3VV4A

Crystal structure of cyanobacteriochrome tepixj gaf domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
LSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQCSEPRQWQEIEIDQFSELASTGSLVLERLHFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
total genus 48
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3vv4A00
2VZWA 4IJGA 4O01A 3NHQA 2M7VA 3IBRA 2O99A 1ZTUA 3LFVA 3KSHA 4RQ9A 4ME4A 3KSFA 3OOVA 3S7OA 2W3DA 5DFYA 2W3GA 3CI6A 3O5YA 4LRXC 4YNRA 5AJGA 2IA2A 3S7QA 5DFXA 2XSSA 4GLQA 4O0PA 2KOIA 3E0YA 2XROA 3IBJA 2G7UA 5C5KA 3RFBA 5TJJA 2HGVA 3EEAA 4MMNA 4QPRA 2ZMFA 4E04A 2XRNA 4Y2FA 2QYBA 5L8MA 3BJNA 3S7PA 5HSQA 4LRYC 2W1TB 4MCWA 3ZQ5A 4DMZA 4ETZA 1STZA 3C2WA 3CITA 2W3FA 4IUHA 3KO6A 3MMHA 4R70A 2B18A 2O0YA 1MKMA 4Y5FA 4ZRRA 3VV4A 4MDZA 4EUVA 2M7UA 3DBAA 2W3HA 2O9BA 2GX5A 3G6OA 5I5LA 4ETXA 4Q0IA 2W1TA 3HCYA 3OBFA 1YSPA 4CQHA 4EU0A 1MC0A 1YSQA 3NOTC 4DN0A 1F5MA 2OOLA 4Q0HA 2O9AA 4PAUA 5HPIA 3MQ0A 1VHMA 2KLIA 4MN7A 1TD5A 3NOPC 5HL6A 2LB5A 4GW9A 4R6LA 5LBRA 3TRCA 5HPFA 3NOUC 4G3VA 4IUKA 2LB9A 3KSIA 4Y3IA 2O9CA 2W3EA 3E98A 3K2NA 4FOFA 3W2ZA 2K2NA 3D3OA 2K31A 4Q0JA 1YKDA 3R4KA 4G3KA 5K5BA 2VKSA 2Y79A 3MF0A 2VEAA 3KSGA 4LRZE 3S7NA 4O8GA 2W1RA 2VJWA 1TF1A 2Y8HA 4YOFA 4G3WA 4Z1WA 4BWIA
chains in the Genus database with same CATH superfamily
3BLMA 5HAPA 4QJGA 1CEFA 4KZ4A 4R3AA 3MXSA 4R1GA 3S22A 4X6TA 3BFDA 2IA2A 3PXPA 1GSVA 2ZM2A 1MWRA 1V9ZA 1DP6A 3ZVWA 5M1AA 4QY5A 4O0PA 4LCMA 4OKPA 3N8RA 5KZHA 1K4EA 1YLPA 2JE5A 4KZ9A 1DP9A 4WBGA 4Y2FA 2EFUA 5FEFA 3BJNA 4KENB 3C5AA 1K55C 1BULA 5G18A 1I5QA 1SKOB 3MMHA 1XX2A 4R3BA 3P7NA 4FH2A 1BTLA 1NY0A 4X1MA 2V0WA 1N9OA 4S2LA 4PM9A 3A3IA 2VV7A 2Y2GA 1LSVA 4BL3A 3IWIA 3Q7VB 3PBOA 4BENA 4N9LA 3IF6C 2I9VA 4Q0HA 3NECA 2QWSA 1PFLA 2V2FF 1JNUA 1J3WA 1A0KA 4A5RA 1G6OA 5EVIA 2RL3A 4GW9A 5LBRA 3OLOA 3LICA 4Y3IA 1DRMA 1I2WA 2WGWA 3Q82A 1S66L 4ARZA 3R4KA 2Y59A 3IXDA 1CEGA 3V67A 1OPXA 3QP4A 3CUEC 2XD1A 1OT9A 2WAFA 3SOIA 5IU1A 4O01A 4BJPA 1QMFA 5EOOA 4LGWA 3GRJA 4ARZB 3S7OA 3LIFA 5EVIB 5FQIA 1JVJA 4OOLA 4PMAA 4EUZA 4LRXC 3E4QA 1PZOA 4N92A 2XSSA 3DTMA 4WF0A 1FCOA 4CPKA 3LGOA 1YMSA 2WZXA 2VLGA 3B33A 1CQAA 3BQAA 4MMNA 4KQOA 4NXEA 4D60A 1ONGA 1MPLA 4WEKA 1JTDA 4EBPA 4DXCA 1FCNA 1PW1A 3GTCA 4GHIB 4WZ5A 3C4OA 3KYQA 4K0XA 4XUXA 2O9BA 1CF0A 1TEMA 2ZC5B 3V3SA 5KMWA 2PR5A 2W1TA 3UMDA 1OTIA 3VP0A 2Y2NA 4OQIA 4FH4A 1KE3A 1DP8A 2HF6A 3W8KA 3B47A 1K25A 1TD5A 3IX3A 4UHUA 3A3FA 1YLYA 4Y0TA 4OPZA 5CTNA 1LHYA 1MWSA 2I72A 3CMZA 3BEBA 4GCZA 4LRZE 3S7NA 5HAQA 3OPPA 3OPHA 4R38A 1OTEA 3ZFZA 4GHIA 3A3DA 5F1FA 3GECA 1TS8A 5L10A 3IBRA 2O99A 3OC2A 4R0QA 5F82A 5HL1A 1NYYA 3HBRA 3G34A 4MNRA 4KZ8A 4UAAA 1VETA 2VK3A 5EE8A 2PDRA 3QNCA 2EX8A 4Y17A 5DFXA 2EX6A 4IHQA 2G7UA 2HP6A 3K3CA 1BLHA 1C3BA 3RXWA 1UGUA 2P74A 1HLUP 2EXAA 4LRYC 4DE0A 3QHYA 1T18A 1Q2QA 5FQMA 2WUQA 3AGEA 1P0ZA 1IELA 2B18A 2V1AA 4RVAA 3Q1FA 1YLWA 3VV4A 3IWQA 3HLCA 4N9KA 3T1QB 1P97A 3GR2A 4JGRA 2HZ5A 4EW7A 5DF8A 1L0FA 1YSPA 1ESUA 2QHKA 4KZAA 4JXWA 1I2SA 3F1NA 3JYIA 5HWTA 5EV0A 3NOTC 5AVFA 1F5MA 1H8YA 2PYPA 4Y0OA 3LCEA 4KQDA 1L0EA 1T1CA 5HPIA 1VHMA 2LB5A 5HPFA 3NOUC 4G3VA 