4IUHA

Crystal structure of nrea of staphylococcus carnosus with bound iodide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
FDYQDALDEIRETEKFDFAAIALPEDGLHSAVIKWKYASGNINYRYRMIVLRPGKGLAGLVIRTGSRKIVEDVDAELSQNDKLGYPIVLSEALTAMVAIPLWKNNRVYGALLLGQREGRPLPEGSTTFRINQRLGSFTDEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NreA protein
publication title The NreA Protein Functions as a Nitrate Receptor in the Staphylococcal Nitrate Regulation System.
pubmed doi rcsb
source organism Staphylococcus carnosus subsp. carnosus tm300
molecule tags Nitrate-binding protein
total genus 35
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4iuhA00
3MMHA 3DBAA 4PAUA 3W2ZA 4DN0A 3MQ0A 4Q0HA 2O9CA 4ZRRA 3E0YA 2W1RA 2G7UA 5I5LA 4IUKA 4FOFA 2ZMFA 2XSSA 3LFVA 5HL6A 2Y79A 4Z1WA 4G3VA 3NOUC 4Y3IA 4Y5FA 5K5BA 1MKMA 3IBRA 4IJGA 2XROA 4O01A 5L8MA 3O5YA 4BWIA 1YSQA 2O9AA 4GW9A 3KSFA 2LB9A 4LRXC 2M7UA 3S7QA 3TRCA 2VJWA 2W1TA 2VEAA 2O99A 4G3KA 3IBJA 2K31A 4ETXA 5DFXA 3CI6A 4YOFA 2VKSA 2W3DA 2W3EA 3MF0A 5HSQA 1F5MA 2W3HA 3HCYA 5DFYA 2W3GA 4MCWA 5HPIA 3R4KA 3KSHA 2LB5A 3CITA 4E04A 2VZWA 1MC0A 3G6OA 4EU0A 3OOVA 2KOIA 1VHMA 3S7OA 2HGVA 4RQ9A 4Y2FA 1ZTUA 4EUVA 5AJGA 2B18A 3NOTC 4YNRA 3EEAA 4DMZA 2GX5A 3VV4A 2XRNA 3D3OA 5C5KA 4QPRA 2OOLA 2W1TB 2W3FA 1YSPA 4GLQA 3C2WA 4LRYC 4MDZA 3KSGA 4R6LA 3BJNA 4MMNA 4ME4A 4Q0IA 2O9BA 2Y8HA 1STZA 5LBRA 4ETZA 2K2NA 4IUHA 1TD5A 4LRZE 4G3WA 5TJJA 2M7VA 3ZQ5A 4CQHA 3NOPC 4MN7A 5HPFA 3RFBA 1YKDA 3NHQA 2QYBA 3KO6A 2KLIA 3S7PA 3KSIA 4Q0JA 4O0PA 3E98A 4O8GA 2IA2A 3S7NA 4R70A 3OBFA 2O0YA 3K2NA 1TF1A
chains in the Genus database with same CATH superfamily
4DKIA 2Y4AA 1KE4A 4S2NA 4B88A 1SZVA 4JXVA 4NXFA 5HL6A 1E25A 5EV0A 1LI9A 1GSWA 1FCNA 4UAAA 4QU3A 3BFDA 4NXGA 3B47A 4LGWA 5GLCA 1EROA 2ZOIA 5EPHA 1DJAA 4NG2A 3S7QA 4DE2A 1UWPX 4S2LA 5FI6A 3PAEA 3GR2A 4WZ4A 5MC7A 3PTEA 1XJ3A 3G31A 1YLYA 3BYDA 1MWTA 2HJEA 5EVIB 5J3WA 4XUXA 1FOFA 3DTMA 3MXSA 3VP3A 3MXQA 1N9BA 4S2JA 3S7OA 2A24B 1TDGA 2ZM0A 4HJ3A 4OLGA 2EX9A 4OQGA 1XGIA 4GZBA 4BL2A 2L0WA 4X55A 1Y28A 3NOTC 2ZC4B 3VP2A 2V1ZA 3CLOA 5KSCA 1OT6A 4MN6A 3TJZC 1VETB 1GA0A 1S67L 5HL1A 1XPBA 4R3AA 2HP5A 1NZOA 1JWZA 3DTIA 1ES3A 1K57C 1PIOA 3IF6B 1O7EA 3QP5A 1IKIA 2P7JA 3CHWP 4HY8A 5M1AA 4LCMA 4I38A 2ZL1B 3Q07A 2V8FA 2H0YA 1N9OA 3NDEA 2VLGA 4HESA 3G35A 4LFUA 3MR0A 2NUTC 1PWDA 3IH9A 2OV5A 4D60A 2ZQ7A 2Y79A 3VE4A 4Y15A 4O7DA 4CPKA 1LSXA 3U2AA 2ZC7A 4DE1A 3M6BA 3BQAA 3IBRA 4DDSA 3MS6A 1K4FA 4GW9A 2H28A 3HLCA 2V0UA 2VGLM 1Z6FA 2M7UA 2X01A 3VP4A 1AWIA 5CTMA 4C6YA 3H7WB 2Y2KA 3EQUA 4JXWA 1J9MA 5G4ZA 3ZYTA 3UPPA 4FSFA 4FUWA 4XUZA 1BLHA 5DKKA 4D2OA 1PI4A 3G2ZA 4R23A 2C5WB 1KVLA 3IXBA 2PU4A 3V3RA 4HNBA 2B18A 3A0RA 3IXGA 3MQQA 5HAPA 1G6AA 4HBTA 5CRFA 3G30A 4OLDA 2ZD8A 1W79A 2W1TB 1D7EA 1W8QA 4R6LA 1TEMA 5DF9A 4KG6A 2R78A 3UN7A 3P98A 1Q2QA 2P08A 4GKUA 3T4SA 3D9YA 1WYBA 4Y0UA 1YLJA 4HEFA 4JGRA 4WZ5C 4MN7A 1K6SA 1F9IA 3MKFA 4UA6A 3UE0A 1S1YA 3QNCA 4KG5A 3LR4A 3TE8A 1NJ4A 4KZAA 2QMIA 4WN5A 2M1CA 2JKFA 5HDCA 3LFVA 4JKTA 4Y0OA 2ZJ9A 5E2HA 2AVXA 3VSKA 1UGUA 4JXSA 2Y2OA 2JKGA 4BWIA 2I72A 1DRMA 5KZHA 1ZHHB 4ZAMA 2Q9NA 1OTBA 3TRCA 1H8MA 3WS4A 2J8YA 4Y0TA 5FEFA 3BFFA 1CJFA 1S1ZA 1TVFA 3E4QA 3IBJA 4X69A 3CI6A 3FKVA 2Q0OA 2X71A 1BLCA 3AGDA 5FQKA 4FCFA 2VV8A 3FC7A 3UMEA 3OPHA 1ES4A 3UPOA 1DJCA 3HLBA 5HD5A 2DNSA 4MN5A 4RQ9A 1XXMA 5F68A 1Z09A 3KYQA 5AQ7A 4HIAA 4OQIA 4CLCD 3C8CA 5HWVA 2GNXA 1NXYA 2XA7S 3LY4A 1PWCA 4H6JB 3HUNA 2OAP1 5DTSA 1STZA 2EX8A 3ZG9B 1NYMA 1XX2A 2J80A 4LLOB 2ZQDA 3LUQA 5A90A 4FH2A 3Q7ZA 1BUEA 4CQHA 5HPFA 3PBNA 4N9KA 5HWWA 4KZBA 5TBMB 2V1AA 3CUEA 5CX7A 1M40A 1ZC2A 4KZ6A 4QY6A 4HJ6A 1CF0A 4F3LA 5EE8A 4AFIA 4IUKA 1JNUA 3JPUA 3CWFA 3F1NA 4G3VA 4DXBA 3EGXC 2P04A 3IX3A 3BLSA 5F1FA 1MKMA 3R7WA 5F83A 1XJ2A 2XD5A 5EVLA 4ARZA 1PNEA 1ACFA 1W8YA 1BLSA 2B02A 3PHYA 1F98A 4X1LA 3BFEA 4G3KA 3ICYA 4WM9A 1IYOA 4OOMA 1JVJA 3ITAA 1K38A 1F5MA 2W3HA 3HCYA 1MWRA 1VEUA 3UMDA 4QWOA 3NCKA 3IWOA 4OQ0A 1E3UA 2WYXA 4OH0A 3FZCA 1IYQA 5DJUA 1LSWA 3BLMA 4WEJA 5DF7A 4DDYA 4GDNA 4N1XA 2JCHA 3T4LA 2EWVA 3T1XA 2GJ3A 4OP8A 2FFFB 3DTEA 3BFCA 3TSGA 3LGOA 3IF5A 3PBRA 3T4TA 5M18A 4PPRA 3T4JA 2OWJA 2Y2PA 3WS0A 1YMXA 5EVIA 5F82A 3VE3A 4BL3A 4JPMA 3N8LA 5EVEA 5E2FA 4G3WA 3VFFA 1LHYA 4EV4A 3VOLA 4BENA 1MY8A 1PWGA 3GMWA 3IXDA 5A8BA 1LL5A 3HLWA 4HOIA 5CEDA 4S2OA 1PYYA 1H5XA 3MMHA 1S4RA 1MXOA 3W2ZA 4MNRA 1NLYA 3E0YA 1G28A 1PRQA 4KENB 1VETA 2PR6A 4BQMA 3MXRA 2PDRA 4P85A 3MZFA 2PBYA 2Y2GA 3W4PA 2Z2LB 2XDMA 4E3IA 3C7VA 4KQOA 2EXAA 5AVFA 4ETXA 1JWVA 1MBLA 5GLDA 3ISGA 4JF6A 2FZ0A 4E3MA 3V39A 1XJ4A 4L0LA 4KQRA 4P6ZS 5FDSA 4N9LA 4UQIS 2QKPA 2HGVA 2XFSA 5FSRA 2HJ9C 3C4PA 4EUVA 1MKIA 4U0TA 3M2KA 1CI8A 4NXBA 2E8JA 2IWCA 2YKHA 