1VB6A

Crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of oxygen-bound form of a Heme PAS domain of Ec DOS
rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
total genus 32
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1vb6A00
3A0SA 2V0UA 4K08A 1S4SA 5AVEA 1DP9A 2JN7A 5DJTA 1OTAA 3BY8A 3H82A 4GCZA 1JNUA 1UWNX 2PYPA 4PKYG 2Z6CA 2W0NA 1BYWA 2H28A 3H82B 1KOUA 1WA9A 4WL9A 4XT2B 3OLOA 2OWJA 2QHKA 3LIAA 1XJ2A 3C8CA 2QWSA 1LL8A 1OJ5A 4JGRA 5IS1A 3NHQA 1S66L 4L9GA 2PYRA 4L9FA 4MN5A 5HWTA 4R6LA 2JHEA 5DKKA 2M1CA 1Y28A 2P7JA 3BY9A 3UB6A 4HJ6A 4EETB 2A24A 2I9VA 1DP6A 1XFQA 4HQAA 2KDKA 3MR0A 4HP4A 1F9IA 4WLAA 1X0OA 3CLOA 1P97A 1GSWA 3G6OA 2CMNA 3FG8A 4HJ3A 3UE6A 1N9NA 5DJUA 2PR5A 2PD8A 2W27A 2GJ3A 3HJIA 3EWKA 5J7EA 2ZBBA 4I3IA 4HJ4A 2KX6A 4NXGA 3P7NA 3MXQA 2D01A 5F68A 4HOIA 1UGUA 4R70A 3UMDA 5HDDA 1TS6A 3RTYA 1OT9A 5HWVA 2INWA 1LSWA 1T19A 2YKHA 1G28A 2BASA 3MFXA 1T1BA 4NXBA 2WKQA 3SW1A 4B9OA 2PD7A 1TS0A 2EA9A 2D02A 2QKPA 5IU1A 2HV1A 3VOLA 3E4PA 4HI4A 4EEPA 4JGQA 5G4YA 2K7SA 3GDIA 4HH2A 1D06A 4E04A 3E4OA 4EEUA 3ICYA 5J4EA 4LRXC 4DJ3A 1OTDA 2PHYA 1D7EA 4LPZA 4KUKA 4LLOB 1XJ6A 3HJKA 1TS8A 3K3CA 3PHYA 4HY8A 3BWLA 2VV7A 4EERA 1GSXA 1MZUA 1EW0A 3LI8A 1LSXA 2Z6DA 5F69A 3LIDA 2ZOHA 1S67L 1TS7A 4LRYC 4DJ2A 3A0RA 4H6JA 3NOPC 4PKYA 5AVFA 3UB7A 3C2WA 5HSQA 4KUOA 4F3LA 4I38A 2PDRA 3LICA 4WN5A 3UB9A 2ZOIA 2B02A 1P0ZA 3GECA 2OOLA 2VV8A 1F98A 3MQQA 4GHIB 5HZHA 1OJGA 2L4RA 2VV6A 4M4XA 1LSVA 3EEHA 2A24B 4I5SA 5EFWA 3IS2A 2WKRA 1UWPX 1OTEA 5I5LA 3CAXA 1DRMA 1OTBA 1XFNA 1S4RA 3F1OB 4BBVA 4EW7A 4GS9A 3F1NA 4HHDA 2WKPA 3H7WA 1DP8A 5TBMA 1T18A 4JGOA 5F6AA 5HD3A 3PYPA 3MJQA 4EESA 5KIZA 1S1YA 3IBRA 2PR6A 2QJ5A 1V9ZA 2QJ7A 3UB8A 3ULFA 4HIAA 3VE3A 4F3LB 4KQDA 4WF0A 3K3DA 1ODVA 3MQOA 1N9OA 4WUJA 2V0WA 4EXOA 5J3WA 4I3AA 1XJ4A 1N9LA 1VB6A 3LIFA 4GHIA 5HD5A 3ZQ5A 5HWWA 4JGPA 4HH3A 3B33A 4HP9A 5F5YA 5HDSA 1LT0A 3UMEA 3D72A 2V1AA 2VEAA 5HDCA 3NJAA 3T50A 3H9WA 3H7WB 3LIBA 5A8BA 3F1NB 4GS9B 4HNBA 4MN6A 2YKFA 3F1OA 4NXEA 4L9EA 1NWZA 1S1ZA 3E4QA 3A0VA 3FC7A 4I39A 1T1AA 3IS2B 3LUQA 4R38A 4I3JA 2V9AA 4BBUA 1T1CA 4GW9A 4BBTA 4LRZE 2OWHA 3LYXA 4NXFA 2VLGA 4R3AA 1GSVA 1XJ3A 2L0WA 3F1PA 4RQ9A 4YWZA 2R78A 3LIEA 5TBMB 4XT2A 1OTIA 3F1PB 2L1MA 3VE4A 1V9YA 3NOUC 3KX0X 2J80A 3NOTC 3RH8B 1OT6A 4H6JB 4EQ1A 2V1BA 5DKLA 3LI9A 3CWFA 5G4ZA
chains in the Genus database with same CATH superfamily
3O5YA 2HPBA 4GDNA 3VOYA 4BD0A 4PKYG 1BYWA 3G30A 4QB8A 3QP8A 3BLMA 5D3OA 3V3SA 4CPKA 3CPTA 3S7OA 3MR0A 3T4KA 4WLAA 3VMAA 5DJUA 3NECA 3EWKA 4R3BA 2NUPC 5HW3A 1PW1A 4ZJ1A 2WZZA 2O9CA 1FR1A 4EBNA 2ZQ9A 4JF4A 2E8IA 4HH2A 4Y17A 1JWZA 4DJ3A 1OTDA 3TW8A 1D7EA 1H8ZA 3SS3A 3IWIA 3ZDJA 2VV7A 1JWPA 1GCEA 2Y2LA 3LR4A 1I2WA 2PU4A 1P9WA 4XUXA 4S2KA 3CAXA 1L0DA 1DRMA 3FV7A 5AQ9A 4EW7A 4BBVA 1S6RA 4S2PA 4CLCE 3LR3A 3EQVA 4YOFA 4JXVA 1RCJA 5L8MA 3CHWP 1XJ4A 3JYIA 1TD5A 1IYSA 3MF0A 4PM9A 3A3JA 3FPWA 5F82A 2XF3A 4JBFA 1NWZA 3A0VA 1K38A 3ITBA 3IF6B 5KMWA 4BBTA 2OWHA 4WMCA 4R3AA 4EUZA 3DWKA 1OTIA 3OBFA 1J3WA 2PRFA 5FQIA 1MPLA 2Y4AA 1ESUA 1KOUA 4Q0JA 5L2FA 2AVXA 3WWXA 2P7JA 4EETB 2ZD8A 4KG6A 4HJ3A 5EVEA 4UAAA 1SDEA 5F68A 4YNRA 3SW1A 2WKQA 2DNSA 3IX3A 1HVBA 5FASA 4UA9A 1PFLA 3HL9A 4E3OA 1FCNA 3G2ZA 2O9BA 3BWLA 3S22A 1EW0A 3VP0A 1LSXA 3ISGA 3LGOA 3PBTA 2EXAA 1L3LA 3G32A 3HUNA 3PBOA 4OQ0A 1OMEA 4GHIB 4Y2FA 5HZHA 5EVID 4P0MA 1NYMA 1YMXA 4DXCA 4FH2A 1FR6A 1PI5A 1LLBA 3IF6C 3HLFA 1SKOA 3UNWA 2DMWA 2QJ5A 1IKGA 2QJ7A 4PPRA 3V67A 1N9OA 4KQQA 1IKIA 3LO7A 3V3RA 4HP9A 3UMEA 5DTKA 3W2ZA 3H7WB 4GS9B 3DTIA 4HNBA 4CLCB 1S1ZA 3FC7A 4S2NA 4HBUA 4N9LA 4Z1WA 1VEUB 1W8YA 3VE4A 4D2OA 3NDGA 1XA7A 2RL3A 3O3VA 3A0SA 3W4OA 3EEAA 3KSFA 2WZXA 4LCLA 4B4XA 1S66L 3GR2A 4R6LA 1Y28A 3NBLA 2JBFA 1G5UA 3GVBA 4UQIM 1PW8A 3NC8A 3RXWA 4S2JA 1J9MA 2FFFB 2D02A 2QPNA 4CLCD 4RX2A 2XH9A 3VOLA 3WS0A 1KGFA 5CX7A 5FQ9A 5G4YA 3N6IA 4ZDXA 5J4EA 2EXBA 4KZBA 4G3WA 1XJ6A 1K4EA 3MSHA 3DBAA 3V5MA 5F69A 4AFIA 4HBTA 5FAPA 3QNCA 3R7WB 4H6JA 1YSQA 5EOEA 4WYYA 3M2KA 2O0YA 3TE8A 3W8KA 5KZHA 3F1OB 4GS9A 3PXPA 4PHTA 4H8RA 3N4IA 4O8GA 1MBLA 1VQQA 1S1YA 2W1TA 1LHYA 3UB8A 4ZJ2A 4BWIA 1XPBA 1H5XA 2A2LA 2OLUA 3CITA 5TJJA 4YINA 3Q7VB 4ZRRA 3D72A 1WYBA 2XSSA 1TF1A 5J8XA 1BSGA 1T1CA 1CF0A 4LRZE 5HFOA 4XT2A 4MLLA 4X1MA 5L07A 1MKIA 2C6WB 2VKSA 1OTAA 4XT2B 1NJ4A 1LL8A 2ZM2A 4G3VA 4L9GA 4MN5A 3TRCA 4OPYA 3U4LP 2I9VA 5CEDA 1H0MA 2PR5A 2M7UA 4NK3A 3P01A 3R7WA 4K0XA 1IYPA 4LV1A 3BFEA 2EA9A 1YLJA 2K7SA 1ES3A 1ZHHB 5CGWA 3GDIA 4E04A 3M2JA 1MXOA 1PWGA 4FTXA 3E2LA 4LLOB 4OPRA 2PAVP 3KO6A 3A3FA 1YLZA 3PTEA 4UHUA 5EPHA 4B4ZA 2X02A 4R4SA 5HSQA 4IEDA 4ID4A 1CI8A 3O88A 5K5BA 3BLSA 1DP8A 5TBMA 1T18A 4DE1A 3ZVWA 5MC7A 4WF0A 2J3TC 3ZYTA 3ZCZA 3SH7A 4E6XA 1LT0A 4MDZA 3F1NB 4MN6A 4NXEA 2YKFA 3IHAA 2JE5A 4WZ5A 2CC1A 3Q81A 3UE3A 1HLUP 1H8MA 5FQMA 5E2HA 3D3OA 4PM5A 5G4ZA 2KOIA 4FSFA 2QZ6A 2JN7A 1KDWA 1K55C 1SHVA 3G2YA 4ZBEA 4OQGA 5IS1A 4ZJ3A 2W3HA 3SZTA 2A24A 3ZG8B 2ZMAA 2R9WA 3ZG0A 2VK3A 3UE6A 3AGDA 4ARZA 1NZOA 3IH8A 3MXQA 2YKHA 2LB5A 2WUQA 1PYYA 3C38A 1YLYA 