3VV4A

Crystal structure of cyanobacteriochrome tepixj gaf domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
LSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQCSEPRQWQEIEIDQFSELASTGSLVLERLHFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 48
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3vv4A00
2GX5A 3RFBA 4RQ9A 1MKMA 1TD5A 3E98A 2M7UA 2W3HA 3R4KA 3IBRA 4BWIA 2O9CA 3C2WA 4MDZA 2O9BA 3VV4A 4Q0HA 2W3FA 2W3GA 2LB9A 4PAUA 2XSSA 4LRYC 3HCYA 5LBRA 4R70A 4CQHA 4O8GA 2W1TB 4ETZA 2W1TA 3KSGA 1YSQA 3S7QA 2Y79A 3OOVA 3S7NA 2LB5A 4Q0JA 2O0YA 4Y5FA 4IJGA 2QYBA 3NOUC 4FOFA 4G3KA 2XRNA 3MMHA 1ZTUA 2K31A 3CITA 3NHQA 2VEAA 2M7VA 3KSHA 2Y8HA 5DFYA 2HGVA 1STZA 3ZQ5A 5K5BA 1MC0A 2ZMFA 3KO6A 3E0YA 3BJNA 4GLQA 2VJWA 2VZWA 5I5LA 2KOIA 4G3WA 2O9AA 3K2NA 5DFXA 3OBFA 4MCWA 4YOFA 2KLIA 4E04A 4QPRA 3NOPC 3TRCA 4ETXA 1VHMA 3KSFA 3S7OA 2XROA 4EUVA 3G6OA 4ZRRA 4Z1WA 4Y3IA 3S7PA 2OOLA 5AJGA 2IA2A 1F5MA 2W1RA 4MN7A 1TF1A 4DMZA 4MMNA 2B18A 5L8MA 1YKDA 3DBAA 2K2NA 5HL6A 5C5KA 4DN0A 4LRZE 4LRXC 2W3EA 4IUHA 4O01A 3W2ZA 4Q0IA 3KSIA 2O99A 4O0PA 4GW9A 4R6LA 4G3VA 3LFVA 2W3DA 5HPFA 3D3OA 3EEAA 3NOTC 5HPIA 3MQ0A 4IUKA 1YSPA 3IBJA 4ME4A 5TJJA 4Y2FA 3CI6A 2G7UA 2VKSA 3MF0A 4EU0A 4YNRA 3O5YA 5HSQA
chains in the Genus database with same CATH superfamily
2QKPA 4MN5A 3RFBA 1W79A 2L1MA 5EVIC 1CQAA 3HUNA 4YWZA 1BLCA 3AGDA 4ZDXA 3KSGA 3NIAA 4OP8A 2OWJA 1H8YA 1MWUA 2B02A 3ZG5A 3LIBA 5FAPA 3JVUA 4KQOA 2O0YA 3CAXA 5F68A 5FATA 4RA7A 1JVJA 1XX2A 1MKIA 4ID4A 3T50A 1ZTUA 3KYZA 2X71A 2I9VA 3BQ8A 1DJBA 1LT0A 4HJ6A 1TS7A 1VEUA 1ONGA 2RCXA 3BJNA 2KX6A 4F94A 2O9AA 4HEFA 1OMEA 2V1BA 1L0EA 1ES4A 3E2KA 4C3QA 4H6JA 1WE4A 3TRCA 4QY5A 3MR0A 4N1XA 2H10A 4MBHA 3OC2A 4PMAA 3UDFA 5HL6A 4UQIM 4O01A 2PHYA 2VV7A 4GW9A 4LGWA 4JGPA 4BL3A 4LPZA 3MBZA 5JYOA 5HWVA 5DF9A 4HP9A 4WZ5A 3LI8A 1P9RA 3HLCA 5HPIA 3QNCA 4DDSA 1PZPA 2VGJA 3PTEA 2XLNA 3LYXA 2JE5A 3A3DA 4JXSA 1MKMA 2VA0A 3BQAA 4X68A 5AQAA 3GQZA 3B33A 4IBXA 3UE6A 2ZOHA 1FOFA 1LI9A 4ZAMA 1ACFA 4IHQA 1OTAA 1J3WA 4K0WA 2PT7A 2D01A 1GHMA 3W4PA 3IF6C 3QHYA 5E43A 5GHZA 1T1CA 5HDSA 4EUZA 1CI8A 4CLCC 2ZQCA 3WS5A 1FCNA 2EXBA 4EV4A 4QD4A 2M7VA 4GNUA 3B42A 1RCJA 4E6XA 3HVFA 1LSXA 2M1CA 1MC0A 2EX9A 3S1YA 4B88A 2Z6CA 2ZM2A 3EOIA 3JVVA 3PBNA 3NY4A 4EQ1A 3TE8A 4FH4A 3GRJA 3TJZC 5FL3A 1G5UA 2WKIA 2Y2NA 4KZBA 4L9EA 1CEFA 1XJ6A 2IA2A 4OKPA 5CHUA 5KSHA 1F9IA 4R4RA 5DTTA 3T4JA 1QMEA 2BASA 4P6BA 1O07A 3CWFA 2CMNA 3OPHA 1L0DA 1JTGA 3T4QA 2A24B 4NKPA 5TGFA 3WWXA 2V8FA 4Y0UA 4NXFA 2VX8A 2EXAA 3M2KA 4I3AA 1K57A 3QP4A 3VV4A 3KYQA 2WKEA 1T19A 2X01A 4L9FA 1K55C 4O8GA 4FH2A 2DRWA 3UB7A 4QHCA 3S7QA 4WF0A 2J3TC 3K3DA 4HJ3A 1ZKJA 5EOEA 3DTEA 2XH9A 3EGXC 3NULA 3MMHA 5GHYA 4DE0A 4OH0A 3E2LA 2HF6A 1FSWA 4P6ZS 4GS9B 1LHYA 5HW3A 5IU1A 5KSCA 2HP6A 4YOFA 3IS2B 1H0MA 3NOPC 4M3KA 3S7OA 2KDKA 4EUVA 3P7NA 3BWLA 1FR1A 1MWRA 4DMZA 5G4YA 1FQGA 3O3VA 3SS5A 5AQ7A 4IVKA 1IEMA 3LR5A 4QJGA 5CTMA 3O86A 4O0PA 2GJ3A 4S2IA 4DE3A 2ZQ7A 3BFFA 5EVIB 2JC7A 3ZVWA 2P9VB 4OP5A 4IVIA 1OJGA 4I3IA 1T1AA 5I94A 2QHKA 2ZLYA 5MC7A 4MEZA 1PYYA 4PAUA 5CGWA 4CQHA 2WGIA 3EQUA 2W1TB 2J9PA 3UY6A 2FFFB 3NC8A 4K91A 3BFDA 2XFSA 1KE4A 3LR0A 1L3LA 2QYBA 4BENA 2YKFA 4LCMA 1GHIA 5DTKA 1PRQA 2QWSA 3UN7A 2HGVA 5HX9A 3GECA 4BMWA 4WL9A 2ZM0A 3VE4A 3ISGA 5E2EA 4GLQA 4E3IA 5GLBA 1OPXA 4P85A 2DCFA 2H5SA 1LL8A 2WK0A 2WGWB 4EERA 1E3UD 2OV5A 3VFFA 1S67L 4Y7PA 3ITBA 4R3JA 4OQIA 4JF4A 4ZBEA 5FQQA 4I38A 3C38A 1GSVA 1BSGA 1BUEA 1KGGA 2HJ9C 4PM9A 4OLDA 3VOYA 4L9GA 4GDBA 5FI7A 2ACGA 4HIAA 2YKHA 3KSIA 1L0FA 4OVDA 1FR6A 1EWZA 3IBJA 5TJJA 2WZZA 2Y2IA 4YNRA 5GHXA 5HAIA 1PNEA 1G68A 3TW8A 5L10A 4ZJ3A 3FYZA 5GLAA 2OLUA 3CJMA 4WEKA 1BLPA 1UGUA 3IF6B 1S6RA 2WGVA 1BZAA 4WZ4A 2FZ0A 3HCYA 3NCKA 1YSQA 3BY9A 3C4PA 1D1JA 1FILA 5HFOA 4EBLA 3KYEA 4S2KA 2PD7A 3N6IA 5DVAA 1HVBA 3MXQA 3IX3A 2NUTC 2ZC3B 3WS4A 3SOIA 3D4FA 5F69A 3SH9A 1H8MA 3BRMA 3LIFA 1MY8A 2VGLM 5J4EA 1M40A 4X25A 5K5BA 2ZMFA 3E4PA 5FQKA 4GB7A 3P01A 5CX7A 3MZEA 2QJ5A 2V1ZA 2KLIA 3IS2A 2V2FF 5E2HA 4KG2A 3ZG9B 2XROA 5FI2A 2HDUA 3WS1A 4XT2B 4OOLA 4HY8A 5DKKA 1IELA 1S4RA 2PDRA 4MMNA 4LCLA 2XD1A 3DTIA 5IS1A 5DF7A 4BBVA 4EW7A 4KQQA 4NEED 1K25A 4IUHA 1MWSA 2J3TD 2EFXA 2ZMVA 5CXWA 2P7JA 4DJ2A 3N7WA 1CI9A 4IUKA 1YSPA 4EQIA 4Y13A 2Y2LA 3ZG7B 4K08A 4MNRA 4WYYA 1SZVA 3IWIA 3ITAA 3B47A 1TVFA 2EA9A 4UAAA 3D72A 2JCHA 4FTXA 3G2ZA 1I2WA 5F6AA 1JTDA 2BTFP 2LB9A 1LLBA 1PFLA 4WEJA 3V39A 2W1TA 1OJ5A 4IBRA 4WLAA 4R0QA 1NWZA 4O7DA 3UMDA 3W4OA 3ZNYA 1UWNX 3A3FA 1YLJA 1NZOA 4IJGA 3Q82A 5CECA 3PXPA 5CHJA 2Y59A 2J8YA 4GN2A 4E3NA 2J80A 5FEGA 3VMAA 1IYSA 5DFYA 2VGKA 2UV0E 3LR4A 3NBLA 4OONA 1Q2PA 2Q9MA 1N9LA 3DAVA 2OAQ1 3UO9A 3CHWP 3CUEC 