4IUHA

Crystal structure of nrea of staphylococcus carnosus with bound iodide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
FDYQDALDEIRETEKFDFAAIALPEDGLHSAVIKWKYASGNINYRYRMIVLRPGKGLAGLVIRTGSRKIVEDVDAELSQNDKLGYPIVLSEALTAMVAIPLWKNNRVYGALLLGQREGRPLPEGSTTFRINQRLGSFTDEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nitrate-binding protein
molecule keywords NreA protein
publication title The NreA Protein Functions as a Nitrate Receptor in the Staphylococcal Nitrate Regulation System.
pubmed doi rcsb
source organism Staphylococcus carnosus subsp. carnosus tm300
total genus 35
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4iuhA00
2O9AA 4IUHA 4LRYC 3KO6A 3S7PA 4LRXC 2W3GA 5AJGA 2XRNA 2KLIA 3ZQ5A 2W1TB 4Q0HA 2W3FA 4IUKA 4Q0IA 5HPFA 4Y5FA 3NHQA 4QPRA 3DBAA 4FOFA 4GW9A 3O5YA 2W3EA 3NOPC 3IBJA 1YSPA 3NOTC 4ZRRA 2VZWA 2GX5A 3OOVA 3MQ0A 4MMNA 4O8GA 4E04A 2M7UA 2VKSA 4O01A 3EEAA 4DN0A 2G7UA 4Z1WA 3IBRA 3S7NA 4ETZA 3R4KA 4LRZE 4RQ9A 3E0YA 1TD5A 4MDZA 4O0PA 2QYBA 2Y79A 2O9BA 2LB5A 1YKDA 3KSHA 3TRCA 5C5KA 3NOUC 3HCYA 2OOLA 5HSQA 2XSSA 3CITA 3K2NA 2O0YA 3S7OA 1ZTUA 2IA2A 2K31A 4YOFA 5TJJA 3VV4A 3C2WA 4G3WA 3MMHA 4R6LA 4EUVA 2M7VA 1TF1A 2W3DA 2HGVA 4DMZA 3LFVA 1F5MA 4Q0JA 4MCWA 5HL6A 5K5BA 4YNRA 2ZMFA 5I5LA 4CQHA 3G6OA 4BWIA 3KSIA 1MKMA 4G3VA 4R70A 4G3KA 3KSGA 1MC0A 2W1TA 3RFBA 3W2ZA 2W3HA 5DFXA 3MF0A 2VJWA 4GLQA 4ME4A 4IJGA 5DFYA 1STZA 2Y8HA 3CI6A 1VHMA 4Y3IA 5HPIA 3D3OA 2O99A 4PAUA 2KOIA 4EU0A 2XROA 4ETXA 2VEAA 3OBFA 2B18A 5LBRA 4MN7A 3BJNA 4Y2FA 3E98A 5L8MA 2K2NA 3S7QA 2LB9A 3KSFA 1YSQA 2O9CA 2W1RA
chains in the Genus database with same CATH superfamily
2O9AA 4EESA 4BENA 2Y2QA 3H82A 1DP9A 4FH4A 1T1CA 5FQMA 4X69A 1L0GA 3TG9A 3BLMA 3IF6B 3ZCZA 1LSWA 4JXGA 4S2IA 2J3WA 3PAEA 4E04A 2VKSA 3T1RA 1L0DA 4B88A 2JKRM 5FQKA 5EUAA 2XK1A 1ES2A 1TD5A 4JF6A 4JGPA 2RCXA 3C7VA 3IS2A 1KDSA 4Y17A 4EBNA 4XT2B 2OAQ1 3IQAA 1E25A 5DF8A 3N4IA 3GRJA 1D7EA 1GSWA 2O0YA 4CPKA 3CLOA 4HQAA 3LEQA 4MBFA 1MWTA 2X01A 1KGGA 2VK3A 3ZGAB 1K55A 1W7FA 5FQIA 4K91A 1L0FA 3BECA 3UPPA 1KOUA 4QY6A 4Q0JA 2DRWA 4BBUA 4N1XA 1NXYA 3LGOA 3T4KA 1PW8A 4O7DA 1K56D 4FH2A 4PKYA 3ZG9B 1IEMA 4P6ZS 2JBFA 2W0NA 4LCLA 5TGFA 4DE1A 2OSUA 3RXWA 4EU0A 1CQAA 3UMEA 2K2NA 3E2KA 2LB9A 2VV6A 5AJGA 2L4RA 3HJKA 3UPOA 2QPNA 3QP1A 5CEDA 1AWIA 2VGKA 5HWWA 5IS1A 5TR7A 3FZCA 1LSXA 5F82A 3PBRA 4EV4A 1SDNA 1EWZA 4R3JA 3C8CA 4O8GA 2WKPA 2EFUA 1LI9A 3K3CA 3C4OA 5AQBA 4UEYA 3MZDA 4N9LA 4R4SA 5M1AA 4B93A 1BSGA 3T50A 2QMIA 4GHIB 5FI2A 3HBRA 1BZAA 2WGIA 1K6SA 3LR5A 4C75A 1V9ZA 2VLGA 2EWVA 1ES3A 2V2FF 2G2WA 3ZVTA 3PBNA 4GOGA 3BY9A 4E3JA 4I39A 4OQHA 1K4FA 2PAVP 3SS3A 1I2WA 5F6AA 3T1SA 4CQHA 3MKEA 1GSXA 4GD6A 4YWZA 2HF6A 2ZC5B 4Y15A 4MNRA 4HH2A 1PI5A 2HP9A 4OQGA 1MPLA 4OPYA 3CI6A 3G2YA 5HWVA 2VEAA 2DMWA 3OZHA 2V20A 5EVIB 4QY5A 3D9YA 4RX2A 3S7QA 2NUPC 1YSQA 1LLBA 1FSYA 4Y7PA 1H8MA 2EX9A 3GQZA 1LHYA 5GLBA 3Q7ZA 4UHUA 1YM1A 4II7A 3LICA 4LLOB 3SH9A 3UE3A 5A93A 4GW9A 2PR5A 1DJAA 1VM1A 2ZM0A 1UWNX 4X55A 4S2PA 2PD8A 4ARZB 2Z2LB 3OPLA 5DJUA 2G7UA 3R7WB 4RQ9A 3S4XA 4R23A 2HPBA 3CPTB 3G31A 2AVXA 2ZQDA 4LENA 1K25A 3UDIA 3A3JA 4WLAA 3ZG8B 1K6RA 4E3LA 5JYOA 2J3TD 1GA9A 5C5KA 2WAEA 1OJ5A 3T4TA 2KX6A 2J9PA 2GZAA 3VV4A 3C2WA 4K0WA 3GECA 3G2ZA 4X25A 5CHUA 2K7SA 1ALQA 3VOYA 4XXRA 4AFIA 3IF6C 1ES5A 3A3DA 3WRZA 4UQIM 2HDRA 3A3FA 1LT0A 3EOIA 3H7WA 1HVBA 3HL9A 3UMDA 3IX8A 1H8ZA 1UWPX 1PWCA 4PM9A 1KVLA 5FAQA 3UB9A 2Y2OA 2EXBA 3VP1A 2HJEA 2HJ9C 1SCWA 4LRXC 2EWWA 1G28A 3UE0A 2Y2LA 5E2FA 3LIDA 1IYPA 2ZC4B 2XA7S 2ZJ9A 3O5YA 4C6YA 5GHZA 3L7HA 3T4OA 3DTMA 3G35A 3OLOA 2XD5A 1KE3A 5DF7A 2XFSA 5F68A 1ZG4A 4EBPA 3SS5A 3EWKA 4OKPA 1FOFA 2FFYA 4NXGA 5TBMB 3ULFA 5HAPA 4HBUA 1OTBA 1ONGA 4OP5A 4JKTA 2P04A 4UA6A 3DTKA 3M2JA 2BTFP 3HCYA 4ZJ1A 3SH7A 3BFCA 4E6XA 1QMFA 3NY4A 5HDCA 3UB7A 1ODVA 5BOHA 2BG1A 2WADA 1UGUA 3KSIA 3A3IA 5L09A 2WGWB 4KQDA 3RFBA 3WS0A 5E43A 3EGDC 4HP4A 2E8JA 4P6ZM 4GLQA 1OPXA 1STZA 1L0EA 4NXBA 1WYBA 1FILA 4GHIA 3BFEA 3HUMA 4HI4A 4N9KA 1PZOA 5CGWA 1RP5A 1MWRA 4MBHA 4P87A 5L8MA 3HLCA 2KLIA 4HJ4A 5DTKA 4QB8A 1NZUA 5CX7A 3RJUA 2VX8A 3FV7A 1W79A 4QPRA 1NJ4A 2ZL1B 1YSPA 2FFFB 4Y0UA 3MXRA 4K0XA 4PM7A 1S4RA 4Z9QA 4JGOA 4OQ0A 3ZVWA 2B5RA 3VP2A 1CK3A 4LV1A 1XX2A 2W27A 3EEAA 2XEPA 3C5AA 5MC7A 3S7NA 2EX6A 2IWDA 3T4SA 1FR6A 5EVIA 2JKTI 1VETB 4RVAA 1HTZA 1VEUB 3TRCA 3KX0X 4L9GA 1CI8A 2WKRA 1L3LA 5E2GA 1SKFA 4N92A 2Q9NA 1J9MA 3OCNA 5EVIC 1BLPA 2D02A 2XSSA 2XGNA 3UO9A 3L9KA 2HDQA 3H9WA 1H0MA 3F1NA 4Q8IA 3IH9A 3ZYTA 3KYQA 3MMHA 3GVBA 4EUVA 5IHVA 4E3OA 4QJGA 2OLUA 5JYPA 4CLCB 2YKHA 2P74A 4LFUA 4F3LB 2Y4AA 1MKMA 4G3VA 1TS8A 2VV8A 1ZG6A 5A8BA 2VJWA 4DE0A 4GB7A 2KDKA 3HLGA 4WELA 5DFYA 1O7EA 3PBQA 4NEED 3IXBA 2JKFA 2JHEA 