1VB6A

Crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
publication title Structure of oxygen-bound form of a Heme PAS domain of Ec DOS
rcsb
source organism Escherichia coli
total genus 32
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1vb6A00
4EERA 2D01A 3A0VA 4L9GA 1T1AA 3E4QA 4BBTA 2PR5A 1GSVA 4I39A 1T1BA 3UMDA 4EESA 2V1AA 3UMEA 1UWPX 5HZHA 1T1CA 4HNBA 5DKLA 5HDCA 5HWVA 2V9AA 3F1OA 3HJKA 1Y28A 4EW7A 3F1PA 3BY9A 1S66L 2JHEA 1DRMA 3NHQA 2WKRA 4HH3A 5G4ZA 1OTDA 1XFQA 2QHKA 3CWFA 1LL8A 2KDKA 4E04A 1XJ3A 1OT6A 4HJ6A 4HP4A 4HJ4A 1F98A 5DKKA 3BWLA 1DP9A 4LRZE 1GSXA 2L0WA 2QJ5A 2I9VA 5KIZA 1JNUA 2CMNA 3OLOA 2PD7A 2WKQA 4GHIB 4RQ9A 5HSQA 4NXEA 4MN6A 4NXGA 3VE4A 2VV7A 1MZUA 4NXBA 1OT9A 4LRYC 4GS9A 5J4EA 4R3AA 4H6JB 3E4OA 3FG8A 5AVEA 5IU1A 4JGRA 4KQDA 4MN5A 1S1YA 2PHYA 3BY8A 3IBRA 3UB6A 4GW9A 4KUOA 4HY8A 1OJ5A 3F1NA 3D72A 3A0RA 4LLOB 2M1CA 3KX0X 3MR0A 4I5SA 3H9WA 2P7JA 3ULFA 2EA9A 3UB9A 4DJ2A 4R38A 3EWKA 1TS7A 1V9ZA 1VB6A 3CAXA 4XT2B 3MFXA 4EQ1A 4F3LB 4JGQA 2V1BA 1D06A 1LSVA 1EW0A 3K3CA 1N9NA 4LPZA 4EEUA 1N9LA 3LICA 2R78A 2OOLA 1LSWA 3LIDA 3PYPA 5F6AA 3PHYA 3LIAA 3G6OA 1WA9A 3C8CA 2PD8A 3HJIA 2V0UA 2D02A 2VLGA 1V9YA 4M4XA 4EETB 2YKFA 3VE3A 2L1MA 4GHIA 3T50A 5J7EA 1P0ZA 4L9EA 3LIEA 5F5YA 5EFWA 4H6JA 5F69A 1T18A 4JGOA 2A24B 3LI8A 2Z6DA 3MJQA 1OTAA 4YWZA 5TBMB 3LI9A 5HDSA 2VV6A 3NOUC 4BBUA 5G4YA 4PKYG 2VV8A 2PYRA 4B9OA 4I3JA 3ICYA 3RTYA 1T19A 4HI4A 4I3IA 4XT2A 5HWWA 4PKYA 4F3LA 2W27A 2Z6CA 1UWNX 3LIFA 2JN7A 4GCZA 3LUQA 3NOTC 3MQOA 4R6LA 1D7EA 3H82B 3B33A 2L4RA 1TS0A 3FC7A 1DP6A 2W0NA 3IS2B 2OWJA 2V0WA 3UE6A 1UGUA 5HDDA 2GJ3A 1TS6A 2BASA 4JGPA 4I3AA 4KUKA 1BYWA 4I38A 5HWTA 3EEHA 2PDRA 3H7WB 4HP9A 4EXOA 1ODVA 4HQAA 1NWZA 1XFNA 2OWHA 3MXQA 4WL9A 2ZOHA 1X0OA 5IS1A 2A24A 3CLOA 2H28A 2ZOIA 5F68A 5TBMA 3VOLA 1P97A 4L9FA 2QWSA 4HH2A 2QJ7A 5J3WA 1OJGA 4K08A 2VEAA 5HD5A 3SW1A 3F1OB 1LT0A 1DP8A 5AVFA 4NXFA 3P7NA 2WKPA 3F1PB 5HD3A 1XJ4A 4HOIA 5A8BA 3UB7A 4DJ3A 4HHDA 3C2WA 1LSXA 3A0SA 5I5LA 4WLAA 2YKHA 3E4PA 3GDIA 3NOPC 4HIAA 1OTEA 1XJ2A 5DJUA 1S67L 1XJ6A 3GECA 4WUJA 1GSWA 4WN5A 1S4SA 1S4RA 2INWA 5DJTA 3K3DA 3MQQA 1TS8A 3H82A 1G28A 2PR6A 2KX6A 1OTIA 3LYXA 4GS9B 3RH8B 2J80A 2QKPA 2PYPA 3ZQ5A 4HJ3A 3IS2A 1N9OA 2B02A 4EEPA 2ZBBA 4WF0A 4LRXC 3NJAA 4R70A 3LIBA 3UB8A 4BBVA 1KOUA 3F1NB 1OTBA 2HV1A 1F9IA 1S1ZA 3H7WA 2K7SA
chains in the Genus database with same CATH superfamily
1T1AA 2R9XA 3N8LA 3T1XA 3ZG7B 4GB7A 3BECA 2V1AA 1SKOA 3E0YA 1UWPX 3UMEA 1LI0A 3KSHA 1Q2QA 2FH5A 1T1CA 2H0TA 3LGOA 5CXWA 3HLEA 5DKLA 2P04A 1PWDA 2I72A 2V9AA 3BFCA 3W4OA 3Q07A 1FIKA 3F1OA 4QD4A 3HJKA 4LCLA 3T1QB 4EW7A 3F1PA 3RJUA 2J7VA 2XGNA 3BY9A 5L2FA 3IH9A 4H8RA 1S66L 4Q0JA 2W1TB 1DRMA 3NHQA 3T4KA 2WKRA 1OTDA 1VEUA 2BTFP 2IA2A 1YSPA 4OVDA 4HJ6A 4HJ4A 4OOMA 5GL9A 3L7HA 2XR0A 5FDHA 3G35A 3C30A 3W4QA 3OLOA 2Y4AA 2PD7A 4QY6A 3FPWA 4KG2A 1I2WA 3CPTB 5HSQA 4JXSA 4RX2A 4Q0IA 2XLNA 4NXBA 3HUMA 4IUKA 5CTMA 5IU1A 1S1YA 4OQ0A 2RCXA 3V39A 1ERQA 2JE5A 1EI5A 2Y2KA 4X53A 4GW9A 4KUOA 5HFOA 1PW8A 5F82A 3OCLA 1K6RA 5CX7A 4GLQA 4DXCA 3F1NA 3D72A 5CEBA 3QP6A 1K57A 4KG5A 2XD1A 4I5SA 3HLDA 3SS3A 2Y79A 1P9WA 4A5RA 1PW1A 1MWTA 3IT9A 1YLTA 1ZC2A 4S2MA 3UB9A 2G7UA 1W8YA 3EWKA 3VFHA 1ES2A 3WRTA 1YQSA 4CLCB 3AGEA 1TS7A 3G2ZA 1VB6A 3CAXA 4Y5FA 2ZLYA 2ZL1B 4ZJ3A 4U0TA 1SKFA 4EWFA 1KDWA 1KE3A 2KLIA 1D06A 3V50A 3ZNTA 2PBYA 1KE4A 2WGIA 1N9NA 2GZAA 3FKVA 5CECA 3U4LP 3LIDA 3HCYA 1EROA 3OZHA 3DW0A 2R9WA 4B88A 3G6OA 3G34A 3KYEA 1NZOA 2D02A 3PBSA 3UPOA 3DWZA 1KE0A 3PAEA 1HVBA 4EETB 3IWIA 1BLSA 1H8MA 1S0WA 4GHIA 4JF4A 3T50A 4X56A 3TOIA 5E43A 3ZG0A 2HP9A 1FILA 4WBGA 4UEYA 3D9YA 4H6JA 5FA7A 1K25A 3VV4A 4OKPA 3UDIA 4JGOA 2Z6DA 2OV5A 3IX3A 4KZ3A 4YWZA 1H8YA 4C3QA 3SOIA 4O7DA 4R4SA 2XFSA 1YM1A 4P6ZM 3IXHA 3A3IA 4IHQA 1IOUA 1ACFA 4E3IA 5FASA 4N9KA 3N8SA 4UQIS 4K91A 3LEZA 1WYCA 2Y2QA 5HL1A 4PKYG 2O9BA 1NRFA 4G3WA 3BFGA 2EXAA 1PRQA 1TF1A 3RTYA 5GHZA 3LFVA 5FEGA 2J9OA 4MBHA 2J9PA 1KVMA 2A2LA 3T4SA 2Z6CA 3OBFA 3VSLA 4N9LA 4WMCA 3RXXA 3BFFA 1MBLA 5CTNA 3WS5A 3BM6A 4IVIA 5EOEA 3H82B 5HARA 3B33A 3UDXA 1XP4A 1L3LA 3O5YA 1JWPA 2PRFA 3V3RA 1VETA 3CHWP 2V0WA 3BRMA 3HLCA 3SS5A 4II7A 2HJEA 3C38A 1CQAA 3HL9A 3SH9A 1YLPA 4HP9A 1ODVA 2W1RA 3WS4A 1XFNA 3NI9A 2OWHA 2HDRA 1K6SA 1E3UD 2EFXA 1K38A 4E3MA 4P6ZS 5EVIB 5TBMA 4B4ZA 4L9FA 2QWSA 3MKEA 1TDGA 2QJ7A 4WEJA 5C5KA 4Y2FA 3FKWA 2Q0OA 3SW1A 1C3BA 4DDYA 1LT0A 1DP8A 5AVFA 4NXFA 4FSFA 3P7NA 5HD3A 4HOIA 2NUPC 4QY5A 2C5WB 3OPLA 4DJ3A 3N8RA 5EUAA 3T1RA 3ZVTA 4EUZA 1LSXA 5KSHA 3HUNA 5I5LA 2JKRI 2O0YA 4WLAA 3N7WA 5EOOA 4HIAA 1OTEA 5DJUA 1XJ6A 1PWGA 4BL2A 1PI4A 3NY4A 3W8KA 4BLMA 5DJTA 1TS8A 1L0DA 1QMEA 2PR6A 4E3OA 2Y2JA 1OTIA 2HDUA 4BD1A 2VGLM 4GJ4A 4Y0TA 4HEFA 2PYPA 4CLCD 3ZQ5A 4WELA 2E8IA 5DF7A 4LV0A 3R7WA 4GZBA 3WWXA 5A91A 4EEPA 1MKIA 2ZBBA 1GCEA 1NLZA 3M6HA 3NJAA 4R70A 1K57C 4N92A 3Q7ZA 2WYXA 5AJGA 3V5MA 1H3QA 3I7JA 1IYSA 4GOGA 4OH0A 2P08A 4I39A 3C7UA 1T1BA 4IBXA 1IYOA 1YMXA 5GHXA 3V3SA 2FFFB 3KSFA 5F1FA 3BFEA 4HNBA 1KDSA 5HWVA 4Y0UA 1DY6A 4UA7A 1Y28A 