2JBFA

Structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
264
structure length
264
Chain Sequence
LPPERPLTNLQQQIQQLVSRQPNLTAGLYFFNLDSGASLNVGGDQVFPAASTIKFPILVAFFKAVDEGRVTLQERLTMRPDLIAPEAGTLQYQKPNSQYAALEVAELMITISDNTATNMIIDRLGGAAELNQQFQEWGLENTVINNPEPDMKGTNTTSPRDLATLMLKIGQGEILSPRSRDRLLDIMRRTVTNTLLPAGLGKGATIAHKTGDIGIVVGDAGMVDMPNGQRYVAAMMVKRPYNDPRGSELIRQVSRMVYQAFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pbp-A from Thermosynechococcus Elongatus, a Penicillin-Binding Protein Closely Related to Class a Beta-Lactamases.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Hydrolase
molecule keywords TLL2115 PROTEIN
total genus 102
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jbfA01
1ES3A 3PBOA 3C7UA 2OV5A 5CHJA 1KE3A 1K55C 1HD8A 4X68A 1IELA 3ITBA 1XP4A 2WGIA 5EUAA 3ZG8B 4S2MA 3MBZA 3OPHA 4N9LA 3W4OA 3OPRA 1MXOA 4OQIA 1GCEA 1PW1A 2B5RA 3IH9A 1SHVA 3BRMA 3V50A 1PWCA 3CJMA 1MY8A 5EPHA 4OKPA 5GHXA 5FQMA 4PM9A 4WEKA 2XDMA 1CI9A 3NIAA 5GLDA 1FCNA 5EOOA 5GLAA 3VFHA 2ZM8A 3VP0A 4DF6A 4X53A 1RGZA 4OP8A 3ZG0A 4B4XA 1VM1A 4HBUA 4OH0A 1ZG6A 2BG1A 1DJCA 4KZ9A 1XXMA 2DRWA 4ZBEA 5HAIA 5TGFA 3ZG9B 3BLMA 4KG5A 4RVAA 4KQRA 2ZQAA 1TEMA 2A3UA 5GHYA 4KG6A 4KZBA 3OZHA 1XA1A 3FV7A 3OPLA 1FQGA 3GVBA 3M6BA 3GV9A 1LL9A 2Y2JA 3G30A 1AXBA 2X02A 3UN7A 5CECA 3ZCZA 2EXBA 3I7JA 4OPRA 4BD1A 1E25A 2Y2MA 2H0TA 4IBXA 4OQGA 5CTMA 4NK3A 2JBFA 1K4FA 4F94A 2G2UA 5FATA 2V1ZA 1QMEA 4ZJ2A 3HVFA 3LY4A 4OPZA 3MZDA 2ZM0A 3A3IA 1L0DA 4FH2A 5DTTA 4N92A 4RX2A 5GL9A 1YMXA 3ZGAB 2WKEA 4DDSA 3HLDA 3IXGA 2Z2LB 1IYOA 4IVIA 5FAPA 4DE0A 3ZFZA 4JXWA 1YLYA 1RP5A 3HUMA 3LCEA 1SDEA 1FOFA 3DWKA 3A3FA 2JC7A 5EVID 1XGJA 2JCHA 3G2YA 1GHPA 4QJGA 2EX6A 3GR2A 5HFOA 1KGEA 1MWUA 4FCFA 2DCFA 3O86A 3G32A 3WRTA 4E3KA 4ID4A 5E2GA 2XFSA 4GKUA 1PZPA 4MNRA 1HTZA 1N9BA 5CTNA 3S4XA 1YLZA 2FFFB 4JXSA 4C75A 4S2IA 5I94A 3FKWA 4R3BA 2UWXA 3UDIA 4XUXA 2QZ6A 5GHZA 1YMSA 1ZG4A 2EX9A 2Y2PA 4Y0TA 1RCJA 5CGWA 2WZXA 1MBLA 4DRTA 1KDSA 4OOLA 5JYOA 3Q7VA 3G31A 1PIOA 3C4OA 2CC1A 1XGIA 1VQQA 2HP5A 3Q7ZA 3C7VA 3ZG7B 1CEGA 2C5WB 1OMEA 2XLNA 2ZD8A 4JPMA 2RCXA 4DDYA 5KMWA 1PW8A 4LENA 4N1HA 5BOHA 4DE2A 1KE0A 3BFFA 2XD1A 1K4EA 3IXHA 4Y7PA 3UDXA 3S1YA 5HW3A 2H0YA 1IKIA 1NYYA 1E4DA 1NY0A 2HPBA 4PMAA 1Q2QA 4XUZA 1BZAA 3NDGA 3VP3A 4ZJ1A 2XQZA 1J9MA 1SKFA 1RGYA 4EQIA 1S0WA 3VP2A 4KZ8A 1WE4A 3OPPA 4GD6A 5FAOA 1K54A 3W4PA 1K56D 4Z9QA 3PAGA 4X6TA 3NBLA 1NJ4A 1PWDA 3G4PA 3NI9A 1K38A 3VSKA 1C3BA 4ZDXA 4BLMA 3NY4A 4XXRA 2BLSA 4S2NA 3Q82A 5FQJA 4Q8IA 4KZ6A 3A3JA 3IQAA 1BLSA 3HREA 3RXXA 1K6SA 4KQOA 5EVIB 1S6RA 2ZQ8A 5FQKA 5CRFA 2XR0A 1ZC2A 3UPNA 5AQ7A 2VGJA 4A5RA 4JF4A 2EXAA 3D4FA 3BFCA 4ZAMA 1BLHA 1JTGA 5CGXA 4BQMA 1XX2A 3LO7A 4HEFA 4O7DA 3EQVA 3IT9A 1YT4A 4OQ0A 3W8KA 3NDEA 1NXYA 4R0QA 4S2KA 2OSUA 3IF6A 3MFDA 5M19A 5CHUA 2WAEA 3VMAA 3IXDA 3IHBA 2HDUA 4BJPA 5CXWA 5CERA 4DKIA 2EFUA 3N8SA 3GMWA 4X55A 3N8RA 1JWVA 4CPKA 4R1GA 5DTKA 1K57C 4DE3A 1M6KA 4JXGA 2HP6A 2P9VB 4PM5A 5HX9A 3PBRA 5HL1A 1MKIA 3VOZA 1JTDA 3NCKA 2V20A 4OP5A 5IHVA 4IVKA 2Z2MB 4QU3A 4E3OA 3M6HA 1L2SA 2Y2KA 4UAAA 3Q07A 1FSWA 5EE8A 1YQSA 5EVIA 3V39A 4B88A 4C6YA 1DJAA 4BENA 4EBLA 3WS2A 3HUOA 3Q7VB 1K55A 3ZG5A 2ZC4B 4GZBA 1W5DA 4N9KA 1ERMA 4E3MA 2Y2GA 1ES2A 1TVFA 2E8IA 4OONA 1GA0A 1Y54A 4S2OA 5A92A 3IH8A 3MZEA 5M1AA 1KDWA 4QHCA 2OLVA 1GHMA 3IF5A 1FCOA 1CK3A 2RL3A 1ESUA 3FWLA 4IEDA 4PPRA 1IKGA 3WRZA 4WMCD 3IF6B 3TG9A 2Y2HA 4OLGA 2J9PA 5FI6A 1M40A 4KENB 3DW0A 2H5SA 5CGSA 4FD8A 5E43A 4JF6A 1Q2PA 1YLJA 3OCLA 3C4PA 1W8QA 4JF5A 1FCMA 5JYPA 4U0XA 3BFDA 4NETA 2VGKA 5TFQA 1K54C 3UPOA 4OPYA 3OCNA 3SS4A 3HLFA 4WZ4A 5F1GA 4LV1A 3TSGA 4DE1A 3WS0A 2J9OA 4UA9A 3VFFA 3AGFA 5F83A 2PU2A 4GOGA 4LV2A 3IWIA 1N4OA 1HVBA 1W7FA 4P85A 5GLCA 4C3QA 4HBTA 5CEDA 1KE4A 4FSFA 4LCMA 4DXBA 4L0LA 2Y4AA 3VOYA 2WGWB 2HDSA 4LCLA 1PI5A 3FYZA 5DF8A 1JWZA 2HP9A 4M3KA 3LY3A 4FH4A 5U47A 1LI0A 2XD5A 4BL3A 4RX3A 2PBYA 4E6XA 4JXVA 2FFYA 4KG2A 3UY6A 2EX8A 1E3UA 2XGNA 2Q9MA 2XK1A 4S2PA 5A91A 3RJUA 3ZVTA 1IYPA 5DTSA 3PTEA 3HLGA 3MXRA 5CEBA 2ZQ9A 3N4IA 3NC8A 3O3VA 3UDFA 1PI4A 3HLWA 3ISGA 3E2KA 3ITAA 4GDNA 1ALQA 1U60A 3ZNTA 3JYIA 1BLCA 3S22A 1I5QA 1FSYA 3UE3A 3M2JA 2HDQA 2OLUA 4PM8A 3V3RA 4PM6A 3ZDJA 3BYDA 1W79A 1BULA 4JBFA 4LV0A 5EVIC 1MWRA 1ZKJA 4GDBA 4MLLA 2Y55A 1L0EA 1K57A 1EROA 1BSGA 4KZ7A 5KZHA 5E2HA 4WYYA 5FA7A 2GDNA 3WS4A 3AGEA 1KVLA 2J7VA 4U3TA 1MPLA 1ES4A 2WADA 2WAFA 4R4SA 4OOMA 3Q81A 3BECA 5E2FA 3Q1FA 2DNSA 4E6WA 5A93A 4KZ3A 2XH9A 5FASA 2ZC3B 1G68A 4KZ4A 2ZM2A 3PBSA 1YLTA 5KSHA 1G6AA 3MXSA 4X69A 4GNUA 3IWQA 2Q9NA 4OLDA 4R3JA 5GLBA 2EX2A 1HZOA 1NRFA 1TDLA 2HDRA 3PBTA 5TR7A 3A3EA 3FZCA 3BLSA 4JKTA 3ZVWA 2EFXA 5HAQA 2PU4A 4P6BA 1XA7A 3DWZA 1ONGA 3WS1A 5FI2A 1IYQA 4UA6A 3WWXA 4OVDA 3V5MA 1NYMA 3UO9A 4QY6A 4WMCA 3UPPA 3WS5A 1L0GA 4LV3A 5A90A 1I2SA 4K91A 3HL9A 2Y2QA 3PBQA 2A49A 1WYCA 3HBRA 3N7WA 4Y0UA 4MBFA 2WGVA 1QMFA 4OOYA 3VP4A 1I2WA 3HLBA 3HLCA 4OQHA 4E3NA 2ZMAA 3IHAA 3M2KA 4N1XA 1EI5A 3BEBA 3TOIA 4WZ5C 4K0XA 2X01A 2Y2IA 3BM6A 1SDNA 2Y2NA 1ESIA 1K6RA 4EBPA 2ZQ7A 2ZQCA 1FR1A 2P74A 5DF9A 4QD4A 1BT5A 4OPQA 4U0TA 3IF6C 3RXWA 4MEZA 2QMIA 1XPBA 1CI8A 1DJBA 5FQIA 4P87A 3UNWA 2I72A 3GSGA 3CMZA 1E3UD 3E2LA 4GN2A 5J8XA 4R4RA 3CZDA 3SOIA 3BFEA 1LI9A 5FSRA 5FQ9A 5M18A 3CG5A 3G34A 4WM9A 2H10A 3AGDA 1IYSA 3V3SA 5KSCA 3P98A 4KQQA 4H8RA 4EV4A 1H8YA 1LLBA 4EWFA 3GTCA 4S2LA 4S2NC 1FR6A 2WZZA 1ERQA 3LEZA 1BLPA 5EVLA 3B3XA 5FDHA 2ZC6B 2G2WA 3SH8A 5HAPA 1JWPA 2WKHA 1YLPA 3UE1A 4B4ZA 1YLWA 1ES5A 1SCWA 2JE5A 1GHIA 3MZFA 4UHUA 2R9XA 3UE0A 2Y2LA 4E3JA 1YM1A 3GRJA 5AQBA 5FQQA 3SH9A 4GB7A 5FI7A 2WYXA 1CEFA 2V2FF 3QNBA 3VP1A 4WBGA 4RYEA 1PZOA 3SS3A 4MBKA 3MKFA 1O07A 2ZJ9A 5G18A 2Y91A 1K56A 5EOEA 4E3IA 4YINA 5HARA 4MBHA 5DF7A 4EUZA 3ZNYA 3P09A 4X56A 4ZTKA 3C5AA 3SH7A 2ZC7A 1W8YA 3SS5A 3G35A 1BUEA 4KZAA 3O87A 1H8ZA 1DY6A 4WELA 3FKVA 5F82A 3OC2A 3W4QA 1MWSA 1KGFA 1L0FA 1NZUA 2X71A 5F1FA 2R9WA 3DTMA 1JVJA 2Y59A 3GQZA 3N6IA 4PM7A 5EECA 4HESA 4ZJ3A 2ZLYA 4UA7A 1IEMA 2QPNA 5DVAA 3EQUA 2XFTA 1LHYA 4IBRA 1O7EA 2IWBA 1TDGA 1MWTA 2XF3A 2WKIA 1ONHA 2ZC5B 4WZ5A 3MKEA 2J8YA 1XKZA 4EBNA 3HLEA 4BL2A 5AQ9A 1Z6FA 3O88A 3IWOA 1WYBA 4WEJA 4KZ5A 4P0MA 3N8LA 4RA7A 1PWGA 5L2FA 2WUQA 3A3DA 5FAQA 2WK0A 3PBNA 5E2EA 2C6WB 4S2JA 2P9VA 2Y2OA 2IWCA 5AQAA 3G2ZA 4QB8A 3IXBA 4E3LA 1K25A 1BTLA 4BD0A 4Y0OA 3VSLA 1H5XA 1KVMA 5CHMA 1EWZA 1KGGA 3BFGA 4QY5A 4K0WA 4DXCA 5D3OA 2WGWA 2IWDA 1PYYA 4R23A 1LL5A 4D2OA 1NZOA 4JLFA 3PAEA 4YFMA 4GD8A 3ZHHA 3HUNA 3QNCA 3QHYA 2ZQDA 1GA9A 4CJNA 2XEPA
chains in the Genus database with same CATH superfamily
