1VB6A

Crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
114
structure length
114
Chain Sequence
b'GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme pas sensor protein
publication title Structure of oxygen-bound form of a Heme PAS domain of Ec DOS
rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 32
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1vb6A00
3RTYA 5TBMA 4PKYG 5HD5A 4LPZA 4JGRA 3UB7A 3B33A 5DJTA 5AVEA 2M1CA 3HJKA 4K08A 4HY8A 1N9OA 5HWVA 1TS8A 4R70A 4YWZA 2V9AA 1T1BA 4JGPA 5J7EA 4I38A 4EEPA 3EWKA 3E4QA 3LIBA 2H28A 3CLOA 4GS9A 1XFNA 1LSXA 4GS9B 3C2WA 2VV7A 2ZBBA 5G4YA 2GJ3A 1T18A 4HJ4A 1GSXA 3P7NA 4LLOB 3LIDA 3PHYA 1XJ6A 1BYWA 1NWZA 3C8CA 4KQDA 4R6LA 2JHEA 3UE6A 1JNUA 1T19A 3K3DA 3LIEA 1LT0A 3LUQA 4HJ6A 1TS7A 3LICA 1UWNX 4WF0A 1DRMA 1S1YA 1S66L 4LRZE 3PYPA 1ODVA 1LL8A 4EW7A 1D06A 3NHQA 3F1OA 1S4RA 2WKRA 2WKPA 3F1OB 4WLAA 4H6JA 5F6AA 2L4RA 4R3AA 5HWWA 4XT2A 4HP9A 2L1MA 1GSWA 1N9LA 3KX0X 4XT2B 3UB8A 3MJQA 2QWSA 1UGUA 3FC7A 1P97A 3GDIA 1Y28A 1GSVA 1EW0A 1VB6A 3LIFA 3LYXA 2QHKA 3E4OA 5EFWA 3MQOA 1OTEA 3ULFA 2L0WA 1KOUA 3E4PA 3GECA 3A0VA 2OWJA 1TS6A 5HDSA 3BY8A 3F1NA 3HJIA 4EESA 2PR6A 4BBUA 1OTDA 2JN7A 3F1NB 4HNBA 5TBMB 4KUOA 4I5SA 3FG8A 1DP9A 3H9WA 1G28A 5J4EA 1OT9A 3LI8A 1T1CA 2QKPA 4GW9A 3VE3A 3UMEA 4I3AA 5AVFA 1XJ4A 4GHIA 5KIZA 3SW1A 5HSQA 4GHIB 4BBVA 2V0UA 4JGOA 1OT6A 4B9OA 4I39A 4EQ1A 4HH2A 4L9GA 5HDDA 2VV6A 3MQQA 2PD7A 1XJ3A 3F1PA 3RH8B 3IS2A 3F1PB 3IS2B 1F98A 3T50A 1UWPX 3NOTC 1S1ZA 4F3LA 4HI4A 4NXBA 2W0NA 4F3LB 3MXQA 1MZUA 4H6JB 2KDKA 1XFQA 2WKQA 2V1AA 2I9VA 4HJ3A 2BASA 1XJ2A 4HP4A 4JGQA 4I3JA 2D02A 4EERA 3A0RA 5DJUA 3CWFA 5J3WA 4HHDA 1OJ5A 4WUJA 5F69A 4KUKA 2INWA 3K3CA 1DP8A 2PYRA 2PD8A 4NXFA 3H7WA 1LSVA 3H7WB 1OTIA 1OJGA 4L9EA 2YKHA 5HD3A 4HOIA 4NXGA 4PKYA 4DJ2A 2QJ5A 5I5LA 2QJ7A 4NXEA 4BBTA 1V9YA 4WN5A 1OTAA 3IBRA 3UB6A 2YKFA 3UMDA 1T1AA 3D72A 4MN5A 2V0WA 4I3IA 2PHYA 5DKKA 4EXOA 4WL9A 5HZHA 4HH3A 2B02A 4LRYC 5IU1A 2K7SA 2W27A 3MFXA 3LIAA 5G4ZA 1P0ZA 1N9NA 2ZOIA 2ZOHA 3A0SA 1F9IA 2VV8A 4GCZA 2VLGA 4R38A 1V9ZA 2A24A 4DJ3A 3VE4A 2A24B 4RQ9A 2PDRA 3VOLA 5HDCA 2D01A 2Z6DA 2OOLA 1LSWA 2CMNA 3NOUC 3NOPC 4M4XA 2KX6A 3ICYA 1TS0A 4HQAA 5A8BA 3BWLA 3MR0A 3CAXA 5HWTA 2OWHA 4L9FA 3UB9A 2V1BA 5F5YA 4E04A 4HIAA 3EEHA 4MN6A 4EEUA 3LI9A 2R78A 5F68A 1S4SA 3G6OA 1S67L 5IS1A 1OTBA 1WA9A 2VEAA 5DKLA 2P7JA 2PYPA 3OLOA 3BY9A 1D7EA 2J80A 2Z6CA 3H82A 1X0OA 2EA9A 2HV1A 3H82B 2PR5A 1DP6A 4EETB 3ZQ5A 3NJAA 4LRXC
chains in the Genus database with same CATH superfamily
3CPTA 4E3KA 4X53A 1SCWA 1ES4A 3KYQA 3G2ZA 4U3TA 2VGKA 3HJKA 1ZHHB 4K08A 2VX8A 2FZ0A 3HLDA 3Q7VB 3MQ0A 1TS8A 3JYIA 4JGPA 2HP9A 5FEGA 5J7EA 1ESIA 4S2LA 4QPRA 2ZMAA 1BLSA 4OQIA 3G31A 3LIBA 2H28A 1XXMA 4G3VA 1IYPA 3IF5A 4HBTA 4GS9B 3SH7A 4O7DA 2VV7A 2ZJ9A 2XEPA 2ZBBA 2Z2LB 4DMZA 3ITAA 2GJ3A 3IHBA 1PZPA 3CUEC 1K57A 3ZG8B 4LV0A 3VP0A 3PHYA 4EV4A 1BYWA 3JPUA 1YQSA 2XA7S 1ES3A 3KYEA 4LV1A 1K0KA 1YLZA 3ZG0A 1SDEA 4R6LA 2EFXA 3UE6A 4IUKA 4IVIA 2WK0A 4DRTA 4BLMA 3NC8A 2VA0A 2HJEA 5DVAA 5KMWA 1DRMA 1S1YA 4LV2A 4YINA 1ODVA 4EW7A 1KGEA 4GZBA 3R7WB 3P98A 1MKMA 4R3AA 3SH8A 4UQIM 5L8MA 4XT2A 1G6AA 4HP9A 1KE3A 3IXGA 4KZ8A 1WYBA 4X6TA 3QP2A 5FAQA 1MY8A 1FR1A 5TFQA 1DJBA 3FC7A 3M2JA 3T1QB 4DE1A 3NECA 1EW0A 3ZNTA 4QD4A 1LL9A 3ZHHA 2HGVA 3VSLA 4QB8A 5EFWA 3MQOA 4L0LA 2XFSA 2ZC3B 4Z1WA 3GECA 5L2FA 3BJNA 3OZHA 1YMSA 5F83A 5HDSA 2ZMFA 3HJIA 2PR6A 2XK1A 4ZBEA 1OTDA 3BFFA 3QNBA 3IH8A 4I5SA 5E2EA 3FG8A 1U60A 2W1RA 4KQRA 3PAGA 3T1RA 1DP9A 3H9WA 3WS2A 3ZVTA 5DF8A 2JCHA 3GQZA 2PU2A 4GW9A 5GHZA 1F5MA 3S7NA 1BZAA 1MC0A 3VE3A 4Y7PA 5CXWA 4I3AA 1XJ4A 4KG6A 1C3BA 5HSQA 3UPOA 4Y0TA 4QY5A 2WAEA 2W3EA 1O07A 1IKIA 1VHMA 4LCLA 5GLAA 2XR0A 5FQQA 5CX7A 1DJAA 3UB5P 4JGOA 1OT6A 4R0QA 4I39A 4KZ3A 2C5WB 2UV0E 4O01A 2VV6A 4C75A 3QNCA 3RH8B 2XROA 3IS2A 2KOIA 3F1PB 3VOZA 3T50A 2WUQA 1E4DA 1CK3A 3MSHA 3PBTA 2W0NA 1QMFA 1G5UA 4E3MA 4WMCD 3E2LA 4B88A 2WKQA 4UA7A 4JLFA 1K57C 4AFIA 2V1AA 4KZBA 1RP5A 4HJ3A 1HD8A 5AQAA 1ONHA 4OKPA 5DTTA 1GHPA 1FCOA 3OOVA 5GHYA 2Y79A 5GLBA 2INWA 2WGIA 4KG2A 3ZDJA 3IF6A 3Q82A 3PR6A 3GVBA 1IELA 3P09A 3OPRA 2PBYA 3IX8A 4NXFA 4CPKA 1H8ZA 3DWZA 1KGGA 1OJGA 4ZDXA 4RX2A 4ZJ1A 5GLDA 3WS4A 3C30A 3E98A 2QJ5A 4GOGA 3DWKA 5I5LA 4P0MA 2J3TD 2HPBA 2WZXA 4EUZA 3C7VA 3UDXA 1J9MA 1OTAA 4YOFA 4IBXA 1KVMA 1NRFA 3IBRA 1E25A 3ZFZA 2JKTM 2ZQDA 4IHQA 3W4PA 4MN5A 2V0WA 1Y54A 4CLCE 3DTIA 3HLGA 3BM6A 5LBRA 1I2SA 3QP6A 3M2KA 2Q9NA 3BRMA 2W3HA 1IOUA 4UAAA 4Q0JA 5HZHA 4GKUA 2IWCA 3MFXA 3MS6A 3NY4A 2WADA 4XUXA 2ZOIA 4OOYA 1F9IA 5FQ9A 3MKEA 3T4LA 4U0XA 3NBLA 3A3IA 4UQIS 4Y2FA 1ZC2A 5DTSA 1V9ZA 2XD5A 4DJ3A 2JKRI 3VE4A 3SZTA 3KSHA 3CHWP 4EBNA 3S1YA 4Y0UA 2CMNA 1EI5A 2EX6A 3NOUC 3NOPC 1G6OA 5CRFA 2IWBA 2J9PA 1FQGA 4LENA 5C5KA 1F2KA 1TS0A 2JBFA 2IA2A 3T4QA 2J3WA 3IXHA 1L2SA 1CJFA 3Q07A 4DE3A 3BWLA 5FQJA 5E2GA 1YSQA 4L9FA 4IBRA 2RL3A 3EEHA 4MN6A 4DDYA 2Y2PA 3KSIA 3G6OA 5EOOA 4F94A 2VGLM 1JVJA 3LEQA 3WRZA 2P74A 2C6WB 4CLCA 1FILA 4XXRA 4ETZA 1XKZA 3WS0A 2VEAA 2PYPA 3UE3A 2G2UA 3OLOA 2J80A 