3RFBA 2BG1A 2IWBA 3BRMA 2Y2QA 5A93A 2XEPA 2FH5A 3ZVTA 1G6OA 2WGIA 2GDNA 3MFDA 4EBLA 2OOLA 1MY8A 5BOHA 3VFFA 2ZC5B 5F83A 3OCNA 5AQBA 5EVIA 4FH4A 3T1RA 3BEBA 3C5AA 4GOGA 2Y79A 1K6SA 4I3AA 2WAEA 3MQ0A 3WS4A 2JKGA 3F1OA 3FYZA 3LUQA 3IS2B 3KSGA 1NY0A 3E98A 5HPIA 3UB5P 1GA0A 4OQIA 2L1MA 2X71A 1EROA 2FFYA 3H82A 3V50A 5LBRA 3H82B 4WL9A 4LV2A 3OC2A 2QWSA 3KYQA 4FD8A 2PYRA 5CERA 2E8JA 1CQAA 2IWCA 3EQUA 2DCFA 2KX6A 1PI4A 2D01A 3IT9A 4R70A 3RTYA 1OT9A 4S2OA 1LSWA 4QPRA 3SOIA 1N4OA 5EM1A 1TS0A 4GLQA 3IXBA 3L7HA 1ZC2A 3NIAA 1D06A 3ICYA 3W4QA 4C6YA 1LI9A 4WEKA 3K3CA 1PZOA 3LIDA 1U60A 4DJ2A 4KUOA 4WN5A 4OLDA 1XP4A 2J3TD 5FQJA 2XA7S 3IF5A 3KSHA 3IS2A 3IQAA 4S2MA 3TJZC 1YKDA 5A90A 1KE3A 1ZTUA 1IELA 3BW6A 4XXRA 3VE3A 3C7VA 3GQZA 2HP5A 1PWDA 3GV9A 3UN7A 1ES4A 4HH3A 5HDCA 3EGDC 1CI9A 3OPLA 4C3QA 3CUEC 4R38A 1AWIA 4DDSA 1G6AA 4II7A 4YWZA 2G7UA 5HAIA 2Y2GA 3DTEA 1MWSA 3LI9A 3CWFA 4PM7A 5HPFA 1BULA 3KSIA 2V0UA 1S4SA 5DJTA 3BY8A 2PYPA 3PBSA 1KGGA 2WGVA 2XROA 2QHKA 5FDSA 1DJCA 2J7VA 5FI2A 4EBPA 4ETZA 3BY9A 4OPQA 1PZPA 1XGIA 4HQAA 4HP4A 3HVFA 5EVIB 3UE0A 4BJPA 4NKPA 3MMHA 3VSLA 3MZFA 4OVDA 1F2KA 2B18A 2PD7A 1P9RA 2HV1A 3CG5A 3S7PA 4HI4A 1KGEA 4PM8A 3VFHA 3N8LA 3P09A 4P87A 4A5RA 4NG2A 4JLFA 4FCFA 3A3IA 1XGJA 3LR0A 1K57A 4N1XA 3ZGAB 2Y2OA 1S67L 4WM9A 2JCHA 1XKZA 3A0RA 3A3EA 3NY4A 3HUMA 4LV0A 1C3BA 1Z6FA 4M4XA 2ZL1B 4PMAA 3L9KA 4Q0HA 2WKRA 1OTEA 2Z2LB 4GNUA 3F1NA 2WKPA 4EU0A 4UA6A 4N92A 4R0QA 3PBQA 2K2NA 2P74A 1YPRA 1IEMA 3LEQA 1V9ZA 4F3LB 4DKIA 5CHMA 4EXOA 1ES5A 4GJ4A 3TOIA 3HUOA 4DE2A 1I2SA 4P85A 1ZG6A 4LV3A 2VEAA 3FPVA 4G3KA 4WZ5C 4UEYA 2V8CA 2HP9A 2OV5A 4GW9A 5AQAA 4P6ZS 3NOTC 1TVFA 3D9YA 5EUAA 4QWOA 1RP5A 1GHMA 5F1FA 5GLCA 4S2IA 4E3NA 4U3TA 1Q2PA 1Y4OA 3D4FA 5IT5A 4RX3A 3VP1A 2HDQA 1K56A 4E3KA 1K54A 4K0WA 3CLOA 3VP4A 2HJEA 3OPHA 3P7NA 1PRQA 3T12B 4BLMA 4E3MA 1G28A 4IVKA 4X6TA 4B9OA 4EUVA 1W7FA 2H0TA 5DF9A 4LPZA 4KUKA 4MBFA 3WS5A 2Y2PA 3PHYA 1NRFA 2FZ0A 3ZNYA 3HCYA 3G34A 1W8QA 1IYQA 2A49A 2P9VB 4QD4A 3DWZA 4F3LA 4GD6A 2OSUA 1ERMA 2WGWB 3OOVA 4WZ4A 2QMIA 2ZQ8A 3UPNA 3IXGA 2MJ6A 3QP4A 3BM6A 2XK1A 3UDFA 3MJQA 5GHZA 3IBRA 4GN2A 2G2UA 1VETA 3IXHA 4R23A 5EVLA 3VOZA 4GHIA 2ZJ9A 2C5WB 3VSKA 3B33A 3WS1A 4X55A 4L9EA 4IVIA 4N9KA 3QP1A 1T1AA 2NUTC 4B93A 3ZFZA 4BBUA 1FSYA 2UV0E 3BYDA 3IBJA 2R78A 1E3UA 3F1PB 1K57C 3KYEA 3OZHA 4H6JB 4X68A 2HZ5A 2XA7M 1VETB 1DP9A 4GCZA 4KZ9A 4OONA 4P6BA 3N8SA 1W63Q 4KQOA 3SH9A 1YSPA 3OLOA 1XJ2A 1YM1A 3OPRA 5HWTA 2ZQDA 3DAVA 4ARZB 2M1CA 1RGZA 3S4XA 5DTSA 5I94A 1BLSA 2JKFA 1LI0A 3WS2A 3R4KA 1DJBA 4HJ4A 2M7VA 3UMDA 3VP3A 1LL9A 5TGFA 1M6KA 4OLGA 2QKPA 2H10A 5E2FA 1PIOA 3P98A 4ETXA 5CXWA 2XGNA 2ZL1A 5DF7A 4QY5A 3QP6A 4IHQA 3O87A 3HBRA 4U0XA 2ZOHA 2XD1A 1DJAA 1P0ZA 1SZVA 3T4SA 2GZAA 4WBGA 3QNBA 5I5LA 3S7NA 3NDEA 2ZQ7A 1XFNA 2Q9MA 4MEZA 5F6AA 5IHVA 4IBRA 4OPZA 1IYOA 2J3WA 3GMWA 1HD8A 5KSCA 5F1GA 2HDRA 1PWCA 5E43A 3B42A 3CJMA 4WUJA 5DTTA 4R3JA 2WYXA 3E4QA 4KG2A 3BQAA 5HAPA 3M6HA 5FA7A 5CTNA 2WKHA 4BD1A 1K25A 4FUWA 4DDYA 2ZC3B 3PAGA 1CEFA 3C7UA 5DKLA 4UA7A 4Y0UA 1E25A 2V20A 3ZHHA 2Y2KA 4Y7PA 2O99A 4Q0IA 3C8CA 4JGRA 2PU2A 4HEFA 1CEGA 3G6OA 3KYZA 1N9NA 4K91A 2ZBBA 2Y55A 3RJUA 2J9OA 2W1TB 4OQHA 4OOLA 2BASA 3CUEA 1JWVA 5C5KA 3T4TA 4EEPA 4JGQA 3DTKA 2IA2A 3JVUA 3AGEA 3VP2A 2PHYA 1VHMA 3UO9A 1CJFA 4E3LA 5AVFA 4Z9QA 3K2NA 3HLWA 4GB7A 1F98A 2UWXA 3MQQA 1OJGA 4Q8IA 3UPOA 1LSVA 4KZ7A 4DMZA 4UQIS 3S1YA 3BJNA 1MWUA 3PAEA 5FI6A 4CLCC 3CMZA 3Q07A 2HP6A 4BMWA 1W79A 5CGSA 1N9LA 3QP5A 5A91A 3H9WA 5A8BA 1EWZA 4JF6A 4I39A 3GTCA 4E3JA 5EOOA 4NXFA 2VLGA 1SCWA 2JKRM 3T1SA 5HAQA 1ESIA 3IXDA 2K31A 4OOMA 2V1BA 4WELA 4Y3IA 4JF5A 2Q9NA 3PR6A 3T4QA 2JHEA 5DKKA 3WRZA 1ES2A 4HJ6A 2ZC6B 3M6BA 1CK3A 1FSWA 1A0KA 4DE0A 1K6RA 2GJ3A 2LB9A 1FIKA 1TS6A 5L09A 5CEBA 1T1BA 5IU1A 4MN7A 1S0WA 3E4OA 3HLEA 4RA7A 4EV4A 3EOIA 2HJ9C 1XA1A 3V39A 1OPXA 2V8FA 3LI8A 4DE3A 2Z6DA 5DF8A 4KZ5A 4X53A 2EX6A 3W4PA 3FKWA 2ZM8A 3JVVA 5M19A 2B02A 4RVAA 1K56D 4O7DA 3FKVA 1MKMA 4PM6A 5EE8A 1TEMA 1K54C 3PYPA 2ZMFA 3BFGA 3ULFA 2Z2MB 4HIAA 1K4FA 2O9AA 2HDSA 5J3WA 5CGXA 1NLYA 5HWWA 2I72A 3LY4A 3DW0A 3Q1FA 3T50A 3TSGA 5U47A 4OKPA 2WADA 2ZMVA 1L2SA 3FZCA 3LR5A 1YMSA 4LCMA 3Q82A 4K08A 3T1XA 2JKTI 4EWFA 4Y0TA 1UWNX 2Z6CA 2PBYA 2H28A 3B3XA 1MWTA 3MZEA 4KZ6A 1N9BA 4MNRA 2B5RA 3IWOA 3Q7ZA 3ZG5A 3HLBA 1DP6A 1G68A 1F9IA 2Y2NA 5FQQA 2OAP1 1YLWA 5HWVA 2INWA 3SH8A 5FAQA 4JXWA 4S2LA 3RXXA 4LFUA 5CHUA 2V1ZA 3A3DA 1VM1A 5FAOA 2H0YA 3CI6A 4EEUA 2J8YA 2VGLM 1BT5A 2JC7A 4KZ8A 3UB7A 5HARA 2XFSA 3HLDA 2GX5A 4KQRA 3S7QA 2W3EA 2P08A 4I5SA 1Q2QA 4IUHA 4BQMA 4CLCA 5CECA 3H7WA 4N1HA 1FOFA 2WKIA 3ITAA 2XRNA 5HL1A 3IHBA 1M40A 1ONGA 2W3DA 5AQ7A 5E2GA 5FI7A 1VB6A 2VZWA 3G31A 4GZBA 3QHYA 3CPTB 2XD5A 3NJAA 2XR0A 1FQGA 3IF6A 4I3JA 3MXRA 1GSVA 5TBMB 2L0WA 3NI9A 2VGJA 3ZNTA 3I7JA 2KLIA 1BTLA 5KSHA 1FILA 5AVEA 5GL9A 1L0FA 4MMNA 3MXSA 3UDIA 4S2NC 4CQHA 4R1GA 3UB6A 4QJGA 2EWWA 1K0KA 1XFQA 3T1QB 1X0OA 3BFCA 4WMCD 2W27A 3HJIA 5FEFA 5J7EA 2W3GA 4Y5FA 3BECA 4NXGA 3LEZA 1NYYA 4HOIA 4EQIA 1Z09A 4NXBA 3BFFA 