1ES3A 5DKKA 4IJGA 3PXPA 1N9OA 5F5YA 1SHVA 2D01A 1MY8A 3C30A 4OKPA 3T4JA 2QJ5A 5GLDA 5EOOA 3VFHA 4DF6A 2ZM8A 4X53A 3R7WA 1RGZA 3T4LA 3ZG0A 1OT6A 1YPRA 4CLCA 3LFVA 4B9OA 2GJ3A 5I5LA 2A24A 4OH0A 1ZG6A 5HAIA 5TGFA 2DRWA 3ZG9B 4KG5A 3E4OA 2ZQAA 5K5BA 3C2WA 4P6ZM 3GV9A 1LL9A 2X02A 4Y17A 2EXBA 3NOUC 2H0TA 4GW9A 4IUHA 4FTXA 2G2UA 2V1ZA 2XRNA 3ZGAB 2WKQA 5GL9A 4HP9A 3HLDA 5FAPA 3ZFZA 4EXOA 3BQ8A 2JCHA 1GHPA 1KGEA 1YAXA 3WRTA 5E2GA 4XT2B 2I9VA 5CTNA 3S4XA 3QP5A 2FFFB 4C75A 3A0SA 4JGPA 3C8CA 2UWXA 1YMSA 1TS6A 1TD5A 1TS7A 5CGWA 4OOLA 2W3HA 3QP8A 1FILA 1XGIA 2OAP1 2ZD8A 4DDYA 1PW8A 4Q0IA 5BOHA 3UDXA 2HPBA 1Q2QA 5HPFA 1J9MA 4D60A 3U4LP 2HV1A 3LR0A 1S0WA 4KZ8A 3HJIA 5LBRA 5F69A 5FAOA 3UMEA 3DTIA 1LSXA 3G4PA 1PWDA 3IBJA 4ZDXA 3NY4A 4XXRA 2BLSA 3Q82A 1S1ZA 3LR3A 3A3JA 1BLSA 3FPWA 1H0MA 1J3WA 2ZQ8A 4F3LA 2LB5A 2L4RA 3T4SA 5HD5A 2Y79A 1JTGA 4BQMA 1XX2A 4O7DA 3EQVA 3IT9A 3KYZA 4OQ0A 3W8KA 3IF6A 2VEAA 5CXWA 2OWHA 4X55A 4CPKA 1P9WA 5DTKA 1SKOA 4ARZA 3PBRA 5HL1A 1MKIA 3NCKA 4OP5A 5IHVA 4IVKA 4UAAA 2Y2KA 3DTKA 1FSWA 4C6YA 5HPIA 4BENA 3WS2A 3HUOA 2ZC4B 1W5DA 1ERMA 1ES2A 5DFYA 3KSFA 3SZTA 1Y54A 2CMNA 3FWLA 1IKGA 4R70A 2Y2HA 2J9PA 5FI6A 3GECA 4KENB 3A0VA 3T1RA 1DP9A 5JYPA 2VGKA 3UPOA 1YSPA 5HDCA 3UMDA 1XJ3A 2J3TC 5F1GA 2J9OA 3VFFA 3O5YA 2O9CA 1F98A 1VEUB 3LEQA 5GLCA 2Y4AA 4LCLA 2HDSA 1JWZA 4M3KA 3LY3A 2ZL1B 1VEUA 4E6XA 4JXVA 4KG2A 2XK1A 2Q9MA 3OBFA 1N9NA 4S2PA 1V9YA 3ZVTA 5DTSA 3PTEA 3MXRA 1G6OA 2ZQ9A 2PT7A 3CPTB 2E8JA 3O3VA 3UDFA 4GDNA 1ALQA 3S22A 3M2JA 3R4KA 2OLUA 3V3RA 4WL9A 3BYDA 5EVIC 1KOUA 4I39A 5L8MA 1K57A 2W1TA 1BSGA 4ETXA 4KZ7A 4R3AA 2J7VA 1MPLA 2WADA 2WAFA 2KX6A 4OOMA 2DNSA 1WA9A 4LFUA 1G68A 4WN5A 3PBSA 1YLTA 1G6AA 3IWQA 2HJ9C 5GLBA 2EX2A 5EV0A 3A3EA 4JKTA 3ZVWA 2PU4A 2HJEA 1IYQA 3NOTC 1ZHHB 1T1BA 1VHMA 3V5MA 1NYMA 4QY6A 3WS5A 2W3DA 5EVEA 3EEAA 2GNXA 3EGXC 5MC7A 3PBQA 1WYCA 3HBRA 4Y0UA 1CQAA 1QMFA 2BASA 1I2WA 5F6AA 3IHAA 3UB6A 2YKFA 1EI5A 3TOIA 5C5KA 4H6JB 4EBPA 4H6JA 2ZQ7A 2O0YA 5KIZA 1W63M 1XPBA 1CI8A 4I5SA 3UNWA 3E2LA 1E3UD 4CLCC 5J8XA 2PDRA 1LI9A 2DMWA 4KQQA 4H8RA 4EV4A 1H8YA 4EEUA 4S2NC 1Z09A 4FOFA 3LEZA 5FDHA 5EVLA 2ZC6B 1P9RA 2J80A 3SH8A 1YLWA 1ES5A 2JE5A 1GHIA 1NLYA 2VGLM 4E3JA 5EFWA 2O9AA 4XT2A 1PZOA 1FIKA 1O07A 2Y91A 1K56A 3TW8A 1S67L 3KYQA 3SH7A 2ZC7A 3SS5A 3UB7A 4WF0A 2M1CA 4GS9B 2R9WA 5FDSA 3N6IA 2GZAA 2IWBA 2XF3A 2J8YA 2W3EA 5DJTA 5IT5A 5AQ9A 1IOUA 2AVXA 4KZ5A 4P0MA 1L3LA 3S7OA 4PKYG 2NUTC 1IFQA 2Y2OA 1OT9A 3G2ZA 1CF0A 1K25A 2W27A 1BTLA 4BD0A 4Y0OA 3CPTA 1H5XA 2Z6DA 1EWZA 2IWDA 4R23A 1NZOA 3PAEA 4YFMA 2INWA 2XEPA 1VB6A 1MKMA 3L9KA 3C7UA 1KE3A 3ITBA 1XP4A 4S2MA 3OPHA 3OPRA 4OQIA 1GCEA 2VJWA 3IH9A 2W1RA 4GLQA 2W3GA 5EPHA 4WEKA 3E0YA 1LSWA 3NIAA 3VP0A 3IX3A 4LRXC 2UV0E 2B18A 3MF0A 1VM1A 1PRQA 4KQRA 5GHYA 3KX0X 4KZBA 1XA1A 5CX7A 3IX8A 4ETZA 2W3FA 2L1MA 3H82A 3FG8A 4BD1A 1E25A 4IBXA 1SKOB 2HGVA 2O9BA 1K4FA 1QMEA 3IS2A 2ZM0A 3A3IA 3NJAA 3F1PB 1ACFA 1IYOA 4DE0A 4JXWA 3A3FA 3V67A 5EVID 4HQAA 4QJGA 3FC7A 5HFOA 1MWUA 2DCFA 2M7UA 4ID4A 2VV6A 1HTZA 3LIEA 5EM1A 2V1BA 3FKWA 4R3BA 4XUXA 5GHZA 4Y0TA 4B93A 5F68A 5HDSA 3GDIA 3C4OA 2HP5A 3UB5P 3ZG7B 1CEGA 2C5WB 2XLNA 2RCXA 4BMWA 1S1YA 3C38A 4DE2A 4LRYC 2XD1A 4Y7PA 5HW3A 3S1YA 4BBVA 2H0YA 1IKIA 1NYYA 1E4DA 3H9WA 4NXBA 1T18A 1YKDA 3NDGA 3VP3A 3QP1A 3VP2A 1K56D 1AWIA 4X6TA 3NBLA 1NJ4A 3NI9A 3VSKA 4GJ4A 5IS1A 1UWNX 4KZ6A 3IQAA 3RXXA 1K6SA 4KQOA 5EVIB 1XJ4A 5CRFA 4A5RA 1UGUA 5CGXA 3ZYTA 2VZWA 4CLCD 4I3IA 3VMAA 3MS6A 2HDUA 4DKIA 3GMWA 1JWVA 4R1GA 4Y13A 3JPUA 3CLOA 3E98A 2P9VB 4PM5A 3BWLA 3CI6A 4E3OA 3M6HA 1L2SA 4RQ9A 5EVIA 2PD8A 4EBLA 1OJGA 4GZBA 3T1QB 4E3MA 4OONA 1F9IA 5HSQA 5A92A 3IH8A 3MZEA 4QHCA 2OLVA 3RH8B 1GHMA 1FCOA 2ACGA 4IEDA 4HI4A 4R38A 4WMCD 2Q0OA 5A8BA 1T1CA 1M40A 4JF6A 1Q2PA 1YLJA 2ZL1A 4JF5A 1OTDA 1FCMA 3BFDA 4NETA 1T19A 5TFQA 1K54C 4OPYA 1Y4OA 4M4XA 3S7QA 3SS4A 4WZ4A 4LV1A 4BWIA 3TSGA 1D06A 2VV8A 3S7NA 1OJ5A 1W7FA 3QP6A 4P85A 3LGOA 5CEDA 4DXBA 3VOYA 4EUVA 3FYZA 2L0WA 2HP9A 4YNRA 1LI0A 2XD5A 4BL3A 2FFYA 2EX8A 3HCYA 1IYPA 3HLGA 1DP8A 1DRMA 3E2KA 3ITAA 1I5QA 2W0NA 3UE3A 2JKRI 3VV4A 3LI9A 1BULA 4LV0A 4WUJA 4EEPA 1ZKJA 1VETB 4MLLA 5TBMA 1EROA 2QKPA 2PBDP 5E2HA 3WS4A 3AGEA 4L9GA 4PHTA 4R4SA 5G4YA 3BECA 5E2FA 3Q1FA 4E6WA 4KZ3A 1XFQA 1MC0A 5KSHA 3MXSA 4MDZA 4KUKA 4X69A 2HDRA 1TDLA 3PBTA 3BLSA 4MN6A 4P6BA 3B33A 1ONGA 3MMHA 4UA6A 4OVDA 4X25A 1OPXA 1XJ2A 3T4KA 2A49A 4NEED 4MBFA 3VP4A 4OOYA 4E3NA 3HLBA 4OQHA 2JKRM 2ZMAA 3CAXA 3M2KA 4WZ5C 3NULA 5EM0A 3BM6A 1ESIA 1K6RA 4O8GA 4KUOA 2QHKA 3K3CA 4U0TA 3RXWA 2K2NA 2QMIA 4MEZA 4O01A 1V9ZA 3LIDA 5FQIA 4P87A 3PHYA 4II7A 3CMZA 4R4RA 4WLAA 4F3LB 4QWOA 5FQ9A 1IYSA 3VOLA 3V3SA 3DAVA 3KSIA 3P98A 2K31A 3MQOA 1LLBA 4EWFA 3GTCA 3FPVA 4S2LA 3KSHA 3T1SA 4L9EA 4GHIA 2G2WA 5HAPA 4Y5FA 4B4ZA 2ZMVA 3MZFA 5DFXA 3UE0A 3GRJA 5FQQA 4GB7A 3K3DA 3QNBA 4RYEA 1G28A 4X1MA 5G18A 3S7PA 5EOEA 3B42A 4EUZA 3NHQA 4ESPA 3P09A 2JN7A 4ZTKA 3G35A 1BUEA 4KZAA 3O87A 1DY6A 4WELA 3W4QA 1KGFA 1L0FA 2X71A 3CUEC 3LIFA 4CQHA 5EECA 4HESA 4ZJ3A 3F1OA 4I3JA 1IEMA 4BBUA 4DJ3A 3EQUA 2XFTA 1LHYA 2LB9A 1ONHA 4WZ5A 1XKZA 4EBNA 4BL2A 5TJJA 3T4TA 4WEJA 1PWGA 4X1LA 2WK0A 5FAQA 3PBNA 5E2EA 2P9VA 2IWCA 3ICYA 1F5MA 5CHMA 1KGGA 3BFGA 4QY5A 4DXCA 5D3OA 5HZHA 4HNBA 4D2OA 1LL5A 5AVEA 4GD8A 3QNCA 2ZQDA 3PBOA 4GCZA 3ULFA 5CHJA 1K55C 1HD8A 4PKYA 2PYRA 5EUAA 3ZG8B 3MBZA 3W4OA 1MXOA 2PHYA 3BY8A 4HJ4A 1PW1A 2B5RA 3V50A 3BRMA 2QWSA 5GHXA 5FQMA 4PM9A 1N9LA 2JKTM 1CI9A 3E4PA 5GLAA 1BYWA 1W63Q 1OTEA 4OP8A 2B02A 3L7HA 3LR5A 4B4XA 2JKGA 2FZ0A 3KYEA 2BG1A 4KZ9A 1XXMA 4RVAA 1FQGA 3M6BA 4JGOA 2V8CA 2Y2JA 3G30A 1AXBA 5CECA 3I7JA 2Y2MA 3HJKA 4OQGA 5CTMA 3LR4A 4NK3A 5FATA 3HVFA 3LY4A 3MZDA 2VKSA 1L0DA 4FH2A 2M7VA 2P04A 3U2AA 3IXGA 2Z2LB 4IVIA 1P97A 3LCEA 3HUMA 3DWKA 1XGJA 2YKHA 4FCFA 3O86A 4E3KA 2MJ6A 1PNEA 1MZUA 1YLZA 5I94A 1GSXA 3UDIA 5IU1A 1ZG4A 2EX9A 1F2KA 1RCJA 4HP4A 2WZXA 1MBLA 4DRTA 1KDSA 2EA9A 3F1NA 3Q7VA 3G31A 5JYOA 4NKPA 3C7VA 4JPMA 1OMEA 5KMWA 4N1HA 3ZQ5A 1K4EA 2PRFA 4Z1WA 4DMZA 1BZAA 1EW0A 1SKFA 1RGYA 4MCWA 3OPPA 1K54A 3PAGA 3KO6A 1C3BA 3VE4A 2OOLA 4Q8IA 4S2NA 5FQJA 2D02A 2PYPA 1S6RA 3NOPC 3UPNA 3T12B 5AQ7A 2EXAA 2V0UA 3D4FA 3BFCA 4ZAMA 1BLHA 1OTAA 3NDEA 3BW6A 1NXYA 4R0QA 4S2KA 3MFDA 5M19A 5CHUA 1JNUA 2WAEA 2PAVP 3IXDA 3MFXA 3IHBA 5CERA 2EFUA 3N8RA 3E4QA 1K57C 5AVFA 4DE3A 2HP6A 5HX9A 1JTDA 2V20A 3CUEA 2Z2MB 4QU3A 3T4QA 4HHDA 1TS8A 5EE8A 3T50A 1YQSA 1DJAA 1K55A 5J4EA 1TVFA 3H7WA 2E8IA 2VK3A 1X0OA 4S2OA 3MJQA 1KDWA 2WKPA 3IF5A 1ESUA 4PPRA 3WRZA 5J7EA 4OLGA 4G3VA 3KSGA 2H5SA 5CGSA 3OCLA 4L9FA 3MSHA 4U0XA 5L10A 3HLFA 3PYPA 5F83A 4KQDA 2PU2A 4LV2A 1HVBA 3TJZC 4C3QA 4HBTA 1LSVA 2JHEA 1KE4A 4FSFA 1SZVA 2WGWB 5HDDA 1PI5A 1D7EA 2VV7A 3CITA 5U47A 2ZOIA 4RX3A 2PBYA 4PAUA 1E3UA 3RJUA 4EESA 3NC8A 3HLWA 1U60A 1BLCA 2VGLS 4HIAA 1FSYA 1S4SA 4UQIS 1W79A 4JBFA 5FEFA 1L0EA 1PFLA 5KZHA 4NXGA 4U3TA 1ES4A 2ZMFA 3Q81A 2VLGA 3JVUA 2QYBA 4CLCE 2ZC3B 3MQ0A 5HWVA 2ZM2A 4Q0HA 3IS2B 2Q9NA 1NRFA 5TR7A 4LLOB 3FZCA 1ZTUA 5HAQA 3F1PA 1XA7A 3MQQA 2JKFA 4ZRRA 4LV3A 1I2SA 3HL9A 2Y2QA 2XROA 2WGVA 3D72A 1CJFA 5J3WA 2Y2IA 1SDNA 2J3TD 2G7UA 4G3WA 3IF6C 4Y3IA 3OLOA 2I72A 3CZDA 3SOIA 3BFEA 5M18A 3G34A 2H10A 