1HD8A 2WGWA 5AVEA 2WKQA 3HJIA 3H82B 2OSUA 5EM1A 5F1FA 1NY0A 3LUQA 5TFQA 3W8KA 5FSRA 4BQMA 4N1HA 1XA1A 4QY6A 3MFDA 3FKVA 4DXBA 4BBTA 1DJCA 1E3UA 4D2OA 2B95A 5HPFA 1S1ZA 1OTEA 2HDSA 3L9KA 5L09A 1NLZA 3DTKA 4YINA 4Y0OA 1I2SA 3R7WB 3VFHA 2J3WA 2V20A 3W4QA 1MPLA 4U3TA 2H0YA 3QP8A 1TD5A 1I5QA 1FCOA 1NYYA 3E4QA 3BECA 4EEUA 4HHDA 3UPNA 5BOHA 5HWWA 3H9WA 5KZHA 3MZDA 3ZCZA 2HV1A 1G6OA 4I5SA 4DKIA 3EGDC 1N9BA 2OWHA 2Y79A 3AGFA 1XGIA 3LY4A 1KE0A 2QJ7A 2XRNA 2QPNA 5E2FA 1XA7A 3MQQA 3KSHA 1IOUA 5EVLA 1GHPA 3HREA 4PPRA 2L0WA 1TS8A 3CPTB 5I5LA 3FV7A 4UA6A 2A49A 1VB6A 3OBFA 3GSGA 5FAOA 1W7FA 1IYPA 3KSFA 2ZQ9A 3DW0A 2XF3A 1OTIA 4XT2A 5AJGA 4S2PA 1PI5A 1NRJA 3LEZA 5DJUA 4B4XA 1M6KA 2ZM8A 4LRZE 4WZ5C 2W0NA 3A3JA 3MXRA 3Q1FA 4Q0IA 5M18A 3IH9A 3T1SA 2O99A 1HTZA 2WUQA 1GA9A 2ZMAA 2GNXA 1TEMA 5EPHA 2JBFA 1NRFA 3IXGA 4LV1A 3CI6A 4Y17A 3V3RA 2VKSA 3MF0A 2Y2PA 3EQVA 4HH3A 2XGNA 2M7UA 3GMWA 5EVEA 1DP6A 2PR6A 4MDZA 1S1YA 1GSWA 1P97A 5G4ZA 2WKRA 1FSYA 1U60A 3SH7A 1PWGA 1Q2QA 3QP5A 5HDDA 1YMXA 2H28A 4GZBA 4GDNA 3HJKA 2VV8A 4UHUA 3P98A 1Y28A 1F2KA 1IYOA 1X0OA 3UDXA 4B4ZA 4N9KA 4R23A 3NOUC 3EWKA 3HLWA 1K56D 2Z6DA 3OLOA 3U4LP 3A0SA 3E4OA 3BFEA 1Z6FA 1IYQA 4PKYG 1YPRA 1G6AA 5J7EA 2Y55A 3VP3A 4MN6A 1K6RA 1N9OA 4B93A 3V67A 2E8JA 4HJ4A 2V8CA 1GSXA 3H82A 4OPYA 2Y2QA 3C30A 4MBFA 3P09A 4HQAA 4LV0A 4NXGA 3LEQA 1S0WA 4HH2A 2W3EA 4KZ5A 3M2JA 4DF6A 4G3VA 1YLWA 4R38A 3UB6A 3QP6A 1W8YA 2W3DA 4OQ0A 1KDWA 3D3OA 5EVID 3FWLA 3G31A 3S22A 1K57C 3R7WA 2Q0OA 2EX8A 1KOUA 3SS3A 3E98A 1W8QA 4WM9A 1KDSA 4WUJA 3C5AA 1ES3A 2W3FA 3ZHHA 2ZC5B 5GLCA 1KE3A 3G2YA 2WADA 2XFTA 4ARZB 4AFIA 3WRTA 1VQQA 4UQIS 1NZUA 5G18A 1TDLA 1D7EA 3HL9A 4HBTA 4JF6A 3QP2A 3C7UA 4KUKA 4PM6A 5F1GA 4BD1A 1YAXA 3CITA 4DE1A 5M19A 2Y8HA 4JGQA 2WAEA 1BLHA 3KO6A 2PD8A 4XUXA 4JXGA 5A92A 2VLGA 3CPTA 1SKFA 3UE1A 4EETB 4FUWA 5DFXA 2A3UA 5TR7A 1IFQA 2XR0A 4GJ4A 4K0XA 3ZFZA 3A3EA 3GVBA 3S4XA 4XXRA 2JKRM 2XD5A 2ZL1B 3BM6A 4CJNA 4M4XA 1K54A 4DE2A 3TSGA 3GR2A 3MS6A 3F1OB 4GD6A 1TF1A 3RTYA 3RXXA 2J9OA 1YKDA 1P9WA 1SKOB 1ZG6A 3GTCA 3QP1A 4N92A 4HI4A 2WAFA 1PW1A 3NDGA 3ZGAB 5HD5A 3V5MA 4JXWA 1TDGA 3PAEA 3NOTC 1EROA 3F1NB 3T4SA 2WKHA 4E3LA 4F3LB 2WKPA 2PR5A 3RJUA 1TS6A 1WYBA 2JKRI 2PYRA 4II7A 4X69A 2ZC6B 1K6SA 3ULFA 3OZHA 3UE0A 2Z2MB 2W3GA 3HUMA 4EXOA 1XJ2A 4I39A 5FDSA 5CEDA 4ETZA 5FI6A 4CLCD 2A24A 2HDQA 2PYPA 3DWKA 4GCZA 3EEHA 1SHVA 4X55A 5FA7A 3BYDA 3N8RA 1ESIA 5HARA 1DRMA 4R1GA 4LV3A 4PM7A 2EWVA 2PAVP 1LSVA 2K31A 3VSKA 4CLCB 3BW6A 1N9NA 2ZJ9A 2OLVA 1STZA 3ZQ5A 2ZOIA 1Z09A 3FKWA 4KQRA 3E0YA 2EFUA 1S4SA 5KIZA 1YLYA 4G3WA 5M1AA 3HLGA 1K56A 1NLYA 3PR6A 1IKIA 4IEDA 3TOIA 3OCNA 1NYMA 3T1XA 1W63Q 3G30A 3JPUA 4NK3A 3UPPA 2EX6A 2WZXA 4GS9A 3VE3A 4BL2A 1O7EA 4S2NC 2HJEA 3ZVTA 3O88A 1RGZA 2QZ6A 3FPVA 3UB9A 4E3MA 2Y2KA 3QNBA 1CK3A 3MQ0A 2OAP1 4GD8A 5FAQA 3O5YA 2R9XA 2GX5A 4S2LA 2L4RA 3T4KA 3PHYA 3R4KA 4KZ6A 4RYEA 2FFYA 4X53A 4BWIA 2O9CA 2O9BA 4KZ8A 1BT5A 2P04A 2R78A 5FASA 3GV9A 5E2GA 5CGXA 5EVIA 2PBYA 3T12B 4ARZA 4WBGA 1ERMA 2P9VA 2JHEA 1FIKA 2HP5A 2E8IA 2FH5A 1KVMA 2ZQAA 3TG9A 5A8BA 2ZC7A 1GA0A 4FOFA 3PBRA 3Q7VB 3MKEA 3NHQA 3SH8A 1CJFA 1BLSA 3N8SA 1PZOA 3MXSA 3SZTA 2PU4A 3WRZA 3CG5A 5EE8A 2VJWA 4RVAA 3WS2A 4E6WA 2XEPA 1W63M 1ZG4A 2G2WA 4KZ3A 4QWOA 2H0TA 4QPRA 2ZL1A 4Z1WA 3I7JA 1K4FA 4S2MA 3HLBA 3WS0A 3F1OA 5J3WA 3UPOA 5DTSA 1SKOA 3DBAA 4KQDA 2HP9A 2A2LA 1DP8A 4I3JA 5A93A 3D9YA 1YLPA 3UB8A 3EEAA 1RGYA 3F1NA 1DJAA 4F3LA 1KGFA 4P6ZM 1LSWA 4GKUA 2W3HA 2C6WB 2Z2LB 4FSFA 5D3OA 5EOOA 4E3JA 1SDEA 5LBRA 5HWTA 1L2SA 2P08A 4N9LA 3JYIA 4PKYA 3H7WB 3OPRA 4WMCD 4EEPA 1NXYA 3IX8A 4X6TA 4DJ3A 4S2OA 4WN5A 5CTNA 1Y54A 3IXHA 3ZNTA 4KZ9A 4OPZA 5TBMB 3IF6A 1QMFA 1K0KA 4HESA 4CLCA 3LICA 2XA7S 4EWFA 4WELA 3AGEA 3NDEA 5HAPA 2RL3A 3BEBA 4DDYA 2VZWA 1XGJA 4R3BA 3BFCA 5HAQA 1S66L 3VP2A 4H8RA 3Q07A 5AQ9A 3FC7A 2ZQDA 3OCLA 1ZC2A 3SW1A 4QB8A 4E3KA 3IXBA 3S7PA 1K38A 1ES5A 1CF0A 4KG6A 2J7VA 2W1RA 4MN7A 4PM5A 1ALQA 1GCEA 3SS4A 5L8MA 5FQMA 5FQJA 3G34A 1TS0A 3VOLA 4P0MA 3M6HA 1EI5A 1PWDA 2C5WB 1ES2A 3IQAA 2VGLS 1OT9A 4YFMA 3ZDJA 2PBDP 4S2JA 3LO7A 1XJ3A 3BLSA 3C4OA 3Q7ZA 1H3QA 4RQ9A 1MXOA 4EESA 1H8ZA 1CEGA 4LRYC 4LV2A 4OOMA 3IWQA 5CHMA 4R70A 4KG5A 4UEYA 5IHVA 3LIEA 3C8CA 3T4TA 3ZYTA 1PIOA 5IT5A 5GL9A 1K55A 1V9YA 1AXBA 2LB5A 3PAGA 5EFWA 4DXCA 1BULA 4Y5FA 2R9WA 4NG2A 2BLSA 3IWOA 1T18A 3Q7VA 1PWCA 1J9MA 3MQOA 2DMWA 4QU3A 3VP4A 4Q8IA 4A5RA 2K7SA 5CRFA 1Y4OA 5A90A 1DP9A 3G35A 5HDCA 3RXWA 3PBTA 4HP4A 3G4PA 1H5XA 2QMIA 4E04A 1FCMA 3HLEA 5EECA 1LL9A 4U0XA 4OPQA 3G6OA 3LY3A 4ZRRA 3T4OA 3RH8B 4RX2A 1XXMA 1YMSA 2JKTM 5J8XA 1T1BA 3LI9A 3BFGA 4JPMA 1PI4A 1AWIA 4BJPA 2HZ5A 4MBKA 4DN0A 3N4IA 4NXEA 3W2ZA 4NETA 4OPRA 