4IUHA

Crystal structure of nrea of staphylococcus carnosus with bound iodide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
FDYQDALDEIRETEKFDFAAIALPEDGLHSAVIKWKYASGNINYRYRMIVLRPGKGLAGLVIRTGSRKIVEDVDAELSQNDKLGYPIVLSEALTAMVAIPLWKNNRVYGALLLGQREGRPLPEGSTTFRINQRLGSFTDEINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NreA protein
publication title The NreA Protein Functions as a Nitrate Receptor in the Staphylococcal Nitrate Regulation System.
pubmed doi rcsb
source organism Staphylococcus carnosus subsp. carnosus tm300
molecule tags Nitrate-binding protein
total genus 35
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4iuhA00
2IA2A 2Y79A 2K31A 3S7QA 1ZTUA 2VEAA 5HPIA 5DFXA 5HPFA 3LFVA 3R4KA 5TJJA 2HGVA 3DBAA 2XRNA 4R70A 2G7UA 4Q0JA 5LBRA 3NOPC 4BWIA 5HL6A 3CI6A 4CQHA 3TRCA 2LB9A 4O8GA 2XROA 4G3WA 4MCWA 4PAUA 1YKDA 3KSFA 2M7UA 2W3FA 4LRYC 2QYBA 2B18A 3CITA 2VJWA 1MC0A 4G3KA 4Y2FA 5DFYA 4ETZA 3IBRA 3KSGA 5AJGA 4MMNA 4IJGA 2W1RA 4RQ9A 4FOFA 3KSHA 4Y5FA 3BJNA 2Y8HA 4YNRA 2O0YA 2O9CA 3D3OA 3KSIA 3E98A 2O9BA 1YSPA 5L8MA 4E04A 2W3HA 3OBFA 2W3DA 3S7NA 4YOFA 4ETXA 2W3EA 2LB5A 3K2NA 3NOTC 4Q0IA 2KLIA 5I5LA 2O9AA 1F5MA 4Y3IA 4LRXC 3HCYA 2W1TA 1TD5A 3W2ZA 3MQ0A 3MF0A 1VHMA 2K2NA 2GX5A 1MKMA 1TF1A 3NOUC 4LRZE 3RFBA 2M7VA 4QPRA 4DN0A 3IBJA 3KO6A 3MMHA 3C2WA 3G6OA 2OOLA 4Z1WA 5C5KA 2O99A 3O5YA 4G3VA 3S7PA 4ME4A 2KOIA 2XSSA 5K5BA 2W3GA 4IUKA 2VKSA 3S7OA 4EU0A 4GLQA 2ZMFA 1STZA 4Q0HA 4EUVA 2W1TB 3ZQ5A 3E0YA 4IUHA 4MDZA 4O01A 4GW9A 1YSQA 3EEAA 4ZRRA 2VZWA 3VV4A 4R6LA 4MN7A 4O0PA 4DMZA 5HSQA 3NHQA 3OOVA
chains in the Genus database with same CATH superfamily
4Z9QA 1DP8A 2Y59A 4UA7A 1GHIA 5BOHA 5TJJA 5GLBA 3UDFA 4Q0JA 1W79A 3NOPC 1CK3A 2HV1A 5DKKA 2VX8A 3ICYA 5E2GA 4CQHA 1WYCA 4P85A 4YWZA 3W4OA 4LV0A 3IBRA 4OH0A 2W27A 3KSGA 3KSHA 1K0KA 4HNBA 5F82A 1W63M 5CGSA 4HP4A 4K0XA 2PD7A 4X56A 5L09A 1D7EA 5GLCA 3QP1A 4ETXA 3MKFA 4MBKA 2OSUA 3WS2A 4E3KA 4Q0IA 1H5XA 2O9AA 3B3XA 4C6YA 3AGDA 3BQ8A 3NBLA 1XP4A 3S22A 3H82A 4IBRA 4KG2A 5DF8A 4BQMA 1Y4OA 5KZHA 4N9KA 1FR1A 5CHJA 3PBQA 5DTKA 3SW1A 3LR4A 3ZNTA 5FDHA 1S6RA 2J3TC 4Z1WA 2O99A 4G3VA 2PBDP 2Y55A 5HWWA 3CPTA 1E3UD 2JKGA 4MLLA 1NXYA 4OLGA 4PM9A 3MQOA 2A2LA 1XA1A 3N4IA 4ARZA 5HW3A 4P6ZS 5EOOA 2IWDA 3IT9A 4OP8A 2VGLM 3FWLA 1BYWA 5HSQA 3WS5A 3N8RA 3DTMA 4R0QA 4ZAMA 3HBRA 3LO7A 4R3AA 3JYIA 4RX3A 2P7JA 3MFXA 3Q7VB 2XR0A 4M4XA 1I5QA 3M2JA 4E3IA 1YKDA 3KSFA 4U0XA 2M7UA 4HBTA 2E8JA 2FZ0A 3SS3A 5AQ9A 1XPBA 1KE4A 5M19A 1XA7A 3G4PA 2HDSA 1T1BA 4OOMA 4YINA 4MN5A 5DKLA 1K4FA 1LL8A 4H6JB 2PAVP 4LCLA 4WUJA 2Q0OA 1MY8A 2P08A 1FOFA 2ZMAA 2B5RA 3TE8A 3IWIA 2P04A 3MFDA 4KG5A 4CLCE 3UB5P 1SHVA 3EWKA 5DJTA 4EESA 3V50A 3ZFZA 1VHMA 5EPHA 3NY4A 3MSHA 1MPLA 3HJKA 3SH9A 4ME4A 1V9ZA 4NXEA 5DTSA 3MZDA 2ZMFA 1STZA 5EM1A 3FG8A 4WL9A 4B4ZA 3LEZA 4EQIA 1GSXA 1RGYA 3B47A 1MZUA 1PYYA 1NZUA 5G4YA 2NUPC 3LUQA 3ZGAB 4Y17A 3TJZC 1I2SA 4S2MA 4JXVA 5E2FA 1KGGA 3N7WA 4PMAA 3T4QA 5GHZA 5EVLA 3V5MA 2LB9A 4E3MA 1PI4A 2QYBA 4EXOA 2VJWA 4IVKA 4D60A 4XUZA 4OLDA 3NJAA 2IWBA 3LY4A 5TFQA 5HL1A 1IKGA 4RQ9A 2PR6A 1OTEA 5FSRA 3LGOA 3G2YA 3QHYA 1N9OA 4S2KA 1NZOA 3IS2A 1LHYA 1PI5A 1G6AA 3AGFA 3S7NA 3D4FA 1KGEA 2Y2IA 1XJ4A 3F1NA 4R4RA 1L0FA 5DF7A 4HJ4A 3IWOA 2ZQDA 3SS5A 2GJ3A 3ZYTA 5E2HA 3PBRA 3C5AA 2J80A 2GNXA 4KG6A 4Y13A 1H8ZA 3IBJA 1ERQA 3V39A 1OTDA 3F1NB 5FI2A 1HVBA 2XD1A 2ZC4B 2CC1A 3BQAA 3G30A 5FAOA 3C30A 1ONHA 5EFWA 5L10A 1DJBA 1JNUA 1Z6FA 3UDXA 3MXQA 4A5RA 3MR0A 2VEAA 3PAEA 4GS9B 1W8QA 3C38A 4KZ6A 2XA7M 1PWCA 2ZM0A 2V8FA 3CUEC 4R70A 3DAVA 2VLGA 1ERMA 3QP5A 4CLCB 1BZAA 1L3LA 3FKVA 1ES5A 4BJPA 3ZDJA 3P01A 1VQQA 3DTEA 4BD0A 3CITA 1IKIA 3N8SA 4MMNA 5HFOA 4JPMA 4PHTA 4H8RA 4FH2A 4GDNA 4QU3A 3E98A 4QB8A 1CI9A 5FAQA 4X53A 3JVVA 1LSXA 4ESPA 3PBSA 1FR6A 3UN7A 4OOLA 5A92A 4QJGA 1EI5A 2EX8A 3G35A 1VB6A 2VA0A 3SH8A 1NWZA 5GHXA 3BFGA 1FSWA 4XT2B 1YLJA 1YLTA 3HL9A 3MKEA 1SZVA 1MBLA 4NK3A 2ZLYA 4GZBA 4OQHA 2Q9MA 3S1YA 5F6AA 1G6OA 2K2NA 4X25A 1NLYA 2OLUA 2Y2GA 4WBGA 3HUNA 2WZXA 4CJNA 5M18A 1AXBA 3CUEA 2VKSA 4R3BA 4NETA 1K25A 3VP1A 3T50A 2Y2QA 1FSYA 2ACGA 3R7WA 3MS6A 4KZ3A 5EVEA 1YSQA 2L4RA 3BECA 1LLBA 2ZQCA 3IF5A 2V20A 3KYEA 2EXBA 2K31A 2D02A 5HPIA 5JYOA 2JKFA 2WKHA 3R7WB 1LL5A 3EQUA 2QJ5A 4P0MA 2C5WB 4CLCD 3T4OA 3N8LA 1GA0A 5HARA 1BUEA 3T4KA 4LENA 4Y2FA 4EBPA 4EBNA 5IS1A 1BLHA 2QJ7A 3W4QA 4IBXA 2FFFB 3HLBA 3NECA 5L2FA 4P87A 3T4TA 4JXGA 3UMEA 3T4JA 1LSVA 2JE5A 3MXRA 2ZC6B 4E04A 2V1BA 4FTXA 4N92A 4L0LA 5CXWA 1IELA 1EROA 4HESA 3K2NA 4X68A 1T19A 4UEYA 1ZC2A 2PU2A 1T1CA 3K3DA 4NG2A 2Z2MB 3LEQA 4L9FA 4U3TA 3TOIA 1NLZA 1ZG6A 1XGIA 2OAP1 3MQ0A 1K4EA 4LCMA 2GX5A 3GRJA 1H8YA 4BL3A 3OPHA 2ZOHA 1QMFA 2H0YA 2KOIA 5F1GA 2W3GA 4GJ4A 4IUKA 