4EESA 5C5KA 1K25A 3RTYA 5FQMA 3Q7VB 2W3FA 5DTKA 3DW0A 1ONGA 3IX4A 3MZDA 3E2KA 2CC1A 4EEPA 2Y55A 4PM8A 3CPTB 4R38A 3FYZA 3UNWA 4IBXA 2HP6A 2Y2LA 5EM1A 3TW8A 3A0VA 2QYBA 3FKWA 1Y54A 3QP6A 4O0PA 3PYPA 3V50A 4X1MA 3VP1A 2PD7A 5G4YA 3C30A 1ERMA 1FSYA 1H8YA 3N7WA 2J3TD 2HZ5A 4DE0A 1L2SA 3IS2A 4EWFA 4RX2A 4YFMA 4RX3A 4Z1WA 5E43A 4PM5A 4E6XA 2XGNA 3UO9A 1S66L 1YLTA 5FL3A 3IQAA 4UEYA 2ZC3B 3UDIA 4E6WA 1M6KA 3BY8A 3GDIA 3GTCA 4KZ3A 1PZOA 5TGFA 2H5SA 3F1PB 1O07A 2VK3A 2WKHA 1KVMA 1DP8A 4EEUA 1WYCA 3LY3A 3SOIA 1LL9A 3CG5A 2Y2IA 4MCWA 4EUZA 3R4KA 3KSHA 1VM1A 2HP9A 3F1OB 4E04A 5HD3A 4GN2A 3FWLA 3UY6A 5EOEA 3C5AA 4L9EA 2HF6A 4IVKA 5CHUA 5AJGA 2JN7A 2XD1A 2H0TA 1ERQA 4DMZA 3WS1A 3H9WA 2GX5A 5D3OA 1DJBA 1XA1A 2PHYA 1NRFA 2OOLA 4WELA 3SS4A 2PRFA 3NY4A 1ZG4A 5L2FA 4FH4A 4X53A 2ZMVA 2ZM2A 4NKPA 3NIAA 2A2LA 3QHYA 5IT5A 4EQIA 3HJKA 1K54C 3S4XA 1T19A 3QNBA 1K55A 2V9AA 2H10A 2WAFA 3MZEA 3E98A 5CHJA 2WZXA 2HV1A 2Z6DA 4GD8A 3DWKA 3DBAA 1RGYA 5DTTA 5KSHA 1IYPA 1Y4OA 2INWA 1NLZA 3O88A 4H6JA 3LI9A 2OLUA 1W5DA 4BBTA 1HTZA 3IXHA 4Y5FA 4GOGA 3O5YA 4UHUA 5HARA 4EXOA 3UB5P 1H8ZA 3VP0A 2WGWB 3LR0A 3C38A 1GHPA 2VGLS 2VEAA 4DRTA 2B5RA 1W63M 2XF3A 1FR6A 3OPLA 4R3JA 4S2PA 3QP1A 1S6RA 3LO7A 2PYRA 1TS8A 1K56A 3VMAA 3OOVA 4LENA 4DF6A 3UB7A 4ZDXA 1SKOA 3KYZA 1E3UD 3UB6A 4JXGA 4WBGA 1FSWA 3UE6A 1N9LA 3D3OA 4LPZA 3U4LP 4IBRA 4RA7A 5EECA 1FILA 5CEBA 1YSPA 4WZ5A 3KSGA 3UE3A 1BYWA 1GHMA 2D01A 4U0XA 1T18A 5LBRA 1N4OA 4EQ1A 4A5RA 1LSVA 3OCLA 1BULA 4S2MA 3PXPA 5EVID 3EQVA 4XT2A 2VV7A 1KGGA 4GHIB 5U47A 4MBFA 4HP9A 2FH5A 4OQHA 3GECA 3K2NA 5JYOA 2PR5A 4II7A 4OP5A 4PMAA 2G7UA 4FOFA 1ES2A 3B33A 2Y2NA 2NUPC 4EBPA 3UB8A 4KUOA 4K08A 5K5BA 3ITBA 3P01A 5GHXA 3ZG8B 3BEBA 3KSFA 1TS6A 5GHZA 1D1JA 2EWWA 3ZGAB 1SDNA 2JBFA 4E3KA 2KDKA 2VKSA 3T4QA 2JE5A 3H82B 2XEPA 2YKFA 2W3EA 1MWUA 3IX8A 1OTIA 3E4OA 5DVAA 2V20A 2ZQAA 4C75A 3FG8A 2KOIA 2A3UA 3WRTA 2ACGA 1DY6A 4M3KA 2XLNA 3LYXA 2L4RA 3V3SA 3OPPA 5HX9A 4I5SA 3A0SA 3N8SA 4JBFA 4KZ8A 1YAXA 5CHMA 4OPZA 2Y59A 4R1GA 4I3IA 1T1BA 4MMNA 2ZQ9A 2Z2MB 3PR6A 2QJ5A 2G2WA 3O86A 4EERA 5F69A 1ESUA 2V0WA 1L3LA 5TJJA 4LV3A 3IWQA 3JVVA 4CLCE 3NDGA 4OPYA 3K3CA 1TDLA 1RP5A 5CGXA 3JYIA 3S7NA 4HJ4A 4DE3A 4GS9B 3UDXA 4ZJ3A 1TF1A 3TG9A 2QZ6A 2E8IA 1HVBA 2V8CA 5FQJA 4IVIA 2ZM8A 3NOUC 3M6HA 1PW1A 4CJNA 4GDBA 4OOYA 4IJGA 3KX0X 3ZNTA 1S4SA 1T1AA 3MSHA 1EWZA 5AVEA 1KE0A 2XH9A 2VJWA 5L09A 1DP9A 1C3BA 2J7VA 4WL9A 4YOFA 2WUQA 4E3OA 1KDSA 1L0DA 4ID4A 4EBNA 1CQAA 2A49A 2GZAA 4R4SA 1X0OA 5IU1A 1U60A 3AGEA 1SDEA 4Y2FA 3QP4A 3T4KA 2WGVA 4L9FA 1OMEA 3HLEA 3UB9A 2ZC5B 4YNRA 3A3JA 2D02A 3WS5A 1LI0A 4QPRA 3F1PA 3GVBA 5AQAA 5FAOA 4B93A 4F94A 3MFXA 3BJNA 1TS0A 3SH7A 3G34A 1MZUA 3D4FA 3A3FA 3PBTA 3F1OA 4X25A 4R3BA 1Q2PA 1NY0A 1YLZA 3ZQ5A 2G2UA 1I2SA 3LIDA 3G2YA 3LIBA 1FCMA 4WMCA 1W63Q 2VX8A 4R70A 1H0MA 3QP2A 4OKPA 3FV7A 5EUAA 4GD6A 4BD1A 2O9CA 3WWXA 2WGIA 1KGEA 4FTXA 3ZG5A 1ES5A 2XSSA 1VB6A 1JWPA 5FAPA 2ZOHA 1A0KA 3BQ8A 2A24A 5E2GA 3WS2A 2XROA 3V67A 2JKRI 3DAVA 3S1YA 3SS5A 1OTAA 2LB9A 3A3IA 1JTDA 2IWDA 2Y2MA 2JKRM 4P0MA 5FASA 4KZ9A 1F2KA 5CGWA 3T1SA 3IF6A 2XFTA 5FEGA 2W3GA 3PBOA 5HPIA 2WKEA 3G6OA 4S2IA 4LV0A 2ZL1A 1XJ6A 5CXWA 1K0KA 3HVFA 2EX2A 4QD4A 3OPRA 1K56D 2K7SA 3QP8A 4JF4A 2WGWA 1YLPA 2J9PA 1P0ZA 5FAQA 3VV4A 4NK3A 3RJUA 2L1MA 3SW1A 5CECA 3C2WA 3OCNA 1YQSA 3S22A 5DF8A 4DJ2A 4NXEA 2BASA 2WADA 4Q0IA 5AQ9A 4ESPA 4LV2A 1YMSA 3MJQA 5F5YA 4KQDA 4ZBEA 4Q8IA 2WKQA 5FQIA 2EX6A 1TS7A 3MFDA 4FD8A 1IKGA 3H7WA 3S7PA 3NJAA 1XP4A 2PBDP 3OBFA 3NECA 2JKTI 4K0XA 2WKIA 4Q0HA 4WF0A 4X6TA 2ZMFA 4QY5A 2JKTM 3PAGA 2IWBA 4Y17A 2V2FF 5E2EA 1RGZA 3N8RA 2PD8A 2XR0A 3MBZA 4GHIA 3NBLA 3HBRA 1QMEA 2HPBA 2W1TA 4NEED 4NETA 2QHKA 4ZJ2A 3AGFA 3ZG7B 5KMWA 4PHTA 4ZJ1A 4QHCA 4PM7A 5HFOA 2WKRA 5GHYA 2JHEA 5J8XA 2PAVP 3F1NB 1T1CA 2R9WA 4E3LA 1XA7A 3R7WB 4BJPA 1AXBA 5HAIA 5FI7A 2X02A 1JTGA 1LL8A 5FA7A 4ARZB 1CEGA 3NC8A 3O87A 2BG1A 5IHVA 3T4OA 2Z6CA 3UDFA 4KG2A 1L0EA 4LRYC 1GHIA 3H82A 4CLCC 1IYSA 2WK0A 2EXBA 2HDQA 2Y2JA 4C3QA 4ME4A 2O9BA 1VEUB 4Y13A 3HUMA 1KE3A 1FR1A 1SHVA 1K57A 4IHQA 4PKYG 3RFBA 3BW6A 4KZ4A 2O0YA 4QB8A 4R0QA 3E2LA 3LIAA 4KZ5A 3T12B 2W1RA 5I5LA 1WE4A 1BT5A 3PBSA 4N1HA 4Y3IA 1NWZA 2P74A 4O01A 4P87A 4JGQA 3NI9A 3LCEA 1H3QA 4S2NC 2VA0A 5HDSA 3IH8A 4GS9A 4DJ3A 1LLBA 3MF0A 5HSQA 3BFGA 4X68A 3OZHA 2LB5A 2CMNA 3ZHHA 3LI8A 5A92A 3NULA 2P9VB 5TBMA 3ZVTA 3SH9A 4ZTKA 5HDDA 1XFQA 1WA9A 5M19A 4BD0A 4Z9QA 4L9GA 2FFYA 1ZG6A 2ZQ8A 4DXCA 4HH2A 5BOHA 5GLBA 2V1BA 4RYEA 3GQZA 3B42A 3WRZA 1IELA 2R9XA 3Q81A 4PM9A 1K55C 3RXWA 1BTLA 3A3DA 4WUJA 5CGSA 1YT4A 3N4IA 2ZC6B 1UWNX 3ZDJA 5DKLA 1CI9A 3OC2A 5FDHA 3LEQA 4WMCD 2UV0E 1L0GA 1GSVA 5HZHA 3EOIA 4KQQA 1YM1A 3TOIA 3K3DA 4I3AA 3W8KA 1XGJA 4CLCB 5FQ9A 5JYPA 