4QU3A 3HLCA 1L3LA 3ISGA 3IX4A 3RXXA 2JKFA 4BMWA 5IHVA 3BECA 3ZQ5A 4RYEA 3NJAA 4WYYA 4P87A 1WE4A 5TBMA 4PKYG 2OAP1 4LPZA 4DKIA 4HEFA 3CPTB 5DJTA 4OQGA 3HL9A 4KZ5A 4OONA 4P6BA 3CG5A 1YSPA 4JXWA 1ONGA 1YLJA 5CGWA 1YMXA 3OPPA 3IBJA 3V3RA 4I38A 4EEPA 1SKFA 3MZFA 4NK3A 3WRTA 3DW0A 2P9VA 3UY6A 2H10A 3CLOA 1K25A 4S2KA 1S6RA 1WYCA 1XFNA 2VJWA 1LSXA 3C2WA 4Q8IA 5G4YA 3G30A 1KGFA 1G68A 1GSXA 2OSUA 2WGWA 5F1FA 5AQ9A 1PZOA 4LLOB 5KSHA 4BD1A 5FI6A 3OC2A 4MNRA 4KZ7A 2XD1A 5HARA 1NWZA 2PRFA 5CTNA 5M19A 3V3SA 3HVFA 1E3UA 3K3DA 3KO6A 4MN7A 1BLHA 2WAFA 1LT0A 3LUQA 4GDNA 4FOFA 4GD6A 3T1SA 3IWIA 1UWNX 4WF0A 3N4IA 5FL3A 1K55A 2QMIA 5CECA 3S4XA 1VQQA 5DFYA 1D06A 2WKPA 4ZJ3A 5E2HA 1GHIA 2L4RA 5FQMA 3KX0X 1GSWA 2J8YA 4XT2B 3UB8A 3MF0A 2XGNA 2M7VA 3QP4A 3C5AA 1ZTUA 1ACFA 1CI9A 3RFBA 5F82A 1TEMA 5EUAA 4EU0A 2X71A 1ERQA 2QHKA 4JXSA 4OOMA 5CGXA 4FSFA 1OTEA 4BD0A 1MWRA 1KOUA 4S2OA 4E6WA 3E4PA 1FSWA 4S2IA 5EVIA 5AJGA 5A90A 3CJMA 5GHXA 1TDLA 1PFLA 2BTFP 4KUOA 2ZC5B 1EWZA 1NZUA 1JWZA 2HDQA 4IVKA 4WELA 1G28A 1NXYA 3FPVA 1J3WA 4R4SA 5TJJA 4JXVA 1ESUA 3HUMA 1XA7A 1T1CA 4CLCC 4LGWA 2EXBA 3VOYA 3M6BA 2JC7A 1PIOA 5FDHA 3BW6A 3UMEA 2Y2KA 5FEFA 4NEED 4K0WA 3T1XA 5KIZA 4UA9A 1CQAA 5CHUA 4BBVA 1GA9A 4ESPA 5L10A 3GRJA 1NLZA 3N6IA 4P6ZM 2XQZA 5DF9A 3WS1A 4JXGA 3G4PA 1D1JA 4QY6A 2Y4AA 1XJ3A 3GR2A 2VGLS 3IS2B 4JF5A 1CF0A 3LCEA 1KDSA 3NOTC 1S1ZA 2PU4A 5HAIA 2Y2JA 3MXQA 4H6JB 4ZTKA 4UEYA 2HDUA 2KDKA 1XFQA 4K0XA 2HJ9C 3O88A 2Y2HA 1OMEA 2XH9A 3VFFA 4R3JA 4JGQA 5HL6A 3SS4A 5EOEA 4DE0A 5DJUA 4R3BA 1NZOA 3RJUA 2O0YA 4BENA 4HHDA 2XLNA 2V8CA 3AGDA 3B47A 2A2LA 1BT5A 2V1ZA 1DP8A 2HP6A 2PD8A 3D9YA 3LGOA 3H7WA 4EUVA 2HDRA 3E0YA 1K55C 3LEZA 3VP3A 1L0FA 5E43A 5M1AA 2YKHA 1JTGA 1PW8A 4RVAA 3A3JA 1Z6FA 3R4KA 2FFYA 5GL9A 4FUWA 3NDGA 2X01A 4CJNA 4OLGA 5A93A 1Y4OA 3UB6A 2E8JA 3Q81A 3TRCA 1H3QA 2JKGA 5CGSA 2PHYA 2PAVP 4JKTA 5DKKA 3PBQA 3PBOA 4WL9A 3BLMA 4E6XA 2XFTA 2EWWA 5M18A 2G7UA 2B02A 5IU1A 3IQAA 5IT5A 3EEAA 3IX3A 1W8QA 1H8YA 2W27A 5EVIC 3BYDA 4BL3A 4CLCD 1P0ZA 1N9NA 2ZOHA 3ZG7B 5FA7A 4FH4A 4WM9A 4KZ4A 4MBFA 3UPPA 3A3DA 4OPQA 4GCZA 4B93A 2Y2QA 1K56D 2H0TA 3LR5A 1CEGA 4M3KA 2VLGA 4R38A 4WZ5A 3LR0A 3IT9A 3VP1A 3TG9A 2E8IA 1ZG6A 4RQ9A 3VOLA 3Q1FA 3MMHA 2OOLA 4X56A 3W4OA 1AWIA 3ZVWA 4KQOA 4ARZA 5A92A 4O8GA 4HQAA 5FI2A 1BTLA 3CAXA 3R7WA 2ZM0A 1TF1A 3UB9A 3HCYA 4HIAA 1VEUA 4EEUA 2WGVA 1BSGA 4PM9A 2R78A 3B3XA 4GD8A 2ZQCA 5HL1A 2IWDA 1S67L 4RX3A 3UE0A 4EBLA 4D2OA 3KSGA 4ZJ2A 4CLCB 4ZAMA 1WA9A 4JF6A 2OAQ1 4HESA 4Q0IA 4R4RA 4Z9QA 4P85A 4EWFA 2Y8HA 1NYYA 3H82A 3JVVA 1X0OA 3LFVA 2HV1A 3UDFA 4Q0HA 2PR5A 5DF7A 2A49A 3N7WA 3S7OA 2Y2OA 4EETB 5HD5A 4E3LA 5JYPA 3UB7A 4P6ZS 3IHAA 4Y15A 5AQBA 2M1CA 4HY8A 1YLYA 2DRWA 2V9AA 2EWVA 1T1BA 3OPLA 2X02A 3G34A 1PI5A 5EV0A 2LB9A 2P9VB 2ZLYA 3QP5A 4MBHA 3OCLA 1IYSA 1PRQA 3EQUA 4FD8A 3LO7A 3IXBA 1XX2A 4OH0A 4OPYA 1T18A 1W63Q 2OV5A 5FSRA 3P7NA 1CI8A 3SH9A 5CEBA 1AXBA 1MPLA 3LIDA 1ALQA 1LLBA 3L9KA 4DDSA 1IYOA 3T4JA 1FCNA 4PAUA 3C8CA 3OCNA 5EVID 5J8XA 2JHEA 4LFUA 2CC1A 2NUTC 4Y5FA 1JNUA 1T19A 1TVFA 1TS7A 2Z2MB 4S2PA 1FOFA 2JE5A 3LICA 5L07A 4X25A 3HLFA 3PYPA 4DXBA 1ZKJA 3F1OA 1S4RA 2P08A 2ZQ7A 3LY4A 4LCMA 5L09A 5HWWA 1LI9A 2L1MA 1XA1A 3MJQA 1ERMA 2QWSA 3V67A 4KQQA 4WZ5C 3HLBA 2HP5A 1UGUA 3GDIA 1Y28A 1GSVA 4FH2A 3LYXA 3E4OA 4Y0OA 4N9LA 3V39A 4NETA 3VP4A 3ULFA 4E3IA 2VK3A 3FWLA 3HLEA 1KDWA 3SOIA 3EQVA 5CTMA 3C4PA 3SS5A 2B18A 5EPHA 3N8LA 3W8KA 5EVIB 2OWJA 5KSCA 3F1NA 4EESA 4BBUA 1SZVA 2JN7A 2WKHA 1P9RA 2EX8A 2WYXA 1RGYA 5E2FA 5K5BA 1PNEA 3FPWA 1OT9A 3LI8A 1K4FA 1H8MA 3IF6C 3BLSA 3FKVA 1SKOA 2W3GA 2FH5A 3GV9A 4S2NA 4WMCA 2V2FF 4DXCA 4QWOA 1K6RA 3OPHA 4CQHA 1P9WA 3MFDA 1XP4A 5AVFA 4GHIA 1FR6A 4YNRA 3FZCA 4MDZA 3K2NA 4BJPA 5F1GA 2B5RA 2BLSA 3S22A 2WKIA 3MZEA 4B9OA 4HH2A 4L9GA 5HDDA 3MQQA 4N1XA 2R9WA 2PD7A 1NJ4A 4WZ4A 1CEFA 1W79A 3PBNA 3DTMA 2XRNA 1F98A 5I94A 1UWPX 5BOHA 3IWQA 1MWSA 4EBPA 2ACGA 3OBFA 4G3KA 4F3LA 4HI4A 1MKIA 5CHMA 2PT7A 3O5YA 1FSYA 4HBUA 2B95A 4PPRA 4U0TA 5HAQA 3IWOA 2I9VA 1S0WA 1XJ2A 4JPMA 4EERA 3A0RA 3B42A 3D4FA 3CWFA 5J3WA 2O9CA 1YKDA 3E2KA 5F69A 1FIKA 4KUKA 5EECA 3IXDA 1YLTA 3K3CA 3S7PA 3HBRA 1LSVA 2H0YA 4KZ9A 3H7WB 3GSGA 1JTDA 3PAEA 5HD3A 2VGJA 1YPRA 3DTKA 4DJ2A 1MWUA 1ZG4A 2QJ7A 4GN2A 4NXEA 3ZG5A 1LHYA 3N8SA 3C4OA 4X68A 1PWDA 1IEMA 2ZM8A 3FV7A 5TR7A 3EGXC 4Y3IA 3UMDA 2VKSA 1T1AA 2WZZA 1A0KA 1RGZA 1VETA 4EXOA 4B4ZA 5HAPA 3O87A 1YLWA 3T12B 4E3OA 3NIAA 3PXPA 2Y2LA 3MBZA 4HH3A 2GNXA 2K7SA 3O3VA 3TW8A 3LR3A 2HDSA 3UE1A 5G4ZA 3LR4A 3A0SA 5HFOA 1K6SA 3BEBA 5D3OA 2QPNA 4A5RA 4QHCA 4IUHA 2A24A 4D60A 2ZM2A 3UPNA 2PDRA 3WS5A 1LSWA 1PI4A 2A3UA 1I2WA 4S2NC 4DN0A 3Q7ZA 4ARZB 1MWTA 5HW3A 1EROA 4R23A 2NUPC 1PWGA 5TGFA 5HWTA 4RA7A 2OWHA 2GDNA 2DNSA 2V1BA 2J7VA 2W1TA 1VEUB 3ZYTA 1K54A 5F68A 1S4SA 3AGFA 2DMWA 3NCKA 4IJGA 2ZC6B 2GX5A 2ZQAA 1DJCA 5IS1A 2ZL1A 3IF6B 2K31A 3FYZA 1VM1A 5DKLA 3A3EA 2P7JA 5EVLA 4BWIA 3BY9A 4Y13A 1D7EA 2J3TC 1M40A 1SHVA 5G18A 2EA9A 3H82B 1NY0A 3QP8A 4OP5A 3GTCA 4II7A 5A91A 4LRXC 3RTYA 1LI0A 1HVBA 3WWXA 4JGRA 4MEZA 3B33A 4BL2A 1BULA 