;  4F94 A;  1S66 L;  5G4Y A;  2M7U A;  1J3W A;  5KIZ A;  2V8F A;  3LO7 A;  4Q8I A;  3VP0 A;  1H0M A;  4HIA A;  2CC1 A;  4IVI A;  4UEY A;  4YWZ A;  3F1P B;  1Z09 A;  4DXB A;  3V3R A;  4KG2 A;  5CXW A;  2J3T D;  4JF4 A;  4NXF A;  2O99 A;  5FQQ A;  2XF3 A;  3VP2 A;  3HJK A;  5CX7 A;  5IT5 A;  4LV2 A;  4HBT A;  5AVE A;  4DDS A;  3OC2 A;  3PBS A;  3CPT A;  4JKT A;  3MQO A;  3T4Q A;  4IJG A;  3Q7V B;  4S2K A;  3LIF A;  2QHK A;  4MBH A;  3CUE C;  4WUJ A;  2V8C A;  1FR1 A;  1ZG4 A;  3SS5 A;  2JKR M;  2XA7 S;  3F1O B;  1UWP X;  1A0K A;  4Y2F A;  5FAP A;  3MR0 A;  3HLD A;  3HLE A;  4MNR A;  3HLC A;  3S1Y A;  1TDG A;  2Y2M A;  2OAP 1;  3BM6 A;  4JXV A;  2JKF A;  3DTE A;  4LV3 A;  4K0W A;  3IT9 A;  4OP8 A;  4AFI A;  2VV7 A;  3P98 A;  2DNS A;  4QWO A;  3MS6 A;  5HSQ A;  2PBY A;  3OBF A;  1NRJ A;  3M2J A;  2BG1 A;  3JYI A;  5HWT A;  3IXB A;  4KQQ A;  1VET B;  4QD4 A;  5TJJ A;  4BLM A;  1KOU A;  4JGQ A;  2RCX A;  4UA7 A;  2WKI A;  3MXR A;  4YNR A;  4OQH A;  1L0D A;  3CAX A;  1LI0 A;  3OPL A;  3U4L P;  5CHU A;  1W63 M;  3MKF A;  4MBK A;  5A93 A;  3QP5 A;  4XT2 A;  4S2N C;  3GQZ A;  4DE3 A;  3T4T A;  3ZHH A;  4E3I A;  4H8R A;  4EER A;  4BWI A;  3PYP A;  5L8M A;  1K4E A;  1KDS A;  1KE3 A;  1BT5 A;  3P01 A;  3NEC A;  1H5X A;  3MXQ A;  1V9Z A;  3NI9 A;  5EOO A;  3SH8 A;  5I94 A;  2IWD A;  4BBU A;  4S2I A;  4DMZ A;  1ACF A;  3Q1F A;  2W3G A;  4LRX C;  1OTA A;  5FDS A;  3WS2 A;  3JVV A;  4CPK A;  5EFW A;  4E3K A;  3ISG A;  4KQO A;  4LV1 A;  5FQI A;  3C7U A;  3G32 A;  5E2E A;  2OLV A;  1IYO A;  2WUQ A;  1S6R A;  2YKH A;  1CJF A;  1OJ5 A;  4WL9 A;  4K0X A;  1NZU A;  5L2F A;  1LL8 A;  1GHM A;  2WKR A;  2V0W A;  4F3L B;  4DF6 A;  1GA0 A;  3HLB A;  3UE1 A;  5IHV A;  1N9L A;  1E3U D;  4HJ4 A;  5FA7 A;  2JKT I;  2Y2I A;  2HZ5 A;  2Q9N A;  2Z6C A;  2O9B A;  1TS8 A;  2XR0 A;  2VJW A;  2HJE A;  3HRE A;  4GJ4 A;  3ULF A;  3FC7 A;  5HAI A;  4D2O A;  1BLC A;  4PM6 A;  3TOI A;  2CMN A;  3KO6 A;  5KZH A;  2VGK A;  4WZ5 A;  1IEM A;  2FFY A;  3N8S A;  1M40 A;  4NK3 A;  3MQ0 A;  2R9W A;  4MN6 A;  2FH5 A;  1OTD A;  4WN5 A;  5DJT A;  1L3L