3S7OA 4EU0A 4Q8IA 1HLUP 3CJMA 3NI9A 1FCNA 1YPRA 4UA9A 4EUVA 2WKQA 4ZDXA 3OCLA 3C4OA 3L9KA 3EEAA 2V1ZA 4Y15A 3GR2A 3G32A 5EUAA 2FH5A 5HD5A 3SS4A 4KZ8A 5IT5A 4GHIB 4KUOA 3VOZA 1S4SA 4OONA 1OTIA 4F3LB 1ES3A 2ZL1B 1PZPA 3TRCA 2WADA 1SKOB 2FFYA 4OPRA 5CHUA 1TDGA 4EWFA 3F1OA 3LR3A 5A91A 1YT4A 3V3SA 1I2WA 4GDBA 1PZOA 4R4SA 1K38A 3WWXA 5EV0A 4BBUA 5KIZA 2M1CA 4FOFA 3EQVA 4GB7A 1DP9A 5HAQA 4GD6A 1KDWA 2OV5A 4B4XA 1W7FA 1SKFA 4HY8A 1BLSA 4DRTA 1IYPA 3NDEA 2V2FF 2X02A 5TBMA 2AVXA 1MWSA 1TD5A 2J8YA 4HJ3A 3FPWA 1QMEA 4WZ5C 3RJUA 3GV9A 1JTGA 4I39A 4ZBEA 1NYMA 3HVFA 1G28A 5A8BA 4OQ0A 5F1FA 3LYXA 4JF4A 1YMXA 3P98A 3HREA 4Y0OA 5FASA 1OT9A 4BENA 3OPPA 4DMZA 4NEED 1S1ZA 5FATA 4D2OA 3LFVA 1JWPA 1XKZA 3A3JA 4WMCD 3CG5A 5KSCA 4E3JA 3LCEA 3EGXC 4BBVA 3H82B 1S4RA 1K6RA 4KZ9A 3HUMA 2XFSA 4L9EA 1UGUA 4OP5A 3CPTB 4Y5FA 3ZNYA 3UB9A 2WKRA 4WZ5A 5E2EA 4ARZB 4PM8A 5HX9A 3MBZA 1DJCA 1YSPA 3ZVWA 5AQBA 3OBFA 2Y2HA 2HP9A 1OT6A 2LB5A 1XFQA 4E6WA 1F9IA 3NULA 1W63Q 1XXMA 5IU1A 3BEBA 2XH9A 3ZG7B 3PBOA 3RTYA 4WN5A 5CEDA 4HBUA 2OLVA 4NKPA 1ZKJA 3ITAA 1DJAA 3S7PA 2UWXA 3A0RA 2WYXA 3MJQA 2HPBA 3D9YA 3UE0A 1CEFA 3CI6A 3ULFA 4PAUA 3VFFA 4UA6A 4JXWA 3UPOA 5CECA 5HPFA 3WS0A 3DWKA 2JKTI 3G2ZA 3DBAA 5M1AA 2VV6A 1YAXA 3GDIA 3LIAA 2G2WA 3LIDA 4PM7A 4BWIA 1IOUA 3A3IA 4O8GA 1JTDA 2HJEA 2W3FA 3UMDA 4KZAA 4EEPA 3ZCZA 2B18A 1MC0A 4G3KA 3FYZA 4ETZA 2KX6A 1LI9A 1P0ZA 5FDSA 1ES4A 3ISGA 4LV2A 1JWVA 1LI0A 3ZHHA 5AQAA 2I9VA 1L0EA 4UQIS 5EVIC 3LIEA 3LIFA 4X55A 2HDQA 2JBFA 4KENB 5MC7A 5CERA 1LSWA 3ZG0A 2Z2LB 1HTZA 3BFDA 1GSVA 1TS6A 2DCFA 4HEFA 4FCFA 1MWTA 3W2ZA 3O88A 4JGPA 2M7VA 4WZ4A 3PAGA 2PT7A 1VETA 1TS8A 2EFXA 3DTIA 4X6TA 3OCNA 2EXAA 1IYSA 2OAQ1 5TR7A 2CMNA 2ZC5B 3E0YA 2WKEA 3GECA 2PDRA 4FH4A 4ZRRA 3IS2B 4N1XA 4R6LA 4Y7PA 3E4PA 4OVDA 1KDSA 3OOVA 3T12B 3GSGA 2W0NA 4EERA 4OPYA 1E4DA 4EEUA 1DRMA 3W4PA 2KDKA 1W5DA 3R4KA 4MN6A 3ITBA 3ZG8B 3UO9A 2WAFA 4S2NC 3IWQA 2JHEA 5EVIA 1N4OA 3U4LP 5FI7A 4R38A 2XDMA 4KZBA 2HZ5A 2PHYA 2L0WA 3O3VA 5GHYA 1BSGA 3VP4A 3ZG9B 3E4OA 2WKIA 4BL2A 4JGQA 1VEUA 2QWSA 1XJ3A 3CAXA 4FSFA 5EVIB 2W3DA 3QNBA 1NY0A 3GVBA 4U0TA 4LLOB 2X71A 4DF6A 5I5LA 1BLCA 1OTAA 1YLWA 3IXGA 5IHVA 4EV4A 3IXHA 3CZDA 4QY5A 3UY6A 1VEUB 2JC7A 3NIAA 2ZM2A 4PKYA 2HJ9C 4DDYA 1FCOA 2JKTM 1N9BA 2HDUA 2J7VA 4L9GA 2PD8A 3RXWA 1PW8A 1PIOA 4ZJ3A 2GZAA 4WELA 4GNUA 4S2NA 1SDEA 2EWVA 4II7A 1F2KA 1WYBA 4MEZA 3QP8A 1XX2A 3QP4A 2ZQAA 4E3NA 1P97A 3NHQA 3IX3A 4DKIA 1K56A 4F94A 3S7QA 3ZVTA 2WGVA 3FV7A 4X1MA 1J9MA 1P9WA 4NXGA 5FQIA 4JKTA 2XRNA 4GKUA 1KE3A 4HQAA 2Y2PA 3TG9A 5GLAA 3P09A 1N9NA 3BFEA 3IHAA 2Z6CA 3B42A 4K0WA 2DNSA 4DE2A 2XK1A 3UE1A 4IEDA 1GCEA 3PYPA 1X0OA 2R9XA 5HDSA 5HAPA 3BJNA 1TEMA 4S2OA 2K7SA 1WA9A 3GTCA 1Y54A 4LPZA 3E4QA 3BFCA 2XFTA 1CF0A 3F1PA 1ES2A 3GMWA 1Y28A 2PR5A 2PYRA 3WRTA 3VE3A 1OJGA 3G31A 3UDIA 3IF6C 3MF0A 2R78A 5CRFA 3NOUC 2B02A 5DJUA 2VK3A 3LIBA 2H0TA 4BD1A 3Q07A 3A0VA 2A24A 1TS7A 3VOYA 4DE3A 1BULA 3HLWA 4JGRA 1PW1A 1HZOA 1N9LA 2VV7A 4UAAA 3CLOA 5CX7A 1IEMA 3V3RA 3VOLA 2EX6A 1WE4A 3UB7A 4I3JA 3K3CA 3LICA 4PM6A 2J9OA 3O87A 2RCXA 1SCWA 2IA2A 3IH9A 5FQKA 3UE6A 1HD8A 5FQMA 3C7VA 4RYEA 3E2KA 2HGVA 4DXBA 3BRMA 2G7UA 4UHUA 3U2AA 1YLYA 1T18A 3HLFA 4WMCA 3OZHA 4LRYC 2PRFA 1E3UA 5D3OA 1IYOA 1BT5A 2V8CA 1GA9A 1A0KA 5DFYA 1YM1A 2H28A 1CEGA 3IF6A 5F5YA 2P74A 3IHBA 4YNRA 4N9LA 3O86A 5EOEA 2O0YA 3D3OA 2XF3A 1XJ6A 1CQAA 3T1QB 3BFFA 4KZ5A 5J3WA 1NRJA 1PRQA 2W3EA 1BTLA 3A3EA 2V9AA 1H8MA 1NJ4A 1PNEA 3VMAA 3VFHA 4B9OA 3LR0A 4XUXA 4DJ3A 1TVFA 3HCYA 4X69A 1UWPX 1PWDA 3WS4A 2WKPA 5AVFA 3DTKA 3BWLA 5L07A 3I7JA 1TF1A 1KVLA 2OOLA 3F1OB 3IH8A 3CHWP 1VM1A 4OPQA 1JWZA 3NCKA 2B95A 1Q2PA 4FD8A 3Q1FA 4P6BA 4O01A 2YKHA 3N6IA 5FAPA 4DE1A 3PBTA 2PYPA 4E3OA 2ZQ7A 1ESUA 1RGZA 2PBYA 1RCJA 4LFUA 2YKFA 1IFQA 4LV1A 1E25A 3IX4A 5F68A 3UB8A 3SZTA 5TBMB 4E6XA 4LGWA 1G5UA 2EWWA 2XD5A 1D06A 2C6WB 3BLSA 2EX2A 4X1LA 4DXCA 5G4ZA 5HZHA 4NXFA 5AJGA 3T1RA 2DMWA 5L8MA 3H9WA 4KQRA 2DRWA 4P6ZM 2Y4AA 2P9VA 4KUKA 4KZ4A 5E43A 5FA7A 1NRFA 3JPUA 3LR5A 3PHYA 1FILA 3T1XA 1K57C 4WF0A 2VGLS 3CWFA 1XJ2A 2Y2NA 1O7EA 5HAIA 3Q7VA 3JVUA 3T4SA 4HJ6A 3MQQA 5FL3A 5GL9A 1YLZA 5AVEA 2ZQ8A 2P9VB 2Y2MA 3KO6A 2NUTC 2ZBBA 2QMIA 4O7DA 1O07A 3VP2A 4RX2A 3PTEA 3OC2A 1FIKA 5J7EA 4S2IA 3QNCA 4EETB 5HWVA 2GDNA 3DWZA 3A3DA 1D1JA 4EQ1A 4H6JA 3IX8A 3UNWA 5JYPA 3BLMA 1ZTUA 5DFXA 1UWNX 2RL3A 3W8KA 1S67L 4WYYA 3VSLA 3SH7A 4DJ2A 2L1MA 1KGFA 5FEGA 5J4EA 1J3WA 1XGJA 1K57A 1MWUA 2ZJ9A 2J3WA 4IJGA 2W1RA 4JF5A 3MZFA 1GSWA 3C8CA 1PFLA 2O9BA 1CJFA 3P7NA 4I38A 4BMWA 4JXSA 1ODVA 2HF6A 5I94A 4OQGA 4FUWA 3NOTC 3B33A 3LY3A 3EOIA 2ZOIA 3D72A 2E8IA 2R9WA 2V0WA 3TW8A 4WLAA 3RH8B 4LRXC 2UV0E 3H7WA 1SDNA 5HD3A 2W1TA 4RVAA 3HLCA 3LI9A 3AGEA 1MKMA 2J9PA 1JVJA 