5AVEA 3Q7VA 1PW1A 1N9OA 5HWVA 4R70A 4FTXA 3DTEA 4X55A 4YWZA 3BFDA 4QJGA 5HPFA 2W3DA 1M6KA 3EWKA 3E4QA 4S2MA 3G32A 1K4EA 3PBRA 4GS9A 2ZC4B 3MXRA 3BFCA 4MCWA 4JBFA 4DE2A 4K91A 1BLPA 3C38A 3JVUA 1NRJA 4HJ4A 4OLDA 3VFHA 3HREA 5FASA 1LL5A 3I7JA 2Y55A 3AGEA 1XJ6A 1Q2PA 4KQDA 4G3WA 5FATA 5FQIA 5JYOA 3HUNA 3BFGA 3LIEA 2O99A 1NLYA 4HJ6A 2DCFA 5DTKA 2KLIA 1W8YA 4LV3A 1S66L 4LRZE 3PBSA 1LL8A 3BQAA 3W4QA 3NHQA 3ITBA 2WKRA 3F1OB 4WLAA 1XGIA 5FQKA 2P04A 4H6JA 5F6AA 4E3JA 1FCMA 3G2YA 5KZHA 1N9LA 3V50A 4N1HA 3UO9A 1Q2QA 3T4SA 3LY3A 2VZWA 4N92A 4WEJA 1P97A 3PTEA 3VV4A 1H5XA 2UWXA 4OPRA 1VB6A 4N9KA 1XGJA 3LIFA 2JKTI 3DAVA 1O7EA 2L0WA 1TD5A 2Y91A 4GNUA 3VSKA 2R9XA 4X1MA 4DF6A 1Z09A 1E3UD 3A0VA 2RCXA 1TS6A 3BY8A 2HF6A 3F1NB 4HNBA 5AQ7A 5TBMB 4KZAA 4PM7A 1W63M 1HLUP 1YLPA 5U47A 1K54C 4PM6A 3V5MA 4JF4A 3ZGAB 1PWCA 2XF3A 4GJ4A 5J4EA 4GDBA 3CI6A 4ID4A 2Y2MA 2QKPA 2XDMA 1TDGA 4Y17A 1JWPA 4PMAA 1SKOB 3BQ8A 3UNWA 2ZMVA 1KE4A 4OQ0A 2GZAA 2LB5A 2Y2GA 3NI9A 3TJZC 3TOIA 3SW1A 4MMNA 4WEKA 5HPIA 4GHIB 2WGWB 3EOIA 2V0UA 2Y2NA 3P01A 3U4LP 1PYYA 3QP1A 4NG2A 1XPBA 2WKEA 1L0DA 3CITA 4PM8A 3O86A 1SDNA 3D3OA 4EQ1A 1YM1A 3F1PA 3QHYA 2O9BA 3NULA 1GCEA 4H8RA 1I5QA 3TE8A 3KSFA 2Y2IA 1N4OA 4NKPA 4X69A 4NXBA 4F3LB 4E3NA 3NDEA 5GLCA 2JKRM 4ZRRA 3HLWA 2AVXA 5DFXA 1MZUA 3UN7A 4BQMA 2HZ5A 2O9AA 1W5DA 3RXWA 1OPXA 4ETXA 1ES2A 1YAXA 4IEDA 2XA7M 1IYQA 1H0MA 3EGDC 4PHTA 2H5SA 5EVEA 2BASA 4HP4A 4I3JA 2Q9MA 1BLCA 2D02A 3W2ZA 2ZC7A 1QMEA 3ZCZA 3U2AA 3C7UA 1IKGA 2QYBA 1OJ5A 3DBAA 4WUJA 4YFMA 2FFFB 4OPZA 2Q0OA 2PYRA 4MLLA 2V20A 1L0EA 1STZA 5CERA 1OTIA 1W7FA 1K56A 2QZ6A 3GMWA 4L9EA 4O0PA 4HOIA 4NXGA 3CUEA 4ME4A 4PKYA 4OP8A 4PM5A 4KENB 2ZD8A 1BUEA 4C6YA 4MBKA 5CHJA 2EX2A 4BBTA 2PBDP 3TSGA 1V9YA 2W3FA 5EE8A 4WN5A 2ZQ8A 1GA0A 4OVDA 3M6HA 3CZDA 2YKFA 1L0GA 4EQIA 3D72A 2ZQ9A 4I3IA 3S7QA 5EM1A 1VETB 3HUOA 3MKFA 4B4XA 4FCFA 4WBGA 2EX9A 3L7HA 4KZ6A 1DY6A 2V8FA 4LRYC 2Y59A 2M7UA 1K38A 3LIAA 3IH9A 1MXOA 3T4TA 1N9BA 5HX9A 3CMZA 2VV8A 2EFUA 2K2NA 5FDSA 1IFQA 1KVLA 5EM0A 1ES5A 3VMAA 4GLQA 2A24B 5CEDA 3G35A 5FAOA 3T4KA 2XSSA 2EXAA 5HDCA 2D01A 2Z6DA 3N8RA 3KYZA 1HTZA 1JWVA 3ZG9B 4M4XA 2KX6A 4GB7A 3ICYA 1YT4A 1RCJA 1MBLA 1NYMA 5A8BA 3MR0A 5FAPA 4UA6A 5F5YA 4E04A 3A3FA 4OQHA 3LI9A 2W1TB 4KG5A 4UHUA 1HZOA 3ZNYA 1OTBA 2ZL1B 5MC7A 3UDIA 4OOLA 3MZDA 4X1LA 2I72A 4R1GA 3T4OA 4S2JA 2Z6CA 2G2WA 2J9OA 2MJ6A 2BG1A 3BFEA 5FI7A 4XUZA 3SS3A 3FKWA 2OLUA 2OLVA 3VP2A 1GHMA 1DP6A 3MXSA 4C3QA 1KE0A
chains in the Genus database with same CATH topology
3RTYA 5TBMA 4PKYG 5HD5A 2OAP1 4LPZA 3KYQA 4JGRA 3UB7A 3B33A 5DJTA 4P6ZS 5AVEA 2M1CA 3HJKA 1ZHHB 4K08A 2VX8A 4HY8A 2FZ0A 1N9OA 1YSPA 3MQ0A 5HWVA 1TS8A 4R70A 4YWZA 2V9AA 2EWVA 1T1BA 4JGPA 5HPFA 2W3DA 3IBJA 5J7EA 4I38A 4EEPA 3EWKA 3E4QA 4QPRA 3LIBA 2H28A 3CLOA 4G3VA 4GS9A 3PBRA 2LB9A 1XFNA 2VJWA 4MCWA 1LSXA 4GS9B 3C2WA 3OCLA 2VV7A 4DMZA 2ZBBA 3EQUA 5G4YA 2GJ3A 3CUEC 3C38A 3JVUA 1NRJA 1T18A 1W63Q 1GSXA 4HJ4A 3P7NA 4LLOB 5KSHA 3LIDA 3PHYA 1BYWA 1XJ6A 3OC2A 2XA7S 3T4JA 1NWZA 4PAUA 3C8CA 3OCNA 4KQDA 4R6LA 4G3WA 2JHEA 3UE6A 2NUTC 4Y5FA 4IUKA 1JNUA 3KO6A 1T19A 3K3DA 4MN7A 3LIEA 2O99A 1NLYA 1LT0A 3LUQA 4HJ6A 1TS7A 4FOFA 2VA0A 2HJEA 3LICA 2KLIA 1UWNX 4WF0A 5FL3A 1DRMA 1S1YA 1S66L 4LRZE 3PYPA 3PBSA 1ODVA 1LL8A 3BQAA 5DFYA 4EW7A 1D06A 3NHQA 3F1OA 3R7WB 1S4RA 2WKRA 2WKPA 3F1OB 4WLAA 2P04A 2P08A 4H6JA 5F6AA 1MKMA 2L4RA 4R3AA 4UQIM 5HWWA 5L8MA 4XT2A 4HP9A 2L1MA 1GSWA 1N9LA 3KX0X 4XT2B 3UB8A 3MJQA 2QWSA 3MF0A 3V67A 3T4SA 2M7VA 2VZWA 1UGUA 1ZTUA 3FC7A 4WEJA 1P97A 3RFBA 3VV4A 3GDIA 4EU0A 1Y28A 1GSVA 1EW0A 1VB6A 3LIFA 3LYXA 2HGVA 2QHKA 2JKTI 3E4OA 5EFWA 3MQOA 4OOMA 4FSFA 4L0LA 1OTEA 3ULFA 2L0WA 1TD5A 1KOUA 4Z1WA 3E4PA 3EQVA 3GECA 2B18A 5AJGA 3A0VA 3BJNA 2OWJA 1TS6A 5HDSA 3BY8A 2ZMFA 3F1NA 2HF6A 3HJIA 4EESA 2PR6A 4BBUA 1OTDA 2JN7A 3F1NB 4HNBA 5TBMB 1P9RA 4KUOA 1W63M 4I5SA 3FG8A 2W1RA 1DP9A 3H9WA 4WELA 1G28A 3FPVA 5K5BA 5TJJA 3FPWA 4GJ4A 5J4EA 1OT9A 3LI8A 3CI6A 1T1CA 1H8MA 4CLCC 2QKPA 2W3GA 2FH5A 4GW9A 1F5MA 3S7NA 4CQHA 1P9WA 3BQ8A 3BW6A 1MC0A 2ZMVA 3VE3A 3UMEA 4I3AA 2GZAA 2LB5A 3TJZC 5AVFA 1XJ4A 4NEED 4GHIA 5KIZA 3SW1A 5HSQA 4MMNA 4WEKA 2W3EA 4GHIB 5HPIA 3EOIA 4YNRA 4BBVA 2V0UA 1VHMA 1NLZA 3P01A 4MDZA 3K2NA 4P6ZM 5CX7A 3CITA 4JGOA 4BJPA 5DF9A 1OT6A 3D3OA 4B9OA 4I39A 4EQ1A 4HH2A 4L9GA 5HDDA 4O01A 2VV6A 3MQQA 2PD7A 1XJ3A 3F1PA 3RH8B 2XROA 3PBNA 2O9BA 2VGLS 3IS2A 2KOIA 3F1PB 2XRNA 3IS2B 3TE8A 1F98A 3KSFA 3T50A 1UWPX 3OBFA 4G3KA 4NKPA 3NOTC 1S1ZA 3PBTA 4HI4A 4F3LA 4NXBA 2PT7A 2W0NA 3O5YA 4F3LB 2JKRM 4ZRRA 3MXQA 5DFXA 1MZUA 4H6JB 2O9AA 4UEYA 2KDKA 1OPXA 1XFQA 4ETXA 2WKQA 2HJ9C 1YAXA 4AFIA 2V1AA 2XA7M 2I9VA 3EGDC 4HJ3A 4PHTA 2BASA 1XJ2A 4HP4A 4JGQA 5HL6A 4I3JA 2D02A 4EERA 3A0RA 3B42A 3W2ZA 5DJUA 3CWFA 3U2AA 5J3WA 2O9CA 3OOVA 1YKDA 2O0YA 2Y79A 4HHDA 2QYBA 1OJ5A 3DBAA 4WUJA 4KUKA 5F69A 2INWA 3B47A 2A2LA 3PR6A 3K3CA 1DP8A 2PYRA 2PD8A 3S7PA 4EUVA 4NXFA 3H7WA 1LSVA 3E0YA 1STZA 3H7WB 1OTIA 1OJGA 4L9EA 4O0PA 2YKHA 5HD3A 4HOIA 4NXGA 3CUEA 4ME4A 4PKYA 4DJ2A 3C30A 3E98A 2QJ5A 5I5LA 