3CZDA 3UE1A 3M2JA 4R4RA 4E3JA 4X56A 3T50A 2JC7A 3BWLA 2ZQCA 3CMZA 5F6AA 3ZCZA 1SKFA 1EI5A 4HBUA 1OTEA 4YINA 4BMWA 3HLDA 3G32A 1OPXA 5DFYA 3Q1FA 4BBUA 3IHBA 2RCXA 3CITA 1DP6A 1KOUA 3IS2B 4WLAA 1FQGA 2RL3A 2ZLYA 3N6IA 4EU0A 3KYEA 1G6OA 2C6WB 4N92A 4EW7A 1XKZA 3EEAA 5EM0A 5G18A 4UA9A 3BM6A 1OTDA 4GLQA 1YLWA 2ZMAA 3IT9A 1P97A 1IFQA 2EA9A 2Y8HA 4ETZA 3EEHA 2Y91A 3VOYA 2QPNA 5A93A 2DCFA 4LRZE 5F1GA 2ZBBA 5TR7A 1FCOA 3GV9A 1YKDA 1PI5A 5A91A 1SCWA 4I39A 1BZAA 4Q0JA 4B4XA 4O8GA 1W7FA 5HW3A 5EFWA 5IS1A 3IHAA 3EWKA 4KUKA 3VFHA 3I7JA 5FI2A 4DN0A 5CTNA 1HLUP 3GSGA 1OJ5A 4MBHA 1HZOA 3DTKA 4OPQA 1NZUA 2J3TC 4HI4A 3D72A 2W27A 5L8MA 1YSQA 4HP4A 1CEFA 4OPRA 4LRXC 1N9NA 4YWZA 3Q7VA 4K91A 2PYPA 5DJTA 5KIZA 2W3DA 1BSGA 1KDWA 3CPTA 2W0NA 5FQQA 4I3JA 4GB7A 1OT9A 1V9ZA 2BLSA 3BECA 1P9WA 1ZKJA 1I2WA 1S0WA 1ZTUA 3T1RA 2OWHA 3SS3A 1ESIA 2J3WA 3FPVA 4M4XA 3UPNA 2XA7M 4PM6A 3ZVWA 4E3NA 4JF5A 1PFLA 3LR3A 2DMWA 4MDZA 1PZPA 1P9RA 2PU2A 3LEZA 3O3VA 1QMFA 5GL9A 1EW0A 4S2KA 2HDRA 1E4DA 2M7VA 3C4OA 1BLPA 4EBLA 4UA7A 4K0WA 2QWSA 5L10A 3KO6A 3SZTA 2Y2HA 1SKOB 2IA2A 4GNUA 3DWZA 3C7UA 1FIKA 3GRJA 3VSLA 2OAQ1 4PAUA 1LT0A 4ZRRA 2B95A 3L9KA 2WZZA 1K4EA 4LV1A 1CK3A 3HUOA 5AQBA 2VGKA 2DRWA 2WAEA 3MQOA 3CAXA 3CUEC 3Q82A 4HH3A 4B4ZA 4HHDA 3LIEA 3SH8A 2HDSA 2VV6A 4XT2B 5HWTA 3P09A 1OJGA 3JVUA 1IEMA 1MWSA 3RXXA 3CJMA 1D06A 4XXRA 1IOUA 1GSXA 1G5UA 3E4PA 3ZNYA 3PBQA 2VZWA 3LIFA 2Y2QA 1L0FA 3HL9A 2UWXA 2EFXA 4MEZA 1XFNA 5J4EA 4OOLA 2BTFP 5L07A 2XRNA 4U3TA 2HDUA 3ZG0A 5EOOA 4P6BA 3LICA 3ZFZA 2EFUA 1NRJA 1MPLA 2I9VA 1HD8A 1GA9A 4IUHA 3HJIA 1I5QA 2QJ7A 4HQAA 1K6RA 3HREA 2P9VA 3KSIA 1ALQA 5EVIC 1PW8A 2KX6A 4JGPA 1YPRA 3MQ0A 2PT7A 2GDNA 5HAQA 3B3XA 1J3WA 5TFQA 3OLOA 4Y7PA 4JLFA 4RVAA 2OSUA 3EGDC 3P7NA 2XK1A 4GCZA 4B9OA 2O9AA 4WEKA 3LR5A 3W4QA 5J7EA 4EETB 5CERA 5GLAA 2O99A 3RH8B 1ODVA 2WKPA 2K31A 5DFXA 3IF6C 3T1QB 1GCEA 4P6ZM 3V5MA 4BBVA 4WYYA 4UQIM 1V9YA 1KGFA 4MLLA 1RCJA 3VOZA 2XQZA 4MBKA 1MC0A 1VHMA 3G4PA 4KZ7A 1VQQA 4CLCA 5I94A 3IWIA 4PKYA 1G68A 2MJ6A 4OONA 4IEDA 2VGJA 3W4OA 3HLGA 3BY9A 3ULFA 5FATA 4F3LB 3MKEA 4GJ4A 3FPWA 3HLFA 2J9OA 2K2NA 4H8RA 1TD5A 1ONHA 3L7HA 2OLVA 4QJGA 2Q9MA 4OVDA 3NOPC 4BLMA 3A3EA 3NHQA 1K54A 3BRMA 2KLIA 1NYYA 4LCLA 4JGOA
chains in the Genus database with same CATH topology
3MMHA 1S4RA 3W2ZA 1NLYA 1GSVA 3E0YA 5HZHA 1G28A 3EOIA 2PR6A 4NXFA 5HL6A 2PDRA 3NOUC 3K3DA 4I3AA 1GSWA 4CLCB 4IJGA 3KX0X 4NXGA 1S4SA 1T1AA 3B47A 2ZOIA 5AVEA 4KQOA 3T50A 3S7QA 1UWPX 2VJWA 3BWLA 5F6AA 1DP9A 4WL9A 5AVFA 4ETXA 5MC7A 1OTEA 4YOFA 1XJ3A 4BMWA 2FZ0A 1XJ4A 4L0LA 2HJEA 1OPXA 5DFYA 4BBUA 4P6ZS 5J3WA 3CITA 1DP6A 1KOUA 2GZAA 3IS2B 4WLAA 3MXQA 1X0OA 4UQIS 5IU1A 4EU0A 2QKPA 3S7OA 2HGVA 2A24B 1G6OA 4HJ3A 2HJ9C 4Y2FA 4EUVA 3T4KA 4L9FA 2L0WA 1Y28A 4EW7A 3NOTC 3UB9A 4YNRA 3EEAA 4NXBA 3CLOA 2YKHA 2D02A 4EESA 1OT6A 4MN6A 5C5KA 3TJZC 4QPRA 3RTYA 3F1PA 1OTDA 2W3FA 4B93A 4GLQA 3MFXA 3BJNA 1TS0A 1P97A 1S67L 4EEPA 4R3AA 1IFQA 1MZUA 2EA9A 2Y8HA 4R38A 4ETZA 3EEHA 3PBTA 3F1OA 4LRZE 3TW8A 3ZQ5A 2ZBBA 2P7JA 4HY8A 3LIDA 3LIBA 4I38A 3A0VA 1YKDA 2QYBA 1W63Q 4I39A 4Q0JA 4O0PA 4O8GA 2VX8A 3PYPA 4R70A 5EFWA 5IS1A 1N9OA 2VLGA 2PD7A 5G4YA 3EWKA 3C30A 4KUKA 3MR0A 2NUTC 2J3TD 4DN0A 2O9CA 3IS2A 2XSSA 1OJ5A 1VB6A 2Y79A 3VE4A 4Z1WA 2ZOHA 3BQ8A 2A24A 1LSXA 3U2AA 4HI4A 2J3TC 3D72A 2W27A 3BQAA 3IBRA 1S66L 2XROA 5L8MA 3V67A 1YSQA 2JKRI 5FL3A 4HP4A 4UEYA 4GW9A 2H28A 1OTAA 2LB9A 4LRXC 2V0UA 2VGLM 1N9NA 2M7UA 4YWZA 3BY8A 3GDIA 2JKRM 3F1PB 3H7WB 3EQUA 2PYPA 5DJTA 5KIZA 5G4ZA 3ZYTA 2W3DA 1DP8A 4EEUA 4FSFA 2W0NA 4I3JA 2W3GA 3PBOA 1OT9A 1V9ZA 4MCWA 5DKKA 5HPIA 3R4KA 3KSHA 3F1OB 4E04A 5HD3A 3G6OA 1XJ6A 1P9WA 4L9EA 2HF6A 1ZTUA 2OWHA 2K7SA 2J3WA 5AJGA 2B18A 2JN7A 3A0RA 3MQQA 4HNBA 3FPVA 4M4XA 4DMZA 2XA7M 3H9WA 1P0ZA 2GX5A 3VV4A 2PHYA 2OOLA 4WELA 2L1MA 2W1TB 3LR3A 1D7EA 3SW1A 2DMWA 3C2WA 4MDZA 3OCNA 1P9RA 4R6LA 5DF9A 4DJ2A 4NXEA 2BASA 2ZMVA 4Q0IA 4NKPA 1EW0A 2R78A 3MJQA 2P08A 2A2LA 5F5YA 3T4SA 5IT5A 2M7VA 3HJKA 4KQDA 2WKQA 1T19A 4JGRA 4MN7A 1TS7A 2QWSA 1F9IA 2V9AA 3KO6A 3H7WA 3S7PA 3NJAA 1S1YA 3E98A 2IA2A 3OBFA 4JGOA 2HV1A 3LR4A 2Z6DA 3TE8A 4WN5A 2JKTI 2M1CA 2OAQ1 3DBAA 4PAUA 1LT0A 5KSHA 4Q0HA 2INWA 1NLZA 4ZRRA 5HDCA 4WF0A 4H6JA 3LI9A 2ZMFA 3LFVA 4BBTA 2JKTM 3MQOA 3CAXA 1UGUA 3CUEC 4Y5FA 4HH3A 4HHDA 3LIEA 3O5YA 2PD8A 4BWIA 4EXOA 1DRMA 2VV6A 1ZHHB 4GHIA 3LR0A 3C38A 4XT2B 5HWTA 1OTBA 3TRCA 1OJGA 2W1TA 1H8MA 4NEED 2VGLS 2VEAA 3JVUA 3E4QA 1S1ZA 1W63M 3IBJA 3CI6A 2QHKA 1D06A 2VV8A 3FC7A 3UMEA 4PHTA 1IOUA 1GSXA 2PYRA 2WKRA 3E4PA 2JHEA 1TS8A 3PBQA 2VZWA 3OOVA 3LIFA 3F1NB 5HD5A 4MN5A 1T1CA 4RQ9A 3UB7A 5F68A 3KYZA 3R7WB 1XFNA 3UB6A 5J4EA 3KYQA 4BJPA 4OOLA 1LL8A 4HIAA 4CLCD 4ARZB 3UE6A 3C8CA 1N9LA 2XRNA 