4GS9A 5KSCA 3F1NB 2V9AA 5G4ZA 2WZZA 3W2ZA 1BLPA 3B3XA 2WKHA 2V1AA 3EWKA 5L07A 2R9XA 2Y2LA 5FI7A 2V2FF 3VP1A 4WBGA 3SS3A 2ZJ9A 5HARA 4MBHA 4Q0JA 3ZNYA 3A0RA 3C5AA 3MXQA 3LICA 1H8ZA 3CWFA 3FKVA 1MWSA 3GQZA 3DTMA 1JVJA 2Y59A 1STZA 2ZLYA 2EWWA 4IBRA 5FEGA 1O7EA 3QP4A 1TDGA 1MWTA 2QJ7A 3JVVA 1Z6FA 1NRJA 4EW7A 2WUQA 3A3DA 2V0WA 2C6WB 3LI8A 1HLUP 2OWJA 5AQAA 3LUQA 3P7NA 3IXBA 2ZBBA 4E3LA 3VSLA 4K08A 2K7SA 4HJ6A 3EEHA 2WGWA 4UEYA 3SW1A 1PYYA 4JLFA 5HWWA 3HUNA 1ODVA 2OV5A 4X68A 1IELA 2WGIA 4N9LA 1PWCA 3CJMA 2KLIA 4NXEA 2XDMA 1FCNA 2O99A 3CHWP 4HBUA 4LRZE 2WKRA 1DJCA 4ZBEA 3LIBA 5HD3A 3BLMA 1S4RA 1TEMA 2A3UA 4KG6A 3OZHA 3FV7A 3OPLA 3GVBA 3ZCZA 4EERA 4OPRA 2PR6A 3VE3A 3TRCA 2JBFA 3IX4A 1A0KA 4F94A 4NXFA 4ZJ2A 4EU0A 4OPZA 4P6ZS 4MN7A 5DTTA 4DDSA 4N92A 4RX2A 1YMXA 2WKEA 2P7JA 4UQIM 4YOFA 1YLYA 1RP5A 1SDEA 1FOFA 2XSSA 2JC7A 3G2YA 2EX6A 3GR2A 3OOVA 3G32A 2KOIA 2XFSA 4GKUA 1PZPA 4MNRA 1N9BA 4QPRA 3D3OA 4JXSA 4EETB 4S2IA 3UB8A 5L09A 1NWZA 2QZ6A 5FL3A 4EQ1A 2Y2PA 3DBAA 3H7WB 1OTBA 1PIOA 2CC1A 4AFIA 1VQQA 3Q7ZA 5AJGA 1H8MA 4LENA 1KE0A 3BFFA 3IXHA 1NY0A 3DTEA 4XUZA 4PMAA 1TS0A 2FH5A 2H28A 2XQZA 4ZJ1A 2R78A 4EQIA 2XA7S 1WE4A 4GD6A 3W4PA 4Z9QA 1K38A 3P01A 4E04A 4ARZB 4BLMA 4LGWA 3T4OA 5TBMB 3H82B 3HREA 5FQKA 4JGRA 2XR0A 1ZC2A 2VGJA 4JF4A 2HZ5A 4BBTA 3LO7A 4NG2A 4HEFA 2JKTI 1T1AA 1YT4A 1DP6A 3NECA 2OSUA 2OAQ1 4BJPA 3B47A 2Z6CA 2NUPC 3N8SA 1D1JA 1M6KA 4JXGA 3VOZA 3BQAA 3Q07A 2A2LA 4B88A 3V39A 3Q7VB 3ZG5A 4N9KA 2Y2GA 1TF1A 1LT0A 1GA0A 4HH2A 4I38A 5M1AA 1VETA 2RL3A 1CK3A 1H3QA 5HL6A 3IBRA 1YSQA 3IF6B 3TG9A 3RFBA 3DW0A 4FD8A 5E43A 3C4PA 1W8QA 3OCNA 4DE1A 4HJ3A 3WS0A 4UA9A 2ZOHA 3AGFA 2PR5A 4GOGA 4ME4A 3IWIA 1N4OA 4LCMA 4L0LA 3UB9A 5DF8A 1LL8A 2B95A 4FH4A 2PD7A 4I3AA 4IHQA 3UY6A 4HH3A 1NLZA 2XGNA 1OTIA 5A91A 5CEBA 3N4IA 1PI4A 3ISGA 3ZNTA 3JYIA 4DN0A 2HDQA 3EOIA 4PM8A 4IUKA 4PM6A 3ZDJA 2IA2A 1MWRA 4GDBA 3F1OB 2Y55A 4FUWA 3G6OA 2BTFP 2GX5A 4WYYA 5FA7A 2GDNA 4CLCB 1KVLA 3TE8A 3MR0A 2Y8HA 4YWZA 5A93A 2XH9A 2EWVA 3UE6A 5FASA 4LPZA 4KZ4A 4GNUA 1XJ6A 4OLDA 4R3JA 1HZOA 2EFXA 3DWZA 3WS1A 4G3KA 5FI2A 2W1TB 3WWXA 3UO9A 4WMCA 3UPPA 1L0GA 5A90A 4K91A 1G5UA 1GSVA 3N7WA 1XFNA 3HLCA 2KDKA 2A24B 4N1XA 3BEBA 4K0XA 2X01A 2Y2NA 2ZQCA 1FR1A 3R7WB 2P74A 5DF9A 4QD4A 4Y15A 1BT5A 4OPQA 5DKLA 2HF6A 2J3WA 1DJBA 3D9YA 4GN2A 3GSGA 3BY9A 3EGDC 5DJUA 5FSRA 4R6LA 3CG5A 4WM9A 3AGDA 1UWPX 3LYXA 4MMNA 2VX8A 3BJNA 1GSWA 1FR6A 1S66L 1ERQA 1JWPA 4GHIB 1YLPA 3UE1A 1SCWA 2VA0A 4UHUA 1YM1A 5AQBA 3SH9A 2WYXA 1CEFA 4MBKA 3MKFA 4MN5A 4E3IA 4YINA 1P0ZA 5DF7A 4X56A 1W8YA 4DJ2A 5F82A 3OC2A 1NZUA 4Y2FA 5F1FA 4PM7A 3QP2A 4UA7A 2QPNA 5DVAA 2V8FA 4JGQA 2WKIA 2ZC5B 4HY8A 3MKEA 3HLEA 3T1XA 3O88A 3IWOA 1WYBA 3N8LA 3K2NA 4RA7A 5L2FA 2XA7M 4S2JA 1K0KA 4QB8A 3RTYA 3PR6A 1KVMA 2P08A 4K0WA 1Y28A 4HOIA 3LIAA 3ZHHA 3UN7A 3QHYA 1GA9A 4CJNA 4O0PA 5HWTA
chains in the Genus database with same CATH topology
1ES3A 3PBOA 3C7UA 2OV5A 5CHJA 1KE3A 1K55C 1HD8A 4X68A 1IELA 3ITBA 1XP4A 2WGIA 5EUAA 3ZG8B 4S2MA 3MBZA 3OPHA 4N9LA 3W4OA 3OPRA 1MXOA 4OQIA 1GCEA 1PW1A 2B5RA 3IH9A 1SHVA 3BRMA 3V50A 1PWCA 3CJMA 1MY8A 5EPHA 4OKPA 5GHXA 5FQMA 4PM9A 4WEKA 2XDMA 1CI9A 3NIAA 5GLDA 1FCNA 5EOOA 5GLAA 3VFHA 2ZM8A 3VP0A 4DF6A 4X53A 1RGZA 4OP8A 3ZG0A 4B4XA 1VM1A 4HBUA 4OH0A 1ZG6A 2BG1A 1DJCA 4KZ9A 1XXMA 2DRWA 4ZBEA 5HAIA 5TGFA 3ZG9B 3BLMA 4KG5A 4RVAA 4KQRA 2ZQAA 1TEMA 2A3UA 5GHYA 4KG6A 4KZBA 3OZHA 1XA1A 3FV7A 3OPLA 1FQGA 3GVBA 3M6BA 3GV9A 1LL9A 2Y2JA 3G30A 1AXBA 2X02A 3UN7A 5CECA 3ZCZA 2EXBA 3I7JA 4OPRA 4BD1A 1E25A 2Y2MA 2H0TA 4IBXA 4OQGA 5CTMA 4NK3A 2JBFA 1K4FA 4F94A 2G2UA 5FATA 2V1ZA 1QMEA 4ZJ2A 3HVFA 3LY4A 4OPZA 3MZDA 2ZM0A 3A3IA 1L0DA 4FH2A 5DTTA 4N92A 4RX2A 5GL9A 1YMXA 3ZGAB 2WKEA 4DDSA 3HLDA 3IXGA 2Z2LB 1IYOA 4IVIA 5FAPA 4DE0A 3ZFZA 4JXWA 1YLYA 1RP5A 3HUMA 3LCEA 1SDEA 1FOFA 3DWKA 3A3FA 2JC7A 5EVID 1XGJA 2JCHA 3G2YA 1GHPA 4QJGA 2EX6A 3GR2A 5HFOA 1KGEA 1MWUA 4FCFA 2DCFA 3O86A 3G32A 3WRTA 4E3KA 4ID4A 5E2GA 2XFSA 4GKUA 1PZPA 4MNRA 1HTZA 1N9BA 5CTNA 3S4XA 1YLZA 2FFFB 4JXSA 4C75A 4S2IA 5I94A 3FKWA 4R3BA 2UWXA 3UDIA 4XUXA 2QZ6A 5GHZA 1YMSA 1ZG4A 2EX9A 2Y2PA 4Y0TA 1RCJA 5CGWA 2WZXA 1MBLA 4DRTA 1KDSA 4OOLA 5JYOA 3Q7VA 3G31A 1PIOA 3C4OA 2CC1A 1XGIA 1VQQA 2HP5A 3Q7ZA 3C7VA 3ZG7B 1CEGA 2C5WB 1OMEA 2XLNA 2ZD8A 4JPMA 2RCXA 4DDYA 5KMWA 1PW8A 4LENA 4N1HA 5BOHA 4DE2A 1KE0A 3BFFA 2XD1A 1K4EA 3IXHA 4Y7PA 3UDXA 3S1YA 5HW3A 2H0YA 1IKIA 1NYYA 1E4DA 1NY0A 2HPBA 4PMAA 1Q2QA 4XUZA 1BZAA 3NDGA 3VP3A 4ZJ1A 2XQZA 1J9MA 1SKFA 1RGYA 4EQIA 1S0WA 3VP2A 4KZ8A 1WE4A 3OPPA 4GD6A 5FAOA 1K54A 3W4PA 1K56D 4Z9QA 3PAGA 4X6TA 3NBLA 1NJ4A 1PWDA 3G4PA 3NI9A 1K38A 3VSKA 1C3BA 4ZDXA 4BLMA 3NY4A 4XXRA 2BLSA 4S2NA 3Q82A 5FQJA 4Q8IA 4KZ6A 3A3JA 3IQAA 1BLSA 3HREA 3RXXA 1K6SA 4KQOA 5EVIB 1S6RA 2ZQ8A 5FQKA 5CRFA 2XR0A 1ZC2A 3UPNA 5AQ7A 2VGJA 4A5RA 4JF4A 2EXAA 3D4FA 3BFCA 4ZAMA 1BLHA 1JTGA 5CGXA 4BQMA 1XX2A 3LO7A 4HEFA 4O7DA 3EQVA 3IT9A 1YT4A 4OQ0A 3W8KA 3NDEA 1NXYA 4R0QA 4S2KA 2OSUA 3IF6A 3MFDA 5M19A 5CHUA 2WAEA 3VMAA 3IXDA 3IHBA 2HDUA 4BJPA 5CXWA 5CERA 4DKIA 2EFUA 3N8SA 3GMWA 4X55A 3N8RA 1JWVA 4CPKA 4R1GA 5DTKA 1K57C 4DE3A 1M6KA 4JXGA 2HP6A 2P9VB 4PM5A 5HX9A 3PBRA 5HL1A 1MKIA 3VOZA 1JTDA 3NCKA 2V20A 4OP5A 5IHVA 4IVKA 2Z2MB 4QU3A 4E3OA 3M6HA 1L2SA 2Y2KA 4UAAA 3Q07A 1FSWA 5EE8A 1YQSA 5EVIA 3V39A 4B88A 4C6YA 1DJAA 4BENA 4EBLA 3WS2A 3HUOA 3Q7VB 1K55A 3ZG5A 2ZC4B 4GZBA 1W5DA 4N9KA 1ERMA 4E3MA 2Y2GA 1ES2A 1TVFA 2E8IA 4OONA 1GA0A 1Y54A 4S2OA 5A92A 3IH8A 3MZEA 5M1AA 1KDWA 4QHCA 2OLVA 1GHMA 3IF5A 1FCOA 1CK3A 2RL3A 1ESUA 3FWLA 4IEDA 4PPRA 1IKGA 3WRZA 4WMCD 3IF6B 3TG9A 2Y2HA 4OLGA 2J9PA 5FI6A 1M40A 4KENB 3DW0A 2H5SA 5CGSA 4FD8A 5E43A 4JF6A 1Q2PA 1YLJA 3OCLA 3C4PA 1W8QA 4JF5A 1FCMA 5JYPA 4U0XA 3BFDA 4NETA 2VGKA 5TFQA 1K54C 3UPOA 4OPYA 3OCNA 3SS4A 3HLFA 4WZ4A 5F1GA 4LV1A 3TSGA 4DE1A 3WS0A 2J9OA 4UA9A 3VFFA 3AGFA 5F83A 2PU2A 4GOGA 4LV2A 3IWIA 1N4OA 1HVBA 1W7FA 4P85A 5GLCA 4C3QA 4HBTA 5CEDA 1KE4A 4FSFA 4LCMA 4DXBA 4L0LA 2Y4AA 3VOYA 2WGWB 2HDSA 4LCLA 1PI5A 3FYZA 5DF8A 1JWZA 2HP9A 4M3KA 3LY3A 4FH4A 5U47A 1LI0A 2XD5A 4BL3A 4RX3A 2PBYA 4E6XA 4JXVA 2FFYA 4KG2A 3UY6A 2EX8A 1E3UA 2XGNA 2Q9MA 2XK1A 4S2PA 5A91A 3RJUA 3ZVTA 1IYPA 5DTSA 3PTEA 3HLGA 3MXRA 5CEBA 2ZQ9A 3N4IA 3NC8A 3O3VA 3UDFA 1PI4A 3HLWA 3ISGA 3E2KA 3ITAA 4GDNA 1ALQA 1U60A 3ZNTA 3JYIA 1BLCA 3S22A 1I5QA 1FSYA 3UE3A 3M2JA 2HDQA 2OLUA 4PM8A 3V3RA 4PM6A 3ZDJA 3BYDA 1W79A 1BULA 4JBFA 4LV0A 5EVIC 1MWRA 1ZKJA 4GDBA 4MLLA 2Y55A 1L0EA 1K57A 1EROA 1BSGA 4KZ7A 5KZHA 5E2HA 4WYYA 5FA7A 2GDNA 3WS4A 3AGEA 1KVLA 2J7VA 4U3TA 1MPLA 1ES4A 2WADA 2WAFA 4R4SA 4OOMA 3Q81A 3BECA 5E2FA 3Q1FA 2DNSA 4E6WA 5A93A 4KZ3A 2XH9A 5FASA 2ZC3B 1G68A 4KZ4A 2ZM2A 3PBSA 1YLTA 5KSHA 1G6AA 3MXSA 4X69A 4GNUA 3IWQA 2Q9NA 4OLDA 4R3JA 5GLBA 2EX2A 1HZOA 1NRFA 1TDLA 2HDRA 3PBTA 5TR7A 3A3EA 3FZCA 3BLSA 4JKTA 3ZVWA 2EFXA 5HAQA 2PU4A 4P6BA 1XA7A 3DWZA 1ONGA 