3IQAA 1FCMA 4DN0A 3MMHA 2WGIA 5J8XA 3KX0X 3C4PA 5CHMA 5FQ9A 1V9YA 4PM5A 4UQIM 1IYQA 4LV3A 3H7WB 2W1TB 3ZQ5A 3EEHA 3KYZA 3HLDA 3HLEA 2VGKA 4RA7A 3T4LA 5HDCA 4MN7A 2OWJA 4CLCC 5FQJA 1FQGA 2INWA 2XGNA 1H0MA 1K55C 5DTTA 2EFUA 1MKIA 2PU4A 2QZ6A 1M40A 1U60A 3V67A 4K91A 5HL6A 5HDDA 4HIAA 4G3WA 1KVMA 3T1SA 4R3JA 1EW0A 4IHQA 4I5SA 4KZ7A 3C7UA 5FEFA 5EM0A 1VETB 2J3TD 4JBFA 4MBFA 4QD4A 3A3FA 2Y91A 5F83A 4HHDA 1T1AA 2Y8HA 3M6BA 4OKPA 4WM9A 2O9CA 3GQZA 3FKWA 4I3IA 5G18A 2ZMVA 4YOFA 3UPPA 1YQSA 4E3LA 4DDSA 3BW6A 4GS9A 1OJ5A 4KQQA 2JKRI 4GCZA 2Y2KA 3VSKA 1NYYA 4OOYA 2BG1A 4JF6A 4CLCA 4MBHA 4B93A 2X01A 4GOGA 4WEKA 1S66L 1DP6A 2WK0A 1K55A 1ESIA 4LRZE 2HP5A 5FQQA 2Y2LA 3PR6A 2Y2JA 3UB6A 1OMEA 3G6OA 2XA7S 1YMSA 4CPKA 2XSSA 5K5BA 2JN7A 2ZC7A 1CI8A 3BY8A 2EA9A 4GLQA 1ONGA 5F69A 2I72A 4HH2A 4M3KA 1MXOA 4IUHA 5HWTA 2H5SA 3KYQA 4KQOA 2IWCA 1MWRA 1GHPA 2WZZA 3PXPA 4ZJ1A 4OPZA 2BASA 5EE8A 1OTBA 1K6SA 2Y79A 5A93A 3OLOA 3QP2A 3G34A 4ZJ2A 2ZM8A 4XT2A 2Y2OA 4GD8A 3MXSA 5LBRA 3M6HA 2OWHA 1Q2QA 1OPXA 4XXRA 3A0SA 4C75A 4OQIA 4MCWA 1EWZA 3HJIA 2G2UA 2WAEA 4EUZA 4R1GA 4JLFA 3MZEA 5DVAA 3Q81A 2QHKA 1LL9A 3HUOA 4KQDA 5FI6A 4EW7A 4IVIA 4DE0A 2VV8A 4GN2A 1TS0A 1S0WA 2W3HA 2QPNA 4QHCA 2ZQ9A 1L0GA 3IXDA 2QKPA 3HLGA 4Y0TA 3S4XA 2HP6A 4S2PA 3CMZA 2ZD8A 3NDGA 3SOIA 1F5MA 3FC7A 5CEBA 4EBLA 2H10A 3LI8A 3Q7ZA 4R23A 3VP3A 1S1YA 2Q9NA 4ID4A 4C3QA 1ALQA 1F98A 3UE3A 3VP0A 5GLDA 5TGFA 1RP5A 2D01A 3RFBA 4PKYG 5C5KA 3M2KA 3O5YA 5CTNA 4AFIA 5EVID 5A90A 4ZTKA 1P9RA 2ZC3B 4HI4A 3RXXA 4Q0HA 2V0UA 4MDZA 1AWIA 3QP6A 4GW9A 4PPRA 1PWGA 2VZWA 5KMWA 3FZCA 5EECA 4HOIA 1G68A 4K08A 4NXBA 3ZG5A 2VGJA 3F1PB 3BM6A 5U47A 1K54C 2V1AA 4QWOA 2JCHA 2WGWA 1ZHHB 1Z09A 1H3QA 3OPLA 2XROA 4BLMA 2JKRM 2MJ6A 3TSGA 5CGWA 1TDLA 3UPNA 1C3BA 4B88A 3WRZA 2A49A 4Y0UA 2A24B 3Q82A 2EX9A 2Z6DA 1YLPA 3VE4A 2WGWB 3KSIA 4YFMA 2XLNA 2WUQA 3DW0A 2XQZA 1XFNA 3IXBA 3L7HA 4GHIA 4S2LA 5DF9A 4MNRA 1KOUA 2KLIA 1M6KA 5CGXA 1ACFA 1K56D 2BLSA 4Y3IA 1L2SA 1L0DA 4F3LA 3PBNA 3EGDC 5CTMA 5AQ7A 4N1HA 1GHMA 1ZG4A 2ZL1A 1BLPA 1SKOA 2A3UA 1KE0A 2BTFP 3NC8A 4QPRA 3C2WA 3BY9A 4HP9A 1W8YA 2XEPA 1K54A 3FPVA 4JGOA 3WS1A 4WEJA 3IF6B 4I3AA 1LT0A 4HH3A 3OPRA 3VV4A 5KSHA 1DY6A 4S2JA 4O0PA 4QY6A 2HDRA 3BYDA 3E2LA 4BBTA
chains in the Genus database with same CATH topology
2W0NA 4EERA 4EEUA 1DRMA 2K31A 1DP8A 1ZTUA 2KDKA 2D02A 5DFXA 1UWNX 5HPIA 3R4KA 5TJJA 4MN6A 1S67L 3R7WB 4Q0JA 3NOPC 2HV1A 5DKKA 2VX8A 3ICYA 4CQHA 2JHEA 4DJ2A 2L1MA 3EQUA 2QJ5A 4CLCD 5J4EA 3T4OA 4YWZA 3T4KA 4R38A 4Y2FA 3IBRA 5IS1A 2J3WA 2PHYA 2QJ7A 2W27A 3KSGA 4IJGA 2L0WA 2W1RA 3KSHA 3E4OA 4HNBA 1GSWA 1W63M 3C8CA 3T4TA 4JGQA 3UMEA 3T4JA 4HP4A 1LSVA 2O9BA 2QWSA 1XJ3A 2PD7A 3P7NA 3CAXA 4FSFA 4E04A 4I38A 4BMWA 1D7EA 2W3DA 2V1BA 4L0LA 4ETXA 1ODVA 2HF6A 3K2NA 1T19A 4UEYA 3NOTC 3B33A 4LLOB 4Q0IA 3EOIA 2ZOIA 3D72A 5I5LA 1T1CA 3K3DA 2O9AA 2V0WA 1OTAA 3TW8A 4WLAA 3BQ8A 3RH8B 4LRXC 3H7WA 4L9FA 5HD3A 2W1TA 1NLZA 3H82A 4PKYA 2OAP1 3MQ0A 2HJ9C 3LI9A 2GX5A 1MKMA 2JKTM 3PBQA 3SW1A 2ZOHA 3LR4A 4DN0A 3MMHA 2J3TC 4L9GA 4Z1WA 2O99A 2PD8A 4G3VA 2KOIA 3KX0X 2W3GA 4GJ4A 4IUKA 2GZAA 4WELA 3S7OA 4EU0A 1V9YA 5HWWA 4UQIM 2EWVA 4II7A 3MQOA 2A2LA 4ARZA 4EUVA 2WKQA 3H7WB 4P6ZS 2W1TB 3ZQ5A 3EEHA 3OCLA 3KYZA 3EEAA 3T4LA 5HDCA 4MN7A 2VGLM 2FH5A 2OWJA 5HD5A 4CLCC 1BYWA 5HSQA 1P97A 3NHQA 2INWA 3S7QA 5IT5A 4GHIB 4KUOA 1P9WA 4NXGA 1S4SA 1OTIA 2XRNA 4F3LB 4R3AA 3V67A 5HL6A 4HQAA 5HDDA 2P7JA 3MFXA 4HIAA 3TRCA 1N9NA 4M4XA 2Z6CA 4G3WA 3B42A 1YKDA 3KSFA 2M7UA 1EW0A 4IHQA 3F1OA 2FZ0A 3LR3A 4I5SA 2J3TD 3PYPA 1X0OA 4BBUA 5HDSA 5KIZA 4HHDA 2M1CA 4FOFA 3BJNA 3EQVA 1T1AA 2Y8HA 2K7SA 1DP9A 1WA9A 1T1BA 2O9CA 4OOMA 4I3IA 4LPZA 2ZMVA 3E4QA 4MN5A 5DKLA 4YOFA 1LL8A 4H6JB 4HY8A 4WUJA 3BW6A 4GS9A 1OJ5A 2P08A 3F1PA 2JKRI 4GCZA 3TE8A 1Y28A 2PR5A 2P04A 5TBMA 2PYRA 3VE3A 1OJGA 4CLCE 1TD5A 4HJ3A 4CLCA 3EWKA 3FPWA 4B93A 5DJTA 4EESA 4WEKA 1S66L 3MF0A 1DP6A 1VHMA 2R78A 3NOUC 4LRZE 3HJKA 2B02A 3PR6A 3UB6A 3G6OA 4I39A 2XA7S 5DJUA 1G28A 5A8BA 3LYXA 4ME4A 2XSSA 5K5BA 2JN7A 3BY8A 3LIBA 1V9ZA 2EA9A 4NXEA 4GLQA 3A0VA 2A24A 2ZMFA 1STZA 1TS7A 5F69A 3FG8A 4WL9A 4HH2A 4IUHA 5HWTA 4JGRA 1N9LA 2VV7A 3KYQA 4KQOA 3CLOA 1OT9A 3PXPA 5CX7A 1GSXA 3B47A 3UB7A 2BASA 3VOLA 4DMZA 4NEED 1MZUA 4I3JA 3K3CA 3LICA 1S1ZA 1OTBA 2IA2A 2Y79A 3OLOA 3UE6A 3LFVA 5G4YA 2NUPC 3LUQA 4XT2A 2HGVA 3TJZC 3EGXC 2G7UA 5LBRA 4BBVA 3T4QA 2OWHA 3U2AA 3H82B 1S4RA 1OPXA 2LB9A 3A0SA 1T18A 4MCWA 3HJIA 4LRYC 2QYBA 4EXOA 2VJWA 4L9EA 1UGUA 5DFYA 3NJAA 2H28A 4RQ9A 2PR6A 1OTEA 4Y5FA 3UB9A 2WKRA 2QHKA 5F5YA 4ARZB 1N9OA 4YNRA 4KQDA 2O0YA 3D3OA 4EW7A 3IS2A 1XJ6A 1YSPA 2VV8A 1TS0A 2W3HA 3OBFA 3S7NA 5J3WA 1NRJA 2W3EA 1OT6A 1XJ4A 2LB5A 2QKPA 1XFQA 1F9IA 3F1NA 2V9AA 1H8MA 1W63Q 