2AVXA 3U2AA 3LFVA 2NUPC 3LGOA 4LENA 4HBUA 2VK3A 2XDMA 4CLCE 4EU0A 5F82A 3T1RA 4EBPA 5HL1A 1RP5A 1OT6A 5HZHA 5FEFA 1XP4A 3IBRA 4KENB 3CMZA 3UB5P 2Y2HA 1SDNA 2JKTI 1VM1A 3O87A 1ODVA 4ZTKA 2Y2GA 4JXVA 4MLLA 4Z9QA 2V1AA 2V0UA 4FD8A 2B5RA 1D06A 2WYXA 2INWA 4DRTA 3H7WA 2Y2OA 3FPWA 1OTBA 3S7NA 4X1LA 4E3OA 2BG1A 4JGOA 4P87A 1OTDA 4Y0TA 5EUAA 3F1PB 4UA7A 1JNUA 5KMWA 4L0LA 5TBMA 3NI9A 4X1MA 2VEAA 3MZFA 3IT9A 1LI0A 2PU2A 1LL5A 3IF5A 3IXDA 3VSLA 4D60A 4WMCA 2Y4AA 3UMEA 5HD3A 1YT4A 3K2NA 3PBOA 3T4LA 3UE3A 1BYWA 3NECA 4ETXA 1ERQA 1VHMA 1YLTA 1YLZA 2G2UA 3LIAA 5AVFA 1MBLA 3MSHA 4Y3IA 5F5YA 2OOLA 1VETB 1F5MA 4KZ7A 3GDIA 1WYCA 3FG8A 2Y2MA 2B18A 3C7VA 1IKGA 3LIDA 3PBQA 4R6LA 5F83A 1WA9A 4GHIB 3IHAA 2ZD8A 4X56A 3ZG8B 4OQGA 2VV6A 4ME4A 3A0VA 5L07A 4JBFA 4BD0A 5FQ9A 5HSQA 2HPBA 3M6BA 5DKLA 2GZAA 4U0TA 2ZBBA 3C2WA 4ESPA 4JKTA 1V9ZA 3BLMA 3ICYA 3HBRA 3VP0A 5DF8A 2ZC4B 2EWWA 4HNBA 5CGSA 4R4SA 3T1QB 4NXBA 3V3SA 3A0RA 4JLFA 2Y91A 3OOVA 3CZDA 4XUZA 4OQHA 4C75A 4G3KA 3V50A 5EV0A 4BLMA 1N4OA 2V9AA 4KZAA 1VEUB 2EX2A 1E4DA 5EM0A 3Q81A 4JGRA 2KOIA 3A3IA 2V0WA 2XQZA 2JKGA 2JKFA 2UWXA 3FZCA 4MCWA 1K54C 1W5DA 3HLFA 4H6JB 4LFUA 4S2NA 1HZOA 4PHTA 4OOYA 2IWDA 2HDRA 1PW8A 2XA7M 2CC1A 3G32A 1MWTA 5C5KA 5JYPA 4LRXC 1C3BA 4B9OA 4RX3A 3DTMA 2DNSA 1ESUA 2W27A 1JWVA 1XFNA 4UA9A 4LLOB 4FCFA 3PYPA 1MZUA 3LCEA 1BTLA 4Y2FA 3IHBA 2P74A 2ZQ8A 3HLDA 1UWPX 4KUOA 1JWZA 2D02A 1KVLA 4Q0HA 2XSSA 3IX4A 4OLGA 1L0GA 1ZHHB 3HUOA 4R3AA 2Y2JA 1G28A 4KZ4A 5GLDA 4PM8A 3VOZA 3N8LA 4Q0JA 1KGEA 2GDNA 5FDHA 4GOGA 2JN7A 1P0ZA 3OPPA 2X02A 4BBUA 3B3XA 3F1PA 2IWBA 4C6YA 4ZJ1A 1YM1A 1HLUP 2IWCA 2XK1A 2I72A 3CLOA 1K4EA 1JWPA 1ONHA 4HOIA 3ZG0A 1A0KA 3MFXA 5CEBA 4ZJ2A 1EW0A 4CPKA 5L2FA 1XFQA 3PBSA 1E25A 3DWZA 3UNWA 4JF5A 1SCWA 1XPBA 3LR3A 1VETA 1DY6A 3CUEA 5CERA 3BY8A 3IH8A 1XKZA 2K2NA 3MKFA 3VP1A 3NJAA 3UDIA 4EBNA 3MJQA 3K3CA 2Q9NA 1YQSA 4Y15A 5A91A 1F98A 3L7HA 2PRFA 5DJTA 2MJ6A 1NJ4A 4GHIA 5U47A 3OPLA 1XJ4A 3KX0X 5AQBA 5FQIA 2G7UA
chains in the Genus database with same CATH topology
2QKPA 4MN5A 3RFBA 1XJ3A 4RQ9A 3TW8A 1H3QA 3E98A 4EESA 2L1MA 4WUJA 4WEKA 1UGUA 2W3FA 4LRYC 4YWZA 2FZ0A 4OOMA 3HCYA 4R70A 4ARZB 4AFIA 3KSGA 1YSQA 2OWJA 4UEYA 3LIEA 4UQIS 3C8CA 3BY9A 3T4TA 2B02A 3ZYTA 1D7EA 5IT5A 3LIBA 3JVUA 1V9YA 2LB5A 5EFWA 4KQOA 2O0YA 3CAXA 4Y5FA 5F68A 2PD7A 1T18A 3MXQA 4KUKA 3T50A 1ZTUA 2NUTC 1YAXA 3KYZA 2DMWA 2I9VA 3CITA 3MQOA 3BQ8A 2K7SA 1LT0A 2Y8HA 5F69A 1H8MA 3LIFA 2VGLM 4HJ6A 4JGQA 5J4EA 1TS7A 5K5BA 2ZMFA 3E4PA 3KO6A 2PD8A 1DP9A 3BJNA 3P01A 5HDCA 5CX7A 2VLGA 2KX6A 3PBTA 2O9AA 4EETB 4HP4A 2QJ5A 2V1BA 5DFXA 2KLIA 3IS2A 1IFQA 4E04A 4GJ4A 4H6JA 3TRCA 3MR0A 2XROA 2JKRM 3G6OA 4ZRRA 3T4OA 3RH8B 4XT2B 4M4XA 4OOLA 4HY8A 5DKKA 1S4RA 3F1OB 3OC2A 2JKTM 1TF1A 1T1BA 2PDRA 3LI9A 3RTYA 4MMNA 1YKDA 5IS1A 1P9WA 4BBVA 4BJPA 4EW7A 4NEED 5HL6A 4UQIM 4DN0A 4HI4A 4IUHA 4O01A 2PHYA 3W2ZA 4NXEA 2VV7A 5HD5A 4GW9A 2J3TD 2ZMVA 3U2AA 4JGPA 3LFVA 4LPZA 2NUPC 4DJ2A 2P7JA 5HWVA 5DF9A 4HP9A 3LI8A 1P9RA 3NOTC 5HPIA 4IUKA 1YSPA 3F1NB 3T4SA 4CLCE 4EU0A 4F3LB 2WKPA 4K08A 2PR5A 3LYXA 1TS6A 2JKRI 2PYRA 3B47A 4II7A 1MKMA 2EA9A 3D72A 1OT6A 5HZHA 2VA0A 3IBRA 3BQAA 3ULFA 5F6AA 3B33A 3UE6A 2JKTI 2W3GA 1ODVA 2LB9A 2ZOHA 4EXOA 1XJ2A 2V1AA 4I39A 2V0UA 4WEJA 1D06A 4ETZA 2W1TA 1OJ5A 4IHQA 1OTAA 4WLAA 2INWA 4CLCD 2A24A 1NWZA 2PYPA 2PT7A 2D01A 3H7WA 3UMDA 4GCZA 3EEHA 1UWNX 3FPWA 1OTBA 3S7NA 1T1CA 4IJGA 5HDSA 4CLCC 4JGOA 1OTDA 3PXPA 1DRMA 2EWVA 3F1PB 1LSVA 1JNUA 2K31A 4L0LA 5TBMA 2J80A 2VEAA 2M7VA 3B42A 4CLCB 3BW6A 1N9NA 5DFYA 1STZA 3ZQ5A 1LSXA 2M1CA 2ZOIA 1MC0A 2Z6CA 3JVVA 3EOIA 3E0YA 3LR4A 3PBNA 1S4SA 3UMEA 4EQ1A 5KIZA 3TE8A 5HD3A 1N9LA 4G3WA 2OAQ1 3TJZC 3PBOA 3K2NA 5FL3A 3T4LA 3UE3A 1BYWA 1NLYA 3PR6A 4L9EA 4ETXA 1VHMA 3OCNA 3CUEC 3LIAA 5AVFA 1XJ6A 5AVEA 4Y3IA 5F5YA 2WKQA 3HJIA 3H82B 1W63Q 2OOLA 2IA2A 3LUQA 1F5MA 3GDIA 3FG8A 2B18A 4GS9A 3VE3A 5KSHA 1F9IA 2HJEA 3T4JA 4BBTA 2BASA 3LIDA 3PBQA 4R6LA 3CWFA 1WA9A 2CMNA 3UB9A 3FPVA 4GHIB 5HPFA 1S1ZA 1OTEA 2VV6A 3MQ0A 4ME4A 3T4QA 2A24B 2OAP1 1NLZA 4NKPA 3A0VA 3O5YA 3R7WB 2J3WA 5HSQA 2GX5A 2L4RA 4NXFA 3T4KA 2VX8A 5DKLA 2GZAA 1TD5A 2ZBBA 3PHYA 3R4KA 4I3AA 4BWIA 2O9CA 3C2WA 2O9BA 3E4QA 3VV4A 3KYQA 2P04A 2R78A 4EEUA 1V9ZA 4HHDA 3ICYA 1T19A 5HWWA 3H9WA 2EWWA 4HNBA 4L9FA 4O8GA 4ARZA 3UB7A 2HV1A 1G6OA 4NXBA 4I5SA 3S7QA 4WF0A 3A0RA 3EGDC 2J3TC 2JHEA 2OWHA 3K3DA 4HJ3A 2Y79A 3OOVA 2FH5A 5A8BA 2QJ7A 3EGXC 4FOFA 4G3KA 2XRNA 3MMHA 3PBRA 3NHQA 3MQQA 2V9AA 3KSHA 1IOUA 2HF6A 4P6ZS 4GS9B 2L0WA 1TS8A 5IU1A 2VJWA 5I5LA 4JGRA 2KOIA 2V0WA 3OBFA 1VB6A 4MCWA 4YOFA 3IS2B 1W63M 4H6JB 4QPRA 3NOPC 3KSFA 3S7OA 2KDKA 4EUVA 4Z1WA 4PHTA 1OTIA 4XT2A 3P7NA 3BWLA 5AJGA 