3WS1A 5FI2A 1IYQA 4UA6A 3WWXA 4OVDA 3V5MA 1NYMA 3UO9A 4QY6A 4WMCA 3UPPA 3WS5A 1L0GA 4LV3A 5A90A 1I2SA 4K91A 3HL9A 2Y2QA 3PBQA 2A49A 1WYCA 3HBRA 3N7WA 4Y0UA 4MBFA 2WGVA 1QMFA 4OOYA 3VP4A 1I2WA 3HLBA 3HLCA 4OQHA 4E3NA 2ZMAA 3IHAA 3M2KA 4N1XA 1EI5A 3BEBA 3TOIA 4WZ5C 4K0XA 2X01A 2Y2IA 3BM6A 1SDNA 2Y2NA 1ESIA 1K6RA 4EBPA 2ZQ7A 2ZQCA 1FR1A 2P74A 5DF9A 4QD4A 1BT5A 4OPQA 4U0TA 3IF6C 3RXWA 4MEZA 2QMIA 1XPBA 1CI8A 1DJBA 5FQIA 4P87A 3UNWA 2I72A 3GSGA 3CMZA 1E3UD 3E2LA 4GN2A 5J8XA 4R4RA 3CZDA 3SOIA 3BFEA 1LI9A 5FSRA 5FQ9A 5M18A 3CG5A 3G34A 4WM9A 2H10A 3AGDA 1IYSA 3V3SA 5KSCA 3P98A 4KQQA 4H8RA 4EV4A 1H8YA 1LLBA 4EWFA 3GTCA 4S2LA 4S2NC 1FR6A 2WZZA 1ERQA 3LEZA 1BLPA 5EVLA 3B3XA 5FDHA 2ZC6B 2G2WA 3SH8A 5HAPA 1JWPA 2WKHA 1YLPA 3UE1A 4B4ZA 1YLWA 1ES5A 1SCWA 2JE5A 1GHIA 3MZFA 4UHUA 2R9XA 3UE0A 2Y2LA 4E3JA 1YM1A 3GRJA 5AQBA 5FQQA 3SH9A 4GB7A 5FI7A 2WYXA 1CEFA 2V2FF 3QNBA 3VP1A 4WBGA 4RYEA 1PZOA 3SS3A 4MBKA 3MKFA 1O07A 2ZJ9A 5G18A 2Y91A 1K56A 5EOEA 4E3IA 4YINA 5HARA 4MBHA 5DF7A 4EUZA 3ZNYA 3P09A 4X56A 4ZTKA 3C5AA 3SH7A 2ZC7A 1W8YA 3SS5A 3G35A 1BUEA 4KZAA 3O87A 1H8ZA 1DY6A 4WELA 3FKVA 5F82A 3OC2A 3W4QA 1MWSA 1KGFA 1L0FA 1NZUA 2X71A 5F1FA 2R9WA 3DTMA 1JVJA 2Y59A 3GQZA 3N6IA 4PM7A 5EECA 4HESA 4ZJ3A 2ZLYA 4UA7A 1IEMA 2QPNA 5DVAA 3EQUA 2XFTA 1LHYA 4IBRA 1O7EA 2IWBA 1TDGA 1MWTA 2XF3A 2WKIA 1ONHA 2ZC5B 4WZ5A 3MKEA 2J8YA 1XKZA 4EBNA 3HLEA 4BL2A 5AQ9A 1Z6FA 3O88A 3IWOA 1WYBA 4WEJA 4KZ5A 4P0MA 3N8LA 4RA7A 1PWGA 5L2FA 2WUQA 3A3DA 5FAQA 2WK0A 3PBNA 5E2EA 2C6WB 4S2JA 2P9VA 2Y2OA 2IWCA 5AQAA 3G2ZA 4QB8A 3IXBA 4E3LA 1K25A 1BTLA 4BD0A 4Y0OA 3VSLA 1H5XA 1KVMA 5CHMA 1EWZA 1KGGA 3BFGA 4QY5A 4K0WA 4DXCA 5D3OA 2WGWA 2IWDA 1PYYA 4R23A 1LL5A 4D2OA 1NZOA 4JLFA 3PAEA 4YFMA 4GD8A 3ZHHA 3HUNA 3QNCA 3QHYA 2ZQDA 1GA9A 4CJNA 2XEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES3 A;  3PBO A;  3C7U A;  2OV5 A;  5CHJ A;  1KE3 A;  1K55 C;  1HD8 A;  4X68 A;  1IEL A;  3ITB A;  1XP4 A;  2WGI A;  5EUA A;  3ZG8 B;  4S2M A;  3MBZ A;  3OPH A;  4N9L A;  3W4O A;  3OPR A;  1MXO A;  4OQI A;  1GCE A;  1PW1 A;  2B5R A;  3IH9 A;  1SHV A;  3BRM A;  3V50 A;  1PWC A;  3CJM A;  1MY8 A;  5EPH A;  4OKP A;  5GHX A;  5FQM A;  4PM9 A;  4WEK A;  2XDM A;  1CI9 A;  3NIA A;  5GLD A;  1FCN A;  5EOO A;  5GLA A;  3VFH A;  2ZM8 A;  3VP0 A;  4DF6 A;  4X53 A;  1RGZ A;  4OP8 A;  3ZG0 A;  4B4X A;  1VM1 A;  4HBU A;  4OH0 A;  1ZG6 A;  2BG1 A;  1DJC A;  4KZ9 A;  1XXM A;  2DRW A;  4ZBE A;  5HAI A;  5TGF A;  3ZG9 B;  3BLM A;  4KG5 A;  4RVA A;  4KQR A;  2ZQA A;  1TEM A;  2A3U A;  5GHY A;  4KG6 A;  4KZB A;  3OZH A;  1XA1 A;  3FV7 A;  3OPL A;  1FQG A;  3GVB A;  3M6B A;  3GV9 A;  1LL9 A;  2Y2J A;  3G30 A;  1AXB A;  2X02 A;  3UN7 A;  5CEC A;  3ZCZ A;  2EXB A;  3I7J A;  4OPR A;  4BD1 A;  1E25 A;  2Y2M A;  2H0T A;  4IBX A;  4OQG A;  5CTM A;  4NK3 A;  2JBF A;  1K4F A;  4F94 A;  2G2U A;  5FAT A;  2V1Z A;  1QME A;  4ZJ2 A;  3HVF A;  3LY4 A;  4OPZ A;  3MZD A;  2ZM0 A;  3A3I A;  1L0D A;  4FH2 A;  5DTT A;  4N92 A;  4RX2 A;  5GL9 A;  1YMX A;  3ZGA B;  2WKE A;  4DDS A;  3HLD A;  3IXG A;  2Z2L B;  1IYO A;  4IVI A;  5FAP A;  4DE0 A;  3ZFZ A;  4JXW A;  1YLY A;  1RP5 A;  3HUM A;  3LCE A;  1SDE A;  1FOF A;  3DWK A;  3A3F A;  2JC7 A;  5EVI D;  1XGJ A;  2JCH A;  3G2Y A;  1GHP A;  4QJG A;  2EX6 A;  3GR2 A;  5HFO A;  1KGE A;  1MWU A;  4FCF A;  2DCF A;  3O86 A;  3G32 A;  3WRT A;  4E3K A;  4ID4 A;  5E2G A;  2XFS A;  4GKU A;  1PZP A;  4MNR A;  1HTZ A;  1N9B A;  5CTN A;  3S4X A;  1YLZ A;  2FFF B;  4JXS A;  4C75 A;  4S2I A;  5I94 A;  3FKW A;  4R3B A;  2UWX A;  3UDI A;  4XUX A;  2QZ6 A;  5GHZ A;  1YMS A;  1ZG4 A;  2EX9 A;  2Y2P A;  4Y0T A;  1RCJ A;  5CGW A;  2WZX A;  1MBL A;  4DRT A;  1KDS A;  4OOL A;  5JYO A;  3Q7V A;  3G31 A;  1PIO A;  3C4O A;  2CC1 A;  1XGI A;  1VQQ A;  2HP5 A;  3Q7Z A;  3C7V A;  3ZG7 B;  1CEG A;  2C5W B;  1OME A;  2XLN A;  2ZD8 A;  4JPM A;  2RCX A;  4DDY A;  5KMW A;  1PW8 A;  4LEN A;  4N1H A;  5BOH A;  4DE2 A;  1KE0 A;  3BFF A;  2XD1 A;  1K4E A;  3IXH A;  4Y7P A;  3UDX A;  3S1Y A;  5HW3 A;  2H0Y A;  1IKI A;  1NYY A;  1E4D A;  1NY0 A;  2HPB A;  4PMA A;  1Q2Q A;  4XUZ A;  1BZA A;  3NDG A;  3VP3 A;  4ZJ1 A;  2XQZ A;  1J9M A;  1SKF A;  1RGY A;  4EQI A;  1S0W A;  3VP2 A;  4KZ8 A;  1WE4 A;  3OPP A;  4GD6 A;  5FAO A;  1K54 A;  3W4P A;  1K56 D;  4Z9Q A;  3PAG A;  4X6T A;  3NBL A;  1NJ4 A;  1PWD A;  3G4P A;  3NI9 A;  1K38 A;  3VSK A;  1C3B A;  4ZDX A;  4BLM A;  3NY4 A;  4XXR A;  2BLS A;  4S2N A;  3Q82 A;  5FQJ A;  4Q8I A;  4KZ6 A;  3A3J A;  3IQA A;  1BLS A;  3HRE A;  3RXX A;  1K6S A;  4KQO A;  5EVI B;  1S6R A;  2ZQ8 A;  5FQK A;  5CRF A;  2XR0 A;  1ZC2 A;  3UPN A;  5AQ7 A;  2VGJ A;  4A5R A;  4JF4 A;  2EXA A;  3D4F A;  3BFC A;  4ZAM A;  1BLH A;  1JTG A;  5CGX A;  4BQM A;  1XX2 A;  3LO7 A;  4HEF A;  4O7D A;  3EQV A;  3IT9 A;  1YT4 A;  4OQ0 A;  3W8K A;  3NDE A;  1NXY A;  4R0Q A;  4S2K A;  2OSU A;  3IF6 A;  3MFD A;  5M19 A;  5CHU A;  2WAE A;  3VMA A;  3IXD A;  3IHB A;  2HDU A;  4BJP A;  5CXW A;  5CER A;  4DKI A;  2EFU A;  3N8S A;  3GMW A;  4X55 A;  3N8R A;  1JWV A;  4CPK A;  4R1G A;  5DTK A;  1K57 C;  4DE3 A;  1M6K A;  4JXG A;  2HP6 A;  2P9V B;  4PM5 A;  5HX9 A;  3PBR A;  5HL1 A;  1MKI A;  3VOZ A;  1JTD A;  3NCK A;  2V20 A;  4OP5 A;  5IHV A;  4IVK A;  2Z2M B;  4QU3 A;  4E3O A;  3M6H A;  1L2S A;  2Y2K A;  4UAA A;  3Q07 A;  1FSW A;  5EE8 A;  1YQS A;  5EVI A;  3V39 A;  4B88 A;  4C6Y A;  1DJA A;  4BEN A;  4EBL A;  3WS2 A;  3HUO A;  3Q7V B;  1K55 A;  3ZG5 A;  2ZC4 B;  4GZB A;  1W5D A;  4N9K A;  1ERM A;  4E3M A;  2Y2G A;  1ES2 A;  1TVF A;  2E8I A;  4OON A;  1GA0 A;  1Y54 A;  4S2O A;  5A92 A;  3IH8 A;  3MZE A;  5M1A A;  1KDW A;  4QHC A;  2OLV A;  1GHM A;  3IF5 A;  1FCO A;  1CK3 A;  2RL3 A;  1ESU A;  3FWL A;  4IED A;  4PPR A;  1IKG A;  3WRZ A;  4WMC D;  3IF6 B;  3TG9 A;  2Y2H A;  4OLG A;  2J9P A;  5FI6 A;  1M40 A;  4KEN B;  3DW0 A;  2H5S A;  5CGS A;  4FD8 A;  5E43 A;  4JF6 A;  1Q2P A;  1YLJ A;  3OCL A;  3C4P A;  1W8Q A;  4JF5 A;  1FCM A;  5JYP A;  4U0X A;  3BFD A;  4NET A;  2VGK A;  5TFQ A;  1K54 C;  3UPO A;  4OPY A;  3OCN A;  3SS4 A;  3HLF A;  4WZ4 A;  5F1G A;  4LV1 A;  3TSG A;  4DE1 A;  3WS0 A;  2J9O A;  4UA9 A;  3VFF A;  3AGF A;  5F83 A;  2PU2 A;  4GOG A;  4LV2 A;  3IWI A;  1N4O A;  1HVB A;  1W7F A;  4P85 A;  5GLC A;  4C3Q A;  4HBT A;  5CED A;  1KE4 A;  4FSF A;  4LCM A;  4DXB A;  4L0L A;  2Y4A A;  3VOY A;  2WGW B;  2HDS A;  4LCL A;  1PI5 A;  3FYZ A;  5DF8 A;  1JWZ A;  2HP9 A;  4M3K A;  3LY3 A;  4FH4 A;  5U47 A;  1LI0 A;  2XD5 A;  4BL3 A;  4RX3 A;  2PBY A;  4E6X A;  4JXV A;  2FFY A;  4KG2 A;  3UY6 A;  2EX8 A;  1E3U A;  2XGN A;  2Q9M A;  2XK1 A;  4S2P A;  5A91 A;  3RJU A;  3ZVT A;  1IYP A;  5DTS A;  3PTE A;  3HLG A;  3MXR A;  5CEB A;  2ZQ9 A;  3N4I A;  3NC8 A;  3O3V A;  3UDF A;  1PI4 A;  3HLW A;  3ISG A;  