3E4PA 3ZG7B 3UE1A 3C4OA 1KVLA 2Y2HA 3LY3A 3O86A 1TS8A 2EX9A 1D1JA 2PBDP 1MZUA 3FWLA 2ZQAA 5FDHA 1MC0A 3NOPC 3GSGA 5EV0A 1IFQA 2ZOIA 2W1RA 4XUZA 1ACFA 2L4RA 1XX2A 2X01A 4OP5A 3BFDA 5DFXA 5HL6A 5GLDA 5E2EA 3TG9A 4RYEA 4HHDA 2VGLS 2VGKA 5HD3A 1XXMA 5FSRA 2ZC4B 5GLAA 4E6WA 1FCMA 1ODVA 3MQOA 1K55A 4MBKA 5HD5A 4JGPA 3PBNA 5JYPA 1EI5A 3MKEA 1ERQA 4X69A 2V1AA 3LIBA 4JPMA 2HGVA 4GD8A 1O7EA 2HF6A 2Y91A 1BZAA 1BLPA 1KDSA 4MBHA 4X1LA 3LIEA 3MZDA 4CJNA 2J80A 3RH8B 1OT6A 3BQ8A 3C4PA 2ZM0A 2EWVA 3MBZA 2XLNA 2W0NA 4E3IA 1AXBA 3LIAA 2JKRI 2Q0OA 4Y13A 2DRWA 4F94A 3UPPA 4O01A 1P97A 4D60A 1NZUA 2PD8A 1KE0A 1UGUA 5HDDA 3HLGA 1KVMA 3E0YA 1T19A 3T4JA 1SKOB 3MFXA 3N7WA 4PAUA 1W63M 2VJWA 2BTFP 5DVAA 4Y0OA 4DXBA 4ESPA 4ZAMA 4LGWA 3GRJA 1NLZA 4YFMA 4HY8A 5GHXA 4KZ3A 2ZLYA 3WRTA 3C2WA 5EM0A 1WYCA 4DRTA 2PDRA 3IX4A 3LICA 1YLTA 2R9XA 2IWDA 1L0GA 1F5MA 2Y8HA 1ALQA 2HDUA 4KG5A 4EESA 2PR6A 1MWRA 4B88A 4HESA 5FEGA 4KQDA 5FQKA 1YAXA 4FOFA 1HTZA 3B47A 4OOYA 4BL2A 5M1AA 1QMFA 1ONHA 2ZC7A 3HLCA 5A92A 4OH0A 3N8RA 4RQ9A 5CRFA 3E2KA 1DY6A 1V9YA 2EX8A 3HREA 3OPPA 2J9PA 2Y2MA 1HZOA 4ZTKA 3NCKA 1JNUA 5CHJA 2WK0A 2P9VA 3LCEA 3VV4A 1OJ5A 1YLPA 3G4PA 2G2WA 1YT4A 1BLHA 3SS4A 2KDKA 1GSWA 1QMEA 3U2AA 2BLSA 1JVJA 2WAFA 1GHIA 4IJGA 3UY6A 2WKEA 3CZDA 1WE4A 1KE4A 1GHPA 4JKTA 3EGXC 2Y59A 3MS6A 2OAQ1 4MCWA 2Y2JA 2WGWA 2VA0A 4LRXC 1SKFA 1W5DA 4JXGA 4QU3A 3LFVA 1Y54A 4LRYC 4PKYA 4Y15A 1GA9A 4I38A 4ME4A 3IX8A 3GECA 2VV8A 5TR7A 2VV6A 4DF6A 3EEHA 2A24B 4R4RA 1UWPX 5AJGA 3SS5A 1NRJA 1S4RA 2XQZA 1BLCA 4JGOA 5KIZA 1RGYA 1FCOA 2XFTA 4X56A 2B95A 5HX9A 3QP2A 5G18A 1TDLA 3LIFA 3ZQ5A 5HDSA 4BL3A 2ACGA 2PT7A 5GHYA 2V9AA 2H5SA 3LYXA 5EECA 4WEJA 1STZA 1ZKJA 4QY6A 4M3KA 4IBXA 4OP8A 4QHCA 5CTMA 1WA9A 1L0EA 2OWJA 2A3UA 4KZ4A 3NHQA 4L9FA 3G35A 4L0LA 2OLVA 1H8YA 4O0PA 2V2FF 5JYOA 2RCXA 1ZG4A 3OCLA 2VX8A 2CMNA 3FG8A 3IH9A 3PBRA 3DTMA 4I3IA 5DFYA 2P04A 1IOUA 1PNEA 4BENA 3UDXA 1JTGA 3ZG9B 4GDBA 5EVIC 1VEUA 4LENA 3JPUA 1E4DA 4U0TA 4GKUA 3HJKA 5M18A 1E3UD 3T4LA 1BUEA 1GSXA 3NULA 1SDNA 2EX2A 2QYBA 1TS7A 1LL5A 4P6ZM 3UB9A 1TDGA 4C75A 3IWQA 2EFXA 2JKTM 5EFWA 1OTBA 2W3FA 3T4OA 4KZAA 5FL3A 1JTDA 4DN0A 3K3DA 2ZQCA 4KENB 2V0WA 2Y2IA 4NEED 2XDMA 1O07A 3Q7VA 1YQSA 5F5YA 5TFQA 3C30A 4X25A 1I5QA 2EFUA 1NXYA 4IUKA 3MKFA 5GLBA 1XJ3A 3F1PA 2GNXA 3AGFA 1H3QA 3NOUC 4NETA 5FATA 3KX0X 4EQ1A 5L10A 4EERA 4JXSA
chains in the Genus database with same CATH topology
2XA7M 5KSHA 2KOIA 3O5YA 4FSFA 5AVEA 1DP9A 2JN7A 4GCZA 4MMNA 4PKYG 1BYWA 1W63Q 4KQOA 1YSPA 3OLOA 1XJ2A 4CQHA 5IS1A 5HWTA 4ARZB 2M1CA 3UB6A 2W3HA 2EWWA 2A24A 1XFQA 3S7OA 3T4KA 3MR0A 4WLAA 1X0OA 3UE6A 5DJUA 2W27A 3HJIA 3EWKA 3R4KA 5J7EA 4ARZA 2W3GA 4Y5FA 4HJ4A 4NXGA 2M7VA 3MXQA 2NUPC 3UMDA 4HOIA 2YKHA 4NXBA 2O9CA 2LB5A 2QKPA 3E4PA 4ETXA 4HH2A 3C38A 4DJ3A 1OTDA 3TW8A 1D7EA 4IHQA 3RFBA 1TS8A 2VV7A 1MZUA 2ZOHA 2FH5A 1MC0A 3NOPC 3LR4A 1G6OA 1IFQA 2ZOIA 2W1RA 1P0ZA 2OOLA 3T4SA 1P9WA 2GZAA 2L4RA 5DFXA 5HL6A 5I5LA 3S7NA 3CAXA 3OCNA 1DRMA 1XFNA 4EW7A 4BBVA 4HHDA 4CLCE 2VGLS 3LR3A 5F6AA 5HD3A 3EQVA 2J3WA 4YOFA 5L8MA 3B42A 1ODVA 3MQOA 4WUJA 2Y79A 4I3AA 1XJ4A 1TD5A 5HD5A 4JGPA 3PBNA 3MF0A 3FPWA 2V1AA 3MQ0A 3LIBA 3F1OA 2HGVA 1NWZA 3E4QA 3A0VA 2HF6A 3BQAA 3LUQA 3IS2B 4BBTA 3KSGA 2OWHA 3E98A 5HPIA 4R3AA 3LIEA 1OTIA 2L1MA 3OBFA 2J80A 3RH8B 1OT6A 3BQ8A 5DKLA 2EWVA 3H82A 5LBRA 3H82B 2W0NA 4WL9A 1KOUA 4Q0JA 2O99A 3LIAA 2JKRI 3OC2A 4Q0IA 3C8CA 2QWSA 3KYQA 4JGRA 2PYRA 2P7JA 4EETB 4O01A 1P97A 3EQUA 3G6OA 3KYZA 4HJ3A 1N9NA 2PD8A 2ZBBA 2KX6A 2D01A 5F68A 1UGUA 4R70A 4YNRA 5HDDA 3RTYA 1OT9A 2W1TB 3E0YA 1LSWA 4OOLA 1T19A 4QPRA 2BASA 3T4JA 3MFXA 3SW1A 2WKQA 3CUEA 1TS0A 5C5KA 3T4TA 4PAUA 4GLQA 1W63M 2VJWA 4EEPA 4JGQA 1D06A 2IA2A 3ICYA 3JVUA 1NLZA 2PHYA 4WEKA 1VHMA 2O9BA 3K3CA 4HY8A 3BWLA 1EW0A 1LSXA 3LIDA 3PBTA 4DJ2A 5AVFA 3C2WA 4KUOA 3PBOA 2PDRA 3LICA 4WN5A 3K2NA 1F98A 3MQQA 2J3TD 4GHIB 4Y2FA 1OJGA 5HZHA 1LSVA 2XA7S 3KSHA 4DMZA 1F5MA 2Y8HA 3IS2A 4UQIS 3TJZC 1YKDA 1ZTUA 3BJNA 4EESA 2DMWA 4CLCC 3BW6A 2PR6A 2QJ5A 2QJ7A 3VE3A 4BMWA 4KQDA 3V67A 1N9OA 1N9LA 1YAXA 4FOFA 4HH3A 4HP9A 3UMEA 3B47A 3W2ZA 5HDCA 3EGDC 3H9WA 3H7WB 5A8BA 4GS9B 4HNBA 4CLCB 1S1ZA 3FC7A 4I39A 3CUEC 4R38A 4Z1WA 4II7A 4NXFA 2G7UA 2VLGA 4RQ9A 4YWZA 2JKRM 3VE4A 2K31A 1V9YA 4OOMA 2V1BA 3LI9A 3CWFA 5HPFA 4WELA 3A0SA 3KSIA 2V0UA 3EEAA 1S4SA 3KSFA 4Y3IA 5DJTA 3BY8A 1JNUA 2PYPA 3PBSA 2XROA 2QHKA 3VV4A 1OJ5A 3PR6A 1S66L 3T4QA 4R6LA 2JHEA 5DKKA 4ETZA 1Y28A 3BY9A 4HJ6A 4HQAA 2KDKA 4HP4A 1GSWA 3U2AA 4UQIM 2GJ3A 2LB9A 4BJPA 4NKPA 4IJGA 3MMHA 1TS6A 1T1BA 2B18A 2PD7A 2D02A 3EGXC 5IU1A 1P9RA 4CLCD 2HV1A 3VOLA 4HI4A 3S7PA 4MN7A 5CX7A 5G4YA 2OAQ1 4MCWA 3E4OA 5J4EA 2VA0A 4LRXC 4G3WA 3EOIA 1XJ6A 2HJ9C 1OPXA 3DBAA 4EERA 3LR0A 3LI8A 2Z6DA 5F69A 3LFVA 4AFIA 1S67L 4LRYC 3R7WB 3A0RA 4H6JA 4PKYA 3JVVA 4I38A 1YSQA 4ME4A 2B02A 3GECA 2VV8A 2VV6A 4M4XA 1MKMA 3EEHA 2A24B 4Q0HA 2O0YA 2WKRA 1UWPX 3TE8A 1OTEA 5AJGA 1NRJA 1S4RA 3F1OB 4GS9A 3F1NA 2WKPA 4EU0A 3PXPA 4PHTA 3PBQA 4JGOA 3PYPA 2K2NA 4O8GA 5KIZA 1S1YA 2W1TA 2ZMFA 3UB8A 