5U47A 3C30A 2UV0E 1FSWA 3EGXC 3FG8A 3BQAA 4HY8A 3KSFA 2QJ7A 1VB6A 1T18A 4LRYC 4EQIA 3TSGA 5CTNA 2JKGA 5HX9A 4KZAA 3K3DA 3RTYA 4GDBA 3P01A 1FR1A 3NOPC 5KSCA 2PU4A 1JTGA 1PIOA 2H28A 3BRMA 1BUEA 4ETZA 5HDDA 4KZ3A 4ZTKA 4R1GA 3WS5A 3DWKA 1PW1A 1LL8A 5KZHA 3T1QB 3UDXA 5GHXA 2QYBA 2X02A 1YKDA 3GMWA 3V3SA 4GKUA 3WS4A 2Y2MA 2A2LA 4CJNA 5EECA 2YKFA 4MLLA 3CZDA 5TJJA 3B3XA 5HDSA 1YMXA 3C38A 2V9AA 4M3KA 5FA7A 3LFVA 3BYDA 4A5RA 2P08A 3A0SA 1KE4A 3WS2A 3V50A 1BLSA 4YNRA 2ZMFA 3ZHHA 4KZ8A 4X68A 3RH8B 3CWFA 5DFXA 3WWXA 4HESA 4PHTA 4WYYA 3DWZA 1ERQA 1T1AA 4BL3A 1Z6FA 3ITBA 2ZQ8A 3O3VA 2O99A 1GHMA 1H8YA 3O88A 3UNWA 5DJTA 3OBFA 5LBRA 1F9IA 3BJNA 4Y2FA 1BTLA 1NZOA 2PYRA 4KQRA 2O9CA 4IUHA 3KO6A 3EQUA 1NRFA 3ZQ5A 2W1TB 5FI7A 4Y5FA 4LV3A 4EQ1A 3LYXA 2XA7M 2PDRA 2OAP1 2GX5A 4JXSA 4S2LA 1YLPA 4OOMA 4PPRA 1ERMA 4MN6A 3VFFA 4DN0A 3R4KA 4P85A 4DF6A 3O86A 1G6AA 4Y0TA 3E2LA 2O9BA 3SOIA 5F83A 4GDNA 4BJPA 1RGZA 3PR6A 4NG2A 1BT5A 3FPVA 4GS9A 1ONHA 5FATA 4B4XA 2WKEA 4HJ6A 1XJ2A 5EVID 1IYSA 3LUQA 2XQZA 3N8RA 2WYXA 1D1JA 4DMZA 1SKOA 5DTSA 5EV0A 3BY8A 4ZDXA 2PHYA 3DTIA 3F1PB 1CF0A 1G68A 4ZAMA 5EVEA 2A24B 4R70A 3TOIA 1RCJA 2ZMVA 2BASA 3QP2A 5DF9A 1W63M 3IWOA 4HEFA 5EPHA 4ME4A 4WEJA 3Q1FA 4L9EA 2P9VA 2P7JA 4ESPA 1I2SA 2JKTM 2L1MA 4FSFA 1K57C 2EX2A 2ZC6B 1J3WA 4JGRA 4WF0A 3ZG7B 1TS6A 3O87A 1DP8A 2EA9A 1K54C 2HP6A 2W3FA 2Q9MA 1MZUA 4EXOA 1BULA 3DBAA 4H8RA 1DY6A 1GA0A 4QHCA 1CJFA 4H6JB 4CLCC 3GSGA 3QP5A 3CAXA 4ZJ2A 3P7NA 4ZBEA 1CEFA 4X1LA 2E8IA 4U0TA 4CLCE 3QP8A 1PYYA 5G4ZA 3ZG5A 4C3QA 3E0YA 4JF4A 2H5SA 4LV0A 3GV9A 4PM6A 2ZBBA 3IHBA 3CG5A 1JNUA 2Y2IA 2OOLA 3VE4A 4OOYA 4WEKA 4KZ7A 2ZM8A 4FUWA 2X71A 4JF5A 4G3WA 1YLZA 3PBOA 1M6KA 4OONA 1LSVA 1FCOA 2HGVA 3Q7VB 3NC8A 3G6OA 2PT7A 3AGDA 4D60A 5HFOA 1PRQA 3KSGA 3BWLA 1IELA 3UE6A 4JXWA 2WZZA 1P9RA 3IF6A 4YFMA 4BL2A 4N1HA 3PTEA 4OPQA 1KGFA 1U60A 1K38A 3RXXA 4KG2A 3G4PA 1PFLA 3UDFA 3OC2A 4ETXA 2HDSA 1YAXA 5AQ9A 2OWJA 1XGIA 3MR0A 5HD3A 4DJ2A 2XD1A 3IX3A 1Q2QA 4R4RA 4OPRA 2V1AA 3OPPA 4XUXA 4GN2A 3HVFA 4E3KA 4XT2A 3AGFA 3E4PA 5DVAA 3IBJA 4DDYA 4ZRRA 4KQOA 5CXWA 2V8FA 3IWQA 3ISGA 1OMEA 4YINA 4E3MA 3VFHA 5DTTA 5F1GA 3ITAA 3HLBA 3BFGA 1TS0A 5FQQA 1KGEA 3OCLA 2Y2GA 1TVFA 3C7UA 3H82B 2ZQAA 3MQOA 1OT9A 2WKIA 3C4PA 4LV2A 5F69A 1C3BA 2B95A 3MS6A 4L9FA 3V5MA 3UY6A 1XGJA 5A91A 2L0WA 5AQAA 1YPRA 3B42A 5CGXA 5J8XA 2DCFA 3T4JA 5GHYA 3E4OA 1YLJA 3Q81A 1NLZA 3IS2B 4G3KA 1GSVA 4EETB 4I3JA 2Q0OA 3G32A 5I94A 3G34A 3ZFZA 5EM1A 3Q07A 4BQMA 3CMZA 5CEBA 2QJ5A 3V67A 3A3EA 3CUEC 1CI9A 2J8YA 1S6RA 5EE8A 3T1XA 1Z09A 4NXEA 2W1RA 1ACFA 1TDGA 1I5QA 2W3GA 3IXHA 5EVLA 3UPNA 2H10A 4BD1A 4OLGA 5CTMA 4WBGA 1G6OA 1GCEA 2G2UA 1H5XA 1RGYA 1ZKJA 4Y0OA 2W3EA 5HAIA 4KZ6A 1K0KA 3MSHA 3MXSA 4RA7A 4MMNA 1L2SA 2QZ6A 5FDSA 4M4XA 4PKYG 3T4QA 2I72A 4KUOA 5GLAA 1IKGA 2Y55A 1BLCA 3NJAA 4DJ3A 3BW6A 3IX4A 2FH5A 3MQQA 1EI5A 2VGJA 1X0OA 3BQ8A 1E4DA 3VP4A 4NKPA 3NDEA 4DDSA 4S2NC 2D01A 3TE8A 1S1YA 1XFQA 1YMSA 4LPZA 5HAQA 1LL5A 4I3IA 3LR0A 4EUZA 3V39A 4E6WA 2R9XA 3V3RA 3S22A 4S2KA 2WAFA 3JVVA 3LO7A 5FI6A 3FWLA 5I5LA 5FAPA 4NK3A 4S2JA 3N6IA 5GLCA 4WZ5C 5HWTA 3NCKA 1V9YA 4I5SA 1FQGA 4IJGA 3T4LA 1SHVA 3DAVA 2KOIA 2XDMA 3FPWA 5L10A 5E2EA 1IKIA 1OTAA 4ARZA 3R7WA 3BM6A 5FSRA 5AVEA 2HDUA 2Y59A 3CPTA 1NRJA 4O01A 3UE1A 3PXPA 4X56A 5DKLA 2H0TA 3PAGA 1ESIA 1OTIA 5J4EA 4HBTA 1XFNA 1XKZA 2JN7A 5HW3A 3IXDA 4NETA 3F1OB 3ZNTA 3VSLA 2QHKA 3UB6A 1F2KA 1JWVA 4WL9A 1N9NA 1NLYA 4MDZA 4KZ5A 4PM5A 1KE0A 3OPHA 1XJ6A 4EW7A 2LB5A 3SZTA 3KSHA 4RYEA 4HNBA 4KG5A 5FQ9A 1OTDA 1DJCA 1WYCA 3S1YA 5KMWA 4WMCA 1PI4A 4Y13A 1DP6A 1S1ZA 4WM9A 2OWHA 2J9OA 2M7VA 2W3DA 3KYEA 3HREA 1OT6A 4HP9A 3MFXA 4OVDA 5AVFA 5TFQA 1MWSA 5CRFA 4B4ZA 3DW0A 1ZHHB 3JVUA 3MFDA 1MC0A 5KIZA 3WRTA 2C6WB 2VV7A 2WK0A 1S4SA 4LCMA 1JTDA 3VP0A 3G30A 1KVMA 3NECA 3VMAA 1YT4A 3LI8A 2VGLS 3B47A 1LI0A 2DNSA 3BFFA 2Y2KA 2EX8A 5TBMA 1NWZA 3FC7A 5M19A 2CC1A 3JPUA 4JXVA 4E3IA 1WE4A 1BLHA 2M1CA 4IHQA 1MKIA 1P97A 4QU3A 2J3TC 3NHQA 4FOFA 3UB5P 3H7WB 4JPMA 3VSKA 3M6BA 1E3UA 2VZWA 5HZHA 1CEGA 1Y28A 2Z6CA 2M7UA 3SS4A 1PZPA 2UWXA 3LIAA 4PMAA 4Z1WA 3HJIA 1XP4A 4LRZE 3VP3A 2GJ3A 3LY4A 2CMNA 1PNEA 2ZC7A 4DXCA 3A0RA 5CERA 3LIBA 2B02A 3W4PA 1MXOA 2WGWA 4BD0A 4DKIA 4GNUA 2PR6A 1Y54A 5D3OA 2JE5A 1K55C 2Y2JA 2ZOIA 4UAAA 3W4QA 2IWBA 1NYYA 5E2HA 3S7OA 4JBFA 2MJ6A 2IA2A 4YOFA 4QWOA 1JWZA 1KDWA 3CHWP 4GD8A 2EFXA 3EEHA 4HIAA 1ESUA 1ES4A 5HARA 3MKFA 1F5MA 2A49A 4KZ9A 2J80A 4R38A 5FASA 1Q2PA 4IVIA 4OH0A 2QKPA 2ZM2A 4BBTA 3IXGA 3MF0A 2V0UA 5DKKA 1VQQA 3ZG0A 2JC7A 2V1ZA 2ZL1A 2RL3A 2BLSA 5L2FA 1VHMA 5CHJA 1TS7A 2XROA 1N9OA 4HOIA 3HLDA 2B18A 2INWA 4S2MA 3LR4A 2Z2MB 3PBTA 3E98A 3HLFA 5G4YA 1FIKA 3TW8A 4K08A 3M6HA 4UA7A 2XRNA 1VETA 2GDNA 1VEUA 2A3UA 3LR3A 