2QJ7A 4NXEA 3R4KA 2J3TD 4BBTA 1V9YA 2W3FA 4WN5A 1OTAA 4YOFA 3IBRA 3UB6A 3EGXC 2JKTM 4Y3IA 3TRCA 2YKFA 1H3QA 4IHQA 3UMDA 2VKSA 1T1AA 3D72A 4MN5A 2V0WA 4CLCE 4I3IA 2PHYA 3S7QA 5DKKA 3PBQA 3PBOA 5LBRA 4EXOA 4WL9A 2EWWA 2W3HA 1IOUA 3PXPA 4Q0JA 5HZHA 2G7UA 4HH3A 2B02A 4LRYC 5IU1A 5IT5A 3EEAA 2GNXA 2K7SA 3TW8A 2W27A 3LR3A 2M7UA 3MFXA 4CLCD 3LIAA 5G4ZA 1P0ZA 1N9NA 2ZOIA 2ZOHA 3T4TA 3LR4A 3A0SA 1F9IA 2VV8A 2K2NA 4GCZA 4B93A 3T4LA 1IFQA 3LR5A 4UQIS 2VLGA 4Y2FA 4IUHA 4R38A 1V9ZA 2A24A 4DJ3A 2JKRI 4GLQA 3VE4A 2A24B 3LR0A 3KSHA 3T4KA 2XSSA 4RQ9A 2PDRA 3VOLA 5HDCA 2D01A 2Z6DA 3MMHA 2OOLA 1LSWA 3KYZA 2CMNA 4KQOA 3NOUC 4ARZA 4DN0A 3NOPC 1G6OA 4ARZB 4M4XA 2KX6A 3ICYA 4O8GA 5C5KA 1TS0A 3T4QA 2IA2A 4HQAA 2J3WA 5A8BA 2NUPC 3BWLA 3MR0A 3CAXA 3R7WA 5HWTA 2OWHA 1YSQA 1TF1A 4L9FA 3UB9A 2V1BA 5F5YA 4E04A 3HCYA 4HIAA 3EEHA 4MN6A 4EEUA 3LI9A 3KSIA 2W1TA 2R78A 3ZYTA 5F68A 1S4SA 2W1TB 3G6OA 2DMWA 2VGLM 1S67L 4IJGA 2GX5A 5IS1A 1OTBA 4CLCA 3KSGA 4CLCB 4ETZA 1WA9A 2K31A 5MC7A 2VEAA 5DKLA 4OOLA 2P7JA 2OAQ1 2PYPA 3T4OA 4Q0IA 3UE3A 4BWIA 3OLOA 3BY9A 1D7EA 2J80A 2Z6CA 2MJ6A 2J3TC 2Y8HA 3JVVA 3H82A 1X0OA 4BMWA 2EA9A 3LFVA 2HV1A 3H82B 4Q0HA 2PR5A 3S7OA 1DP6A 4EETB 3ZQ5A 4II7A 3NJAA 4LRXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTY A;  5TBM A;  4PKY G;  5HD5 A;  4LPZ A;  4JGR A;  3UB7 A;  3B33 A;  5DJT A;  5AVE A;  2M1C A;  3HJK A;  4K08 A;  4HY8 A;  1N9O A;  5HWV A;  1TS8 A;  4R70 A;  4YWZ A;  2V9A A;  1T1B A;  4JGP A;  5J7E A;  4I38 A;  4EEP A;  3EWK A;  3E4Q A;  3LIB A;  2H28 A;  3CLO A;  4GS9 A;  1XFN A;  1LSX A;  4GS9 B;  3C2W A;  2VV7 A;  2ZBB A;  5G4Y A;  2GJ3 A;  1T18 A;  4HJ4 A;  1GSX A;  3P7N A;  4LLO B;  3LID A;  3PHY A;  1XJ6 A;  1BYW A;  1NWZ A;  3C8C A;  4KQD A;  4R6L A;  2JHE A;  3UE6 A;  1JNU A;  1T19 A;  3K3D A;  3LIE A;  1LT0 A;  3LUQ A;  4HJ6 A;  1TS7 A;  3LIC A;  1UWN X;  4WF0 A;  1DRM A;  1S1Y A;  1S66 L;  4LRZ E;  3PYP A;  1ODV A;  1LL8 A;  4EW7 A;  1D06 A;  3NHQ A;  3F1O A;  1S4R A;  2WKR A;  2WKP A;  3F1O B;  4WLA A;  4H6J A;  5F6A A;  2L4R A;  4R3A A;  5HWW A;  4XT2 A;  4HP9 A;  2L1M A;  1GSW A;  1N9L A;  3KX0 X;  4XT2 B;  3UB8 A;  3MJQ A;  2QWS A;  1UGU A;  3FC7 A;  1P97 A;  3GDI A;  1Y28 A;  1GSV A;  1EW0 A;  1VB6 A;  3LIF A;  3LYX A;  2QHK A;  3E4O A;  5EFW A;  3MQO A;  1OTE A;  3ULF A;  2L0W A;  1KOU A;  3E4P A;  3GEC A;  3A0V A;  2OWJ A;  1TS6 A;  5HDS A;  3BY8 A;  3F1N A;  3HJI A;  4EES A;  2PR6 A;  4BBU A;  1OTD A;  2JN7 A;  3F1N B;  4HNB A;  5TBM B;  4KUO A;  4I5S A;  3FG8 A;  1DP9 A;  3H9W A;  1G28 A;  5J4E A;  1OT9 A;  3LI8 A;  1T1C A;  2QKP A;  4GW9 A;  3VE3 A;  3UME A;  4I3A A;  5AVF A;  1XJ4 A;  4GHI A;  5KIZ A;  3SW1 A;  5HSQ A;  4GHI B;  4BBV A;  2V0U A;  4JGO A;  1OT6 A;  4B9O A;  4I39 A;  4EQ1 A;  4HH2 A;  4L9G A;  5HDD A;  2VV6 A;  3MQQ A;  2PD7 A;  1XJ3 A;  3F1P A;  3RH8 B;  3IS2 A;  3F1P B;  3IS2 B;  1F98 A;  3T50 A;  1UWP X;  3NOT C;  1S1Z A;  4F3L A;  4HI4 A;  4NXB A;  2W0N A;  4F3L B;  3MXQ A;  1MZU A;  4H6J B;  2KDK A;  1XFQ A;  2WKQ A;  2V1A A;  2I9V A;  4HJ3 A;  2BAS A;  1XJ2 A;  4HP4 A;  4JGQ A;  4I3J A;  2D02 A;  4EER A;  3A0R A;  5DJU A;  3CWF A;  5J3W A;  4HHD A;  1OJ5 A;  4WUJ A;  5F69 A;  4KUK A;  2INW A;  3K3C A;  1DP8 A;  2PYR A;  2PD8 A;  4NXF A;  3H7W A;  1LSV A;  3H7W B;  1OTI A;  1OJG A;  4L9E A;  2YKH A;  5HD3 A;  4HOI A;  4NXG A;  4PKY A;  4DJ2 A;  2QJ5 A;  5I5L A;  2QJ7 A;  4NXE A;  4BBT A;  1V9Y A;  4WN5 A;  1OTA A;  3IBR A;  3UB6 A;  2YKF A;  3UMD A;  1T1A A;  3D72 A;  4MN5 A;  2V0W A;  4I3I A;  2PHY A;  5DKK A;  4EXO A;  4WL9 A;  5HZH A;  4HH3 A;  2B02 A;  4LRY C;  5IU1 A;  2K7S A;  2W27 A;  3MFX A;  3LIA A;  5G4Z A;  1P0Z A;  1N9N A;  2ZOI A;  2ZOH A;  3A0S A;  1F9I A;  2VV8 A;  4GCZ A;  2VLG A;  4R38 A;  1V9Z A;  2A24 A;  4DJ3 A;  3VE4 A;  2A24 B;  4RQ9 A;  2PDR A;  3VOL A;  5HDC A;  2D01 A;  2Z6D A;  2OOL A;  1LSW A;  2CMN A;  3NOU C;  3NOP C;  4M4X A;  2KX6 A;  3ICY A;  1TS0 A;  4HQA A;  5A8B A;  3BWL A;  3MR0 A;  3CAX A;  5HWT A;  2OWH A;  4L9F A;  3UB9 A;  2V1B A;  5F5Y A;  4E04 A;  4HIA A;  3EEH A;  4MN6 A;  4EEU A;  3LI9 A;  2R78 A;  5F68 A;  1S4S A;  3G6O A;  1S67 L;  5IS1 A;  1OTB A;  1WA9 A;  2VEA A;  5DKL A;  2P7J A;  2PYP A;  3OLO A;  3BY9 A;  1D7E A;  2J80 A;  2Z6C A;  3H82 A;  1X0O A;  2EA9 A;  2HV1 A;  3H82 B;  2PR5 A;  1DP6 A;  4EET B;  3ZQ5 A;  3NJA A;  4LRX C; 
#chains in the Genus database with same CATH topology