1V9ZA 3ULFA 4HIAA 4BWIA 4F3LB 2A2LA 3CITA 4EXOA 2O9AA 5J3WA 4GJ4A 3LIFA 5TJJA 1NLYA 3ZQ5A 5HWWA 4ZRRA 5HDSA 3D72A 3T50A 2VEAA 2XSSA 1TF1A 3FPVA 4G3KA 2PT7A 4UEYA 2V9AA 1T1CA 4GW9A 4LRZE 2ZMVA 3LYXA 4WEJA 1STZA 3LR5A 4XT2A 4P6ZS 3NOTC 4K08A 2JKTI 2VKSA 1OTAA 1UWNX 2Z6CA 2H28A 4XT2B 1WA9A 2OWJA 1LL8A 5IT5A 3NHQA 4G3VA 4L9GA 4MN5A 4L9FA 3TRCA 4L0LA 4O0PA 2I9VA 1DP6A 1F9IA 3CLOA 3OCLA 2VX8A 2CMNA 3FG8A 2HJEA 2PR5A 2M7UA 3P01A 3PBRA 4I3IA 3R7WA 2OAP1 3P7NA 5DFYA 2P04A 1IOUA 5HWVA 2INWA 1G28A 4B9OA 2EA9A 2K7SA 1ZHHB 3GDIA 4E04A 3CI6A 4EEUA 4EUVA 5DF9A 4LPZA 4KUKA 4LLOB 3HJKA 2VGLM 3KO6A 3PHYA 3T4LA 1GSXA 2FZ0A 3HCYA 2QYBA 1TS7A 5HSQA 3UB7A 4P6ZM 4F3LA 3UB9A 2GX5A 3S7QA 2W3EA 2P08A 4I5SA 3OOVA 2JKTM 5EFWA 5K5BA 4IUHA 1OTBA 4CLCA 2W3FA 3T4OA 3H7WA 2MJ6A 1DP8A 5TBMA 1T18A 5FL3A 2XRNA 3MJQA 5MC7A 3IBRA 2W3DA 4DN0A 4WF0A 2J3TC 3K3DA 3ZYTA 2V0WA 1VB6A 4NEED 4GHIA 2VZWA 3B33A 5F5YA 1LT0A 3NJAA 4MDZA 3F1NB 4MN6A 4NXEA 2YKFA 4L9EA 3C30A 1T1AA 2NUTC 4B93A 4BBUA 4I3JA 4IUKA 1GSVA 1XJ3A 2L0WA 3F1PA 3IBJA 1H8MA 2GNXA 2R78A 5TBMB 3UE3A 3F1PB 1H3QA 3NOUC 3KX0X 2KLIA 4EQ1A 4H6JB 3D3OA 5G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0S A;  2V0U A;  4K08 A;  1S4S A;  5AVE A;  1DP9 A;  2JN7 A;  5DJT A;  1OTA A;  3BY8 A;  3H82 A;  4GCZ A;  1JNU A;  1UWN X;  2PYP A;  4PKY G;  2Z6C A;  2W0N A;  1BYW A;  2H28 A;  3H82 B;  1KOU A;  1WA9 A;  4WL9 A;  4XT2 B;  3OLO A;  2OWJ A;  2QHK A;  3LIA A;  1XJ2 A;  3C8C A;  2QWS A;  1LL8 A;  1OJ5 A;  4JGR A;  5IS1 A;  3NHQ A;  1S66 L;  4L9G A;  2PYR A;  4L9F A;  4MN5 A;  5HWT A;  4R6L A;  2JHE A;  5DKK A;  2M1C A;  1Y28 A;  2P7J A;  3BY9 A;  3UB6 A;  4HJ6 A;  4EET B;  2A24 A;  2I9V A;  1DP6 A;  1XFQ A;  4HQA A;  2KDK A;  3MR0 A;  4HP4 A;  1F9I A;  4WLA A;  1X0O A;  3CLO A;  1P97 A;  1GSW A;  3G6O A;  2CMN A;  3FG8 A;  4HJ3 A;  3UE6 A;  1N9N A;  5DJU A;  2PR5 A;  2PD8 A;  2W27 A;  2GJ3 A;  3HJI A;  3EWK A;  5J7E A;  2ZBB A;  4I3I A;  4HJ4 A;  2KX6 A;  4NXG A;  3P7N A;  3MXQ A;  2D01 A;  5F68 A;  4HOI A;  1UGU A;  4R70 A;  3UMD A;  5HDD A;  1TS6 A;  3RTY A;  1OT9 A;  5HWV A;  2INW A;  1LSW A;  1T19 A;  2YKH A;  1G28 A;  2BAS A;  3MFX A;  1T1B A;  4NXB A;  2WKQ A;  3SW1 A;  4B9O A;  2PD7 A;  1TS0 A;  2EA9 A;  2D02 A;  2QKP A;  5IU1 A;  2HV1 A;  3VOL A;  3E4P A;  4HI4 A;  4EEP A;  4JGQ A;  5G4Y A;  2K7S A;  3GDI A;  4HH2 A;  1D06 A;  4E04 A;  3E4O A;  4EEU A;  3ICY A;  5J4E A;  4LRX C;  4DJ3 A;  1OTD A;  2PHY A;  1D7E A;  4LPZ A;  4KUK A;  4LLO B;  1XJ6 A;  3HJK A;  1TS8 A;  3K3C A;  3PHY A;  4HY8 A;  3BWL A;  2VV7 A;  4EER A;  1GSX A;  1MZU A;  1EW0 A;  3LI8 A;  1LSX A;  2Z6D A;  5F69 A;  3LID A;  2ZOH A;  1S67 L;  1TS7 A;  4LRY C;  4DJ2 A;  3A0R A;  4H6J A;  3NOP C;  4PKY A;  5AVF A;  3UB7 A;  3C2W A;  5HSQ A;  4KUO A;  4F3L A;  4I38 A;  2PDR A;  3LIC A;  4WN5 A;  3UB9 A;  2ZOI A;  2B02 A;  1P0Z A;  3GEC A;  2OOL A;  2VV8 A;  1F98 A;  3MQQ A;  4GHI B;  5HZH A;  1OJG A;  2L4R A;  2VV6 A;  4M4X A;  1LSV A;  3EEH A;  2A24 B;  4I5S A;  5EFW A;  3IS2 A;  2WKR A;  1UWP X;  1OTE A;  5I5L A;  3CAX A;  1DRM A;  1OTB A;  1XFN A;  1S4R A;  3F1O B;  4BBV A;  4EW7 A;  4GS9 A;  3F1N A;  4HHD A;  2WKP A;  3H7W A;  1DP8 A;  5TBM A;  1T18 A;  4JGO A;  5F6A A;  5HD3 A;  3PYP A;  3MJQ A;  4EES A;  5KIZ A;  1S1Y A;  3IBR A;  2PR6 A;  2QJ5 A;  1V9Z A;  2QJ7 A;  3UB8 A;  3ULF A;  4HIA A;  3VE3 A;  4F3L B;  4KQD A;  4WF0 A;  3K3D A;  1ODV A;  3MQO A;  1N9O A;  4WUJ A;  2V0W A;  4EXO A;  5J3W A;  4I3A A;  1XJ4 A;  1N9L A;  1VB6 A;  3LIF A;  4GHI A;  5HD5 A;  3ZQ5 A;  5HWW A;  4JGP A;  4HH3 A;  3B33 A;  4HP9 A;  5F5Y A;  5HDS A;  1LT0 A;  3UME A;  3D72 A;  2V1A A;  2VEA A;  5HDC A;  3NJA A;  3T50 A;  3H9W A;  3H7W B;  3LIB A;  5A8B A;  3F1N B;  4GS9 B;  4HNB A;  4MN6 A;  2YKF A;  3F1O A;  4NXE A;  4L9E A;  1NWZ A;  1S1Z A;  3E4Q A;  3A0V A;  3FC7 A;  4I39 A;  1T1A A;  3IS2 B;  3LUQ A;  4R38 A;  4I3J A;  2V9A A;  4BBU A;  1T1C A;  4GW9 A;  4BBT A;  4LRZ E;  2OWH A;  3LYX A;  4NXF A;  2VLG A;  4R3A A;  1GSV A;  1XJ3 A;  2L0W A;  3F1P A;  4RQ9 A;  4YWZ A;  2R78 A;  3LIE A;  5TBM B;  4XT2 A;  1OTI A;  3F1P B;  2L1M A;  3VE4 A;  1V9Y A;  3NOU C;  3KX0 X;  2J80 A;  3NOT C;  3RH8 B;  1OT6 A;  4H6J B;  4EQ1 A;  2V1B A;  5DKL A;  3LI9 A;  3CWF A;  5G4Z A; 
#chains in the Genus database with same CATH topology
 3O5Y A;  2HPB A;  4GDN A;  3VOY A;  4BD0 A;  4PKY G;  1BYW A;  3G30 A;  4QB8 A;  3QP8 A;  3BLM A;  5D3O A;  3V3S A;  4CPK A;  3CPT A;  3S7O A;  3MR0 A;  3T4K A;  4WLA A;  3VMA A;  5DJU A;  3NEC A;  3EWK A;  4R3B A;  2NUP C;  5HW3 A;  1PW1 A;  4ZJ1 A;  2WZZ A;  2O9C A;  1FR1 A;  4EBN A;  2ZQ9 A;  4JF4 A;  2E8I A;  4HH2 A;  4Y17 A;  1JWZ A;  4DJ3 A;  1OTD A;  3TW8 A;  1D7E A;  1H8Z A;  3SS3 A;  3IWI A;  3ZDJ A;  2VV7 A;  1JWP A;  1GCE A;  2Y2L A;  3LR4 A;  1I2W A;  2PU4 A;  1P9W A;  4XUX A;  4S2K A;  3CAX A;  1L0D A;  1DRM A;  3FV7 A;  5AQ9 A;  4EW7 A;  4BBV A;  1S6R A;  4S2P A;  4CLC E;  3LR3 A;  3EQV A;  4YOF A;  4JXV A;  1RCJ A;  5L8M A;  3CHW P;  1XJ4 A;  3JYI A;  1TD5 A;  1IYS A;  3MF0 A;  4PM9 A;  3A3J A;  3FPW A;  5F82 A;  2XF3 A;  4JBF A;  1NWZ A;  3A0V A;  1K38 A;  3ITB A;  3IF6 B;  5KMW A;  4BBT A;  2OWH A;  4WMC A;  4R3A A;  4EUZ A;  3DWK A;  1OTI A;  3OBF A;  1J3W A;  2PRF A;  5FQI A;  1MPL A;  2Y4A A;  1ESU A;  1KOU A;  4Q0J A;  5L2F A;  2AVX A;  3WWX A;  2P7J A;  4EET B;  2ZD8 A;  4KG6 A;  4HJ3 A;  5EVE A;  4UAA A;  1SDE A;  5F68 A;  4YNR A;  3SW1 A;  2WKQ A;  2DNS A;  3IX3 A;  1HVB A;  5FAS A;  4UA9 A;  1PFL A;  3HL9 A;  4E3O A;  1FCN A;  3G2Z A;  2O9B A;  3BWL A;  3S22 A;  1EW0 A;  3VP0 A;  1LSX A;  3ISG A;  3LGO A;  3PBT A;  2EXA A;  1L3L A;  3G32 A;  3HUN A;  3PBO A;  4OQ0 A;  1OME A;  4GHI B;  4Y2F A;  5HZH A;  5EVI D;  4P0M A;  1NYM A;  1YMX A;  4DXC A;  4FH2 A;  1FR6 A;  1PI5 A;  1LLB A;  3IF6 C;  3HLF A;  1SKO A;  3UNW A;  2DMW A;  2QJ5 A;  1IKG A;  2QJ7 A;  4PPR A;  3V67 A;  1N9O A;  4KQQ A;  1IKI A;  3LO7 A;  3V3R A;  4HP9 A;  3UME A;  5DTK A;  3W2Z A;  3H7W B;  4GS9 B;  3DTI A;  4HNB A;  4CLC B;  1S1Z A;  3FC7 A;  4S2N A;  4HBU A;  4N9L A;  4Z1W A;  1VEU B;  1W8Y A;  3VE4 A;  4D2O A;  3NDG A;  1XA7 A;  2RL3 A;  3O3V A;  3A0S A;  3W4O A;  3EEA A;  3KSF A;  2WZX A;  4LCL A;  4B4X A;  1S66 L;  3GR2 A;  4R6L A;  1Y28 A;  3NBL A;  2JBF A;  1G5U A;  3GVB A;  4UQI M;  1PW8 A;  3NC8 A;  3RXW A;  4S2J A;  1J9M A;  2FFF B;  2D02 A;  2QPN A;  4CLC D;  4RX2 A;  2XH9 A;  3VOL A;  3WS0 A;  1KGF A;  5CX7 A;  5FQ9 A;  5G4Y A;  3N6I A;  4ZDX A;  5J4E A;  2EXB A;  4KZB A;  4G3W A;  1XJ6 A;  1K4E A;  3MSH A;  3DBA A;  3V5M A;  5F69 A;  4AFI A;  4HBT A;  5FAP A;  3QNC A;  3R7W B;  4H6J A;  1YSQ A;  5EOE A;  4WYY A;  3M2K A;  2O0Y A;  3TE8 A;  3W8K A;  5KZH A;  3F1O B;  4GS9 A;  3PXP A;  4PHT A;  4H8R A;  3N4I A;  4O8G A;  1MBL A;  1VQQ A;  1S1Y A;  2W1T A;  1LHY A;  3UB8 A;  4ZJ2 A;  4BWI A;  1XPB A;  1H5X A;  2A2L A;  2OLU A;  3CIT A;  5TJJ A;  4YIN A;  3Q7V B;  4ZRR A;  3D72 A;  1WYB A;  2XSS A;  1TF1 A;  5J8X A;  1BSG A;  1T1C A;  1CF0 A;  4LRZ E;  5HFO A;  4XT2 A;  4MLL A;  4X1M A;  5L07 A;  1MKI A;  2C6W B;  2VKS A;  1OTA A;  4XT2 B;  1NJ4 A;  1LL8 A;  2ZM2 A;  4G3V A;  4L9G A;  4MN5 A;  3TRC A;  4OPY A;  3U4L P;  2I9V A;  5CED A;  1H0M A;  2PR5 A;  2M7U A;  4NK3 A;  3P01 A;  3R7W A;  4K0X A;  1IYP A;  4LV1 A;  3BFE A;  2EA9 A;  1YLJ A;  2K7S A;  1ES3 A;  1ZHH B;  5CGW A;  3GDI A;  4E04 A;  3M2J A;  1MXO A;  1PWG A;  4FTX A;  3E2L A;  4LLO B;  4OPR A;  2PAV P;  3KO6 A;  3A3F A;  1YLZ A;  3PTE A;  4UHU A;  5EPH A;  4B4Z A;  2X02 A;  4R4S A;  5HSQ A;  4IED A;  4ID4 A;  1CI8 A;  3O88 A;  5K5B A;  3BLS A;  1DP8 A;  5TBM A;  1T18 A;  4DE1 A;  3ZVW A;  5MC7 A;  4WF0 A;  2J3T C;  3ZYT A;  3ZCZ A;  3SH7 A;  4E6X A;  1LT0 A;  4MDZ A;  3F1N B;  4MN6 A;  4NXE A;  2YKF A;  3IHA A;  2JE5 A;  4WZ5 A;  2CC1 A;  3Q81 A;  3UE3 A;  1HLU P;  1H8M A;  5FQM A;  5E2H A;  3D3O A;  4PM5 A;  5G4Z A;  2KOI A;  4FSF A;  2QZ6 A;  2JN7 A;  1KDW A;  1K55 C;  1SHV A;  3G2Y A;  4ZBE A;  4OQG A;  5IS1 A;  4ZJ3 A;  2W3H A;  3SZT A;  2A24 A;  3ZG8 B;  2ZMA A;  2R9W A;  3ZG0 A;  2VK3 A;  3UE6 A;  3AGD A;  4ARZ A;  1NZO A;  3IH8 A;  3MXQ A;  2YKH A;  2LB5 A;  2WUQ A;  1PYY A;  3C38 A;  1YLY A;  3RFB A;  2BG1 A;  2IWB A;  3BRM A;  2Y2Q A;  5A93 A;  2XEP A;  2FH5 A;  3ZVT A;  1G6O A;  2WGI A;  2GDN A;  3MFD A;  4EBL A;  2OOL A;  1MY8 A;  5BOH A;  3VFF A;  2ZC5 B;  5F83 A;  3OCN A;  5AQB A;  5EVI A;  4FH4 A;  3T1R A;  3BEB A;  3C5A A;  4GOG A;  2Y79 A;  1K6S A;  4I3A A;  2WAE A;  3MQ0 A;  3WS4 A;  2JKG A;  3F1O A;  3FYZ A;  3LUQ A;  3IS2 B;  3KSG A;  1NY0 A;  3E98 A;  5HPI A;  3UB5 P;  1GA0 A;  4OQI A;  2L1M A;  2X71 A;  1ERO A;  2FFY A;  3H82 A;  3V50 A;  5LBR A;  3H82 B;  4WL9 A;  4LV2 A;  3OC2 A;  2QWS A;  3KYQ A;  4FD8 A;  2PYR A;  5CER A;  2E8J A;  1CQA A;  2IWC A;  3EQU A;  2DCF A;  2KX6 A;  1PI4 A;  2D01 A;  3IT9 A;  4R70 A;  3RTY A;  1OT9 A;  4S2O A;  1LSW A;  4QPR A;  3SOI A;  1N4O A;  5EM1 A;  1TS0 A;  4GLQ A;  3IXB A;  3L7H A;  1ZC2 A;  3NIA A;  1D06 A;  3ICY A;  3W4Q A;  4C6Y A;  1LI9 A;  4WEK A;  3K3C A;  1PZO A;  3LID A;  1U60 A;  4DJ2 A;  4KUO A;  4WN5 A;  4OLD A;  1XP4 A;  2J3T D;  5FQJ A;  2XA7 S;  3IF5 A;  3KSH A;  3IS2 A;  3IQA A;  4S2M A;  3TJZ C;  1YKD A;  5A90 A;  1KE3 A;  1ZTU A;  1IEL A;  3BW6 A;  4XXR A;  3VE3 A;  3C7V A;  3GQZ A;  2HP5 A;  1PWD A;  3GV9 A;  3UN7 A;  1ES4 A;  4HH3 A;  5HDC A;  3EGD C;  1CI9 A;  3OPL A;  4C3Q A;  3CUE C;  4R38 A;  1AWI A;  4DDS A;  1G6A A;  4II7 A;  4YWZ A;  2G7U A;  5HAI A;  2Y2G A;  3DTE A;  1MWS A;  3LI9 A;  3CWF A;  4PM7 A;  5HPF A;  1BUL A;  3KSI A;  2V0U A;  1S4S A;  5DJT A;  3BY8 A;  2PYP A;  3PBS A;  1KGG A;  2WGV A;  2XRO A;  2QHK A;  5FDS A;  1DJC A;  2J7V A;  5FI2 A;  4EBP A;  4ETZ A;  3BY9 A;  4OPQ A;  1PZP A;  1XGI A;  4HQA A;  4HP4 A;  3HVF A;  5EVI B;  3UE0 A;  4BJP A;  4NKP A;  3MMH A;  3VSL A;  3MZF A;  4OVD A;  1F2K A;  2B18 A;  2PD7 A;  