3E2K A;  3ITA A;  4GDN A;  1ALQ A;  1U60 A;  3ZNT A;  3JYI A;  1BLC A;  3S22 A;  1I5Q A;  1FSY A;  3UE3 A;  3M2J A;  2HDQ A;  2OLU A;  4PM8 A;  3V3R A;  4PM6 A;  3ZDJ A;  3BYD A;  1W79 A;  1BUL A;  4JBF A;  4LV0 A;  5EVI C;  1MWR A;  1ZKJ A;  4GDB A;  4MLL A;  2Y55 A;  1L0E A;  1K57 A;  1ERO A;  1BSG A;  4KZ7 A;  5KZH A;  5E2H A;  4WYY A;  5FA7 A;  2GDN A;  3WS4 A;  3AGE A;  1KVL A;  2J7V A;  4U3T A;  1MPL A;  1ES4 A;  2WAD A;  2WAF A;  4R4S A;  4OOM A;  3Q81 A;  3BEC A;  5E2F A;  3Q1F A;  2DNS A;  4E6W A;  5A93 A;  4KZ3 A;  2XH9 A;  5FAS A;  2ZC3 B;  1G68 A;  4KZ4 A;  2ZM2 A;  3PBS A;  1YLT A;  5KSH A;  1G6A A;  3MXS A;  4X69 A;  4GNU A;  3IWQ A;  2Q9N A;  4OLD A;  4R3J A;  5GLB A;  2EX2 A;  1HZO A;  1NRF A;  1TDL A;  2HDR A;  3PBT A;  5TR7 A;  3A3E A;  3FZC A;  3BLS A;  4JKT A;  3ZVW A;  2EFX A;  5HAQ A;  2PU4 A;  4P6B A;  1XA7 A;  3DWZ A;  1ONG A;  3WS1 A;  5FI2 A;  1IYQ A;  4UA6 A;  3WWX A;  4OVD A;  3V5M A;  1NYM A;  3UO9 A;  4QY6 A;  4WMC A;  3UPP A;  3WS5 A;  1L0G A;  4LV3 A;  5A90 A;  1I2S A;  4K91 A;  3HL9 A;  2Y2Q A;  3PBQ A;  2A49 A;  1WYC A;  3HBR A;  3N7W A;  4Y0U A;  4MBF A;  2WGV A;  1QMF A;  4OOY A;  3VP4 A;  1I2W A;  3HLB A;  3HLC A;  4OQH A;  4E3N A;  2ZMA A;  3IHA A;  3M2K A;  4N1X A;  1EI5 A;  3BEB A;  3TOI A;  4WZ5 C;  4K0X A;  2X01 A;  2Y2I A;  3BM6 A;  1SDN A;  2Y2N A;  1ESI A;  1K6R A;  4EBP A;  2ZQ7 A;  2ZQC A;  1FR1 A;  2P74 A;  5DF9 A;  4QD4 A;  1BT5 A;  4OPQ A;  4U0T A;  3IF6 C;  3RXW A;  4MEZ A;  2QMI A;  1XPB A;  1CI8 A;  1DJB A;  5FQI A;  4P87 A;  3UNW A;  2I72 A;  3GSG A;  3CMZ A;  1E3U D;  3E2L A;  4GN2 A;  5J8X A;  4R4R A;  3CZD A;  3SOI A;  3BFE A;  1LI9 A;  5FSR A;  5FQ9 A;  5M18 A;  3CG5 A;  3G34 A;  4WM9 A;  2H10 A;  3AGD A;  1IYS A;  3V3S A;  5KSC A;  3P98 A;  4KQQ A;  4H8R A;  4EV4 A;  1H8Y A;  1LLB A;  4EWF A;  3GTC A;  4S2L A;  4S2N C;  1FR6 A;  2WZZ A;  1ERQ A;  3LEZ A;  1BLP A;  5EVL A;  3B3X A;  5FDH A;  2ZC6 B;  2G2W A;  3SH8 A;  5HAP A;  1JWP A;  2WKH A;  1YLP A;  3UE1 A;  4B4Z A;  1YLW A;  1ES5 A;  1SCW A;  2JE5 A;  1GHI A;  3MZF A;  4UHU A;  2R9X A;  3UE0 A;  2Y2L A;  4E3J A;  1YM1 A;  3GRJ A;  5AQB A;  5FQQ A;  3SH9 A;  4GB7 A;  5FI7 A;  2WYX A;  1CEF A;  2V2F F;  3QNB A;  3VP1 A;  4WBG A;  4RYE A;  1PZO A;  3SS3 A;  4MBK A;  3MKF A;  1O07 A;  2ZJ9 A;  5G18 A;  2Y91 A;  1K56 A;  5EOE A;  4E3I A;  4YIN A;  5HAR A;  4MBH A;  5DF7 A;  4EUZ A;  3ZNY A;  3P09 A;  4X56 A;  4ZTK A;  3C5A A;  3SH7 A;  2ZC7 A;  1W8Y A;  3SS5 A;  3G35 A;  1BUE A;  4KZA A;  3O87 A;  1H8Z A;  1DY6 A;  4WEL A;  3FKV A;  5F82 A;  3OC2 A;  3W4Q A;  1MWS A;  1KGF A;  1L0F A;  1NZU A;  2X71 A;  5F1F A;  2R9W A;  3DTM A;  1JVJ A;  2Y59 A;  3GQZ A;  3N6I A;  4PM7 A;  5EEC A;  4HES A;  4ZJ3 A;  2ZLY A;  4UA7 A;  1IEM A;  2QPN A;  5DVA A;  3EQU A;  2XFT A;  1LHY A;  4IBR A;  1O7E A;  2IWB A;  1TDG A;  1MWT A;  2XF3 A;  2WKI A;  1ONH A;  2ZC5 B;  4WZ5 A;  3MKE A;  2J8Y A;  1XKZ A;  4EBN A;  3HLE A;  4BL2 A;  5AQ9 A;  1Z6F A;  3O88 A;  3IWO A;  1WYB A;  4WEJ A;  4KZ5 A;  4P0M A;  3N8L A;  4RA7 A;  1PWG A;  5L2F A;  2WUQ A;  3A3D A;  5FAQ A;  2WK0 A;  3PBN A;  5E2E A;  2C6W B;  4S2J A;  2P9V A;  2Y2O A;  2IWC A;  5AQA A;  3G2Z A;  4QB8 A;  3IXB A;  4E3L A;  1K25 A;  1BTL A;  4BD0 A;  4Y0O A;  3VSL A;  1H5X A;  1KVM A;  5CHM A;  1EWZ A;  1KGG A;  3BFG A;  4QY5 A;  4K0W A;  4DXC A;  5D3O A;  2WGW A;  2IWD A;  1PYY A;  4R23 A;  1LL5 A;  4D2O A;  1NZO A;  4JLF A;  3PAE A;  4YFM A;  4GD8 A;  3ZHH A;  3HUN A;  3QNC A;  3QHY A;  2ZQD A;  1GA9 A;  4CJN A;  2XEP A; 
#chains in the Genus database with same CATH topology
 1ES3 A;  5DKK A;  4IJG A;  3PXP A;  1N9O A;  5F5Y A;  1SHV A;  2D01 A;  1MY8 A;  3C30 A;  4OKP A;  3T4J A;  2QJ5 A;  5GLD A;  5EOO A;  3VFH A;  4DF6 A;  2ZM8 A;  4X53 A;  3R7W A;  1RGZ A;  3T4L A;  3ZG0 A;  1OT6 A;  1YPR A;  4CLC A;  3LFV A;  4B9O A;  2GJ3 A;  5I5L A;  2A24 A;  4OH0 A;  1ZG6 A;  5HAI A;  5TGF A;  2DRW A;  3ZG9 B;  4KG5 A;  3E4O A;  2ZQA A;  5K5B A;  3C2W A;  4P6Z M;  3GV9 A;  1LL9 A;  2X02 A;  4Y17 A;  2EXB A;  3NOU C;  2H0T A;  4GW9 A;  4IUH A;  4FTX A;  2G2U A;  2V1Z A;  2XRN A;  3ZGA B;  2WKQ A;  5GL9 A;  4HP9 A;  3HLD A;  5FAP A;  3ZFZ A;  4EXO A;  3BQ8 A;  2JCH A;  1GHP A;  1KGE A;  1YAX A;  3WRT A;  5E2G A;  4XT2 B;  2I9V A;  5CTN A;  3S4X A;  3QP5 A;  2FFF B;  4C75 A;  3A0S A;  4JGP A;  3C8C A;  2UWX A;  1YMS A;  1TS6 A;  1TD5 A;  1TS7 A;  5CGW A;  4OOL A;  2W3H A;  3QP8 A;  1FIL A;  1XGI A;  2OAP 1;  2ZD8 A;  4DDY A;  1PW8 A;  4Q0I A;  5BOH A;  3UDX A;  2HPB A;  1Q2Q A;  5HPF A;  1J9M A;  4D60 A;  3U4L P;  2HV1 A;  3LR0 A;  1S0W A;  4KZ8 A;  3HJI A;  5LBR A;  5F69 A;  5FAO A;  3UME A;  3DTI A;  1LSX A;  3G4P A;  1PWD A;  3IBJ A;  4ZDX A;  3NY4 A;  4XXR A;  2BLS A;  3Q82 A;  1S1Z A;  3LR3 A;  3A3J A;  1BLS A;  3FPW A;  1H0M A;  1J3W A;  2ZQ8 A;  4F3L A;  2LB5 A;  2L4R A;  3T4S A;  5HD5 A;  2Y79 A;  1JTG A;  4BQM A;  1XX2 A;  4O7D A;  3EQV A;  3IT9 A;  3KYZ A;  4OQ0 A;  3W8K A;  3IF6 A;  2VEA A;  5CXW A;  2OWH A;  4X55 A;  4CPK A;  1P9W A;  5DTK A;  1SKO A;  4ARZ A;  3PBR A;  5HL1 A;  1MKI A;  3NCK A;  4OP5 A;  5IHV A;  4IVK A;  4UAA A;  2Y2K A;  3DTK A;  1FSW A;  4C6Y A;  5HPI A;  4BEN A;  3WS2 A;  3HUO A;  2ZC4 B;  1W5D A;  1ERM A;  1ES2 A;  5DFY A;  3KSF A;  3SZT A;  1Y54 A;  2CMN A;  3FWL A;  1IKG A;  4R70 A;  2Y2H A;  2J9P A;  5FI6 A;  3GEC A;  4KEN B;  3A0V A;  3T1R A;  1DP9 A;  5JYP A;  2VGK A;  3UPO A;  1YSP A;  5HDC A;  3UMD A;  1XJ3 A;  2J3T C;  5F1G A;  2J9O A;  3VFF A;  3O5Y A;  2O9C A;  1F98 A;  1VEU B;  3LEQ A;  5GLC A;  2Y4A A;  4LCL A;  2HDS A;  1JWZ A;  4M3K A;  3LY3 A;  2ZL1 B;  1VEU A;  4E6X A;  4JXV A;  4KG2 A;  2XK1 A;  2Q9M A;  3OBF A;  1N9N A;  4S2P A;  1V9Y A;  3ZVT A;  5DTS A;  3PTE A;  3MXR A;  1G6O A;  2ZQ9 A;  2PT7 A;  3CPT B;  2E8J A;  3O3V A;  3UDF A;  4GDN A;  1ALQ A;  3S22 A;  3M2J A;  3R4K A;  2OLU A;  3V3R A;  4WL9 A;  3BYD A;  5EVI C;  1KOU A;  4I39 A;  5L8M A;  1K57 A;  2W1T A;  1BSG A;  4ETX A;  4KZ7 A;  4R3A A;  2J7V A;  1MPL A;  2WAD A;  2WAF A;  2KX6 A;  4OOM A;  2DNS A;  1WA9 A;  4LFU A;  1G68 A;  4WN5 A;  3PBS A;  1YLT A;  1G6A A;  3IWQ A;  2HJ9 C;  5GLB A;  2EX2 A;  5EV0 A;  3A3E A;  4JKT A;  3ZVW A;  2PU4 A;  2HJE A;  1IYQ A;  3NOT C;  1ZHH B;  1T1B A;  1VHM A;  3V5M A;  1NYM A;  4QY6 A;  3WS5 A;  2W3D A;  5EVE A;  3EEA A;  2GNX A;  3EGX C;  5MC7 A;  3PBQ A;  1WYC A;  3HBR A;  4Y0U A;  1CQA A;  1QMF A;  2BAS A;  1I2W A;  5F6A A;  3IHA A;  3UB6 A;  2YKF A;  1EI5 A;  3TOI A;  5C5K A;  4H6J B;  4EBP A;  4H6J A;  2ZQ7 A;  2O0Y A;  5KIZ A;  1W63 M;  1XPB A;  1CI8 A;  4I5S A;  3UNW A;  3E2L A;  1E3U D;  4CLC C;  5J8X A;  2PDR A;  1LI9 A;  2DMW A;  4KQQ A;  4H8R A;  4EV4 A;  1H8Y A;  4EEU A;  4S2N C;  1Z09 A;  