3F1OA 1NRJA 4DMZA 5G4YA 2XA7M 5DJUA 5J3WA 3DBAA 4KQDA 5C5KA 4LRZE 4LRXC 3LR5A 4B9OA 2W27A 1XFNA 2A2LA 2W0NA 1DP8A 4I3JA 4Q0IA 4LLOB 2O99A 4O0PA 2GJ3A 3PYPA 1MZUA 2GNXA 3UB8A 3EEAA 4Y2FA 3F1NA 3CI6A 2VKSA 3MF0A 4F3LA 3EQVA 4HH3A 1OJGA 4P6ZM 1LSWA 4I3IA 1T1AA 2M7UA 2QHKA 2W3HA 1UWPX 4KUOA 5MC7A 1DP6A 2PR6A 4MDZA 1S1YA 2D02A 1GSWA 4Q0HA 4FSFA 1P97A 4PAUA 5G4ZA 2WKRA 2XSSA 5LBRA 4CQHA 3EQUA 5HWTA 2W1TB 1ZHHB 2P08A 4PKYA 4R3AA 5HDDA 3H7WB 2H28A 1G28A 3HJKA 2VV8A 4EEPA 1Y28A 1X0OA 4Q0JA 3LR0A 4DJ3A 2JN7A 4WN5A 2QYBA 1P0ZA 3NOUC 3EWKA 4BBUA 3F1PA 2YKFA 5TBMB 2Z6DA 3OLOA 3A0SA 3E4OA 4CLCA 2QWSA 3LICA 2HGVA 2XA7S 3GECA 4BMWA 4PKYG 4WELA 3CLOA 4WL9A 3VE4A 4HOIA 4GLQA 2VZWA 1OPXA 5J7EA 3MFXA 4MN6A 1N9OA 1S66L 1EW0A 4B93A 1LL8A 1XFQA 3PBSA 3V67A 4HJ4A 3FC7A 3OCLA 3SW1A 1GSXA 4EERA 3S7PA 3H82A 1S67L 3C30A 3LR3A 4I38A 3C38A 1GSVA 2W1RA 4MN7A 3CUEA 4HQAA 4NXGA 2HJ9C 3BY8A 5L8MA 2K2NA 4HH2A 3NJAA 4L9GA 1TS0A 3VOLA 2W3EA 4HIAA 2YKHA 3KSIA 3MJQA 3K3CA 4G3VA 4R38A 3UB6A 2VGLS 1F98A 1OT9A 5DJTA 2MJ6A 4GHIA 2W3DA 3D3OA 1XJ4A 3IBJA 5TJJA 3KX0X 2G7UA 4YNRA 3R7WA 1KOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX5 A;  3RFB A;  4RQ9 A;  1MKM A;  1TD5 A;  3E98 A;  2M7U A;  2W3H A;  3R4K A;  3IBR A;  4BWI A;  2O9C A;  3C2W A;  4MDZ A;  2O9B A;  3VV4 A;  4Q0H A;  2W3F A;  2W3G A;  2LB9 A;  4PAU A;  2XSS A;  4LRY C;  3HCY A;  5LBR A;  4R70 A;  4CQH A;  4O8G A;  2W1T B;  4ETZ A;  2W1T A;  3KSG A;  1YSQ A;  3S7Q A;  2Y79 A;  3OOV A;  3S7N A;  2LB5 A;  4Q0J A;  2O0Y A;  4Y5F A;  4IJG A;  2QYB A;  3NOU C;  4FOF A;  4G3K A;  2XRN A;  3MMH A;  1ZTU A;  2K31 A;  3CIT A;  3NHQ A;  2VEA A;  2M7V A;  3KSH A;  2Y8H A;  5DFY A;  2HGV A;  1STZ A;  3ZQ5 A;  5K5B A;  1MC0 A;  2ZMF A;  3KO6 A;  3E0Y A;  3BJN A;  4GLQ A;  2VJW A;  2VZW A;  5I5L A;  2KOI A;  4G3W A;  2O9A A;  3K2N A;  5DFX A;  3OBF A;  4MCW A;  4YOF A;  2KLI A;  4E04 A;  4QPR A;  3NOP C;  3TRC A;  4ETX A;  1VHM A;  3KSF A;  3S7O A;  2XRO A;  4EUV A;  3G6O A;  4ZRR A;  4Z1W A;  4Y3I A;  3S7P A;  2OOL A;  5AJG A;  2IA2 A;  1F5M A;  2W1R A;  4MN7 A;  1TF1 A;  4DMZ A;  4MMN A;  2B18 A;  5L8M A;  1YKD A;  3DBA A;  2K2N A;  5HL6 A;  5C5K A;  4DN0 A;  4LRZ E;  4LRX C;  2W3E A;  4IUH A;  4O01 A;  3W2Z A;  4Q0I A;  3KSI A;  2O99 A;  4O0P A;  4GW9 A;  4R6L A;  4G3V A;  3LFV A;  2W3D A;  5HPF A;  3D3O A;  3EEA A;  3NOT C;  5HPI A;  3MQ0 A;  4IUK A;  1YSP A;  3IBJ A;  4ME4 A;  5TJJ A;  4Y2F A;  3CI6 A;  2G7U A;  2VKS A;  3MF0 A;  4EU0 A;  4YNR A;  3O5Y A;  5HSQ A; 
#chains in the Genus database with same CATH topology
 2QKP A;  4MN5 A;  3RFB A;  1W79 A;  2L1M A;  5EVI C;  1CQA A;  3HUN A;  4YWZ A;  1BLC A;  3AGD A;  4ZDX A;  3KSG A;  3NIA A;  4OP8 A;  2OWJ A;  1H8Y A;  1MWU A;  2B02 A;  3ZG5 A;  3LIB A;  5FAP A;  3JVU A;  4KQO A;  2O0Y A;  3CAX A;  5F68 A;  5FAT A;  4RA7 A;  1JVJ A;  1XX2 A;  1MKI A;  4ID4 A;  3T50 A;  1ZTU A;  3KYZ A;  2X71 A;  2I9V A;  3BQ8 A;  1DJB A;  1LT0 A;  4HJ6 A;  1TS7 A;  1VEU A;  1ONG A;  2RCX A;  3BJN A;  2KX6 A;  4F94 A;  2O9A A;  4HEF A;  1OME A;  2V1B A;  1L0E A;  1ES4 A;  3E2K A;  4C3Q A;  4H6J A;  1WE4 A;  3TRC A;  4QY5 A;  3MR0 A;  4N1X A;  2H10 A;  4MBH A;  3OC2 A;  4PMA A;  3UDF A;  5HL6 A;  4UQI M;  4O01 A;  2PHY A;  2VV7 A;  4GW9 A;  4LGW A;  4JGP A;  4BL3 A;  4LPZ A;  3MBZ A;  5JYO A;  5HWV A;  5DF9 A;  4HP9 A;  4WZ5 A;  3LI8 A;  1P9R A;  3HLC A;  5HPI A;  3QNC A;  4DDS A;  1PZP A;  2VGJ A;  3PTE A;  2XLN A;  3LYX A;  2JE5 A;  3A3D A;  4JXS A;  1MKM A;  2VA0 A;  3BQA A;  4X68 A;  5AQA A;  3GQZ A;  3B33 A;  4IBX A;  3UE6 A;  2ZOH A;  1FOF A;  1LI9 A;  4ZAM A;  1ACF A;  4IHQ A;  1OTA A;  1J3W A;  4K0W A;  2PT7 A;  2D01 A;  1GHM A;  3W4P A;  3IF6 C;  3QHY A;  5E43 A;  5GHZ A;  1T1C A;  5HDS A;  4EUZ A;  1CI8 A;  4CLC C;  2ZQC A;  3WS5 A;  1FCN A;  2EXB A;  4EV4 A;  4QD4 A;  2M7V A;  4GNU A;  3B42 A;  1RCJ A;  4E6X A;  3HVF A;  1LSX A;  2M1C A;  1MC0 A;  2EX9 A;  3S1Y A;  4B88 A;  2Z6C A;  2ZM2 A;  3EOI A;  3JVV A;  3PBN A;  3NY4 A;  4EQ1 A;  3TE8 A;  4FH4 A;  3GRJ A;  3TJZ C;  5FL3 A;  1G5U A;  2WKI A;  2Y2N A;  4KZB A;  4L9E A;  1CEF A;  1XJ6 A;  2IA2 A;  4OKP A;  5CHU A;  5KSH A;  1F9I A;  4R4R A;  5DTT A;  3T4J A;  1QME A;  2BAS A;  4P6B A;  1O07 A;  3CWF A;  2CMN A;  3OPH A;  1L0D A;  1JTG A;  3T4Q A;  2A24 B;  4NKP A;  5TGF A;  3WWX A;  2V8F A;  4Y0U A;  4NXF A;  2VX8 A;  2EXA A;  3M2K A;  4I3A A;  1K57 A;  3QP4 A;  3VV4 A;  3KYQ A;  2WKE A;  1T19 A;  2X01 A;  4L9F A;  1K55 C;  4O8G A;  4FH2 A;  2DRW A;  3UB7 A;  4QHC A;  3S7Q A;  4WF0 A;  2J3T C;  3K3D A;  4HJ3 A;  1ZKJ A;  5EOE A;  3DTE A;  2XH9 