A;  2GNX A;  4EUV A;  3MBZ A;  1F98 A;  2EX9 A;  4DDY A;  3CJM A;  1GSV A;  4WEJ A;  3VP3 A;  2KDK A;  3C4P A;  1IFQ A;  2C5W B;  5FI6 A;  2GZA A;  1YLY A;  4GOG A;  3S7N A;  1XX2 A;  3ZDJ A;  4LPZ A;  2INW A;  2PT7 A;  3LID A;  4GS9 A;  3TE8 A;  1S4S A;  3E98 A;  4RX3 A;  3JVU A;  4UHU A;  1UGU A;  4X68 A;  1MWU A;  5JYO A;  2P9V B;  2ZC5 B;  3LGO A;  1O7E A;  1VEU B;  4OPR A;  2JKR I;  4R3J A;  2DCF A;  3VV4 A;  1QME A;  1NZO A;  1UWN X;  1MKM A;  2XQZ A;  4B4X A;  5HDD A;  2EFX A;  2JBF A;  4FOF A;  4HBU A;  4WEL A;  5EM0 A;  2V1A A;  4IBR A;  2WZZ A;  1AXB A;  4P85 A;  2BAS A;  4GHI B;  1FCM A;  1MWS A;  3VSL A;  5L10 A;  1G6O A;  4DE0 A;  1TS6 A;  3T4L A;  4RX2 A;  1MWR A;  5F5Y A;  2ZC6 B;  3IWI A;  4DE2 A;  3QP4 A;  4JGP A;  2HDQ A;  2JKG A;  2MJ6 A;  1XJ2 A;  3UPO A;  2BTF P;  3QP1 A;  1XFN A;  5GLA A;  3O3V A;  3MQQ A;  2RL3 A;  3HLG A;  5AQ7 A;  2OWJ A;  4CLC A;  1TS0 A;  1IOU A;  2X71 A;  3CI6 A;  2DMW A;  2W1T A;  5G4Z A;  2ZM8 A;  4M4X A;  4WYY A;  3L9K A;  3PAE A;  3UNW A;  2V0U A;  5EE8 A;  3KSG A;  4Y0U A;  1L0E A;  1ALQ A;  1C3B A;  4GD6 A;  3UB9 A;  2P04 A;  1ZC2 A;  1K4F A;  3IX4 A;  3MZE A;  4JGR A;  4K08 A;  4JLF A;  5HDS A;  1SDN A;  1ZG6 A;  1CEF A;  4DE1 A;  3RH8 B;  4KUK A;  3DWZ A;  2WKQ A;  1YAX A;  3PBR A;  1LSV A;  2XSS A;  4CLC E;  3OOV A;  4LEN A;  2XRN A;  3LY3 A;  3EGD C;  1IYQ A;  3GEC A;  2Y2N A;  2WKP A;  3IF6 C;  5CGS A;  4HH2 A;  4GZB A;  1E4D A;  3UPP A;  5HZH A;  5HWW A;  3IH8 A;  3SOI A;  2XEP A;  3DTM A;  2WYX A;  1ES5 A;  1PYY A;  3W4P A;  1CI9 A;  3IH9 A;  5F68 A;  1U60 A;  3QP2 A;  2Y2O A;  4OPY A;  2L4R A;  4UA6 A;  5L07 A;  4JBF A;  1YSQ A;  1FR6 A;  4WMC A;  4DXC A;  5FEF A;  1YM1 A;  2Y59 A;  4OVD A;  1TF1 A;  3ZQ5 A;  1J9M A;  1CQA A;  5A92 A;  1OTE A;  3LR3 A;  3W8K A;  4H6J A;  1K55 A;  4FH2 A;  2EWW A;  2Y2H A;  5HAQ A;  3F1N A;  1ZKJ A;  4MDZ A;  5TBM A;  2ZM2 A;  4WF0 A;  1CK3 A; 
#chains in the Genus database with same CATH homology