1G5UA 1K57A 3QHYA 5FAOA 4GJ4A 2R9WA 3OPRA 5EFWA 1ZC2A 3MQ0A 3LIEA 4HHDA 1K54A 2V1BA 3PBSA 2V8CA 1Y4OA 2FZ0A 1AXBA 4BLMA 4DRTA 4U0XA 4CLCA 4OP8A 1YLYA 3IHAA 4OPZA 4O0PA 1GHIA 4F3LA 3A0VA 2Z6DA 5EOOA 4XUZA 3PYPA 2Y91A 2ZD8A 3K2NA 3SH8A 1S66L 4WUJA 1HD8A 1MBLA 2ZC3B 5FDHA 4HH3A 3FYZA 2ZLYA 4R6LA 1NYMA 4IBXA 3F1OA 3UB8A 1S0WA 3IH8A 1EW0A 1SDEA 3JYIA 1XJ4A 1IYQA 3HLWA 5J7EA 3QNBA 5F1FA 4MN5A 5K5BA 4JLFA 3DTEA 4WMCD 1MWUA 4BWIA 5M18A 3NI9A 3ZNYA 4P0MA 2W3HA 2NUTC 2WKHA 4B9OA 1EROA 4Y3IA 3B33A 2XLNA 1IYOA 3KYZA 3F1NB 3D3OA 2Y2HA 4PAUA 4MBKA 4S2OA 5F5YA 5EOEA 4JGQA 5CECA 5J3WA 3NULA 3HUOA 3S7PA 2C5WB 2PRFA 3FKVA 1FCMA 1YQSA 3BEBA 1T19A 3GTCA 4OOLA 4OQIA 5GL9A 2WUQA 2I9VA 4GZBA 1N9BA 1NY0A 4I38A 2PBYA 2XF3A 1XA7A 3D4FA 3PHYA 4X1MA 3IBRA 5CGSA 3WS1A 5HL1A 3W4OA 4DE3A 2R78A 4KG6A 4DE2A 1E3UD 1PWGA 2GNXA 1JWPA 3QP4A 3IF5A 4ZJ3A 2Y79A 3E4QA 4WN5A 5CHMA 4X53A 2OV5A 1S67L 1TDLA 3CITA 2K31A 3EQVA 3LI9A 1BYWA 3QP6A 1W5DA 1WA9A 4HJ3A 4DXBA 1N4OA 4KUKA 1GHPA 3SW1A 2IWCA 4R3AA 1W63Q 2PBDP 4MEZA 2HV1A 3U2AA 3UN7A 2JCHA 1HLUP 1JVJA 2JKRI 3N7WA 4IBRA 2W1TA 2ZMAA 3LY3A 5G18A 4D2OA 4NXFA 5FEGA 1HZOA 1XA1A 2OLVA 1MY8A 2H0YA 4LGWA 4EBLA 4I3AA 1XXMA 2VGLM 3QNCA 2XH9A 5HPIA 4FD8A 2WGVA 1P0ZA 3U4LP 3NIAA 3D72A 3BLSA 5EM0A 3CUEA 1TEMA 4Q0HA 4FCFA 4IUKA 4Q0IA 3P09A 4GCZA 1YLTA 4RX3A 5IT5A 2ZQCA 3NOTC 4L0LA 2XFTA 2WKQA 3HLEA 1PWDA 2ZQ9A 3VOLA 4WZ4A 5L07A 1A0KA 3LCEA 3P98A 3CJMA 3W8KA 4EERA 2Y2NA 3MJQA 3F1PA 3HUNA 2QWSA 2A24A 1OJGA 5KSHA 3MZEA 4KQQA 3N8SA 3MZFA 3NOUC 3IT9A 1DJBA 4CLCD 2J7VA 3Q82A 3N8LA 1N9LA 5FEFA 1FCNA 1K56A 2PD7A 4S2NA 1O07A 4BMWA 5HL6A 4R0QA 1F98A 3M2KA 1T1BA 1K4EA 2HZ5A 3BFDA 3MBZA 4GS9B 4EEUA 2EXAA 4H6JA 4KENB 3ZDJA 1OTEA 1QMEA 3I7JA 4WZ5A 4X6TA 1P9WA 4R3BA 1H3QA 4MN7A 3VE3A 1SKOB 1IOUA 1M40A 4KZBA 4PM8A 2XR0A 4FTXA 2VA0A 5HPFA 3IWIA 2PYPA 1W8QA 3VOZA 4IEDA 3OOVA 5A90A 2P9VB 3GR2A 3NDGA 4EWFA 1YLWA 3ICYA 3TJZC 2V0WA 3Q7VA 4IVKA 4E3NA 5FL3A 2PU2A 3GDIA 5GLDA 1DRMA 5FQJA 4EEPA 1XJ3A 5HSQA 4OLDA 2ACGA 1SZVA 1ZTUA 3LIFA 1TF1A 5A92A 4MCWA 1IFQA 4U3TA 3NBLA 4UQIS 3W2ZA 1D06A 4F94A 5HD5A 3T12B 5AQ7A 4P6BA 5IU1A 4KZ4A 3LEZA 4ID4A 2Y8HA 2ZQ7A 3FKWA 2ZOHA 2HP5A 3AGEA 3MXQA 1XPBA 1LL9A 1W8YA 4QD4A 4BBVA 2WZXA 4UA9A 2Y2PA
chains in the Genus database with same CATH topology
3MR0A 2O9AA 4EESA 5HD3A 4DJ2A 2XRNA 3H82A 1DP9A 1T1CA 2V1AA 5CX7A 2VX8A 3LR3A 4QPRA 4XT2A 4GJ4A 3E4PA 3IBJA 1YSPA 1LSWA 4ZRRA 5EFWA 4KQOA 3MQ0A 3LIEA 4HHDA 1S4RA 2J3WA 4JGOA 4E04A 2V1BA 2VKSA 3PBSA 2W27A 2FZ0A 3EEAA 1TS0A 5MC7A 3S7NA 2JKRM 4CLCA 3OCLA 3T4SA 1TD5A 2JKTI 4O0PA 4JGPA 4F3LA 3H82B 3IS2A 3A0VA 2Z6DA 3MQOA 1OT9A 3TRCA 3KX0X 4L9GA 2WKRA 5F69A 4XT2B 2OAQ1 3PYPA 3OCNA 2D02A 2XSSA 1D7EA 4L9FA 1GSWA 2O0YA 3K2NA 3CLOA 2L0WA 1S66L 4HQAA 4WUJA 3B42A 3H9WA 3F1NA 3ZYTA 3KYQA 3MMHA 4HH3A 4R6LA 4EUVA 3F1OA 3UB8A 1EW0A 3T4JA 1XJ4A 3E4OA 1KOUA 5J7EA 4Q0JA 4CLCB 4MN5A 2YKHA 5K5BA 4BBUA 4BWIA 4F3LB 1NLZA 3IS2B 1MKMA 4G3VA 1TS8A 4G3KA 1GSVA 4EETB 4I3JA 3T4KA 2VV8A 2W3HA 5A8BA 2NUTC 2VJWA 4PKYA 2KDKA 4P6ZS 4WELA 5DFYA 3PBQA 4NEED 2W0NA 4B9OA 4Y3IA 2QJ5A 2JHEA 3B33A 3KYZA 3V67A 3F1NB 3C30A 3D3OA 4PAUA 3CUEC 4EU0A 3EGXC 5F5YA 3UMEA 3FG8A 4JGQA 3BQAA 2K2NA 4HY8A 5J3WA 2LB9A 3KSFA 2QJ7A 4NXEA 1VB6A 2W1RA 2VV6A 1T18A 4LRYC 3S7PA 2W3GA 5AJGA 2L4RA 3HJKA 3K3DA 5HWWA 1T19A 5IS1A 1G6OA 4OOLA 3RTYA 1LSXA 3P01A 2I9VA 3PBRA 2W3EA 3NOPC 4I38A 4MMNA 3C8CA 4O8GA 2WKPA 2H28A 4M4XA 3K3CA 4PKYG 3T4QA 3PHYA 4KUOA 3IBRA 4UEYA 5HDDA 4ETZA 3NJAA 4DJ3A 3BW6A 2R78A 2FH5A 3MQQA 4B93A 2GNXA 1LL8A 1X0OA 2QYBA 2Y79A 3BQ8A 3E4QA 3T50A 1YKDA 4GHIB 4WN5A 4NKPA 2A2LA 1S67L 3LR5A 2D01A 3CITA 3TE8A 1S1YA 2YKFA 1XFQA 2K31A 3EQVA 5TJJA 4LPZA 3LI9A 1BYWA 1V9ZA 1WA9A 2VLGA 2EWVA 4HJ3A 4I3IA 4KUKA 3LR0A 5HDSA 3PBNA 3C38A 3SW1A 2V9AA 3LFVA 4R3AA 3BY9A 4I39A 2P08A 1W63Q 3A0SA 3JVVA 5F6AA 4YNRA 2HV1A 2ZMFA 5I5LA 4CQHA 3U2AA 1GSXA 4YWZA 2JKRI 2HF6A 3RH8B 3CWFA 2W1TA 5HWTA 5DFXA 1V9YA 4NXFA 4HH2A 4I5SA 4PHTA 4IJGA 1T1AA 3T4LA 4I3AA 3CI6A 2VGLM 5HPIA 2O99A 1P0ZA 2KOIA 3FPWA 5DJTA 5HWVA 2VEAA 1OTAA 3OBFA 2DMWA 4ARZA 3D72A 5LBRA 1F9IA 3BJNA 4Y2FA 3R7WA 2PYRA 5AVEA 3S7QA 2NUPC 1NRJA 1YSQA 4O01A 2O9CA 4IUHA 3PXPA 3KO6A 1H8MA 5DKLA 3EQUA 3CUEA 5J4EA 1OTIA 3ZQ5A 2W1TB 1XFNA 4Q0HA 4IUKA 4II7A 4Q0IA 4GCZA 3LICA 4LLOB 4Y5FA 4EQ1A 3LYXA 3UE3A 2XA7M 4GW9A 2PDRA 2PR5A 5IT5A 2JN7A 2OAP1 3NOTC 4L0LA 2GX5A 3F1OB 2WKQA 4OOMA 3VOLA 4MN6A 1UWNX 2PD8A 4ARZB 5DJUA 3R7WB 2G7UA 4DN0A 2QHKA 3UB6A 3R4KA 4RQ9A 4EERA 4WL9A 1N9NA 1NLYA 4MDZA 3MJQA 3F1PA 2QWSA 4WLAA 2A24A 1XJ6A 1OJGA 4EW7A 2O9BA 2LB5A 5KSHA 2J3TD 3KSHA 4BJPA 3PR6A 5C5KA 3NOUC 4HNBA 3FPVA 1OTDA 4GS9A 1OJ5A 3T4TA 4CLCD 2KX6A 1DP6A 4HJ6A 1XJ2A 2GZAA 3VV4A 1S1ZA 3C2WA 