3D3OA 4LPZA 5HWVA 3T4OA 2GNXA 2XA7S 2Z6CA 1YSPA 3LICA 4LRYC 4H6JB 3KSGA 3UE3A 3H82A 4CLCC 1NRJA 2OAP1 1BYWA 2D01A 2I9VA 4ME4A 2O9BA 1T18A 1STZA 5LBRA 2J80A 4IUHA 4LLOB 4EQ1A 1LSVA 3OCLA 3HJIA 3PXPA 3LUQA 3EQVA 4IHQA 2QJ7A 4XT2A 4HQAA 4CQHA 2VV7A 4PKYG 4GHIB 5HPFA 3RFBA 3PBNA 3BW6A 3KSIA 4HP9A 2FH5A 5HWWA 5TBMB 2V1AA 3CUEA 3GECA 2O0YA 3K2NA 5CX7A 2KX6A 4JGPA 2PR5A 3LIAA 4HJ6A 3MQ0A 4F3LA 4II7A 2W1RA 2PT7A 2G7UA 5I5LA 4AFIA 4IUKA 4FOFA 3PBSA 1JNUA 3OLOA 3CWFA 3F1NA 3B33A 4G3VA 2NUPC 3UB8A 4KUOA 4K08A 3EGXC 3EGDC 4Y3IA 2P04A 5K5BA 1NWZA 3P7NA 4GCZA 1MKMA 3P01A 3R7WA 4B9OA 4O01A 1XJ2A 2O9AA 4WEKA 3LR5A 3KSFA 4ARZA 1TS6A 4JGQA 1H3QA 2EWWA 4EETB 5J7EA 2B02A 3PHYA 2VA0A 5HDSA 1F98A 2O99A 3RH8B 1ODVA 2WKPA 4G3KA 2K31A 2KDKA 3ICYA 4GS9A 5DFXA 2VKSA 3T4QA 4DJ3A 4OOMA 3H82B 2YKFA 4P6ZM 2W3EA 3MF0A 5HSQA 1F5MA 2W3HA 3HCYA 1OTIA 4BBVA 3UMDA 4UQIM 3E4OA 1V9YA 2LB5A 2CMNA 3LI8A 3FG8A 1MC0A 2KOIA 1VHMA 5DJUA 1LSWA 4CLCA 4WEJA 3LYXA 4PKYA 2L4RA 2MJ6A 5TBMA 3T4LA 2EWVA 2GJ3A 4I5SA 3A0SA 5HDDA 1XFQA 1WA9A 1YAXA 3PBRA 3T4TA 3BY9A 3ULFA 3T4JA 4F3LB 4L9GA 4GJ4A 3FPWA 2OWJA 4I3IA 1T1BA 4HH2A 4MMNA 3PR6A 2QJ5A 2V1BA 3VE3A 2K2NA 3B42A 4EERA 1TD5A 5F69A 2V0WA 4G3WA 5TJJA 3VOLA 4WUJA 3JVVA 3NOPC 4CLCE 3K3CA 3NHQA 5A8BA 2KLIA 1UWNX 4HOIA 5DKLA 3S7NA 4HJ4A 3OC2A 4GS9B 1TF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMH A;  3DBA A;  4PAU A;  3W2Z A;  4DN0 A;  3MQ0 A;  4Q0H A;  2O9C A;  4ZRR A;  3E0Y A;  2W1R A;  2G7U A;  5I5L A;  4IUK A;  4FOF A;  2ZMF A;  2XSS A;  3LFV A;  5HL6 A;  2Y79 A;  4Z1W A;  4G3V A;  3NOU C;  4Y3I A;  4Y5F A;  5K5B A;  1MKM A;  3IBR A;  4IJG A;  2XRO A;  4O01 A;  5L8M A;  3O5Y A;  4BWI A;  1YSQ A;  2O9A A;  4GW9 A;  3KSF A;  2LB9 A;  4LRX C;  2M7U A;  3S7Q A;  3TRC A;  2VJW A;  2W1T A;  2VEA A;  2O99 A;  4G3K A;  3IBJ A;  2K31 A;  4ETX A;  5DFX A;  3CI6 A;  4YOF A;  2VKS A;  2W3D A;  2W3E A;  3MF0 A;  5HSQ A;  1F5M A;  2W3H A;  3HCY A;  5DFY A;  2W3G A;  4MCW A;  5HPI A;  3R4K A;  3KSH A;  2LB5 A;  3CIT A;  4E04 A;  2VZW A;  1MC0 A;  3G6O A;  4EU0 A;  3OOV A;  2KOI A;  1VHM A;  3S7O A;  2HGV A;  4RQ9 A;  4Y2F A;  1ZTU A;  4EUV A;  5AJG A;  2B18 A;  3NOT C;  4YNR A;  3EEA A;  4DMZ A;  2GX5 A;  3VV4 A;  2XRN A;  3D3O A;  5C5K A;  4QPR A;  2OOL A;  2W1T B;  2W3F A;  1YSP A;  4GLQ A;  3C2W A;  4LRY C;  4MDZ A;  3KSG A;  4R6L A;  3BJN A;  4MMN A;  4ME4 A;  4Q0I A;  2O9B A;  2Y8H A;  1STZ A;  5LBR A;  4ETZ A;  2K2N A;  4IUH A;  1TD5 A;  4LRZ E;  4G3W A;  5TJJ A;  2M7V A;  3ZQ5 A;  4CQH A;  3NOP C;  4MN7 A;  5HPF A;  3RFB A;  1YKD A;  3NHQ A;  2QYB A;  3KO6 A;  2KLI A;  3S7P A;  3KSI A;  4Q0J A;  4O0P A;  3E98 A;  4O8G A;  2IA2 A;  3S7N A;  4R70 A;  3OBF A;  2O0Y A;  3K2N A;  1TF1 A; 
#chains in the Genus database with same CATH topology
 4DKI A;  2Y4A A;  1KE4 A;  4S2N A;  4B88 A;  1SZV A;  4JXV A;  4NXF A;  5HL6 A;  1E25 A;  5EV0 A;  1LI9 A;  1GSW A;  1FCN A;  4UAA A;  4QU3 A;  3BFD A;  4NXG A;  3B47 A;  4LGW A;  5GLC A;  1ERO A;  2ZOI A;  5EPH A;  1DJA A;  4NG2 A;  3S7Q A;  4DE2 A;  1UWP X;  4S2L A;  5FI6 A;  3PAE A;  3GR2 A;  4WZ4 A;  5MC7 A;  3PTE A;  1XJ3 A;  3G31 A;  1YLY A;  3BYD A;  1MWT A;  2HJE A;  5EVI B;  5J3W A;  4XUX A;  1FOF A;  3DTM A;  3MXS A;  3VP3 A;  3MXQ A;  1N9B A;  4S2J A;  3S7O A;  2A24 B;  1TDG A;  2ZM0 A;  4HJ3 A;  4OLG A;  2EX9 A;  4OQG A;  1XGI A;  4GZB A;  4BL2 A;  2L0W A;  4X55 A;  1Y28 A;  3NOT C;  2ZC4 B;  3VP2 A;  2V1Z A;  3CLO A;  5KSC A;  1OT6 A;  4MN6 A;  3TJZ C;  1VET B;  1GA0 A;  1S67 L;  5HL1 A;  1XPB A;  4R3A A;  2HP5 A;  1NZO A;  1JWZ A;  3DTI A;  1ES3 A;  1K57 C;  1PIO A;  3IF6 B;  1O7E A;  3QP5 A;  1IKI A;  2P7J A;  3CHW P;  4HY8 A;  5M1A A;  4LCM A;  4I38 A;  2ZL1 B;  3Q07 A;  2V8F A;  2H0Y A;  1N9O A;  3NDE A;  2VLG A;  4HES A;  3G35 A;  4LFU A;  3MR0 A;  2NUT C;  1PWD A;  3IH9 A;  2OV5 A;  4D60 A;  2ZQ7 A;  2Y79 A;  3VE4 A;  4Y15 A;  4O7D A;  4CPK A;  1LSX A;  3U2A A;  2ZC7 A;  4DE1 A;  3M6B A;  3BQA A;  3IBR A;  4DDS A;  3MS6 A;  1K4F A;  4GW9 A;  2H28 A;  3HLC A;  2V0U A;  2VGL M;  1Z6F A;  2M7U A;  2X01 A;  3VP4 A;  1AWI A;  5CTM A;  4C6Y A;  3H7W B;  2Y2K A;  3EQU A;  4JXW A;  1J9M A;  5G4Z A;  3ZYT A;  3UPP A;  4FSF A;  4FUW A;  4XUZ A;  1BLH A;  5DKK A;  4D2O A;  1PI4 A;  3G2Z A;  4R23 A;  2C5W B;  1KVL A;  3IXB A;  2PU4 A;  3V3R A;  4HNB A;  2B18 A;  3A0R A;  3IXG A;  3MQQ A;  5HAP A;  1G6A A;  4HBT A;  5CRF A;  3G30 A;  4OLD A;  2ZD8 A;  1W79 A;  2W1T B;  1D7E A;  1W8Q A;  4R6L A;  1TEM A;  5DF9 A;  4KG6 A;  2R78 A;  3UN7 A;  3P98 A;  1Q2Q A;  2P08 A;  4GKU A;  3T4S A;  3D9Y A;  1WYB A;  4Y0U A;  1YLJ A;  4HEF A;  4JGR A;  4WZ5 C;  4MN7 A;  1K6S