 1ZG4 A;  3SS5 A;  5FAT A;  3PBO A;  4HEF A;  3PAG A;  1KE4 A;  4QB8 A;  3A3I A;  2EX2 A;  2H0T A;  1EI5 A;  5FAP A;  2ZQ8 A;  3HLD A;  3HLE A;  2EXB A;  4MNR A;  4BD0 A;  3HLC A;  1NJ4 A;  3GR2 A;  1TDG A;  2Y2M A;  2QZ6 A;  4KZ5 A;  3S1Y A;  3VFF A;  4JXG A;  4OPZ A;  3BM6 A;  3OCL A;  4S2J A;  3WWX A;  2QPN A;  4JXV A;  2J9O A;  4LV3 A;  4ZJ3 A;  1JVJ A;  4UA9 A;  4K0W A;  3IT9 A;  4OP8 A;  4OPQ A;  2R9X A;  5FI7 A;  2Y2K A;  3P98 A;  2DNS A;  4BJP A;  4ZDX A;  3ZVT A;  5KSH A;  3ZVW A;  3BFG A;  2JC7 A;  3OPR A;  2PBY A;  2WGW A;  3DW0 A;  3M2J A;  3WRZ A;  2BG1 A;  4PM7 A;  3GTC A;  1PIO A;  3G31 A;  3JYI A;  2VGJ A;  3IXB A;  2ZC4 B;  3B3X A;  4KQQ A;  4S2P A;  3Q07 A;  4QD4 A;  4BLM A;  5FQ9 A;  1DJC A;  2RCX A;  4KZ4 A;  5FDH A;  3IF6 B;  5TFQ A;  4UA7 A;  5A90 A;  4E6W A;  2WKI A;  4B4Z A;  4YFM A;  1ERM A;  1LL5 A;  2P9V A;  3MXR A;  3OCN A;  4OQH A;  4PPR A;  5A91 A;  4FSF A;  1L0D A;  4P0M A;  3BYD A;  3ZG7 B;  1MKI A;  1YT4 A;  4EBL A;  4ZJ2 A;  3W4O A;  2ZM0 A;  1IKI A;  4P6B A;  5M18 A;  3BFD A;  1HZO A;  1LI0 A;  4U0T A;  2IWB A;  3A3D A;  5EVI B;  4BL2 A;  3OPL A;  4C75 A;  1XA1 A;  2Y2J A;  4E3M A;  2XGN A;  3FV7 A;  3IHA A;  5CHU A;  3NIA A;  1W8Y A;  1PI5 A;  3MKF A;  3VSK A;  3OZH A;  4MBK A;  2WAD A;  3ZNT A;  5A93 A;  3S22 A;  2XLN A;  4IVK A;  1RP5 A;  3G30 A;  4GNU A;  1NXY A;  3IWO A;  4RYE A;  4U0X A;  1HTZ A;  4S2N C;  3GQZ A;  4DE3 A;  2WGI A;  3GRJ A;  2Y55 A;  2V2F F;  5CEB A;  1N9B A;  3ZHH A;  1CI8 A;  3N4I A;  4OLD A;  3GSG A;  4E3I A;  1NY0 A;  1SCW A;  3NDE A;  1PWC A;  1XKZ A;  4H8R A;  1IEL A;  2P74 A;  4HES A;  4X53 A;  1FQG A;  5AQB A;  1RGZ A;  5EUA A;  4RA7 A;  1YLP A;  2H0Y A;  1K4E A;  4GKU A;  2X01 A;  4R0Q A;  1KDS A;  4Z9Q A;  4BD1 A;  1KE3 A;  1BT5 A;  4GDN A;  5F1F A;  3FYZ A;  3G34 A;  3AGD A;  3Q7V A;  1H5X A;  3MXS A;  3IXG A;  1W79 A;  5AQ9 A;  3NI9 A;  5EOO A;  1G68 A;  2E8I A;  2XH9 A;  3SH8 A;  5I94 A;  5F83 A;  2IWD A;  4S2I A;  2J7V A;  5KMW A;  1KE0 A;  3PBQ A;  4E3L A;  1L0F A;  5CHM A;  3Q1F A;  2OV5 A;  4OH0 A;  3M2K A;  4XUZ A;  1K57 A;  4Y0O A;  3HLW A;  1WYC A;  4FD8 A;  1GHP A;  3WS2 A;  3LY4 A;  4CPK A;  3NCK A;  2GDN A;  4QU3 A;  1WE4 