3OPPA 3A3EA 4NKPA 3KSIA 3TE8A 1PZOA 3Q7VB 4E04A 1XJ3A 5CHMA 2WZXA 4GN2A 2LB5A 1MWUA 2WK0A 4E3LA 5DKKA 4LRZE 1GSXA 2L0WA 2QJ5A 1LL5A 4JBFA 4X69A 5KIZA 2WGWA 2VZWA 3C4PA 2ZC4B 4GD8A 1K55C 3HLBA 1YMSA 4MN6A 3ZG8B 2VV7A 3UDFA 4QPRA 4LRYC 1TVFA 1F5MA 3HLWA 4K0WA 3BW6A 3A3JA 3T12B 4BD0A 4DRTA 1HLUP 5M18A 4HY8A 2GX5A 2JKRM 3QP5A 3OPHA 4Q8IA 1K4EA 1IKGA 3G30A 3QNBA 5HAIA 4JPMA 4LLOB 3HLFA 2ZMVA 5DF8A 5FQIA 2X71A 3FWLA 4ID4A 1PZPA 3T4QA 2A49A 1VM1A 4X25A 3EQUA 4Q0HA 4DJ2A 2J3TD 4P87A 4Y7PA 4DDSA 4E6WA 1NYYA 2X02A 4MBKA 1V9ZA 2Y59A 2H10A 4XT2B 2RL3A 2EX9A 3AGFA 5CERA 4F3LB 4WEKA 5HAPA 2PT7A 3TSGA 2ZM2A 1ERMA 4LPZA 3IF6A 3R7WB 1D1JA 1RGZA 4R4RA 3LR3A 3S7OA 4KZ9A 2ZD8A 2OOLA 2WKHA 1LSWA 1HD8A 3PYPA 2XEPA 3DTIA 1SCWA 4LENA 5F6AA 3PHYA 5EVID 2HPBA 2Y2OA 2NUTC 4PM7A 3LEQA 5FAOA 1PNEA 2QPNA 3C4OA 1V9YA 4M4XA 1NRJA 5CRFA 3T4OA 2YKFA 3VE3A 3S22A 2ZC3B 1P0ZA 2XK1A 1IFQA 1ZHHB 3IXDA 1IYPA 3LIEA 1FCNA 5EFWA 1FCOA 1A0KA 1AXBA 4CQHA 5U47A 2A24B 4EU0A 1L2SA 3LI9A 3M2JA 4PM6A 4X55A 3D3OA 5HDSA 3SZTA 3DTEA 3NDGA 2J8YA 2VV6A 4ARZA 1EWZA 3LO7A 4NK3A 4U0XA 2Y2PA 4G3KA 4PM9A 3JPUA 2M7VA 3WS1A 1VQQA 5FQJA 3BYDA 2VV8A 4L0LA 2WAFA 4PMAA 4B9OA 4I3JA 2WGWB 3RXWA 2EXBA 4FH4A 2XA7S 2MJ6A 3NBLA 2HDSA 2W3EA 5FL3A 4UQIM 1YPRA 4I3IA 4HBTA 2C6WB 1KGFA 4DE2A 3IXBA 3BQAA 4PAUA 3UN7A 5EM1A 2FZ0A 4GCZA 3OC2A 3LUQA 3PR6A 3CJMA 5AQAA 1RGYA 2B95A 3ITBA 3N6IA 1OMEA 4OPQA 1PI5A 5HX9A 3QP2A 3W4PA 3C5AA 2JKTM 2W0NA 3TRCA 2HP6A 1TS6A 5FQKA 5FATA 2VA0A 2BASA 1JVJA 4I38A 5FAPA 4EBPA 2CC1A 5EPHA 2ZMFA 4QWOA 3VOZA 2BG1A 2PU2A 4UHUA 4EXOA 2Y55A 1CEFA 1MKMA 4X1LA 1K0KA 1MY8A 3IHAA 3QP4A 1SKOB 2KOIA 4Y13A 1K55A 1PFLA 2P74A 4S2OA 1G6OA 1FOFA 3TG9A 2O9CA 3UY6A 3PTEA 4K08A 1CJFA 5EE8A 3ZDJA 2XH9A 4B93A 3F1OB 5BOHA 2HJ9C 3GRJA 3IHBA 4NG2A 2ZM8A 4LV2A 3F1PB 4DE3A 1XJ4A 2M7UA 5L10A 1VEUB 3MKFA 1Y4OA 3B3XA 3N4IA 4OONA 3TJZC 3GDIA 1FQGA 2GNXA 1XJ2A 3ZFZA 3GECA 3GTCA 4UA9A 1RCJA 4WN5A 5A93A 1XPBA 1S4RA 4MLLA 1G28A 1BUEA 4U3TA 2KX6A 3NCKA 2J80A 3GMWA 1BTLA 3CITA 3VFFA 4R3JA 3IS2A 2B02A 3O87A 2K31A 3LY3A 3QHYA 5MC7A 3BJNA 4NETA 1ES4A 4WF0A 1P9RA 1O07A 3FPVA 2XROA 3TW8A 4DMZA 1KOUA 5M19A 3F1NB 1H0MA 2OSUA 4JKTA 1K54C 4MMNA 1S1ZA 2EFUA 1W63M 3H7WA 3HLGA 1Y54A 2PAVP 2D01A 3A0VA 3VP4A 5AQ7A 1FSYA 1GSVA 4ZAMA 2PU4A 4NEED 3CI6A 4OPYA 2ACGA 5HPFA 5EV0A 5DF9A 2Y2HA 4FUWA 2V8FA 4WYYA 2DMWA 4MNRA 2E8JA 5DFXA 3GVBA 5TGFA 1XGJA 2Z2LB 3PAGA 4XUZA 3IF6C 2B18A 3VOYA 4OQHA 4HH3A 5G4ZA 1ZG4A 5AQBA 2QHKA 3CWFA 3PXPA 2KDKA 4HBUA 2UV0E 5HAQA 3PBOA 1ZTUA 4JLFA 1OT6A 3S1YA 1F98A 1F2KA 3BWLA 1DP9A 2I9VA 4JXVA 4OOLA 3S7QA 2H5SA 2CMNA 2FFYA 3RFBA 2WKQA 4GHIB 4RQ9A 3M6BA 4NXEA 2W3HA 4NXGA 3VE4A 5D3OA 1MZUA 1QMFA 1K56D 4GS9A 5J4EA 4R3AA 1PYYA 4H6JB 1ZG6A 3FG8A 5AVEA 4JGRA 4MN5A 4BENA 1E4DA 2PHYA 4G3VA 2P9VA 3ZGAB 4AFIA 2QZ6A 2ZC6B 1NLYA 2XQZA 2JC7A 5CHUA 3UB6A 2ZQ8A 4E3NA 4R0QA 4S2NA 2EWVA 1NZUA 3T4LA 2HDQA 3UO9A 2M1CA 4OLDA 3KX0X 3BLMA 1N4OA 1ONHA 2Y2IA 2HF6A 4IEDA 1G6AA 2DNSA 5FQ9A 1NYMA 4BQMA 2P7JA 2EA9A 4R38A 3MQ0A 1M6KA 4Z9QA 4F94A 1E25A 2WADA 2Y91A 1WE4A 2O9AA 2JCHA 4EQ1A 4JGQA 4R3BA 2V20A 2Q9MA 1LSVA 2IWBA 5IHVA 3K3CA 4P85A 2JBFA 1XGIA 1Z09A 4KG6A 3CZDA 3IWQA 4PM5A 4RYEA 1OPXA 3EQVA 3P01A 5KMWA 3BQ8A 3FV7A 4YFMA 2ZMAA 1VETB 1E3UA 3UB5P 2PD8A 3HJIA 4IVKA 2V0UA 4MBFA 3DAVA 2VLGA 2ZQCA 1BSGA 4YINA 3VP1A 1ESUA 3G2YA 1W63Q 3CPTA 5J7EA 3DBAA 4L9EA 2IWDA 5F5YA 1SDNA 5L07A 3E2LA 2AVXA 2Q9NA 4KZ5A 1LI9A 5F69A 2ZQAA 1SDEA 1N9BA 1T18A 4ZTKA 3O3VA 2VJWA 3S7PA 5TBMB 3C7VA 4KZ4A 4RA7A 3IQAA 1KGEA 1XX2A 4GDNA 4BBUA 1BLCA 5EVLA 4ME4A 2WUQA 4KZBA 2G2UA 1RP5A 2PYRA 1DJCA 5TJJA 2WKIA 2OAP1 4BL3A 1L0GA 1J3WA 1K54A 3IH8A 4S2IA 4CLCA 4KQRA 4LCMA 3QNCA 3G32A 4HI4A 3B42A 1LHYA 3MSHA 4EQIA 4KENB 3ZYTA 2ZL1A 4LV3A 2JKTI 1HZOA 3IBJA 5JYOA 2Z2MB 3MZEA 4GKUA 2XF3A 3LIFA 5E2EA 3ZG5A 2EX6A 2XDMA 3CG5A 2JKFA 4D60A 3B47A 3GV9A 1LLBA 4O0PA 3MS6A 1Q2PA 1H5XA 2XA7M 3MQOA 2O99A 3EOIA 4R6LA 1D7EA 1ES5A 3D4FA 2Y2MA 2L4RA 3WRZA 3UE3A 3FC7A 3FZCA 3HVFA 4YNRA 1ESIA 2V1ZA 2OWJA 3UE6A 1UGUA 5FSRA 3G4PA 5HDDA 2GJ3A 4S2LA 2HP5A 1VHMA 4E3JA 3JVUA 4C75A 1G68A 3L9KA 1CI9A 4LV1A 2OAQ1 1W5DA 4ZJ2A 3GQZA 3T1SA 3Q1FA 4JXWA 3Q82A 1ALQA 3MXSA 5CGWA 4HQAA 5CGXA 1NWZA 2DRWA 1WYBA 4WL9A 2ZOHA 1X0OA 1BT5A 3SS4A 5IS1A 2LB9A 4N1HA 3CLOA 4EBLA 2ZOIA 3HREA 1J9MA 5KSCA 5F68A 1MWRA 5GHYA 3VOLA 1NY0A 3UNWA 2EWWA 1W79A 5CGSA 4Z1WA 4HH2A 3T4TA 3WS0A 4DF6A 4YOFA 5DVAA 4MEZA 4JXGA 2WKPA 4Y3IA 5A8BA 4ZRRA 5FI2A 5DFYA 1XA7A 3UE0A 4Y0OA 5FAQA 4HHDA 4DKIA 3C2WA 3UPNA 4IJGA 1GHMA 2VK3A 4O8GA 1G5UA 3R4KA 5FI6A 2YKHA 3MFDA 3NOPC 4O01A 2OLVA 3DTMA 3QP8A 1S67L 3CUEA 3WS2A 5L8MA 3PBNA 4EBNA 4X68A 1LL9A 3MZFA 1S4SA 1YSQA 1XA1A 3K3DA 3MQQA 4OLGA 3DTKA 3H82A 1DJAA 3LR5A 1CK3A 2Y2NA 1BLPA 1YLYA 3RH8B 2V8CA 1KGGA 5G18A 4DE1A 5IT5A 1IEMA 1N9OA 3S4XA 1MXOA 3GR2A 3KSGA 5GLBA 3IWOA 3NC8A 4S2NC 4LRXC 1JWVA 3IX4A 3UB8A 4BBVA 1XXMA 1BULA 3EEAA 4WMCD 2VKSA 3MZDA 4QHCA 1DJBA 2K7SA 4EERA 5HW3A 4L9GA 1NJ4A 3MBZA 3HUOA 2GDNA 3E4QA 4BBTA 2PR5A 4C6YA 1YAXA 4PPRA 1KVLA 3GSGA 