3GECA 3LUQA 1N9LA 2OWHA 2PD7A 2M7VA 2W3DA 4DMZA 1OT6A 4HP9A 3MFXA 2K7SA 4BMWA 5AVFA 3BY8A 5HL6A 4AFIA 2PHYA 3F1PB 1F98A 1ZHHB 1T1BA 3JVUA 2A24B 4R70A 4UQIM 1MC0A 5KIZA 2ZMVA 2BASA 5DF9A 1W63M 2VV7A 1S4SA 1LT0A 4GS9B 4ME4A 3EOIA 4WEJA 3H7WA 4EEUA 3UMDA 4H6JA 1OTEA 3LI8A 2VGLS 3B47A 1UWPX 4L9EA 2P7JA 1P9WA 3UB9A 1H3QA 2JKTM 4MN7A 3VE3A 2L1MA 1IOUA 4FSFA 5TBMA 2HJEA 1NWZA 3FC7A 2HJ9C 4LRXC 4JGRA 4WF0A 2EWWA 1TS6A 1G28A 1DP8A 2EA9A 2M1CA 4IHQA 2W3FA 2VA0A 1P97A 5HPFA 2J3TC 3LIDA 1MZUA 4EXOA 3NHQA 2PYPA 3DBAA 4FOFA 2XA7S 3H7WB 3O5YA 2VZWA 4H6JB 4CLCC 3T4OA 5HZHA 3CAXA 3OOVA 3P7NA 3OLOA 1Y28A 2Z6CA 5F68A 2M7UA 3LIAA 3EWKA 3ICYA 4CLCE 3TJZC 4Z1WA 3HJIA 4LRZE 2GJ3A 4NXGA 2CMNA 5G4ZA 5TBMB 2V0WA 3A0RA 3LIBA 3ULFA 2B02A 3E0YA 1OTBA 5FL3A 3GDIA 2P04A 2PR6A 2ZBBA 1DRMA 1JNUA 4EEPA 1XJ3A 2ZOIA 3HCYA 2OOLA 5HSQA 3VE4A 4WEKA 3S7OA 1ZTUA 2IA2A 2MJ6A 4YOFA 3LIFA 5HDCA 3UB7A 4G3WA 3PBOA 1LSVA 3EEHA 1ODVA 1TF1A 4HIAA 2HGVA 1F5MA 4MCWA 1UGUA 2J80A 4R38A 3G6OA 3KSIA 1IFQA 2PT7A 2QKPA 4KQDA 3KSGA 3BWLA 4UQIS 3RFBA 3W2ZA 4BBTA 1D06A 3EGDC 5HD5A 3MF0A 3UE6A 4HP4A 4P6ZM 5IU1A 2V0UA 5DKKA 4GLQA 1OPXA 1STZA 1P9RA 4NXBA 4GHIA 2Y8HA 1VHMA 2ZOHA 4HI4A 3MXQA 1TS7A 3OC2A 2XROA 4ETXA 1N9OA 4HOIA 2B18A 2INWA 3LR4A 3PBTA 1YAXA 3E98A 2OWJA 5G4YA 4BBVA 5L8MA 3TW8A 2KLIA 4HJ4A 4K08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9A A;  4IUH A;  4LRY C;  3KO6 A;  3S7P A;  4LRX C;  2W3G A;  5AJG A;  2XRN A;  2KLI A;  3ZQ5 A;  2W1T B;  4Q0H A;  2W3F A;  4IUK A;  4Q0I A;  5HPF A;  4Y5F A;  3NHQ A;  4QPR A;  3DBA A;  4FOF A;  4GW9 A;  3O5Y A;  2W3E A;  3NOP C;  3IBJ A;  1YSP A;  3NOT C;  4ZRR A;  2VZW A;  2GX5 A;  3OOV A;  3MQ0 A;  4MMN A;  4O8G A;  4E04 A;  2M7U A;  2VKS A;  4O01 A;  3EEA A;  4DN0 A;  2G7U A;  4Z1W A;  3IBR A;  3S7N A;  4ETZ A;  3R4K A;  4LRZ E;  4RQ9 A;  3E0Y A;  1TD5 A;  4MDZ A;  4O0P A;  2QYB A;  2Y79 A;  2O9B A;  2LB5 A;  1YKD A;  3KSH A;  3TRC A;  5C5K A;  3NOU C;  3HCY A;  2OOL A;  5HSQ A;  2XSS A;  3CIT A;  3K2N A;  2O0Y A;  3S7O A;  1ZTU A;  2IA2 A;  2K31 A;  4YOF A;  5TJJ A;  3VV4 A;  3C2W A;  4G3W A;  3MMH A;  4R6L A;  4EUV A;  2M7V A;  1TF1 A;  2W3D A;  2HGV A;  4DMZ A;  3LFV A;  1F5M A;  4Q0J A;  4MCW A;  5HL6 A;  5K5B A;  4YNR A;  2ZMF A;  5I5L A;  4CQH A;  3G6O A;  4BWI A;  3KSI A;  1MKM A;  4G3V A;  4R70 A;  4G3K A;  3KSG A;  1MC0 A;  2W1T A;  3RFB A;  3W2Z A;  2W3H A;  5DFX A;  3MF0 A;  2VJW A;  4GLQ A;  4ME4 A;  4IJG A;  5DFY A;  1STZ A;  2Y8H A;  3CI6 A;  1VHM A;  4Y3I A;  5HPI A;  3D3O A;  2O99 A;  4PAU A;  2KOI A;  4EU0 A;  2XRO A;  4ETX A;  2VEA A;  3OBF A;  2B18 A;  5LBR A;  4MN7 A;  3BJN A;  4Y2F A;  3E98 A;  5L8M A;  2K2N A;  3S7Q A;  2LB9 A;  3KSF A;  1YSQ A;  2O9C A;  2W1R A; 
#chains in the Genus database with same CATH topology
 2O9A A;  4EES A;  4BEN A;  2Y2Q A;  3H82 A;  1DP9 A;  4FH4 A;  1T1C A;  5FQM A;  4X69 A;  1L0G A;  3TG9 A;  3BLM A;  3IF6 B;  3ZCZ A;  1LSW A;  4JXG A;  4S2I A;  2J3W A;  3PAE A;  4E04 A;  2VKS A;  3T1R A;  1L0D A;  4B88 A;  2JKR M;  5FQK A;  5EUA A;  2XK1 A;  1ES2 A;  1TD5 A;  4JF6 A;  4JGP A;  2RCX A;  3C7V A;  3IS2 A;  1KDS A;  4Y17 A;  4EBN A;  4XT2 B;  2OAQ 1;  3IQA A;  1E25 A;  5DF8 A;  3N4I A;  3GRJ A;  1D7E A;  1GSW A;  2O0Y A;  4CPK A;  3CLO A;  4HQA A;  3LEQ A;  4MBF A;  1MWT A;  2X01 A;  1KGG A;  2VK3 A;  3ZGA B;  1K55 A;  1W7F A;  5FQI A;  4K91 A;  1L0F A;  3BEC A;  3UPP A;  1KOU A;  4QY6 A;  4Q0J A;  2DRW A;  4BBU A;  4N1X A;  1NXY A;  3LGO A;  3T4K A;  1PW8 A;  4O7D A;  1K56 D;  4FH2 A;  4PKY A;  3ZG9 B;  1IEM A;  4P6Z S;  2JBF A;  2W0N A;  4LCL A;  5TGF A;  4DE1 A;  2OSU A;  3RXW A;  4EU0 A;  1CQA A;  3UME A;  2K2N A;  3E2K A;  2LB9 A;  2VV6 A;  5AJG A;  2L4R A;  3HJK A;  3UPO A;  2QPN A;  3QP1 A;  5CED A;  1AWI A;  2VGK A;  5HWW A;  5IS1 A;  5TR7 A;  3FZC A;  1LSX A;  5F82 A;  3PBR A;  4EV4 A;  1SDN A;  1EWZ A;  4R3J A;  3C8C A;  4O8G A;  2WKP A;  2EFU A;  1LI9 A;  3K3C A;  3C4O A;  5AQB A;  4UEY A;  3MZD A;  4N9L A;  4R4S A;  5M1A A;  4B93 A;  1BSG A;  3T50 A;  2QMI A;  4GHI B;  5FI2 A;  3HBR A;  1BZA A;  2WGI A;  1K6S A;  3LR5 A;  4C75 A;  1V9Z A;  2VLG A;  2EWV A;  1ES3 A;  2V2F F;  2G2W A;  3ZVT A;  3PBN A;  4GOG A;  3BY9 A;  4E3J A;  4I39 A;  4OQH A;  1K4F A;  2PAV P;  3SS3 A;  1I2W A;  5F6A A;  3T1S A;  4CQH A;  3MKE A;  1GSX A;  4GD6 A;  4YWZ A;  2HF6 A;  2ZC5 B;  4Y15 A;  4MNR A;  4HH2 A;  1PI5 A;  2HP9 A;  4OQG A;  1MPL A;  4OPY A;  3CI6 A;  3G2Y A;  5HWV A;  2VEA A;  2DMW A;  3OZH A;  2V20 A;  5EVI B;  4QY5 A;  3D9Y A;  4RX2 A;  3S7Q A;  2NUP C;  1YSQ A;  1LLB A;  1FSY A;  4Y7P A;  1H8M A;  2EX9 A;  3GQZ A;  1LHY A;  5GLB A;  3Q7Z A;  4UHU