3BFGA 4B9OA 4GN2A 3UE0A 3UDXA 3UY6A 3MZEA 4XT2B 4BBVA 1H3QA 4UA9A 3HUNA 4U0TA 4PKYG 2W1RA 4OPYA 1F98A 3NY4A 4BMWA 1SKOA 3IX4A 3LR5A 1ES4A 3A0SA 3BLSA 1Z09A 2C6WB 5CHMA 3CHWP 3PBRA 3T1RA 1NLZA 2X71A 4E3JA 4R23A 3VFHA 1HZOA 2ZOIA 5FATA 1EI5A 3MR0A 5A91A 2WADA 4GD6A 2XRNA 4C3QA 3QP5A 2ZM0A 4EQIA 3UPOA 5M19A 3FC7A 1YM1A 3VMAA 4DE2A 3NBLA 4JKTA 3SS4A 3Q07A 2ZQAA 2Z6CA 1XGIA 1XP4A 3G6OA 4ETXA 2WKQA 1IKGA 4PHTA 2P9VB 1YSQA 4HJ4A 1PYYA 1K57C 1ACFA 3T4LA 2RCXA 4QHCA 3G2ZA 5HX9A 3PBSA 5IT5A 1XXMA 4HP9A 3P01A 5FAQA 4M4XA 2FH5A 4PPRA 4ZAMA 1FOFA 4S2NC 3W2ZA 3C8CA 3EEHA 4HH3A 4OQGA 2V8FA 5F6AA 5K5BA 4GKUA 3JPUA 2GNXA 3MF0A 3LO7A 1WA9A 3DW0A 1ES3A 5IS1A 2EXBA 1S0WA 2Y8HA 4GDBA 3CPTB 1S6RA 2WZZA 3EQVA 3CAXA 3DWKA 1IOUA 2WGVA 2XDMA 4LLOB 2HDQA 1GHIA 4X69A 2W3DA 3G2YA 3IF5A 3DAVA 5HDDA 3N7WA 3MS6A 3PAEA 4WN5A 2XROA 5CERA 3N8LA 3W4PA 3QP8A 4WL9A 5CRFA 3M6HA 5CXWA 3FYZA 2K7SA 4QU3A 4E04A 3VSLA 3ZVTA 2Y2IA 4MBKA 1S67L 3Q7VA 4ETZA 5U47A 4B88A 3P98A 4JXSA 1LT0A 5DJTA 3C2WA 1W63M 5HWWA 3UB7A 1FR1A 2HP9A 2JCHA 3HUMA 1BLCA 2NUTC 3H82A 4PM5A 3T4SA 3DBAA 5GHXA 3M2JA 5JYOA 2XF3A 2OWHA 1ZG6A 5DJUA 5CGXA 5TBMB 1PIOA 4LV2A 1SZVA 3MBZA 3H7WB 3Q7ZA 1XKZA 2PR6A 2WKIA 2O9AA 1VB6A 3ITAA 1YMXA 1K56A 1VEUB 2HJ9C 4P85A 3MXRA 4ESPA 5E43A 2P9VA 5FAPA 5G4YA 1FSYA 3T12B 3ZCZA 3DTEA 3VFFA 1Q2PA 4DE3A 5DF7A 2UV0E 3BRMA 3KSIA 2W3EA 2ZJ9A 5EPHA 4RA7A 4NKPA 1E3UD 4HJ3A 3HLFA 4CLCA 2Y2PA 2OSUA 2WYXA 2L4RA 4O8GA 2XK1A 3PBTA 1MBLA 4Z1WA 3QNBA 4S2KA 5CHUA 4GB7A 2WAEA 1BUEA 5FDSA 3DTKA 3UE1A 5EVIC 2DNSA 2V1ZA 3LFVA 3LR3A 3UB9A 1KVLA 4HHDA 2DRWA 3OPRA 2WGIA 2H5SA 4MN6A 1U60A 3HJIA 3OPLA 2HV1A 1VEUA 1S1YA 1W63Q 4OOMA 1KDWA 4MN5A 2PYRA 2Y2KA 3UB5P 1LL8A 3KX0X 4E3KA 4OQHA 2ZQDA 4JGPA 1H0MA 1EWZA 4UA6A 1V9YA 3MKFA 3IXHA 5EVLA 2ZL1A 2H0YA 4L0LA 2W3FA 4BBUA 3KO6A 5FI6A 2ZC7A 2A2LA 2HJEA 1RP5A 1EW0A 1XJ2A 2M7UA 3C7VA 1W7FA 2B95A 1K57A 3IXGA 1XGJA 4HIAA 4EERA 4BBTA 4EEUA 4GZBA 4JPMA 5GHYA 1ERQA 5EM0A 3GVBA 1IYSA 2PAVP 3TRCA 5KSCA 1PWGA 3ZDJA 3FWLA 3WS0A 4B4ZA 3F1OA 4NXFA 1YKDA 1W5DA 4Y7PA 3UB6A 3ZNYA 1W79A 5TR7A 2VEAA 3KSGA 1ZHHB 5CHJA 1DJCA 2VJWA 1GHMA 3CPTA 3EQUA 3IQAA 2VZWA 2VA0A 4X68A 3VOYA 1TS0A 3ITBA 4OP8A 2M7VA 5HWVA 1QMEA 5HZHA 3T4JA 3P09A 4RX3A 1LI0A 3IHBA 4N1HA 3MQQA 2XQZA 2C5WB 1RGZA 5AJGA 3QP1A 2ZC6B 4IEDA 2WKRA 4I3IA 1VETB 4K91A 1ZG4A 3IBJA 3JVUA 4EESA 4U0XA 5TJJA 1ALQA 4EWFA 2Y2QA 1CI9A 5L8MA 4F3LB 2FFYA 3G31A 1OJ5A 4FUWA 1GSXA 3KYEA 3A3JA 1ESIA 4DJ3A 2ZQ7A 4X25A 4EUVA 1F2KA 2XGNA 3IF6B 1J9MA 5DTSA 3SH7A 1GA0A 4CLCE 4PKYA 4KUOA 4I38A 2DCFA 1W8QA 4CQHA 2XEPA 1JWVA 1ES2A 3A0VA 2QPNA 3FKVA 2OWJA 3VOZA 2ACGA 3U4LP 3FPWA 5TBMA 1K4FA 3LY3A 4FCFA 1LI9A 1RGYA 3T1SA 5TFQA 4P6ZS 2B5RA 1SDNA 4LV0A 5CEBA 3H9WA 4G3KA 5FA7A 1E25A 3FZCA 1TS7A 3ULFA 4HEFA 3MFXA 3D9YA 2ZC3B 1DY6A 4IBXA 4HI4A 1K38A 4I3AA 4HNBA 2WK0A 5FAOA 1ES5A 1MXOA 3BYDA 1PZPA 1PW8A 3OOVA 3CWFA 1BZAA 4GS9B 5HFOA 3HLBA 4KZBA 3OCLA 3CI6A 4YNRA 2ZMVA 5CEDA 2G2WA 3V3RA 3T50A 5DKKA 2BASA 3U2AA 3OCNA 3TE8A 1G6AA 3EEAA 2ZMFA 4L9GA 3FV7A 4H8RA 3HLWA 4QB8A 2WKEA 3BFFA 2R9XA 4DE1A 1MWTA 1TDGA 4WM9A 3VP1A 1E4DA 2O0YA 2Q0OA 3NIAA 4Y13A 4LV1A 