3VV4A

Crystal structure of cyanobacteriochrome tepixj gaf domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
LSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQCSEPRQWQEIEIDQFSELASTGSLVLERLHFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 48
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3vv4A00
4O8GA 3NOPC 5DFXA 4YOFA 2XRNA 5K5BA 4MMNA 3MQ0A 4YNRA 2LB9A 4BWIA 2O9BA 2O0YA 1YKDA 3TRCA 3C2WA 2B18A 2W3DA 2W1RA 4LRZE 3LFVA 2W1TB 4ME4A 2W3GA 3G6OA 1MKMA 4ETZA 2W1TA 3S7QA 3CI6A 4DN0A 5AJGA 4R6LA 4Y5FA 4Q0IA 4LRXC 3S7OA 2W3EA 5C5KA 3VV4A 2IA2A 4Z1WA 3RFBA 3EEAA 4G3VA 3NOUC 1YSQA 2OOLA 5HL6A 2O9CA 2M7UA 3KSGA 2W3FA 3OOVA 4Y3IA 2QYBA 2ZMFA 2M7VA 3S7PA 5HPFA 3NOTC 2HGVA 3DBAA 3KSIA 4DMZA 4GLQA 4PAUA 3CITA 3MF0A 1VHMA 1MC0A 2KLIA 2VEAA 4O01A 2K2NA 2G7UA 1STZA 1F5MA 4MCWA 3KSFA 2O99A 3ZQ5A 3E0YA 3S7NA 4G3KA 5HPIA 1TD5A 2W3HA 3R4KA 5LBRA 2K31A 4RQ9A 3IBRA 4ETXA 4IUKA 4R70A 2Y79A 2O9AA 3BJNA 5HSQA 4Q0HA 2VJWA 3W2ZA 3OBFA 4GW9A 5DFYA 4LRYC 4O0PA 4EUVA 4G3WA 3E98A 1TF1A 2VZWA 2Y8HA 4E04A 2VKSA 5TJJA 3HCYA 3KO6A 4CQHA 4Q0JA 4FOFA 4Y2FA 2XROA 4ZRRA 3MMHA 2LB5A 3O5YA 4EU0A 4MN7A 4MDZA 3NHQA 3KSHA 3IBJA 2XSSA 4IJGA 5I5LA 2GX5A 3K2NA 5L8MA 1ZTUA 3D3OA 1YSPA 4IUHA 2KOIA 4QPRA
chains in the Genus database with same CATH superfamily
4HY8A 2LB9A 5E2GA 2YKFA 2DCFA 1NLYA 4CLCE 3BEBA 1H3QA 2Z6DA 1OTIA 3FPWA 3PBNA 4OVDA 2ZC3B 3UB7A 4RYEA 3VE3A 3DTEA 3DTKA 1K55A 1LLBA 5MC7A 1VEUB 3F1PA 2OV5A 4IVKA 1HTZA 4BQMA 4LRXC 5C5KA 2ZQDA 3DWKA 3NCKA 2OAP1 1GA0A 4Z9QA 1L0GA 2J3WA 4YFMA 2OOLA 4HEFA 3C8CA 2VGJA 1KDSA 3CWFA 1Y28A 5F82A 1T1AA 5HDSA 3MSHA 4LLOB 2QJ5A 5FQIA 3B42A 1BLPA 4MCWA 1SCWA 1U60A 2O99A 2ZLYA 3W4OA 2JE5A 3QP1A 5F1GA 1EW0A 5KMWA 4HP9A 4X69A 3FYZA 3IWOA 3IH8A 2KDKA 5DTSA 4M3KA 4K91A 4FH2A 2D01A 2NUTC 3UDFA 4KENB 4Q0HA 1SDEA 4HBUA 3OPLA 2V1AA 4E3OA 2VLGA 3Q81A 4EUVA 2Z6CA 2XK1A 1G6OA 3KO6A 3E2LA 2VV8A 4X6TA 4P6ZS 2E8IA 2J8YA 4HQAA 3WS4A 1T18A 5A93A 3KYEA 4Q8IA 2XROA 1KVLA 4EEPA 3ICYA 1L0EA 2HPBA 2QHKA 3K2NA 5FASA 1E3UD 4QPRA 3OLOA 2VA0A 3FZCA 4KQDA 3SH9A 3SS4A 2Z2LB 3WS0A 4IBXA 4RX3A 3HLGA 3N4IA 4HJ6A 4JLFA 1SZVA 3T4QA 3T1QB 3P7NA 2W3DA 2EX8A 2W1TB 3PBSA 1CEGA 3MBZA 3K3DA 3UE0A 1FILA 1IKGA 2PYPA 2GNXA 3IF5A 2L4RA 3MR0A 4WMCD 3JYIA 3PTEA 5HL6A 1E4DA 1K57A 1MWRA 1C3BA 2W3FA 2XFTA 3PBOA 5FATA 2ZM2A 5BOHA 2KLIA 2VGLS 3MJQA 3HUNA 5DJUA 1W63M 2C5WB 3MXRA 3KSFA 3E0YA 4Y0UA 1DP9A 1KGGA 2BASA 1NLZA 4NK3A 4EQ1A 3N8RA 3HVFA 2ZL1B 2O9AA 3HLWA 4XXRA 2H10A 5F5YA 3AGDA 2L0WA 4JF6A 1TF1A 2XH9A 2ZM8A 1PNEA 3HCYA 3OPPA 1LSXA 1YT4A 2XA7S 4CLCA 5M18A 3AGFA 1ZG6A 4ZDXA 3OCLA 1E25A 4Y15A 5A91A 1BUEA 3S22A 2K7SA 2W27A 2ZM0A 4I39A 3D3OA 4IUHA 4E3LA 4MBKA 2PBYA 2B5RA 4UA7A 2O9BA 1GCEA 3BY8A 3D72A 1PRQA 4R3BA 3H82A 4PM7A 2Y2QA 1CQAA 1GHIA 5AQ7A 4HHDA 1P0ZA 1M40A 2R9XA 3A3IA 4P0MA 4JXSA 4RA7A 2OSUA 5EM0A 3IXGA 1S67L 4Y5FA 3BFCA 5AVFA 2X02A 2I9VA 1VEUA 4X25A 3IWIA 4XUZA 3P98A 4BMWA 4I3IA 3WS2A 4DE2A 3RXXA 5HDCA 3BECA 2Y2MA 1KE4A 4U0XA 1OTAA 3MXSA 2JKTI 3TW8A 1Y54A 3KSIA 2V20A 4DDYA 5FI7A 4M4XA 2VEAA 1YM1A 2K2NA 4KZAA 3VFHA 5HPIA 2Y4AA 3HLCA 3R4KA 1L0DA 5CERA 4GN2A 1HZOA 4GZBA 4D2OA 3MFXA 3UPOA 1S6RA 3IQAA 4R4SA 4PM6A 4GW9A 5DFYA 3T1SA 4JBFA 2VKSA 3EWKA 3MKFA 2KX6A 1FQGA 4B4XA 4WZ5C 3TE8A 2V1BA 2WKRA 4F94A 4I3AA 4LGWA 5L07A 4OPYA 2XSSA 4ID4A 2XQZA 3IT9A 5L8MA 2WKPA 5HD5A 1YLPA 5DFXA 1GHMA 2XRNA 4NXBA 4OLGA 3EQVA 1XJ3A 2DMWA 2O0YA 2CMNA 2WZZA 1H8YA 5FI2A 3TRCA 3LY4A 2V2FF 3SS5A 1L0FA 3DWZA 4KQOA 3VP4A 2W1TA 5G18A 1CI9A 3NULA 4X56A 3JPUA 1GA9A 2QMIA 1SDNA 3G2ZA 2A3UA 2FH5A 2P7JA 4IBRA 3VV4A 4RVAA 2ZJ9A 3E4QA 4JKTA 1SKFA 3C7VA 3F1NB 1SKOB 3VOLA 3D9YA 5DF9A 1YSQA 3QHYA 5EV0A 5CHUA 4R38A 3IX3A 4IVIA 5F6AA 4JXVA 2J9PA 1PI5A 4L0LA 3O3VA 1XA7A 3LR5A 1STZA 1DJAA 4UHUA 1TS0A 1FR6A 4N1XA 4Y17A 1W79A 3HL9A 4DE0A 4S2PA 1MPLA 2MJ6A 4R70A 3MQOA 3MS6A 2ZL1A 2JKTM 1J9MA 4QY6A 1ERMA 3UB8A 3OBFA 3C30A 4JGRA 5E2HA 1ES2A 3SS3A 1L2SA 3MKEA 4QD4A 3SW1A 2ZOIA 1XX2A 1LI9A 1BSGA 4WLAA 3ZG9B 3HUOA 3TOIA 2A2LA 4KQQA 4D60A 4EQIA 3IXBA 1YQSA 3H7WB 3UNWA 1MY8A 3V39A 1H0MA 3S1YA 4KG2A 4GKUA 1QMEA 2JBFA 1XJ2A 1YLJA 4MBFA 2L1MA 1TDGA 1MKMA 1T19A 3NIAA 3T4SA 1DJBA 1CJFA 2YKHA 1FSWA 4NEED 2HP5A 5AVEA 2IA2A 4I5SA 3RFBA 4N9KA 4EETB 1K0KA 4WF0A 4U0TA 4PMAA 3IXHA 1MC0A 4X1LA 3PAGA 3EOIA 3E4PA 3JVVA 3MZEA 4NG2A 1K4FA 1OTDA 4N92A 5A92A 5DVAA 5IS1A 3M2KA 3UMEA 5CHJA 3G30A 3ZGAB 3DTMA 1L3LA 2ACGA 1H5XA 3KYZA 3MZDA 1YMSA 3ZG5A 1K56D 3E4OA 4S2IA 4LFUA 1ZHHB 4YINA 1ESUA 3T4KA 4KZ4A 3BQ8A 1T1BA 3T4OA 1TDLA 2KOIA 3ITAA 5K5BA 4EBLA 1ES4A 3SH8A 5L2FA 2EFXA 3C2WA 2B18A 4S2NA 5J8XA 4OKPA 3VSLA 4KQRA 2PDRA 3FPVA 4Y0TA 3VE4A 1FSYA 1O7EA 2HDSA 