A;  4N9K A;  5CTM A;  4OQG A;  5GHY A;  4WM9 A;  3UPN A;  3WS1 A;  3E2K A;  3PTE A;  3RJU A;  4E3K A;  1SKF A;  3D4F A;  1RCJ A;  3QNC A;  3ZG5 A;  3ISG A;  3WS4 A;  4KQO A;  4KZB A;  4LV1 A;  4C3Q A;  5FQI A;  2Y91 A;  3C7U A;  3G32 A;  5U47 A;  5E2E A;  4N1H A;  2OLV A;  4PM9 A;  4FCF A;  3TG9 A;  1IYO A;  2WUQ A;  1S6R A;  3VP1 A;  3N7W A;  1Z6F A;  3OPH A;  4QY5 A;  5HAP A;  4EV4 A;  2WAF A;  5CTN A;  5E2F A;  3HBR A;  3WS0 A;  1M6K A;  2EX6 A;  4KG6 A;  5KSC A;  1YLJ A;  4K0X A;  2ZQD A;  4OQI A;  5E43 A;  1NZU A;  4PM8 A;  1K54 A;  5L2F A;  4GN2 A;  1K6S A;  1FCO A;  1GHM A;  4EWF A;  4C6Y A;  2J8Y A;  3GMW A;  3C5A A;  4QJG A;  5D3O A;  4DF6 A;  1BTL A;  1TEM A;  1GA0 A;  2V20 A;  1BLS A;  3AGE A;  1XA7 A;  3BFE A;  3EQU A;  4GB7 A;  4MLL A;  4JF6 A;  1YQS A;  2ZJ9 A;  3V50 A;  1FSW A;  3HVF A;  4OLG A;  3HLB A;  1GHI A;  4XXR A;  2WAE A;  5DTK A;  1MWT A;  4ZJ1 A;  2V1Z A;  3UE1 A;  3BLS A;  3IF5 A;  2B5R A;  5EPH A;  5FQJ A;  5IHV A;  1ERQ A;  1E3U D;  3BFF A;  4KZ9 A;  4BL3 A;  2XD5 A;  4RVA A;  2ZLY A;  5FA7 A;  3PBT A;  1PZP A;  2Y2I A;  4JPM A;  2Q9N A;  1I2S A;  4OOL A;  1ES2 A;  1ES4 A;  5EVL A;  4DKI A;  2Y2P A;  5J8X A;  1DY6 A;  1K57 C;  2XR0 A;  5EOE A;  1ESU A;  5DTT A;  3HRE A;  4E3N A;  1K55 C;  4N1X A;  1BUE A;  3BRM A;  4CJN A;  5HAI A;  1HVB A;  2G2W A;  1VM1 A;  4D2O A;  1BLC A;  3ZNY A;  1TVF A;  5M19 A;  3C4O A;  1LI9 A;  5DF9 A;  4PM6 A;  2G2U A;  3TOI A;  3ZG8 B;  1H8Z A;  3FWL A;  4X56 A;  3A3F A;  4Y0T A;  3UDF A;  2I72 A;  5KZH A;  3IXH A;  2VGK A;  4WZ5 A;  3N8L A;  1NYM A;  1IEM A;  3Q81 A;  3BLM A;  2FFY A;  4R4R A;  3N8S A;  3I7J A;  1M40 A;  2XK1 A;  3AGF A;  3S4X A;  4NK3 A;  3O88 A;  1XGJ A;  2R9W A;  1W7F A;  3VFH A;  1MY8 A;  2ZC7 A;  5CGX A;  1E3U A;  1KGG A;  5JYP A;  1DJA A;  4R3B A;  2XFT A;  4XUX A;  1ERO A;  1TDL A;  4KZA A;  4B88 A;  2FFF B;  3MBZ A;  2HDU A;  3VP4 A;  4DRT A;  2EX9 A;  1H8Y A;  2EFU A;  4LCL A;  3CMZ A;  1LL9 A;  2QMI A;  4DDY A;  1K25 A;  2EX8 A;  1DJB A;  3CJM A;  4R4S A;  4WEJ A;  3G2Z A;  3VP3 A;  3O86 A;  3UE3 A;  1I5Q A;  