3BFCA 3N6IA 5F1GA 5EVEA 2W3HA 3E4PA 3PBNA 1NRFA 4YINA 5I5LA 3HCYA 4WELA 3TJZC 4EXOA 3VOLA 3AGDA 1XA7A 1Y4OA 3DWZA 3EWKA 1PNEA 1CJFA 3BY8A 2D02A 1NXYA 4NK3A 1NRJA 4QWOA 1AWIA 4OLGA 3V50A 2KLIA 4GS9A 4I39A 5DTKA 1O7EA 2JN7A 3T4QA 1SDEA 2IWBA 1NLYA 4L9FA 2K2NA 2J3WA 4ZJ3A 5DTTA 4E3OA 2VKSA 2Y79A 2ZBBA 5GLDA 3IF6A 1TF1A 5GLCA 2JKRI 3A0RA 3NHQA 1D06A 4PM7A 3R7WB 3UE3A 4X55A 3L9KA 3LR0A 5A90A 5CTMA 1TVFA 2QJ5A 2X02A 3LI9A 3HLDA 3HL9A 5HD5A 4LPZA 3GV9A 3RTYA 2QMIA 1KVMA 3QP6A 3RJUA 2XH9A 3KYZA 4QPRA 2KDKA 2J9OA 1GA9A 1RCJA 4Y0UA 3SH9A 2V0UA 4IUHA 3C7UA 4O7DA 3D72A 3PR6A 2V20A 4MEZA 1AXBA 2JKTM 4D2OA 1T1BA 4LCLA 4F3LA 4P87A 1BT5A 2L1MA 1CI8A 2HDUA 2VGKA 4KG5A 4FD8A 3TG9A 3W4OA 5F5YA 4EU0A 5GHZA 3UE6A 1PWDA 5MC7A 3ZG9B 3A3EA 1YAXA 4GDNA 2Z2MB 2D01A 4N1XA 2YKHA 4RX2A 3MQ0A 3NOPC 3NC8A 2V8CA 1S4RA 2CMNA 4FTXA 1XJ3A 2OAP1 4E3MA 4Q0JA 3G32A 4DKIA 4GNUA 1F9IA 2PD8A 4S2NA 4C6YA 5KIZA 4K08A 1ODVA 1D1JA 3LUQA 4G3WA 3UDIA 3SZTA 5E2GA 5HARA 4II7A 2BTFP 3B42A 2JHEA 3KSHA 5HAIA 3S1YA 4BL2A 5EM1A 4YWZA 5A8BA 4Q8IA 1LL5A 3C30A 3N8SA 4GJ4A 1UWNX 3NULA 2PT7A 3BW6A 3E0YA 1GSWA 3WS5A 2HGVA 5CGSA 4HP4A 4F94A 3WS4A 3C4PA 3ICYA 2Z6DA 5FQ9A 3UNWA 5E2HA 4ZJ2A 2BG1A 2X01A 4R70A 2Y2JA 4S2OA 2IWDA 2H10A 1P9WA 3IX8A 1NJ4A 2J8YA 3FPVA 3F1PA 4Q0IA 3OBFA 2PU4A 3E2LA 4NETA 4OP5A 5KSHA 2GDNA 1WE4A 3BWLA 5E2FA 4Z9QA 3O3VA 4DN0A 4KZ5A 2OOLA 3GSGA 5EVID 2KX6A 2FZ0A 4ZDXA 5HL6A 2VV8A 2Y4AA 3E98A 2W0NA 1IEMA 1K54A 1FIKA 4UEYA 4OQ0A 5G4ZA 2XFTA 1LL9A 1TDLA 3ZGAB 2VV6A 5CECA 5FQQA 4CLCB 4K0WA 3LY4A 5FASA 4ZBEA 2PD7A 1N9LA 4RQ9A 1P9RA 1KOUA 3BY9A 3ZG0A 3VP4A 2HP5A 1K0KA 4NXBA 3S7QA 1N4OA 4WMCA 3VSKA 5AQ7A 3HLGA 2ZLYA 4HOIA 5C5KA 1SHVA 5EECA 3HUOA 1H8MA 1XFQA 5J8XA 5HSQA 4EETB 5AQAA 3CITA 1VQQA 2JBFA 5FQKA 3B3XA 4XUZA 3T4OA 1GHPA 4KZ6A 3JVVA 4ID4A 3SS5A 1G5UA 4S2MA 4ZRRA 1SCWA 2WGWB 3BM6A 2QZ6A 2GX5A 2Y2HA 3MZDA 4S2IA 2EFXA 3M6BA 5EFWA 1DJBA 3BQ8A 3PAGA 1FSWA 4AFIA 4KZ3A 2HDRA 2M1CA 2GJ3A 3E4OA 1OT6A 5DKLA 1N9NA 4MLLA 4WEJA 4HY8A 5DVAA 4IUKA 3WS2A 3D4FA 1OTAA 3MJQA 1KGFA 4X1LA 4S2JA 4R4SA 3UB8A 1SKFA 4NXGA 3SH8A 4KQQA 5E2EA 1FILA 2ZL1B 3CJMA 3MQOA 1Z6FA 2VGLS 1WYCA 4JF6A 4JF5A 1VM1A 4WZ4A 4ME4A 3KSFA 1YPRA 2QJ7A 1L0DA 3NDGA 2A24A 4WYYA 2KOIA 1G68A 3C38A 3HJKA 2G2UA 4NG2A 4CLCD 3ZG7B 1H8ZA 3T1XA 4HH2A 1XJ6A 2W1TB 2P7JA 1BYWA 4C75A 2INWA 3R7WA 4HESA 5FL3A 3V5MA 2PBDP 2VGJA 5AQ9A 4MDZA 3Q81A 5FSRA 2QKPA 3IH9A 2J7VA 3LR4A 3SS3A 3UN7A 2ZM8A 1L2SA 2WKPA 3ZHHA 4OPQA 4E3NA 5FQJA 4B93A 5L2FA 4R4RA 4I5SA 5FI2A 3LIAA 1T19A 1KGGA 2J80A 1YLZA 2EX9A 4IVKA 2XA7S 2Q9MA 2LB9A 3HREA 4S2PA 5BOHA 2EA9A 2CC1A 3WWXA 2W27A 3IS2B 1D7EA 1PRQA 1MZUA 2V1BA 1H5XA 1Y28A 4EBLA 1G28A 4HBTA 2L0WA 2NUPC 2ZQ8A 3LEQA 4JF4A 1BLPA 3HLEA 4BD1A 1OTDA 4R3JA 3UO9A 3UPNA 4LV3A 1FCMA 1FQGA 3FG8A 2ZQ9A 1W8YA 2VX8A 2OLUA 3NCKA 5DFYA 2W3GA 2HDSA 4KUKA 3MFDA 5HD3A 3LYXA 5EOEA 4Y15A 4DXBA 2E8JA 3IT9A 5I94A 4JGQA 4HBUA 1S1ZA 4GLQA 3DTIA 3UPPA 3UDFA 5GLAA 4EV4A 2XD5A 2YKFA 5FDHA 1M40A 2Y2MA 3TOIA 4OONA 1BLSA 4DMZA 4MCWA 3ZQ5A 2P08A 4OOYA 2PHYA 3IS2A 2ZD8A 4PM8A 5JYPA 1MKMA 1DJAA 4WZ5C 2OAQ1 4X56A 4FSFA 2Y91A 1YLJA 3T4TA 1BSGA 