3DAVA 4K08A 5CXWA 1NYYA 2EXBA 3H82B 5EE8A 1HD8A 3EEAA 1Q2PA 3I7JA 4S2OA 4UA6A 3PBQA 2Y59A 3BW6A 4LV2A 3F1NA 1SKOA 3FKVA 3A3JA 3ISGA 3LR3A 1I5QA 1GSXA 3VP1A 3BQAA 3CPTB 4KUOA 4OQIA 1RGZA 4LENA 2Y2LA 3NC8A 4DXBA 1MKIA 3QP8A 4OQGA 2XLNA 2R9WA 1QMFA 2PBDP 5L09A 4EWFA 3HUMA 4ETXA 4IUKA 5HWVA 2QJ7A 5EVIC 4HH3A 1S1YA 1LHYA 1LSVA 2PHYA 1F98A 1K6RA 4X55A 2ZQCA 3GSGA 2Y8HA 4E04A 5TJJA 1IYPA 3CUEC 4FOFA 2LB5A 5D3OA 3NJAA 3IBJA 4EBPA 4HJ4A 3EEHA 3P09A 3CHWP 3CJMA 3NBLA 4KZ5A 1EROA 1G6AA 1E3UA 2HDRA 2OWHA 2X71A 3VFFA 2Y2KA 3H7WA 3N6IA 1WE4A 3TJZC 4PM5A 3ZFZA 3PR6A 3IF6C 2ZQ7A 3CI6A 5F83A 5L10A 3NDEA 3WRTA 4KZ9A 5JYOA 4CPKA 4B88A 5EVID 1S4SA 3GQZA 3SZTA 4GDNA 4WMCA 2M7UA 1G5UA 3S7PA 3B47A 1F9IA 1TVFA 3GECA 3CITA 3LI9A 4OQHA 1F5MA 3B3XA 1IYQA 1JTGA 2WGVA 2P04A 3IH9A 3A3FA 5HAPA 1XKZA 3HJIA 3RJUA 4OPQA 1S1ZA 2OAQ1 2J9OA 3G2YA 4KUKA 3VP2A 2AVXA 1CI8A 2W0NA 4EU0A 3OPHA 1Z09A 4MDZA 3V3RA 3OCNA 2XDMA 3ZG7B 4B4ZA 3QP4A 3UE6A 5EPHA 4EXOA 1T1CA 4OOMA 4EW7A 4MMNA 4ZJ1A 2BG1A 4HJ3A 5HZHA 4GD6A 3LIAA 5KZHA 1PIOA 2WGWB 5E2EA 1TEMA 1BTLA 3LFVA 3LR0A 4B93A 1KOUA 4OQ0A 1JVJA 2PR6A 3LCEA 2ZMVA 1MBLA 3UY6A 3TG9A 4DJ3A 3UB6A 3OZHA 4AFIA 1FIKA 2UV0E 1P97A 1V9YA 4WZ4A 2P74A 2WZXA 2P9VB 5GLDA 1FCNA 2EX6A 4P6BA 5F1FA 3B33A 4JXWA 2DRWA 3Q7ZA 1BZAA 1N9BA 4I38A 4DKIA 4KZ6A 4E3JA 1IEMA 1VHMA 3PXPA 2GJ3A 3CPTA 1NZOA 3MZFA 4MN6A 5DF8A 3V3SA 4BBVA 3ZG8B 1OT6A 3C4OA 1K38A 3T4JA 3FKWA 1S4RA 4LV1A 4II7A 3BJNA 5HSQA 2VJWA 5EECA 2B02A 4DXCA 1WYCA 1XFQA 5KIZA 4E6WA 3NDGA 4E3MA 4EEUA 3QP2A 1N9NA 2XR0A 1OJ5A 4R4RA 1VB6A 1MZUA 4E3NA 3PHYA 1JTDA 3H9WA 1P9RA 2VX8A 1LI0A 1CF0A 2NUPC 3CG5A 3SOIA 2J80A 3D4FA 3ZDJA 4UQIM 4CJNA 1IOUA 4KZ8A 2H0TA 2HV1A 4BWIA 4GNUA 2PU4A 1FCMA 2WUQA 1PYYA 1DRMA 3EGDC 1NY0A 2JC7A 4QB8A 4LRZE 2PAVP 5GL9A 4ARZB 4KZ7A 1MWTA 4BJPA 3ZCZA 3A0SA 4F3LB 4Z1WA 4EERA 1K54C 4G3VA 5GHXA 2ZC7A 1RP5A 3KYQA 1LSWA 3KSGA 3UN7A 2V8FA 1OTBA 2I72A 2QYBA 3BFFA 2D02A 4PHTA 3N8SA 4HOIA 2Y2JA 5A90A 5CGXA 2G7UA 4WZ5A 3T1RA 2VGKA 2VK3A 2JCHA 3HJKA 1XGJA 5AQAA 3LYXA 3T4LA 2EWVA 4YWZA 1NYMA 5DF7A 3G35A 5J3WA 1OMEA 4H6JB 1BULA 1S66L 4MN5A 5AQ9A 2IWBA 1MWUA 4BL2A 2WKIA 4K0WA 2PD7A 4DJ2A 3IHBA 1ZKJA 3O87A 2JKFA 4MN7A 2EFUA 4HI4A 5EVEA 3KSHA 1HVBA 2GX5A 4HIAA 1BLCA 2P08A 3W4PA 5A8BA 2GDNA 4E6XA 1IKIA 3E2KA 2WAFA 1AXBA 5GHYA 3OC2A 3NI9A 4MEZA 3O88A 3AGEA 4UEYA 2Y91A 1XXMA 4LCMA 4KZBA 2RL3A 2W3GA 2WGWA 4C6YA 1JWPA 2FFYA 4JF5A 3UO9A 4NXGA 2HDUA 2JN7A 4WELA 5EVLA 5EVIB 2JKRM 1KE3A 4NETA 2J7VA 1GSWA 2P9VA 3OOVA 5HW3A 1BLSA 3T1XA 1Q2QA 3NOTC 3BWLA 3QNBA 1K4EA 3KX0X 4Y13A 3LGOA 4R3JA 4XT2B 1KGFA 2W3HA 2INWA 5LBRA 2ZMAA 3C7UA 1XP4A 4OPRA 2RCXA 4QHCA 4EV4A 2Y2GA 5E43A 2EX9A 2M1CA 5TBMB 1BYWA 4G3WA 2HJ9C 4WUJA 2VZWA 3ZG0A 3ZVWA 5GLBA 5FSRA 1UGUA 2EX2A 5J7EA 4IEDA 1K56A 2HF6A 4DE3A 3O5YA 3IF6B 4JGPA 5FI6A 1I2WA 3LEZA 3IX4A 1ES5A 4S2JA 5I5LA 4FUWA 1DJCA 4JPMA 1V9ZA 5FAPA 2ZC6B 3CLOA 2Y2NA 3GVBA 4LPZA 4YNRA 2Y55A 3V67A 1S0WA 1FOFA 3ULFA 4ZAMA 1ZC2A 3RTYA 2W1RA 3F1OB 5FA7A 4S2NC 1OTEA 4ETZA 3VOZA 4DF6A 4R6LA 1F2KA 5DKKA 4R23A 4ARZA 5CTMA 4Q0IA 4HP4A 1IELA 3WS5A 3S7OA 4IHQA 2W3EA 2WAEA 4JGQA 4F3LA 2B95A 2O9CA 1PWCA 5HD3A 4GD8A 1CEFA 5DTTA 4MNRA 3A0RA 5FEFA 4DRTA 1VM1A 4GLQA 2G2UA 1FCOA 1K55C 3L9KA 4S2MA 3VP3A 5F68A 4L9GA 2ZD8A 1PWDA 1LL8A 4WL9A 5TGFA 4O01A 4GS9B 3V50A 1TD5A 4WEJA 2ZQ8A 4OP5A 1IYOA 1XA1A 1NJ4A 2VV6A 3O86A 4H6JA 3SH7A 4LV0A 3BLMA 3RH8B 1JWVA 1RCJA 4U3TA 5GHZA 1ES3A 4BBUA 1JWZA 3UE1A 1G68A 2XEPA 5CGWA 2ZOHA 3BFDA 4WM9A 3T4TA 1M6KA 2QPNA 3LO7A 2V9AA 3N7WA 1WA9A 1ZTUA 1ERQA 2FZ0A 2EA9A 5HX9A 4FH4A 3FC7A 1ESIA 4OLDA 4ESPA 1PW8A 2GZAA 2A24B 3BFGA 2PT7A 4FTXA 3A3EA 1ZG4A 4UA9A 4RX2A 4R1GA 3W4QA 3A0VA 1OPXA 2WKQA 3S7QA 4OP8A 1N9LA 4NXEA 1YLZA 3IX8A 3Q82A 1W7FA 5EFWA 1Z6FA 3UE3A 3NOUC 4PKYG 1PZOA 2DNSA 5EVIA 5KSCA 1BT5A 3QNCA 3FV7A 3P01A 1P9WA 4P85A 3MXQA 4HBTA 5CHMA 4DMZA 3DW0A 2Q9NA 2Q9MA 1K25A 3CUEA 4XT2A 5CEDA 4HESA 3T50A 3ZVTA 1LT0A 3S7NA 4G3KA 3UMDA 1W8YA 1VQQA 3MFDA 4BLMA 5CGSA 3NY4A 1K57C 4ZBEA 3EQUA 4O0PA 4P87A 3UDIA 4OH0A 1NRJA 3N8LA 5TBMA 3A3DA 4P6ZM 1N9OA 4Q0JA 5E2FA 4KZ3A 5FAQA 4E3IA 4N9LA 2V1ZA 5CTNA 3MMHA 4BBTA 4GHIB 3IF6A 2HP9A 2QKPA 2HZ5A 5G4YA 3V5MA 1UWPX 4CLCC 3M6HA 2J3TC 2ZC4B 1NWZA 4WBGA 3F1OA 4OOLA 5FQKA 1HLUP 5TFQA 1VETB 2UWXA 4DN0A 1NZUA 2H0YA 1K6SA 1LL5A 4EBNA 2H28A 2R78A 1G28A 4FCFA 2V0UA 3LI8A 4EESA 4E3KA 4WEKA 4C75A 4OPZA 5M1AA 4H8RA 4GB7A 3HLEA 4S2LA 1X0OA 3CMZA 1MXOA 2OLVA 2ZQ9A 3Q1FA 5HPFA 1ALQA 3DBAA 3PAEA 3IHAA 3HBRA 2PU2A 2VGLM 5FQQA 1W63Q 3BYDA 2V8CA 3WRZA 3C5AA 5FQ9A 4L9EA 5HWWA 5HFOA 4GOGA 3ZNYA 1ACFA 4GS9A 4RQ9A 3IBRA 3QP6A 3LY3A 2V0WA 1YLTA 2Y79A 4EUZA 1PW1A 5U47A 1H8ZA 3W2ZA 1H8MA 