A;  3EGX C;  3NUL A;  3MMH A;  5GHY A;  4DE0 A;  4OH0 A;  3E2L A;  2HF6 A;  1FSW A;  4P6Z S;  4GS9 B;  1LHY A;  5HW3 A;  5IU1 A;  5KSC A;  2HP6 A;  4YOF A;  3IS2 B;  1H0M A;  3NOP C;  4M3K A;  3S7O A;  2KDK A;  4EUV A;  3P7N A;  3BWL A;  1FR1 A;  1MWR A;  4DMZ A;  5G4Y A;  1FQG A;  3O3V A;  3SS5 A;  5AQ7 A;  4IVK A;  1IEM A;  3LR5 A;  4QJG A;  5CTM A;  3O86 A;  4O0P A;  2GJ3 A;  4S2I A;  4DE3 A;  2ZQ7 A;  3BFF A;  5EVI B;  2JC7 A;  3ZVW A;  2P9V B;  4OP5 A;  4IVI A;  1OJG A;  4I3I A;  1T1A A;  5I94 A;  2QHK A;  2ZLY A;  5MC7 A;  4MEZ A;  1PYY A;  4PAU A;  5CGW A;  4CQH A;  2WGI A;  3EQU A;  2W1T B;  2J9P A;  3UY6 A;  2FFF B;  3NC8 A;  4K91 A;  3BFD A;  2XFS A;  1KE4 A;  3LR0 A;  1L3L A;  2QYB A;  4BEN A;  2YKF A;  4LCM A;  1GHI A;  5DTK A;  1PRQ A;  2QWS A;  3UN7 A;  2HGV A;  5HX9 A;  3GEC A;  4BMW A;  4WL9 A;  2ZM0 A;  3VE4 A;  3ISG A;  5E2E A;  4GLQ A;  4E3I A;  5GLB A;  1OPX A;  4P85 A;  2DCF A;  2H5S A;  1LL8 A;  2WK0 A;  2WGW B;  4EER A;  1E3U D;  2OV5 A;  3VFF A;  1S67 L;  4Y7P A;  3ITB A;  4R3J A;  4OQI A;  4JF4 A;  4ZBE A;  5FQQ A;  4I38 A;  3C38 A;  1GSV A;  1BSG A;  1BUE A;  1KGG A;  2HJ9 C;  4PM9 A;  4OLD A;  3VOY A;  4L9G A;  4GDB A;  5FI7 A;  2ACG A;  4HIA A;  2YKH A;  3KSI A;  1L0F A;  4OVD A;  1FR6 A;  1EWZ A;  3IBJ A;  5TJJ A;  2WZZ A;  2Y2I A;  4YNR A;  5GHX A;  5HAI A;  1PNE A;  1G68 A;  3TW8 A;  5L10 A;  4ZJ3 A;  3FYZ A;  5GLA A;  2OLU A;  3CJM A;  4WEK A;  1BLP A;  1UGU A;  3IF6 B;  1S6R A;  2WGV A;  1BZA A;  4WZ4 A;  2FZ0 A;  3HCY A;  3NCK A;  1YSQ A;  3BY9 A;  3C4P A;  1D1J A;  1FIL A;  5HFO A;  4EBL A;  3KYE A;  4S2K A;  2PD7 A;  3N6I A;  5DVA A;  1HVB A;  3MXQ A;  3IX3 A;  2NUT C;  2ZC3 B;  3WS4 A;  3SOI A;  3D4F A;  5F69 A;  3SH9 A;  1H8M A;  3BRM A;  3LIF A;  1MY8 A;  2VGL M;  5J4E A;  1M40 A;  4X25 A;  5K5B A;  2ZMF A;  3E4P A;  5FQK A;  4GB7 A;  3P01 A;  5CX7 A;  3MZE A;  2QJ5 A;  2V1Z A;  2KLI A;  3IS2 A;  2V2F F;  5E2H A;  4KG2 A;  3ZG9 B;  2XRO A;  5FI2 A;  2HDU A;  3WS1 A;  4XT2 B;  4OOL A;  4HY8 A;  5DKK A;  1IEL A;  1S4R A;  2PDR A;  4MMN A;  4LCL A;  2XD1 A;  3DTI A;  5IS1 A;  5DF7 A;  4BBV A;  4EW7 A;  4KQQ A;  4NEE D;  1K25 A;  4IUH A;  1MWS A;  2J3T D;  2EFX A;  2ZMV A;  5CXW A;  2P7J A;  4DJ2 A;  3N7W A;  1CI9 A;  4IUK A;  1YSP A;  4EQI A;  4Y13 A;  2Y2L A;  3ZG7 B;  4K08 A;  4MNR A;  4WYY A;  1SZV A;  3IWI A;  3ITA A;  3B47 A;  1TVF A;  2EA9 A;  4UAA A;  3D72 A;  2JCH A;  4FTX A;  3G2Z A;  1I2W A;  5F6A A;  1JTD A;  2BTF P;  2LB9 A;  1LLB A;  1PFL A;  4WEJ A;  3V39 A;  2W1T A;  1OJ5 A;  4IBR A;  4WLA A;  4R0Q A;  1NWZ A;  4O7D A;  3UMD A;  3W4O A;  3ZNY A;  1UWN X;  3A3F A;  1YLJ A;  1NZO A;  4IJG A;  3Q82 A;  5CEC A;  3PXP A;  5CHJ A;  2Y59 A;  2J8Y A;  4GN2 A;  4E3N A;  2J80 A;  5FEG A;  3VMA A;  1IYS A;  5DFY A;  2VGK A;  2UV0 E;  3LR4 A;  3NBL A;  4OON A;  1Q2P A;  2Q9M A;  1N9L A;  3DAV A;  2OAQ 1;  3UO9 A;  3CHW P;  3CUE C;  1HD8 A;  2WGW A;  5AVE A;  2WKQ A;  3HJI A;  3H82 B;  2OSU A;  5EM1 A;  5F1F A;  1NY0 A;  3LUQ A;  5TFQ A;  3W8K A;  5FSR A;  4BQM A;  4N1H A;  1XA1 A;  4QY6 A;  3MFD A;  3FKV A;  4DXB A;  4BBT A;  1DJC A;  1E3U A;  4D2O A;  2B95 A;  5HPF A;  1S1Z A;  1OTE A;  2HDS A;  3L9K A;  5L09 A;  1NLZ A;  3DTK A;  4YIN A;  4Y0O A;  1I2S A;  3R7W B;  3VFH A;  2J3W A;  2V20 A;  3W4Q A;  1MPL A;  4U3T A;  2H0Y A;  3QP8 A;  1TD5 A;  1I5Q A;  1FCO A;  1NYY A;  3E4Q A;  3BEC A;  4EEU A;  4HHD A;  3UPN A;  5BOH A;  5HWW A;  3H9W A;  5KZH A;  3MZD A;  3ZCZ A;  2HV1 A;  1G6O A;  4I5S A;  4DKI A;  3EGD C;  1N9B A;  2OWH A;  2Y79 A;  3AGF A;  1XGI A;  3LY4 A;  1KE0 A;  2QJ7 A;  2XRN A;  2QPN A;  5E2F A;  1XA7 A;  3MQQ A;  3KSH A;  1IOU A;  5EVL A;  1GHP A;  3HRE A;  4PPR A;  2L0W A;  1TS8 A;  3CPT B;  5I5L A;  3FV7 A;  4UA6 A;  2A49 A;  1VB6 A;  3OBF A;  3GSG A;  5FAO A;  1W7F A;  1IYP A;  3KSF A;  2ZQ9 A;  3DW0 A;  2XF3 A;  1OTI A;  4XT2 A;  5AJG A;  4S2P A;  1PI5 A;  1NRJ A;  3LEZ A;  5DJU A;  4B4X A;  1M6K A;  2ZM8 A;  4LRZ E;  4WZ5 C;  2W0N A;  3A3J A;  3MXR A;  3Q1F A;  4Q0I A;  5M18 A;  3IH9 A;  3T1S A;  2O99 A;  1HTZ A;  2WUQ A;  1GA9 A;  2ZMA A;  2GNX A;  1TEM A;  5EPH A;  2JBF A;  1NRF A;  3IXG A;  4LV1 A;  3CI6 A;  4Y17 A;  3V3R A;  2VKS A;  3MF0 A;  2Y2P A;  3EQV A;  4HH3 A;  2XGN A;  2M7U A;  3GMW A;  5EVE A;  1DP6 A;  2PR6 A;  4MDZ A;  1S1Y A;  1GSW A;  1P97 A;  5G4Z A;  2WKR A;  1FSY A;  1U60 A;  3SH7 A;  1PWG A;  1Q2Q A;  3QP5 A;  5HDD A;  1YMX A;  2H28 A;  4GZB A;  4GDN A;  3HJK A;  2VV8 A;  4UHU A;  3P98 A;  1Y28 A;  1F2K A;  1IYO A;  1X0O A;  3UDX A;  4B4Z A;  4N9K A;  4R23 A;  3NOU C;  3EWK