4DRTA 3QP2A 4DDSA 5CX7A 4R6LA 1L0GA 3CZDA 3VP3A 4FOFA 1WYBA 3S4XA 2P04A 1TS6A 3VE3A 3EOIA 5F83A 2HPBA 1YQSA 4EBNA 4RYEA 2OV5A 4E6WA 4YOFA 3ZG5A 4IJGA 1PI5A 2ZOHA 1KDSA 1PWCA 3TW8A 5GLBA 4QY6A 3GQZA 2R9WA 4E3LA 3O5YA 3WRTA 4U3TA 1ZC2A 4NEED 1NWZA 2A24B 5HDSA 4JXGA 3L7HA 2XFSA 3H7WA 2J3TD 4H6JA 1MWUA 2J3TC 1M6KA 2WKHA 4GD8A 1IYPA 5IHVA 2R78A 2Y55A 2EWVA 1LLBA 1STZA 2Q9NA 3IH8A 3GMWA 4OLDA 4M3KA 3MKEA 3F1OB 2A3UA 4XT2A 3LI8A 4Y5FA 1LSWA 3M2KA 4JLFA 3CG5A 4JBFA 4DF6A 4OPRA 3IXBA 1ZKJA 1S4SA 4KG2A 3WS1A 1MC0A 1UWPX 1NZUA 1XA1A 3EGDC 3MSHA 3HVFA 5EUAA 5F69A 1KGEA 4KZ7A 1XPBA 1IYOA 3GDIA 3MZFA 1OTBA 2JKRM 3CLOA 1KE4A 3PTEA 4OVDA 2XLNA 2MJ6A 5M18A 3D3OA 2K31A 1N9BA 4EQ1A 1HTZA 1IFQA 2IWCA 3EGXC 5F68A 4B4XA 5AVEA 1OJGA 3AGFA 3K3DA 4BD0A 3MXQA 1ERMA 5J7EA 1GCEA 3IWOA 1HVBA 4IVIA 1JWPA 5L07A 5FI7A 1PI4A 1ZTUA 3OZHA 1IYQA 4MBFA 1K54C 4UA7A 4LENA 2ZC4B 1JWZA 2A49A 2XA7M 1EROA 5J4EA 1YT4A 2GZAA 3BECA 4BLMA 4UQIS 4E6XA 4JGOA 2H28A 2J9PA 1KE0A 2PU2A 2B02A 3V39A 3PYPA 5A92A 4KG6A 1K6SA 1K55A 1O07A 3BFEA 4HJ6A 3VE4A 1HD8A 4MBHA 3E2KA 2Y2OA 5AQBA 4JXVA 5L09A 3IHAA 2PBYA 3RXXA 4UQIM 4P0MA 1MY8A 3TSGA 4HQAA 4WUJA 3VP2A 4MN7A 5TGFA 1FR6A 3ISGA 3F1PB 5GL9A 2O9CA 3K2NA 3O87A 4DJ2A 2UWXA 3SW1A 3LIDA 1YLTA 4PM6A 2H0TA 1IKIA 4EEPA 1MKIA 4ZTKA 3H82B 1Y54A 1NZOA 4BWIA 2ZMAA 2BLSA 4WLAA 2JKGA 1XJ4A 4IBRA 2JKFA 5HW3A 3WRZA 4WMCD 1K6RA 4BQMA 1X0OA 3PHYA 4P6ZM 2V9AA 5A93A 2OLVA 5FEGA 3NJAA 4CJNA 2XR0A 1NYMA 3ZG8B 3I7JA 3F1NB 2E8IA 5D3OA 3PBQA 2JC7A 2Z2LB 4I3JA 3RFBA 3G35A 1CK3A 3O88A 2Y2LA 4YFMA 2QYBA 3S7PA 3N4IA 1L3LA 1JTGA 4QD4A 4P6BA 2PRFA 2VGLM 3NI9A 3RH8B 4OH0A 3W4QA 4XXRA 3ZNTA 2DMWA 3LIBA 4DDYA 3LEZA 2ZQCA 2EX2A 5HDCA 3T4KA 1ONHA 3CUEA 5J3WA 2EWWA 4PAUA 2FFFB 4H6JB 1OMEA 3UMEA 4L9EA 3NDEA 2JKTI 4E3IA 3O86A 1K56D 4ZJ1A 1XFNA 4X53A 3FKWA 5CGWA 3LIEA 4KQRA 4LFUA 4CLCC 4GOGA 2AVXA 1T1AA 3G4PA 5DF9A 1LSXA 3ZYTA 3G30A 1E3UA
chains in the Genus database with same CATH topology
3A0RA 3EQVA 3CAXA 1OTDA 3NHQA 1D06A 3R7WB 3UE3A 3LR0A 1IOUA 2QJ5A 3FG8A 2VX8A 4R3AA 4LLOB 2W3DA 3LI9A 5DFYA 2W3GA 4KUKA 5HD3A 3LYXA 2IA2A 3PXPA 1GSVA 4JGQA 5HDDA 1V9ZA 1DP6A 1S1ZA 5HD5A 4GLQA 4LPZA 4O0PA 4WN5A 3RTYA 2XROA 3KYZA 4WL9A 2YKFA 4QPRA 1DP9A 2K7SA 4E04A 2KDKA 4Y2FA 1S67L 3BJNA 4DMZA 4MCWA 3ZQ5A 4ETZA 2P08A 1LT0A 5DJTA 2V0UA 1W63M 3C2WA 2PHYA 5HWWA 4IUHA 3UB7A 3MMHA 3D72A 3PR6A 3P7NA 3IS2A 2JKTM 1T1BA 2NUTC 1MKMA 4F3LA 3H82A 3T4SA 2V0WA 1N9OA 2L1MA 2OAQ1 3DBAA 2VV7A 4FSFA 1LSVA 3PBOA 2OWHA 5DJUA 5TBMB 4EU0A 5F5YA 3T4TA 3H7WB 3UE6A 5MC7A 2I9VA 2PR6A 4Q0HA 1YAXA 2O9AA 1VB6A 2QWSA 2D01A 2HJ9C 2YKHA 1JNUA 3MQ0A 5G4YA 1G6OA 3NOPC 5CX7A 4GW9A 4R6LA 5LBRA 3OLOA 1S4RA 2CMNA 3LICA 3KSIA 4Y3IA 2W3EA 1XJ3A 2OAP1 4FOFA 1DRMA 4Q0JA 1S66L 2P04A 4ARZA 1TS6A 3VE3A 3EOIA 4NKPA 3R4KA 1F9IA 2PD8A 4HJ3A 5KIZA 3V67A 1OPXA 4CLCA 4K08A 2L4RA 4O8GA 3PBTA 1ODVA 3CUEC 3LUQA 4YOFA 1OT9A 4G3WA 4Z1WA 5IU1A 4IJGA 4O01A 4BJPA 2ZOHA 4II7A 3B42A 2JHEA 3TW8A 3LFVA 3LR3A 3KSHA 3UB9A 4HHDA 4ARZB 3S7OA 3LIFA 4OOLA 5A8BA 4YWZA 3O5YA 4LRXC 3E4QA 4NEED 3C30A 1NWZA 2A24B 5HDSA 4MN6A 2XSSA 3HJIA 4GJ4A 4WF0A 1UWNX 2HV1A 