3UMDA 4KZAA 4EESA 4FH2A 5CEDA 1YLZA 5EVIA 1CF0A 2UWXA 1AWIA 4RX3A 5HZHA 5TR7A 1IYQA 3CMZA 4K0XA 3OCNA 2J3WA 5EVEA 5HDCA 3A3DA 1FR6A 3VP2A 2BLSA 4E3KA 3ISGA 2WAEA 3A3FA 1MWSA 1MPLA 3IF6B 5A90A 5TFQA 2ZJ9A 1XFQA 3EGXC 4WZ4A 4ETXA 1LL8A 2V2FF 2WGVA 4HP4A 4QU3A 1JNUA 5AQ9A 3OOVA 4KQOA 4QJGA 2H0YA 5EM0A 5FQQA 3ZG9B 3VSKA 2Y2LA 3V67A 4BJPA 4OP5A 1OT9A 2A3UA 3IXGA 4QB8A 3E4OA 4JF6A 5DTSA 3UE1A 4ZBEA 4KQDA 1SHVA 1YKDA 3BY8A 3VP3A 2ZC7A 4DXBA 1FR1A 3PBQA 3IBRA 3SH8A 4IUHA 2ZQDA 3ZHHA 4KZ8A 4ZJ1A 1OJ5A 2Y2GA 4ARZB 3A0RA 3S7NA 4MCWA 3MR0A 2WZZA 5L09A 3H9WA 1FCMA 3ULFA 4ZDXA 3NDEA 2QYBA 1YT4A 5DTTA 1ONGA 4FOFA 1NXYA 3LY4A 4CLCC 3W2ZA 3ITAA 3PBTA 3OPRA 5K5BA 1TEMA 4GNUA 3MFXA 1PIOA 3M2KA 1Z6FA 2EX2A 1S6RA 3T4JA 1PWCA 2V1BA 5EECA 1O7EA 5F83A 1EW0A 1GHIA 4EEUA 3MF0A 1JTDA 4S2JA 1N9LA 1IKIA 3LICA 2R78A 5LBRA 4WZ5C 3G31A 2VX8A 5J8XA 3Q7VA 3VMAA 3BEBA 1HTZA 3LIAA 3E2KA 1I5QA 4ETZA 4CLCE 1WA9A 5HL6A 3C8CA 3NECA 5GLCA 2W3FA 3QP1A 2Y8HA 4S2PA 1GA9A 3BFDA 2L1MA 2ZC5B 4LFUA 3NULA 2XFTA 4ESPA 1I2SA 4MDZA 4PM8A 1ZKJA 4N1XA 1JWZA 1XKZA 4OQIA 3JYIA 3E98A 3LI8A 1CI8A 4Y15A 1L0FA 3MJQA 1OTAA 2W3DA 4WM9A 4HESA 4X1MA 4EV4A 3NOUC 1BLHA 4FTXA 3KYQA 3MMHA 3LR4A 5M1AA 4GD6A 5E2HA 5G4YA 4UAAA 5E2GA 3KO6A 4P0MA 4OPZA 4DN0A 2K2NA 3ICYA 5DTKA 1TD5A 5KZHA 2ZQ7A 1FSWA 2PBDP 1T19A 4IBRA 4RVAA 2IWCA 4LGWA 4XT2A 5HWWA 4PKYA 4F3LA 2W27A 4E6XA 3CUEC 1UWNX 4JF5A 2JN7A 4UA6A 2OLUA 5FDSA 5E2FA 5GLDA 4KZ7A 5FEFA 3UPPA 4B4XA 3NIAA 3NOTC 4PHTA 4Y17A 3LR0A 1BZAA 3ZNYA 1TS0A 3BLSA 3JVVA 5CHJA 1DP6A 2VGJA 1TDLA 2EX8A 3IS2B 2J3TC 3AGDA 4FCFA 1GA0A 2W1TA 4JGPA 4I3AA 4KUKA 1BYWA 2HZ5A 2WKEA 3HBRA 5HWTA 2W3GA 3FYZA 5FI7A 3EEHA 2PDRA 3H7WB 3ZCZA 5JYPA 3K2NA 3O86A 4D2OA 3LCEA 5F1GA 3MXQA 4S2KA 2A24A 4KZ6A 4DE0A 3MXRA 2B5RA 5HPIA 2H28A 1CEGA 5EVIC 2X01A 4FD8A 4EUVA 1P97A 3VP0A 4OPRA 2DCFA 4BMWA 5J3WA 1OJGA 2VEAA 4KQQA 4R23A 3KYZA 1JTGA 5HD5A 4OP8A 1SZVA 4XUXA 4M3KA 2XSSA 1U60A 2JKGA 4BWIA 1M40A 3UB7A 1K56A 1ES3A 1H8ZA 3U2AA 1W7FA 5FQMA 3SH7A 3A0SA 2ZQ9A 3Q81A 5I94A 3E4PA 2VGLS 4GDBA 3EGDC 3PBRA 1L0EA 4R1GA 2ZM0A 4WUJA 2VGKA 5A92A 2G2WA 3ZVWA 3IF5A 1GSWA 4XXRA 1YLWA 1IELA 2INWA 4P6BA 4CJNA 3O88A 3P98A 3LYXA 4GS9B 5GLAA 2QKPA 2XD5A 2P9VB 4HJ3A 1YLJA 4CPKA 1K4FA 2HGVA 1STZA 1W8QA 1MC0A 4MN7A 3LIBA 4OOYA 4WZ5A 1OTBA 2QMIA 4X6TA 2HV1A 3DWKA 1F9IA 2XRNA 3P09A 3IX8A 2JHEA 4OQGA 1GHPA
chains in the Genus database with same CATH topology
4EERA 2D01A 3A0VA 4L9GA 1T1AA 3E4QA 4BBTA 2PR5A 1GSVA 2P08A 4I39A 1YAXA 1T1BA 4NEED 3UMDA 4EESA 2V1AA 3E0YA 1UWPX 3UMEA 3CI6A 3KSHA 3KSFA 2FH5A 5HZHA 1T1CA 5HPFA 4HNBA 3OCNA 2J3WA 5DKLA 2P04A 5HDCA 5DF9A 5HWVA 2V9AA 2DMWA 5DFXA 3F1OA 3HJKA 1Y28A 4EW7A 3F1PA 3BY9A 2B18A 1S66L 4Q0JA 4NKPA 3KSIA 2JHEA 2W1TB 1DRMA 3NHQA 3TE8A 3T4KA 2WKRA 4HH3A 5G4ZA 1OTDA 1XFQA 3EGXC 2QHKA 3CWFA 3PXPA 1LL8A 4ETXA 2KDKA 4E04A 2IA2A 1XJ3A 3PBOA 1YSPA 1ZTUA 1OT6A 2LB5A 4HJ6A 4HP4A 4HJ4A 4OOMA 1F98A 5DKKA 3BWLA 1DP9A 4LRZE 1GSXA 2L0WA 2QJ5A 2I9VA 4OOLA 3C30A 3S7QA 5KIZA 1JNUA 2CMNA 3OLOA 2VZWA 2PD7A 3RFBA 3OOVA 4KQOA 2WKQA 3FPWA 4GHIB 4RQ9A 5HSQA 4NXEA 2W3HA 4MN6A 4NXGA 4Q0IA 3VE4A 2VV7A 1MZUA 3V67A 4QPRA 4BJPA 4NXBA 1OT9A 4LRYC 4GS9A 5J4EA 4IUKA 4R3AA 4H6JB 3E4OA 3FG8A 5AVEA 5IU1A 4JGRA 4KQDA 4MN5A 1S1YA 1YKDA 2PHYA 3BY8A 4G3VA 1F5MA 4AFIA 3PBQA 3IBRA 3BW6A 1NLYA 3UB6A 4GW9A 4IUHA 4KUOA 2EWVA 4HY8A 1OJ5A 3OCLA 2GX5A 2JKRM 5CX7A 4GLQA 3T4LA 3F1NA 3D72A 4ARZB 3A0RA 3S7NA 4LLOB 2M1CA 2ZMVA 3KX0X 4MCWA 3MR0A 4I5SA 2HF6A 2Y79A 3T4QA 1P9WA 3H9WA 2P7JA 3ULFA 2QYBA 2EA9A 3EQUA 4Q0HA 2G7UA 3UB9A 4DJ2A 4R38A 3MQ0A 3EWKA 4FOFA 4CLCC 2J3TD 3W2ZA 4CLCB 3PBTA 1TS7A 2O9AA 1V9ZA 5K5BA 1VB6A 3CAXA 4XT2B 3MFXA 4Y5FA 4EQ1A 4F3LB 4WEKA 4JGQA 3T4JA 2KLIA 2V1BA 1D06A 2PT7A 1LSVA 1EW0A 3K3CA 1N9NA 4LPZA 4EEUA 3MF0A 3R7WB 3LR3A 1N9LA 3S7OA 3LICA 2GZAA 2R78A 5LBRA 2OOLA 1LSWA 1OPXA 3EQVA 3P01A 5AJGA 3LIDA 3PYPA 2VX8A 3BQ8A 5F6AA 3PHYA 3HCYA 3LIAA 3G6OA 4ETZA 4CLCE 1WA9A 5HL6A 3C8CA 2NUTC 2PD8A 3HJIA 2W3FA 2V0UA 2D02A 3PBSA 2VLGA 1V9YA 4M4XA 1NRJA 2Y8HA 4EETB 3T4OA 2YKFA 1H8MA 1W63Q 2L1MA 4GHIA 3VE3A 3T50A 5J7EA 1P0ZA 3DBAA 4MDZA 4L9EA 1IFQA 1ZHHB 3LIEA 4UEYA 5EFWA 5F5YA 4H6JA 5F69A 1T18A 3VV4A 4CQHA 2VJWA 4JGOA 3S7PA 2A24B 3E98A 4EU0A 3LI8A 2Z6DA 3MJQA 2W3DA 1OTAA 4YWZA 5TBMB 3LI9A 3D3OA 5HDSA 4P6ZM 4IHQA 2VV6A 3NOUC 4ARZA 1IOUA 4G3KA 3KYQA 3MMHA 3LR4A 4BBUA 2M7VA 4UQIS 4ME4A 5G4YA 4PKYG 2O9BA 2VV8A 2PYRA 3KO6A 4G3WA 4L0LA 4DN0A 2K2NA 4B9OA 4I3JA 5TJJA 3ICYA 3RTYA 1TF1A 1TD5A 2OAP1 3LFVA 2XA7S 1T19A 2MJ6A 4CLCA 2W3EA 5FL3A 4UQIM 4HI4A 4I3IA 3B42A 4XT2A 5HWWA 4PKYA 2A2LA 3T4SA 3ZYTA 2W27A 4F3LA 2JKTI 2Z6CA 3OBFA 3CUEC 1UWNX 3IBJA 3BQAA 3LIFA 2JN7A 4PAUA 2FZ0A 4GCZA 3OC2A 3B47A 3LUQA 4O0PA 3NOTC 2XA7M 3MQOA 3PR6A 2O99A 4PHTA 3EOIA 3LR0A 4R6LA 1D7EA 3H82B 3B33A 2L4RA 1TS0A 3UE3A 3FC7A 3O5YA 3JVVA 4YNRA 1DP6A 2JKTM 2W0NA 3TRCA 3IS2B 2OWJA 2V0WA 3UE6A 1UGUA 2J3TC 5HDDA 2GJ3A 1TS6A 1VHMA 2VA0A 2BASA 2W1TA 3JVUA 4II7A 4JGPA 4I3AA 4KUKA 1BYWA 4I38A 2OAQ1 2HJEA 3C38A 5HWTA 2W3GA 