A;  1YM1 A;  4II7 A;  3LIC A;  4LLO B;  3SH9 A;  3UE3 A;  5A93 A;  4GW9 A;  2PR5 A;  1DJA A;  1VM1 A;  2ZM0 A;  1UWN X;  4X55 A;  4S2P A;  2PD8 A;  4ARZ B;  2Z2L B;  3OPL A;  5DJU A;  2G7U A;  3R7W B;  4RQ9 A;  3S4X A;  4R23 A;  2HPB A;  3CPT B;  3G31 A;  2AVX A;  2ZQD A;  4LEN A;  1K25 A;  3UDI A;  3A3J A;  4WLA A;  3ZG8 B;  1K6R A;  4E3L A;  5JYO A;  2J3T D;  1GA9 A;  5C5K A;  2WAE A;  1OJ5 A;  3T4T A;  2KX6 A;  2J9P A;  2GZA A;  3VV4 A;  3C2W A;  4K0W A;  3GEC A;  3G2Z A;  4X25 A;  5CHU A;  2K7S A;  1ALQ A;  3VOY A;  4XXR A;  4AFI A;  3IF6 C;  1ES5 A;  3A3D A;  3WRZ A;  4UQI M;  2HDR A;  3A3F A;  1LT0 A;  3EOI A;  3H7W A;  1HVB A;  3HL9 A;  3UMD A;  3IX8 A;  1H8Z A;  1UWP X;  1PWC A;  4PM9 A;  1KVL A;  5FAQ A;  3UB9 A;  2Y2O A;  2EXB A;  3VP1 A;  2HJE A;  2HJ9 C;  1SCW A;  4LRX C;  2EWW A;  1G28 A;  3UE0 A;  2Y2L A;  5E2F A;  3LID A;  1IYP A;  2ZC4 B;  2XA7 S;  2ZJ9 A;  3O5Y A;  4C6Y A;  5GHZ A;  3L7H A;  3T4O A;  3DTM A;  3G35 A;  3OLO A;  2XD5 A;  1KE3 A;  5DF7 A;  2XFS A;  5F68 A;  1ZG4 A;  4EBP A;  3SS5 A;  3EWK A;  4OKP A;  1FOF A;  2FFY A;  4NXG A;  5TBM B;  3ULF A;  5HAP A;  4HBU A;  1OTB A;  1ONG A;  4OP5 A;  4JKT A;  2P04 A;  4UA6 A;  3DTK A;  3M2J A;  2BTF P;  3HCY A;  4ZJ1 A;  3SH7 A;  3BFC A;  4E6X A;  1QMF A;  3NY4 A;  5HDC A;  3UB7 A;  1ODV A;  5BOH A;  2BG1 A;  2WAD A;  1UGU A;  3KSI A;  3A3I A;  5L09 A;  2WGW B;  4KQD A;  3RFB A;  3WS0 A;  5E43 A;  3EGD C;  4HP4 A;  2E8J A;  4P6Z M;  4GLQ A;  1OPX A;  1STZ A;  1L0E A;  4NXB A;  1WYB A;  1FIL A;  4GHI A;  3BFE A;  3HUM A;  4HI4 A;  4N9K A;  1PZO A;  5CGW A;  1RP5 A;  1MWR A;  4MBH A;  4P87 A;  5L8M A;  3HLC A;  2KLI A;  4HJ4 A;  5DTK A;  4QB8 A;  1NZU A;  5CX7 A;  3RJU A;  2VX8 A;  3FV7 A;  1W79 A;  4QPR A;  1NJ4 A;  2ZL1 B;  1YSP A;  2FFF B;  4Y0U A;  3MXR A;  4K0X A;  4PM7 A;  1S4R A;  4Z9Q A;  4JGO A;  4OQ0 A;  3ZVW A;  2B5R A;  3VP2 A;  1CK3 A;  4LV1 A;  1XX2 A;  2W27 A;  3EEA A;  2XEP A;  3C5A A;  5MC7 A;  3S7N A;  2EX6 A;  2IWD A;  3T4S A;  1FR6 A;  5EVI A;  2JKT I;  1VET B;  4RVA A;  1HTZ A;  1VEU B;  3TRC A;  3KX0 X;  4L9G A;  1CI8 A;  2WKR A;  1L3L A;  5E2G A;  1SKF A;  4N92 A;  2Q9N A;  1J9M A;  3OCN A;  5EVI C;  1BLP A;  2D02 A;  2XSS A;  2XGN A;  3UO9 A;  3L9K A;  2HDQ A;  3H9W A;  1H0M A;  3F1N A;  4Q8I A;  3IH9 A;  3ZYT A;  3KYQ A;  3MMH A;  3GVB A;  4EUV A;  5IHV A;  4E3O A;  4QJG A;  2OLU A;  5JYP A;  4CLC B;  2YKH A;  2P74 A;  4LFU A;  4F3L B;  2Y4A A;  1MKM A;  4G3V A;  1TS8 A;  2VV8 A;  1ZG6 A;  5A8B A;  2VJW A;  4DE0 A;  4GB7 A;  2KDK A;  3HLG A;  4WEL A;  5DFY A;  1O7E A;  3PBQ A;  4NEE D;  3IXB A;  2JKF A;  2JHE A;  5U47 A;  3C30 A;  2UV0 E;  1FSW A;  3EGX C;  3FG8 A;  3BQA A;  4HY8 A;  3KSF A;  2QJ7 A;  1VB6 A;  1T18 A;  4LRY C;  4EQI A;  3TSG A;  5CTN A;  2JKG A;  5HX9 A;  4KZA A;  3K3D A;  3RTY A;  4GDB A;  3P01 A;  1FR1 A;  3NOP C;  5KSC A;  2PU4 A;  1JTG A;  1PIO A;  2H28 A;  3BRM A;  1BUE A;  4ETZ A;  5HDD A;  4KZ3 A;  4ZTK A;  4R1G A;  3WS5 A;  3DWK A;  1PW1 A;  1LL8 A;  5KZH A;  3T1Q B;  3UDX A;  5GHX A;  2QYB A;  2X02 A;  1YKD A;  3GMW A;  3V3S A;  4GKU A;  3WS4 A;  2Y2M A;  2A2L A;  4CJN A;  5EEC A;  2YKF A;  4MLL A;  3CZD A;  5TJJ A;  3B3X A;  5HDS A;  1YMX A;  3C38 A;  2V9A A;  4M3K A;  5FA7 A;  3LFV A;  3BYD A;  4A5R A;  2P08 A;  3A0S A;  1KE4 A;  3WS2 A;  3V50 A;  1BLS A;  4YNR A;  2ZMF A;  3ZHH A;  4KZ8 A;  4X68 A;  3RH8 B;  3CWF A;  5DFX A;  3WWX A;  4HES A;  4PHT A;  4WYY A;  3DWZ A;  1ERQ A;  1T1A A;  4BL3 A;  1Z6F A;  3ITB A;  2ZQ8 A;  3O3V A;  2O99 A;  1GHM A;  1H8Y A;  3O88 A;  3UNW A;  5DJT A;  3OBF A;  5LBR A;  1F9I A;  3BJN A;  4Y2F A;  1BTL A;  1NZO A;  2PYR A;  4KQR A;  2O9C A;  4IUH A;  3KO6 A;  3EQU A;  1NRF A;  3ZQ5 A;  2W1T B;  5FI7 A;  4Y5F A;  4LV3 A;  4EQ1 A;  3LYX A;  2XA7 M;  2PDR A;  2OAP 1;  2GX5 A;  4JXS A;  4S2L A;  1YLP A;  4OOM A;  4PPR A;  1ERM A;  4MN6 A;  3VFF A;  4DN0 A;  3R4K A;  4P85 A;  4DF6 A;  3O86 A;  1G6A A;  4Y0T A;  3E2L A;  2O9B A;  3SOI A;  5F83 A;  4GDN A;  4BJP A;  1RGZ A;  3PR6 A;  4NG2 A;  1BT5 A;  3FPV A;  4GS9 A;  1ONH A;  5FAT A;  4B4X A;  2WKE A;  4HJ6 A;  1XJ2 A;  5EVI D;  1IYS A;  3LUQ A;  2XQZ A;  3N8R A;  2WYX A;  1D1J A;  4DMZ A;  1SKO A;  5DTS A;  5EV0 A;  3BY8 A;  4ZDX A;  2PHY A;  3DTI A;  3F1P B;  1CF0 A;  1G68 A;  4ZAM A;  5EVE A;  2A24 B;  4R70 A;  3TOI A;  1RCJ A;  2ZMV A;  2BAS A;  3QP2 A;  5DF9 A;  1W63 M;  3IWO A;  4HEF A;  5EPH A;  4ME4 A;  4WEJ A;  3Q1F A;  4L9E A;  2P9V A;  2P7J A;  4ESP A;  1I2S A;  2JKT M;  2L1M A;  4FSF A;  1K57 C;  2EX2 A;  2ZC6 B;  1J3W A;  4JGR A;  4WF0 A;  3ZG7 B;  1TS6 A;  3O87 A;  1DP8 A;  2EA9 A;  