3H7WA 2PT7A 3BW6A 3E0YA 2J3TD 1GSWA 1S1YA 1W63Q 4H6JA 4OOMA 2VLGA 4MN5A 2PYRA 3B33A 2HGVA 3BQAA 2J3TC 4MMNA 4KQOA 1LL8A 4HP4A 4NXEA 3KX0X 3ICYA 2Z6DA 4JGPA 4WEKA 1V9YA 2R78A 2EWVA 1STZA 4L0LA 2W3FA 4BBUA 3KO6A 4GHIB 4R70A 2A2LA 2HJEA 1XJ2A 1EW0A 3F1OB 4Y5FA 4XT2A 3LI8A 2M7UA 3KYQA 1LSWA 1P9WA 2O9BA 3FPVA 3F1PA 2PR5A 2W1TA 4Q0IA 3OBFA 1S4SA 3UMDA 4HIAA 4EERA 4BBTA 1OTIA 4EEUA 1MC0A 5KSHA 3BWLA 1UWPX 1DP8A 4DN0A 2OOLA 3EGDC 2HF6A 5F69A 2KX6A 3B47A 3GDIA 2FZ0A 1TD5A 1OTBA 2JKRM 3CLOA 5HL6A 3TRCA 2VV8A 3E98A 2W0NA 2MJ6A 3D3OA 2K31A 4UEYA 4EQ1A 1IFQA 3F1OA 5G4ZA 5F68A 3EGXC 1YKDA 4NXFA 5AVEA 3UB6A 1OJGA 3K3DA 2VEAA 3KSGA 2VV6A 4GCZA 3MXQA 4LRZE 1ZHHB 3S7NA 4CLCB 2VJWA 4R38A 5J7EA 1OTEA 3EQUA 2VZWA 2VA0A 4GHIA 1TS0A 2M7VA 3GECA 1TS8A 5HWVA 2PD7A 5HZHA 3T4JA 3IBRA 1N9LA 2O99A 1ZTUA 3OC2A 4RQ9A 1P9RA 1KOUA 3BY9A 3MQQA 5AJGA 4NXBA 3S7QA 2PDRA 2WKRA 5DFXA 4I3IA 2XA7M 3IBJA 3JVUA 2G7UA 4HOIA 4IHQA 5C5KA 4EESA 5J4EA 5TJJA 3K3CA 1H8MA 2GZAA 4UQIS 1UGUA 1XFQA 4JGOA 5L8MA 2H28A 4F3LB 5HSQA 4LRYC 2B02A 4EETB 1T18A 3PYPA 1OJ5A 3CITA 1GSXA 3T4OA 3JVVA 1P0ZA 2V1AA 2B18A 4HJ6A 3VE4A 4DJ3A 3VV4A 4ZRRA 4EUVA 1P97A 4JGRA 4EW7A 2GX5A 4CLCE 4PKYA 4KUOA 4I38A 1YSPA 2QHKA 4CQHA 3F1NA 5EFWA 3BQ8A 5HWTA 3A0VA 3NOTC 5AVFA 1F5MA 2OWJA 2PYPA 4UQIM 4AFIA 4HQAA 4WUJA 2M1CA 4KQDA 2GJ3A 3E4OA 1T1CA 5HPIA 1OT6A 1VHMA 3FPWA 4MN7A 5DKLA 1N9NA 5TBMA 4WEJA 2LB5A 4HY8A 5HPFA 3NOUC 3F1PB 4G3VA 4B9OA 4IUKA 2O9CA 3K2NA 1OTAA 3MJQA 4P6ZS 4DJ2A 3UB8A 3H9WA 4XT2B 3SW1A 3LIDA 4G3KA 4BBVA 1H3QA 4NXGA 1TS7A 3ULFA 3MFXA 4EEPA 3H82B 2W1RA 4PKYG 3MQOA 2VGLS 4HI4A 4BWIA 1F98A 4I3AA 4WLAA 4HNBA 4BMWA 1XJ4A 3LR5A 3A0SA 3KSFA 3OOVA 4ME4A 3CWFA 4GS9B 2QJ7A 3OCLA 3CI6A 1X0OA 4YNRA 3PHYA 4P6ZM 2V9AA 2ZMVA 3PBRA 2A24A 1NLZA 3NJAA 3F1NB 2KOIA 3T50A 5DKKA 3C38A 3PBQA 2BASA 4I3JA 3U2AA 3OCNA 3RFBA 3TE8A 2ZOIA 3HJKA 3EEAA 4CLCD 2ZMFA 3MR0A 4L9GA 2XRNA 2QYBA 4HH2A 1XJ6A 3S7PA 2W1TB 2P7JA 1BYWA 2INWA 3R7WA 2VGLM 3FC7A 3RH8B 5FL3A 2O0YA 4MDZA 2DMWA 3LIBA 2Z6CA 2W3HA 3E4PA 3PBNA 2QKPA 3G6OA 3LR4A 5I5LA 4ETXA 2WKQA 3HCYA 4WELA 3TJZC 5HDCA 2WKPA 4PHTA 1YSQA 4HJ4A 3T4KA 4EXOA 3VOLA 4B93A 3EWKA 3CUEA 5J3WA 2EWWA 4PAUA 3BY8A 2D02A 4H6JB 3T4LA 4I5SA 1NRJA 3LIAA 5IT5A 3PBSA 1T19A 3UMEA 4L9EA 2J80A 2JKTI 2KLIA 4HP9A 4GS9A 2XA7S 3P01A 4I39A 1XFNA 2JN7A 4M4XA 2FH5A 3T4QA 1NLYA 2LB9A 3LIEA 4L9FA 3W2ZA 2K2NA 3C8CA 3EEHA 4CLCC 2J3WA 2EA9A 4HH3A 1T1AA 2W27A 5F6AA 5K5BA 3IS2B 1D7EA 2VKSA 5DF9A 2Y79A 2GNXA 3MF0A 1LSXA 2ZBBA 1MZUA 1WA9A 2V1BA 3ZYTA 1Y28A 5IS1A 1G28A 1TF1A 2Y8HA 2L0WA 2NUPC 2JKRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZW A;  4IJG A;  4O01 A;  3NHQ A;  2M7V A;  3IBR A;  2O99 A;  1ZTU A;  3LFV A;  3KSH A;  4RQ9 A;  4ME4 A;  3KSF A;  3OOV A;  3S7O A;  2W3D A;  5DFY A;  2W3G A;  3CI6 A;  3O5Y A;  4LRX C;  4YNR A;  5AJG A;  2IA2 A;  3S7Q A;  5DFX A;  2XSS A;  4GLQ A;  4O0P A;  2KOI A;  3E0Y A;  2XRO A;  3IBJ A;  2G7U A;  5C5K A;  3RFB A;  5TJJ A;  2HGV A;  3EEA A;  4MMN A;  4QPR A;  2ZMF A;  4E04 A;  2XRN A;  4Y2F A;  2QYB A;  5L8M A;  3BJN A;  3S7P A;  5HSQ A;  4LRY C;  2W1T B;  4MCW A;  3ZQ5 