4FOF A;  3LEZ A;  5FDH A;  5EVL A;  2ZC6 B;  1P9R A;  2J80 A;  3SH8 A;  1YLW A;  1ES5 A;  2JE5 A;  1GHI A;  1NLY A;  2VGL M;  4E3J A;  5EFW A;  2O9A A;  4XT2 A;  1PZO A;  1FIK A;  1O07 A;  2Y91 A;  1K56 A;  3TW8 A;  1S67 L;  3KYQ A;  3SH7 A;  2ZC7 A;  3SS5 A;  3UB7 A;  4WF0 A;  2M1C A;  4GS9 B;  2R9W A;  5FDS A;  3N6I A;  2GZA A;  2IWB A;  2XF3 A;  2J8Y A;  2W3E A;  5DJT A;  5IT5 A;  5AQ9 A;  1IOU A;  2AVX A;  4KZ5 A;  4P0M A;  1L3L A;  3S7O A;  4PKY G;  2NUT C;  1IFQ A;  2Y2O A;  1OT9 A;  3G2Z A;  1CF0 A;  1K25 A;  2W27 A;  1BTL A;  4BD0 A;  4Y0O A;  3CPT A;  1H5X A;  2Z6D A;  1EWZ A;  2IWD A;  4R23 A;  1NZO A;  3PAE A;  4YFM A;  2INW A;  2XEP A;  1VB6 A;  1MKM A;  3L9K A;  3C7U A;  1KE3 A;  3ITB A;  1XP4 A;  4S2M A;  3OPH A;  3OPR A;  4OQI A;  1GCE A;  2VJW A;  3IH9 A;  2W1R A;  4GLQ A;  2W3G A;  5EPH A;  4WEK A;  3E0Y A;  1LSW A;  3NIA A;  3VP0 A;  3IX3 A;  4LRX C;  2UV0 E;  2B18 A;  3MF0 A;  1VM1 A;  1PRQ A;  4KQR A;  5GHY A;  3KX0 X;  4KZB A;  1XA1 A;  5CX7 A;  3IX8 A;  4ETZ A;  2W3F A;  2L1M A;  3H82 A;  3FG8 A;  4BD1 A;  1E25 A;  4IBX A;  1SKO B;  2HGV A;  2O9B A;  1K4F A;  1QME A;  3IS2 A;  2ZM0 A;  3A3I A;  3NJA A;  3F1P B;  1ACF A;  1IYO A;  4DE0 A;  4JXW A;  3A3F A;  3V67 A;  5EVI D;  4HQA A;  4QJG A;  3FC7 A;  5HFO A;  1MWU A;  2DCF A;  2M7U A;  4ID4 A;  2VV6 A;  1HTZ A;  3LIE A;  5EM1 A;  2V1B A;  3FKW A;  4R3B A;  4XUX A;  5GHZ A;  4Y0T A;  4B93 A;  5F68 A;  5HDS A;  3GDI A;  3C4O A;  2HP5 A;  3UB5 P;  3ZG7 B;  1CEG A;  2C5W B;  2XLN A;  2RCX A;  4BMW A;  1S1Y A;  3C38 A;  4DE2 A;  4LRY C;  2XD1 A;  4Y7P A;  5HW3 A;  3S1Y A;  4BBV A;  2H0Y A;  1IKI A;  1NYY A;  1E4D A;  3H9W A;  4NXB A;  1T18 A;  1YKD A;  3NDG A;  3VP3 A;  3QP1 A;  3VP2 A;  1K56 D;  1AWI A;  4X6T A;  3NBL A;  1NJ4 A;  3NI9 A;  3VSK A;  4GJ4 A;  5IS1 A;  1UWN X;  4KZ6 A;  3IQA A;  3RXX A;  1K6S A;  4KQO A;  5EVI B;  1XJ4 A;  5CRF A;  4A5R A;  1UGU A;  5CGX A;  3ZYT A;  2VZW A;  4CLC D;  4I3I A;  3VMA A;  3MS6 A;  2HDU A;  4DKI A;  3GMW A;  1JWV A;  4R1G A;  4Y13 A;  3JPU A;  3CLO A;  3E98 A;  2P9V B;  4PM5 A;  3BWL A;  3CI6 A;  4E3O A;  3M6H A;  1L2S A;  4RQ9 A;  5EVI A;  2PD8 A;  4EBL A;  1OJG A;  4GZB A;  3T1Q B;  4E3M A;  4OON A;  1F9I A;  5HSQ A;  5A92 A;  3IH8 A;  3MZE A;  4QHC A;  2OLV A;  3RH8 B;  1GHM A;  1FCO A;  2ACG A;  4IED A;  4HI4 A;  4R38 A;  4WMC D;  2Q0O A;  5A8B A;  1T1C A;  1M40 A;  4JF6 A;  1Q2P A;  1YLJ A;  2ZL1 A;  4JF5 A;  1OTD A;  1FCM A;  3BFD A;  4NET A;  1T19 A;  5TFQ A;  1K54 C;  4OPY A;  1Y4O A;  4M4X A;  3S7Q A;  3SS4 A;  4WZ4 A;  4LV1 A;  4BWI A;  3TSG A;  1D06 A;  2VV8 A;  3S7N A;  1OJ5 A;  1W7F A;  3QP6 A;  4P85 A;  3LGO A;  5CED A;  4DXB A;  3VOY A;  4EUV A;  3FYZ A;  2L0W A;  2HP9 A;  4YNR A;  1LI0 A;  2XD5 A;  4BL3 A;  2FFY A;  2EX8 A;  3HCY A;  1IYP A;  3HLG A;  1DP8 A;  1DRM A;  3E2K A;  3ITA A;  1I5Q A;  2W0N A;  3UE3 A;  2JKR I;  3VV4 A;  3LI9 A;  1BUL A;  4LV0 A;  4WUJ A;  4EEP A;  1ZKJ A;  1VET B;  4MLL A;  5TBM A;  1ERO A;  2QKP A;  2PBD P;  5E2H A;  3WS4 A;  3AGE A;  4L9G A;  4PHT A;  4R4S A;  5G4Y A;  3BEC A;  5E2F A;  3Q1F A;  4E6W A;  4KZ3 A;  1XFQ A;  1MC0 A;  5KSH A;  3MXS A;  4MDZ A;  4KUK A;  4X69 A;  2HDR A;  1TDL A;  3PBT A;  3BLS A;  4MN6 A;  4P6B A;  3B33 A;  1ONG A;  3MMH A;  4UA6 A;  4OVD A;  4X25 A;  1OPX A;  1XJ2 A;  3T4K A;  2A49 A;  4NEE D;  4MBF A;  3VP4 A;  4OOY A;  4E3N A;  3HLB A;  4OQH A;  2JKR M;  2ZMA A;  3CAX A;  3M2K A;  4WZ5 C;  3NUL A;  5EM0 A;  3BM6 A;  1ESI A;  1K6R A;  4O8G A;  4KUO A;  2QHK A;  3K3C A;  4U0T A;  3RXW A;  2K2N A;  2QMI A;  4MEZ A;  4O01 A;  1V9Z A;  3LID A;  5FQI A;  4P87 A;  3PHY A;  4II7 A;  3CMZ A;  4R4R A;  4WLA A;  4F3L B;  4QWO A;  5FQ9 A;  1IYS A;  3VOL A;  3V3S A;  3DAV A;  3KSI A;  3P98 A;  2K31 A;  3MQO A;  1LLB A;  4EWF A;  3GTC A;  3FPV A;  4S2L A;  3KSH A;  3T1S A;  4L9E A;  4GHI A;  2G2W A;  5HAP A;  4Y5F A;  4B4Z A;  2ZMV A;  3MZF A;  5DFX A;  3UE0 A;  3GRJ A;  5FQQ A;  4GB7 A;  3K3D A;  3QNB A;  4RYE A;  1G28 A;  4X1M A;  5G18 A;  3S7P A;  5EOE A;  3B42 A;  4EUZ A;  3NHQ A;  4ESP A;  3P09 A;  2JN7 A;  4ZTK A;  3G35 A;  1BUE A;  4KZA A;  3O87 A;  1DY6 A;  4WEL A;  3W4Q A;  1KGF A;  1L0F A;  2X71 A;  3CUE C;  3LIF A;  4CQH A;  5EEC A;  4HES A;  4ZJ3 A;  3F1O A;  4I3J A;  1IEM A;  4BBU A;  4DJ3 A;  3EQU A;  2XFT A;  1LHY A;  2LB9 A;  1ONH A;  4WZ5 A;  1XKZ A;  4EBN A;  4BL2 A;  5TJJ A;  3T4T A;  4WEJ A;  1PWG A;  4X1L A;  2WK0 A;  5FAQ A;  3PBN A;  5E2E A;  2P9V A;  2IWC A;  3ICY A;  1F5M A;  5CHM A;  1KGG A;  3BFG A;  4QY5 A;  4DXC A;  5D3O A;  5HZH A;  4HNB A;  4D2O A;  1LL5 A;  5AVE A;  4GD8 A;  3QNC A;  2ZQD A;  3PBO A;  4GCZ A;  3ULF A;  5CHJ A;  1K55 C;  1HD8 A;  4PKY A;  2PYR A;  5EUA A;  3ZG8 B;  3MBZ A;  3W4O A;  1MXO A;  2PHY A;  3BY8 A;  4HJ4 A;  1PW1 A;  2B5R A;  3V50 A;  3BRM A;  2QWS A;  5GHX A;  5FQM A;  4PM9 A;  1N9L A;  2JKT M;  1CI9 A;  3E4P A;  5GLA A;  1BYW A;  1W63 Q;  1OTE A;  4OP8 A;  2B02 A;  3L7H A;  3LR5 A;  4B4X A;  2JKG A;  2FZ0 A;  3KYE A;  2BG1 A;  4KZ9 A;  1XXM A;  4RVA A;  1FQG A;  3M6B A;  4JGO A;  2V8C A;  2Y2J A;  3G30 A;  1AXB A;  5CEC A;  3I7J A;  2Y2M A;  3HJK A;  4OQG A;  5CTM A;  3LR4 A;  4NK3 A;  5FAT A;  3HVF A;  3LY4 A;  3MZD A;  2VKS A;  1L0D A;  4FH2 A;  2M7V A;  2P04 A;  3U2A A;  3IXG A;  2Z2L B;  4IVI A;  1P97 A;  3LCE A;  3HUM A;  3DWK A;  1XGJ A;  2YKH A;  4FCF A;  3O86 A;  4E3K A;  2MJ6 A;  1PNE A;  1MZU A;  1YLZ A;  5I94 A;  1GSX A;  3UDI A;  5IU1 A;  1ZG4 A;  2EX9 A;  1F2K A;  1RCJ A;  4HP4 A;  2WZX A;  1MBL A;  4DRT A;  1KDS A;  2EA9 A;  3F1N A;  3Q7V A;  3G31 A;  5JYO A;  4NKP A;  3C7V A;  4JPM A;  1OME A;  5KMW A;  4N1H A;  3ZQ5 A;  1K4E A;  2PRF A;  4Z1W A;  4DMZ A;  1BZA A;  1EW0 A;  1SKF A;  1RGY A;  4MCW A;  3OPP A;  1K54 A;  3PAG A;  3KO6 A;  1C3B A;  3VE4 A;  2OOL A;  4Q8I A;  4S2N A;  5FQJ A;  2D02 A;  2PYP A;  1S6R A;  3NOP C;  3UPN A;  3T12 B;  5AQ7 A;  2EXA A;  2V0U A;  3D4F A;  3BFC A;  4ZAM A;  1BLH A;  1OTA A;  3NDE A;  3BW6 A;  1NXY A;  4R0Q A;  4S2K A;  3MFD A;  5M19 A;  5CHU A;  1JNU A;  2WAE A;  2PAV P;  3IXD A;  3MFX A;  3IHB A;  5CER A;  2EFU A;  3N8R A;  3E4Q A;  1K57 C;  5AVF A;  4DE3 A;  2HP6 A;  5HX9 A;  1JTD A;  2V20 A;  3CUE A;  2Z2M B;  4QU3 A;  3T4Q A;  4HHD A;  1TS8 A;  5EE8 A;  3T50 A;  1YQS A;  1DJA A;  1K55 A;  5J4E A;  1TVF A;  3H7W A;  2E8I A;  2VK3 A;  1X0O A;  4S2O A;  3MJQ A;  1KDW A;  2WKP A;  3IF5 A;  1ESU A;  4PPR A;  3WRZ A;  5J7E A;  4OLG A;  4G3V A;  3KSG A;  2H5S A;  5CGS A;  3OCL A;  4L9F A;  3MSH A;  4U0X A;  5L10 A;  3HLF A;  3PYP A;  5F83 A;  4KQD A;  2PU2 A;  4LV2 A;  1HVB A;  3TJZ C;  4C3Q A;  4HBT A;  1LSV A;  2JHE A;  1KE4 A;  4FSF A;  1SZV A;  2WGW B;  5HDD A;  1PI5 A;  1D7E A;  2VV7 A;  3CIT A;  