3JVUA 1XFNA 1XGIA 3GMWA 4OOYA 2CC1A 2WKHA 4CLCD 2XA7M 2J3TD 5I94A 2A49A 1XJ4A 2FFFB 4ZRRA 5EUAA 3IS2B 2QWSA 2WK0A 4QU3A 4UQIS 5IHVA 1NRFA 3FG8A 5FEGA 5IT5A 3R7WB 2Y2IA 1WYBA 2HP6A 3GDIA 3W8KA 1PFLA 5CRFA 3NOPC 4YOFA 3MQ0A 1N4OA 1TS6A 4FSFA 1YKDA 1DP8A 2A24A 1OJGA 4N1HA 4ME4A 3GR2A 4JXGA 2BLSA 5EOOA 1LL9A 1YLWA 3LIEA 3VMAA 1IYSA 5AJGA 4PM8A 5IU1A 4NKPA 4PM9A 5G4ZA 4PKYA 1CK3A 3BRMA 4X53A 2JKRI 4Y3IA 3G34A 5HL1A 2HGVA 3PBRA 2PYRA 3MF0A 4BD0A 5KSHA 2H5SA 3CAXA 4L9FA 4QWOA 4GDBA 2ZBBA 2OLUA 4HNBA 3BFEA 2JHEA 3UB9A 2K31A 4Y7PA 3ZYTA 2EXAA 3Q7VB 5FDSA 3UB5P 2IWDA 1SHVA 4C3QA 1YAXA 4LRYC 2Y2HA 4DDSA 4XUXA 1YPRA 3GV9A 1D7EA 1TS7A 4DE1A 4MLLA 4BL3A 2XD5A 5HWTA 3VP0A 4IJGA 3LIBA 3UPPA 1PWGA 3RXWA 4GHIA 5JYPA 5EM1A 2C6WB 3ZNTA 2EWWA 3M2JA 3LIDA 1K54A 4QJGA 5DKLA 3C4PA 1NXYA 4BENA 1I2SA 4R3AA 4OONA 2IWCA 5HAIA 2XD1A 1MWSA 2Q0OA 3G6OA 3F1PB 2WYXA 3LEQA 4UAAA 1VETA 5GLCA 4MBHA 1ODVA 2JKGA 4B9OA 3S4XA 1D1JA 3BLSA 3C38A 5CECA 3LUQA 2WGIA 3CZDA 5FQJA 1W5DA 2PR5A 4GCZA 1TS8A 2XFSA 3G31A 3BY9A 3T12B 1ONHA 3PBTA 1IFQA 5CX7A 1YLYA 4KG5A 3M6BA 1DP6A 5CEBA 2WKEA 4HH2A 3MQQA 1GSVA 2WADA 3PYPA 1J3WA 4LCLA 3G4PA 4S2KA 4GJ4A 1GHPA 4JGOA 1YMXA 1PI4A 3DTIA 5FDHA 3HLDA 4X1MA 1KVMA 1OT9A 1O07A 5DJTA 3IS2A 4BD1A 4ZTKA 2XF3A 4PPRA 4LV3A 1YSPA 3VSKA 3R7WA 3K3CA 4KG6A 4O8GA 5FAOA 4NXFA 2VV7A 4X68A 4WN5A 3BM6A 5HARA 1UWNX 2HDQA 3Q07A 3ZHHA 3UPNA 1D06A 5AQBA 1RGYA 3WS1A 2ZQAA 1PZPA 4JF4A 1EI5A 1EWZA 5GLAA 4Y0OA 2QZ6A 3HLFA 4ZJ3A 3IXDA 3VOYA 3ITBA 2E8JA 2BTFP 3QP5A 5DTKA 4WYYA 3HLBA 2X01A 4R0QA 1KGEA 2ZMFA 3U4LP 2M7VA 4I3JA 1FR1A 2Z2MB 2PRFA 5M19A 1BLHA 4PAUA 4O7DA 4FD8A 3ZQ5A 3GTCA 2PD8A 3TSGA 5HAQA 3U2AA 3OPRA 3LICA 4QY5A 3FWLA 1JNUA 3HREA 5J4EA 2G2WA 1XPBA 3GRJA 4A5RA 5FL3A 1DY6A 1KDWA 2HJEA 3NECA 2Y2PA 3G32A 2ZC5B 2XGNA 4ZJ2A 3LR4A 3Q7VA 1A0KA 5HDDA 4CLCB 3E98A 3IWQA 1AWIA 5FQMA 4CQHA 4Y2FA 1ONGA 1Y4OA 1XJ6A 2Y2OA 3L7HA 5EOEA 3WWXA 3NHQA 3UDXA 3EGXC 3LIFA 1W8QA 4K0XA 2OWJA 5TR7A 5F69A 1KE0A
chains in the Genus database with same CATH topology
4HY8A 2HV1A 2LB9A 4BWIA 3H7WB 5G4YA 1UWPX 2YKFA 1NLYA 4CLCE 1H3QA 4CLCC 1DRMA 2J3TC 3EGDC 2Z6DA 1OTIA 3FPWA 3PBNA 1XJ2A 4LRZE 3UB7A 1NWZA 3VE3A 2L1MA 3F1OA 4OOLA 1MKMA 4ARZB 5MC7A 3F1PA 4DN0A 1T19A 3T4SA 2YKHA 4LRXC 4NEED 2H28A 2R78A 5AVEA 5C5KA 4BJPA 2IA2A 1G28A 3A0SA 2V0UA 3LI8A 4I5SA 2OAP1 4EESA 4F3LB 4Z1WA 3RFBA 4EERA 4G3VA 4WEKA 4EETB 4WF0A 2J3WA 2OOLA 3KYQA 1LSWA 3C8CA 3KSGA 1X0OA 1OTBA 2QYBA 3CWFA 5HPFA 1Y28A 3DBAA 2D02A 1T1AA 4PHTA 5HDSA 4HOIA 4LLOB 1MC0A 2QJ5A 2VGLM 1W63Q 3B42A 3EOIA 2G7UA 3E4PA 3JVVA 4L9EA 4MCWA 2O99A 5HWWA 3HJKA 1EW0A 1OTDA 5IS1A 3LYXA 4HP9A 3T4LA 4GS9A 2EWVA 2KDKA 4RQ9A 4YWZA 3IBRA 2V0WA 3UMEA 2Y79A 5J3WA 2D01A 2NUTC 4Q0HA 4H6JB 3W2ZA 1H8MA 1S66L 4MN5A 3JVUA 3KYZA 1XFNA 2V1AA 2VLGA 4EUVA 2Z6CA 1G6OA 3KO6A 4CLCD 2VV8A 2XA7M 2J3TD 4P6ZS 2PD7A 4HQAA 3E4OA 4DJ2A 1XJ4A 1T18A 2XROA 4ZRRA 4MN7A 3IS2B 1ZHHB 4HI4A 2QWSA 4EEPA 3KSHA 3ICYA 2GX5A 4HIAA 4UQIS 3T4KA 2QHKA 3FG8A 3K2NA 5IT5A 2P08A 3R7WB 5A8BA 3BQ8A 3GDIA 1T1BA 3T4OA 2KOIA 4QPRA 3NOPC 2VA0A 3OLOA 4KQDA 4YOFA 5K5BA 3MQ0A 1TS6A 3OC2A 4FSFA 1YKDA 4HJ6A 1DP8A 2A24A 3T4QA 1OJGA 3P7NA 4UEYA 3C2WA 2B18A 2W3DA 4ME4A 2W1TB 3PBSA 2W3GA 3LIEA 4NXGA 2PDRA 5AJGA 3FPVA 3K3DA 3VE4A 5IU1A 4K08A 2JN7A 2PYPA 4NKPA 4WELA 5G4ZA 3H82B 4PKYA 2JKRM 2GNXA 3EEAA 2L4RA 3MR0A 1GSWA 2JKRI 5HL6A 3PBQA 3BW6A 3F1NA 2W3FA 3OOVA 4Y3IA 3LR3A 1GSXA 3NOTC 2HGVA 3BWLA 3BQAA 3PBOA 3KX0X 3PBRA 4KUOA 4XT2B 2PYRA 3MF0A 2KLIA 2VGLS 5KSHA 3MJQA 3CAXA 5DJUA 1W63M 4L9FA 3KSFA 3E0YA 2ZBBA 1DP9A 2BASA 1NLZA 4HNBA 4EQ1A 2W3HA 2INWA 2JHEA 5LBRA 2K31A 3UB9A 4ETXA 4IUKA 5HWVA 2QJ7A 2O9AA 4HH3A 1S1YA 3ZYTA 1LSVA 2PHYA 5F5YA 1F98A 2L0WA 2M1CA 5TBMB 1YAXA 4LRYC 1BYWA 4G3WA 2HJ9C 4WUJA 1TF1A 2VZWA 2Y8HA 4E04A 5TJJA 3HCYA 1LSXA 2XA7S 4CLCA 1UGUA 1D7EA 3CUEC 1TS7A 4FOFA 5J7EA 2HF6A 3OCLA 2LB5A 3O5YA 4JGPA 3NJAA 5HWTA 3IBJA 4IJGA 5I5LA 3LIBA 4HJ4A 2K7SA 3EEHA 1V9ZA 2W27A 4GHIA 4I39A 3D3OA 3CLOA 4LPZA 4IUHA 2EWWA 3LIDA 2OWHA 4YNRA 2O9BA 3V67A 5DKLA 3BY8A 3D72A 3H7WA 3H82A 3ULFA 3RTYA 4R3AA 3TJZC 2W1RA 3F1OB 1OTEA 4HHDA 3G6OA 3F1PB 1P0ZA 3PR6A 4ETZA 3CI6A 4R6LA 5DKKA 4Y5FA 1S67L 4ARZA 4Q0IA 5AVFA 2I9VA 4HP4A 3S7OA 4IHQA 2W3EA 1ODVA 4JGQA 4B9OA 1S4SA 4BMWA 3C38A 3LUQA 4F3LA 4I3IA 2O9CA 2PR5A 5HD3A 2M7UA 4GCZA 5HDCA 1TS8A 3S7PA 1OTAA 3A0RA 2JKTI 3B47A 1F9IA 3KSIA 3TW8A 3BY9A 4GLQA 3GECA 3CITA 3PBTA 5F68A 1IFQA 4L9GA 5CX7A 4M4XA 1LL8A 2VEAA 4WL9A 4O01A 2K2NA 3LI9A 1F5MA 1DP6A 4GS9B 5HPIA 1TD5A 4HH2A 3R4KA 3MQQA 4WEJA 1GSVA 2P04A 3HJIA 3PYPA 3MFXA 2VV6A 1S1ZA 2OAQ1 4GJ4A 4GW9A 5DFYA 4H6JA 4JGOA 3RH8B 2VKSA 3EWKA 4KUKA 2KX6A 2W0NA 4BBUA 