4B9OA 1F5MA 3LR0A 3FC7A 5IU1A 4DJ3A 3HCYA 4HJ4A 3LI8A 1UWPX 1S1YA 2GJ3A 2WKPA 3PBOA 3ZYTA 5AVFA 3RTYA 1F98A 3UE3A 3PBRA 3BWLA 4WN5A 2J80A 2GNXA 1TF1A 2D01A 3RFBA 4NKPA 4PKYG 3IBJA 2OOLA 5C5KA 1OTDA 3F1OB 3O5YA 3F1NB 4AFIA 3S7PA 1P9RA 4HI4A 3A0RA 4Q0HA 3BQAA 2V0UA 3C30A 4MDZA 3MJQA 4O01A 4GW9A 2YKHA 5EFWA 2VZWA 4BBTA 3PBTA 2PYPA 1JNUA 3CI6A 4HOIA 3ULFA 4PAUA 3MXQA 3MR0A 4K08A 4NXBA 2YKFA 1IFQA 3UB8A 5F68A 2VEAA 4GS9B 5HPFA 3F1PB 2JKTI 3C38A 3DBAA 2XA7M 5TBMB 2VV6A 1YAXA 3GDIA 3CUEC 4R70A 3LIAA 2EWWA 2V1AA 3LIDA 2VLGA 4BWIA 4CLCB 1ZHHB 1IOUA 4O8GA 4BJPA 1H3QA 2XROA 2HJEA 2JKRM 1D06A 3P01A 2MJ6A 2W3FA 3UMDA 4EEPA 2B18A 3CITA 1MC0A 4G3KA 4ETZA 2KX6A 5G4ZA 5HZHA 1P0ZA 4NXFA 5AJGA 4MMNA 2A24B 4PHTA 2Z6DA 3VE4A 3KSIA 3E98A 2DMWA 3JVVA 1LSXA 5L8MA 3H9WA 2I9VA 3PBSA 4P6ZM 1XFNA 4KUKA 4OOLA 4UQIS 4GHIA 1VB6A 2VA0A 3LIEA 3LIFA 5DF9A 1KOUA 1NWZA 2KLIA 3LR5A 3PHYA 5MC7A 4XT2B 1LSWA 4Y3IA 4WF0A 2VGLS 3CWFA 4F3LA 1GSVA 1XJ2A 1TS6A 3EGDC 3PBNA 3W2ZA 3JVUA 3T4SA 4HJ6A 3MQQA 5F6AA 4JGPA 5FL3A 1G6OA 2K2NA 1NLYA 5AVEA 2M7VA 4QPRA 3KO6A 3C2WA 2NUTC 2PT7A 3BY9A 1TS8A 4HP9A 2ZBBA 3CUEA 2VKSA 3OCNA 3FPVA 2OAQ1 4JGOA 2CMNA 4WEJA 3OC2A 3T50A 5J7EA 3R7WA 4I3AA 3E0YA 4EETB 5HWVA 1LT0A 3GECA 4HH3A 1YSQA 2PDRA 2L4RA 4ZRRA 3VV4A 5KSHA 3IS2B 4R6LA 4EQ1A 3E4PA 4O0PA 4H6JA 3OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA2 A;  2Y79 A;  2K31 A;  3S7Q A;  1ZTU A;  2VEA A;  5HPI A;  5DFX A;  5HPF A;  3LFV A;  3R4K A;  5TJJ A;  2HGV A;  3DBA A;  2XRN A;  4R70 A;  2G7U A;  4Q0J A;  5LBR A;  3NOP C;  4BWI A;  5HL6 A;  3CI6 A;  4CQH A;  3TRC A;  2LB9 A;  4O8G A;  2XRO A;  4G3W A;  4MCW A;  4PAU A;  1YKD A;  3KSF A;  2M7U A;  2W3F A;  4LRY C;  2QYB A;  2B18 A;  3CIT A;  2VJW A;  1MC0 A;  4G3K A;  4Y2F A;  5DFY A;  4ETZ A;  3IBR A;  3KSG A;  5AJG A;  4MMN A;  4IJG A;  2W1R A;  4RQ9 A;  4FOF A;  3KSH A;  4Y5F A;  3BJN A;  2Y8H A;  4YNR A;  2O0Y A;  2O9C A;  3D3O A;  3KSI A;  3E98 A;  2O9B A;  1YSP A;  5L8M A;  4E04 A;  2W3H A;  3OBF A;  2W3D A;  3S7N A;  4YOF A;  4ETX A;  2W3E A;  2LB5 A;  3K2N A;  3NOT C;  4Q0I A;  2KLI A;  5I5L A;  2O9A A;  1F5M A;  4Y3I A;  4LRX C;  3HCY A;  2W1T A;  1TD5 A;  3W2Z A;  3MQ0 A;  3MF0 A;  1VHM A;  2K2N A;  2GX5 A;  1MKM A;  1TF1 A;  3NOU C;  4LRZ E;  3RFB A;  2M7V A;  4QPR A;  4DN0 A;  3IBJ A;  3KO6 A;  3MMH A;  3C2W A;  3G6O A;  2OOL A;  4Z1W A;  5C5K A;  2O99 A;  3O5Y A;  4G3V A;  3S7P A;  4ME4 A;  2KOI A;  2XSS A;  5K5B A;  2W3G A;  4IUK A;  2VKS A;  3S7O A;  4EU0 A;  4GLQ A;  2ZMF A;  1STZ A;  4Q0H A;  4EUV A;  2W1T B;  3ZQ5 A;  3E0Y A;  4IUH A;  4MDZ A;  4O01 A;  4GW9 A;  1YSQ A;  3EEA A;  4ZRR A;  2VZW A;  3VV4 A;  4R6L A;  4MN7 A;  4O0P A;  4DMZ A;  5HSQ A;  3NHQ A;  3OOV A; 
#chains in the Genus database with same CATH topology
 4Z9Q A;  1DP8 A;  2Y59 A;  4UA7 A;  1GHI A;  5BOH A;  5TJJ A;  5GLB A;  3UDF A;  4Q0J A;  1W79 A;  3NOP C;  1CK3 A;  2HV1 A;  5DKK A;  2VX8 A;  3ICY A;  5E2G A;  4CQH A;  1WYC A;  4P85 A;  4YWZ A;  3W4O A;  4LV0 A;  3IBR A;  4OH0 A;  2W27 A;  3KSG A;  3KSH A;  1K0K A;  4HNB A;  5F82 A;  1W63 M;  5CGS A;  4HP4 A;  4K0X A;  2PD7 A;  4X56 A;  5L09 A;  1D7E A;  5GLC A;  3QP1 A;  4ETX A;  3MKF A;  4MBK A;  2OSU A;  3WS2 A;  4E3K A;  4Q0I A;  1H5X A;  2O9A A;  3B3X A;  4C6Y A;  3AGD A;  3BQ8 A;  3NBL A;  1XP4 A;  3S22 A;  3H82 A;  4IBR A;  4KG2 A;  5DF8 A;  4BQM A;  1Y4O A;  5KZH A;  4N9K A;  1FR1 A;  5CHJ A;  3PBQ A;  5DTK A;  3SW1 A;  3LR4 A;  3ZNT A;  5FDH A;  1S6R A;  2J3T C;  4Z1W A;  2O99 A;  4G3V A;  2PBD P;  2Y55 A;  5HWW A;  3CPT A;  1E3U D;  2JKG A;  4MLL A;  1NXY A;  4OLG A;  4PM9 A;  3MQO A;  2A2L A;  1XA1 A;  3N4I A;  4ARZ A;  5HW3 A;  4P6Z S;  5EOO A;  2IWD A;  3IT9 A;  4OP8 A;  2VGL M;  3FWL A;  1BYW A;  5HSQ A;  3WS5 A;  3N8R A;  3DTM A;  4R0Q A;  4ZAM A;  3HBR A;  3LO7 A;  4R3A A;  3JYI A;  4RX3 A;  2P7J A;  3MFX A;  3Q7V B;  2XR0 A;  4M4X A;  1I5Q A;  3M2J A;  4E3I A;  1YKD A;  3KSF A;  4U0X A;  2M7U A;  4HBT A;  2E8J A;  2FZ0 A;  3SS3 A;  5AQ9 A;  1XPB A;  1KE4 A;  5M19 A;  1XA7 A;  3G4P A;  2HDS A;  1T1B A;  4OOM A;  4YIN A;  4MN5 A;  5DKL A;  1K4F A;  1LL8 A;  4H6J B;  2PAV P;  4LCL A;  4WUJ A;  2Q0O A;  1MY8 A;  2P08 A;  1FOF A;  2ZMA A;  2B5R A;  3TE8 A;  3IWI A;  2P04 A;  3MFD A;  4KG5 A;  4CLC E;  3UB5 P;  1SHV A;  3EWK A;  5DJT A;  4EES A;  3V50 A;  3ZFZ A;  1VHM A;  5EPH A;  3NY4 A;  3MSH A;  1MPL A;  3HJK A;  3SH9 A;  4ME4 A;  1V9Z A;  4NXE A;  5DTS A;  3MZD A;  2ZMF A;  1STZ A;  5EM1 A;  3FG8 A;  4WL9 A;  4B4Z A;  3LEZ A;  4EQI A;  1GSX A;  1RGY A;  3B47 A;  1MZU A;  1PYY A;  1NZU A;  5G4Y A;  2NUP C;  3LUQ A;  3ZGA B;  4Y17 A;  3TJZ C;  1I2S