5U47 A;  2ZOI A;  4RX3 A;  2PBY A;  4PAU A;  1E3U A;  3RJU A;  4EES A;  3NC8 A;  3HLW A;  1U60 A;  1BLC A;  2VGL S;  4HIA A;  1FSY A;  1S4S A;  4UQI S;  1W79 A;  4JBF A;  5FEF A;  1L0E A;  1PFL A;  5KZH A;  4NXG A;  4U3T A;  1ES4 A;  2ZMF A;  3Q81 A;  2VLG A;  3JVU A;  2QYB A;  4CLC E;  2ZC3 B;  3MQ0 A;  5HWV A;  2ZM2 A;  4Q0H A;  3IS2 B;  2Q9N A;  1NRF A;  5TR7 A;  4LLO B;  3FZC A;  1ZTU A;  5HAQ A;  3F1P A;  1XA7 A;  3MQQ A;  2JKF A;  4ZRR A;  4LV3 A;  1I2S A;  3HL9 A;  2Y2Q A;  2XRO A;  2WGV A;  3D72 A;  1CJF A;  5J3W A;  2Y2I A;  1SDN A;  2J3T D;  2G7U A;  4G3W A;  3IF6 C;  4Y3I A;  3OLO A;  2I72 A;  3CZD A;  3SOI A;  3BFE A;  5M18 A;  3G34 A;  2H10 A;  4GS9 A;  5KSC A;  3F1N B;  2V9A A;  5G4Z A;  2WZZ A;  3W2Z A;  1BLP A;  3B3X A;  2WKH A;  2V1A A;  3EWK A;  5L07 A;  2R9X A;  2Y2L A;  5FI7 A;  2V2F F;  3VP1 A;  4WBG A;  3SS3 A;  2ZJ9 A;  5HAR A;  4MBH A;  4Q0J A;  3ZNY A;  3A0R A;  3C5A A;  3MXQ A;  3LIC A;  1H8Z A;  3CWF A;  3FKV A;  1MWS A;  3GQZ A;  3DTM A;  1JVJ A;  2Y59 A;  1STZ A;  2ZLY A;  2EWW A;  4IBR A;  5FEG A;  1O7E A;  3QP4 A;  1TDG A;  1MWT A;  2QJ7 A;  3JVV A;  1Z6F A;  1NRJ A;  4EW7 A;  2WUQ A;  3A3D A;  2V0W A;  2C6W B;  3LI8 A;  1HLU P;  2OWJ A;  5AQA A;  3LUQ A;  3P7N A;  3IXB A;  2ZBB A;  4E3L A;  3VSL A;  4K08 A;  2K7S A;  4HJ6 A;  3EEH A;  2WGW A;  4UEY A;  3SW1 A;  1PYY A;  4JLF A;  5HWW A;  3HUN A;  1ODV A;  2OV5 A;  4X68 A;  1IEL A;  2WGI A;  4N9L A;  1PWC A;  3CJM A;  2KLI A;  4NXE A;  2XDM A;  1FCN A;  2O99 A;  3CHW P;  4HBU A;  4LRZ E;  2WKR A;  1DJC A;  4ZBE A;  3LIB A;  5HD3 A;  3BLM A;  1S4R A;  1TEM A;  2A3U A;  4KG6 A;  3OZH A;  3FV7 A;  3OPL A;  3GVB A;  3ZCZ A;  4EER A;  4OPR A;  2PR6 A;  3VE3 A;  3TRC A;  2JBF A;  3IX4 A;  1A0K A;  4F94 A;  4NXF A;  4ZJ2 A;  4EU0 A;  4OPZ A;  4P6Z S;  4MN7 A;  5DTT A;  4DDS A;  4N92 A;  4RX2 A;  1YMX A;  2WKE A;  2P7J A;  4UQI M;  4YOF A;  1YLY A;  1RP5 A;  1SDE A;  1FOF A;  2XSS A;  2JC7 A;  3G2Y A;  2EX6 A;  3GR2 A;  3OOV A;  3G32 A;  2KOI A;  2XFS A;  4GKU A;  1PZP A;  4MNR A;  1N9B A;  4QPR A;  3D3O A;  4JXS A;  4EET B;  4S2I A;  3UB8 A;  5L09 A;  1NWZ A;  2QZ6 A;  5FL3 A;  4EQ1 A;  2Y2P A;  3DBA A;  3H7W B;  1OTB A;  1PIO A;  2CC1 A;  4AFI A;  1VQQ A;  3Q7Z A;  5AJG A;  1H8M A;  4LEN A;  1KE0 A;  3BFF A;  3IXH A;  1NY0 A;  3DTE A;  4XUZ A;  4PMA A;  1TS0 A;  2FH5 A;  2H28 A;  2XQZ A;  4ZJ1 A;  2R78 A;  4EQI A;  2XA7 S;  1WE4 A;  4GD6 A;  3W4P A;  4Z9Q A;  1K38 A;  3P01 A;  4E04 A;  4ARZ B;  4BLM A;  4LGW A;  3T4O A;  5TBM B;  3H82 B;  3HRE A;  5FQK A;  4JGR A;  2XR0 A;  1ZC2 A;  2VGJ A;  4JF4 A;  2HZ5 A;  4BBT A;  3LO7 A;  4NG2 A;  4HEF A;  2JKT I;  1T1A A;  1YT4 A;  1DP6 A;  3NEC A;  2OSU A;  2OAQ 1;  4BJP A;  3B47 A;  2Z6C A;  2NUP C;  3N8S A;  1D1J A;  1M6K A;  4JXG A;  3VOZ A;  3BQA A;  3Q07 A;  2A2L A;  4B88 A;  3V39 A;  3Q7V B;  3ZG5 A;  4N9K A;  2Y2G A;  1TF1 A;  1LT0 A;  1GA0 A;  4HH2 A;  4I38 A;  5M1A A;  1VET A;  2RL3 A;  1CK3 A;  1H3Q A;  5HL6 A;  3IBR A;  1YSQ A;  3IF6 B;  3TG9 A;  3RFB A;  3DW0 A;  4FD8 A;  5E43 A;  3C4P A;  1W8Q A;  3OCN A;  4DE1 A;  4HJ3 A;  3WS0 A;  4UA9 A;  2ZOH A;  3AGF A;  2PR5 A;  4GOG A;  4ME4 A;  3IWI A;  1N4O A;  4LCM A;  4L0L A;  3UB9 A;  5DF8 A;  1LL8 A;  2B95 A;  4FH4 A;  2PD7 A;  4I3A A;  4IHQ A;  3UY6 A;  4HH3 A;  1NLZ A;  2XGN A;  1OTI A;  5A91 A;  5CEB A;  3N4I A;  1PI4 A;  3ISG A;  3ZNT A;  3JYI A;  4DN0 A;  2HDQ A;  3EOI A;  4PM8 A;  4IUK A;  4PM6 A;  3ZDJ A;  2IA2 A;  1MWR A;  4GDB A;  3F1O B;  2Y55 A;  4FUW A;  3G6O A;  2BTF P;  2GX5 A;  4WYY A;  5FA7 A;  2GDN A;  4CLC B;  1KVL A;  3TE8 A;  3MR0 A;  2Y8H A;  4YWZ A;  5A93 A;  2XH9 A;  2EWV A;  3UE6 A;  5FAS A;  4LPZ A;  4KZ4 A;  4GNU A;  1XJ6 A;  4OLD A;  4R3J A;  1HZO A;  2EFX A;  3DWZ A;  3WS1 A;  4G3K A;  5FI2 A;  2W1T B;  3WWX A;  3UO9 A;  4WMC A;  3UPP A;  1L0G A;  5A90 A;  4K91 A;  1G5U A;  1GSV A;  3N7W A;  1XFN A;  3HLC A;  2KDK A;  2A24 B;  4N1X A;  3BEB A;  4K0X A;  2X01 A;  2Y2N A;  2ZQC A;  1FR1 A;  3R7W B;  2P74 A;  5DF9 A;  4QD4 A;  4Y15 A;  1BT5 A;  4OPQ A;  5DKL A;  2HF6 A;  2J3W A;  1DJB A;  3D9Y A;  4GN2 A;  3GSG A;  3BY9 A;  3EGD C;  5DJU A;  5FSR A;  4R6L A;  3CG5 A;  4WM9 A;  3AGD A;  1UWP X;  3LYX A;  4MMN A;  2VX8 A;  3BJN A;  1GSW A;  1FR6 A;  1S66 L;  1ERQ A;  1JWP A;  4GHI B;  1YLP A;  3UE1 A;  1SCW A;  2VA0 A;  4UHU A;  1YM1 A;  5AQB A;  3SH9 A;  2WYX A;  1CEF A;  4MBK A;  3MKF A;  4MN5 A;  4E3I A;  4YIN A;  1P0Z A;  5DF7 A;  4X56 A;  1W8Y A;  4DJ2 A;  5F82 A;  3OC2 A;  1NZU A;  4Y2F A;  5F1F A;  4PM7 A;  3QP2 A;  4UA7 A;  2QPN A;  5DVA A;  2V8F A;  4JGQ A;  2WKI A;  2ZC5 B;  4HY8 A;  3MKE A;  3HLE A;  3T1X A;  3O88 A;  3IWO A;  1WYB A;  3N8L A;  3K2N A;  4RA7 A;  5L2F A;  2XA7 M;  4S2J A;  1K0K A;  4QB8 A;  3RTY A;  3PR6 A;  1KVM A;  2P08 A;  4K0W A;  1Y28 A;  4HOI A;  3LIA A;  3ZHH A;  3UN7 A;  3QHY A;  1GA9 A;  4CJN A;  4O0P A;  5HWT A; 
#chains in the Genus database with same CATH homology
 1ES3 A;  3PBO A;  3C7U A;  2OV5 A;  5CHJ A;  1KE3 A;  1K55 C;  1HD8 A;  4X68 A;  1IEL A;  3ITB A;  1XP4 A;  2WGI A;  5EUA A;  3ZG8 B;  4S2M A;  3MBZ A;  3OPH A;  4N9L A;  3W4O A;  3OPR A;  1MXO A;  4OQI A;  1GCE A;  1PW1 A;  2B5R A;  3IH9 A;  1SHV A;  3BRM A;  3V50 A;  1PWC A;  3CJM A;  1MY8 A;  5EPH A;  4OKP A;  5GHX A;  5FQM A;  4PM9 A;  4WEK A;  2XDM A;  1CI9 A;  3NIA A;  5GLD A;  1FCN A;  5EOO A;  5GLA A;  3VFH A;  2ZM8 A;  3VP0 A;  4DF6 A;  4X53 A;  1RGZ A;  4OP8 A;  3ZG0 A;  4B4X A;  1VM1 A;  4HBU A;  4OH0 A;  1ZG6 A;  2BG1 A;  1DJC A;  4KZ9 A;  1XXM A;  2DRW A;  4ZBE A;  5HAI A;  5TGF A;  3ZG9 B;  3BLM A;  4KG5 A;  4RVA A;  4KQR A;  2ZQA A;  1TEM A;  2A3U A;  5GHY A;  4KG6 A;  4KZB A;  3OZH A;  1XA1 A;  3FV7 A;  3OPL A;  1FQG A;  3GVB A;  3M6B A;  3GV9 A;  1LL9 A;  2Y2J A;  3G30 A;  1AXB A;  2X02 A;  3UN7 A;  5CEC A;  3ZCZ A;  2EXB A;  3I7J A;  4OPR A;  4BD1 A;  1E25 A;  2Y2M A;  2H0T A;  4IBX A;  4OQG A;  5CTM A;  4NK3 A;  2JBF A;  1K4F A;  4F94 A;  2G2U A;  5FAT A;  2V1Z A;  1QME A;  4ZJ2 A;  3HVF A;  3LY4 A;  4OPZ A;  3MZD A;  2ZM0 A;  3A3I A;  1L0D A;  4FH2 A;  5DTT A;  4N92 A;  4RX2 A;  5GL9 A;  1YMX A;  3ZGA B;  2WKE A;  4DDS A;  3HLD A;  3IXG A;  2Z2L B;  1IYO A;  4IVI A;  5FAP A;  4DE0 A;  3ZFZ A;  4JXW A;  1YLY A;  1RP5 A;  3HUM A;  3LCE A;  1SDE A;  1FOF A;  3DWK A;  3A3F A;  2JC7 A;  5EVI D;  1XGJ A;  2JCH A;  3G2Y A;  1GHP A;  4QJG A;  2EX6 A;  3GR2 A;  5HFO A;  1KGE A;  1MWU A;  4FCF A;  2DCF A;  3O86 A;  3G32 A;  3WRT A;  4E3K A;  4ID4 A;  5E2G A;  2XFS A;  4GKU A;  1PZP A;  4MNR A;  1HTZ A;  1N9B A;  5CTN A;  3S4X A;  1YLZ A;  2FFF B;  4JXS A;  4C75 A;  4S2I A;  5I94 A;  3FKW A;  4R3B A;  2UWX A;  3UDI A;  4XUX A;  2QZ6 A;  5GHZ A;  1YMS A;  1ZG4 A;  2EX9 A;  2Y2P A;  4Y0T