3TE8A 2V1BA 2WKRA 4I3AA 4EU0A 2ZOHA 1OT9A 4MDZA 3OCNA 2XSSA 5DJTA 3T4TA 3IS2A 2V9AA 5L8MA 3UE6A 2WKPA 1WA9A 1ZTUA 5HD5A 2FZ0A 2EA9A 1YSPA 3R7WA 3K3CA 4O8GA 5DFXA 4EXOA 2XRNA 1T1CA 3FC7A 4NXBA 4MMNA 4OOMA 4EW7A 3EQVA 1XJ3A 2DMWA 4HJ3A 2GZAA 2A24B 2O0YA 4NXFA 5HZHA 2CMNA 2VV7A 4WN5A 2PT7A 1UWNX 3TRCA 3LIAA 1D06A 3LFVA 3A0VA 3LR0A 4KQOA 4B93A 1KOUA 1OPXA 2W1TA 2PR6A 2WKQA 3S7QA 2ZMVA 1N9LA 4NXEA 4DJ3A 3UB6A 4AFIA 2FH5A 2P7JA 3VV4A 1P97A 1V9YA 3E4QA 5EFWA 3UE3A 3NOUC 3F1NB 4PKYG 3VOLA 5DF9A 1YSQA 3B33A 4R38A 2ZMFA 2M7VA 4I3JA 3P01A 1P9WA 5F6AA 3MXQA 4I38A 4DMZA 4PAUA 1VHMA 3PXPA 4L0LA 2GJ3A 3CUEA 4XT2A 3LR5A 4MN6A 1STZA 3T50A 3ZQ5A 1TS0A 2PD8A 4BBVA 1LT0A 1OT6A 3S7NA 4G3KA 3UMDA 3T4JA 3U2AA 1S4RA 3LICA 1JNUA 2MJ6A 4R70A 5J4EA 3MQOA 4II7A 3BJNA 2JKTM 5HSQA 5FL3A 2VJWA 2B02A 1XFQA 5KIZA 2HJEA 3UB8A 3OBFA 4EEUA 3C30A 3EQUA 4JGRA 1N9NA 4O0PA 1OJ5A 3LR4A 1VB6A 5HDDA 1MZUA 4CLCB 3E98A 1NRJA 5TBMA 3PHYA 3SW1A 4P6ZM 1N9OA 2ZOIA 4CQHA 3H9WA 4Q0JA 1P9RA 4Y2FA 2VX8A 1XJ6A 3MMHA 4BBTA 2NUPC 3NHQA 4WLAA 2J80A 4GHIB 3EGXC 3LIFA 4UQIM 2OWJA 1IOUA 2A2LA 2QKPA 5F69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8G A;  3NOP C;  5DFX A;  4YOF A;  2XRN A;  5K5B A;  4MMN A;  3MQ0 A;  4YNR A;  2LB9 A;  4BWI A;  2O9B A;  2O0Y A;  1YKD A;  3TRC A;  3C2W A;  2B18 A;  2W3D A;  2W1R A;  4LRZ E;  3LFV A;  2W1T B;  4ME4 A;  2W3G A;  3G6O A;  1MKM A;  4ETZ A;  2W1T A;  3S7Q A;  3CI6 A;  4DN0 A;  5AJG A;  4R6L A;  4Y5F A;  4Q0I A;  4LRX C;  3S7O A;  2W3E A;  5C5K A;  3VV4 A;  2IA2 A;  4Z1W A;  3RFB A;  3EEA A;  4G3V A;  3NOU C;  1YSQ A;  2OOL A;  5HL6 A;  2O9C A;  2M7U A;  3KSG A;  2W3F A;  3OOV A;  4Y3I A;  2QYB A;  2ZMF A;  2M7V A;  3S7P A;  5HPF A;  3NOT C;  2HGV A;  3DBA A;  3KSI A;  4DMZ A;  4GLQ A;  4PAU A;  3CIT A;  3MF0 A;  1VHM A;  1MC0 A;  2KLI A;  2VEA A;  4O01 A;  2K2N A;  2G7U A;  1STZ A;  1F5M A;  4MCW A;  3KSF A;  2O99 A;  3ZQ5 A;  3E0Y A;  3S7N A;  4G3K A;  5HPI A;  1TD5 A;  2W3H A;  3R4K A;  5LBR A;  2K31 A;  4RQ9 A;  3IBR A;  4ETX A;  4IUK A;  4R70 A;  2Y79 A;  2O9A A;  3BJN A;  5HSQ A;  4Q0H A;  2VJW A;  3W2Z A;  3OBF A;  4GW9 A;  5DFY A;  4LRY C;  4O0P A;  4EUV A;  4G3W A;  3E98 A;  1TF1 A;  2VZW A;  2Y8H A;  4E04 A;  2VKS A;  5TJJ A;  3HCY A;  3KO6 A;  4CQH A;  4Q0J A;  4FOF A;  4Y2F A;  2XRO A;  4ZRR A;  3MMH A;  2LB5 A;  3O5Y A;  4EU0 A;  4MN7 A;  4MDZ A;  3NHQ A;  3KSH A;  3IBJ A;  2XSS A;  4IJG A;  5I5L A;  2GX5 A;  3K2N A;  5L8M A;  1ZTU A;  3D3O A;  1YSP A;  4IUH A;  2KOI A;  4QPR A; 
#chains in the Genus database with same CATH topology
 4HY8 A;  2LB9 A;  5E2G A;  2YKF A;  2DCF A;  1NLY A;  4CLC E;  3BEB A;  1H3Q A;  2Z6D A;  1OTI A;  3FPW A;  3PBN A;  4OVD A;  2ZC3 B;  3UB7 A;  4RYE A;  3VE3 A;  3DTE A;  3DTK A;  1K55 A;  1LLB A;  5MC7 A;  1VEU B;  3F1P A;  2OV5 A;  4IVK A;  1HTZ A;  4BQM A;  4LRX C;  5C5K A;  2ZQD A;  3DWK A;  3NCK A;  2OAP 1;  1GA0 A;  4Z9Q A;  1L0G A;  2J3W A;  4YFM A;  2OOL A;  4HEF A;  3C8C A;  2VGJ A;  1KDS A;  3CWF A;  1Y28 A;  5F82 A;  1T1A A;  5HDS A;  3MSH A;  4LLO B;  2QJ5 A;  5FQI A;  3B42 A;  1BLP A;  4MCW A;  1SCW A;  1U60 A;  2O99 A;  2ZLY A;  3W4O A;  2JE5 A;  3QP1 A;  5F1G A;  1EW0 A;  5KMW A;  4HP9 A;  4X69 A;  3FYZ A;  3IWO A;  3IH8 A;  2KDK A;  5DTS A;  4M3K A;  4K91 A;  4FH2 A;  2D01 A;  2NUT C;  3UDF A;  4KEN B;  4Q0H A;  1SDE A;  4HBU A;  3OPL A;  2V1A A;  4E3O A;  2VLG A;  3Q81 A;  4EUV A;  2Z6C A;  2XK1 A;  1G6O A;  3KO6 A;  3E2L A;  2VV8 A;  4X6T A;  4P6Z S;  2E8I A;  2J8Y A;  4HQA A;  3WS4 A;  1T18 A;  5A93 A;  3KYE A;  4Q8I A;  2XRO A;  1KVL A;  4EEP A;  3ICY A;  1L0E A;  2HPB A;  2QHK A;  3K2N A;  5FAS A;  1E3U D;  4QPR A;  3OLO A;  2VA0 A;  3FZC A;  4KQD A;  3SH9 A;  3SS4 A;  2Z2L B;  3WS0 A;  4IBX A;  4RX3 A;  3HLG A;  3N4I A;  4HJ6 A;  4JLF A;  1SZV A;  3T4Q A;  3T1Q B;  3P7N A;  2W3D A;  2EX8 A;  2W1T B;  3PBS A;  1CEG A;  3MBZ A;  3K3D A;  3UE0 A;  1FIL A;  1IKG A;  2PYP A;  2GNX A;  3IF5 A;  2L4R A;  3MR0 A;  4WMC D;  3JYI A;  3PTE A;  5HL6 A;  1E4D A;  1K57 A;  1MWR A;  1C3B A;  2W3F A;  2XFT A;  3PBO A;  5FAT A;  2ZM2 A;  5BOH A;  2KLI A;  2VGL S;  3MJQ A;  3HUN A;  5DJU A;  1W63 M;  2C5W B;  3MXR A;  3KSF A;  3E0Y A;  4Y0U A;  1DP9 A;  1KGG A;  2BAS A;  1NLZ A;  4NK3 A;  4EQ1 A;  3N8R A;  3HVF A;  2ZL1 B;  2O9A A;  3HLW A;  4XXR A;  2H10 A;  5F5Y A;  3AGD A;  2L0W A;  4JF6 A;  1TF1 A;  2XH9 A;  2ZM8 A;  1PNE A;  3HCY A;  3OPP A;  1LSX A;  1YT4 A;  2XA7 S;  4CLC A;  5M18 A;  3AGF A;  1ZG6 A;  4ZDX A;  3OCL A;  1E25 A;  4Y15 A;  5A91 A;  1BUE A;  3S22 A;  2K7S A;  2W27 A;  2ZM0 A;  4I39 A;  3D3O A;  4IUH