A;  4DMZ A;  4ETZ A;  1STZ A;  3C2W A;  3CIT A;  2W3F A;  4IUH A;  3KO6 A;  3MMH A;  4R70 A;  2B18 A;  2O0Y A;  1MKM A;  4Y5F A;  4ZRR A;  3VV4 A;  4MDZ A;  4EUV A;  2M7U A;  3DBA A;  2W3H A;  2O9B A;  2GX5 A;  3G6O A;  5I5L A;  4ETX A;  4Q0I A;  2W1T A;  3HCY A;  3OBF A;  1YSP A;  4CQH A;  4EU0 A;  1MC0 A;  1YSQ A;  3NOT C;  4DN0 A;  1F5M A;  2OOL A;  4Q0H A;  2O9A A;  4PAU A;  5HPI A;  3MQ0 A;  1VHM A;  2KLI A;  4MN7 A;  1TD5 A;  3NOP C;  5HL6 A;  2LB5 A;  4GW9 A;  4R6L A;  5LBR A;  3TRC A;  5HPF A;  3NOU C;  4G3V A;  4IUK A;  2LB9 A;  3KSI A;  4Y3I A;  2O9C A;  2W3E A;  3E98 A;  3K2N A;  4FOF A;  3W2Z A;  2K2N A;  3D3O A;  2K31 A;  4Q0J A;  1YKD A;  3R4K A;  4G3K A;  5K5B A;  2VKS A;  2Y79 A;  3MF0 A;  2VEA A;  3KSG A;  4LRZ E;  3S7N A;  4O8G A;  2W1R A;  2VJW A;  1TF1 A;  2Y8H A;  4YOF A;  4G3W A;  4Z1W A;  4BWI A; 
#chains in the Genus database with same CATH topology
 3BLM A;  5HAP A;  4QJG A;  1CEF A;  4KZ4 A;  4R3A A;  3MXS A;  4R1G A;  3S22 A;  4X6T A;  3BFD A;  2IA2 A;  3PXP A;  1GSV A;  2ZM2 A;  1MWR A;  1V9Z A;  1DP6 A;  3ZVW A;  5M1A A;  4QY5 A;  4O0P A;  4LCM A;  4OKP A;  3N8R A;  5KZH A;  1K4E A;  1YLP A;  2JE5 A;  4KZ9 A;  1DP9 A;  4WBG A;  4Y2F A;  2EFU A;  5FEF A;  3BJN A;  4KEN B;  3C5A A;  1K55 C;  1BUL A;  5G18 A;  1I5Q A;  1SKO B;  3MMH A;  1XX2 A;  4R3B A;  3P7N A;  4FH2 A;  1BTL A;  1NY0 A;  4X1M A;  2V0W A;  1N9O A;  4S2L A;  4PM9 A;  3A3I A;  2VV7 A;  2Y2G A;  1LSV A;  4BL3 A;  3IWI A;  3Q7V B;  3PBO A;  4BEN A;  4N9L A;  3IF6 C;  2I9V A;  4Q0H A;  3NEC A;  2QWS A;  1PFL A;  2V2F F;  1JNU A;  1J3W A;  1A0K A;  4A5R A;  1G6O A;  5EVI A;  2RL3 A;  4GW9 A;  5LBR A;  3OLO A;  3LIC A;  4Y3I A;  1DRM A;  1I2W A;  2WGW A;  3Q82 A;  1S66 L;  4ARZ A;  3R4K A;  2Y59 A;  3IXD A;  1CEG A;  3V67 A;  1OPX A;  3QP4 A;  3CUE C;  2XD1 A;  1OT9 A;  2WAF A;  3SOI A;  5IU1 A;  4O01 A;  4BJP A;  1QMF A;  5EOO A;  4LGW A;  3GRJ A;  4ARZ B;  3S7O A;  3LIF A;  5EVI B;  5FQI A;  1JVJ A;  4OOL A;  4PMA A;  4EUZ A;  4LRX C;  3E4Q A;  1PZO A;  4N92 A;  2XSS A;  3DTM A;  4WF0 A;  1FCO A;  4CPK A;  3LGO A;  1YMS A;  2WZX A;  2VLG A;  3B33 A;  1CQA A;  3BQA A;  4MMN A;  4KQO A;  4NXE A;  4D60 A;  1ONG A;  1MPL A;  4WEK A;  1JTD A;  4EBP A;  4DXC A;  1FCN A;  1PW1 A;  3GTC A;  4GHI B;  4WZ5 A;  3C4O A;  3KYQ A;  4K0X A;  4XUX A;  2O9B A;  1CF0 A;  1TEM A;  2ZC5 B;  3V3S A;  5KMW A;  2PR5 A;  2W1T A;  3UMD A;  1OTI A;  3VP0 A;  2Y2N A;  4OQI A;  4FH4 A;  1KE3 A;  1DP8 A;  2HF6 A;  3W8K A;  3B47 A;  1K25 A;  1TD5 A;  3IX3 A;  4UHU A;  3A3F A;  1YLY A;  4Y0T A;  4OPZ A;  5CTN A;  1LHY A;  1MWS A;  2I72 A;  3CMZ A;  3BEB A;  4GCZ A;  4LRZ E;  3S7N A;  5HAQ A;  3OPP A;  3OPH A;  4R38 A;  1OTE A;  3ZFZ A;  4GHI A;  3A3D A;  5F1F A;  3GEC A;  1TS8 A;  5L10 A;  3IBR A;  2O99 A;  3OC2 A;  4R0Q A;  5F82 A;  5HL1 A;  1NYY A;  3HBR A;  3G34 A;  4MNR A;  4KZ8 A;  4UAA A;  1VET A;  2VK3 A;  5EE8 A;  2PDR A;  3QNC A;  2EX8 A;  4Y17 A;  5DFX A;  2EX6 A;  4IHQ A;  2G7U A;  2HP6 A;  3K3C A;  1BLH A;  1C3B A;  3RXW A;  1UGU A;  2P74 A;  1HLU P;  2EXA A;  