2ZMFA 3EEHA 2PDRA 3H7WB 4HP9A 4EXOA 1ODVA 1MKMA 2W1RA 3K2NA 4HQAA 1NWZA 1XFNA 2OWHA 3MXQA 4WL9A 2ZOHA 1X0OA 5IS1A 2LB9A 2A24A 3CLOA 5HPIA 2H28A 2KOIA 2ZOIA 4P6ZS 5F68A 4EUVA 5TBMA 3VOLA 1P97A 1G6OA 4L9FA 2QWSA 2EWWA 4Z1WA 4BMWA 2O9CA 4HH2A 2QJ7A 4WEJA 5J3WA 1OJGA 4K08A 2VEAA 5C5KA 3T4TA 4Y2FA 3KYZA 4YOFA 5HD5A 4B93A 3SW1A 3F1OB 1LT0A 1DP8A 5AVFA 2HJ9C 2XSSA 4NXFA 4FSFA 3P7NA 2WKPA 3F1PB 4Y3IA 5HD3A 4BWIA 1XJ4A 4HOIA 2NUPC 5A8BA 4ZRRA 2M7UA 3UB7A 5DFYA 4DJ3A 4HHDA 3C2WA 3U2AA 1LSXA 4IJGA 5KSHA 4O8GA 3A0SA 5I5LA 2JKRI 2O0YA 4WLAA 3R4KA 3TJZC 2YKHA 3E4PA 2VGLS 3GDIA 3NOPC 4O01A 2GNXA 3EGDC 4HIAA 1OTEA 1XJ2A 3PBRA 5DJUA 1S67L 3CUEA 1XJ6A 5L8MA 3GECA 4WUJA 3PBNA 1GSWA 4WN5A 1S4SA 1S4RA 1YSQA 2INWA 5DJTA 3K3DA 3MQQA 1TS8A 3H82A 1G28A 2PR6A 3LR5A 2KX6A 1OTIA 3LYXA 4GS9B 3RH8B 2J80A 2VGLM 3CITA 4GJ4A 5IT5A 2QKPA 2PYPA 4CLCD 3ZQ5A 4HJ3A 4WELA 3IS2A 1N9OA 2B02A 2K31A 3R7WA 2HGVA 3KSGA 4EEPA 5MC7A 2ZBBA 3BJNA 1STZA 4WF0A 4LRXC 1NLZA 3NJAA 1MC0A 1P9RA 3FPVA 4MN7A 4R70A 3LIBA 3TW8A 3UB8A 2XROA 4BBVA 4DMZA 1KOUA 3EEAA 3F1NB 1OTBA 2VKSA 2HV1A 4MMNA 1F9IA 2XRNA 1S1ZA 1W63M 3H7WA 1H3QA 2K7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EER A;  2D01 A;  3A0V A;  4L9G A;  1T1A A;  3E4Q A;  4BBT A;  2PR5 A;  1GSV A;  4I39 A;  1T1B A;  3UMD A;  4EES A;  2V1A A;  3UME A;  1UWP X;  5HZH A;  1T1C A;  4HNB A;  5DKL A;  5HDC A;  5HWV A;  2V9A A;  3F1O A;  3HJK A;  1Y28 A;  4EW7 A;  3F1P A;  3BY9 A;  1S66 L;  2JHE A;  1DRM A;  3NHQ A;  2WKR A;  4HH3 A;  5G4Z A;  1OTD A;  1XFQ A;  2QHK A;  3CWF A;  1LL8 A;  2KDK A;  4E04 A;  1XJ3 A;  1OT6 A;  4HJ6 A;  4HP4 A;  4HJ4 A;  1F98 A;  5DKK A;  3BWL A;  1DP9 A;  4LRZ E;  1GSX A;  2L0W A;  2QJ5 A;  2I9V A;  5KIZ A;  1JNU A;  2CMN A;  3OLO A;  2PD7 A;  2WKQ A;  4GHI B;  4RQ9 A;  5HSQ A;  4NXE A;  4MN6 A;  4NXG A;  3VE4 A;  2VV7 A;  1MZU A;  4NXB A;  1OT9 A;  4LRY C;  4GS9 A;  5J4E A;  4R3A A;  4H6J B;  3E4O A;  3FG8 A;  5AVE A;  5IU1 A;  4JGR A;  4KQD A;  4MN5 A;  1S1Y A;  2PHY A;  3BY8 A;  3IBR A;  3UB6 A;  4GW9 A;  4KUO A;  4HY8 A;  1OJ5 A;  3F1N A;  3D72 A;  3A0R A;  4LLO B;  2M1C A;  3KX0 X;  3MR0 A;  4I5S A;  3H9W A;  2P7J A;  3ULF A;  2EA9 A;  3UB9 A;  4DJ2 A;  4R38 A;  3EWK A;  1TS7 A;  1V9Z A;  1VB6 A;  3CAX A;  4XT2 B;  3MFX A;  4EQ1 A;  4F3L B;  4JGQ A;  2V1B A;  1D06 A;  1LSV A;  1EW0 A;  3K3C A;  1N9N A;  4LPZ A;  4EEU A;  1N9L A;  3LIC A;  2R78 A;  2OOL A;  1LSW A;  3LID A;  3PYP A;  5F6A A;  3PHY A;  3LIA A;  3G6O A;  1WA9 A;  3C8C A;  2PD8 A;  3HJI A;  2V0U A;  2D02 A;  2VLG A;  1V9Y A;  4M4X A;  4EET B;  2YKF A;  3VE3 A;  2L1M A;  4GHI A;  3T50 A;  5J7E A;  1P0Z A;  4L9E A;  3LIE A;  5F5Y A;  5EFW A;  4H6J A;  5F69 A;  1T18 A;  4JGO A;  2A24 B;  3LI8 A;  2Z6D A;  3MJQ A;  1OTA A;  4YWZ A;  5TBM B;  3LI9 A;  5HDS A;  2VV6 A;  3NOU C;  4BBU A;  5G4Y A;  4PKY G;  2VV8 A;  2PYR A;  4B9O A;  4I3J A;  3ICY A;  3RTY A;  1T19 A;  4HI4 A;  4I3I A;  4XT2 A;  5HWW A;  4PKY A;  4F3L A;  2W27 A;  2Z6C A;  1UWN X;  3LIF A;  2JN7 A;  4GCZ A;  3LUQ A;  3NOT C;  3MQO A;  4R6L A;  1D7E A;  3H82 B;  3B33 A;  2L4R A;  1TS0 A;  3FC7 A;  1DP6 A;  2W0N A;  3IS2 B;  2OWJ A;  2V0W A;  3UE6 A;  1UGU A;  5HDD A;  2GJ3 A;  1TS6 A;  2BAS A;  4JGP A;  4I3A A;  4KUK A;  1BYW A;  4I38 A;  5HWT A;  3EEH A;  2PDR A;  3H7W B;  4HP9 A;  4EXO A;  1ODV A;  4HQA A;  1NWZ A;  1XFN A;  2OWH A;  3MXQ A;  4WL9 A;  2ZOH A;  1X0O A;  5IS1 A;  2A24 A;  3CLO A;  2H28 A;  2ZOI A;  5F68 A;  5TBM A;  3VOL A;  1P97 A;  4L9F A;  2QWS A;  4HH2 A;  2QJ7 A;  5J3W A;  1OJG A;  4K08 A;  2VEA A;  5HD5 A;  3SW1 A;  3F1O B;  1LT0 A;  1DP8 A;  5AVF A;  4NXF A;  3P7N A;  2WKP A;  3F1P B;  5HD3 A;  1XJ4 A;  4HOI A;  5A8B A;  3UB7 A;  4DJ3 A;  4HHD A;  3C2W A;  1LSX A;  3A0S A;  5I5L A;  4WLA A;  2YKH A;  3E4P A;  3GDI A;  3NOP C;  4HIA A;  1OTE A;  1XJ2 A;  5DJU A;  1S67 L;  1XJ6 A;  3GEC A;  4WUJ A;  1GSW A;  4WN5 A;  1S4S A;  1S4R A;  2INW A;  5DJT A;  3K3D A;  3MQQ A;  1TS8 A;  3H82 A;  1G28 A;  2PR6 A;  2KX6 A;  1OTI A;  3LYX A;  4GS9 B;  3RH8 B;  2J80 A;  2QKP A;  2PYP A;  3ZQ5 A;  4HJ3 A;  3IS2 A;  1N9O A;  2B02 A;  4EEP A;  2ZBB A;  4WF0 A;  4LRX C;  3NJA A;  4R70 A;  3LIB A;  3UB8 A;  4BBV A;  1KOU A;  3F1N B;  1OTB A;  2HV1 A;  1F9I A;  1S1Z A;  3H7W A;  2K7S A; 
#chains in the Genus database with same CATH topology