A;  3HLW A;  1K56 D;  2Z6D A;  3OLO A;  3U4L P;  3A0S A;  3E4O A;  3BFE A;  1Z6F A;  1IYQ A;  4PKY G;  1YPR A;  1G6A A;  5J7E A;  2Y55 A;  3VP3 A;  4MN6 A;  1K6R A;  1N9O A;  4B93 A;  3V67 A;  2E8J A;  4HJ4 A;  2V8C A;  1GSX A;  3H82 A;  4OPY A;  2Y2Q A;  3C30 A;  4MBF A;  3P09 A;  4HQA A;  4LV0 A;  4NXG A;  3LEQ A;  1S0W A;  4HH2 A;  2W3E A;  4KZ5 A;  3M2J A;  4DF6 A;  4G3V A;  1YLW A;  4R38 A;  3UB6 A;  3QP6 A;  1W8Y A;  2W3D A;  4OQ0 A;  1KDW A;  3D3O A;  5EVI D;  3FWL A;  3G31 A;  3S22 A;  1K57 C;  3R7W A;  2Q0O A;  2EX8 A;  1KOU A;  3SS3 A;  3E98 A;  1W8Q A;  4WM9 A;  1KDS A;  4WUJ A;  3C5A A;  1ES3 A;  2W3F A;  3ZHH A;  2ZC5 B;  5GLC A;  1KE3 A;  3G2Y A;  2WAD A;  2XFT A;  4ARZ B;  4AFI A;  3WRT A;  1VQQ A;  4UQI S;  1NZU A;  5G18 A;  1TDL A;  1D7E A;  3HL9 A;  4HBT A;  4JF6 A;  3QP2 A;  3C7U A;  4KUK A;  4PM6 A;  5F1G A;  4BD1 A;  1YAX A;  3CIT A;  4DE1 A;  5M19 A;  2Y8H A;  4JGQ A;  2WAE A;  1BLH A;  3KO6 A;  2PD8 A;  4XUX A;  4JXG A;  5A92 A;  2VLG A;  3CPT A;  1SKF A;  3UE1 A;  4EET B;  4FUW A;  5DFX A;  2A3U A;  5TR7 A;  1IFQ A;  2XR0 A;  4GJ4 A;  4K0X A;  3ZFZ A;  3A3E A;  3GVB A;  3S4X A;  4XXR A;  2JKR M;  2XD5 A;  2ZL1 B;  3BM6 A;  4CJN A;  4M4X A;  1K54 A;  4DE2 A;  3TSG A;  3GR2 A;  3MS6 A;  3F1O B;  4GD6 A;  1TF1 A;  3RTY A;  3RXX A;  2J9O A;  1YKD A;  1P9W A;  1SKO B;  1ZG6 A;  3GTC A;  3QP1 A;  4N92 A;  4HI4 A;  2WAF A;  1PW1 A;  3NDG A;  3ZGA B;  5HD5 A;  3V5M A;  4JXW A;  1TDG A;  3PAE A;  3NOT C;  1ERO A;  3F1N B;  3T4S A;  2WKH A;  4E3L A;  4F3L B;  2WKP A;  2PR5 A;  3RJU A;  1TS6 A;  1WYB A;  2JKR I;  2PYR A;  4II7 A;  4X69 A;  2ZC6 B;  1K6S A;  3ULF A;  3OZH A;  3UE0 A;  2Z2M B;  2W3G A;  3HUM A;  4EXO A;  1XJ2 A;  4I39 A;  5FDS A;  5CED A;  4ETZ A;  5FI6 A;  4CLC D;  2A24 A;  2HDQ A;  2PYP A;  3DWK A;  4GCZ A;  3EEH A;  1SHV A;  4X55 A;  5FA7 A;  3BYD A;  3N8R A;  1ESI A;  5HAR A;  1DRM A;  4R1G A;  4LV3 A;  4PM7 A;  2EWV A;  2PAV P;  1LSV A;  2K31 A;  3VSK A;  4CLC B;  3BW6 A;  1N9N A;  2ZJ9 A;  2OLV A;  1STZ A;  3ZQ5 A;  2ZOI A;  1Z09 A;  3FKW A;  4KQR A;  3E0Y A;  2EFU A;  1S4S A;  5KIZ A;  1YLY A;  4G3W A;  5M1A A;  3HLG A;  1K56 A;  1NLY A;  3PR6 A;  1IKI A;  4IED A;  3TOI A;  3OCN A;  1NYM A;  3T1X A;  1W63 Q;  3G30 A;  3JPU A;  4NK3 A;  3UPP A;  2EX6 A;  2WZX A;  4GS9 A;  3VE3 A;  4BL2 A;  1O7E A;  4S2N C;  2HJE A;  3ZVT A;  3O88 A;  1RGZ A;  2QZ6 A;  3FPV A;  3UB9 A;  4E3M A;  2Y2K A;  3QNB A;  1CK3 A;  3MQ0 A;  2OAP 1;  4GD8 A;  5FAQ A;  3O5Y A;  2R9X A;  2GX5 A;  4S2L A;  2L4R A;  3T4K A;  3PHY A;  3R4K A;  4KZ6 A;  4RYE A;  2FFY A;  4X53 A;  4BWI A;  2O9C A;  2O9B A;  4KZ8 A;  1BT5 A;  2P04 A;  2R78 A;  5FAS A;  3GV9 A;  5E2G A;  5CGX A;  5EVI A;  2PBY A;  3T12 B;  4ARZ A;  4WBG A;  1ERM A;  2P9V A;  2JHE A;  1FIK A;  2HP5 A;  2E8I A;  2FH5 A;  1KVM A;  2ZQA A;  3TG9 A;  5A8B A;  2ZC7 A;  1GA0 A;  4FOF A;  3PBR A;  3Q7V B;  3MKE A;  3NHQ A;  3SH8 A;  1CJF A;  1BLS A;  3N8S A;  1PZO A;  3MXS A;  3SZT A;  2PU4 A;  3WRZ A;  3CG5 A;  5EE8 A;  2VJW A;  4RVA A;  3WS2 A;  4E6W A;  2XEP A;  1W63 M;  1ZG4 A;  2G2W A;  4KZ3 A;  4QWO A;  2H0T A;  4QPR A;  2ZL1 A;  4Z1W A;  3I7J A;  1K4F A;  4S2M A;  3HLB A;  3WS0 A;  3F1O A;  5J3W A;  3UPO A;  5DTS A;  1SKO A;  3DBA A;  4KQD A;  2HP9 A;  2A2L A;  1DP8 A;  4I3J A;  5A93 A;  3D9Y A;  1YLP A;  3UB8 A;  3EEA A;  1RGY A;  3F1N A;  1DJA A;  4F3L A;  1KGF A;  4P6Z M;  1LSW A;  4GKU A;  2W3H A;  2C6W B;  2Z2L B;  4FSF A;  5D3O A;  5EOO A;  4E3J A;  1SDE A;  5LBR A;  5HWT A;  1L2S A;  2P08 A;  4N9L A;  3JYI A;  4PKY A;  3H7W B;  3OPR A;  4WMC D;  4EEP A;  1NXY A;  3IX8 A;  4X6T A;  4DJ3 A;  4S2O A;  4WN5 A;  5CTN A;  1Y54 A;  3IXH A;  3ZNT A;  4KZ9 A;  4OPZ A;  5TBM B;  3IF6 A;  1QMF A;  1K0K A;  4HES A;  4CLC A;  3LIC A;  2XA7 S;  4EWF A;  4WEL A;  3AGE A;  3NDE A;  5HAP A;  2RL3 A;  3BEB A;  4DDY A;  2VZW A;  1XGJ A;  4R3B A;  3BFC A;  5HAQ A;  1S66 L;  3VP2 A;  4H8R A;  3Q07 A;  5AQ9 A;  3FC7 A;  2ZQD A;  3OCL A;  1ZC2 A;  3SW1 A;  4QB8 A;  4E3K A;  3IXB A;  3S7P A;  1K38 A;  1ES5 A;  1CF0 A;  4KG6 A;  2J7V A;  2W1R A;  4MN7 A;  4PM5 A;  1ALQ A;  1GCE A;  3SS4 A;  5L8M A;  5FQM A;  5FQJ A;  3G34 A;  1TS0 A;  3VOL A;  4P0M A;  3M6H A;  1EI5 A;  1PWD A;  2C5W B;  1ES2 A;  3IQA A;  2VGL S;  1OT9 A;  4YFM A;  3ZDJ A;  2PBD P;  4S2J A;  3LO7 A;  1XJ3 A;  3BLS A;  3C4O A;  3Q7Z A;  1H3Q A;  4RQ9 A;  1MXO A;  4EES A;  1H8Z A;  1CEG A;  4LRY C;  4LV2 A;  4OOM A;  3IWQ A;  5CHM A;  4R70 A;  4KG5 A;  4UEY A;  5IHV A;  3LIE A;  3C8C A;  3T4T A;  3ZYT A;  1PIO A;  5IT5 A;  5GL9 A;  1K55 A;  1V9Y