A;  4E3L A;  4MBK A;  2PBY A;  2B5R A;  4UA7 A;  2O9B A;  1GCE A;  3BY8 A;  3D72 A;  1PRQ A;  4R3B A;  3H82 A;  4PM7 A;  2Y2Q A;  1CQA A;  1GHI A;  5AQ7 A;  4HHD A;  1P0Z A;  1M40 A;  2R9X A;  3A3I A;  4P0M A;  4JXS A;  4RA7 A;  2OSU A;  5EM0 A;  3IXG A;  1S67 L;  4Y5F A;  3BFC A;  5AVF A;  2X02 A;  2I9V A;  1VEU A;  4X25 A;  3IWI A;  4XUZ A;  3P98 A;  4BMW A;  4I3I A;  3WS2 A;  4DE2 A;  3RXX A;  5HDC A;  3BEC A;  2Y2M A;  1KE4 A;  4U0X A;  1OTA A;  3MXS A;  2JKT I;  3TW8 A;  1Y54 A;  3KSI A;  2V20 A;  4DDY A;  5FI7 A;  4M4X A;  2VEA A;  1YM1 A;  2K2N A;  4KZA A;  3VFH A;  5HPI A;  2Y4A A;  3HLC A;  3R4K A;  1L0D A;  5CER A;  4GN2 A;  1HZO A;  4GZB A;  4D2O A;  3MFX A;  3UPO A;  1S6R A;  3IQA A;  4R4S A;  4PM6 A;  4GW9 A;  5DFY A;  3T1S A;  4JBF A;  2VKS A;  3EWK A;  3MKF A;  2KX6 A;  1FQG A;  4B4X A;  4WZ5 C;  3TE8 A;  2V1B A;  2WKR A;  4F94 A;  4I3A A;  4LGW A;  5L07 A;  4OPY A;  2XSS A;  4ID4 A;  2XQZ A;  3IT9 A;  5L8M A;  2WKP A;  5HD5 A;  1YLP A;  5DFX A;  1GHM A;  2XRN A;  4NXB A;  4OLG A;  3EQV A;  1XJ3 A;  2DMW A;  2O0Y A;  2CMN A;  2WZZ A;  1H8Y A;  5FI2 A;  3TRC A;  3LY4 A;  2V2F F;  3SS5 A;  1L0F A;  3DWZ A;  4KQO A;  3VP4 A;  2W1T A;  5G18 A;  1CI9 A;  3NUL A;  4X56 A;  3JPU A;  1GA9 A;  2QMI A;  1SDN A;  3G2Z A;  2A3U A;  2FH5 A;  2P7J A;  4IBR A;  3VV4 A;  4RVA A;  2ZJ9 A;  3E4Q A;  4JKT A;  1SKF A;  3C7V A;  3F1N B;  1SKO B;  3VOL A;  3D9Y A;  5DF9 A;  1YSQ A;  3QHY A;  5EV0 A;  5CHU A;  4R38 A;  3IX3 A;  4IVI A;  5F6A A;  4JXV A;  2J9P A;  1PI5 A;  4L0L A;  3O3V A;  1XA7 A;  3LR5 A;  1STZ A;  1DJA A;  4UHU A;  1TS0 A;  1FR6 A;  4N1X A;  4Y17 A;  1W79 A;  3HL9 A;  4DE0 A;  4S2P A;  1MPL A;  2MJ6 A;  4R70 A;  3MQO A;  3MS6 A;  2ZL1 A;  2JKT M;  1J9M A;  4QY6 A;  1ERM A;  3UB8 A;  3OBF A;  3C30 A;  4JGR A;  5E2H A;  1ES2 A;  3SS3 A;  1L2S A;  3MKE A;  4QD4 A;  3SW1 A;  2ZOI A;  1XX2 A;  1LI9 A;  1BSG A;  4WLA A;  3ZG9 B;  3HUO A;  3TOI A;  2A2L A;  4KQQ A;  4D60 A;  4EQI A;  3IXB A;  1YQS A;  3H7W B;  3UNW A;  1MY8 A;  3V39 A;  1H0M A;  3S1Y A;  4KG2 A;  4GKU A;  1QME A;  2JBF A;  1XJ2 A;  1YLJ A;  4MBF A;  2L1M A;  1TDG A;  1MKM A;  1T19 A;  3NIA A;  3T4S A;  1DJB A;  1CJF A;  2YKH A;  1FSW A;  4NEE D;  2HP5 A;  5AVE A;  2IA2 A;  4I5S A;  3RFB A;  4N9K A;  4EET B;  1K0K A;  4WF0 A;  4U0T A;  4PMA A;  3IXH A;  1MC0 A;  4X1L A;  3PAG A;  3EOI A;  3E4P A;  3JVV A;  3MZE A;  4NG2 A;  1K4F A;  1OTD A;  4N92 A;  5A92 A;  5DVA A;  5IS1 A;  3M2K A;  3UME A;  5CHJ A;  3G30 A;  3ZGA B;  3DTM A;  1L3L A;  2ACG A;  1H5X A;  3KYZ A;  3MZD A;  1YMS A;  3ZG5 A;  1K56 D;  3E4O A;  4S2I A;  4LFU A;  1ZHH B;  4YIN A;  1ESU A;  3T4K A;  4KZ4 A;  3BQ8 A;  1T1B A;  3T4O A;  1TDL A;  2KOI A;  3ITA A;  5K5B A;  4EBL A;  1ES4 A;  3SH8 A;  5L2F A;  2EFX A;  3C2W A;  2B18 A;  4S2N A;  5J8X A;  4OKP A;  3VSL A;  4KQR A;  2PDR A;  3FPV A;  4Y0T A;  3VE4 A;  1FSY A;  1O7E A;  2HDS A;  3DAV A;  4K08 A;  5CXW A;  1NYY A;  2EXB A;  3H82 B;  5EE8 A;  1HD8 A;  3EEA A;  1Q2P A;  3I7J A;  4S2O A;  4UA6 A;  3PBQ A;  2Y59 A;  3BW6 A;  4LV2 A;  3F1N A;  1SKO A;  3FKV A;  3A3J A;  3ISG A;  3LR3 A;  1I5Q A;  1GSX A;  3VP1 A;  3BQA A;  3CPT B;  4KUO A;  4OQI A;  1RGZ A;  4LEN A;  2Y2L A;  3NC8 A;  4DXB A;  1MKI A;  3QP8 A;  4OQG A;  2XLN A;  2R9W A;  1QMF A;  2PBD P;  5L09 A;  4EWF A;  3HUM A;  4ETX A;  4IUK A;  5HWV A;  2QJ7 A;  5EVI C;  4HH3 A;  1S1Y A;  1LHY A;  1LSV A;  2PHY A;  1F98 A;  1K6R A;  4X55 A;  2ZQC A;  3GSG A;  2Y8H A;  4E04 A;  5TJJ A;  1IYP A;  3CUE C;  4FOF A;  2LB5 A;  5D3O A;  3NJA A;  3IBJ A;  4EBP A;  4HJ4 A;  3EEH A;  3P09 A;  3CHW P;  3CJM A;  3NBL A;  4KZ5 A;  1ERO A;  1G6A A;  1E3U A;  2HDR A;  2OWH A;  2X71 A;  3VFF A;  2Y2K A;  3H7W A;  3N6I A;  1WE4 A;  3TJZ C;  4PM5 A;  3ZFZ A;  3PR6 A;  3IF6 C;  2ZQ7 A;  3CI6 A;  5F83 A;  5L10 A;  3NDE A;  3WRT A;  4KZ9 A;  5JYO A;  4CPK A;  4B88 A;  5EVI D;  1S4S A;  3GQZ A;  3SZT A;  4GDN A;  4WMC A;  2M7U A;  1G5U A;  3S7P A;  3B47 A;  1F9I A;  1TVF A;  3GEC A;  3CIT A;  3LI9 A;  4OQH A;  1F5M A;  3B3X A;  1IYQ A;  1JTG A;  2WGV A;  2P04 A;  3IH9 A;  3A3F A;  5HAP A;  1XKZ A;  3HJI A;  3RJU A;  4OPQ A;  1S1Z A;  2OAQ 1;  2J9O A;  3G2Y A;  4KUK A;  3VP2 A;  2AVX A;  1CI8 A;  2W0N A;  4EU0 A;  3OPH A;  1Z09 A;  4MDZ A;  3V3R A;  3OCN A;  2XDM A;  3ZG7 B;  4B4Z A;  3QP4 A;  3UE6 A;  5EPH A;  4EXO A;  1T1C A;  4OOM A;  4EW7 A;  4MMN A;  4ZJ1 A;  2BG1 A;  4HJ3 A;  5HZH A;  4GD6 A;  3LIA A;  5KZH A;  1PIO A;  2WGW B;  5E2E A;  1TEM A;  1BTL A;  3LFV A;  3LR0 A;  4B93 A;  1KOU A;  4OQ0 A;  1JVJ A;  2PR6 A;  3LCE A;  2ZMV