A;  4S2M A;  4JXV A;  5E2F A;  1KGG A;  3N7W A;  4PMA A;  3T4Q A;  5GHZ A;  5EVL A;  3V5M A;  2LB9 A;  4E3M A;  1PI4 A;  2QYB A;  4EXO A;  2VJW A;  4IVK A;  4D60 A;  4XUZ A;  4OLD A;  3NJA A;  2IWB A;  3LY4 A;  5TFQ A;  5HL1 A;  1IKG A;  4RQ9 A;  2PR6 A;  1OTE A;  5FSR A;  3LGO A;  3G2Y A;  3QHY A;  1N9O A;  4S2K A;  1NZO A;  3IS2 A;  1LHY A;  1PI5 A;  1G6A A;  3AGF A;  3S7N A;  3D4F A;  1KGE A;  2Y2I A;  1XJ4 A;  3F1N A;  4R4R A;  1L0F A;  5DF7 A;  4HJ4 A;  3IWO A;  2ZQD A;  3SS5 A;  2GJ3 A;  3ZYT A;  5E2H A;  3PBR A;  3C5A A;  2J80 A;  2GNX A;  4KG6 A;  4Y13 A;  1H8Z A;  3IBJ A;  1ERQ A;  3V39 A;  1OTD A;  3F1N B;  5FI2 A;  1HVB A;  2XD1 A;  2ZC4 B;  2CC1 A;  3BQA A;  3G30 A;  5FAO A;  3C30 A;  1ONH A;  5EFW A;  5L10 A;  1DJB A;  1JNU A;  1Z6F A;  3UDX A;  3MXQ A;  4A5R A;  3MR0 A;  2VEA A;  3PAE A;  4GS9 B;  1W8Q A;  3C38 A;  4KZ6 A;  2XA7 M;  1PWC A;  2ZM0 A;  2V8F A;  3CUE C;  4R70 A;  3DAV A;  2VLG A;  1ERM A;  3QP5 A;  4CLC B;  1BZA A;  1L3L A;  3FKV A;  1ES5 A;  4BJP A;  3ZDJ A;  3P01 A;  1VQQ A;  3DTE A;  4BD0 A;  3CIT A;  1IKI A;  3N8S A;  4MMN A;  5HFO A;  4JPM A;  4PHT A;  4H8R A;  4FH2 A;  4GDN A;  4QU3 A;  3E98 A;  4QB8 A;  1CI9 A;  5FAQ A;  4X53 A;  3JVV A;  1LSX A;  4ESP A;  3PBS A;  1FR6 A;  3UN7 A;  4OOL A;  5A92 A;  4QJG A;  1EI5 A;  2EX8 A;  3G35 A;  1VB6 A;  2VA0 A;  3SH8 A;  1NWZ A;  5GHX A;  3BFG A;  1FSW A;  4XT2 B;  1YLJ A;  1YLT A;  3HL9 A;  3MKE A;  1SZV A;  1MBL A;  4NK3 A;  2ZLY A;  4GZB A;  4OQH A;  2Q9M A;  3S1Y A;  5F6A A;  1G6O A;  2K2N A;  4X25 A;  1NLY A;  2OLU A;  2Y2G A;  4WBG A;  3HUN A;  2WZX A;  4CJN A;  5M18 A;  1AXB A;  3CUE A;  2VKS A;  4R3B A;  4NET A;  1K25 A;  3VP1 A;  3T50 A;  2Y2Q A;  1FSY A;  2ACG A;  3R7W A;  3MS6 A;  4KZ3 A;  5EVE A;  1YSQ A;  2L4R A;  3BEC A;  1LLB A;  2ZQC A;  3IF5 A;  2V20 A;  3KYE A;  2EXB A;  2K31 A;  2D02 A;  5HPI A;  5JYO A;  2JKF A;  2WKH A;  3R7W B;  1LL5 A;  3EQU A;  2QJ5 A;  4P0M A;  2C5W B;  4CLC D;  3T4O A;  3N8L A;  1GA0 A;  5HAR A;  1BUE A;  3T4K A;  4LEN A;  4Y2F A;  4EBP A;  4EBN A;  5IS1 A;  1BLH A;  2QJ7 A;  3W4Q A;  4IBX A;  2FFF B;  3HLB A;  3NEC A;  5L2F A;  4P87 A;  3T4T A;  4JXG A;  3UME A;  3T4J A;  1LSV A;  2JE5 A;  3MXR A;  2ZC6 B;  4E04 A;  2V1B A;  4FTX A;  4N92 A;  4L0L A;  5CXW A;  1IEL A;  1ERO A;  4HES A;  3K2N A;  4X68 A;  1T19 A;  4UEY A;  1ZC2 A;  2PU2 A;  1T1C A;  3K3D A;  4NG2 A;  2Z2M B;  3LEQ A;  4L9F A;  4U3T A;  3TOI A;  1NLZ A;  1ZG6 A;  1XGI A;  2OAP 1;  3MQ0 A;  1K4E A;  4LCM A;  2GX5 A;  3GRJ A;  1H8Y A;  4BL3 A;  3OPH A;  2ZOH A;  1QMF A;  2H0Y A;  2KOI A;  5F1G A;  2W3G A;  4GJ4 A;  4IUK A;  3S7O A;  4EU0 A;  4Q8I A;  1HLU P;  3CJM A;  3NI9 A;  1FCN A;  1YPR A;  4UA9 A;  4EUV A;  2WKQ A;  4ZDX A;  3OCL A;  3C4O A;  3L9K A;  3EEA A;  2V1Z A;  4Y15 A;  3GR2 A;  3G32 A;  5EUA A;  2FH5 A;  5HD5 A;  3SS4 A;  4KZ8 A;  5IT5 A;  4GHI B;  4KUO A;  3VOZ A;  1S4S A;  4OON A;  1OTI A;  4F3L B;  1ES3 A;  2ZL1 B;  1PZP A;  3TRC A;  2WAD A;  1SKO B;  2FFY A;  4OPR A;  5CHU A;  1TDG A;  4EWF A;  3F1O A;  3LR3 A;  5A91 A;  1YT4 A;  3V3S A;  1I2W A;  4GDB A;  1PZO A;  4R4S A;  1K38 A;  3WWX A;  5EV0 A;  4BBU A;  5KIZ A;  2M1C A;  4FOF A;  3EQV A;  4GB7 A;  1DP9 A;  5HAQ A;  4GD6 A;  1KDW A;  2OV5 A;  4B4X A;  1W7F A;  1SKF A;  4HY8 A;  1BLS A;  4DRT A;  1IYP A;  3NDE A;  2V2F F;  2X02 A;  5TBM A;  2AVX A;  1MWS A;  1TD5 A;  2J8Y A;  4HJ3 A;  3FPW A;  1QME A;  4WZ5 C;  3RJU A;  3GV9 A;  1JTG A;  4I39 A;  4ZBE A;  1NYM A;  3HVF A;  1G28 A;  5A8B A;  4OQ0 A;  5F1F A;  3LYX A;  4JF4 A;  1YMX A;  3P98 A;  3HRE A;  4Y0O A;  5FAS A;  1OT9 A;  4BEN A;  3OPP A;  4DMZ A;  4NEE D;  1S1Z A;  5FAT A;  4D2O A;  3LFV A;  1JWP A;  1XKZ A;  3A3J A;  4WMC D;  3CG5 A;  5KSC A;  4E3J A;  3LCE A;  3EGX C;  4BBV A;  3H82 B;  1S4R A;  1K6R A;  4KZ9 A;  3HUM A;  2XFS A;  4L9E A;  1UGU A;  4OP5 A;  3CPT B;  4Y5F A;  3ZNY A;  3UB9 A;  2WKR A;  4WZ5 A;  5E2E A;  4ARZ B;  4PM8 A;  5HX9 A;  3MBZ A;  1DJC A;  1YSP A;  3ZVW A;  5AQB A;  3OBF A;  2Y2H A;  2HP9 A;  1OT6 A;  2LB5 A;  1XFQ A;  4E6W A;  1F9I A;  3NUL A;  1W63 Q;  1XXM A;  5IU1 A;  3BEB A;  2XH9 A;  3ZG7 B;  3PBO A;  3RTY A;  4WN5 A;  5CED A;  4HBU A;  2OLV A;  4NKP A;  1ZKJ A;  3ITA A;  1DJA A;  3S7P A;  2UWX A;  3A0R A;  2WYX A;  3MJQ A;  2HPB A;  3D9Y A;  3UE0 A;  1CEF A;  3CI6 A;  3ULF A;  4PAU A;  3VFF A;  4UA6 A;  4JXW A;  3UPO A;  5CEC A;  5HPF A;  3WS0 A;  3DWK A;  2JKT I;  3G2Z A;  3DBA A;  5M1A A;  2VV6 A;  1YAX A;  3GDI A;  3LIA A;  2G2W A;  3LID A;  4PM7 A;  4BWI A;  1IOU A;  3A3I A;  4O8G A;  1JTD A;  2HJE A;  2W3F A;  3UMD A;  4KZA A;  4EEP A;  3ZCZ A;  