4LRY C;  4DE0 A;  3QHY A;  1T18 A;  1Q2Q A;  5FQM A;  2WUQ A;  3AGE A;  1P0Z A;  1IEL A;  2B18 A;  2V1A A;  4RVA A;  3Q1F A;  1YLW A;  3VV4 A;  3IWQ A;  3HLC A;  4N9K A;  3T1Q B;  1P97 A;  3GR2 A;  4JGR A;  2HZ5 A;  4EW7 A;  5DF8 A;  1L0F A;  1YSP A;  1ESU A;  2QHK A;  4KZA A;  4JXW A;  1I2S A;  3F1N A;  3JYI A;  5HWT A;  5EV0 A;  3NOT C;  5AVF A;  1F5M A;  1H8Y A;  2PYP A;  4Y0O A;  3LCE A;  4KQD A;  1L0E A;  1T1C A;  5HPI A;  1VHM A;  2LB5 A;  5HPF A;  3NOU C;  4G3V A;  3BFG A;  4B9O A;  4GN2 A;  3UE0 A;  3UDX A;  3UY6 A;  3MZE A;  4XT2 B;  4BBV A;  1H3Q A;  4UA9 A;  3HUN A;  4U0T A;  4PKY G;  2W1R A;  4OPY A;  1F98 A;  3NY4 A;  4BMW A;  1SKO A;  3IX4 A;  3LR5 A;  1ES4 A;  3A0S A;  3BLS A;  1Z09 A;  2C6W B;  5CHM A;  3CHW P;  3PBR A;  3T1R A;  1NLZ A;  2X71 A;  4E3J A;  4R23 A;  3VFH A;  1HZO A;  2ZOI A;  5FAT A;  1EI5 A;  3MR0 A;  5A91 A;  2WAD A;  4GD6 A;  2XRN A;  4C3Q A;  3QP5 A;  2ZM0 A;  4EQI A;  3UPO A;  5M19 A;  3FC7 A;  1YM1 A;  3VMA A;  4DE2 A;  3NBL A;  4JKT A;  3SS4 A;  3Q07 A;  2ZQA A;  2Z6C A;  1XGI A;  1XP4 A;  3G6O A;  4ETX A;  2WKQ A;  1IKG A;  4PHT A;  2P9V B;  1YSQ A;  4HJ4 A;  1PYY A;  1K57 C;  1ACF A;  3T4L A;  2RCX A;  4QHC A;  3G2Z A;  5HX9 A;  3PBS A;  5IT5 A;  1XXM A;  4HP9 A;  3P01 A;  5FAQ A;  4M4X A;  2FH5 A;  4PPR A;  4ZAM A;  1FOF A;  4S2N C;  3W2Z A;  3C8C A;  3EEH A;  4HH3 A;  4OQG A;  2V8F A;  5F6A A;  5K5B A;  4GKU A;  3JPU A;  2GNX A;  3MF0 A;  3LO7 A;  1WA9 A;  3DW0 A;  1ES3 A;  5IS1 A;  2EXB A;  1S0W A;  2Y8H A;  4GDB A;  3CPT B;  1S6R A;  2WZZ A;  3EQV A;  3CAX A;  3DWK A;  1IOU A;  2WGV A;  2XDM A;  4LLO B;  2HDQ A;  1GHI A;  4X69 A;  2W3D A;  3G2Y A;  3IF5 A;  3DAV A;  5HDD A;  3N7W A;  3MS6 A;  3PAE A;  4WN5 A;  2XRO A;  5CER A;  3N8L A;  3W4P A;  3QP8 A;  4WL9 A;  5CRF A;  3M6H A;  5CXW A;  3FYZ A;  2K7S A;  4QU3 A;  4E04 A;  3VSL A;  3ZVT A;  2Y2I A;  4MBK A;  1S67 L;  3Q7V A;  4ETZ A;  5U47 A;  4B88 A;  3P98 A;  4JXS A;  1LT0 A;  5DJT A;  3C2W A;  1W63 M;  5HWW A;  3UB7 A;  1FR1 A;  2HP9 A;  2JCH A;  3HUM A;  1BLC A;  2NUT C;  3H82 A;  4PM5 A;  3T4S A;  3DBA A;  5GHX A;  3M2J A;  5JYO A;  2XF3 A;  2OWH A;  1ZG6 A;  5DJU A;  5CGX A;  5TBM B;  1PIO A;  4LV2 A;  1SZV A;  3MBZ A;  3H7W B;  3Q7Z A;  1XKZ A;  2PR6 A;  2WKI A;  2O9A A;  1VB6 A;  3ITA A;  1YMX A;  1K56 A;  1VEU B;  2HJ9 C;  4P85 A;  3MXR A;  4ESP A;  5E43 A;  2P9V A;  5FAP A;  5G4Y A;  1FSY A;  3T12 B;  3ZCZ A;  3DTE A;  3VFF A;  1Q2P A;  4DE3 A;  5DF7 A;  2UV0 E;  3BRM A;  3KSI A;  2W3E A;  2ZJ9 A;  5EPH A;  4RA7 A;  4NKP A;  1E3U D;  4HJ3 A;  3HLF A;  4CLC A;  2Y2P A;  2OSU A;  2WYX A;  2L4R A;  4O8G A;  2XK1 A;  3PBT A;  1MBL A;  4Z1W A;  3QNB A;  4S2K A;  5CHU A;  4GB7 A;  2WAE A;  1BUE A;  5FDS A;  3DTK A;  3UE1 A;  5EVI C;  2DNS A;  2V1Z A;  3LFV A;  3LR3 A;  3UB9 A;  1KVL A;  4HHD A;  2DRW A;  3OPR A;  2WGI A;  2H5S A;  4MN6 A;  1U60 A;  3HJI A;  3OPL A;  2HV1 A;  1VEU A;  1S1Y A;  1W63 Q;  4OOM A;  1KDW A;  4MN5 A;  2PYR A;  2Y2K A;  3UB5 P;  1LL8 A;  3KX0 X;  4E3K A;  4OQH A;  2ZQD A;  4JGP A;  1H0M A;  1EWZ A;  4UA6 