A;  1MBL A;  3UY6 A;  3TG9 A;  4DJ3 A;  3UB6 A;  3OZH A;  4AFI A;  1FIK A;  2UV0 E;  1P97 A;  1V9Y A;  4WZ4 A;  2P74 A;  2WZX A;  2P9V B;  5GLD A;  1FCN A;  2EX6 A;  4P6B A;  5F1F A;  3B33 A;  4JXW A;  2DRW A;  3Q7Z A;  1BZA A;  1N9B A;  4I38 A;  4DKI A;  4KZ6 A;  4E3J A;  1IEM A;  1VHM A;  3PXP A;  2GJ3 A;  3CPT A;  1NZO A;  3MZF A;  4MN6 A;  5DF8 A;  3V3S A;  4BBV A;  3ZG8 B;  1OT6 A;  3C4O A;  1K38 A;  3T4J A;  3FKW A;  1S4R A;  4LV1 A;  4II7 A;  3BJN A;  5HSQ A;  2VJW A;  5EEC A;  2B02 A;  4DXC A;  1WYC A;  1XFQ A;  5KIZ A;  4E6W A;  3NDG A;  4E3M A;  4EEU A;  3QP2 A;  1N9N A;  2XR0 A;  1OJ5 A;  4R4R A;  1VB6 A;  1MZU A;  4E3N A;  3PHY A;  1JTD A;  3H9W A;  1P9R A;  2VX8 A;  1LI0 A;  1CF0 A;  2NUP C;  3CG5 A;  3SOI A;  2J80 A;  3D4F A;  3ZDJ A;  4UQI M;  4CJN A;  1IOU A;  4KZ8 A;  2H0T A;  2HV1 A;  4BWI A;  4GNU A;  2PU4 A;  1FCM A;  2WUQ A;  1PYY A;  1DRM A;  3EGD C;  1NY0 A;  2JC7 A;  4QB8 A;  4LRZ E;  2PAV P;  5GL9 A;  4ARZ B;  4KZ7 A;  1MWT A;  4BJP A;  3ZCZ A;  3A0S A;  4F3L B;  4Z1W A;  4EER A;  1K54 C;  4G3V A;  5GHX A;  2ZC7 A;  1RP5 A;  3KYQ A;  1LSW A;  3KSG A;  3UN7 A;  2V8F A;  1OTB A;  2I72 A;  2QYB A;  3BFF A;  2D02 A;  4PHT A;  3N8S A;  4HOI A;  2Y2J A;  5A90 A;  5CGX A;  2G7U A;  4WZ5 A;  3T1R A;  2VGK A;  2VK3 A;  2JCH A;  3HJK A;  1XGJ A;  5AQA A;  3LYX A;  3T4L A;  2EWV A;  4YWZ A;  1NYM A;  5DF7 A;  3G35 A;  5J3W A;  1OME A;  4H6J B;  1BUL A;  1S66 L;  4MN5 A;  5AQ9 A;  2IWB A;  1MWU A;  4BL2 A;  2WKI A;  4K0W A;  2PD7 A;  4DJ2 A;  3IHB A;  1ZKJ A;  3O87 A;  2JKF A;  4MN7 A;  2EFU A;  4HI4 A;  5EVE A;  3KSH A;  1HVB A;  2GX5 A;  4HIA A;  1BLC A;  2P08 A;  3W4P A;  5A8B A;  2GDN A;  4E6X A;  1IKI A;  3E2K A;  2WAF A;  1AXB A;  5GHY A;  3OC2 A;  3NI9 A;  4MEZ A;  3O88 A;  3AGE A;  4UEY A;  2Y91 A;  1XXM A;  4LCM A;  4KZB A;  2RL3 A;  2W3G A;  2WGW A;  4C6Y A;  1JWP A;  2FFY A;  4JF5 A;  3UO9 A;  4NXG A;  2HDU A;  2JN7 A;  4WEL A;  5EVL A;  5EVI B;  2JKR M;  1KE3 A;  4NET A;  2J7V A;  1GSW A;  2P9V A;  3OOV A;  5HW3 A;  1BLS A;  3T1X A;  1Q2Q A;  3NOT C;  3BWL A;  3QNB A;  1K4E A;  3KX0 X;  4Y13 A;  3LGO A;  4R3J A;  4XT2 B;  1KGF A;  2W3H A;  2INW A;  5LBR A;  2ZMA A;  3C7U A;  1XP4 A;  4OPR A;  2RCX A;  4QHC A;  4EV4 A;  2Y2G A;  5E43 A;  2EX9 A;  2M1C A;  5TBM B;  1BYW A;  4G3W A;  2HJ9 C;  4WUJ A;  2VZW A;  3ZG0 A;  3ZVW A;  5GLB A;  5FSR A;  1UGU A;  2EX2 A;  5J7E A;  4IED A;  1K56 A;  2HF6 A;  4DE3 A;  3O5Y A;  3IF6 B;  4JGP A;  5FI6 A;  1I2W A;  3LEZ A;  3IX4 A;  1ES5 A;  4S2J A;  5I5L A;  4FUW A;  1DJC A;  4JPM A;  1V9Z A;  5FAP A;  2ZC6 B;  3CLO A;  2Y2N A;  3GVB A;  4LPZ A;  4YNR A;  2Y55 A;  3V67 A;  1S0W A;  1FOF A;  3ULF A;  4ZAM A;  1ZC2 A;  3RTY A;  2W1R A;  3F1O B;  5FA7 A;  4S2N C;  1OTE A;  4ETZ A;  3VOZ A;  4DF6 A;  4R6L A;  1F2K A;  5DKK A;  4R23 A;  4ARZ A;  5CTM A;  4Q0I A;  4HP4 A;  1IEL A;  3WS5 A;  3S7O A;  4IHQ A;  2W3E A;  2WAE A;  4JGQ A;  4F3L A;  2B95 A;  2O9C A;  1PWC A;  5HD3 A;  4GD8 A;  1CEF A;  5DTT A;  4MNR A;  3A0R A;  5FEF A;  4DRT A;  1VM1 A;  4GLQ A;  2G2U A;  1FCO A;  1K55 C;  3L9K A;  4S2M A;  3VP3 A;  5F68 A;  4L9G A;  2ZD8 A;  1PWD A;  1LL8 A;  4WL9 A;  5TGF A;  4O01 A;  4GS9 B;  3V50 A;  1TD5 A;  4WEJ A;  2ZQ8 A;  4OP5 A;  1IYO A;  1XA1 A;  1NJ4 A;  2VV6 A;  3O86 A;  4H6J A;  3SH7 A;  4LV0 A;  3BLM A;  3RH8 B;  1JWV A;  1RCJ A;  4U3T A;  5GHZ A;  1ES3 A;  4BBU A;  1JWZ A;  3UE1 A;  1G68 A;  2XEP A;  5CGW A;  2ZOH A;  3BFD A;  4WM9 A;  3T4T A;  1M6K A;  2QPN A;  3LO7 A;  2V9A A;  3N7W A;  1WA9 A;  1ZTU A;  1ERQ A;  2FZ0 A;  2EA9 A;  5HX9 A;  4FH4 A;  3FC7 A;  1ESI A;  4OLD A;  4ESP A;  1PW8 A;  2GZA A;  2A24 B;  3BFG A;  2PT7 A;  4FTX A;  3A3E A;  1ZG4 A;  4UA9 A;  4RX2 A;  4R1G A;  3W4Q A;  3A0V A;  1OPX A;  2WKQ A;  3S7Q A;  4OP8 A;  1N9L A;  4NXE A;  1YLZ A;  3IX8 A;  3Q82 A;  1W7F A;  5EFW A;  1Z6F A;  3UE3 A;  3NOU C;  4PKY G;  1PZO A;  2DNS A;  5EVI A;  5KSC A;  1BT5 A;  3QNC A;  3FV7 A;  3P01 A;  1P9W A;  4P85 A;  3MXQ A;  4HBT A;  5CHM A;  4DMZ A;  3DW0 A;  2Q9N A;  2Q9M A;  1K25 A;  3CUE A;  4XT2 A;  5CED A;  4HES A;  3T50 A;  3ZVT A;  1LT0 A;  3S7N A;  4G3K A;  3UMD A;  1W8Y A;  1VQQ A;  3MFD A;  4BLM A;  5CGS A;  3NY4 A;  1K57 C;  4ZBE A;  3EQU A;  4O0P A;  4P87 A;  3UDI A;  4OH0 A;  1NRJ A;  3N8L A;  5TBM A;  3A3D A;  4P6Z M;  1N9O A;  4Q0J A;  5E2F A;  4KZ3 A;  5FAQ A;  4E3I A;  4N9L A;  2V1Z A;  5CTN A;  3MMH A;  4BBT A;  4GHI B;  3IF6 A;  2HP9 A;  2QKP A;  2HZ5 A;  5G4Y A;  3V5M A;  1UWP X;  4CLC C;  3M6H A;  2J3T C;  2ZC4 B;  1NWZ A;  4WBG A;  3F1O A;  4OOL A;  5FQK A;  1HLU