A;  1F9I A;  3MKF A;  4UA6 A;  3UE0 A;  1S1Y A;  3QNC A;  4KG5 A;  3LR4 A;  3TE8 A;  1NJ4 A;  4KZA A;  2QMI A;  4WN5 A;  2M1C A;  2JKF A;  5HDC A;  3LFV A;  4JKT A;  4Y0O A;  2ZJ9 A;  5E2H A;  2AVX A;  3VSK A;  1UGU A;  4JXS A;  2Y2O A;  2JKG A;  4BWI A;  2I72 A;  1DRM A;  5KZH A;  1ZHH B;  4ZAM A;  2Q9N A;  1OTB A;  3TRC A;  1H8M A;  3WS4 A;  2J8Y A;  4Y0T A;  5FEF A;  3BFF A;  1CJF A;  1S1Z A;  1TVF A;  3E4Q A;  3IBJ A;  4X69 A;  3CI6 A;  3FKV A;  2Q0O A;  2X71 A;  1BLC A;  3AGD A;  5FQK A;  4FCF A;  2VV8 A;  3FC7 A;  3UME A;  3OPH A;  1ES4 A;  3UPO A;  1DJC A;  3HLB A;  5HD5 A;  2DNS A;  4MN5 A;  4RQ9 A;  1XXM A;  5F68 A;  1Z09 A;  3KYQ A;  5AQ7 A;  4HIA A;  4OQI A;  4CLC D;  3C8C A;  5HWV A;  2GNX A;  1NXY A;  2XA7 S;  3LY4 A;  1PWC A;  4H6J B;  3HUN A;  2OAP 1;  5DTS A;  1STZ A;  2EX8 A;  3ZG9 B;  1NYM A;  1XX2 A;  2J80 A;  4LLO B;  2ZQD A;  3LUQ A;  5A90 A;  4FH2 A;  3Q7Z A;  1BUE A;  4CQH A;  5HPF A;  3PBN A;  4N9K A;  5HWW A;  4KZB A;  5TBM B;  2V1A A;  3CUE A;  5CX7 A;  1M40 A;  1ZC2 A;  4KZ6 A;  4QY6 A;  4HJ6 A;  1CF0 A;  4F3L A;  5EE8 A;  4AFI A;  4IUK A;  1JNU A;  3JPU A;  3CWF A;  3F1N A;  4G3V A;  4DXB A;  3EGX C;  2P04 A;  3IX3 A;  3BLS A;  5F1F A;  1MKM A;  3R7W A;  5F83 A;  1XJ2 A;  2XD5 A;  5EVL A;  4ARZ A;  1PNE A;  1ACF A;  1W8Y A;  1BLS A;  2B02 A;  3PHY A;  1F98 A;  4X1L A;  3BFE A;  4G3K A;  3ICY A;  4WM9 A;  1IYO A;  4OOM A;  1JVJ A;  3ITA A;  1K38 A;  1F5M A;  2W3H A;  3HCY A;  1MWR A;  1VEU A;  3UMD A;  4QWO A;  3NCK A;  3IWO A;  4OQ0 A;  1E3U A;  2WYX A;  4OH0 A;  3FZC A;  1IYQ A;  5DJU A;  1LSW A;  3BLM A;  4WEJ A;  5DF7 A;  4DDY A;  4GDN A;  4N1X A;  2JCH A;  3T4L A;  2EWV A;  3T1X A;  2GJ3 A;  4OP8 A;  2FFF B;  3DTE A;  3BFC A;  3TSG A;  3LGO A;  3IF5 A;  3PBR A;  3T4T A;  5M18 A;  4PPR A;  3T4J A;  2OWJ A;  2Y2P A;  3WS0 A;  1YMX A;  5EVI A;  5F82 A;  3VE3 A;  4BL3 A;  4JPM A;  3N8L A;  5EVE A;  5E2F A;  4G3W A;  3VFF A;  1LHY A;  4EV4 A;  3VOL A;  4BEN A;  1MY8 A;  1PWG A;  3GMW A;  3IXD A;  5A8B A;  1LL5 A;  3HLW A;  4HOI A;  5CED A;  4S2O A;  1PYY A;  1H5X A;  3MMH A;  1S4R A;  1MXO A;  3W2Z A;  4MNR A;  1NLY A;  3E0Y A;  1G28 A;  1PRQ A;  4KEN B;  1VET A;  2PR6 A;  4BQM A;  3MXR A;  2PDR A;  4P85 A;  3MZF A;  2PBY A;  2Y2G A;  3W4P A;  2Z2L B;  2XDM A;  4E3I A;  3C7V A;  4KQO A;  2EXA A;  5AVF A;  4ETX A;  1JWV A;  1MBL A;  5GLD A;  3ISG A;  4JF6 A;  2FZ0 A;  4E3M A;  3V39 A;  1XJ4 A;  4L0L A;  4KQR A;  4P6Z S;  5FDS A;  4N9L A;  4UQI S;  2QKP A;  2HGV A;  2XFS A;  5FSR A;  2HJ9 C;  3C4P A;  4EUV A;  1MKI A;  4U0T A;  3M2K A;  1CI8 A;  4NXB A;  2E8J A;  2IWC A;  2YKH A;  4EES A;  5C5K A;  1K25 A;  3RTY A;  5FQM A;  3Q7V B;  2W3F A;  5DTK A;  3DW0 A;  1ONG A;  3IX4 A;  3MZD A;  3E2K A;  2CC1 A;  4EEP A;  2Y55 A;  4PM8 A;  3CPT B;  4R38 A;  3FYZ A;  3UNW A;  4IBX A;  2HP6 A;  2Y2L A;  5EM1 A;  3TW8 A;  3A0V A;  2QYB A;  3FKW A;  1Y54 A;  3QP6 A;  4O0P A;  3PYP A;  3V50 A;  4X1M A;  3VP1 A;  2PD7 A;  5G4Y A;  3C30 A;  1ERM A;  1FSY A;  1H8Y A;  3N7W A;  2J3T D;  2HZ5 A;  4DE0 A;  1L2S A;  3IS2 A;  4EWF A;  4RX2 A;  4YFM A;  4RX3 A;  4Z1W A;  5E43 A;  4PM5 A;  4E6X A;  2XGN A;  3UO9 A;  1S66 L;  1YLT A;  5FL3 A;  3IQA A;  4UEY A;  2ZC3 B;  3UDI A;  4E6W A;  1M6K A;  3BY8 A;  3GDI A;  3GTC A;  4KZ3 A;  1PZO A;  5TGF A;  2H5S A;  3F1P B;  1O07 A;  2VK3 A;  2WKH A;  1KVM A;  1DP8 A;  4EEU A;  1WYC A;  3LY3 A;  3SOI A;  1LL9 A;  3CG5 A;  2Y2I A;  4MCW A;  4EUZ A;  3R4K A;  3KSH A;  1VM1 A;  2HP9 A;  3F1O B;  4E04 A;  5HD3 A;  4GN2 A;  3FWL A;  3UY6 A;  5EOE A;  3C5A A;  4L9E A;  2HF6 A;  4IVK A;  5CHU A;  5AJG A;  2JN7 A;  2XD1 A;  2H0T A;  1ERQ A;  4DMZ A;  3WS1 A;  3H9W A;  2GX5 A;  5D3O A;  1DJB A;  1XA1 A;  2PHY A;  1NRF A;  2OOL A;  4WEL A;  3SS4 A;  2PRF A;  3NY4 A;  1ZG4 A;  5L2F A;  4FH4 A;  4X53 A;  2ZMV A;  2ZM2 A;  4NKP A;  3NIA A;  2A2L A;  3QHY A;  5IT5 A;  4EQI A;  3HJK A;  1K54 C;  3S4X A;  1T19 A;  3QNB A;  1K55 A;  2V9A A;  2H10 A;  2WAF A;  3MZE A;  3E98 A;  5CHJ A;  2WZX A;  2HV1 A;  2Z6D A;  4GD8 A;  3DWK A;  3DBA A;  1RGY A;  5DTT A;  5KSH A;  1IYP A;  1Y4O A;  2INW A;  1NLZ A;  3O88 A;  4H6J A;  3LI9 A;  2OLU A;  1W5D A;  4BBT A;  1HTZ A;  3IXH A;  4Y5F A;  4GOG A;  3O5Y A;  4UHU A;  5HAR A;  4EXO A;  3UB5 P;  1H8Z A;  3VP0 A;  2WGW B;  3LR0 A;  3C38 A;  1GHP A;  2VGL S;  2VEA A;  4DRT A;  2B5R A;  1W63 M;  2XF3 A;  1FR6 A;  3OPL A;  4R3J A;  4S2P A;  3QP1 A;  1S6R A;  3LO7 A;  2PYR A;  1TS8 A;  1K56 A;  3VMA A;  3OOV A;  4LEN A;  4DF6 A;  3UB7 A;  4ZDX A;  1SKO A;  3KYZ A;  1E3U D;  3UB6 A;  4JXG A;  4WBG A;  1FSW A;  3UE6 A;  1N9L A;  3D3O A;  