1P9R A;  2HV1 A;  3CG5 A;  3S7P A;  4HI4 A;  1KGE A;  4PM8 A;  3VFH A;  3N8L A;  3P09 A;  4P87 A;  4A5R A;  4NG2 A;  4JLF A;  4FCF A;  3A3I A;  1XGJ A;  3LR0 A;  1K57 A;  4N1X A;  3ZGA B;  2Y2O A;  1S67 L;  4WM9 A;  2JCH A;  1XKZ A;  3A0R A;  3A3E A;  3NY4 A;  3HUM A;  4LV0 A;  1C3B A;  1Z6F A;  4M4X A;  2ZL1 B;  4PMA A;  3L9K A;  4Q0H A;  2WKR A;  1OTE A;  2Z2L B;  4GNU A;  3F1N A;  2WKP A;  4EU0 A;  4UA6 A;  4N92 A;  4R0Q A;  3PBQ A;  2K2N A;  2P74 A;  1YPR A;  1IEM A;  3LEQ A;  1V9Z A;  4F3L B;  4DKI A;  5CHM A;  4EXO A;  1ES5 A;  4GJ4 A;  3TOI A;  3HUO A;  4DE2 A;  1I2S A;  4P85 A;  1ZG6 A;  4LV3 A;  2VEA A;  3FPV A;  4G3K A;  4WZ5 C;  4UEY A;  2V8C A;  2HP9 A;  2OV5 A;  4GW9 A;  5AQA A;  4P6Z S;  3NOT C;  1TVF A;  3D9Y A;  5EUA A;  4QWO A;  1RP5 A;  1GHM A;  5F1F A;  5GLC A;  4S2I A;  4E3N A;  4U3T A;  1Q2P A;  1Y4O A;  3D4F A;  5IT5 A;  4RX3 A;  3VP1 A;  2HDQ A;  1K56 A;  4E3K A;  1K54 A;  4K0W A;  3CLO A;  3VP4 A;  2HJE A;  3OPH A;  3P7N A;  1PRQ A;  3T12 B;  4BLM A;  4E3M A;  1G28 A;  4IVK A;  4X6T A;  4B9O A;  4EUV A;  1W7F A;  2H0T A;  5DF9 A;  4LPZ A;  4KUK A;  4MBF A;  3WS5 A;  2Y2P A;  3PHY A;  1NRF A;  2FZ0 A;  3ZNY A;  3HCY A;  3G34 A;  1W8Q A;  1IYQ A;  2A49 A;  2P9V B;  4QD4 A;  3DWZ A;  4F3L A;  4GD6 A;  2OSU A;  1ERM A;  2WGW B;  3OOV A;  4WZ4 A;  2QMI A;  2ZQ8 A;  3UPN A;  3IXG A;  2MJ6 A;  3QP4 A;  3BM6 A;  2XK1 A;  3UDF A;  3MJQ A;  5GHZ A;  3IBR A;  4GN2 A;  2G2U A;  1VET A;  3IXH A;  4R23 A;  5EVL A;  3VOZ A;  4GHI A;  2ZJ9 A;  2C5W B;  3VSK A;  3B33 A;  3WS1 A;  4X55 A;  4L9E A;  4IVI A;  4N9K A;  3QP1 A;  1T1A A;  2NUT C;  4B93 A;  3ZFZ A;  4BBU A;  1FSY A;  2UV0 E;  3BYD A;  3IBJ A;  2R78 A;  1E3U A;  3F1P B;  1K57 C;  3KYE A;  3OZH A;  4H6J B;  4X68 A;  2HZ5 A;  2XA7 M;  1VET B;  1DP9 A;  4GCZ A;  4KZ9 A;  4OON A;  4P6B A;  3N8S A;  1W63 Q;  4KQO A;  3SH9 A;  1YSP A;  3OLO A;  1XJ2 A;  1YM1 A;  3OPR A;  5HWT A;  2ZQD A;  3DAV A;  4ARZ B;  2M1C A;  1RGZ A;  3S4X A;  5DTS A;  5I94 A;  1BLS A;  2JKF A;  1LI0 A;  3WS2 A;  3R4K A;  1DJB A;  4HJ4 A;  2M7V A;  3UMD A;  3VP3 A;  1LL9 A;  5TGF A;  1M6K A;  4OLG A;  2QKP A;  2H10 A;  5E2F A;  1PIO A;  3P98 A;  4ETX A;  5CXW A;  2XGN A;  2ZL1 A;  5DF7 A;  4QY5 A;  3QP6 A;  4IHQ A;  3O87 A;  3HBR A;  4U0X A;  2ZOH A;  2XD1 A;  1DJA A;  1P0Z A;  1SZV A;  3T4S A;  2GZA A;  4WBG A;  3QNB A;  5I5L A;  3S7N A;  3NDE A;  2ZQ7 A;  1XFN A;  2Q9M A;  4MEZ A;  5F6A A;  5IHV A;  4IBR A;  4OPZ A;  1IYO A;  2J3W A;  3GMW A;  1HD8 A;  5KSC A;  5F1G A;  2HDR A;  1PWC A;  5E43 A;  3B42 A;  3CJM A;  4WUJ A;  5DTT A;  4R3J A;  2WYX A;  3E4Q A;  4KG2 A;  3BQA A;  5HAP A;  3M6H A;  5FA7 A;  5CTN A;  2WKH A;  4BD1 A;  1K25 A;  4FUW A;  4DDY A;  2ZC3 B;  3PAG A;  1CEF A;  3C7U A;  5DKL A;  4UA7 A;  4Y0U A;  1E25 A;  2V20 A;  3ZHH A;  2Y2K A;  4Y7P A;  2O99 A;  4Q0I A;  3C8C A;  4JGR A;  2PU2 A;  4HEF A;  1CEG A;  3G6O A;  3KYZ A;  1N9N A;  4K91 A;  2ZBB A;  2Y55 A;  3RJU A;  2J9O A;  2W1T B;  4OQH A;  4OOL A;  2BAS A;  3CUE A;  1JWV A;  5C5K A;  3T4T A;  4EEP A;  4JGQ A;  3DTK A;  2IA2 A;  3JVU A;  3AGE A;  3VP2 A;  2PHY A;  1VHM A;  3UO9 A;  1CJF A;  4E3L A;  5AVF A;  4Z9Q A;  3K2N A;  3HLW A;  4GB7 A;  1F98 A;  2UWX A;  3MQQ A;  1OJG A;  4Q8I A;  3UPO A;  1LSV A;  4KZ7 A;  4DMZ A;  4UQI S;  3S1Y A;  3BJN A;  1MWU A;  3PAE A;  5FI6 A;  4CLC C;  3CMZ A;  3Q07 A;  2HP6 A;  4BMW A;  1W79 A;  5CGS A;  1N9L A;  3QP5 A;  5A91 A;  3H9W A;  5A8B A;  1EWZ A;  4JF6 A;  4I39 A;  3GTC A;  4E3J A;  5EOO A;  4NXF A;  2VLG A;  1SCW A;  2JKR M;  3T1S A;  5HAQ A;  1ESI A;  3IXD A;  2K31 A;  4OOM A;  2V1B A;  4WEL A;  4Y3I A;  4JF5 A;  2Q9N A;  3PR6 A;  3T4Q A;  2JHE A;  5DKK A;  3WRZ A;  1ES2 A;  4HJ6 A;  2ZC6 B;  3M6B A;  1CK3 A;  1FSW A;  1A0K A;  4DE0 A;  1K6R A;  2GJ3 A;  2LB9 A;  1FIK A;  1TS6 A;  5L09 A;  5CEB A;  1T1B A;  5IU1 A;  4MN7 A;  1S0W A;  3E4O A;  3HLE A;  4RA7 A;  4EV4 A;  3EOI A;  2HJ9 C;  1XA1 A;  3V39 A;  1OPX A;  2V8F A;  3LI8 A;  4DE3 A;  2Z6D A;  5DF8 A;  4KZ5 A;  4X53 A;  2EX6 A;  3W4P A;  3FKW A;  2ZM8 A;  3JVV A;  5M19 A;  2B02 A;  4RVA A;  1K56 D;  4O7D A;  3FKV A;  1MKM A;  4PM6 A;  5EE8 A;  1TEM A;  1K54 C;  3PYP A;  2ZMF A;  3BFG A;  3ULF A;  2Z2M B;  4HIA A;  1K4F A;  2O9A A;  2HDS A;  5J3W A;  5CGX A;  1NLY A;  5HWW A;  2I72 A;  3LY4 A;  3DW0 A;  3Q1F A;  3T50 A;  3TSG A;  5U47 A;  4OKP A;  2WAD A;  2ZMV A;  1L2S A;  3FZC A;  3LR5 A;  1YMS A;  4LCM A;  3Q82 A;  4K08 A;  3T1X A;  2JKT I;  4EWF A;  4Y0T A;  1UWN X;  2Z6C A;  2PBY A;  2H28 A;  3B3X A;  1MWT A;  3MZE A;  4KZ6 A;  1N9B A;  4MNR A;  2B5R A;  3IWO A;  3Q7Z A;  3ZG5 A;  3HLB A;  1DP6 A;  1G68 A;  1F9I A;  2Y2N A;  5FQQ A;  2OAP 1;  1YLW A;  5HWV A;  2INW A;  3SH8 A;  5FAQ A;  4JXW A;  4S2L A;  3RXX A;  4LFU A;  5CHU A;  2V1Z A;  3A3D A;  1VM1 A;  5FAO A;  2H0Y A;  3CI6 A;  4EEU A;  2J8Y A;  2VGL M;  1BT5 A;  2JC7 A;  4KZ8 A;  3UB7 A;  5HAR A;  2XFS A;  3HLD A;  2GX5 