 3CPT A;  4E3K A;  4X53 A;  1SCW A;  1ES4 A;  3KYQ A;  3G2Z A;  4U3T A;  2VGK A;  3HJK A;  1ZHH B;  4K08 A;  2VX8 A;  2FZ0 A;  3HLD A;  3Q7V B;  3MQ0 A;  1TS8 A;  3JYI A;  4JGP A;  2HP9 A;  5FEG A;  5J7E A;  1ESI A;  4S2L A;  4QPR A;  2ZMA A;  1BLS A;  4OQI A;  3G31 A;  3LIB A;  2H28 A;  1XXM A;  4G3V A;  1IYP A;  3IF5 A;  4HBT A;  4GS9 B;  3SH7 A;  4O7D A;  2VV7 A;  2ZJ9 A;  2XEP A;  2ZBB A;  2Z2L B;  4DMZ A;  3ITA A;  2GJ3 A;  3IHB A;  1PZP A;  3CUE C;  1K57 A;  3ZG8 B;  4LV0 A;  3VP0 A;  3PHY A;  4EV4 A;  1BYW A;  3JPU A;  1YQS A;  2XA7 S;  1ES3 A;  3KYE A;  4LV1 A;  1K0K A;  1YLZ A;  3ZG0 A;  1SDE A;  4R6L A;  2EFX A;  3UE6 A;  4IUK A;  4IVI A;  2WK0 A;  4DRT A;  4BLM A;  3NC8 A;  2VA0 A;  2HJE A;  5DVA A;  5KMW A;  1DRM A;  1S1Y A;  4LV2 A;  4YIN A;  1ODV A;  4EW7 A;  1KGE A;  4GZB A;  3R7W B;  3P98 A;  1MKM A;  4R3A A;  3SH8 A;  4UQI M;  5L8M A;  4XT2 A;  1G6A A;  4HP9 A;  1KE3 A;  3IXG A;  4KZ8 A;  1WYB A;  4X6T A;  3QP2 A;  5FAQ A;  1MY8 A;  1FR1 A;  5TFQ A;  1DJB A;  3FC7 A;  3M2J A;  3T1Q B;  4DE1 A;  3NEC A;  1EW0 A;  3ZNT A;  4QD4 A;  1LL9 A;  3ZHH A;  2HGV A;  3VSL A;  4QB8 A;  5EFW A;  3MQO A;  4L0L A;  2XFS A;  2ZC3 B;  4Z1W A;  3GEC A;  5L2F A;  3BJN A;  3OZH A;  1YMS A;  5F83 A;  5HDS A;  2ZMF A;  3HJI A;  2PR6 A;  2XK1 A;  4ZBE A;  1OTD A;  3BFF A;  3QNB A;  3IH8 A;  4I5S A;  5E2E A;  3FG8 A;  1U60 A;  2W1R A;  4KQR A;  3PAG A;  3T1R A;  1DP9 A;  3H9W A;  3WS2 A;  3ZVT A;  5DF8 A;  2JCH A;  3GQZ A;  2PU2 A;  4GW9 A;  5GHZ A;  1F5M A;  3S7N A;  1BZA A;  1MC0 A;  3VE3 A;  4Y7P A;  5CXW A;  4I3A A;  1XJ4 A;  4KG6 A;  1C3B A;  5HSQ A;  3UPO A;  4Y0T A;  4QY5 A;  2WAE A;  2W3E A;  1O07 A;  1IKI A;  1VHM A;  4LCL A;  5GLA A;  2XR0 A;  5FQQ A;  5CX7 A;  1DJA A;  3UB5 P;  4JGO A;  1OT6 A;  4R0Q A;  4I39 A;  4KZ3 A;  2C5W B;  2UV0 E;  4O01 A;  2VV6 A;  4C75 A;  3QNC A;  3RH8 B;  2XRO A;  3IS2 A;  2KOI A;  3F1P B;  3VOZ A;  3T50 A;  2WUQ A;  1E4D A;  1CK3 A;  3MSH A;  3PBT A;  2W0N A;  1QMF A;  1G5U A;  4E3M A;  4WMC D;  3E2L A;  4B88 A;  2WKQ A;  4UA7 A;  4JLF A;  1K57 C;  4AFI A;  2V1A A;  4KZB A;  1RP5 A;  4HJ3 A;  1HD8 A;  5AQA A;  1ONH A;  4OKP A;  5DTT A;  1GHP A;  1FCO A;  3OOV A;  5GHY A;  2Y79 A;  5GLB A;  2INW A;  2WGI A;  4KG2 A;  3ZDJ A;  3IF6 A;  3Q82 A;  3PR6 A;  3GVB A;  1IEL A;  3P09 A;  3OPR A;  2PBY A;  3IX8 A;  4NXF A;  4CPK A;  1H8Z A;  3DWZ A;  1KGG A;  1OJG A;  4ZDX A;  4RX2 A;  4ZJ1 A;  5GLD A;  3WS4 A;  3C30 A;  3E98 A;  2QJ5 A;  4GOG A;  3DWK A;  5I5L A;  4P0M A;  2J3T D;  2HPB A;  2WZX A;  4EUZ A;  3C7V A;  3UDX A;  1J9M A;  1OTA A;  4YOF A;  4IBX A;  1KVM A;  1NRF A;  3IBR A;  1E25 A;  3ZFZ A;  2JKT M;  2ZQD A;  4IHQ A;  3W4P A;  4MN5 A;  2V0W A;  1Y54 A;  4CLC E;  3DTI A;  3HLG A;  3BM6 A;  5LBR A;  1I2S A;  3QP6 A;  3M2K A;  2Q9N A;  3BRM A;  2W3H A;  1IOU A;  4UAA A;  4Q0J A;  5HZH A;  4GKU A;  2IWC A;  3MFX A;  3MS6 A;  3NY4 A;  2WAD A;  4XUX A;  2ZOI A;  4OOY A;  1F9I A;  5FQ9 A;  3MKE A;  3T4L A;  4U0X A;  3NBL A;  3A3I A;  4UQI S;  4Y2F A;  1ZC2 A;  5DTS A;  1V9Z A;  2XD5 A;  4DJ3 A;  2JKR I;  3VE4 A;  3SZT A;  3KSH A;  3CHW P;  4EBN A;  3S1Y A;  4Y0U A;  2CMN A;  1EI5 A;  2EX6 A;  3NOU C;  3NOP C;  1G6O A;  5CRF A;  2IWB A;  2J9P A;  1FQG A;  4LEN A;  5C5K A;  1F2K A;  1TS0 A;  2JBF A;  2IA2 A;  3T4Q A;  2J3W A;  3IXH A;  1L2S A;  1CJF A;  3Q07 A;  4DE3 A;  3BWL A;  5FQJ A;  5E2G A;  1YSQ A;  4L9F A;  4IBR A;  2RL3 A;  3EEH A;  4MN6 A;  4DDY A;  2Y2P A;  3KSI A;  3G6O A;  5EOO A;  4F94 A;  2VGL M;  1JVJ A;  3LEQ A;  3WRZ A;  2P74 A;  2C6W B;  4CLC A;  1FIL A;  4XXR A;  4ETZ A;  1XKZ A;  3WS0 A;  2VEA A;  2PYP A;  3UE3 A;  2G2U A;  3OLO A;  2J80 A;  4QU3 A;  3HLC A;  1L3L A;  3ISG A;  3IX4 A;  3RXX A;  2JKF A;  4BMW A;  5IHV A;  3BEC A;  3ZQ5 A;  4RYE A;  3NJA A;  4WYY A;  4P87 A;  1WE4 A;  5TBM A;  4PKY G;  2OAP 1;  4LPZ A;  4DKI A;  4HEF A;  3CPT B;  5DJT A;  4OQG A;  3HL9 A;  4KZ5 A;  4OON A;  4P6B A;  3CG5 A;  1YSP A;  4JXW A;  1ONG A;  1YLJ A;  5CGW A;  1YMX A;  3OPP A;  3IBJ A;  3V3R A;  4I38 A;  4EEP A;  1SKF A;  3MZF A;  4NK3 A;  3WRT A;  3DW0 A;  2P9V A;  3UY6 A;  2H10 A;  3CLO A;  1K25 A;  4S2K A;  1S6R A;  1WYC A;  1XFN A;  2VJW A;  1LSX A;  3C2W A;  4Q8I A;  5G4Y A;  3G30 A;  1KGF A;  1G68 A;  1GSX A;  2OSU A;  2WGW A;  5F1F A;  5AQ9 A;  1PZO A;  4LLO B;  5KSH A;  4BD1 A;  5FI6 A;  3OC2 A;  4MNR A;  4KZ7 A;  2XD1 A;  5HAR A;  1NWZ A;  2PRF A;  5CTN A;  5M19 A;  3V3S A;  3HVF A;  1E3U A;  3K3D A;  3KO6 A;  4MN7 A;  1BLH A;  2WAF A;  1LT0 A;  3LUQ A;  4GDN A;  4FOF A;  4GD6 A;  3T1S A;  3IWI A;  1UWN X;  4WF0 A;  3N4I A;  5FL3 A;  1K55 A;  2QMI A;  5CEC A;  3S4X A;  1VQQ A;  5DFY A;  1D06 A;  2WKP A;  4ZJ3 A;  5E2H A;  1GHI A;  2L4R A;  5FQM A;  3KX0 X;  1GSW A;  2J8Y A;  4XT2 B;  3UB8 A;  3MF0 A;  2XGN A;  2M7V A;  3QP4 A;  3C5A A;  1ZTU A;  1ACF A;  1CI9 A;  3RFB A;  5F82 A;  1TEM A;  5EUA A;  4EU0 A;  2X71 A;  1ERQ A;  2QHK A;  4JXS A;  4OOM A;  5CGX A;  4FSF A;  1OTE A;  4BD0 A;  1MWR A;  1KOU A;  4S2O A;  4E6W A;  3E4P A;  1FSW A;  4S2I A;  5EVI A;  5AJG A;  5A90 A;  3CJM A;  5GHX A;  1TDL A;  1PFL A;  2BTF P;  4KUO A;  2ZC5 B;  1EWZ A;  1NZU A;  1JWZ A;  2HDQ A;  4IVK A;  4WEL A;  1G28 A;  1NXY A;  3FPV A;  1J3W A;  4R4S A;  5TJJ A;  4JXV A;  1ESU A;  3HUM A;  1XA7 A;  1T1C A;  4CLC C;  4LGW A;  2EXB A;  3VOY A;  3M6B A;  2JC7 A;  1PIO A;  5FDH A;  3BW6 A;  3UME A;  2Y2K A;  5FEF A;  4NEE D;  4K0W A;  3T1X A;  5KIZ A;  4UA9 A;  1CQA A;  5CHU A;  4BBV A;  1GA9 A;  4ESP A;  5L10 