P;  5TFQ A;  1VET B;  2UWX A;  4DN0 A;  1NZU A;  2H0Y A;  1K6S A;  1LL5 A;  4EBN A;  2H28 A;  2R78 A;  1G28 A;  4FCF A;  2V0U A;  3LI8 A;  4EES A;  4E3K A;  4WEK A;  4C75 A;  4OPZ A;  5M1A A;  4H8R A;  4GB7 A;  3HLE A;  4S2L A;  1X0O A;  3CMZ A;  1MXO A;  2OLV A;  2ZQ9 A;  3Q1F A;  5HPF A;  1ALQ A;  3DBA A;  3PAE A;  3IHA A;  3HBR A;  2PU2 A;  2VGL M;  5FQQ A;  1W63 Q;  3BYD A;  2V8C A;  3WRZ A;  3C5A A;  5FQ9 A;  4L9E A;  5HWW A;  5HFO A;  4GOG A;  3ZNY A;  1ACF A;  4GS9 A;  4RQ9 A;  3IBR A;  3QP6 A;  3LY3 A;  2V0W A;  1YLT A;  2Y79 A;  4EUZ A;  1PW1 A;  5U47 A;  1H8Z A;  3W2Z A;  1H8M A;  3JVU A;  1XFN A;  1XGI A;  3GMW A;  4OOY A;  2CC1 A;  2WKH A;  4CLC D;  2XA7 M;  2J3T D;  5I94 A;  2A49 A;  1XJ4 A;  2FFF B;  4ZRR A;  5EUA A;  3IS2 B;  2QWS A;  2WK0 A;  4QU3 A;  4UQI S;  5IHV A;  1NRF A;  3FG8 A;  5FEG A;  5IT5 A;  3R7W B;  2Y2I A;  1WYB A;  2HP6 A;  3GDI A;  3W8K A;  1PFL A;  5CRF A;  3NOP C;  4YOF A;  3MQ0 A;  1N4O A;  1TS6 A;  4FSF A;  1YKD A;  1DP8 A;  2A24 A;  1OJG A;  4N1H A;  4ME4 A;  3GR2 A;  4JXG A;  2BLS A;  5EOO A;  1LL9 A;  1YLW A;  3LIE A;  3VMA A;  1IYS A;  5AJG A;  4PM8 A;  5IU1 A;  4NKP A;  4PM9 A;  5G4Z A;  4PKY A;  1CK3 A;  3BRM A;  4X53 A;  2JKR I;  4Y3I A;  3G34 A;  5HL1 A;  2HGV A;  3PBR A;  2PYR A;  3MF0 A;  4BD0 A;  5KSH A;  2H5S A;  3CAX A;  4L9F A;  4QWO A;  4GDB A;  2ZBB A;  2OLU A;  4HNB A;  3BFE A;  2JHE A;  3UB9 A;  2K31 A;  4Y7P A;  3ZYT A;  2EXA A;  3Q7V B;  5FDS A;  3UB5 P;  2IWD A;  1SHV A;  4C3Q A;  1YAX A;  4LRY C;  2Y2H A;  4DDS A;  4XUX A;  1YPR A;  3GV9 A;  1D7E A;  1TS7 A;  4DE1 A;  4MLL A;  4BL3 A;  2XD5 A;  5HWT A;  3VP0 A;  4IJG A;  3LIB A;  3UPP A;  1PWG A;  3RXW A;  4GHI A;  5JYP A;  5EM1 A;  2C6W B;  3ZNT A;  2EWW A;  3M2J A;  3LID A;  1K54 A;  4QJG A;  5DKL A;  3C4P A;  1NXY A;  4BEN A;  1I2S A;  4R3A A;  4OON A;  2IWC A;  5HAI A;  2XD1 A;  1MWS A;  2Q0O A;  3G6O A;  3F1P B;  2WYX A;  3LEQ A;  4UAA A;  1VET A;  5GLC A;  4MBH A;  1ODV A;  2JKG A;  4B9O A;  3S4X A;  1D1J A;  3BLS A;  3C38 A;  5CEC A;  3LUQ A;  2WGI A;  3CZD A;  5FQJ A;  1W5D A;  2PR5 A;  4GCZ A;  1TS8 A;  2XFS A;  3G31 A;  3BY9 A;  3T12 B;  1ONH A;  3PBT A;  1IFQ A;  5CX7 A;  1YLY A;  4KG5 A;  3M6B A;  1DP6 A;  5CEB A;  2WKE A;  4HH2 A;  3MQQ A;  1GSV A;  2WAD A;  3PYP A;  1J3W A;  4LCL A;  3G4P A;  4S2K A;  4GJ4 A;  1GHP A;  4JGO A;  1YMX A;  1PI4 A;  3DTI A;  5FDH A;  3HLD A;  4X1M A;  1KVM A;  1OT9 A;  1O07 A;  5DJT A;  3IS2 A;  4BD1 A;  4ZTK A;  2XF3 A;  4PPR A;  4LV3 A;  1YSP A;  3VSK A;  3R7W A;  3K3C A;  4KG6 A;  4O8G A;  5FAO A;  4NXF A;  2VV7 A;  4X68 A;  4WN5 A;  3BM6 A;  5HAR A;  1UWN X;  2HDQ A;  3Q07 A;  3ZHH A;  3UPN A;  1D06 A;  5AQB A;  1RGY A;  3WS1 A;  2ZQA A;  1PZP A;  4JF4 A;  1EI5 A;  1EWZ A;  5GLA A;  4Y0O A;  2QZ6 A;  3HLF A;  4ZJ3 A;  3IXD A;  3VOY A;  3ITB A;  2E8J A;  2BTF P;  3QP5 A;  5DTK A;  4WYY A;  3HLB A;  2X01 A;  4R0Q A;  1KGE A;  2ZMF A;  3U4L P;  2M7V A;  4I3J A;  1FR1 A;  2Z2M B;  2PRF A;  5M19 A;  1BLH A;  4PAU A;  4O7D A;  4FD8 A;  3ZQ5 A;  3GTC A;  2PD8 A;  3TSG A;  5HAQ A;  3U2A A;  3OPR A;  3LIC A;  4QY5 A;  3FWL A;  1JNU A;  3HRE A;  5J4E A;  2G2W A;  1XPB A;  3GRJ A;  4A5R A;  5FL3 A;  1DY6 A;  1KDW A;  2HJE A;  3NEC A;  2Y2P A;  3G32 A;  2ZC5 B;  2XGN A;  4ZJ2 A;  3LR4 A;  3Q7V A;  1A0K A;  5HDD A;  4CLC B;  3E98 A;  3IWQ A;  1AWI A;  5FQM A;  4CQH A;  4Y2F A;  1ONG A;  1Y4O A;  1XJ6 A;  2Y2O A;  3L7H A;  5EOE A;  3WWX A;  3NHQ A;  3UDX A;  3EGX C;  3LIF A;  1W8Q A;  4K0X A;  2OWJ A;  5TR7 A;  5F69 A;  1KE0 A; 
#chains in the Genus database with same CATH homology
 4HY8 A;  2HV1 A;  2LB9 A;  4BWI A;  3H7W B;  5G4Y A;  1UWP X;  2YKF A;  1NLY A;  4CLC E;  1H3Q A;  4CLC C;  1DRM A;  2J3T C;  3EGD C;  2Z6D A;  1OTI A;  3FPW A;  3PBN A;  1XJ2 A;  4LRZ E;  3UB7 A;  1NWZ A;  3VE3 A;  2L1M A;  3F1O A;  4OOL A;  1MKM A;  4ARZ B;  5MC7 A;  3F1P A;  4DN0 A;  1T19 A;  3T4S A;  2YKH A;  4LRX C;  4NEE D;  2H28 A;  2R78 A;  5AVE A;  5C5K A;  4BJP A;  2IA2 A;  1G28 A;  3A0S A;  2V0U A;  3LI8 A;  4I5S A;  2OAP 1;  4EES A;  4F3L B;  4Z1W A;  3RFB A;  4EER A;  4G3V A;  4WEK A;  4EET B;  4WF0 A;  2J3W A;  2OOL A;  3KYQ A;  1LSW A;  3C8C A;  3KSG A;  1X0O A;  1OTB A;  2QYB A;  3CWF A;  5HPF A;  1Y28 A;  3DBA A;  2D02 A;  1T1A A;  4PHT A;  5HDS A;  4HOI A;  4LLO B;  1MC0 A;  2QJ5 A;  2VGL M;  1W63 Q;  3B42 A;  3EOI A;  2G7U A;  3E4P A;  3JVV A;  4L9E A;  4MCW A;  2O99 A;  5HWW A;  3HJK A;  1EW0 A;  1OTD A;  5IS1 A;  3LYX A;  4HP9 A;  3T4L A;  4GS9 A;  2EWV A;  2KDK A;  4RQ9 A;  4YWZ A;  3IBR A;  2V0W A;  3UME A;  2Y79 