4LPZ A;  3U4L P;  4IBR A;  4RA7 A;  5EEC A;  1FIL A;  5CEB A;  1YSP A;  4WZ5 A;  3KSG A;  3UE3 A;  1BYW A;  1GHM A;  2D01 A;  4U0X A;  1T18 A;  5LBR A;  1N4O A;  4EQ1 A;  4A5R A;  1LSV A;  3OCL A;  1BUL A;  4S2M A;  3PXP A;  5EVI D;  3EQV A;  4XT2 A;  2VV7 A;  1KGG A;  4GHI B;  5U47 A;  4MBF A;  4HP9 A;  2FH5 A;  4OQH A;  3GEC A;  3K2N A;  5JYO A;  2PR5 A;  4II7 A;  4OP5 A;  4PMA A;  2G7U A;  4FOF A;  1ES2 A;  3B33 A;  2Y2N A;  2NUP C;  4EBP A;  3UB8 A;  4KUO A;  4K08 A;  5K5B A;  3ITB A;  3P01 A;  5GHX A;  3ZG8 B;  3BEB A;  3KSF A;  1TS6 A;  5GHZ A;  1D1J A;  2EWW A;  3ZGA B;  1SDN A;  2JBF A;  4E3K A;  2KDK A;  2VKS A;  3T4Q A;  2JE5 A;  3H82 B;  2XEP A;  2YKF A;  2W3E A;  1MWU A;  3IX8 A;  1OTI A;  3E4O A;  5DVA A;  2V20 A;  2ZQA A;  4C75 A;  3FG8 A;  2KOI A;  2A3U A;  3WRT A;  2ACG A;  1DY6 A;  4M3K A;  2XLN A;  3LYX A;  2L4R A;  3V3S A;  3OPP A;  5HX9 A;  4I5S A;  3A0S A;  3N8S A;  4JBF A;  4KZ8 A;  1YAX A;  5CHM A;  4OPZ A;  2Y59 A;  4R1G A;  4I3I A;  1T1B A;  4MMN A;  2ZQ9 A;  2Z2M B;  3PR6 A;  2QJ5 A;  2G2W A;  3O86 A;  4EER A;  5F69 A;  1ESU A;  2V0W A;  1L3L A;  5TJJ A;  4LV3 A;  3IWQ A;  3JVV A;  4CLC E;  3NDG A;  4OPY A;  3K3C A;  1TDL A;  1RP5 A;  5CGX A;  3JYI A;  3S7N A;  4HJ4 A;  4DE3 A;  4GS9 B;  3UDX A;  4ZJ3 A;  1TF1 A;  3TG9 A;  2QZ6 A;  2E8I A;  1HVB A;  2V8C A;  5FQJ A;  4IVI A;  2ZM8 A;  3NOU C;  3M6H A;  1PW1 A;  4CJN A;  4GDB A;  4OOY A;  4IJG A;  3KX0 X;  3ZNT A;  1S4S A;  1T1A A;  3MSH A;  1EWZ A;  5AVE A;  1KE0 A;  2XH9 A;  2VJW A;  5L09 A;  1DP9 A;  1C3B A;  2J7V A;  4WL9 A;  4YOF A;  2WUQ A;  4E3O A;  1KDS A;  1L0D A;  4ID4 A;  4EBN A;  1CQA A;  2A49 A;  2GZA A;  4R4S A;  1X0O A;  5IU1 A;  1U60 A;  3AGE A;  1SDE A;  4Y2F A;  3QP4 A;  3T4K A;  2WGV A;  4L9F A;  1OME A;  3HLE A;  3UB9 A;  2ZC5 B;  4YNR A;  3A3J A;  2D02 A;  3WS5 A;  1LI0 A;  4QPR A;  3F1P A;  3GVB A;  5AQA A;  5FAO A;  4B93 A;  4F94 A;  3MFX A;  3BJN A;  1TS0 A;  3SH7 A;  3G34 A;  1MZU A;  3D4F A;  3A3F A;  3PBT A;  3F1O A;  4X25 A;  4R3B A;  1Q2P A;  1NY0 A;  1YLZ A;  3ZQ5 A;  2G2U A;  1I2S A;  3LID A;  3G2Y A;  3LIB A;  1FCM A;  4WMC A;  1W63 Q;  2VX8 A;  4R70 A;  1H0M A;  3QP2 A;  4OKP A;  3FV7 A;  5EUA A;  4GD6 A;  4BD1 A;  2O9C A;  3WWX A;  2WGI A;  1KGE A;  4FTX A;  3ZG5 A;  1ES5 A;  2XSS A;  1VB6 A;  1JWP A;  5FAP A;  2ZOH A;  1A0K A;  3BQ8 A;  2A24 A;  5E2G A;  3WS2 A;  2XRO A;  3V67 A;  2JKR I;  3DAV A;  3S1Y A;  3SS5 A;  1OTA A;  2LB9 A;  3A3I A;  1JTD A;  2IWD A;  2Y2M A;  2JKR M;  4P0M A;  5FAS A;  4KZ9 A;  1F2K A;  5CGW A;  3T1S A;  3IF6 A;  2XFT A;  5FEG A;  2W3G A;  3PBO A;  5HPI A;  2WKE A;  3G6O A;  4S2I A;  4LV0 A;  2ZL1 A;  1XJ6 A;  5CXW A;  1K0K A;  3HVF A;  2EX2 A;  4QD4 A;  3OPR A;  1K56 D;  2K7S A;  3QP8 A;  4JF4 A;  2WGW A;  1YLP A;  2J9P A;  1P0Z A;  5FAQ A;  3VV4 A;  4NK3 A;  3RJU A;  2L1M A;  3SW1 A;  5CEC A;  3C2W A;  3OCN A;  1YQS A;  3S22 A;  5DF8 A;  4DJ2 A;  4NXE A;  2BAS A;  2WAD A;  4Q0I A;  5AQ9 A;  4ESP A;  4LV2 A;  1YMS A;  3MJQ A;  5F5Y A;  4KQD A;  4ZBE A;  4Q8I A;  2WKQ A;  5FQI A;  2EX6 A;  1TS7 A;  3MFD A;  4FD8 A;  1IKG A;  3H7W A;  3S7P A;  3NJA A;  1XP4 A;  2PBD P;  3OBF A;  3NEC A;  2JKT I;  4K0X A;  2WKI A;  4Q0H A;  4WF0 A;  4X6T A;  2ZMF A;  4QY5 A;  2JKT M;  3PAG A;  2IWB A;  4Y17 A;  2V2F F;  5E2E A;  1RGZ A;  3N8R A;  2PD8 A;  2XR0 A;  3MBZ A;  4GHI A;  3NBL A;  3HBR A;  1QME A;  2HPB A;  2W1T A;  4NEE D;  4NET A;  2QHK A;  4ZJ2 A;  3AGF A;  3ZG7 B;  5KMW A;  4PHT A;  4ZJ1 A;  4QHC A;  4PM7 A;  5HFO A;  2WKR A;  5GHY A;  2JHE A;  5J8X A;  2PAV P;  3F1N B;  1T1C A;  2R9W A;  4E3L A;  1XA7 A;  3R7W B;  4BJP A;  1AXB A;  5HAI A;  5FI7 A;  2X02 A;  1JTG A;  1LL8 A;  5FA7 A;  4ARZ B;  1CEG A;  3NC8 A;  3O87 A;  2BG1 A;  5IHV A;  3T4O A;  2Z6C A;  3UDF A;  4KG2 A;  1L0E A;  4LRY C;  1GHI A;  3H82 A;  4CLC C;  1IYS A;  2WK0 A;  2EXB A;  2HDQ A;  2Y2J A;  4C3Q A;  4ME4 A;  2O9B A;  1VEU B;  4Y13 A;  3HUM A;  1KE3 A;  1FR1 A;  1SHV A;  1K57 A;  4IHQ A;  4PKY G;  3RFB A;  3BW6 A;  4KZ4 A;  2O0Y A;  4QB8 A;  4R0Q A;  3E2L A;  3LIA A;  4KZ5 A;  3T12 B;  2W1R A;  5I5L A;  1WE4 A;  1BT5 A;  3PBS A;  4N1H A;  4Y3I A;  1NWZ A;  2P74 A;  4O01 A;  4P87 A;  4JGQ A;  3NI9 A;  3LCE A;  1H3Q A;  4S2N C;  2VA0 A;  5HDS A;  3IH8 A;  4GS9 A;  4DJ3 A;  1LLB A;  3MF0 A;  5HSQ A;  3BFG A;  4X68 A;  3OZH A;  2LB5 A;  2CMN A;  3ZHH A;  3LI8 A;  5A92 A;  3NUL A;  2P9V B;  5TBM A;  3ZVT A;  3SH9 A;  4ZTK A;  5HDD A;  1XFQ A;  1WA9 A;  5M19 A;  4BD0 A;  4Z9Q A;  4L9G A;  2FFY A;  1ZG6 A;  2ZQ8 A;  4DXC A;  4HH2 A;  5BOH A;  5GLB A;  2V1B A;  4RYE A;  3GQZ A;  3B42 A;  3WRZ A;  1IEL