A;  3GRJ A;  1NLZ A;  3N6I A;  4P6Z M;  2XQZ A;  5DF9 A;  3WS1 A;  4JXG A;  3G4P A;  1D1J A;  4QY6 A;  2Y4A A;  1XJ3 A;  3GR2 A;  2VGL S;  3IS2 B;  4JF5 A;  1CF0 A;  3LCE A;  1KDS A;  3NOT C;  1S1Z A;  2PU4 A;  5HAI A;  2Y2J A;  3MXQ A;  4H6J B;  4ZTK A;  4UEY A;  2HDU A;  2KDK A;  1XFQ A;  4K0X A;  2HJ9 C;  3O88 A;  2Y2H A;  1OME A;  2XH9 A;  3VFF A;  4R3J A;  4JGQ A;  5HL6 A;  3SS4 A;  5EOE A;  4DE0 A;  5DJU A;  4R3B A;  1NZO A;  3RJU A;  2O0Y A;  4BEN A;  4HHD A;  2XLN A;  2V8C A;  3AGD A;  3B47 A;  2A2L A;  1BT5 A;  2V1Z A;  1DP8 A;  2HP6 A;  2PD8 A;  3D9Y A;  3LGO A;  3H7W A;  4EUV A;  2HDR A;  3E0Y A;  1K55 C;  3LEZ A;  3VP3 A;  1L0F A;  5E43 A;  5M1A A;  2YKH A;  1JTG A;  1PW8 A;  4RVA A;  3A3J A;  1Z6F A;  3R4K A;  2FFY A;  5GL9 A;  4FUW A;  3NDG A;  2X01 A;  4CJN A;  4OLG A;  5A93 A;  1Y4O A;  3UB6 A;  2E8J A;  3Q81 A;  3TRC A;  1H3Q A;  2JKG A;  5CGS A;  2PHY A;  2PAV P;  4JKT A;  5DKK A;  3PBQ A;  3PBO A;  4WL9 A;  3BLM A;  4E6X A;  2XFT A;  2EWW A;  5M18 A;  2G7U A;  2B02 A;  5IU1 A;  3IQA A;  5IT5 A;  3EEA A;  3IX3 A;  1W8Q A;  1H8Y A;  2W27 A;  5EVI C;  3BYD A;  4BL3 A;  4CLC D;  1P0Z A;  1N9N A;  2ZOH A;  3ZG7 B;  5FA7 A;  4FH4 A;  4WM9 A;  4KZ4 A;  4MBF A;  3UPP A;  3A3D A;  4OPQ A;  4GCZ A;  4B93 A;  2Y2Q A;  1K56 D;  2H0T A;  3LR5 A;  1CEG A;  4M3K A;  2VLG A;  4R38 A;  4WZ5 A;  3LR0 A;  3IT9 A;  3VP1 A;  3TG9 A;  2E8I A;  1ZG6 A;  4RQ9 A;  3VOL A;  3Q1F A;  3MMH A;  2OOL A;  4X56 A;  3W4O A;  1AWI A;  3ZVW A;  4KQO A;  4ARZ A;  5A92 A;  4O8G A;  4HQA A;  5FI2 A;  1BTL A;  3CAX A;  3R7W A;  2ZM0 A;  1TF1 A;  3UB9 A;  3HCY A;  4HIA A;  1VEU A;  4EEU A;  2WGV A;  1BSG A;  4PM9 A;  2R78 A;  3B3X A;  4GD8 A;  2ZQC A;  5HL1 A;  2IWD A;  1S67 L;  4RX3 A;  3UE0 A;  4EBL A;  4D2O A;  3KSG A;  4ZJ2 A;  4CLC B;  4ZAM A;  1WA9 A;  4JF6 A;  2OAQ 1;  4HES A;  4Q0I A;  4R4R A;  4Z9Q A;  4P85 A;  4EWF A;  2Y8H A;  1NYY A;  3H82 A;  3JVV A;  1X0O A;  3LFV A;  2HV1 A;  3UDF A;  4Q0H A;  2PR5 A;  5DF7 A;  2A49 A;  3N7W A;  3S7O A;  2Y2O A;  4EET B;  5HD5 A;  4E3L A;  5JYP A;  3UB7 A;  4P6Z S;  3IHA A;  4Y15 A;  5AQB A;  2M1C A;  4HY8 A;  1YLY A;  2DRW A;  2V9A A;  2EWV A;  1T1B A;  3OPL A;  2X02 A;  3G34 A;  1PI5 A;  5EV0 A;  2LB9 A;  2P9V B;  2ZLY A;  3QP5 A;  4MBH A;  3OCL A;  1IYS A;  1PRQ A;  3EQU A;  4FD8 A;  3LO7 A;  3IXB A;  1XX2 A;  4OH0 A;  4OPY A;  1T18 A;  1W63 Q;  2OV5 A;  5FSR A;  3P7N A;  1CI8 A;  3SH9 A;  5CEB A;  1AXB A;  1MPL A;  3LID A;  1ALQ A;  1LLB A;  3L9K A;  4DDS A;  1IYO A;  3T4J A;  1FCN A;  4PAU A;  3C8C A;  3OCN A;  5EVI D;  5J8X A;  2JHE A;  4LFU A;  2CC1 A;  2NUT C;  4Y5F A;  1JNU A;  1T19 A;  1TVF A;  1TS7 A;  2Z2M B;  4S2P A;  1FOF A;  2JE5 A;  3LIC A;  5L07 A;  4X25 A;  3HLF A;  3PYP A;  4DXB A;  1ZKJ A;  3F1O A;  1S4R A;  2P08 A;  2ZQ7 A;  3LY4 A;  4LCM A;  5L09 A;  5HWW A;  1LI9 A;  2L1M A;  1XA1 A;  3MJQ A;  1ERM A;  2QWS A;  3V67 A;  4KQQ A;  4WZ5 C;  3HLB A;  2HP5 A;  1UGU A;  3GDI A;  1Y28 A;  1GSV A;  4FH2 A;  3LYX A;  3E4O A;  4Y0O A;  4N9L A;  3V39 A;  4NET A;  3VP4 A;  3ULF A;  4E3I A;  2VK3 A;  3FWL A;  3HLE A;  1KDW A;  3SOI A;  3EQV A;  5CTM A;  3C4P A;  3SS5 A;  2B18 A;  5EPH A;  3N8L A;  3W8K A;  5EVI B;  2OWJ A;  5KSC A;  3F1N A;  4EES A;  4BBU A;  1SZV A;  2JN7 A;  2WKH A;  1P9R A;  2EX8 A;  2WYX A;  1RGY A;  5E2F A;  5K5B A;  1PNE A;  3FPW A;  1OT9 A;  3LI8 A;  1K4F A;  1H8M A;  3IF6 C;  3BLS A;  3FKV A;  1SKO A;  2W3G A;  2FH5 A;  3GV9 A;  4S2N A;  4WMC A;  2V2F F;  4DXC A;  4QWO A;  1K6R A;  3OPH A;  4CQH A;  1P9W A;  3MFD A;  1XP4 A;  5AVF A;  4GHI A;  1FR6 A;  4YNR A;  3FZC A;  4MDZ A;  3K2N A;  4BJP A;  5F1G A;  2B5R A;  2BLS A;  3S22 A;  2WKI A;  3MZE A;  4B9O A;  4HH2 A;  4L9G A;  5HDD A;  3MQQ A;  4N1X A;  2R9W A;  2PD7 A;  1NJ4 A;  4WZ4 A;  1CEF A;  1W79 A;  3PBN A;  3DTM A;  2XRN A;  1F98 A;  5I94 A;  1UWP X;  5BOH A;  3IWQ A;  1MWS A;  4EBP A;  2ACG A;  3OBF A;  4G3K A;  4F3L A;  4HI4 A;  1MKI A;  5CHM A;  2PT7 A;  3O5Y A;  1FSY A;  4HBU A;  2B95 A;  4PPR A;  4U0T A;  5HAQ A;  3IWO A;  2I9V A;  1S0W A;  1XJ2 A;  4JPM A;  4EER A;  3A0R A;  3B42 A;  3D4F A;  3CWF A;  5J3W A;  2O9C A;  1YKD A;  3E2K A;  5F69 A;  1FIK A;  4KUK A;  5EEC A;  3IXD A;  1YLT A;  3K3C A;  3S7P A;  3HBR A;  1LSV A;  2H0Y A;  4KZ9 A;  3H7W B;  3GSG A;  1JTD A;  3PAE A;  5HD3 A;  2VGJ A;  1YPR A;  3DTK A;  4DJ2 A;  1MWU A;  1ZG4 A;  2QJ7 A;  4GN2 A;  4NXE A;  3ZG5 A;  1LHY A;  3N8S A;  3C4O A;  4X68 A;  1PWD A;  1IEM A;  2ZM8 A;  3FV7 A;  5TR7 A;  3EGX C;  4Y3I A;  3UMD A;  2VKS A;  1T1A A;  2WZZ A;  1A0K A;  1RGZ A;  1VET A;  4EXO A;  4B4Z A;  5HAP A;  3O87 A;  1YLW A;  3T12 B;  4E3O A;  3NIA A;  3PXP A;  2Y2L A;  3MBZ A;  4HH3 A;  2GNX A;  2K7S A;  3O3V A;  3TW8 A;  3LR3 A;  2HDS A;  3UE1 A;  5G4Z A;  3LR4 A;  3A0S A;  5HFO A;  1K6S A;  3BEB A;  5D3O A;  2QPN A;  4A5R A;  4QHC A;  4IUH A;  2A24 A;  4D60 A;  2ZM2 A;  3UPN A;  2PDR A;  3WS5 A;  1LSW A;  1PI4 A;  2A3U A;  