1PZO A;  2C5W B;  2ZC3 B;  3C4P A;  5FI6 A;  3UE0 A;  5FAS A;  3W4Q A;  1Q2P A;  2WGW B;  1YLY A;  4R1G A;  4GOG A;  4KZ6 A;  3DWK A;  1XX2 A;  5DTS A;  3ZDJ A;  1ESI A;  4P87 A;  1FCN A;  3VMA A;  5FQK A;  1JWZ A;  3IHB A;  3BEC A;  3GVB A;  2HDS A;  1YLT A;  1BZA A;  4E6X A;  1E25 A;  4RX3 A;  4UAA A;  4UHU A;  1Q2Q A;  4X68 A;  1HD8 A;  1MWU A;  1VQQ A;  2Y2L A;  4LCM A;  5JYO A;  1XPB A;  2X02 A;  3HUO A;  2PU4 A;  2P9V B;  2ZC5 B;  1O7E A;  1PWG A;  5G18 A;  4JXW A;  2WGV A;  4N9L A;  4ZBE A;  2XFS A;  3BEB A;  1OME A;  4OPR A;  1XGI A;  4R3J A;  3HL9 A;  2HP5 A;  4K91 A;  1QMF A;  2JCH A;  2HPB A;  3ZFZ A;  2XDM A;  2DCF A;  3A3J A;  4IED A;  1BLP A;  1N4O A;  1QME A;  5DVA A;  3NDG A;  3O87 A;  1NZO A;  2XQZ A;  4B4X A;  2EFX A;  4O7D A;  4BEN A;  2JBF A;  2ZD8 A;  3LEZ A;  2A49 A;  3OPP A;  5M1A A;  4R23 A;  4WZ5 C;  3G35 A;  1L0G A;  4HBU A;  5EVI D;  4WEL A;  4IBR A;  5DF8 A;  5FQM A;  1K56 A;  5HAR A;  5HX9 A;  1G6A A;  2WZZ A;  1NYY A;  1AXB A;  5F1G A;  2WKE A;  4P85 A;  5CHJ A;  3RXX A;  3V3S A;  2IWC A;  3SH9 A;  5E2H A;  1FCM A;  2H10 A;  1MWS A;  1IYS A;  3VSL A;  5FAQ A;  2ZQ7 A;  5EEC A;  3IQA A;  3UN7 A;  4DE0 A;  3ITB A;  3IWQ A;  4KZ7 A;  3G2Y A;  1PW1 A;  1IKG A;  3MKE A;  3E2L A;  4RX2 A;  1MWR A;  3HUN A;  5HL1 A;  3A3E A;  3CG5 A;  5CED A;  4X69 A;  2ZC6 B;  3IWI A;  1FOF A;  1BSG A;  3IF6 A;  4DE2 A;  5CER A;  5F82 A;  2HDQ A;  3HLF A;  3ITA A;  4FH4 A;  4ZTK A;  3UPO A;  3MFD A;  4EQI A;  1ONG A;  2Y4A A;  4WEK A;  3ZG0 A;  3UDI A;  2ZQ9 A;  1WYB A;  5GLA A;  1I2W A;  4JXS A;  3O3V A;  2HDR A;  1JTD A;  4ID4 A;  3HUM A;  4OON A;  5HW3 A;  4L0L A;  2RL3 A;  1Y54 A;  3HLG A;  5AQ7 A;  3QHY A;  5EVI A;  4S2N A;  1JWP A;  3GV9 A;  1L2S A;  4KZ3 A;  2X71 A;  1SDE A;  4KEN B;  2ZMA A;  4BQM A;  3NBL A;  3TSG A;  1YMX A;  3G4P A;  2ZM8 A;  1FSY A;  1YLZ A;  3RXW A;  2PU2 A;  4MBF A;  4WYY A;  1KDW A;  3PAE A;  4OOM A;  4S2O A;  4PM5 A;  1BLH A;  3ZCZ A;  3UNW A;  5EE8 A;  4S2M A;  1LHY A;  3FKV A;  4Y0U A;  1L0E A;  1EWZ A;  4N92 A;  3UY6 A;  3ZGA B;  3WRT A;  1ALQ A;  1C3B A;  