2B18 A;  1MC0 A;  4G3K A;  3FYZ A;  4ETZ A;  2KX6 A;  1LI9 A;  1P0Z A;  5FDS A;  1ES4 A;  3ISG A;  4LV2 A;  1JWV A;  1LI0 A;  3ZHH A;  5AQA A;  2I9V A;  1L0E A;  4UQI S;  5EVI C;  3LIE A;  3LIF A;  4X55 A;  2HDQ A;  2JBF A;  4KEN B;  5MC7 A;  5CER A;  1LSW A;  3ZG0 A;  2Z2L B;  1HTZ A;  3BFD A;  1GSV A;  1TS6 A;  2DCF A;  4HEF A;  4FCF A;  1MWT A;  3W2Z A;  3O88 A;  4JGP A;  2M7V A;  4WZ4 A;  3PAG A;  2PT7 A;  1VET A;  1TS8 A;  2EFX A;  3DTI A;  4X6T A;  3OCN A;  2EXA A;  1IYS A;  2OAQ 1;  5TR7 A;  2CMN A;  2ZC5 B;  3E0Y A;  2WKE A;  3GEC A;  2PDR A;  4FH4 A;  4ZRR A;  3IS2 B;  4N1X A;  4R6L A;  4Y7P A;  3E4P A;  4OVD A;  1KDS A;  3OOV A;  3T12 B;  3GSG A;  2W0N A;  4EER A;  4OPY A;  1E4D A;  4EEU A;  1DRM A;  3W4P A;  2KDK A;  1W5D A;  3R4K A;  4MN6 A;  3ITB A;  3ZG8 B;  3UO9 A;  2WAF A;  4S2N C;  3IWQ A;  2JHE A;  5EVI A;  1N4O A;  3U4L P;  5FI7 A;  4R38 A;  2XDM A;  4KZB A;  2HZ5 A;  2PHY A;  2L0W A;  3O3V A;  5GHY A;  1BSG A;  3VP4 A;  3ZG9 B;  3E4O A;  2WKI A;  4BL2 A;  4JGQ A;  1VEU A;  2QWS A;  1XJ3 A;  3CAX A;  4FSF A;  5EVI B;  2W3D A;  3QNB A;  1NY0 A;  3GVB A;  4U0T A;  4LLO B;  2X71 A;  4DF6 A;  5I5L A;  1BLC A;  1OTA A;  1YLW A;  3IXG A;  5IHV A;  4EV4 A;  3IXH A;  3CZD A;  4QY5 A;  3UY6 A;  1VEU B;  2JC7 A;  3NIA A;  2ZM2 A;  4PKY A;  2HJ9 C;  4DDY A;  1FCO A;  2JKT M;  1N9B A;  2HDU A;  2J7V A;  4L9G A;  2PD8 A;  3RXW A;  1PW8 A;  1PIO A;  4ZJ3 A;  2GZA A;  4WEL A;  4GNU A;  4S2N A;  1SDE A;  2EWV A;  4II7 A;  1F2K A;  1WYB A;  4MEZ A;  3QP8 A;  1XX2 A;  3QP4 A;  2ZQA A;  4E3N A;  1P97 A;  3NHQ A;  3IX3 A;  4DKI A;  1K56 A;  4F94 A;  3S7Q A;  3ZVT A;  2WGV A;  3FV7 A;  4X1M A;  1J9M A;  1P9W A;  4NXG A;  5FQI A;  4JKT A;  2XRN A;  4GKU A;  1KE3 A;  4HQA A;  2Y2P A;  3TG9 A;  5GLA A;  3P09 A;  1N9N A;  3BFE A;  3IHA A;  2Z6C A;  3B42 A;  4K0W A;  2DNS A;  4DE2 A;  2XK1 A;  3UE1 A;  4IED A;  1GCE A;  3PYP A;  1X0O A;  2R9X A;  5HDS A;  5HAP A;  3BJN A;  1TEM A;  4S2O A;  2K7S A;  1WA9 A;  3GTC A;  1Y54 A;  4LPZ A;  3E4Q A;  3BFC A;  2XFT A;  1CF0 A;  3F1P A;  1ES2 A;  3GMW A;  1Y28 A;  2PR5 A;  2PYR A;  3WRT A;  3VE3 A;  1OJG A;  3G31 A;  3UDI A;  3IF6 C;  3MF0 A;  2R78 A;  5CRF A;  3NOU C;  2B02 A;  5DJU A;  2VK3 A;  3LIB A;  2H0T A;  4BD1 A;  3Q07 A;  3A0V A;  2A24 A;  1TS7 A;  3VOY A;  4DE3 A;  1BUL A;  3HLW A;  4JGR A;  1PW1 A;  1HZO A;  1N9L A;  2VV7 A;  4UAA A;  3CLO A;  5CX7 A;  1IEM A;  3V3R A;  3VOL A;  2EX6 A;  1WE4 A;  3UB7 A;  4I3J A;  3K3C A;  3LIC A;  4PM6 A;  2J9O A;  3O87 A;  2RCX A;  1SCW A;  2IA2 A;  3IH9 A;  5FQK A;  3UE6 A;  1HD8 A;  5FQM A;  3C7V A;  4RYE A;  3E2K A;  2HGV A;  4DXB A;  3BRM A;  2G7U A;  4UHU A;  3U2A A;  1YLY A;  1T18 A;  3HLF A;  4WMC A;  3OZH A;  4LRY C;  2PRF A;  1E3U A;  5D3O A;  1IYO A;  1BT5 A;  2V8C A;  1GA9 A;  1A0K A;  5DFY A;  1YM1 A;  2H28 A;  1CEG A;  3IF6 A;  5F5Y A;  2P74 A;  3IHB A;  4YNR A;  4N9L A;  3O86 A;  5EOE A;  2O0Y A;  3D3O A;  2XF3 A;  1XJ6 A;  1CQA A;  3T1Q B;  3BFF A;  4KZ5 A;  5J3W A;  1NRJ A;  1PRQ A;  2W3E A;  1BTL A;  3A3E A;  2V9A A;  1H8M A;  1NJ4 A;  1PNE A;  3VMA A;  3VFH A;  4B9O A;  3LR0 A;  4XUX A;  4DJ3 A;  1TVF A;  3HCY A;  4X69 A;  1UWP X;  1PWD A;  3WS4 A;  2WKP A;  5AVF A;  3DTK A;  3BWL A;  5L07 A;  3I7J A;  1TF1 A;  1KVL A;  2OOL A;  3F1O B;  3IH8 A;  3CHW P;  1VM1 A;  4OPQ A;  1JWZ A;  3NCK A;  2B95 A;  1Q2P A;  4FD8 A;  3Q1F A;  4P6B A;  4O01 A;  2YKH A;  3N6I A;  5FAP A;  4DE1 A;  3PBT A;  2PYP A;  4E3O A;  2ZQ7 A;  1ESU A;  1RGZ A;  2PBY A;  1RCJ A;  4LFU A;  2YKF A;  1IFQ A;  4LV1 A;  1E25 A;  3IX4 A;  5F68 A;  3UB8 A;  3SZT A;  5TBM B;  4E6X A;  4LGW A;  1G5U A;  2EWW A;  2XD5 A;  1D06 A;  2C6W B;  3BLS A;  2EX2 A;  4X1L A;  4DXC A;  5G4Z A;  5HZH A;  4NXF A;  5AJG A;  3T1R A;  2DMW A;  5L8M A;  3H9W A;  4KQR A;  2DRW A;  4P6Z M;  2Y4A A;  2P9V A;  4KUK A;  4KZ4 A;  5E43 A;  5FA7 A;  1NRF A;  3JPU A;  3LR5 A;  3PHY A;  1FIL A;  3T1X A;  1K57 C;  4WF0 A;  2VGL S;  3CWF A;  1XJ2 A;  2Y2N A;  1O7E A;  5HAI A;  3Q7V A;  3JVU A;  3T4S A;  4HJ6 A;  3MQQ A;  5FL3 A;  5GL9 A;  1YLZ A;  5AVE A;  2ZQ8 A;  2P9V B;  2Y2M A;  3KO6 A;  2NUT C;  2ZBB A;  2QMI A;  4O7D A;  1O07 A;  3VP2 A;  4RX2 A;  3PTE A;  3OC2 A;  1FIK A;  5J7E A;  4S2I A;  3QNC A;  4EET B;  5HWV A;  2GDN A;  3DWZ A;  3A3D A;  1D1J A;  4EQ1 A;  4H6J A;  3IX8 A;  3UNW A;  5JYP A;  3BLM A;  1ZTU A;  5DFX A;  1UWN X;  2RL3 A;  3W8K A;  1S67 L;  4WYY A;  3VSL A;  3SH7 A;  4DJ2 A;  2L1M A;  1KGF A;  5FEG A;  5J4E A;  1J3W A;  1XGJ A;  1K57 A;  1MWU A;  2ZJ9 A;  2J3W A;  4IJG A;  2W1R A;  4JF5 A;  3MZF A;  1GSW A;  3C8C A;  1PFL A;  2O9B A;  1CJF