 1T1A A;  2R9X A;  3N8L A;  3T1X A;  3ZG7 B;  4GB7 A;  3BEC A;  2V1A A;  1SKO A;  3E0Y A;  1UWP X;  3UME A;  1LI0 A;  3KSH A;  1Q2Q A;  2FH5 A;  1T1C A;  2H0T A;  3LGO A;  5CXW A;  3HLE A;  5DKL A;  2P04 A;  1PWD A;  2I72 A;  2V9A A;  3BFC A;  3W4O A;  3Q07 A;  1FIK A;  3F1O A;  4QD4 A;  3HJK A;  4LCL A;  3T1Q B;  4EW7 A;  3F1P A;  3RJU A;  2J7V A;  2XGN A;  3BY9 A;  5L2F A;  3IH9 A;  4H8R A;  1S66 L;  4Q0J A;  2W1T B;  1DRM A;  3NHQ A;  3T4K A;  2WKR A;  1OTD A;  1VEU A;  2BTF P;  2IA2 A;  1YSP A;  4OVD A;  4HJ6 A;  4HJ4 A;  4OOM A;  5GL9 A;  3L7H A;  2XR0 A;  5FDH A;  3G35 A;  3C30 A;  3W4Q A;  3OLO A;  2Y4A A;  2PD7 A;  4QY6 A;  3FPW A;  4KG2 A;  1I2W A;  3CPT B;  5HSQ A;  4JXS A;  4RX2 A;  4Q0I A;  2XLN A;  4NXB A;  3HUM A;  4IUK A;  5CTM A;  5IU1 A;  1S1Y A;  4OQ0 A;  2RCX A;  3V39 A;  1ERQ A;  2JE5 A;  1EI5 A;  2Y2K A;  4X53 A;  4GW9 A;  4KUO A;  5HFO A;  1PW8 A;  5F82 A;  3OCL A;  1K6R A;  5CX7 A;  4GLQ A;  4DXC A;  3F1N A;  3D72 A;  5CEB A;  3QP6 A;  1K57 A;  4KG5 A;  2XD1 A;  4I5S A;  3HLD A;  3SS3 A;  2Y79 A;  1P9W A;  4A5R A;  1PW1 A;  1MWT A;  3IT9 A;  1YLT A;  1ZC2 A;  4S2M A;  3UB9 A;  2G7U A;  1W8Y A;  3EWK A;  3VFH A;  1ES2 A;  3WRT A;  1YQS A;  4CLC B;  3AGE A;  1TS7 A;  3G2Z A;  1VB6 A;  3CAX A;  4Y5F A;  2ZLY A;  2ZL1 B;  4ZJ3 A;  4U0T A;  1SKF A;  4EWF A;  1KDW A;  1KE3 A;  2KLI A;  1D06 A;  3V50 A;  3ZNT A;  2PBY A;  1KE4 A;  2WGI A;  1N9N A;  2GZA A;  3FKV A;  5CEC A;  3U4L P;  3LID A;  3HCY A;  1ERO A;  3OZH A;  3DW0 A;  2R9W A;  4B88 A;  3G6O A;  3G34 A;  3KYE A;  1NZO A;  2D02 A;  3PBS A;  3UPO A;  3DWZ A;  1KE0 A;  3PAE A;  1HVB A;  4EET B;  3IWI A;  1BLS A;  1H8M A;  1S0W A;  4GHI A;  4JF4 A;  3T50 A;  4X56 A;  3TOI A;  5E43 A;  3ZG0 A;  2HP9 A;  1FIL A;  4WBG A;  4UEY A;  3D9Y A;  4H6J A;  5FA7 A;  1K25 A;  3VV4 A;  4OKP A;  3UDI A;  4JGO A;  2Z6D A;  2OV5 A;  3IX3 A;  4KZ3 A;  4YWZ A;  1H8Y A;  4C3Q A;  3SOI A;  4O7D A;  4R4S A;  2XFS A;  1YM1 A;  4P6Z M;  3IXH A;  3A3I A;  4IHQ A;  1IOU A;  1ACF A;  4E3I A;  5FAS A;  4N9K A;  3N8S A;  4UQI S;  4K91 A;  3LEZ A;  1WYC A;  2Y2Q A;  5HL1 A;  4PKY G;  2O9B A;  1NRF A;  4G3W A;  3BFG A;  2EXA A;  1PRQ A;  1TF1 A;  3RTY A;  5GHZ A;  3LFV A;  5FEG A;  2J9O A;  4MBH A;  2J9P A;  1KVM A;  2A2L A;  3T4S A;  2Z6C A;  3OBF A;  3VSL A;  4N9L A;  4WMC A;  3RXX A;  3BFF A;  1MBL A;  5CTN A;  3WS5 A;  3BM6 A;  4IVI A;  5EOE A;  3H82 B;  5HAR A;  3B33 A;  3UDX A;  1XP4 A;  1L3L A;  3O5Y A;  1JWP A;  2PRF A;  3V3R A;  1VET A;  3CHW P;  2V0W A;  3BRM A;  3HLC A;  3SS5 A;  4II7 A;  2HJE A;  3C38 A;  1CQA A;  3HL9 A;  3SH9 A;  1YLP A;  4HP9 A;  1ODV A;  2W1R A;  3WS4 A;  1XFN A;  3NI9 A;  2OWH A;  2HDR A;  1K6S A;  1E3U D;  2EFX A;  1K38 A;  4E3M A;  4P6Z S;  5EVI B;  5TBM A;  4B4Z A;  4L9F A;  2QWS A;  3MKE A;  1TDG A;  2QJ7 A;  4WEJ A;  5C5K A;  4Y2F A;  3FKW A;  2Q0O A;  3SW1 A;  1C3B A;  4DDY A;  1LT0 A;  1DP8 A;  5AVF A;  4NXF A;  4FSF A;  3P7N A;  5HD3 A;  4HOI A;  2NUP C;  4QY5 A;  2C5W B;  3OPL A;  4DJ3 A;  3N8R A;  5EUA A;  3T1R A;  3ZVT A;  4EUZ A;  1LSX A;  5KSH A;  3HUN A;  5I5L A;  2JKR I;  2O0Y A;  4WLA A;  3N7W A;  5EOO A;  4HIA A;  1OTE A;  5DJU A;  1XJ6 A;  1PWG A;  4BL2 A;  1PI4 A;  3NY4 A;  3W8K A;  4BLM A;  5DJT A;  1TS8 A;  1L0D A;  1QME A;  2PR6 A;  4E3O A;  2Y2J A;  1OTI A;  2HDU A;  4BD1 A;  2VGL M;  4GJ4 A;  4Y0T A;  4HEF A;  2PYP A;  4CLC D;  3ZQ5 A;  4WEL A;  2E8I A;  5DF7 A;  4LV0 A;  3R7W A;  4GZB A;  3WWX A;  5A91 A;  4EEP A;  1MKI A;  2ZBB A;  1GCE A;  1NLZ A;  3M6H A;  3NJA A;  4R70 A;  1K57 C;  4N92 A;  3Q7Z A;  2WYX A;  5AJG A;  3V5M A;  1H3Q A;  3I7J A;  1IYS A;  4GOG A;  4OH0 A;  2P08 A;  4I39 A;  3C7U A;  1T1B A;  4IBX A;  1IYO A;  1YMX A;  5GHX A;  3V3S A;  2FFF B;  3KSF A;  5F1F A;  3BFE A;  4HNB A;  1KDS A;  5HWV A;  4Y0U A;  1DY6 A;  4UA7 A;  1Y28 A;  3OPP A;  3A3E A;  4NKP A;  3KSI A;  3TE8 A;  1PZO A;  3Q7V B;  4E04 A;  1XJ3 A;  5CHM A;  2WZX A;  4GN2 A;  2LB5 A;  1MWU A;  2WK0 A;  4E3L A;  5DKK A;  4LRZ E;  1GSX A;  2L0W A;  2QJ5 A;  1LL5 A;  4JBF A;  4X69 A;  5KIZ A;  2WGW A;  2VZW A;  3C4P A;  2ZC4 B;  4GD8 A;  1K55 C;  3HLB A;  1YMS A;  4MN6 A;  3ZG8 B;  2VV7 A;  3UDF A;  4QPR A;  4LRY C;  1TVF A;  1F5M A;  3HLW A;  4K0W A;  3BW6 A;  3A3J A;  3T12 B;  4BD0 A;  4DRT A;  1HLU P;  5M18 A;  4HY8 A;  2GX5 A;  2JKR M;  3QP5 A;  3OPH A;  4Q8I A;  1K4E A;  1IKG A;  3G30 A;  3QNB A;  5HAI A;  4JPM A;  4LLO B;  3HLF A;  2ZMV A;  5DF8 A;  5FQI A;  2X71 A;  3FWL A;  4ID4 A;  1PZP A;  3T4Q A;  2A49 A;  1VM1 A;  4X25 A;  3EQU A;  4Q0H A;  4DJ2 A;  2J3T D;  4P87 A;  4Y7P A;  4DDS A;  4E6W A;  1NYY A;  2X02 A;  4MBK A;  1V9Z A;  2Y59 A;  2H10 A;  4XT2 B;  2RL3 A;  2EX9 A;  3AGF A;  5CER A;  4F3L B;  4WEK A;  5HAP A;  2PT7 A;  3TSG A;  2ZM2 A;  1ERM A;  4LPZ A;  3IF6 A;  3R7W B;  1D1J A;  1RGZ A;  4R4R A;  3LR3 A;  3S7O A;  4KZ9 A;  2ZD8 A;  2OOL A;  2WKH A;  1LSW A;  1HD8 A;  3PYP A;  2XEP A;  3DTI A;  1SCW A;  4LEN A;  5F6A A;  3PHY A;  5EVI D;  2HPB A;  2Y2O A;  2NUT C;  4PM7 A;  3LEQ A;  5FAO A;  1PNE A;  2QPN A;  3C4O A;  1V9Y A;  4M4X A;  1NRJ A;  5CRF A;  3T4O A;  2YKF A;  3VE3 A;  3S22 A;  2ZC3 B;  1P0Z A;  2XK1 A;  1IFQ A;  1ZHH B;  3IXD A;  1IYP A;  3LIE A;  1FCN A;  5EFW A;  1FCO A;  1A0K A;  1AXB A;  4CQH A;  5U47 A;  2A24 B;  4EU0 A;  1L2S A;  3LI9 A;  3M2J A;  4PM6 A;  4X55 A;  3D3O A;  5HDS A;  3SZT A;  3DTE A;  3NDG A;  2J8Y A;  2VV6 A;  4ARZ A;  1EWZ A;  3LO7 A;  4NK3 A;  4U0X A;  2Y2P A;  4G3K A;  4PM9 A;  3JPU A;  2M7V A;  3WS1 A;  1VQQ A;  5FQJ A;  3BYD A;  2VV8 A;  4L0L