3QNB A;  4GD6 A;  1KVM A;  1ZC2 A;  3IXD A;  3PBN A;  4OOY A;  1K4F A;  3M6B A;  3MZE A;  1K38 A;  5GHX A;  1PI4 A;  4JLF A;  1MBL A;  1SDN A;  1ZG6 A;  1CEF A;  4WBG A;  5CGW A;  5FAO A;  4DE1 A;  4ZAM A;  5CEC A;  1O07 A;  3DWZ A;  4WZ4 A;  1JTG A;  3CZD A;  2WZX A;  1GCE A;  2ZQA A;  4Y7P A;  3PBR A;  1W8Q A;  4GDB A;  1XP4 A;  3MZF A;  4LEN A;  3LY3 A;  1PW8 A;  5GLB A;  4JF5 A;  2J9P A;  1IYQ A;  1K54 C;  3N6I A;  2Y2N A;  1NRF A;  1S0W A;  3M6H A;  4E3O A;  2Q9M A;  3VOZ A;  3IF6 C;  4M3K A;  5HFO A;  4WMC D;  1MXO A;  5CGS A;  5BOH A;  4S2L A;  2ZQC A;  4GZB A;  3LCE A;  2BLS A;  4X55 A;  1XXM A;  4A5R A;  1E4D A;  2OLU A;  4NET A;  3UPP A;  1ES3 A;  2A3U A;  3V5M A;  1CEG A;  2WK0 A;  3SH7 A;  1K56 D;  5CRF A;  4PMA A;  3ZG9 B;  3NY4 A;  3IH8 A;  5EVI C;  4OQ0 A;  4YIN A;  2Z2L B;  3VOY A;  2WKH A;  1GA9 A;  1YMS A;  2JE5 A;  3SOI A;  2XEP A;  5TR7 A;  1LLB A;  3DTM A;  4EUZ A;  2WYX A;  1ES5 A;  1ONH A;  4MEZ A;  4U3T A;  1PYY A;  4KZ8 A;  5TGF A;  3SS3 A;  1JWV A;  1CI9 A;  2OSU A;  1YLW A;  2UWX A;  3IH9 A;  4OP5 A;  3UDX A;  3W4P A;  4F94 A;  3WS5 A;  1SHV A;  1U60 A;  1IYP A;  2C6W B;  2Y2O A;  3LO7 A;  4OPY A;  1W5D A;  2HP6 A;  3VP0 A;  4Q8I A;  4UA6 A;  2CC1 A;  1MPL A;  2Z2M B;  4JBF A;  4IVI A;  3Q82 A;  4LV0 A;  1FR6 A;  3SS4 A;  4WMC A;  4E3J A;  3FZC A;  4DXC A;  3C7V A;  3MZD A;  4DXB A;  3Q7Z A;  1YM1 A;  1K6R A;  4IBX A;  2Y59 A;  4OKP A;  5FI2 A;  3UO9 A;  3V39 A;  3FKW A;  3V3R A;  4KG5 A;  4KG2 A;  4OVD A;  1KGE A;  3NC8 A;  5CXW A;  4EBN A;  1J9M A;  4X6T A;  4JF4 A;  5A92 A;  3BFC A;  2DRW A;  2Y2G A;  5FQQ A;  2XF3 A;  3VP2 A;  3W8K A;  4QHC A;  4EBP A;  5GL9 A;  3EQV A;  4LV2 A;  1K55 A;  2HP9 A;  4FH2 A;  4HBT A;  1KVL A;  4KQR A;  5GHZ A;  4DDS A;  2Y2H A;  2Y2Q A;  1BUL A;  3P09 A;  3OC2 A;  3PBS A;  2XD1 A;  4JKT A;  4GD8 A;  5HAQ A;  5GLD A;  1ZKJ A;  2H5S A;  1RGY A;  1PWD A;  5DF7 A;  5GLC A;  3Q7V B;  4S2K A;  4QY6 A;  1KGF A;  2ZM2 A;  4MBH A;  2EXA A;  5FSR A;  5E2G A;  3N8R A;  1CK3 A;  1FR1 A;  5AQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...