A;  2R9X A;  3Q81 A;  4PM9 A;  1K55 C;  3RXW A;  1BTL A;  3A3D A;  4WUJ A;  5CGS A;  1YT4 A;  3N4I A;  2ZC6 B;  1UWN X;  3ZDJ A;  5DKL A;  1CI9 A;  3OC2 A;  5FDH A;  3LEQ A;  4WMC D;  2UV0 E;  1L0G A;  1GSV A;  5HZH A;  3EOI A;  4KQQ A;  1YM1 A;  3TOI A;  3K3D A;  4I3A A;  3W8K A;  1XGJ A;  4CLC B;  5FQ9 A;  5JYP A;  3CZD A;  3UE1 A;  3M2J A;  4R4R A;  4E3J A;  4X56 A;  3T50 A;  2JC7 A;  3BWL A;  2ZQC A;  3CMZ A;  5F6A A;  3ZCZ A;  1SKF A;  1EI5 A;  4HBU A;  1OTE A;  4YIN A;  4BMW A;  3HLD A;  3G32 A;  1OPX A;  5DFY A;  3Q1F A;  4BBU A;  3IHB A;  2RCX A;  3CIT A;  1DP6 A;  1KOU A;  3IS2 B;  4WLA A;  1FQG A;  2RL3 A;  2ZLY A;  3N6I A;  4EU0 A;  3KYE A;  1G6O A;  2C6W B;  4N92 A;  4EW7 A;  1XKZ A;  3EEA A;  5EM0 A;  5G18 A;  4UA9 A;  3BM6 A;  1OTD A;  4GLQ A;  1YLW A;  2ZMA A;  3IT9 A;  1P97 A;  1IFQ A;  2EA9 A;  2Y8H A;  4ETZ A;  3EEH A;  2Y91 A;  3VOY A;  2QPN A;  5A93 A;  2DCF A;  4LRZ E;  5F1G A;  2ZBB A;  5TR7 A;  1FCO A;  3GV9 A;  1YKD A;  1PI5 A;  5A91 A;  1SCW A;  4I39 A;  1BZA A;  4Q0J A;  4B4X A;  4O8G A;  1W7F A;  5HW3 A;  5EFW A;  5IS1 A;  3IHA A;  3EWK A;  4KUK A;  3VFH A;  3I7J A;  5FI2 A;  4DN0 A;  5CTN A;  1HLU P;  3GSG A;  1OJ5 A;  4MBH A;  1HZO A;  3DTK A;  4OPQ A;  1NZU A;  2J3T C;  4HI4 A;  3D72 A;  2W27 A;  5L8M A;  1YSQ A;  4HP4 A;  1CEF A;  4OPR A;  4LRX C;  1N9N A;  4YWZ A;  3Q7V A;  4K91 A;  2PYP A;  5DJT A;  5KIZ A;  2W3D A;  1BSG A;  1KDW A;  3CPT A;  2W0N A;  5FQQ A;  4I3J A;  4GB7 A;  1OT9 A;  1V9Z A;  2BLS A;  3BEC A;  1P9W A;  1ZKJ A;  1I2W A;  1S0W A;  1ZTU A;  3T1R A;  2OWH A;  3SS3 A;  1ESI A;  2J3W A;  3FPV A;  4M4X A;  3UPN A;  2XA7 M;  4PM6 A;  3ZVW A;  4E3N A;  4JF5 A;  1PFL A;  3LR3 A;  2DMW A;  4MDZ A;  1PZP A;  1P9R A;  2PU2 A;  3LEZ A;  3O3V A;  1QMF A;  5GL9 A;  1EW0 A;  4S2K A;  2HDR A;  1E4D A;  2M7V A;  3C4O A;  1BLP A;  4EBL A;  4UA7 A;  4K0W A;  2QWS A;  5L10 A;  3KO6 A;  3SZT A;  2Y2H A;  1SKO B;  2IA2 A;  4GNU A;  3DWZ A;  3C7U A;  1FIK A;  3GRJ A;  3VSL A;  2OAQ 1;  4PAU A;  1LT0 A;  4ZRR A;  2B95 A;  3L9K A;  2WZZ A;  1K4E A;  4LV1 A;  1CK3 A;  3HUO A;  5AQB A;  2VGK A;  2DRW A;  2WAE A;  3MQO A;  3CAX A;  3CUE C;  3Q82 A;  4HH3 A;  4B4Z A;  4HHD A;  3LIE A;  3SH8 A;  2HDS A;  2VV6 A;  4XT2 B;  5HWT A;  3P09 A;  1OJG A;  3JVU A;  1IEM A;  1MWS A;  3RXX A;  3CJM A;  1D06 A;  4XXR A;  1IOU A;  1GSX A;  1G5U A;  3E4P A;  3ZNY A;  3PBQ A;  2VZW A;  3LIF A;  2Y2Q A;  1L0F A;  3HL9 A;  2UWX A;  2EFX A;  4MEZ A;  1XFN A;  5J4E A;  4OOL A;  2BTF P;  5L07 A;  2XRN A;  4U3T A;  2HDU A;  3ZG0 A;  5EOO A;  4P6B A;  3LIC A;  3ZFZ A;  2EFU A;  1NRJ A;  1MPL A;  2I9V A;  1HD8 A;  1GA9 A;  4IUH A;  3HJI A;  1I5Q A;  2QJ7 A;  4HQA A;  1K6R A;  3HRE A;  2P9V A;  3KSI A;  1ALQ A;  5EVI C;  1PW8 A;  2KX6 A;  4JGP A;  1YPR A;  3MQ0 A;  2PT7 A;  2GDN A;  5HAQ A;  3B3X A;  1J3W A;  5TFQ A;  3OLO A;  4Y7P A;  4JLF A;  4RVA A;  2OSU A;  3EGD C;  3P7N A;  2XK1 A;  4GCZ A;  4B9O A;  2O9A A;  4WEK A;  3LR5 A;  3W4Q A;  5J7E A;  4EET B;  5CER A;  5GLA A;  2O99 A;  3RH8 B;  1ODV A;  2WKP A;  2K31 A;  5DFX A;  3IF6 C;  3T1Q B;  1GCE A;  4P6Z M;  3V5M A;  4BBV A;  4WYY A;  4UQI M;  1V9Y A;  1KGF A;  4MLL A;  1RCJ A;  3VOZ A;  2XQZ A;  4MBK A;  1MC0 A;  1VHM A;  3G4P A;  4KZ7 A;  1VQQ A;  4CLC A;  5I94 A;  3IWI A;  4PKY A;  1G68 A;  2MJ6 A;  4OON A;  4IED A;  2VGJ A;  3W4O A;  3HLG A;  3BY9 A;  3ULF A;  5FAT A;  4F3L B;  3MKE A;  4GJ4 A;  3FPW A;  3HLF A;  2J9O A;  2K2N A;  4H8R A;  1TD5 A;  1ONH A;  3L7H A;  2OLV A;  4QJG A;  2Q9M A;  4OVD A;  3NOP C;  4BLM A;  3A3E A;  3NHQ A;  1K54 A;  3BRM A;  2KLI A;  1NYY A;  4LCL A;  4JGO A; 
#chains in the Genus database with same CATH homology
 3MMH A;  1S4R A;  3W2Z A;  1NLY A;  1GSV A;  3E0Y A;  5HZH A;  1G28 A;  3EOI A;  2PR6 A;  4NXF A;  5HL6 A;  2PDR A;  3NOU C;  3K3D A;  4I3A A;  1GSW A;  4CLC B;  4IJG A;  3KX0 X;  4NXG A;  1S4S A;  1T1A A;  3B47 A;  2ZOI A;  5AVE A;  4KQO A;  3T50 A;  3S7Q A;  1UWP X;  2VJW A;  3BWL A;  5F6A A;  1DP9 A;  4WL9 A;  5AVF A;  4ETX A;  5MC7 A;  1OTE A;  4YOF A;  1XJ3 A;  4BMW A;  2FZ0 A;  1XJ4 A;  4L0L A;  2HJE A;  1OPX A;  5DFY A;  4BBU A;  4P6Z S;  5J3W A;  3CIT A;  1DP6 A;  1KOU A;  2GZA A;  3IS2 B;  4WLA A;  3MXQ A;  1X0O A;  4UQI S;  5IU1 A;  4EU0 A;  2QKP A;  3S7O A;  2HGV A;  2A24 B;  1G6O A;  4HJ3 A;  2HJ9 C;  4Y2F A;  4EUV A;  3T4K A;  4L9F A;  2L0W A;  1Y28 A;  4EW7 A;  3NOT C;  3UB9 A;  4YNR A;  3EEA A;  4NXB A;  3CLO A;  2YKH A;  2D02 A;  4EES A;  1OT6 A;  4MN6 A;  5C5K A;  3TJZ C;  4QPR A;  3RTY A;  3F1P A;  1OTD A;  2W3F A;  4B93 A;  4GLQ A;  3MFX A;  3BJN A;  1TS0 A;  1P97 A;  1S67 L;  