A;  1AXB A;  2LB5 A;  3PAG A;  5EFW A;  4DXC A;  1BUL A;  4Y5F A;  2R9W A;  4NG2 A;  2BLS A;  3IWO A;  1T18 A;  3Q7V A;  1PWC A;  1J9M A;  3MQO A;  2DMW A;  4QU3 A;  3VP4 A;  4Q8I A;  4A5R A;  2K7S A;  5CRF A;  1Y4O A;  5A90 A;  1DP9 A;  3G35 A;  5HDC A;  3RXW A;  3PBT A;  4HP4 A;  3G4P A;  1H5X A;  2QMI A;  4E04 A;  1FCM A;  3HLE A;  5EEC A;  1LL9 A;  4U0X A;  4OPQ A;  3G6O A;  3LY3 A;  4ZRR A;  3T4O A;  3RH8 B;  4RX2 A;  1XXM A;  1YMS A;  2JKT M;  5J8X A;  1T1B A;  3LI9 A;  3BFG A;  4JPM A;  1PI4 A;  1AWI A;  4BJP A;  2HZ5 A;  4MBK A;  4DN0 A;  3N4I A;  4NXE A;  3W2Z A;  4NET A;  4OPR A;  2AVX A;  3U2A A;  3LFV A;  2NUP C;  3LGO A;  4LEN A;  4HBU A;  2VK3 A;  2XDM A;  4CLC E;  4EU0 A;  5F82 A;  3T1R A;  4EBP A;  5HL1 A;  1RP5 A;  1OT6 A;  5HZH A;  5FEF A;  1XP4 A;  3IBR A;  4KEN B;  3CMZ A;  3UB5 P;  2Y2H A;  1SDN A;  2JKT I;  1VM1 A;  3O87 A;  1ODV A;  4ZTK A;  2Y2G A;  4JXV A;  4MLL A;  4Z9Q A;  2V1A A;  2V0U A;  4FD8 A;  2B5R A;  1D06 A;  2WYX A;  2INW A;  4DRT A;  3H7W A;  2Y2O A;  3FPW A;  1OTB A;  3S7N A;  4X1L A;  4E3O A;  2BG1 A;  4JGO A;  4P87 A;  1OTD A;  4Y0T A;  5EUA A;  3F1P B;  4UA7 A;  1JNU A;  5KMW A;  4L0L A;  5TBM A;  3NI9 A;  4X1M A;  2VEA A;  3MZF A;  3IT9 A;  1LI0 A;  2PU2 A;  1LL5 A;  3IF5 A;  3IXD A;  3VSL A;  4D60 A;  4WMC A;  2Y4A A;  3UME A;  5HD3 A;  1YT4 A;  3K2N A;  3PBO A;  3T4L A;  3UE3 A;  1BYW A;  3NEC A;  4ETX A;  1ERQ A;  1VHM A;  1YLT A;  1YLZ A;  2G2U A;  3LIA A;  5AVF A;  1MBL A;  3MSH A;  4Y3I A;  5F5Y A;  2OOL A;  1VET B;  1F5M A;  4KZ7 A;  3GDI A;  1WYC A;  3FG8 A;  2Y2M A;  2B18 A;  3C7V A;  1IKG A;  3LID A;  3PBQ A;  4R6L A;  5F83 A;  1WA9 A;  4GHI B;  3IHA A;  2ZD8 A;  4X56 A;  3ZG8 B;  4OQG A;  2VV6 A;  4ME4 A;  3A0V A;  5L07 A;  4JBF A;  4BD0 A;  5FQ9 A;  5HSQ A;  2HPB A;  3M6B A;  5DKL A;  2GZA A;  4U0T A;  2ZBB A;  3C2W A;  4ESP A;  4JKT A;  1V9Z A;  3BLM A;  3ICY A;  3HBR A;  3VP0 A;  5DF8 A;  2ZC4 B;  2EWW A;  4HNB A;  5CGS A;  4R4S A;  3T1Q B;  4NXB A;  3V3S A;  3A0R A;  4JLF A;  2Y91 A;  3OOV A;  3CZD A;  4XUZ A;  4OQH A;  4C75 A;  4G3K A;  3V50 A;  5EV0 A;  4BLM A;  1N4O A;  2V9A A;  4KZA A;  1VEU B;  2EX2 A;  1E4D A;  5EM0 A;  3Q81 A;  4JGR A;  2KOI A;  3A3I A;  2V0W A;  2XQZ A;  2JKG A;  2JKF A;  2UWX A;  3FZC A;  4MCW A;  1K54 C;  1W5D A;  3HLF A;  4H6J B;  4LFU A;  4S2N A;  1HZO A;  4PHT A;  4OOY A;  2IWD A;  2HDR A;  1PW8 A;  2XA7 M;  2CC1 A;  3G32 A;  1MWT A;  5C5K A;  5JYP A;  4LRX C;  1C3B A;  4B9O A;  4RX3 A;  3DTM A;  2DNS A;  1ESU A;  2W27 A;  1JWV A;  1XFN A;  4UA9 A;  4LLO B;  4FCF A;  3PYP A;  1MZU A;  3LCE A;  1BTL A;  4Y2F A;  3IHB A;  2P74 A;  2ZQ8 A;  3HLD A;  1UWP X;  4KUO A;  1JWZ A;  2D02 A;  1KVL A;  4Q0H A;  2XSS A;  3IX4 A;  4OLG A;  1L0G A;  1ZHH B;  3HUO A;  4R3A A;  2Y2J A;  1G28 A;  4KZ4 A;  5GLD A;  4PM8 A;  3VOZ A;  3N8L A;  4Q0J A;  1KGE A;  2GDN A;  5FDH A;  4GOG A;  2JN7 A;  1P0Z A;  3OPP A;  2X02 A;  4BBU A;  3B3X A;  3F1P A;  2IWB A;  4C6Y A;  4ZJ1 A;  1YM1 A;  1HLU P;  2IWC A;  2XK1 A;  2I72 A;  3CLO A;  1K4E A;  1JWP A;  1ONH A;  4HOI A;  3ZG0 A;  1A0K A;  3MFX A;  5CEB A;  4ZJ2 A;  1EW0 A;  4CPK A;  5L2F A;  1XFQ A;  3PBS A;  1E25 A;  3DWZ A;  3UNW A;  4JF5 A;  1SCW A;  1XPB A;  3LR3 A;  1VET A;  1DY6 A;  3CUE A;  5CER A;  3BY8 A;  3IH8 A;  1XKZ A;  2K2N A;  3MKF A;  3VP1 A;  3NJA A;  3UDI A;  4EBN A;  3MJQ A;  3K3C A;  2Q9N A;  1YQS A;  4Y15 A;  5A91 A;  1F98 A;  3L7H A;  2PRF A;  5DJT A;  2MJ6 A;  1NJ4 A;  4GHI A;  5U47 A;  3OPL A;  1XJ4 A;  3KX0 X;  5AQB A;  5FQI A;  2G7U A; 
#chains in the Genus database with same CATH homology
 2QKP A;  4MN5 A;  3RFB A;  1XJ3 A;  4RQ9 A;  3TW8 A;  1H3Q A;  3E98 A;  4EES A;  2L1M A;  4WUJ A;  4WEK A;  1UGU A;  2W3F A;  4LRY C;  4YWZ A;  2FZ0 A;  4OOM A;  3HCY A;  4R70 A;  4ARZ B;  4AFI A;  3KSG A;  1YSQ A;  2OWJ A;  4UEY A;  3LIE A;  4UQI S;  3C8C A;  3BY9 A;  3T4T A;  2B02 A;  3ZYT A;  1D7E A;  5IT5 A;  3LIB A;  3JVU A;  1V9Y A;  2LB5 A;  5EFW A;  4KQO A;  2O0Y A;  3CAX A;  4Y5F A;  5F68 A;  2PD7 A;  1T18 A;  3MXQ A;  4KUK A;  3T50 A;  1ZTU A;  2NUT C;  1YAX A;  3KYZ A;  2DMW A;  2I9V A;  3CIT A;  3MQO A;  3BQ8 A;  2K7S A;  1LT0 A;  2Y8H A;  5F69 A;  1H8M A;  3LIF A;  2VGL M;  4HJ6 A;  4JGQ A;  5J4E A;  1TS7 A;  5K5B A;  2ZMF A;  3E4P A;  3KO6 A;  2PD8 A;  1DP9 A;  3BJN A;  3P01 A;  5HDC A;  5CX7 A;  2VLG A;  2KX6 A;  3PBT A;  2O9A A;  4EET B;  4HP4 A;  2QJ5 A;  2V1B A;  5DFX A;  2KLI A;  3IS2 A;  1IFQ A;  4E04 A;  4GJ4 A;  4H6J A;  3TRC A;  3MR0 A;  2XRO A;  2JKR M;  3G6O A;  4ZRR A;  3T4O A;  3RH8 B;  4XT2 B;  4M4X A;  4OOL