A;  3P7N A;  4I38 A;  4BMW A;  4JXS A;  1ODV A;  2HF6 A;  5I94 A;  4OQG A;  4FUW A;  3NOT C;  3B33 A;  3LY3 A;  3EOI A;  2ZOI A;  3D72 A;  2E8I A;  2R9W A;  2V0W A;  3TW8 A;  4WLA A;  3RH8 B;  4LRX C;  2UV0 E;  3H7W A;  1SDN A;  5HD3 A;  2W1T A;  4RVA A;  3HLC A;  3LI9 A;  3AGE A;  1MKM A;  2J9P A;  1JVJ A;  3IQA A;  1FCM A;  4DN0 A;  3MMH A;  2WGI A;  5J8X A;  3KX0 X;  3C4P A;  5CHM A;  5FQ9 A;  1V9Y A;  4PM5 A;  4UQI M;  1IYQ A;  4LV3 A;  3H7W B;  2W1T B;  3ZQ5 A;  3EEH A;  3KYZ A;  3HLD A;  3HLE A;  2VGK A;  4RA7 A;  3T4L A;  5HDC A;  4MN7 A;  2OWJ A;  4CLC C;  5FQJ A;  1FQG A;  2INW A;  2XGN A;  1H0M A;  1K55 C;  5DTT A;  2EFU A;  1MKI A;  2PU4 A;  2QZ6 A;  1M40 A;  1U60 A;  3V67 A;  4K91 A;  5HL6 A;  5HDD A;  4HIA A;  4G3W A;  1KVM A;  3T1S A;  4R3J A;  1EW0 A;  4IHQ A;  4I5S A;  4KZ7 A;  3C7U A;  5FEF A;  5EM0 A;  1VET B;  2J3T D;  4JBF A;  4MBF A;  4QD4 A;  3A3F A;  2Y91 A;  5F83 A;  4HHD A;  1T1A A;  2Y8H A;  3M6B A;  4OKP A;  4WM9 A;  2O9C A;  3GQZ A;  3FKW A;  4I3I A;  5G18 A;  2ZMV A;  4YOF A;  3UPP A;  1YQS A;  4E3L A;  4DDS A;  3BW6 A;  4GS9 A;  1OJ5 A;  4KQQ A;  2JKR I;  4GCZ A;  2Y2K A;  3VSK A;  1NYY A;  4OOY A;  2BG1 A;  4JF6 A;  4CLC A;  4MBH A;  4B93 A;  2X01 A;  4GOG A;  4WEK A;  1S66 L;  1DP6 A;  2WK0 A;  1K55 A;  1ESI A;  4LRZ E;  2HP5 A;  5FQQ A;  2Y2L A;  3PR6 A;  2Y2J A;  3UB6 A;  1OME A;  3G6O A;  2XA7 S;  1YMS A;  4CPK A;  2XSS A;  5K5B A;  2JN7 A;  2ZC7 A;  1CI8 A;  3BY8 A;  2EA9 A;  4GLQ A;  1ONG A;  5F69 A;  2I72 A;  4HH2 A;  4M3K A;  1MXO A;  4IUH A;  5HWT A;  2H5S A;  3KYQ A;  4KQO A;  2IWC A;  1MWR A;  1GHP A;  2WZZ A;  3PXP A;  4ZJ1 A;  4OPZ A;  2BAS A;  5EE8 A;  1OTB A;  1K6S A;  2Y79 A;  5A93 A;  3OLO A;  3QP2 A;  3G34 A;  4ZJ2 A;  2ZM8 A;  4XT2 A;  2Y2O A;  4GD8 A;  3MXS A;  5LBR A;  3M6H A;  2OWH A;  1Q2Q A;  1OPX A;  4XXR A;  3A0S A;  4C75 A;  4OQI A;  4MCW A;  1EWZ A;  3HJI A;  2G2U A;  2WAE A;  4EUZ A;  4R1G A;  4JLF A;  3MZE A;  5DVA A;  3Q81 A;  2QHK A;  1LL9 A;  3HUO A;  4KQD A;  5FI6 A;  4EW7 A;  4IVI A;  4DE0 A;  2VV8 A;  4GN2 A;  1TS0 A;  1S0W A;  2W3H A;  2QPN A;  4QHC A;  2ZQ9 A;  1L0G A;  3IXD A;  2QKP A;  3HLG A;  4Y0T A;  3S4X A;  2HP6 A;  4S2P A;  3CMZ A;  2ZD8 A;  3NDG A;  3SOI A;  1F5M A;  3FC7 A;  5CEB A;  4EBL A;  2H10 A;  3LI8 A;  3Q7Z A;  4R23 A;  3VP3 A;  1S1Y A;  2Q9N A;  4ID4 A;  4C3Q A;  1ALQ A;  1F98 A;  3UE3 A;  3VP0 A;  5GLD A;  5TGF A;  1RP5 A;  2D01 A;  3RFB A;  4PKY G;  5C5K A;  3M2K A;  3O5Y A;  5CTN A;  4AFI A;  5EVI D;  5A90 A;  4ZTK A;  1P9R A;  2ZC3 B;  4HI4 A;  3RXX A;  4Q0H A;  2V0U A;  4MDZ A;  1AWI A;  3QP6 A;  4GW9 A;  4PPR A;  1PWG A;  2VZW A;  5KMW A;  3FZC A;  5EEC A;  4HOI A;  1G68 A;  4K08 A;  4NXB A;  3ZG5 A;  2VGJ A;  3F1P B;  3BM6 A;  5U47 A;  1K54 C;  2V1A A;  4QWO A;  2JCH A;  2WGW A;  1ZHH B;  1Z09 A;  1H3Q A;  3OPL A;  2XRO A;  4BLM A;  2JKR M;  2MJ6 A;  3TSG A;  5CGW A;  1TDL A;  3UPN A;  1C3B A;  4B88 A;  3WRZ A;  2A49 A;  4Y0U A;  2A24 B;  3Q82 A;  2EX9 A;  2Z6D A;  1YLP A;  3VE4 A;  2WGW B;  3KSI A;  4YFM A;  2XLN A;  2WUQ A;  3DW0 A;  2XQZ A;  1XFN A;  3IXB A;  3L7H A;  4GHI A;  4S2L A;  5DF9 A;  4MNR A;  1KOU A;  2KLI A;  1M6K A;  5CGX A;  1ACF A;  1K56 D;  2BLS A;  4Y3I A;  1L2S A;  1L0D A;  4F3L A;  3PBN A;  3EGD C;  5CTM A;  5AQ7 A;  4N1H A;  1GHM A;  1ZG4 A;  2ZL1 A;  1BLP A;  1SKO A;  2A3U A;  1KE0 A;  2BTF P;  3NC8 A;  4QPR A;  3C2W A;  3BY9 A;  4HP9 A;  1W8Y A;  2XEP A;  1K54 A;  3FPV A;  4JGO A;  3WS1 A;  4WEJ A;  3IF6 B;  4I3A A;  1LT0 A;  4HH3 A;  3OPR A;  3VV4 A;  5KSH A;  1DY6 A;  4S2J A;  4O0P A;  4QY6 A;  2HDR A;  3BYD A;  3E2L A;  4BBT A; 
#chains in the Genus database with same CATH homology
 2W0N A;  4EER A;  4EEU A;  1DRM A;  2K31 A;  1DP8 A;  1ZTU A;  2KDK A;  2D02 A;  5DFX A;  1UWN X;  5HPI A;  3R4K A;  5TJJ A;  4MN6 A;  1S67 L;  3R7W B;  4Q0J A;  3NOP C;  2HV1 A;  5DKK A;  2VX8 A;  3ICY A;  4CQH A;  2JHE A;  4DJ2 A;  2L1M A;  3EQU A;  2QJ5 A;  4CLC D;  5J4E A;  3T4O A;  4YWZ A;  3T4K A;  4R38 A;  4Y2F A;  3IBR A;  5IS1 A;  2J3W A;  2PHY A;  2QJ7 A;  2W27 A;  3KSG A;  4IJG A;  2L0W A;  2W1R A;  3KSH A;  3E4O A;  4HNB A;  1GSW A;  1W63 M;  3C8C A;  3T4T A;  4JGQ A;  3UME A;  3T4J A;  4HP4 A;  1LSV A;  2O9B A;  2QWS A;  1XJ3 A;  2PD7 A;  3P7N A;  3CAX A;  4FSF A;  4E04 A;  4I38 A;  4BMW A;  1D7E A;  2W3D A;  2V1B A;  4L0L A;  4ETX A;  1ODV A;  2HF6 A;  3K2N A;  1T19 A;  4UEY A;  3NOT C;  3B33 A;  4LLO B;  4Q0I A;  3EOI A;  2ZOI A;  3D72 A;  5I5L A;  1T1C A;  3K3D A;  2O9A A;  2V0W A;  1OTA A;  3TW8 A;  4WLA A;  3BQ8 A;  3RH8 B;  4LRX C;  3H7W A;  4L9F A;  5HD3 A;  2W1T A;  1NLZ A;  