1K54 C;  2HP6 A;  2W3F A;  2Q9M A;  1MZU A;  4EXO A;  1BUL A;  3DBA A;  4H8R A;  1DY6 A;  1GA0 A;  4QHC A;  1CJF A;  4H6J B;  4CLC C;  3GSG A;  3QP5 A;  3CAX A;  4ZJ2 A;  3P7N A;  4ZBE A;  1CEF A;  4X1L A;  2E8I A;  4U0T A;  4CLC E;  3QP8 A;  1PYY A;  5G4Z A;  3ZG5 A;  4C3Q A;  3E0Y A;  4JF4 A;  2H5S A;  4LV0 A;  3GV9 A;  4PM6 A;  2ZBB A;  3IHB A;  3CG5 A;  1JNU A;  2Y2I A;  2OOL A;  3VE4 A;  4OOY A;  4WEK A;  4KZ7 A;  2ZM8 A;  4FUW A;  2X71 A;  4JF5 A;  4G3W A;  1YLZ A;  3PBO A;  1M6K A;  4OON A;  1LSV A;  1FCO A;  2HGV A;  3Q7V B;  3NC8 A;  3G6O A;  2PT7 A;  3AGD A;  4D60 A;  5HFO A;  1PRQ A;  3KSG A;  3BWL A;  1IEL A;  3UE6 A;  4JXW A;  2WZZ A;  1P9R A;  3IF6 A;  4YFM A;  4BL2 A;  4N1H A;  3PTE A;  4OPQ A;  1KGF A;  1U60 A;  1K38 A;  3RXX A;  4KG2 A;  3G4P A;  1PFL A;  3UDF A;  3OC2 A;  4ETX A;  2HDS A;  1YAX A;  5AQ9 A;  2OWJ A;  1XGI A;  3MR0 A;  5HD3 A;  4DJ2 A;  2XD1 A;  3IX3 A;  1Q2Q A;  4R4R A;  4OPR A;  2V1A A;  3OPP A;  4XUX A;  4GN2 A;  3HVF A;  4E3K A;  4XT2 A;  3AGF A;  3E4P A;  5DVA A;  3IBJ A;  4DDY A;  4ZRR A;  4KQO A;  5CXW A;  2V8F A;  3IWQ A;  3ISG A;  1OME A;  4YIN A;  4E3M A;  3VFH A;  5DTT A;  5F1G A;  3ITA A;  3HLB A;  3BFG A;  1TS0 A;  5FQQ A;  1KGE A;  3OCL A;  2Y2G A;  1TVF A;  3C7U A;  3H82 B;  2ZQA A;  3MQO A;  1OT9 A;  2WKI A;  3C4P A;  4LV2 A;  5F69 A;  1C3B A;  2B95 A;  3MS6 A;  4L9F A;  3V5M A;  3UY6 A;  1XGJ A;  5A91 A;  2L0W A;  5AQA A;  1YPR A;  3B42 A;  5CGX A;  5J8X A;  2DCF A;  3T4J A;  5GHY A;  3E4O A;  1YLJ A;  3Q81 A;  1NLZ A;  3IS2 B;  4G3K A;  1GSV A;  4EET B;  4I3J A;  2Q0O A;  3G32 A;  5I94 A;  3G34 A;  3ZFZ A;  5EM1 A;  3Q07 A;  4BQM A;  3CMZ A;  5CEB A;  2QJ5 A;  3V67 A;  3A3E A;  3CUE C;  1CI9 A;  2J8Y A;  1S6R A;  5EE8 A;  3T1X A;  1Z09 A;  4NXE A;  2W1R A;  1ACF A;  1TDG A;  1I5Q A;  2W3G A;  3IXH A;  5EVL A;  3UPN A;  2H10 A;  4BD1 A;  4OLG A;  5CTM A;  4WBG A;  1G6O A;  1GCE A;  2G2U A;  1H5X A;  1RGY A;  1ZKJ A;  4Y0O A;  2W3E A;  5HAI A;  4KZ6 A;  1K0K A;  3MSH A;  3MXS A;  4RA7 A;  4MMN A;  1L2S A;  2QZ6 A;  5FDS A;  4M4X A;  4PKY G;  3T4Q A;  2I72 A;  4KUO A;  5GLA A;  1IKG A;  2Y55 A;  1BLC A;  3NJA A;  4DJ3 A;  3BW6 A;  3IX4 A;  2FH5 A;  3MQQ A;  1EI5 A;  2VGJ A;  1X0O A;  3BQ8 A;  1E4D A;  3VP4 A;  4NKP A;  3NDE A;  4DDS A;  4S2N C;  2D01 A;  3TE8 A;  1S1Y A;  1XFQ A;  1YMS A;  4LPZ A;  5HAQ A;  1LL5 A;  4I3I A;  3LR0 A;  4EUZ A;  3V39 A;  4E6W A;  2R9X A;  3V3R A;  3S22 A;  4S2K A;  2WAF A;  3JVV A;  3LO7 A;  5FI6 A;  3FWL A;  5I5L A;  5FAP A;  4NK3 A;  4S2J A;  3N6I A;  5GLC A;  4WZ5 C;  5HWT A;  3NCK A;  1V9Y A;  4I5S A;  1FQG A;  4IJG A;  3T4L A;  1SHV A;  3DAV A;  2KOI A;  2XDM A;  3FPW A;  5L10 A;  5E2E A;  1IKI A;  1OTA A;  4ARZ A;  3R7W A;  3BM6 A;  5FSR A;  5AVE A;  2HDU A;  2Y59 A;  3CPT A;  1NRJ A;  4O01 A;  3UE1 A;  3PXP A;  4X56 A;  5DKL A;  2H0T A;  3PAG A;  1ESI A;  1OTI A;  5J4E A;  4HBT A;  1XFN A;  1XKZ A;  2JN7 A;  5HW3 A;  3IXD A;  4NET A;  3F1O B;  3ZNT A;  3VSL A;  2QHK A;  3UB6 A;  1F2K A;  1JWV A;  4WL9 A;  1N9N A;  1NLY A;  4MDZ A;  4KZ5 A;  4PM5 A;  1KE0 A;  3OPH A;  1XJ6 A;  4EW7 A;  2LB5 A;  3SZT A;  3KSH A;  4RYE A;  4HNB A;  4KG5 A;  5FQ9 A;  1OTD A;  1DJC A;  1WYC A;  3S1Y A;  5KMW A;  4WMC A;  1PI4 A;  4Y13 A;  1DP6 A;  1S1Z A;  4WM9 A;  2OWH A;  2J9O A;  2M7V A;  2W3D A;  3KYE A;  3HRE A;  1OT6 A;  4HP9 A;  3MFX A;  4OVD A;  5AVF A;  5TFQ A;  1MWS A;  5CRF A;  4B4Z A;  3DW0 A;  1ZHH B;  3JVU A;  3MFD A;  1MC0 A;  5KIZ A;  3WRT A;  2C6W B;  2VV7 A;  2WK0 A;  1S4S A;  4LCM A;  1JTD A;  3VP0 A;  3G30 A;  1KVM A;  3NEC A;  3VMA A;  1YT4 A;  3LI8 A;  2VGL S;  3B47 A;  1LI0 A;  2DNS A;  3BFF A;  2Y2K A;  2EX8 A;  5TBM A;  1NWZ A;  3FC7 A;  5M19 A;  2CC1 A;  3JPU A;  4JXV A;  4E3I A;  1WE4 A;  1BLH A;  2M1C A;  4IHQ A;  1MKI A;  1P97 A;  4QU3 A;  2J3T C;  3NHQ A;  4FOF A;  3UB5 P;  3H7W B;  4JPM A;  3VSK A;  3M6B A;  1E3U A;  2VZW A;  5HZH A;  1CEG A;  1Y28 A;  2Z6C A;  2M7U A;  3SS4 A;  1PZP A;  2UWX A;  3LIA A;  4PMA A;  4Z1W A;  3HJI A;  1XP4 A;  4LRZ E;  3VP3 A;  2GJ3 A;  3LY4 A;  2CMN A;  1PNE A;  2ZC7 A;  4DXC A;  3A0R A;  5CER A;  3LIB A;  2B02 A;  3W4P A;  1MXO A;  2WGW A;  4BD0 A;  4DKI A;  4GNU A;  2PR6 A;  1Y54 A;  5D3O A;  2JE5 A;  1K55 C;  2Y2J A;  2ZOI A;  4UAA A;  3W4Q A;  2IWB A;  1NYY A;  5E2H A;  3S7O A;  4JBF A;  2MJ6 A;  2IA2 A;  4YOF A;  4QWO A;  1JWZ A;  1KDW A;  3CHW P;  4GD8 A;  2EFX A;  3EEH A;  4HIA A;  1ESU A;  1ES4 A;  5HAR A;  3MKF A;  1F5M A;  2A49 A;  4KZ9 A;  2J80 A;  4R38 A;  5FAS A;  1Q2P A;  4IVI A;  4OH0 A;  2QKP A;  2ZM2 A;  4BBT A;  3IXG A;  3MF0 A;  2V0U A;  5DKK A;  1VQQ A;  3ZG0 A;  2JC7 A;  2V1Z A;  2ZL1 A;  2RL3 A;  2BLS A;  5L2F A;  1VHM A;  5CHJ A;  1TS7 A;  2XRO A;  1N9O A;  4HOI A;  3HLD A;  2B18 A;  2INW A;  4S2M A;  3LR4 A;  2Z2M B;  3PBT A;  3E98 A;  3HLF A;  5G4Y A;  1FIK A;  3TW8 A;  4K08 A;  3M6H A;  4UA7 A;  2XRN A;  1VET A;  2GDN A;  1VEU A;  2A3U A;  3LR3 A;  1G5U A;  1K57 A;  3QHY A;  5FAO A;  4GJ4 A;  2R9W A;  3OPR A;  5EFW A;  1ZC2 A;  3MQ0 A;  3LIE A;  4HHD A;  1K54 A;  2V1B A;  3PBS A;  2V8C A;  1Y4O A;  2FZ0 A;  1AXB A;  4BLM A;  4DRT A;  4U0X A;  4CLC A;  4OP8 A;  1YLY A;  3IHA A;  4OPZ A;  4O0P A;  1GHI A;  4F3L A;  3A0V A;  2Z6D A;  5EOO A;  4XUZ A;  3PYP A;  2Y91 A;  2ZD8 A;  3K2N A;  3SH8 A;  1S66 L;  4WUJ A;  1HD8 A;  1MBL A;  2ZC3 B;  5FDH A;  4HH3 A;  3FYZ A;  2ZLY A;  4R6L A;  1NYM A;  4IBX A;  3F1O A;  3UB8 A;  1S0W A;  3IH8 A;  1EW0 A;  1SDE A;  3JYI A;  1XJ4 A;  1IYQ A;  3HLW A;  5J7E A;  3QNB A;  5F1F A;  4MN5 A;  5K5B A;  4JLF A;  3DTE A;  4WMC D;  1MWU A;  4BWI A;  5M18 A;  3NI9 A;  3ZNY A;  4P0M A;  2W3H A;  2NUT C;  2WKH A;  4B9O A;  1ERO A;  4Y3I A;  3B33 A;  2XLN A;  1IYO A;  3KYZ A;  3F1N B;  3D3O A;  2Y2H A;  4PAU A;  4MBK A;  4S2O A;  5F5Y A;  5EOE A;  4JGQ A;  5CEC A;  5J3W A;  3NUL A;  3HUO A;  3S7P A;  2C5W B;  2PRF A;  3FKV A;  1FCM A;  1YQS A;  3BEB A;  1T19 A;  3GTC A;  4OOL A;  4OQI A;  5GL9 A;  2WUQ A;  2I9V A;  4GZB A;  1N9B A;  1NY0 A;  4I38 A;  2PBY A;  2XF3 A;  1XA7 A;  3D4F A;  3PHY A;  4X1M A;  3IBR A;  5CGS A;  3WS1 A;  5HL1 A;  3W4O A;  4DE3 A;  2R78 A;  4KG6 A;  4DE2 A;  1E3U D;  1PWG A;  2GNX A;  1JWP A;  3QP4 A;  3IF5 A;  4ZJ3 A;  2Y79 A;  3E4Q A;  4WN5 A;  5CHM A;  4X53 A;  2OV5 A;  1S67 L;  1TDL A;  3CIT A;  2K31 A;  3EQV A;  3LI9 A;  1BYW A;  3QP6 A;  1W5D A;  1WA9 A;  4HJ3 A;  4DXB A;  1N4O A;  4KUK A;  1GHP A;  3SW1 A;  2IWC A;  4R3A A;  1W63 Q;  2PBD P;  4MEZ A;  2HV1 A;  3U2A A;  3UN7 A;  2JCH A;  1HLU P;  1JVJ A;  2JKR I;  3N7W A;  4IBR A;  2W1T A;  2ZMA A;  3LY3 A;  5G18 A;  4D2O A;  4NXF A;  5FEG A;  1HZO A;  1XA1 A;  2OLV A;  1MY8 A;  2H0Y A;  4LGW A;  4EBL A;  4I3A A;  1XXM A;  2VGL M;  3QNC A;  2XH9 A;  5HPI A;  4FD8 A;  2WGV A;  1P0Z A;  3U4L P;  3NIA A;  3D72 A;  3BLS A;  5EM0 A;  3CUE A;  1TEM A;  4Q0H A;  4FCF A;  4IUK A;  4Q0I A;  3P09 A;  4GCZ A;  1YLT A;  4RX3 A;  5IT5 A;  2ZQC A;  3NOT C;  4L0L A;  2XFT A;  2WKQ A;  3HLE A;  1PWD A;  2ZQ9 A;  3VOL A;  4WZ4 A;  5L07 A;  1A0K A;  3LCE A;  3P98 A;  3CJM A;  3W8K A;  4EER A;  2Y2N A;  3MJQ A;  3F1P A;  3HUN A;  2QWS A;  2A24 A;  1OJG A;  5KSH A;  3MZE A;  4KQQ A;  3N8S A;  3MZF A;  3NOU C;  3IT9 A;  1DJB A;  4CLC D;  2J7V A;  3Q82 A;  3N8L A;  1N9L A;  5FEF A;  1FCN A;  1K56 A;  2PD7 A;  4S2N A;  1O07 A;  4BMW A;  5HL6 A;  4R0Q A;  1F98 A;  3M2K A;  1T1B A;  1K4E A;  2HZ5 A;  3BFD A;  3MBZ A;  4GS9 B;  4EEU A;  2EXA A;  4H6J A;  4KEN B;  3ZDJ A;  1OTE A;  1QME A;  3I7J A;  4WZ5 A;  4X6T A;  1P9W A;  4R3B A;  1H3Q A;  4MN7 A;  3VE3 A;  1SKO B;  1IOU A;  1M40 A;  4KZB A;  4PM8 A;  2XR0 A;  4FTX A;  2VA0 A;  5HPF A;  3IWI A;  2PYP A;  1W8Q A;  3VOZ A;  4IED A;  3OOV A;  5A90 A;  2P9V B;  3GR2 A;  3NDG A;  4EWF A;  1YLW A;  3ICY A;  3TJZ C;  2V0W A;  3Q7V A;  4IVK A;  4E3N A;  5FL3 A;  2PU2 A;  3GDI A;  5GLD A;  1DRM A;  5FQJ A;  4EEP A;  1XJ3 A;  5HSQ A;  4OLD A;  2ACG A;  1SZV A;  1ZTU A;  3LIF A;  1TF1 A;  5A92 A;  4MCW A;  1IFQ A;  4U3T A;  3NBL A;  4UQI S;  3W2Z A;  1D06 A;  4F94 A;  5HD5 A;  3T12 B;  5AQ7 A;  4P6B A;  5IU1 A;  4KZ4 A;  3LEZ A;  4ID4 A;  2Y8H A;  2ZQ7 A;  3FKW A;  2ZOH A;  2HP5 A;  3AGE A;  3MXQ A;  1XPB A;  1LL9 A;  1W8Y A;  4QD4 A;  4BBV A;  2WZX A;  4UA9 A;  2Y2P A; 
#chains in the Genus database with same CATH homology
 3MR0 A;  2O9A A;  4EES A;  5HD3 A;  4DJ2 A;  2XRN A;  3H82 A;  1DP9 A;  1T1C A;  2V1A A;  5CX7 A;  2VX8 A;  3LR3 A;  4QPR A;  4XT2 A;  4GJ4 A;  3E4P A;  3IBJ A;  1YSP A;  1LSW A;  4ZRR A;  5EFW A;  4KQO A;  3MQ0 A;  3LIE A;  4HHD A;  1S4R A;  2J3W A;  4JGO A;  4E04 A;  2V1B A;  2VKS A;  3PBS A;  2W27 A;  2FZ0 A;  3EEA A;  1TS0 A;  5MC7 A;  3S7N A;  2JKR M;  4CLC A;  3OCL A;  3T4S A;  1TD5 A;  2JKT I;  4O0P A;  4JGP A;  4F3L A;  3H82 B;  3IS2 A;  3A0V A;  2Z6D A;  3MQO A;  1OT9 A;  3TRC A;  3KX0 X;  4L9G A;  2WKR A;  5F69 A;  4XT2 B;  2OAQ 1;  3PYP A;  3OCN A;  2D02 A;  2XSS A;  1D7E A;  4L9F A;  1GSW A;  2O0Y A;  3K2N A;  3CLO A;  2L0W A;  1S66 L;  4HQA A;  4WUJ A;  3B42 A;  3H9W A;  3F1N A;  3ZYT A;  3KYQ A;  3MMH A;  4HH3 A;  4R6L A;  4EUV A;  3F1O A;  3UB8 A;  1EW0 A;  3T4J A;  1XJ4 A;  3E4O A;  1KOU A;  5J7E A;  4Q0J A;  4CLC B;  4MN5 A;  2YKH A;  5K5B A;  4BBU A;  4BWI A;  4F3L B;  1NLZ A;  