A;  4HY8 A;  5DKK A;  1S4R A;  3F1O B;  3OC2 A;  2JKT M;  1TF1 A;  1T1B A;  2PDR A;  3LI9 A;  3RTY A;  4MMN A;  1YKD A;  5IS1 A;  1P9W A;  4BBV A;  4BJP A;  4EW7 A;  4NEE D;  5HL6 A;  4UQI M;  4DN0 A;  4HI4 A;  4IUH A;  4O01 A;  2PHY A;  3W2Z A;  4NXE A;  2VV7 A;  5HD5 A;  4GW9 A;  2J3T D;  2ZMV A;  3U2A A;  4JGP A;  3LFV A;  4LPZ A;  2NUP C;  4DJ2 A;  2P7J A;  5HWV A;  5DF9 A;  4HP9 A;  3LI8 A;  1P9R A;  3NOT C;  5HPI A;  4IUK A;  1YSP A;  3F1N B;  3T4S A;  4CLC E;  4EU0 A;  4F3L B;  2WKP A;  4K08 A;  2PR5 A;  3LYX A;  1TS6 A;  2JKR I;  2PYR A;  3B47 A;  4II7 A;  1MKM A;  2EA9 A;  3D72 A;  1OT6 A;  5HZH A;  2VA0 A;  3IBR A;  3BQA A;  3ULF A;  5F6A A;  3B33 A;  3UE6 A;  2JKT I;  2W3G A;  1ODV A;  2LB9 A;  2ZOH A;  4EXO A;  1XJ2 A;  2V1A A;  4I39 A;  2V0U A;  4WEJ A;  1D06 A;  4ETZ A;  2W1T A;  1OJ5 A;  4IHQ A;  1OTA A;  4WLA A;  2INW A;  4CLC D;  2A24 A;  1NWZ A;  2PYP A;  2PT7 A;  2D01 A;  3H7W A;  3UMD A;  4GCZ A;  3EEH A;  1UWN X;  3FPW A;  1OTB A;  3S7N A;  1T1C A;  4IJG A;  5HDS A;  4CLC C;  4JGO A;  1OTD A;  3PXP A;  1DRM A;  2EWV A;  3F1P B;  1LSV A;  1JNU A;  2K31 A;  4L0L A;  5TBM A;  2J80 A;  2VEA A;  2M7V A;  3B42 A;  4CLC B;  3BW6 A;  1N9N A;  5DFY A;  1STZ A;  3ZQ5 A;  1LSX A;  2M1C A;  2ZOI A;  1MC0 A;  2Z6C A;  3JVV A;  3EOI A;  3E0Y A;  3LR4 A;  3PBN A;  1S4S A;  3UME A;  4EQ1 A;  5KIZ A;  3TE8 A;  5HD3 A;  1N9L A;  4G3W A;  2OAQ 1;  3TJZ C;  3PBO A;  3K2N A;  5FL3 A;  3T4L A;  3UE3 A;  1BYW A;  1NLY A;  3PR6 A;  4L9E A;  4ETX A;  1VHM A;  3OCN A;  3CUE C;  3LIA A;  5AVF A;  1XJ6 A;  5AVE A;  4Y3I A;  5F5Y A;  2WKQ A;  3HJI A;  3H82 B;  1W63 Q;  2OOL A;  2IA2 A;  3LUQ A;  1F5M A;  3GDI A;  3FG8 A;  2B18 A;  4GS9 A;  3VE3 A;  5KSH A;  1F9I A;  2HJE A;  3T4J A;  4BBT A;  2BAS A;  3LID A;  3PBQ A;  4R6L A;  3CWF A;  1WA9 A;  2CMN A;  3UB9 A;  3FPV A;  4GHI B;  5HPF A;  1S1Z A;  1OTE A;  2VV6 A;  3MQ0 A;  4ME4 A;  3T4Q A;  2A24 B;  2OAP 1;  1NLZ A;  4NKP A;  3A0V A;  3O5Y A;  3R7W B;  2J3W A;  5HSQ A;  2GX5 A;  2L4R A;  4NXF A;  3T4K A;  2VX8 A;  5DKL A;  2GZA A;  1TD5 A;  2ZBB A;  3PHY A;  3R4K A;  4I3A A;  4BWI A;  2O9C A;  3C2W A;  2O9B A;  3E4Q A;  3VV4 A;  3KYQ A;  2P04 A;  2R78 A;  4EEU A;  1V9Z A;  4HHD A;  3ICY A;  1T19 A;  5HWW A;  3H9W A;  2EWW A;  4HNB A;  4L9F A;  4O8G A;  4ARZ A;  3UB7 A;  2HV1 A;  1G6O A;  4NXB A;  4I5S A;  3S7Q A;  4WF0 A;  3A0R A;  3EGD C;  2J3T C;  2JHE A;  2OWH A;  3K3D A;  4HJ3 A;  2Y79 A;  3OOV A;  2FH5 A;  5A8B A;  2QJ7 A;  3EGX C;  4FOF A;  4G3K A;  2XRN A;  3MMH A;  3PBR A;  3NHQ A;  3MQQ A;  2V9A A;  3KSH A;  1IOU A;  2HF6 A;  4P6Z S;  4GS9 B;  2L0W A;  1TS8 A;  5IU1 A;  2VJW A;  5I5L A;  4JGR A;  2KOI A;  2V0W A;  3OBF A;  1VB6 A;  4MCW A;  4YOF A;  3IS2 B;  1W63 M;  4H6J B;  4QPR A;  3NOP C;  3KSF A;  3S7O A;  2KDK A;  4EUV A;  4Z1W A;  4PHT A;  1OTI A;  4XT2 A;  3P7N A;  3BWL A;  5AJG A;  3F1O A;  1NRJ A;  4DMZ A;  5G4Y A;  2XA7 M;  5DJU A;  5J3W A;  3DBA A;  4KQD A;  5C5K A;  4LRZ E;  4LRX C;  3LR5 A;  4B9O A;  2W27 A;  1XFN A;  2A2L A;  2W0N A;  1DP8 A;  4I3J A;  4Q0I A;  4LLO B;  2O99 A;  4O0P A;  2GJ3 A;  3PYP A;  1MZU A;  2GNX A;  3UB8 A;  3EEA A;  4Y2F A;  3F1N A;  3CI6 A;  2VKS A;  3MF0 A;  4F3L A;  3EQV A;  4HH3 A;  1OJG A;  4P6Z M;  1LSW A;  4I3I A;  1T1A A;  2M7U A;  2QHK A;  2W3H A;  1UWP X;  4KUO A;  5MC7 A;  1DP6 A;  2PR6 A;  4MDZ A;  1S1Y A;  2D02 A;  1GSW A;  4Q0H A;  4FSF A;  1P97 A;  4PAU A;  5G4Z A;  2WKR A;  2XSS A;  5LBR A;  4CQH A;  3EQU A;  5HWT A;  2W1T B;  1ZHH B;  2P08 A;  4PKY A;  4R3A A;  5HDD A;  3H7W B;  2H28 A;  1G28 A;  3HJK A;  2VV8 A;  4EEP A;  1Y28 A;  1X0O A;  4Q0J A;  3LR0 A;  4DJ3 A;  2JN7 A;  4WN5 A;  2QYB A;  1P0Z A;  3NOU C;  3EWK A;  4BBU A;  3F1P A;  2YKF A;  5TBM B;  2Z6D A;  3OLO A;  3A0S A;  3E4O A;  4CLC A;  2QWS A;  3LIC A;  2HGV A;  2XA7 S;  3GEC A;  4BMW A;  4PKY G;  4WEL A;  3CLO A;  4WL9 A;  3VE4 A;  4HOI A;  4GLQ A;  2VZW A;  1OPX A;  5J7E A;  3MFX A;  4MN6 A;  1N9O A;  1S66 L;  1EW0 A;  4B93 A;  1LL8 A;  1XFQ A;  3PBS A;  3V67 A;  4HJ4 A;  3FC7 A;  3OCL A;  3SW1 A;  1GSX A;  4EER A;  3S7P A;  3H82 A;  1S67 L;  3C30 A;  3LR3 A;  4I38 A;  3C38 A;  1GSV A;  2W1R A;  4MN7 A;  3CUE A;  4HQA A;  4NXG A;  2HJ9 C;  3BY8 A;  5L8M A;  2K2N A;  4HH2 A;  3NJA A;  4L9G A;  1TS0 A;  3VOL A;  2W3E A;  4HIA A;  2YKH A;  3KSI A;  3MJQ A;  3K3C A;  4G3V A;  4R38 A;  3UB6 A;  2VGL S;  1F98 A;  1OT9 A;  5DJT A;  2MJ6 A;  4GHI A;  2W3D A;  3D3O A;  1XJ4 A;  3IBJ A;  5TJJ A;  3KX0 X;  2G7U A;  4YNR A;  3R7W A;  1KOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...