A;  5J3W A;  2D01 A;  2NUT C;  4Q0H A;  4H6J B;  3W2Z A;  1H8M A;  1S66 L;  4MN5 A;  3JVU A;  3KYZ A;  1XFN A;  2V1A A;  2VLG A;  4EUV A;  2Z6C A;  1G6O A;  3KO6 A;  4CLC D;  2VV8 A;  2XA7 M;  2J3T D;  4P6Z S;  2PD7 A;  4HQA A;  3E4O A;  4DJ2 A;  1XJ4 A;  1T18 A;  2XRO A;  4ZRR A;  4MN7 A;  3IS2 B;  1ZHH B;  4HI4 A;  2QWS A;  4EEP A;  3KSH A;  3ICY A;  2GX5 A;  4HIA A;  4UQI S;  3T4K A;  2QHK A;  3FG8 A;  3K2N A;  5IT5 A;  2P08 A;  3R7W B;  5A8B A;  3BQ8 A;  3GDI A;  1T1B A;  3T4O A;  2KOI A;  4QPR A;  3NOP C;  2VA0 A;  3OLO A;  4KQD A;  4YOF A;  5K5B A;  3MQ0 A;  1TS6 A;  3OC2 A;  4FSF A;  1YKD A;  4HJ6 A;  1DP8 A;  2A24 A;  3T4Q A;  1OJG A;  3P7N A;  4UEY A;  3C2W A;  2B18 A;  2W3D A;  4ME4 A;  2W1T B;  3PBS A;  2W3G A;  3LIE A;  4NXG A;  2PDR A;  5AJG A;  3FPV A;  3K3D A;  3VE4 A;  5IU1 A;  4K08 A;  2JN7 A;  2PYP A;  4NKP A;  4WEL A;  5G4Z A;  3H82 B;  4PKY A;  2JKR M;  2GNX A;  3EEA A;  2L4R A;  3MR0 A;  1GSW A;  2JKR I;  5HL6 A;  3PBQ A;  3BW6 A;  3F1N A;  2W3F A;  3OOV A;  4Y3I A;  3LR3 A;  1GSX A;  3NOT C;  2HGV A;  3BWL A;  3BQA A;  3PBO A;  3KX0 X;  3PBR A;  4KUO A;  4XT2 B;  2PYR A;  3MF0 A;  2KLI A;  2VGL S;  5KSH A;  3MJQ A;  3CAX A;  5DJU A;  1W63 M;  4L9F A;  3KSF A;  3E0Y A;  2ZBB A;  1DP9 A;  2BAS A;  1NLZ A;  4HNB A;  4EQ1 A;  2W3H A;  2INW A;  2JHE A;  5LBR A;  2K31 A;  3UB9 A;  4ETX A;  4IUK A;  5HWV A;  2QJ7 A;  2O9A A;  4HH3 A;  1S1Y A;  3ZYT A;  1LSV A;  2PHY A;  5F5Y A;  1F98 A;  2L0W A;  2M1C A;  5TBM B;  1YAX A;  4LRY C;  1BYW A;  4G3W A;  2HJ9 C;  4WUJ A;  1TF1 A;  2VZW A;  2Y8H A;  4E04 A;  5TJJ A;  3HCY A;  1LSX A;  2XA7 S;  4CLC A;  1UGU A;  1D7E A;  3CUE C;  1TS7 A;  4FOF A;  5J7E A;  2HF6 A;  3OCL A;  2LB5 A;  3O5Y A;  4JGP A;  3NJA A;  5HWT A;  3IBJ A;  4IJG A;  5I5L A;  3LIB A;  4HJ4 A;  2K7S A;  3EEH A;  1V9Z A;  2W27 A;  4GHI A;  4I39 A;  3D3O A;  3CLO A;  4LPZ A;  4IUH A;  2EWW A;  3LID A;  2OWH A;  4YNR A;  2O9B A;  3V67 A;  5DKL A;  3BY8 A;  3D72 A;  3H7W A;  3H82 A;  3ULF A;  3RTY A;  4R3A A;  3TJZ C;  2W1R A;  3F1O B;  1OTE A;  4HHD A;  3G6O A;  3F1P B;  1P0Z A;  3PR6 A;  4ETZ A;  3CI6 A;  4R6L A;  5DKK A;  4Y5F A;  1S67 L;  4ARZ A;  4Q0I A;  5AVF A;  2I9V A;  4HP4 A;  3S7O A;  4IHQ A;  2W3E A;  1ODV A;  4JGQ A;  4B9O A;  1S4S A;  4BMW A;  3C38 A;  3LUQ A;  4F3L A;  4I3I A;  2O9C A;  2PR5 A;  5HD3 A;  2M7U A;  4GCZ A;  5HDC A;  1TS8 A;  3S7P A;  1OTA A;  3A0R A;  2JKT I;  3B47 A;  1F9I A;  3KSI A;  3TW8 A;  3BY9 A;  4GLQ A;  3GEC A;  3CIT A;  3PBT A;  5F68 A;  1IFQ A;  4L9G A;  5CX7 A;  4M4X A;  1LL8 A;  2VEA A;  4WL9 A;  4O01 A;  2K2N A;  3LI9 A;  1F5M A;  1DP6 A;  4GS9 B;  5HPI A;  1TD5 A;  4HH2 A;  3R4K A;  3MQQ A;  4WEJ A;  1GSV A;  2P04 A;  3HJI A;  3PYP A;  3MFX A;  2VV6 A;  1S1Z A;  2OAQ 1;  4GJ4 A;  4GW9 A;  5DFY A;  4H6J A;  4JGO A;  3RH8 B;  2VKS A;  3EWK A;  4KUK A;  2KX6 A;  2W0N A;  4BBU A;  3TE8 A;  2V1B A;  2WKR A;  4I3A A;  4EU0 A;  2ZOH A;  1OT9 A;  4MDZ A;  3OCN A;  2XSS A;  5DJT A;  3T4T A;  3IS2 A;  2V9A A;  5L8M A;  3UE6 A;  2WKP A;  1WA9 A;  1ZTU A;  5HD5 A;  2FZ0 A;  2EA9 A;  1YSP A;  3R7W A;  3K3C A;  4O8G A;  5DFX A;  4EXO A;  2XRN A;  1T1C A;  3FC7 A;  4NXB A;  4MMN A;  4OOM A;  4EW7 A;  3EQV A;  1XJ3 A;  2DMW A;  4HJ3 A;  2GZA A;  2A24 B;  2O0Y A;  4NXF A;  5HZH A;  2CMN A;  2VV7 A;  4WN5 A;  2PT7 A;  1UWN X;  3TRC A;  3LIA A;  1D06 A;  3LFV A;  3A0V A;  3LR0 A;  4KQO A;  4B93 A;  1KOU A;  1OPX A;  2W1T A;  2PR6 A;  2WKQ A;  3S7Q A;  2ZMV A;  1N9L A;  4NXE A;  4DJ3 A;  3UB6 A;  4AFI A;  2FH5 A;  2P7J A;  3VV4 A;  1P97 A;  1V9Y A;  3E4Q A;  5EFW A;  3UE3 A;  3NOU C;  3F1N B;  4PKY G;  3VOL A;  5DF9 A;  1YSQ A;  3B33 A;  4R38 A;  2ZMF A;  2M7V A;  4I3J A;  3P01 A;  1P9W A;  5F6A A;  3MXQ A;  4I38 A;  4DMZ A;  4PAU A;  1VHM A;  3PXP A;  4L0L A;  2GJ3 A;  3CUE A;  4XT2 A;  3LR5 A;  4MN6 A;  1STZ A;  3T50 A;  3ZQ5 A;  1TS0 A;  2PD8 A;  4BBV A;  1LT0 A;  1OT6 A;  3S7N A;  4G3K A;  3UMD A;  3T4J A;  3U2A A;  1S4R A;  3LIC A;  1JNU A;  2MJ6 A;  4R70 A;  5J4E A;  3MQO A;  4II7 A;  3BJN A;  2JKT M;  5HSQ A;  5FL3 A;  2VJW A;  2B02 A;  1XFQ A;  5KIZ A;  2HJE A;  3UB8 A;  3OBF A;  4EEU A;  3C30 A;  3EQU A;  4JGR A;  1N9N A;  4O0P A;  1OJ5 A;  3LR4 A;  1VB6 A;  5HDD A;  1MZU A;  4CLC B;  3E98 A;  1NRJ A;  5TBM A;  3PHY A;  3SW1 A;  4P6Z M;  1N9O A;  2ZOI A;  4CQH A;  3H9W A;  4Q0J A;  1P9R A;  4Y2F A;  2VX8 A;  1XJ6 A;  3MMH A;  4BBT A;  2NUP C;  3NHQ A;  4WLA A;  2J80 A;  4GHI B;  3EGX C;  3LIF A;  4UQI M;  2OWJ A;  1IOU A;  2A2L A;  2QKP A;  5F69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...