A;  4KQR A;  3S7Q A;  2W3E A;  2P08 A;  4I5S A;  1Q2Q A;  4IUH A;  4BQM A;  4CLC A;  5CEC A;  3H7W A;  4N1H A;  1FOF A;  2WKI A;  3ITA A;  2XRN A;  5HL1 A;  3IHB A;  1M40 A;  1ONG A;  2W3D A;  5AQ7 A;  5E2G A;  5FI7 A;  1VB6 A;  2VZW A;  3G31 A;  4GZB A;  3QHY A;  3CPT B;  2XD5 A;  3NJA A;  2XR0 A;  1FQG A;  3IF6 A;  4I3J A;  3MXR A;  1GSV A;  5TBM B;  2L0W A;  3NI9 A;  2VGJ A;  3ZNT A;  3I7J A;  2KLI A;  1BTL A;  5KSH A;  1FIL A;  5AVE A;  5GL9 A;  1L0F A;  4MMN A;  3MXS A;  3UDI A;  4S2N C;  4CQH A;  4R1G A;  3UB6 A;  4QJG A;  2EWW A;  1K0K A;  1XFQ A;  3T1Q B;  1X0O A;  3BFC A;  4WMC D;  2W27 A;  3HJI A;  5FEF A;  5J7E A;  2W3G A;  4Y5F A;  3BEC A;  4NXG A;  3LEZ A;  1NYY A;  4HOI A;  4EQI A;  1Z09 A;  4NXB A;  3BFF A;  3E4P A;  3ZG7 B;  3UE1 A;  3C4O A;  1KVL A;  2Y2H A;  3LY3 A;  3O86 A;  1TS8 A;  2EX9 A;  1D1J A;  2PBD P;  1MZU A;  3FWL A;  2ZQA A;  5FDH A;  1MC0 A;  3NOP C;  3GSG A;  5EV0 A;  1IFQ A;  2ZOI A;  2W1R A;  4XUZ A;  1ACF A;  2L4R A;  1XX2 A;  2X01 A;  4OP5 A;  3BFD A;  5DFX A;  5HL6 A;  5GLD A;  5E2E A;  3TG9 A;  4RYE A;  4HHD A;  2VGL S;  2VGK A;  5HD3 A;  1XXM A;  5FSR A;  2ZC4 B;  5GLA A;  4E6W A;  1FCM A;  1ODV A;  3MQO A;  1K55 A;  4MBK A;  5HD5 A;  4JGP A;  3PBN A;  5JYP A;  1EI5 A;  3MKE A;  1ERQ A;  4X69 A;  2V1A A;  3LIB A;  4JPM A;  2HGV A;  4GD8 A;  1O7E A;  2HF6 A;  2Y91 A;  1BZA A;  1BLP A;  1KDS A;  4MBH A;  4X1L A;  3LIE A;  3MZD A;  4CJN A;  2J80 A;  3RH8 B;  1OT6 A;  3BQ8 A;  3C4P A;  2ZM0 A;  2EWV A;  3MBZ A;  2XLN A;  2W0N A;  4E3I A;  1AXB A;  3LIA A;  2JKR I;  2Q0O A;  4Y13 A;  2DRW A;  4F94 A;  3UPP A;  4O01 A;  1P97 A;  4D60 A;  1NZU A;  2PD8 A;  1KE0 A;  1UGU A;  5HDD A;  3HLG A;  1KVM A;  3E0Y A;  1T19 A;  3T4J A;  1SKO B;  3MFX A;  3N7W A;  4PAU A;  1W63 M;  2VJW A;  2BTF P;  5DVA A;  4Y0O A;  4DXB A;  4ESP A;  4ZAM A;  4LGW A;  3GRJ A;  1NLZ A;  4YFM A;  4HY8 A;  5GHX A;  4KZ3 A;  2ZLY A;  3WRT A;  3C2W A;  5EM0 A;  1WYC A;  4DRT A;  2PDR A;  3IX4 A;  3LIC A;  1YLT A;  2R9X A;  2IWD A;  1L0G A;  1F5M A;  2Y8H A;  1ALQ A;  2HDU A;  4KG5 A;  4EES A;  2PR6 A;  1MWR A;  4B88 A;  4HES A;  5FEG A;  4KQD A;  5FQK A;  1YAX A;  4FOF A;  1HTZ A;  3B47 A;  4OOY A;  4BL2 A;  5M1A A;  1QMF A;  1ONH A;  2ZC7 A;  3HLC A;  5A92 A;  4OH0 A;  3N8R A;  4RQ9 A;  5CRF A;  3E2K A;  1DY6 A;  1V9Y A;  2EX8 A;  3HRE A;  3OPP A;  2J9P A;  2Y2M A;  1HZO A;  4ZTK A;  3NCK A;  1JNU A;  5CHJ A;  2WK0 A;  2P9V A;  3LCE A;  3VV4 A;  1OJ5 A;  1YLP A;  3G4P A;  2G2W A;  1YT4 A;  1BLH A;  3SS4 A;  2KDK A;  1GSW A;  1QME A;  3U2A A;  2BLS A;  1JVJ A;  2WAF A;  1GHI A;  4IJG A;  3UY6 A;  2WKE A;  3CZD A;  1WE4 A;  1KE4 A;  1GHP A;  4JKT A;  3EGX C;  2Y59 A;  3MS6 A;  2OAQ 1;  4MCW A;  2Y2J A;  2WGW A;  2VA0 A;  4LRX C;  1SKF A;  1W5D A;  4JXG A;  4QU3 A;  3LFV A;  1Y54 A;  4LRY C;  4PKY A;  4Y15 A;  1GA9 A;  4I38 A;  4ME4 A;  3IX8 A;  3GEC A;  2VV8 A;  5TR7 A;  2VV6 A;  4DF6 A;  3EEH A;  2A24 B;  4R4R A;  1UWP X;  5AJG A;  3SS5 A;  1NRJ A;  1S4R A;  2XQZ A;  1BLC A;  4JGO A;  5KIZ A;  1RGY A;  1FCO A;  2XFT A;  4X56 A;  2B95 A;  5HX9 A;  3QP2 A;  5G18 A;  1TDL A;  3LIF A;  3ZQ5 A;  5HDS A;  4BL3 A;  2ACG A;  2PT7 A;  5GHY A;  2V9A A;  2H5S A;  3LYX A;  5EEC A;  4WEJ A;  1STZ A;  1ZKJ A;  4QY6 A;  4M3K A;  4IBX A;  4OP8 A;  4QHC A;  5CTM A;  1WA9 A;  1L0E A;  2OWJ A;  2A3U A;  4KZ4 A;  3NHQ A;  4L9F A;  3G35 A;  4L0L A;  2OLV A;  1H8Y A;  4O0P A;  2V2F F;  5JYO A;  2RCX A;  1ZG4 A;  3OCL A;  2VX8 A;  2CMN A;  3FG8 A;  3IH9 A;  3PBR A;  3DTM A;  4I3I A;  5DFY A;  2P04 A;  1IOU A;  1PNE A;  4BEN A;  3UDX A;  1JTG A;  3ZG9 B;  4GDB A;  5EVI C;  1VEU A;  4LEN A;  3JPU A;  1E4D A;  4U0T A;  4GKU A;  3HJK A;  5M18 A;  1E3U D;  3T4L A;  1BUE A;  1GSX A;  3NUL A;  1SDN A;  2EX2 A;  2QYB A;  1TS7 A;  1LL5 A;  4P6Z M;  3UB9 A;  1TDG A;  4C75 A;  3IWQ A;  2EFX A;  2JKT M;  5EFW A;  1OTB A;  2W3F A;  3T4O A;  4KZA A;  5FL3 A;  1JTD A;  4DN0 A;  3K3D A;  2ZQC A;  4KEN B;  2V0W A;  2Y2I A;  4NEE D;  2XDM A;  1O07 A;  3Q7V A;  1YQS A;  5F5Y A;  5TFQ A;  3C30 A;  4X25 A;  1I5Q A;  2EFU A;  1NXY A;  4IUK A;  3MKF A;  5GLB A;  1XJ3 A;  3F1P A;  2GNX A;  3AGF A;  1H3Q A;  3NOU C;  4NET A;  5FAT A;  3KX0 X;  4EQ1 A;  5L10 A;  4EER A;  4JXS A; 
#chains in the Genus database with same CATH homology