A;  2WAF A;  4PMA A;  4B9O A;  4I3J A;  2WGW B;  3RXW A;  2EXB A;  4FH4 A;  2XA7 S;  2MJ6 A;  3NBL A;  2HDS A;  2W3E A;  5FL3 A;  4UQI M;  1YPR A;  4I3I A;  4HBT A;  2C6W B;  1KGF A;  4DE2 A;  3IXB A;  3BQA A;  4PAU A;  3UN7 A;  5EM1 A;  2FZ0 A;  4GCZ A;  3OC2 A;  3LUQ A;  3PR6 A;  3CJM A;  5AQA A;  1RGY A;  2B95 A;  3ITB A;  3N6I A;  1OME A;  4OPQ A;  1PI5 A;  5HX9 A;  3QP2 A;  3W4P A;  3C5A A;  2JKT M;  2W0N A;  3TRC A;  2HP6 A;  1TS6 A;  5FQK A;  5FAT A;  2VA0 A;  2BAS A;  1JVJ A;  4I38 A;  5FAP A;  4EBP A;  2CC1 A;  5EPH A;  2ZMF A;  4QWO A;  3VOZ A;  2BG1 A;  2PU2 A;  4UHU A;  4EXO A;  2Y55 A;  1CEF A;  1MKM A;  4X1L A;  1K0K A;  1MY8 A;  3IHA A;  3QP4 A;  1SKO B;  2KOI A;  4Y13 A;  1K55 A;  1PFL A;  2P74 A;  4S2O A;  1G6O A;  1FOF A;  3TG9 A;  2O9C A;  3UY6 A;  3PTE A;  4K08 A;  1CJF A;  5EE8 A;  3ZDJ A;  2XH9 A;  4B93 A;  3F1O B;  5BOH A;  2HJ9 C;  3GRJ A;  3IHB A;  4NG2 A;  2ZM8 A;  4LV2 A;  3F1P B;  4DE3 A;  1XJ4 A;  2M7U A;  5L10 A;  1VEU B;  3MKF A;  1Y4O A;  3B3X A;  3N4I A;  4OON A;  3TJZ C;  3GDI A;  1FQG A;  2GNX A;  1XJ2 A;  3ZFZ A;  3GEC A;  3GTC A;  4UA9 A;  1RCJ A;  4WN5 A;  5A93 A;  1XPB A;  1S4R A;  4MLL A;  1G28 A;  1BUE A;  4U3T A;  2KX6 A;  3NCK A;  2J80 A;  3GMW A;  1BTL A;  3CIT A;  3VFF A;  4R3J A;  3IS2 A;  2B02 A;  3O87 A;  2K31 A;  3LY3 A;  3QHY A;  5MC7 A;  3BJN A;  4NET A;  1ES4 A;  4WF0 A;  1P9R A;  1O07 A;  3FPV A;  2XRO A;  3TW8 A;  4DMZ A;  1KOU A;  5M19 A;  3F1N B;  1H0M A;  2OSU A;  4JKT A;  1K54 C;  4MMN A;  1S1Z A;  2EFU A;  1W63 M;  3H7W A;  3HLG A;  1Y54 A;  2PAV P;  2D01 A;  3A0V A;  3VP4 A;  5AQ7 A;  1FSY A;  1GSV A;  4ZAM A;  2PU4 A;  4NEE D;  3CI6 A;  4OPY A;  2ACG A;  5HPF A;  5EV0 A;  5DF9 A;  2Y2H A;  4FUW A;  2V8F A;  4WYY A;  2DMW A;  4MNR A;  2E8J A;  5DFX A;  3GVB A;  5TGF A;  1XGJ A;  2Z2L B;  3PAG A;  4XUZ A;  3IF6 C;  2B18 A;  3VOY A;  4OQH A;  4HH3 A;  5G4Z A;  1ZG4 A;  5AQB A;  2QHK A;  3CWF A;  3PXP A;  2KDK A;  4HBU A;  2UV0 E;  5HAQ A;  3PBO A;  1ZTU A;  4JLF A;  1OT6 A;  3S1Y A;  1F98 A;  1F2K A;  3BWL A;  1DP9 A;  2I9V A;  4JXV A;  4OOL A;  3S7Q A;  2H5S A;  2CMN A;  2FFY A;  3RFB A;  2WKQ A;  4GHI B;  4RQ9 A;  3M6B A;  4NXE A;  2W3H A;  4NXG A;  3VE4 A;  5D3O A;  1MZU A;  1QMF A;  1K56 D;  4GS9 A;  5J4E A;  4R3A A;  1PYY A;  4H6J B;  1ZG6 A;  3FG8 A;  5AVE A;  4JGR A;  4MN5 A;  4BEN A;  1E4D A;  2PHY A;  4G3V A;  2P9V A;  3ZGA B;  4AFI A;  2QZ6 A;  2ZC6 B;  1NLY A;  2XQZ A;  2JC7 A;  5CHU A;  3UB6 A;  2ZQ8 A;  4E3N A;  4R0Q A;  4S2N A;  2EWV A;  1NZU A;  3T4L A;  2HDQ A;  3UO9 A;  2M1C A;  4OLD A;  3KX0 X;  3BLM A;  1N4O A;  1ONH A;  2Y2I A;  2HF6 A;  4IED A;  1G6A A;  2DNS A;  5FQ9 A;  1NYM A;  4BQM A;  2P7J A;  2EA9 A;  4R38 A;  3MQ0 A;  1M6K A;  4Z9Q A;  4F94 A;  1E25 A;  2WAD A;  2Y91 A;  1WE4 A;  2O9A A;  2JCH A;  4EQ1 A;  4JGQ A;  4R3B A;  2V20 A;  2Q9M A;  1LSV A;  2IWB A;  5IHV A;  3K3C A;  4P85 A;  2JBF A;  1XGI A;  1Z09 A;  4KG6 A;  3CZD A;  3IWQ A;  4PM5 A;  4RYE A;  1OPX A;  3EQV A;  3P01 A;  5KMW A;  3BQ8 A;  3FV7 A;  4YFM A;  2ZMA A;  1VET B;  1E3U A;  3UB5 P;  2PD8 A;  3HJI A;  4IVK A;  2V0U A;  4MBF A;  3DAV A;  2VLG A;  2ZQC A;  1BSG A;  4YIN A;  3VP1 A;  1ESU A;  3G2Y A;  1W63 Q;  3CPT A;  5J7E A;  3DBA A;  4L9E A;  2IWD A;  5F5Y A;  1SDN A;  5L07 A;  3E2L A;  2AVX A;  2Q9N A;  4KZ5 A;  1LI9 A;  5F69 A;  2ZQA A;  1SDE A;  1N9B A;  1T18 A;  4ZTK A;  3O3V A;  2VJW A;  3S7P A;  5TBM B;  3C7V A;  4KZ4 A;  4RA7 A;  3IQA A;  1KGE A;  1XX2 A;  4GDN A;  4BBU A;  1BLC A;  5EVL A;  4ME4 A;  2WUQ A;  4KZB A;  2G2U A;  1RP5 A;  2PYR A;  1DJC A;  5TJJ A;  2WKI A;  2OAP 1;  4BL3 A;  1L0G A;  1J3W A;  1K54 A;  3IH8 A;  4S2I A;  4CLC A;  4KQR A;  4LCM A;  3QNC A;  3G32 A;  4HI4 A;  3B42 A;  1LHY A;  3MSH A;  4EQI A;  4KEN B;  3ZYT A;  2ZL1 A;  4LV3 A;  2JKT I;  1HZO A;  3IBJ A;  5JYO A;  2Z2M B;  3MZE A;  4GKU A;  2XF3 A;  3LIF A;  5E2E A;  3ZG5 A;  2EX6 A;  2XDM A;  3CG5 A;  2JKF A;  4D60 A;  3B47 A;  3GV9 A;  1LLB A;  4O0P A;  3MS6 A;  1Q2P A;  1H5X A;  2XA7 M;  3MQO A;  2O99 A;  3EOI A;  4R6L A;  1D7E A;  1ES5 A;  3D4F A;  2Y2M A;  2L4R A;  3WRZ A;  3UE3 A;  3FC7 A;  3FZC A;  3HVF A;  4YNR A;  1ESI A;  2V1Z A;  2OWJ A;  3UE6 A;  1UGU A;  5FSR A;  3G4P A;  5HDD A;  2GJ3 A;  4S2L A;  2HP5 A;  1VHM A;  4E3J A;  3JVU A;  4C75 A;  1G68 A;  3L9K A;  1CI9 A;  4LV1 A;  2OAQ 1;  1W5D A;  4ZJ2 A;  3GQZ A;  3T1S A;  3Q1F A;  4JXW A;  3Q82 A;  1ALQ A;  3MXS A;  5CGW A;  4HQA A;  5CGX A;  1NWZ A;  2DRW A;  1WYB A;  4WL9 A;  2ZOH A;  1X0O A;  1BT5 A;  3SS4 A;  5IS1 A;  2LB9 A;  4N1H A;  3CLO A;  4EBL A;  2ZOI A;  3HRE A;  1J9M A;  5KSC A;  5F68 A;  1MWR A;  5GHY A;  3VOL A;  1NY0 A;  3UNW A;  2EWW A;  1W79 A;  5CGS A;  4Z1W A;  4HH2 A;  3T4T A;  3WS0 A;  4DF6 A;  4YOF A;  5DVA A;  4MEZ A;  4JXG A;  2WKP A;  4Y3I A;  5A8B A;  4ZRR A;  5FI2 A;  5DFY A;  1XA7 A;  3UE0 A;  4Y0O A;  5FAQ A;  4HHD A;  4DKI A;  3C2W A;  3UPN A;  4IJG A;  