1I2W A;  4S2N C;  4DN0 A;  3Q7Z A;  4ARZ B;  1MWT A;  5HW3 A;  1ERO A;  4R23 A;  2NUP C;  1PWG A;  5TGF A;  5HWT A;  4RA7 A;  2OWH A;  2GDN A;  2DNS A;  2V1B A;  2J7V A;  2W1T A;  1VEU B;  3ZYT A;  1K54 A;  5F68 A;  1S4S A;  3AGF A;  2DMW A;  3NCK A;  4IJG A;  2ZC6 B;  2GX5 A;  2ZQA A;  1DJC A;  5IS1 A;  2ZL1 A;  3IF6 B;  2K31 A;  3FYZ A;  1VM1 A;  5DKL A;  3A3E A;  2P7J A;  5EVL A;  4BWI A;  3BY9 A;  4Y13 A;  1D7E A;  2J3T C;  1M40 A;  1SHV A;  5G18 A;  2EA9 A;  3H82 B;  1NY0 A;  3QP8 A;  4OP5 A;  3GTC A;  4II7 A;  5A91 A;  4LRX C;  3RTY A;  1LI0 A;  1HVB A;  3WWX A;  4JGR A;  4MEZ A;  3B33 A;  4BL2 A;  1BUL A;  5AVE A;  3Q7V A;  1PW1 A;  1N9O A;  5HWV A;  4R70 A;  4FTX A;  3DTE A;  4X55 A;  4YWZ A;  3BFD A;  4QJG A;  5HPF A;  2W3D A;  1M6K A;  3EWK A;  3E4Q A;  4S2M A;  3G32 A;  1K4E A;  3PBR A;  4GS9 A;  2ZC4 B;  3MXR A;  3BFC A;  4MCW A;  4JBF A;  4DE2 A;  4K91 A;  1BLP A;  3C38 A;  3JVU A;  1NRJ A;  4HJ4 A;  4OLD A;  3VFH A;  3HRE A;  5FAS A;  1LL5 A;  3I7J A;  2Y55 A;  3AGE A;  1XJ6 A;  1Q2P A;  4KQD A;  4G3W A;  5FAT A;  5FQI A;  5JYO A;  3HUN A;  3BFG A;  3LIE A;  2O99 A;  1NLY A;  4HJ6 A;  2DCF A;  5DTK A;  2KLI A;  1W8Y A;  4LV3 A;  1S66 L;  4LRZ E;  3PBS A;  1LL8 A;  3BQA A;  3W4Q A;  3NHQ A;  3ITB A;  2WKR A;  3F1O B;  4WLA A;  1XGI A;  5FQK A;  2P04 A;  4H6J A;  5F6A A;  4E3J A;  1FCM A;  3G2Y A;  5KZH A;  1N9L A;  3V50 A;  4N1H A;  3UO9 A;  1Q2Q A;  3T4S A;  3LY3 A;  2VZW A;  4N92 A;  4WEJ A;  1P97 A;  3PTE A;  3VV4 A;  1H5X A;  2UWX A;  4OPR A;  1VB6 A;  4N9K A;  1XGJ A;  3LIF A;  2JKT I;  3DAV A;  1O7E A;  2L0W A;  1TD5 A;  2Y91 A;  4GNU A;  3VSK A;  2R9X A;  4X1M A;  4DF6 A;  1Z09 A;  1E3U D;  3A0V A;  2RCX A;  1TS6 A;  3BY8 A;  2HF6 A;  3F1N B;  4HNB A;  5AQ7 A;  5TBM B;  4KZA A;  4PM7 A;  1W63 M;  1HLU P;  1YLP A;  5U47 A;  1K54 C;  4PM6 A;  3V5M A;  4JF4 A;  3ZGA B;  1PWC A;  2XF3 A;  4GJ4 A;  5J4E A;  4GDB A;  3CI6 A;  4ID4 A;  2Y2M A;  2QKP A;  2XDM A;  1TDG A;  4Y17 A;  1JWP A;  4PMA A;  1SKO B;  3BQ8 A;  3UNW A;  2ZMV A;  1KE4 A;  4OQ0 A;  2GZA A;  2LB5 A;  2Y2G A;  3NI9 A;  3TJZ C;  3TOI A;  3SW1 A;  4MMN A;  4WEK A;  5HPI A;  4GHI B;  2WGW B;  3EOI A;  2V0U A;  2Y2N A;  3P01 A;  3U4L P;  1PYY A;  3QP1 A;  4NG2 A;  1XPB A;  2WKE A;  1L0D A;  3CIT A;  4PM8 A;  3O86 A;  1SDN A;  3D3O A;  4EQ1 A;  1YM1 A;  3F1P A;  3QHY A;  2O9B A;  3NUL A;  1GCE A;  4H8R A;  1I5Q A;  3TE8 A;  3KSF A;  2Y2I A;  1N4O A;  4NKP A;  4X69 A;  4NXB A;  4F3L B;  4E3N A;  3NDE A;  5GLC A;  2JKR M;  4ZRR A;  3HLW A;  2AVX A;  5DFX A;  1MZU A;  3UN7 A;  4BQM A;  2HZ5 A;  2O9A A;  1W5D A;  3RXW A;  1OPX A;  4ETX A;  1ES2 A;  1YAX A;  4IED A;  2XA7 M;  1IYQ A;  1H0M A;  3EGD C;  4PHT A;  2H5S A;  5EVE A;  2BAS A;  4HP4 A;  4I3J A;  2Q9M A;  1BLC A;  2D02 A;  3W2Z A;  2ZC7 A;  1QME A;  3ZCZ A;  3U2A A;  3C7U A;  1IKG A;  2QYB A;  1OJ5 A;  3DBA A;  4WUJ A;  4YFM A;  2FFF B;  4OPZ A;  2Q0O A;  2PYR A;  4MLL A;  2V20 A;  1L0E A;  1STZ A;  5CER A;  1OTI A;  1W7F A;  1K56 A;  2QZ6 A;  3GMW A;  4L9E A;  4O0P A;  4HOI A;  4NXG A;  3CUE A;  4ME4 A;  4PKY A;  4OP8 A;  4PM5 A;  4KEN B;  2ZD8 A;  1BUE A;  4C6Y A;  4MBK A;  5CHJ A;  2EX2 A;  4BBT A;  2PBD P;  3TSG A;  1V9Y A;  2W3F A;  5EE8 A;  4WN5 A;  2ZQ8 A;  1GA0 A;  4OVD A;  3M6H A;  3CZD A;  2YKF A;  1L0G A;  4EQI A;  3D72 A;  2ZQ9 A;  4I3I A;  3S7Q A;  5EM1 A;  1VET B;  3HUO A;  3MKF A;  4B4X A;  4FCF A;  4WBG A;  2EX9 A;  3L7H A;  4KZ6 A;  1DY6 A;  2V8F A;  4LRY C;  2Y59 A;  2M7U A;  1K38 A;  3LIA A;  3IH9 A;  1MXO A;  3T4T A;  1N9B A;  5HX9 A;  3CMZ A;  2VV8 A;  2EFU A;  2K2N A;  5FDS A;  1IFQ A;  1KVL A;  5EM0 A;  1ES5 A;  3VMA A;  4GLQ A;  2A24 B;  5CED A;  3G35 A;  5FAO A;  3T4K A;  2XSS A;  2EXA A;  5HDC A;  2D01 A;  2Z6D A;  3N8R A;  3KYZ A;  1HTZ A;  1JWV A;  3ZG9 B;  4M4X A;  2KX6 A;  4GB7 A;  3ICY A;  1YT4 A;  1RCJ A;  1MBL A;  1NYM A;  5A8B A;  3MR0 A;  5FAP A;  4UA6 A;  5F5Y A;  4E04 A;  3A3F A;  4OQH A;  3LI9 A;  2W1T B;  4KG5 A;  4UHU A;  1HZO A;  3ZNY A;  1OTB A;  2ZL1 B;  5MC7 A;  3UDI A;  4OOL A;  3MZD A;  4X1L A;  2I72 A;  4R1G A;  3T4O A;  4S2J A;  2Z6C A;  2G2W A;  2J9O A;  2MJ6 A;  2BG1 A;  3BFE A;  5FI7 A;  4XUZ A;  3SS3 A;  3FKW A;  2OLU A;  2OLV A;  3VP2 A;  1GHM A;  1DP6 A;  3MXS A;  4C3Q A;  1KE0 A; 
#chains in the Genus database with same CATH homology