 2XA7 M;  5KSH A;  2KOI A;  3O5Y A;  4FSF A;  5AVE A;  1DP9 A;  2JN7 A;  4GCZ A;  4MMN A;  4PKY G;  1BYW A;  1W63 Q;  4KQO A;  1YSP A;  3OLO A;  1XJ2 A;  4CQH A;  5IS1 A;  5HWT A;  4ARZ B;  2M1C A;  3UB6 A;  2W3H A;  2EWW A;  2A24 A;  1XFQ A;  3S7O A;  3T4K A;  3MR0 A;  4WLA A;  1X0O A;  3UE6 A;  5DJU A;  2W27 A;  3HJI A;  3EWK A;  3R4K A;  5J7E A;  4ARZ A;  2W3G A;  4Y5F A;  4HJ4 A;  4NXG A;  2M7V A;  3MXQ A;  2NUP C;  3UMD A;  4HOI A;  2YKH A;  4NXB A;  2O9C A;  2LB5 A;  2QKP A;  3E4P A;  4ETX A;  4HH2 A;  3C38 A;  4DJ3 A;  1OTD A;  3TW8 A;  1D7E A;  4IHQ A;  3RFB A;  1TS8 A;  2VV7 A;  1MZU A;  2ZOH A;  2FH5 A;  1MC0 A;  3NOP C;  3LR4 A;  1G6O A;  1IFQ A;  2ZOI A;  2W1R A;  1P0Z A;  2OOL A;  3T4S A;  1P9W A;  2GZA A;  2L4R A;  5DFX A;  5HL6 A;  5I5L A;  3S7N A;  3CAX A;  3OCN A;  1DRM A;  1XFN A;  4EW7 A;  4BBV A;  4HHD A;  4CLC E;  2VGL S;  3LR3 A;  5F6A A;  5HD3 A;  3EQV A;  2J3W A;  4YOF A;  5L8M A;  3B42 A;  1ODV A;  3MQO A;  4WUJ A;  2Y79 A;  4I3A A;  1XJ4 A;  1TD5 A;  5HD5 A;  4JGP A;  3PBN A;  3MF0 A;  3FPW A;  2V1A A;  3MQ0 A;  3LIB A;  3F1O A;  2HGV A;  1NWZ A;  3E4Q A;  3A0V A;  2HF6 A;  3BQA A;  3LUQ A;  3IS2 B;  4BBT A;  3KSG A;  2OWH A;  3E98 A;  5HPI A;  4R3A A;  3LIE A;  1OTI A;  2L1M A;  3OBF A;  2J80 A;  3RH8 B;  1OT6 A;  3BQ8 A;  5DKL A;  2EWV A;  3H82 A;  5LBR A;  3H82 B;  2W0N A;  4WL9 A;  1KOU A;  4Q0J A;  2O99 A;  3LIA A;  2JKR I;  3OC2 A;  4Q0I A;  3C8C A;  2QWS A;  3KYQ A;  4JGR A;  2PYR A;  2P7J A;  4EET B;  4O01 A;  1P97 A;  3EQU A;  3G6O A;  3KYZ A;  4HJ3 A;  1N9N A;  2PD8 A;  2ZBB A;  2KX6 A;  2D01 A;  5F68 A;  1UGU A;  4R70 A;  4YNR A;  5HDD A;  3RTY A;  1OT9 A;  2W1T B;  3E0Y A;  1LSW A;  4OOL A;  1T19 A;  4QPR A;  2BAS A;  3T4J A;  3MFX A;  3SW1 A;  2WKQ A;  3CUE A;  1TS0 A;  5C5K A;  3T4T A;  4PAU A;  4GLQ A;  1W63 M;  2VJW A;  4EEP A;  4JGQ A;  1D06 A;  2IA2 A;  3ICY A;  3JVU A;  1NLZ A;  2PHY A;  4WEK A;  1VHM A;  2O9B A;  3K3C A;  4HY8 A;  3BWL A;  1EW0 A;  1LSX A;  3LID A;  3PBT A;  4DJ2 A;  5AVF A;  3C2W A;  4KUO A;  3PBO A;  2PDR A;  3LIC A;  4WN5 A;  3K2N A;  1F98 A;  3MQQ A;  2J3T D;  4GHI B;  4Y2F A;  1OJG A;  5HZH A;  1LSV A;  2XA7 S;  3KSH A;  4DMZ A;  1F5M A;  2Y8H A;  3IS2 A;  4UQI S;  3TJZ C;  1YKD A;  1ZTU A;  3BJN A;  4EES A;  2DMW A;  4CLC C;  3BW6 A;  2PR6 A;  2QJ5 A;  2QJ7 A;  3VE3 A;  4BMW A;  4KQD A;  3V67 A;  1N9O A;  1N9L A;  1YAX A;  4FOF A;  4HH3 A;  4HP9 A;  3UME A;  3B47 A;  3W2Z A;  5HDC A;  3EGD C;  3H9W A;  3H7W B;  5A8B A;  4GS9 B;  4HNB A;  4CLC B;  1S1Z A;  3FC7 A;  4I39 A;  3CUE C;  4R38 A;  4Z1W A;  4II7 A;  4NXF A;  2G7U A;  2VLG A;  4RQ9 A;  4YWZ A;  2JKR M;  3VE4 A;  2K31 A;  1V9Y A;  4OOM A;  2V1B A;  3LI9 A;  3CWF A;  5HPF A;  4WEL A;  3A0S A;  3KSI A;  2V0U A;  3EEA A;  1S4S A;  3KSF A;  4Y3I A;  5DJT A;  3BY8 A;  1JNU A;  2PYP A;  3PBS A;  2XRO A;  2QHK A;  3VV4 A;  1OJ5 A;  3PR6 A;  1S66 L;  3T4Q A;  4R6L A;  2JHE A;  5DKK A;  4ETZ A;  1Y28 A;  3BY9 A;  4HJ6 A;  4HQA A;  2KDK A;  4HP4 A;  1GSW A;  3U2A A;  4UQI M;  2GJ3 A;  2LB9 A;  4BJP A;  4NKP A;  4IJG A;  3MMH A;  1TS6 A;  1T1B A;  2B18 A;  2PD7 A;  2D02 A;  3EGX C;  5IU1 A;  1P9R A;  4CLC D;  2HV1 A;  3VOL A;  4HI4 A;  3S7P A;  4MN7 A;  5CX7 A;  5G4Y A;  2OAQ 1;  4MCW A;  3E4O A;  5J4E A;  2VA0 A;  4LRX C;  4G3W A;  3EOI A;  1XJ6 A;  2HJ9 C;  1OPX A;  3DBA A;  4EER A;  3LR0 A;  3LI8 A;  2Z6D A;  5F69 A;  3LFV A;  4AFI A;  1S67 L;  4LRY C;  3R7W B;  3A0R A;  4H6J A;  4PKY A;  3JVV A;  4I38 A;  1YSQ A;  4ME4 A;  2B02 A;  3GEC A;  2VV8 A;  2VV6 A;  4M4X A;  1MKM A;  3EEH A;  2A24 B;  4Q0H A;  2O0Y A;  2WKR A;  1UWP X;  3TE8 A;  1OTE A;  5AJG A;  1NRJ A;  1S4R A;  3F1O B;  4GS9 A;  3F1N A;  2WKP A;  4EU0 A;  3PXP A;  4PHT A;  3PBQ A;  4JGO A;  3PYP A;  2K2N A;  4O8G A;  5KIZ A;  1S1Y A;  2W1T A;  2ZMF A;  3UB8 A;  1V9Z A;  3ULF A;  4HIA A;  4BWI A;  4F3L B;  2A2L A;  3CIT A;  4EXO A;  2O9A A;  5J3W A;  4GJ4 A;  3LIF A;  5TJJ A;  1NLY A;  3ZQ5 A;  5HWW A;  4ZRR A;  5HDS A;  3D72 A;  3T50 A;  2VEA A;  2XSS A;  1TF1 A;  3FPV A;  4G3K A;  2PT7 A;  4UEY A;  2V9A A;  1T1C A;  4GW9 A;  4LRZ E;  2ZMV A;  3LYX A;  4WEJ A;  1STZ A;  3LR5 A;  4XT2 A;  4P6Z S;  3NOT C;  4K08 A;  2JKT I;  2VKS A;  1OTA A;  1UWN X;  2Z6C A;  2H28 A;  4XT2 B;  1WA9 A;  2OWJ A;  1LL8 A;  5IT5 A;  3NHQ A;  4G3V A;  4L9G A;  4MN5 A;  4L9F A;  3TRC A;  4L0L A;  4O0P A;  2I9V A;  1DP6 A;  1F9I A;  3CLO A;  3OCL A;  2VX8 A;  2CMN A;  3FG8 A;  2HJE A;  2PR5 A;  2M7U A;  3P01 A;  3PBR A;  4I3I A;  3R7W A;  2OAP 1;  3P7N A;  5DFY A;  2P04 A;  1IOU A;  5HWV A;  2INW A;  1G28 A;  4B9O A;  2EA9 A;  2K7S A;  1ZHH B;  3GDI A;  4E04 A;  3CI6 A;  4EEU A;  4EUV A;  5DF9 A;  4LPZ A;  4KUK A;  4LLO B;  3HJK A;  2VGL M;  3KO6 A;  3PHY A;  3T4L A;  1GSX A;  2FZ0 A;  3HCY A;  2QYB A;  1TS7 A;  5HSQ A;  3UB7 A;  4P6Z M;  4F3L A;  3UB9 A;  2GX5 A;  3S7Q A;  2W3E A;  2P08 A;  4I5S A;  3OOV A;  2JKT M;  5EFW A;  5K5B A;  4IUH A;  1OTB A;  4CLC A;  2W3F A;  3T4O A;  3H7W A;  2MJ6 A;  1DP8 A;  5TBM A;  1T18 A;  5FL3 A;  2XRN A;  3MJQ A;  5MC7 A;  3IBR A;  2W3D A;  4DN0 A;  4WF0 A;  2J3T C;  3K3D A;  3ZYT A;  2V0W A;  1VB6 A;  4NEE D;  4GHI A;  2VZW A;  3B33 A;  5F5Y A;  1LT0 A;  3NJA A;  4MDZ A;  3F1N B;  4MN6 A;  4NXE A;  2YKF A;  4L9E A;  3C30 A;  1T1A A;  2NUT C;  4B93 A;  4BBU A;  4I3J A;  4IUK A;  1GSV A;  1XJ3 A;  2L0W A;  3F1P A;  3IBJ A;  1H8M A;  2GNX A;  2R78 A;  5TBM B;  3UE3 A;  3F1P B;  1H3Q A;  3NOU C;  3KX0 X;  2KLI A;  4EQ1 A;  4H6J B;  3D3O A;  5G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...