1GHM A;  2VK3 A;  4O8G A;  1G5U A;  3R4K A;  5FI6 A;  2YKH A;  3MFD A;  3NOP C;  4O01 A;  2OLV A;  3DTM A;  3QP8 A;  1S67 L;  3CUE A;  3WS2 A;  5L8M A;  3PBN A;  4EBN A;  4X68 A;  1LL9 A;  3MZF A;  1S4S A;  1YSQ A;  1XA1 A;  3K3D A;  3MQQ A;  4OLG A;  3DTK A;  3H82 A;  1DJA A;  3LR5 A;  1CK3 A;  2Y2N A;  1BLP A;  1YLY A;  3RH8 B;  2V8C A;  1KGG A;  5G18 A;  4DE1 A;  5IT5 A;  1IEM A;  1N9O A;  3S4X A;  1MXO A;  3GR2 A;  3KSG A;  5GLB A;  3IWO A;  3NC8 A;  4S2N C;  4LRX C;  1JWV A;  3IX4 A;  3UB8 A;  4BBV A;  1XXM A;  1BUL A;  3EEA A;  4WMC D;  2VKS A;  3MZD A;  4QHC A;  1DJB A;  2K7S A;  4EER A;  5HW3 A;  4L9G A;  1NJ4 A;  3MBZ A;  3HUO A;  2GDN A;  3E4Q A;  4BBT A;  2PR5 A;  4C6Y A;  1YAX A;  4PPR A;  1KVL A;  3GSG A;  3UMD A;  4KZA A;  4EES A;  4FH2 A;  5CED A;  1YLZ A;  5EVI A;  1CF0 A;  2UWX A;  1AWI A;  4RX3 A;  5HZH A;  5TR7 A;  1IYQ A;  3CMZ A;  4K0X A;  3OCN A;  2J3W A;  5EVE A;  5HDC A;  3A3D A;  1FR6 A;  3VP2 A;  2BLS A;  4E3K A;  3ISG A;  2WAE A;  3A3F A;  1MWS A;  1MPL A;  3IF6 B;  5A90 A;  5TFQ A;  2ZJ9 A;  1XFQ A;  3EGX C;  4WZ4 A;  4ETX A;  1LL8 A;  2V2F F;  2WGV A;  4HP4 A;  4QU3 A;  1JNU A;  5AQ9 A;  3OOV A;  4KQO A;  4QJG A;  2H0Y A;  5EM0 A;  5FQQ A;  3ZG9 B;  3VSK A;  2Y2L A;  3V67 A;  4BJP A;  4OP5 A;  1OT9 A;  2A3U A;  3IXG A;  4QB8 A;  3E4O A;  4JF6 A;  5DTS A;  3UE1 A;  4ZBE A;  4KQD A;  1SHV A;  1YKD A;  3BY8 A;  3VP3 A;  2ZC7 A;  4DXB A;  1FR1 A;  3PBQ A;  3IBR A;  3SH8 A;  4IUH A;  2ZQD A;  3ZHH A;  4KZ8 A;  4ZJ1 A;  1OJ5 A;  2Y2G A;  4ARZ B;  3A0R A;  3S7N A;  4MCW A;  3MR0 A;  2WZZ A;  5L09 A;  3H9W A;  1FCM A;  3ULF A;  4ZDX A;  3NDE A;  2QYB A;  1YT4 A;  5DTT A;  1ONG A;  4FOF A;  1NXY A;  3LY4 A;  4CLC C;  3W2Z A;  3ITA A;  3PBT A;  3OPR A;  5K5B A;  1TEM A;  4GNU A;  3MFX A;  1PIO A;  3M2K A;  1Z6F A;  2EX2 A;  1S6R A;  3T4J A;  1PWC A;  2V1B A;  5EEC A;  1O7E A;  5F83 A;  1EW0 A;  1GHI A;  4EEU A;  3MF0 A;  1JTD A;  4S2J A;  1N9L A;  1IKI A;  3LIC A;  2R78 A;  5LBR A;  4WZ5 C;  3G31 A;  2VX8 A;  5J8X A;  3Q7V A;  3VMA A;  3BEB A;  1HTZ A;  3LIA A;  3E2K A;  1I5Q A;  4ETZ A;  4CLC E;  1WA9 A;  5HL6 A;  3C8C A;  3NEC A;  5GLC A;  2W3F A;  3QP1 A;  2Y8H A;  4S2P A;  1GA9 A;  3BFD A;  2L1M A;  2ZC5 B;  4LFU A;  3NUL A;  2XFT A;  4ESP A;  1I2S A;  4MDZ A;  4PM8 A;  1ZKJ A;  4N1X A;  1JWZ A;  1XKZ A;  4OQI A;  3JYI A;  3E98 A;  3LI8 A;  1CI8 A;  4Y15 A;  1L0F A;  3MJQ A;  1OTA A;  2W3D A;  4WM9 A;  4HES A;  4X1M A;  4EV4 A;  3NOU C;  1BLH A;  4FTX A;  3KYQ A;  3MMH A;  3LR4 A;  5M1A A;  4GD6 A;  5E2H A;  5G4Y A;  4UAA A;  5E2G A;  3KO6 A;  4P0M A;  4OPZ A;  4DN0 A;  2K2N A;  3ICY A;  5DTK A;  1TD5 A;  5KZH A;  2ZQ7 A;  1FSW A;  2PBD P;  1T19 A;  4IBR A;  4RVA A;  2IWC A;  4LGW A;  4XT2 A;  5HWW A;  4PKY A;  4F3L A;  2W27 A;  4E6X A;  3CUE C;  1UWN X;  4JF5 A;  2JN7 A;  4UA6 A;  2OLU A;  5FDS A;  5E2F A;  5GLD A;  4KZ7 A;  5FEF A;  3UPP A;  4B4X A;  3NIA A;  3NOT C;  4PHT A;  4Y17 A;  3LR0 A;  1BZA A;  3ZNY A;  1TS0 A;  3BLS A;  3JVV A;  5CHJ A;  1DP6 A;  2VGJ A;  1TDL A;  2EX8 A;  3IS2 B;  2J3T C;  3AGD A;  4FCF A;  1GA0 A;  2W1T A;  4JGP A;  4I3A A;  4KUK A;  1BYW A;  2HZ5 A;  2WKE A;  3HBR A;  5HWT A;  2W3G A;  3FYZ A;  5FI7 A;  3EEH A;  2PDR A;  3H7W B;  3ZCZ A;  5JYP A;  3K2N A;  3O86 A;  4D2O A;  3LCE A;  5F1G A;  3MXQ A;  4S2K A;  2A24 A;  4KZ6 A;  4DE0 A;  3MXR A;  2B5R A;  5HPI A;  2H28 A;  1CEG A;  5EVI C;  2X01 A;  4FD8 A;  4EUV A;  1P97 A;  3VP0 A;  4OPR A;  2DCF A;  4BMW A;  5J3W A;  1OJG A;  2VEA A;  4KQQ A;  4R23 A;  3KYZ A;  1JTG A;  5HD5 A;  4OP8 A;  1SZV A;  4XUX A;  4M3K A;  2XSS A;  1U60 A;  2JKG A;  4BWI A;  1M40 A;  3UB7 A;  1K56 A;  1ES3 A;  1H8Z A;  3U2A A;  1W7F A;  5FQM A;  3SH7 A;  3A0S A;  2ZQ9 A;  3Q81 A;  5I94 A;  3E4P A;  2VGL S;  4GDB A;  3EGD C;  3PBR A;  1L0E A;  4R1G A;  2ZM0 A;  4WUJ A;  2VGK A;  5A92 A;  2G2W A;  3ZVW A;  3IF5 A;  1GSW A;  4XXR A;  1YLW A;  1IEL A;  2INW A;  4P6B A;  4CJN A;  3O88 A;  3P98 A;  3LYX A;  4GS9 B;  5GLA A;  2QKP A;  2XD5 A;  2P9V B;  4HJ3 A;  1YLJ A;  4CPK A;  1K4F A;  2HGV A;  1STZ A;  1W8Q A;  1MC0 A;  4MN7 A;  3LIB A;  4OOY A;  4WZ5 A;  1OTB A;  2QMI A;  4X6T A;  2HV1 A;  3DWK A;  1F9I A;  2XRN A;  3P09 A;  3IX8 A;  2JHE A;  4OQG A;  1GHP A; 
#chains in the Genus database with same CATH homology