3IS2 B;  1MKM A;  4G3V A;  1TS8 A;  4G3K A;  1GSV A;  4EET B;  4I3J A;  3T4K A;  2VV8 A;  2W3H A;  5A8B A;  2NUT C;  2VJW A;  4PKY A;  2KDK A;  4P6Z S;  4WEL A;  5DFY A;  3PBQ A;  4NEE D;  2W0N A;  4B9O A;  4Y3I A;  2QJ5 A;  2JHE A;  3B33 A;  3KYZ A;  3V67 A;  3F1N B;  3C30 A;  3D3O A;  4PAU A;  3CUE C;  4EU0 A;  3EGX C;  5F5Y A;  3UME A;  3FG8 A;  4JGQ A;  3BQA A;  2K2N A;  4HY8 A;  5J3W A;  2LB9 A;  3KSF A;  2QJ7 A;  4NXE A;  1VB6 A;  2W1R A;  2VV6 A;  1T18 A;  4LRY C;  3S7P A;  2W3G A;  5AJG A;  2L4R A;  3HJK A;  3K3D A;  5HWW A;  1T19 A;  5IS1 A;  1G6O A;  4OOL A;  3RTY A;  1LSX A;  3P01 A;  2I9V A;  3PBR A;  2W3E A;  3NOP C;  4I38 A;  4MMN A;  3C8C A;  4O8G A;  2WKP A;  2H28 A;  4M4X A;  3K3C A;  4PKY G;  3T4Q A;  3PHY A;  4KUO A;  3IBR A;  4UEY A;  5HDD A;  4ETZ A;  3NJA A;  4DJ3 A;  3BW6 A;  2R78 A;  2FH5 A;  3MQQ A;  4B93 A;  2GNX A;  1LL8 A;  1X0O A;  2QYB A;  2Y79 A;  3BQ8 A;  3E4Q A;  3T50 A;  1YKD A;  4GHI B;  4WN5 A;  4NKP A;  2A2L A;  1S67 L;  3LR5 A;  2D01 A;  3CIT A;  3TE8 A;  1S1Y A;  2YKF A;  1XFQ A;  2K31 A;  3EQV A;  5TJJ A;  4LPZ A;  3LI9 A;  1BYW A;  1V9Z A;  1WA9 A;  2VLG A;  2EWV A;  4HJ3 A;  4I3I A;  4KUK A;  3LR0 A;  5HDS A;  3PBN A;  3C38 A;  3SW1 A;  2V9A A;  3LFV A;  4R3A A;  3BY9 A;  4I39 A;  2P08 A;  1W63 Q;  3A0S A;  3JVV A;  5F6A A;  4YNR A;  2HV1 A;  2ZMF A;  5I5L A;  4CQH A;  3U2A A;  1GSX A;  4YWZ A;  2JKR I;  2HF6 A;  3RH8 B;  3CWF A;  2W1T A;  5HWT A;  5DFX A;  1V9Y A;  4NXF A;  4HH2 A;  4I5S A;  4PHT A;  4IJG A;  1T1A A;  3T4L A;  4I3A A;  3CI6 A;  2VGL M;  5HPI A;  2O99 A;  1P0Z A;  2KOI A;  3FPW A;  5DJT A;  5HWV A;  2VEA A;  1OTA A;  3OBF A;  2DMW A;  4ARZ A;  3D72 A;  5LBR A;  1F9I A;  3BJN A;  4Y2F A;  3R7W A;  2PYR A;  5AVE A;  3S7Q A;  2NUP C;  1NRJ A;  1YSQ A;  4O01 A;  2O9C A;  4IUH A;  3PXP A;  3KO6 A;  1H8M A;  5DKL A;  3EQU A;  3CUE A;  5J4E A;  1OTI A;  3ZQ5 A;  2W1T B;  1XFN A;  4Q0H A;  4IUK A;  4II7 A;  4Q0I A;  4GCZ A;  3LIC A;  4LLO B;  4Y5F A;  4EQ1 A;  3LYX A;  3UE3 A;  2XA7 M;  4GW9 A;  2PDR A;  2PR5 A;  5IT5 A;  2JN7 A;  2OAP 1;  3NOT C;  4L0L A;  2GX5 A;  3F1O B;  2WKQ A;  4OOM A;  3VOL A;  4MN6 A;  1UWN X;  2PD8 A;  4ARZ B;  5DJU A;  3R7W B;  2G7U A;  4DN0 A;  2QHK A;  3UB6 A;  3R4K A;  4RQ9 A;  4EER A;  4WL9 A;  1N9N A;  1NLY A;  4MDZ A;  3MJQ A;  3F1P A;  2QWS A;  4WLA A;  2A24 A;  1XJ6 A;  1OJG A;  4EW7 A;  2O9B A;  2LB5 A;  5KSH A;  2J3T D;  3KSH A;  4BJP A;  3PR6 A;  5C5K A;  3NOU C;  4HNB A;  3FPV A;  1OTD A;  4GS9 A;  1OJ5 A;  3T4T A;  4CLC D;  2KX6 A;  1DP6 A;  4HJ6 A;  1XJ2 A;  2GZA A;  3VV4 A;  1S1Z A;  3C2W A;  3GEC A;  3LUQ A;  1N9L A;  2OWH A;  2PD7 A;  2M7V A;  2W3D A;  4DMZ A;  1OT6 A;  4HP9 A;  3MFX A;  2K7S A;  4BMW A;  5AVF A;  3BY8 A;  5HL6 A;  4AFI A;  2PHY A;  3F1P B;  1F98 A;  1ZHH B;  1T1B A;  3JVU A;  2A24 B;  4R70 A;  4UQI M;  1MC0 A;  5KIZ A;  2ZMV A;  2BAS A;  5DF9 A;  1W63 M;  2VV7 A;  1S4S A;  1LT0 A;  4GS9 B;  4ME4 A;  3EOI A;  4WEJ A;  3H7W A;  4EEU A;  3UMD A;  4H6J A;  1OTE A;  3LI8 A;  2VGL S;  3B47 A;  1UWP X;  4L9E A;  2P7J A;  1P9W A;  3UB9 A;  1H3Q A;  2JKT M;  4MN7 A;  3VE3 A;  2L1M A;  1IOU A;  4FSF A;  5TBM A;  2HJE A;  1NWZ A;  3FC7 A;  2HJ9 C;  4LRX C;  4JGR A;  4WF0 A;  2EWW A;  1TS6 A;  1G28 A;  1DP8 A;  2EA9 A;  2M1C A;  4IHQ A;  2W3F A;  2VA0 A;  1P97 A;  5HPF A;  2J3T C;  3LID A;  1MZU A;  4EXO A;  3NHQ A;  2PYP A;  3DBA A;  4FOF A;  2XA7 S;  3H7W B;  3O5Y A;  2VZW A;  4H6J B;  4CLC C;  3T4O A;  5HZH A;  3CAX A;  3OOV A;  3P7N A;  3OLO A;  1Y28 A;  2Z6C A;  5F68 A;  2M7U A;  3LIA A;  3EWK A;  3ICY A;  4CLC E;  3TJZ C;  4Z1W A;  3HJI A;  4LRZ E;  2GJ3 A;  4NXG A;  2CMN A;  5G4Z A;  5TBM B;  2V0W A;  3A0R A;  3LIB A;  3ULF A;  2B02 A;  3E0Y A;  1OTB A;  5FL3 A;  3GDI A;  2P04 A;  2PR6 A;  2ZBB A;  1DRM A;  1JNU A;  4EEP A;  1XJ3 A;  2ZOI A;  3HCY A;  2OOL A;  5HSQ A;  3VE4 A;  4WEK A;  3S7O A;  1ZTU A;  2IA2 A;  2MJ6 A;  4YOF A;  3LIF A;  5HDC A;  3UB7 A;  4G3W A;  3PBO A;  1LSV A;  3EEH A;  1ODV A;  1TF1 A;  4HIA A;  2HGV A;  1F5M A;  4MCW A;  1UGU A;  2J80 A;  4R38 A;  3G6O A;  3KSI A;  1IFQ A;  2PT7 A;  2QKP A;  4KQD A;  3KSG A;  3BWL A;  4UQI S;  3RFB A;  3W2Z A;  4BBT A;  1D06 A;  3EGD C;  5HD5 A;  3MF0 A;  3UE6 A;  4HP4 A;  4P6Z M;  5IU1 A;  2V0U A;  5DKK A;  4GLQ A;  1OPX A;  1STZ A;  1P9R A;  4NXB A;  4GHI A;  2Y8H A;  1VHM A;  2ZOH A;  4HI4 A;  3MXQ A;  1TS7 A;  3OC2 A;  2XRO A;  4ETX A;  1N9O A;  4HOI A;  2B18 A;  2INW A;  3LR4 A;  3PBT A;  1YAX A;  3E98 A;  2OWJ A;  5G4Y A;  4BBV A;  5L8M A;  3TW8 A;  2KLI A;  4HJ4 A;  4K08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...