A;  1RCJ A;  5CGW A;  2WZX A;  1MBL A;  4DRT A;  1KDS A;  4OOL A;  5JYO A;  3Q7V A;  3G31 A;  1PIO A;  3C4O A;  2CC1 A;  1XGI A;  1VQQ A;  2HP5 A;  3Q7Z A;  3C7V A;  3ZG7 B;  1CEG A;  2C5W B;  1OME A;  2XLN A;  2ZD8 A;  4JPM A;  2RCX A;  4DDY A;  5KMW A;  1PW8 A;  4LEN A;  4N1H A;  5BOH A;  4DE2 A;  1KE0 A;  3BFF A;  2XD1 A;  1K4E A;  3IXH A;  4Y7P A;  3UDX A;  3S1Y A;  5HW3 A;  2H0Y A;  1IKI A;  1NYY A;  1E4D A;  1NY0 A;  2HPB A;  4PMA A;  1Q2Q A;  4XUZ A;  1BZA A;  3NDG A;  3VP3 A;  4ZJ1 A;  2XQZ A;  1J9M A;  1SKF A;  1RGY A;  4EQI A;  1S0W A;  3VP2 A;  4KZ8 A;  1WE4 A;  3OPP A;  4GD6 A;  5FAO A;  1K54 A;  3W4P A;  1K56 D;  4Z9Q A;  3PAG A;  4X6T A;  3NBL A;  1NJ4 A;  1PWD A;  3G4P A;  3NI9 A;  1K38 A;  3VSK A;  1C3B A;  4ZDX A;  4BLM A;  3NY4 A;  4XXR A;  2BLS A;  4S2N A;  3Q82 A;  5FQJ A;  4Q8I A;  4KZ6 A;  3A3J A;  3IQA A;  1BLS A;  3HRE A;  3RXX A;  1K6S A;  4KQO A;  5EVI B;  1S6R A;  2ZQ8 A;  5FQK A;  5CRF A;  2XR0 A;  1ZC2 A;  3UPN A;  5AQ7 A;  2VGJ A;  4A5R A;  4JF4 A;  2EXA A;  3D4F A;  3BFC A;  4ZAM A;  1BLH A;  1JTG A;  5CGX A;  4BQM A;  1XX2 A;  3LO7 A;  4HEF A;  4O7D A;  3EQV A;  3IT9 A;  1YT4 A;  4OQ0 A;  3W8K A;  3NDE A;  1NXY A;  4R0Q A;  4S2K A;  2OSU A;  3IF6 A;  3MFD A;  5M19 A;  5CHU A;  2WAE A;  3VMA A;  3IXD A;  3IHB A;  2HDU A;  4BJP A;  5CXW A;  5CER A;  4DKI A;  2EFU A;  3N8S A;  3GMW A;  4X55 A;  3N8R A;  1JWV A;  4CPK A;  4R1G A;  5DTK A;  1K57 C;  4DE3 A;  1M6K A;  4JXG A;  2HP6 A;  2P9V B;  4PM5 A;  5HX9 A;  3PBR A;  5HL1 A;  1MKI A;  3VOZ A;  1JTD A;  3NCK A;  2V20 A;  4OP5 A;  5IHV A;  4IVK A;  2Z2M B;  4QU3 A;  4E3O A;  3M6H A;  1L2S A;  2Y2K A;  4UAA A;  3Q07 A;  1FSW A;  5EE8 A;  1YQS A;  5EVI A;  3V39 A;  4B88 A;  4C6Y A;  1DJA A;  4BEN A;  4EBL A;  3WS2 A;  3HUO A;  3Q7V B;  1K55 A;  3ZG5 A;  2ZC4 B;  4GZB A;  1W5D A;  4N9K A;  1ERM A;  4E3M A;  2Y2G A;  1ES2 A;  1TVF A;  2E8I A;  4OON A;  1GA0 A;  1Y54 A;  4S2O A;  5A92 A;  3IH8 A;  3MZE A;  5M1A A;  1KDW A;  4QHC A;  2OLV A;  1GHM A;  3IF5 A;  1FCO A;  1CK3 A;  2RL3 A;  1ESU A;  3FWL A;  4IED A;  4PPR A;  1IKG A;  3WRZ A;  4WMC D;  3IF6 B;  3TG9 A;  2Y2H A;  4OLG A;  2J9P A;  5FI6 A;  1M40 A;  4KEN B;  3DW0 A;  2H5S A;  5CGS A;  4FD8 A;  5E43 A;  4JF6 A;  1Q2P A;  1YLJ A;  3OCL A;  3C4P A;  1W8Q A;  4JF5 A;  1FCM A;  5JYP A;  4U0X A;  3BFD A;  4NET A;  2VGK A;  5TFQ A;  1K54 C;  3UPO A;  4OPY A;  3OCN A;  3SS4 A;  3HLF A;  4WZ4 A;  5F1G A;  4LV1 A;  3TSG A;  4DE1 A;  3WS0 A;  2J9O A;  4UA9 A;  3VFF A;  3AGF A;  5F83 A;  2PU2 A;  4GOG A;  4LV2 A;  3IWI A;  1N4O A;  1HVB A;  1W7F A;  4P85 A;  5GLC A;  4C3Q A;  4HBT A;  5CED A;  1KE4 A;  4FSF A;  4LCM A;  4DXB A;  4L0L A;  2Y4A A;  3VOY A;  2WGW B;  2HDS A;  4LCL A;  1PI5 A;  3FYZ A;  5DF8 A;  1JWZ A;  2HP9 A;  4M3K A;  3LY3 A;  4FH4 A;  5U47 A;  1LI0 A;  2XD5 A;  4BL3 A;  4RX3 A;  2PBY A;  4E6X A;  4JXV A;  2FFY A;  4KG2 A;  3UY6 A;  2EX8 A;  1E3U A;  2XGN A;  2Q9M A;  2XK1 A;  4S2P A;  5A91 A;  3RJU A;  3ZVT A;  1IYP A;  5DTS A;  3PTE A;  3HLG A;  3MXR A;  5CEB A;  2ZQ9 A;  3N4I A;  3NC8 A;  3O3V A;  3UDF A;  1PI4 A;  3HLW A;  3ISG A;  3E2K A;  3ITA A;  4GDN A;  1ALQ A;  1U60 A;  3ZNT A;  3JYI A;  1BLC A;  3S22 A;  1I5Q A;  1FSY A;  3UE3 A;  3M2J A;  2HDQ A;  2OLU A;  4PM8 A;  3V3R A;  4PM6 A;  3ZDJ A;  3BYD A;  1W79 A;  1BUL A;  4JBF A;  4LV0 A;  5EVI C;  1MWR A;  1ZKJ A;  4GDB A;  4MLL A;  2Y55 A;  1L0E A;  1K57 A;  1ERO A;  1BSG A;  4KZ7 A;  5KZH A;  5E2H A;  4WYY A;  5FA7 A;  2GDN A;  3WS4 A;  3AGE A;  1KVL A;  2J7V A;  4U3T A;  1MPL A;  1ES4 A;  2WAD A;  2WAF A;  4R4S A;  4OOM A;  3Q81 A;  3BEC A;  5E2F A;  3Q1F A;  2DNS A;  4E6W A;  5A93 A;  4KZ3 A;  2XH9 A;  5FAS A;  2ZC3 B;  1G68 A;  4KZ4 A;  2ZM2 A;  3PBS A;  1YLT A;  5KSH A;  1G6A A;  3MXS A;  4X69 A;  4GNU A;  3IWQ A;  2Q9N A;  4OLD A;  4R3J A;  5GLB A;  2EX2 A;  1HZO A;  1NRF A;  1TDL A;  2HDR A;  3PBT A;  5TR7 A;  3A3E A;  3FZC A;  3BLS A;  4JKT A;  3ZVW A;  2EFX A;  5HAQ A;  2PU4 A;  4P6B A;  1XA7 A;  3DWZ A;  1ONG A;  3WS1 A;  5FI2 A;  1IYQ A;  4UA6 A;  3WWX A;  4OVD A;  3V5M A;  1NYM A;  3UO9 A;  4QY6 A;  4WMC A;  3UPP A;  3WS5 A;  1L0G A;  4LV3 A;  5A90 A;  1I2S A;  4K91 A;  3HL9 A;  2Y2Q A;  3PBQ A;  2A49 A;  1WYC A;  3HBR A;  3N7W A;  4Y0U A;  4MBF A;  2WGV A;  1QMF A;  4OOY A;  3VP4 A;  1I2W A;  3HLB A;  3HLC A;  4OQH A;  4E3N A;  2ZMA A;  3IHA A;  3M2K A;  4N1X A;  1EI5 A;  3BEB A;  3TOI A;  4WZ5 C;  4K0X A;  2X01 A;  2Y2I A;  3BM6 A;  1SDN A;  2Y2N A;  1ESI A;  1K6R A;  4EBP A;  2ZQ7 A;  2ZQC A;  1FR1 A;  2P74 A;  5DF9 A;  4QD4 A;  1BT5 A;  4OPQ A;  4U0T A;  3IF6 C;  3RXW A;  4MEZ A;  2QMI A;  1XPB A;  1CI8 A;  1DJB A;  5FQI A;  4P87 A;  3UNW A;  2I72 A;  3GSG A;  3CMZ A;  1E3U D;  3E2L A;  4GN2 A;  5J8X A;  4R4R A;  3CZD A;  3SOI A;  3BFE A;  1LI9 A;  5FSR A;  5FQ9 A;  5M18 A;  3CG5 A;  3G34 A;  4WM9 A;  2H10 A;  3AGD A;  1IYS A;  3V3S A;  5KSC A;  3P98 A;  4KQQ A;  4H8R A;  4EV4 A;  1H8Y A;  1LLB A;  4EWF A;  3GTC A;  4S2L A;  4S2N C;  1FR6 A;  2WZZ A;  1ERQ A;  3LEZ A;  1BLP A;  5EVL A;  3B3X A;  5FDH A;  2ZC6 B;  2G2W A;  3SH8 A;  5HAP A;  1JWP A;  2WKH A;  1YLP A;  3UE1 A;  4B4Z A;  1YLW A;  1ES5 A;  1SCW A;  2JE5 A;  1GHI A;  3MZF A;  4UHU A;  2R9X A;  3UE0 A;  2Y2L A;  4E3J A;  1YM1 A;  3GRJ A;  5AQB A;  5FQQ A;  3SH9 A;  4GB7 A;  5FI7 A;  2WYX A;  1CEF A;  2V2F F;  3QNB A;  3VP1 A;  4WBG A;  4RYE A;  1PZO A;  3SS3 A;  4MBK A;  3MKF A;  1O07 A;  2ZJ9 A;  5G18 A;  2Y91 A;  1K56 A;  5EOE A;  4E3I A;  4YIN A;  5HAR A;  4MBH A;  5DF7 A;  4EUZ A;  3ZNY A;  3P09 A;  4X56 A;  4ZTK A;  3C5A A;  3SH7 A;  2ZC7 A;  1W8Y A;  3SS5 A;  3G35 A;  1BUE A;  4KZA A;  3O87 A;  1H8Z A;  1DY6 A;  4WEL A;  3FKV A;  5F82 A;  3OC2 A;  3W4Q A;  1MWS A;  1KGF A;  1L0F A;  1NZU A;  2X71 A;  5F1F A;  2R9W A;  3DTM A;  1JVJ A;  2Y59 A;  3GQZ A;  3N6I A;  4PM7 A;  5EEC A;  4HES A;  4ZJ3 A;  2ZLY A;  4UA7 A;  1IEM A;  2QPN A;  5DVA A;  3EQU A;  2XFT A;  1LHY A;  4IBR A;  1O7E A;  2IWB A;  1TDG A;  1MWT A;  2XF3 A;  2WKI A;  1ONH A;  2ZC5 B;  4WZ5 A;  3MKE A;  2J8Y A;  1XKZ A;  4EBN A;  3HLE A;  4BL2 A;  5AQ9 A;  1Z6F A;  3O88 A;  3IWO A;  1WYB A;  4WEJ A;  4KZ5 A;  4P0M A;  3N8L A;  4RA7 A;  1PWG A;  5L2F A;  2WUQ A;  3A3D A;  5FAQ A;  2WK0 A;  3PBN A;  5E2E A;  2C6W B;  4S2J A;  2P9V A;  2Y2O A;  2IWC A;  5AQA A;  3G2Z A;  4QB8 A;  3IXB A;  4E3L A;  1K25 A;  1BTL A;  4BD0 A;  4Y0O A;  3VSL A;  1H5X A;  1KVM A;  5CHM A;  1EWZ A;  1KGG A;  3BFG A;  4QY5 A;  4K0W A;  4DXC A;  5D3O A;  2WGW A;  2IWD A;  1PYY A;  4R23 A;  1LL5 A;  4D2O A;  1NZO A;  4JLF A;  3PAE A;  4YFM A;  4GD8 A;  3ZHH A;  3HUN A;  3QNC A;  3QHY A;  2ZQD A;  1GA9 A;  4CJN A;  2XEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...