 4EER A;  2D01 A;  3A0V A;  4L9G A;  1T1A A;  3E4Q A;  4BBT A;  2PR5 A;  1GSV A;  2P08 A;  4I39 A;  1YAX A;  1T1B A;  4NEE D;  3UMD A;  4EES A;  2V1A A;  3E0Y A;  1UWP X;  3UME A;  3CI6 A;  3KSH A;  3KSF A;  2FH5 A;  5HZH A;  1T1C A;  5HPF A;  4HNB A;  3OCN A;  2J3W A;  5DKL A;  2P04 A;  5HDC A;  5DF9 A;  5HWV A;  2V9A A;  2DMW A;  5DFX A;  3F1O A;  3HJK A;  1Y28 A;  4EW7 A;  3F1P A;  3BY9 A;  2B18 A;  1S66 L;  4Q0J A;  4NKP A;  3KSI A;  2JHE A;  2W1T B;  1DRM A;  3NHQ A;  3TE8 A;  3T4K A;  2WKR A;  4HH3 A;  5G4Z A;  1OTD A;  1XFQ A;  3EGX C;  2QHK A;  3CWF A;  3PXP A;  1LL8 A;  4ETX A;  2KDK A;  4E04 A;  2IA2 A;  1XJ3 A;  3PBO A;  1YSP A;  1ZTU A;  1OT6 A;  2LB5 A;  4HJ6 A;  4HP4 A;  4HJ4 A;  4OOM A;  1F98 A;  5DKK A;  3BWL A;  1DP9 A;  4LRZ E;  1GSX A;  2L0W A;  2QJ5 A;  2I9V A;  4OOL A;  3C30 A;  3S7Q A;  5KIZ A;  1JNU A;  2CMN A;  3OLO A;  2VZW A;  2PD7 A;  3RFB A;  3OOV A;  4KQO A;  2WKQ A;  3FPW A;  4GHI B;  4RQ9 A;  5HSQ A;  4NXE A;  2W3H A;  4MN6 A;  4NXG A;  4Q0I A;  3VE4 A;  2VV7 A;  1MZU A;  3V67 A;  4QPR A;  4BJP A;  4NXB A;  1OT9 A;  4LRY C;  4GS9 A;  5J4E A;  4IUK A;  4R3A A;  4H6J B;  3E4O A;  3FG8 A;  5AVE A;  5IU1 A;  4JGR A;  4KQD A;  4MN5 A;  1S1Y A;  1YKD A;  2PHY A;  3BY8 A;  4G3V A;  1F5M A;  4AFI A;  3PBQ A;  3IBR A;  3BW6 A;  1NLY A;  3UB6 A;  4GW9 A;  4IUH A;  4KUO A;  2EWV A;  4HY8 A;  1OJ5 A;  3OCL A;  2GX5 A;  2JKR M;  5CX7 A;  4GLQ A;  3T4L A;  3F1N A;  3D72 A;  4ARZ B;  3A0R A;  3S7N A;  4LLO B;  2M1C A;  2ZMV A;  3KX0 X;  4MCW A;  3MR0 A;  4I5S A;  2HF6 A;  2Y79 A;  3T4Q A;  1P9W A;  3H9W A;  2P7J A;  3ULF A;  2QYB A;  2EA9 A;  3EQU A;  4Q0H A;  2G7U A;  3UB9 A;  4DJ2 A;  4R38 A;  3MQ0 A;  3EWK A;  4FOF A;  4CLC C;  2J3T D;  3W2Z A;  4CLC B;  3PBT A;  1TS7 A;  2O9A A;  1V9Z A;  5K5B A;  1VB6 A;  3CAX A;  4XT2 B;  3MFX A;  4Y5F A;  4EQ1 A;  4F3L B;  4WEK A;  4JGQ A;  3T4J A;  2KLI A;  2V1B A;  1D06 A;  2PT7 A;  1LSV A;  1EW0 A;  3K3C A;  1N9N A;  4LPZ A;  4EEU A;  3MF0 A;  3R7W B;  3LR3 A;  1N9L A;  3S7O A;  3LIC A;  2GZA A;  2R78 A;  5LBR A;  2OOL A;  1LSW A;  1OPX A;  3EQV A;  3P01 A;  5AJG A;  3LID A;  3PYP A;  2VX8 A;  3BQ8 A;  5F6A A;  3PHY A;  3HCY A;  3LIA A;  3G6O A;  4ETZ A;  4CLC E;  1WA9 A;  5HL6 A;  3C8C A;  2NUT C;  2PD8 A;  3HJI A;  2W3F A;  2V0U A;  2D02 A;  3PBS A;  2VLG A;  1V9Y A;  4M4X A;  1NRJ A;  2Y8H A;  4EET B;  3T4O A;  2YKF A;  1H8M A;  1W63 Q;  2L1M A;  4GHI A;  3VE3 A;  3T50 A;  5J7E A;  1P0Z A;  3DBA A;  4MDZ A;  4L9E A;  1IFQ A;  1ZHH B;  3LIE A;  4UEY A;  5EFW A;  5F5Y A;  4H6J A;  5F69 A;  1T18 A;  3VV4 A;  4CQH A;  2VJW A;  4JGO A;  3S7P A;  2A24 B;  3E98 A;  4EU0 A;  3LI8 A;  2Z6D A;  3MJQ A;  2W3D A;  1OTA A;  4YWZ A;  5TBM B;  3LI9 A;  3D3O A;  5HDS A;  4P6Z M;  4IHQ A;  2VV6 A;  3NOU C;  4ARZ A;  1IOU A;  4G3K A;  3KYQ A;  3MMH A;  3LR4 A;  4BBU A;  2M7V A;  4UQI S;  4ME4 A;  5G4Y A;  4PKY G;  2O9B A;  2VV8 A;  2PYR A;  3KO6 A;  4G3W A;  4L0L A;  4DN0 A;  2K2N A;  4B9O A;  4I3J A;  5TJJ A;  3ICY A;  3RTY A;  1TF1 A;  1TD5 A;  2OAP 1;  3LFV A;  2XA7 S;  1T19 A;  2MJ6 A;  4CLC A;  2W3E A;  5FL3 A;  4UQI M;  4HI4 A;  4I3I A;  3B42 A;  4XT2 A;  5HWW A;  4PKY A;  2A2L A;  3T4S A;  3ZYT A;  2W27 A;  4F3L A;  2JKT I;  2Z6C A;  3OBF A;  3CUE C;  1UWN X;  3IBJ A;  3BQA A;  3LIF A;  2JN7 A;  4PAU A;  2FZ0 A;  4GCZ A;  3OC2 A;  3B47 A;  3LUQ A;  4O0P A;  3NOT C;  2XA7 M;  3MQO A;  3PR6 A;  2O99 A;  4PHT A;  3EOI A;  3LR0 A;  4R6L A;  1D7E A;  3H82 B;  3B33 A;  2L4R A;  1TS0 A;  3UE3 A;  3FC7 A;  3O5Y A;  3JVV A;  4YNR A;  1DP6 A;  2JKT M;  2W0N A;  3TRC A;  3IS2 B;  2OWJ A;  2V0W A;  3UE6 A;  1UGU A;  2J3T C;  5HDD A;  2GJ3 A;  1TS6 A;  1VHM A;  2VA0 A;  2BAS A;  2W1T A;  3JVU A;  4II7 A;  4JGP A;  4I3A A;  4KUK A;  1BYW A;  4I38 A;  2OAQ 1;  2HJE A;  3C38 A;  5HWT A;  2W3G A;  2ZMF A;  3EEH A;  2PDR A;  3H7W B;  4HP9 A;  4EXO A;  1ODV A;  1MKM A;  2W1R A;  3K2N A;  4HQA A;  1NWZ A;  1XFN A;  2OWH A;  3MXQ A;  4WL9 A;  2ZOH A;  1X0O A;  5IS1 A;  2LB9 A;  2A24 A;  3CLO A;  5HPI A;  2H28 A;  2KOI A;  2ZOI A;  4P6Z S;  5F68 A;  4EUV A;  5TBM A;  3VOL A;  1P97 A;  1G6O A;  4L9F A;  2QWS A;  2EWW A;  4Z1W A;  4BMW A;  2O9C A;  4HH2 A;  2QJ7 A;  4WEJ A;  5J3W A;  1OJG A;  4K08 A;  2VEA A;  5C5K A;  3T4T A;  4Y2F A;  3KYZ A;  4YOF A;  5HD5 A;  4B93 A;  3SW1 A;  3F1O B;  1LT0 A;  1DP8 A;  5AVF A;  2HJ9 C;  2XSS A;  4NXF A;  4FSF A;  3P7N A;  2WKP A;  3F1P B;  4Y3I A;  5HD3 A;  4BWI A;  1XJ4 A;  4HOI A;  2NUP C;  5A8B A;  4ZRR A;  2M7U A;  3UB7 A;  5DFY A;  4DJ3 A;  4HHD A;  3C2W A;  3U2A A;  1LSX A;  4IJG A;  5KSH A;  4O8G A;  3A0S A;  5I5L A;  2JKR I;  2O0Y A;  4WLA A;  3R4K A;  3TJZ C;  2YKH A;  3E4P A;  2VGL S;  3GDI A;  3NOP C;  4O01 A;  2GNX A;  3EGD C;  4HIA A;  1OTE A;  1XJ2 A;  3PBR A;  5DJU A;  1S67 L;  3CUE A;  1XJ6 A;  5L8M A;  3GEC A;  4WUJ A;  3PBN A;  1GSW A;  4WN5 A;  1S4S A;  1S4R A;  1YSQ A;  2INW A;  5DJT A;  3K3D A;  3MQQ A;  1TS8 A;  3H82 A;  1G28 A;  2PR6 A;  3LR5 A;  2KX6 A;  1OTI A;  3LYX A;  4GS9 B;  3RH8 B;  2J80 A;  2VGL M;  3CIT A;  4GJ4 A;  5IT5 A;  2QKP A;  2PYP A;  4CLC D;  3ZQ5 A;  4HJ3 A;  4WEL A;  3IS2 A;  1N9O A;  2B02 A;  2K31 A;  3R7W A;  2HGV A;  3KSG A;  4EEP A;  5MC7 A;  2ZBB A;  3BJN A;  1STZ A;  4WF0 A;  4LRX C;  1NLZ A;  3NJA A;  1MC0 A;  1P9R A;  3FPV A;  4MN7 A;  4R70 A;  3LIB A;  3TW8 A;  3UB8 A;  2XRO A;  4BBV A;  4DMZ A;  1KOU A;  3EEA A;  3F1N B;  1OTB A;  2VKS A;  2HV1 A;  4MMN A;  1F9I A;  2XRN A;  1S1Z A;  1W63 M;  3H7W A;  1H3Q A;  2K7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...