4EEP A;  4R3A A;  1IFQ A;  1MZU A;  2EA9 A;  2Y8H A;  4R38 A;  4ETZ A;  3EEH A;  3PBT A;  3F1O A;  4LRZ E;  3TW8 A;  3ZQ5 A;  2ZBB A;  2P7J A;  4HY8 A;  3LID A;  3LIB A;  4I38 A;  3A0V A;  1YKD A;  2QYB A;  1W63 Q;  4I39 A;  4Q0J A;  4O0P A;  4O8G A;  2VX8 A;  3PYP A;  4R70 A;  5EFW A;  5IS1 A;  1N9O A;  2VLG A;  2PD7 A;  5G4Y A;  3EWK A;  3C30 A;  4KUK A;  3MR0 A;  2NUT C;  2J3T D;  4DN0 A;  2O9C A;  3IS2 A;  2XSS A;  1OJ5 A;  1VB6 A;  2Y79 A;  3VE4 A;  4Z1W A;  2ZOH A;  3BQ8 A;  2A24 A;  1LSX A;  3U2A A;  4HI4 A;  2J3T C;  3D72 A;  2W27 A;  3BQA A;  3IBR A;  1S66 L;  2XRO A;  5L8M A;  3V67 A;  1YSQ A;  2JKR I;  5FL3 A;  4HP4 A;  4UEY A;  4GW9 A;  2H28 A;  1OTA A;  2LB9 A;  4LRX C;  2V0U A;  2VGL M;  1N9N A;  2M7U A;  4YWZ A;  3BY8 A;  3GDI A;  2JKR M;  3F1P B;  3H7W B;  3EQU A;  2PYP A;  5DJT A;  5KIZ A;  5G4Z A;  3ZYT A;  2W3D A;  1DP8 A;  4EEU A;  4FSF A;  2W0N A;  4I3J A;  2W3G A;  3PBO A;  1OT9 A;  1V9Z A;  4MCW A;  5DKK A;  5HPI A;  3R4K A;  3KSH A;  3F1O B;  4E04 A;  5HD3 A;  3G6O A;  1XJ6 A;  1P9W A;  4L9E A;  2HF6 A;  1ZTU A;  2OWH A;  2K7S A;  2J3W A;  5AJG A;  2B18 A;  2JN7 A;  3A0R A;  3MQQ A;  4HNB A;  3FPV A;  4M4X A;  4DMZ A;  2XA7 M;  3H9W A;  1P0Z A;  2GX5 A;  3VV4 A;  2PHY A;  2OOL A;  4WEL A;  2L1M A;  2W1T B;  3LR3 A;  1D7E A;  3SW1 A;  2DMW A;  3C2W A;  4MDZ A;  3OCN A;  1P9R A;  4R6L A;  5DF9 A;  4DJ2 A;  4NXE A;  2BAS A;  2ZMV A;  4Q0I A;  4NKP A;  1EW0 A;  2R78 A;  3MJQ A;  2P08 A;  2A2L A;  5F5Y A;  3T4S A;  5IT5 A;  2M7V A;  3HJK A;  4KQD A;  2WKQ A;  1T19 A;  4JGR A;  4MN7 A;  1TS7 A;  2QWS A;  1F9I A;  2V9A A;  3KO6 A;  3H7W A;  3S7P A;  3NJA A;  1S1Y A;  3E98 A;  2IA2 A;  3OBF A;  4JGO A;  2HV1 A;  3LR4 A;  2Z6D A;  3TE8 A;  4WN5 A;  2JKT I;  2M1C A;  2OAQ 1;  3DBA A;  4PAU A;  1LT0 A;  5KSH A;  4Q0H A;  2INW A;  1NLZ A;  4ZRR A;  5HDC A;  4WF0 A;  4H6J A;  3LI9 A;  2ZMF A;  3LFV A;  4BBT A;  2JKT M;  3MQO A;  3CAX A;  1UGU A;  3CUE C;  4Y5F A;  4HH3 A;  4HHD A;  3LIE A;  3O5Y A;  2PD8 A;  4BWI A;  4EXO A;  1DRM A;  2VV6 A;  1ZHH B;  4GHI A;  3LR0 A;  3C38 A;  4XT2 B;  5HWT A;  1OTB A;  3TRC A;  1OJG A;  2W1T A;  1H8M A;  4NEE D;  2VGL S;  2VEA A;  3JVU A;  3E4Q A;  1S1Z A;  1W63 M;  3IBJ A;  3CI6 A;  2QHK A;  1D06 A;  2VV8 A;  3FC7 A;  3UME A;  4PHT A;  1IOU A;  1GSX A;  2PYR A;  2WKR A;  3E4P A;  2JHE A;  1TS8 A;  3PBQ A;  2VZW A;  3OOV A;  3LIF A;  3F1N B;  5HD5 A;  4MN5 A;  1T1C A;  4RQ9 A;  3UB7 A;  5F68 A;  3KYZ A;  3R7W B;  1XFN A;  3UB6 A;  5J4E A;  3KYQ A;  4BJP A;  4OOL A;  1LL8 A;  4HIA A;  4CLC D;  4ARZ B;  3UE6 A;  3C8C A;  1N9L A;  2XRN A;  3D3O A;  4LPZ A;  5HWV A;  3T4O A;  2GNX A;  2XA7 S;  2Z6C A;  1YSP A;  3LIC A;  4LRY C;  4H6J B;  3KSG A;  3UE3 A;  3H82 A;  4CLC C;  1NRJ A;  2OAP 1;  1BYW A;  2D01 A;  2I9V A;  4ME4 A;  2O9B A;  1T18 A;  1STZ A;  5LBR A;  2J80 A;  4IUH A;  4LLO B;  4EQ1 A;  1LSV A;  3OCL A;  3HJI A;  3PXP A;  3LUQ A;  3EQV A;  4IHQ A;  2QJ7 A;  4XT2 A;  4HQA A;  4CQH A;  2VV7 A;  4PKY G;  4GHI B;  5HPF A;  3RFB A;  3PBN A;  3BW6 A;  3KSI A;  4HP9 A;  2FH5 A;  5HWW A;  5TBM B;  2V1A A;  3CUE A;  3GEC A;  2O0Y A;  3K2N A;  5CX7 A;  2KX6 A;  4JGP A;  2PR5 A;  3LIA A;  4HJ6 A;  3MQ0 A;  4F3L A;  4II7 A;  2W1R A;  2PT7 A;  2G7U A;  5I5L A;  4AFI A;  4IUK A;  4FOF A;  3PBS A;  1JNU A;  3OLO A;  3CWF A;  3F1N A;  3B33 A;  4G3V A;  2NUP C;  3UB8 A;  4KUO A;  4K08 A;  3EGX C;  3EGD C;  4Y3I A;  2P04 A;  5K5B A;  1NWZ A;  3P7N A;  4GCZ A;  1MKM A;  3P01 A;  3R7W A;  4B9O A;  4O01 A;  1XJ2 A;  2O9A A;  4WEK A;  3LR5 A;  3KSF A;  4ARZ A;  1TS6 A;  4JGQ A;  1H3Q A;  2EWW A;  4EET B;  5J7E A;  2B02 A;  3PHY A;  2VA0 A;  5HDS A;  1F98 A;  2O99 A;  3RH8 B;  1ODV A;  2WKP A;  4G3K A;  2K31 A;  2KDK A;  3ICY A;  4GS9 A;  5DFX A;  2VKS A;  3T4Q A;  4DJ3 A;  4OOM A;  3H82 B;  2YKF A;  4P6Z M;  2W3E A;  3MF0 A;  5HSQ A;  1F5M A;  2W3H A;  3HCY A;  1OTI A;  4BBV A;  3UMD A;  4UQI M;  3E4O A;  1V9Y A;  2LB5 A;  2CMN A;  3LI8 A;  3FG8 A;  1MC0 A;  2KOI A;  1VHM A;  5DJU A;  1LSW A;  4CLC A;  4WEJ A;  3LYX A;  4PKY A;  2L4R A;  2MJ6 A;  5TBM A;  3T4L A;  2EWV A;  2GJ3 A;  4I5S A;  3A0S A;  5HDD A;  1XFQ A;  1WA9 A;  1YAX A;  3PBR A;  3T4T A;  3BY9 A;  3ULF A;  3T4J A;  4F3L B;  4L9G A;  4GJ4 A;  3FPW A;  2OWJ A;  4I3I A;  1T1B A;  4HH2 A;  4MMN A;  3PR6 A;  2QJ5 A;  2V1B A;  3VE3 A;  2K2N A;  3B42 A;  4EER A;  1TD5 A;  5F69 A;  2V0W A;  4G3W A;  5TJJ A;  3VOL A;  4WUJ A;  3JVV A;  3NOP C;  4CLC E;  3K3C A;  3NHQ A;  5A8B A;  2KLI A;  1UWN X;  4HOI A;  5DKL A;  3S7N A;  4HJ4 A;  3OC2 A;  4GS9 B;  1TF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...