3H82 A;  4PKY A;  2OAP 1;  3MQ0 A;  2HJ9 C;  3LI9 A;  2GX5 A;  1MKM A;  2JKT M;  3PBQ A;  3SW1 A;  2ZOH A;  3LR4 A;  4DN0 A;  3MMH A;  2J3T C;  4L9G A;  4Z1W A;  2O99 A;  2PD8 A;  4G3V A;  2KOI A;  3KX0 X;  2W3G A;  4GJ4 A;  4IUK A;  2GZA A;  4WEL A;  3S7O A;  4EU0 A;  1V9Y A;  5HWW A;  4UQI M;  2EWV A;  4II7 A;  3MQO A;  2A2L A;  4ARZ A;  4EUV A;  2WKQ A;  3H7W B;  4P6Z S;  2W1T B;  3ZQ5 A;  3EEH A;  3OCL A;  3KYZ A;  3EEA A;  3T4L A;  5HDC A;  4MN7 A;  2VGL M;  2FH5 A;  2OWJ A;  5HD5 A;  4CLC C;  1BYW A;  5HSQ A;  1P97 A;  3NHQ A;  2INW A;  3S7Q A;  5IT5 A;  4GHI B;  4KUO A;  1P9W A;  4NXG A;  1S4S A;  1OTI A;  2XRN A;  4F3L B;  4R3A A;  3V67 A;  5HL6 A;  4HQA A;  5HDD A;  2P7J A;  3MFX A;  4HIA A;  3TRC A;  1N9N A;  4M4X A;  2Z6C A;  4G3W A;  3B42 A;  1YKD A;  3KSF A;  2M7U A;  1EW0 A;  4IHQ A;  3F1O A;  2FZ0 A;  3LR3 A;  4I5S A;  2J3T D;  3PYP A;  1X0O A;  4BBU A;  5HDS A;  5KIZ A;  4HHD A;  2M1C A;  4FOF A;  3BJN A;  3EQV A;  1T1A A;  2Y8H A;  2K7S A;  1DP9 A;  1WA9 A;  1T1B A;  2O9C A;  4OOM A;  4I3I A;  4LPZ A;  2ZMV A;  3E4Q A;  4MN5 A;  5DKL A;  4YOF A;  1LL8 A;  4H6J B;  4HY8 A;  4WUJ A;  3BW6 A;  4GS9 A;  1OJ5 A;  2P08 A;  3F1P A;  2JKR I;  4GCZ A;  3TE8 A;  1Y28 A;  2PR5 A;  2P04 A;  5TBM A;  2PYR A;  3VE3 A;  1OJG A;  4CLC E;  1TD5 A;  4HJ3 A;  4CLC A;  3EWK A;  3FPW A;  4B93 A;  5DJT A;  4EES A;  4WEK A;  1S66 L;  3MF0 A;  1DP6 A;  1VHM A;  2R78 A;  3NOU C;  4LRZ E;  3HJK A;  2B02 A;  3PR6 A;  3UB6 A;  3G6O A;  4I39 A;  2XA7 S;  5DJU A;  1G28 A;  5A8B A;  3LYX A;  4ME4 A;  2XSS A;  5K5B A;  2JN7 A;  3BY8 A;  3LIB A;  1V9Z A;  2EA9 A;  4NXE A;  4GLQ A;  3A0V A;  2A24 A;  2ZMF A;  1STZ A;  1TS7 A;  5F69 A;  3FG8 A;  4WL9 A;  4HH2 A;  4IUH A;  5HWT A;  4JGR A;  1N9L A;  2VV7 A;  3KYQ A;  4KQO A;  3CLO A;  1OT9 A;  3PXP A;  5CX7 A;  1GSX A;  3B47 A;  3UB7 A;  2BAS A;  3VOL A;  4DMZ A;  4NEE D;  1MZU A;  4I3J A;  3K3C A;  3LIC A;  1S1Z A;  1OTB A;  2IA2 A;  2Y79 A;  3OLO A;  3UE6 A;  3LFV A;  5G4Y A;  2NUP C;  3LUQ A;  4XT2 A;  2HGV A;  3TJZ C;  3EGX C;  2G7U A;  5LBR A;  4BBV A;  3T4Q A;  2OWH A;  3U2A A;  3H82 B;  1S4R A;  1OPX A;  2LB9 A;  3A0S A;  1T18 A;  4MCW A;  3HJI A;  4LRY C;  2QYB A;  4EXO A;  2VJW A;  4L9E A;  1UGU A;  5DFY A;  3NJA A;  2H28 A;  4RQ9 A;  2PR6 A;  1OTE A;  4Y5F A;  3UB9 A;  2WKR A;  2QHK A;  5F5Y A;  4ARZ B;  1N9O A;  4YNR A;  4KQD A;  2O0Y A;  3D3O A;  4EW7 A;  3IS2 A;  1XJ6 A;  1YSP A;  2VV8 A;  1TS0 A;  2W3H A;  3OBF A;  3S7N A;  5J3W A;  1NRJ A;  2W3E A;  1OT6 A;  1XJ4 A;  2LB5 A;  2QKP A;  1XFQ A;  1F9I A;  3F1N A;  2V9A A;  1H8M A;  1W63 Q;  4B9O A;  1F5M A;  3LR0 A;  3FC7 A;  5IU1 A;  4DJ3 A;  3HCY A;  4HJ4 A;  3LI8 A;  1UWP X;  1S1Y A;  2GJ3 A;  2WKP A;  3PBO A;  3ZYT A;  5AVF A;  3RTY A;  1F98 A;  3UE3 A;  3PBR A;  3BWL A;  4WN5 A;  2J80 A;  2GNX A;  1TF1 A;  2D01 A;  3RFB A;  4NKP A;  4PKY G;  3IBJ A;  2OOL A;  5C5K A;  1OTD A;  3F1O B;  3O5Y A;  3F1N B;  4AFI A;  3S7P A;  1P9R A;  4HI4 A;  3A0R A;  4Q0H A;  3BQA A;  2V0U A;  3C30 A;  4MDZ A;  3MJQ A;  4O01 A;  4GW9 A;  2YKH A;  5EFW A;  2VZW A;  4BBT A;  3PBT A;  2PYP A;  1JNU A;  3CI6 A;  4HOI A;  3ULF A;  4PAU A;  3MXQ A;  3MR0 A;  4K08 A;  4NXB A;  2YKF A;  1IFQ A;  3UB8 A;  5F68 A;  2VEA A;  4GS9 B;  5HPF A;  3F1P B;  2JKT I;  3C38 A;  3DBA A;  2XA7 M;  5TBM B;  2VV6 A;  1YAX A;  3GDI A;  3CUE C;  4R70 A;  3LIA A;  2EWW A;  2V1A A;  3LID A;  2VLG A;  4BWI A;  4CLC B;  1ZHH B;  1IOU A;  4O8G A;  4BJP A;  1H3Q A;  2XRO A;  2HJE A;  2JKR M;  1D06 A;  3P01 A;  2MJ6 A;  2W3F A;  3UMD A;  4EEP A;  2B18 A;  3CIT A;  1MC0 A;  4G3K A;  4ETZ A;  2KX6 A;  5G4Z A;  5HZH A;  1P0Z A;  4NXF A;  5AJG A;  4MMN A;  2A24 B;  4PHT A;  2Z6D A;  3VE4 A;  3KSI A;  3E98 A;  2DMW A;  3JVV A;  1LSX A;  5L8M A;  3H9W A;  2I9V A;  3PBS A;  4P6Z M;  1XFN A;  4KUK A;  4OOL A;  4UQI S;  4GHI A;  1VB6 A;  2VA0 A;  3LIE A;  3LIF A;  5DF9 A;  1KOU A;  1NWZ A;  2KLI A;  3LR5 A;  3PHY A;  5MC7 A;  4XT2 B;  1LSW A;  4Y3I A;  4WF0 A;  2VGL S;  3CWF A;  4F3L A;  1GSV A;  1XJ2 A;  1TS6 A;  3EGD C;  3PBN A;  3W2Z A;  3JVU A;  3T4S A;  4HJ6 A;  3MQQ A;  5F6A A;  4JGP A;  5FL3 A;  1G6O A;  2K2N A;  1NLY A;  5AVE A;  2M7V A;  4QPR A;  3KO6 A;  3C2W A;  2NUT C;  2PT7 A;  3BY9 A;  1TS8 A;  4HP9 A;  2ZBB A;  3CUE A;  2VKS A;  3OCN A;  3FPV A;  2OAQ 1;  4JGO A;  2CMN A;  4WEJ A;  3OC2 A;  3T50 A;  5J7E A;  3R7W A;  4I3A A;  3E0Y A;  4EET B;  5HWV A;  1LT0 A;  3GEC A;  4HH3 A;  1YSQ A;  2PDR A;  2L4R A;  4ZRR A;  3VV4 A;  5KSH A;  3IS2 B;  4R6L A;  4EQ1 A;  3E4P A;  4O0P A;  4H6J A;  3OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...