 3RTY A;  5TBM A;  4PKY G;  5HD5 A;  2OAP 1;  4LPZ A;  3KYQ A;  4JGR A;  3UB7 A;  3B33 A;  5DJT A;  4P6Z S;  5AVE A;  2M1C A;  3HJK A;  1ZHH B;  4K08 A;  2VX8 A;  4HY8 A;  2FZ0 A;  1N9O A;  1YSP A;  3MQ0 A;  5HWV A;  1TS8 A;  4R70 A;  4YWZ A;  2V9A A;  2EWV A;  1T1B A;  4JGP A;  5HPF A;  2W3D A;  3IBJ A;  5J7E A;  4I38 A;  4EEP A;  3EWK A;  3E4Q A;  4QPR A;  3LIB A;  2H28 A;  3CLO A;  4G3V A;  4GS9 A;  3PBR A;  2LB9 A;  1XFN A;  2VJW A;  4MCW A;  1LSX A;  4GS9 B;  3C2W A;  3OCL A;  2VV7 A;  4DMZ A;  2ZBB A;  3EQU A;  5G4Y A;  2GJ3 A;  3CUE C;  3C38 A;  3JVU A;  1NRJ A;  1T18 A;  1W63 Q;  1GSX A;  4HJ4 A;  3P7N A;  4LLO B;  5KSH A;  3LID A;  3PHY A;  1BYW A;  1XJ6 A;  3OC2 A;  2XA7 S;  3T4J A;  1NWZ A;  4PAU A;  3C8C A;  3OCN A;  4KQD A;  4R6L A;  4G3W A;  2JHE A;  3UE6 A;  2NUT C;  4Y5F A;  4IUK A;  1JNU A;  3KO6 A;  1T19 A;  3K3D A;  4MN7 A;  3LIE A;  2O99 A;  1NLY A;  1LT0 A;  3LUQ A;  4HJ6 A;  1TS7 A;  4FOF A;  2VA0 A;  2HJE A;  3LIC A;  2KLI A;  1UWN X;  4WF0 A;  5FL3 A;  1DRM A;  1S1Y A;  1S66 L;  4LRZ E;  3PYP A;  3PBS A;  1ODV A;  1LL8 A;  3BQA A;  5DFY A;  4EW7 A;  1D06 A;  3NHQ A;  3F1O A;  3R7W B;  1S4R A;  2WKR A;  2WKP A;  3F1O B;  4WLA A;  2P04 A;  2P08 A;  4H6J A;  5F6A A;  1MKM A;  2L4R A;  4R3A A;  4UQI M;  5HWW A;  5L8M A;  4XT2 A;  4HP9 A;  2L1M A;  1GSW A;  1N9L A;  3KX0 X;  4XT2 B;  3UB8 A;  3MJQ A;  2QWS A;  3MF0 A;  3V67 A;  3T4S A;  2M7V A;  2VZW A;  1UGU A;  1ZTU A;  3FC7 A;  4WEJ A;  1P97 A;  3RFB A;  3VV4 A;  3GDI A;  4EU0 A;  1Y28 A;  1GSV A;  1EW0 A;  1VB6 A;  3LIF A;  3LYX A;  2HGV A;  2QHK A;  2JKT I;  3E4O A;  5EFW A;  3MQO A;  4OOM A;  4FSF A;  4L0L A;  1OTE A;  3ULF A;  2L0W A;  1TD5 A;  1KOU A;  4Z1W A;  3E4P A;  3EQV A;  3GEC A;  2B18 A;  5AJG A;  3A0V A;  3BJN A;  2OWJ A;  1TS6 A;  5HDS A;  3BY8 A;  2ZMF A;  3F1N A;  2HF6 A;  3HJI A;  4EES A;  2PR6 A;  4BBU A;  1OTD A;  2JN7 A;  3F1N B;  4HNB A;  5TBM B;  1P9R A;  4KUO A;  1W63 M;  4I5S A;  3FG8 A;  2W1R A;  1DP9 A;  3H9W A;  4WEL A;  1G28 A;  3FPV A;  5K5B A;  5TJJ A;  3FPW A;  4GJ4 A;  5J4E A;  1OT9 A;  3LI8 A;  3CI6 A;  1T1C A;  1H8M A;  4CLC C;  2QKP A;  2W3G A;  2FH5 A;  4GW9 A;  1F5M A;  3S7N A;  4CQH A;  1P9W A;  3BQ8 A;  3BW6 A;  1MC0 A;  2ZMV A;  3VE3 A;  3UME A;  4I3A A;  2GZA A;  2LB5 A;  3TJZ C;  5AVF A;  1XJ4 A;  4NEE D;  4GHI A;  5KIZ A;  3SW1 A;  5HSQ A;  4MMN A;  4WEK A;  2W3E A;  4GHI B;  5HPI A;  3EOI A;  4YNR A;  4BBV A;  2V0U A;  1VHM A;  1NLZ A;  3P01 A;  4MDZ A;  3K2N A;  4P6Z M;  5CX7 A;  3CIT A;  4JGO A;  4BJP A;  5DF9 A;  1OT6 A;  3D3O A;  4B9O A;  4I39 A;  4EQ1 A;  4HH2 A;  4L9G A;  5HDD A;  4O01 A;  2VV6 A;  3MQQ A;  2PD7 A;  1XJ3 A;  3F1P A;  3RH8 B;  2XRO A;  3PBN A;  2O9B A;  2VGL S;  3IS2 A;  2KOI A;  3F1P B;  2XRN A;  3IS2 B;  3TE8 A;  1F98 A;  3KSF A;  3T50 A;  1UWP X;  3OBF A;  4G3K A;  4NKP A;  3NOT C;  1S1Z A;  3PBT A;  4HI4 A;  4F3L A;  4NXB A;  2PT7 A;  2W0N A;  3O5Y A;  4F3L B;  2JKR M;  4ZRR A;  3MXQ A;  5DFX A;  1MZU A;  4H6J B;  2O9A A;  4UEY A;  2KDK A;  1OPX A;  1XFQ A;  4ETX A;  2WKQ A;  2HJ9 C;  1YAX A;  4AFI A;  2V1A A;  2XA7 M;  2I9V A;  3EGD C;  4HJ3 A;  4PHT A;  2BAS A;  1XJ2 A;  4HP4 A;  4JGQ A;  5HL6 A;  4I3J A;  2D02 A;  4EER A;  3A0R A;  3B42 A;  3W2Z A;  5DJU A;  3CWF A;  3U2A A;  5J3W A;  2O9C A;  3OOV A;  1YKD A;  2O0Y A;  2Y79 A;  4HHD A;  2QYB A;  1OJ5 A;  3DBA A;  4WUJ A;  4KUK A;  5F69 A;  2INW A;  3B47 A;  2A2L A;  3PR6 A;  3K3C A;  1DP8 A;  2PYR A;  2PD8 A;  3S7P A;  4EUV A;  4NXF A;  3H7W A;  1LSV A;  3E0Y A;  1STZ A;  3H7W B;  1OTI A;  1OJG A;  4L9E A;  4O0P A;  2YKH A;  5HD3 A;  4HOI A;  4NXG A;  3CUE A;  4ME4 A;  4PKY A;  4DJ2 A;  3C30 A;  3E98 A;  2QJ5 A;  5I5L A;  2QJ7 A;  4NXE A;  3R4K A;  2J3T D;  4BBT A;  1V9Y A;  2W3F A;  4WN5 A;  1OTA A;  4YOF A;  3IBR A;  3UB6 A;  3EGX C;  2JKT M;  4Y3I A;  3TRC A;  2YKF A;  1H3Q A;  4IHQ A;  3UMD A;  2VKS A;  1T1A A;  3D72 A;  4MN5 A;  2V0W A;  4CLC E;  4I3I A;  2PHY A;  3S7Q A;  5DKK A;  3PBQ A;  3PBO A;  5LBR A;  4EXO A;  4WL9 A;  2EWW A;  2W3H A;  1IOU A;  3PXP A;  4Q0J A;  5HZH A;  2G7U A;  4HH3 A;  2B02 A;  4LRY C;  5IU1 A;  5IT5 A;  3EEA A;  2GNX A;  2K7S A;  3TW8 A;  2W27 A;  3LR3 A;  2M7U A;  3MFX A;  4CLC D;  3LIA A;  5G4Z A;  1P0Z A;  1N9N A;  2ZOI A;  2ZOH A;  3T4T A;  3LR4 A;  3A0S A;  1F9I A;  2VV8 A;  2K2N A;  4GCZ A;  4B93 A;  3T4L A;  1IFQ A;  3LR5 A;  4UQI S;  2VLG A;  4Y2F A;  4IUH A;  4R38 A;  1V9Z A;  2A24 A;  4DJ3 A;  2JKR I;  4GLQ A;  3VE4 A;  2A24 B;  3LR0 A;  3KSH A;  3T4K A;  2XSS A;  4RQ9 A;  2PDR A;  3VOL A;  5HDC A;  2D01 A;  2Z6D A;  3MMH A;  2OOL A;  1LSW A;  3KYZ A;  2CMN A;  4KQO A;  3NOU C;  4ARZ A;  4DN0 A;  3NOP C;  1G6O A;  4ARZ B;  4M4X A;  2KX6 A;  3ICY A;  4O8G A;  5C5K A;  1TS0 A;  3T4Q A;  2IA2 A;  4HQA A;  2J3W A;  5A8B A;  2NUP C;  3BWL A;  3MR0 A;  3CAX A;  3R7W A;  5HWT A;  2OWH A;  1YSQ A;  1TF1 A;  4L9F A;  3UB9 A;  2V1B A;  5F5Y A;  4E04 A;  3HCY A;  4HIA A;  3EEH A;  4MN6 A;  4EEU A;  3LI9 A;  3KSI A;  2W1T A;  2R78 A;  3ZYT A;  5F68 A;  1S4S A;  2W1T B;  3G6O A;  2DMW A;  2VGL M;  1S67 L;  4IJG A;  2GX5 A;  5IS1 A;  1OTB A;  4CLC A;  3KSG A;  4CLC B;  4ETZ A;  1WA9 A;  2K31 A;  5MC7 A;  2VEA A;  5DKL A;  4OOL A;  2P7J A;  2OAQ 1;  2PYP A;  3T4O A;  4Q0I A;  3UE3 A;  4BWI A;  3OLO A;  3BY9 A;  1D7E A;  2J80 A;  2Z6C A;  2MJ6 A;  2J3T C;  2Y8H A;  3JVV A;  3H82 A;  1X0O A;  4BMW A;  2EA9 A;  3LFV A;  2HV1 A;  3H82 B;  4Q0H A;  2PR5 A;  3S7O A;  1DP6 A;  4EET B;  3ZQ5 A;  4II7 A;  3NJA A;  4LRX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...