A;  1V9Y A;  3MKF A;  3IXH A;  5EVL A;  2ZL1 A;  2H0Y A;  4L0L A;  2W3F A;  4BBU A;  3KO6 A;  5FI6 A;  2ZC7 A;  2A2L A;  2HJE A;  1RP5 A;  1EW0 A;  1XJ2 A;  2M7U A;  3C7V A;  1W7F A;  2B95 A;  1K57 A;  3IXG A;  1XGJ A;  4HIA A;  4EER A;  4BBT A;  4EEU A;  4GZB A;  4JPM A;  5GHY A;  1ERQ A;  5EM0 A;  3GVB A;  1IYS A;  2PAV P;  3TRC A;  5KSC A;  1PWG A;  3ZDJ A;  3FWL A;  3WS0 A;  4B4Z A;  3F1O A;  4NXF A;  1YKD A;  1W5D A;  4Y7P A;  3UB6 A;  3ZNY A;  1W79 A;  5TR7 A;  2VEA A;  3KSG A;  1ZHH B;  5CHJ A;  1DJC A;  2VJW A;  1GHM A;  3CPT A;  3EQU A;  3IQA A;  2VZW A;  2VA0 A;  4X68 A;  3VOY A;  1TS0 A;  3ITB A;  4OP8 A;  2M7V A;  5HWV A;  1QME A;  5HZH A;  3T4J A;  3P09 A;  4RX3 A;  1LI0 A;  3IHB A;  4N1H A;  3MQQ A;  2XQZ A;  2C5W B;  1RGZ A;  5AJG A;  3QP1 A;  2ZC6 B;  4IED A;  2WKR A;  4I3I A;  1VET B;  4K91 A;  1ZG4 A;  3IBJ A;  3JVU A;  4EES A;  4U0X A;  5TJJ A;  1ALQ A;  4EWF A;  2Y2Q A;  1CI9 A;  5L8M A;  4F3L B;  2FFY A;  3G31 A;  1OJ5 A;  4FUW A;  1GSX A;  3KYE A;  3A3J A;  1ESI A;  4DJ3 A;  2ZQ7 A;  4X25 A;  4EUV A;  1F2K A;  2XGN A;  3IF6 B;  1J9M A;  5DTS A;  3SH7 A;  1GA0 A;  4CLC E;  4PKY A;  4KUO A;  4I38 A;  2DCF A;  1W8Q A;  4CQH A;  2XEP A;  1JWV A;  1ES2 A;  3A0V A;  2QPN A;  3FKV A;  2OWJ A;  3VOZ A;  2ACG A;  3U4L P;  3FPW A;  5TBM A;  1K4F A;  3LY3 A;  4FCF A;  1LI9 A;  1RGY A;  3T1S A;  5TFQ A;  4P6Z S;  2B5R A;  1SDN A;  4LV0 A;  5CEB A;  3H9W A;  4G3K A;  5FA7 A;  1E25 A;  3FZC A;  1TS7 A;  3ULF A;  4HEF A;  3MFX A;  3D9Y A;  2ZC3 B;  1DY6 A;  4IBX A;  4HI4 A;  1K38 A;  4I3A A;  4HNB A;  2WK0 A;  5FAO A;  1ES5 A;  1MXO A;  3BYD A;  1PZP A;  1PW8 A;  3OOV A;  3CWF A;  1BZA A;  4GS9 B;  5HFO A;  3HLB A;  4KZB A;  3OCL A;  3CI6 A;  4YNR A;  2ZMV A;  5CED A;  2G2W A;  3V3R A;  3T50 A;  5DKK A;  2BAS A;  3U2A A;  3OCN A;  3TE8 A;  1G6A A;  3EEA A;  2ZMF A;  4L9G A;  3FV7 A;  4H8R A;  3HLW A;  4QB8 A;  2WKE A;  3BFF A;  2R9X A;  4DE1 A;  1MWT A;  1TDG A;  4WM9 A;  3VP1 A;  1E4D A;  2O0Y A;  2Q0O A;  3NIA A;  4Y13 A;  4LV1 A;  3BFC A;  3N6I A;  5F1G A;  5EVE A;  2W3H A;  3E4P A;  3PBN A;  1NRF A;  4YIN A;  5I5L A;  3HCY A;  4WEL A;  3TJZ C;  4EXO A;  3VOL A;  3AGD A;  1XA7 A;  1Y4O A;  3DWZ A;  3EWK A;  1PNE A;  1CJF A;  3BY8 A;  2D02 A;  1NXY A;  4NK3 A;  1NRJ A;  4QWO A;  1AWI A;  4OLG A;  3V50 A;  2KLI A;  4GS9 A;  4I39 A;  5DTK A;  1O7E A;  2JN7 A;  3T4Q A;  1SDE A;  2IWB A;  1NLY A;  4L9F A;  2K2N A;  2J3W A;  4ZJ3 A;  5DTT A;  4E3O A;  2VKS A;  2Y79 A;  2ZBB A;  5GLD A;  3IF6 A;  1TF1 A;  5GLC A;  2JKR I;  3A0R A;  3NHQ A;  1D06 A;  4PM7 A;  3R7W B;  3UE3 A;  4X55 A;  3L9K A;  3LR0 A;  5A90 A;  5CTM A;  1TVF A;  2QJ5 A;  2X02 A;  3LI9 A;  3HLD A;  3HL9 A;  5HD5 A;  4LPZ A;  3GV9 A;  3RTY A;  2QMI A;  1KVM A;  3QP6 A;  3RJU A;  2XH9 A;  3KYZ A;  4QPR A;  2KDK A;  2J9O A;  1GA9 A;  1RCJ A;  4Y0U A;  3SH9 A;  2V0U A;  4IUH A;  3C7U A;  4O7D A;  3D72 A;  3PR6 A;  2V20 A;  4MEZ A;  1AXB A;  2JKT M;  4D2O A;  1T1B A;  4LCL A;  4F3L A;  4P87 A;  1BT5 A;  2L1M A;  1CI8 A;  2HDU A;  2VGK A;  4KG5 A;  4FD8 A;  3TG9 A;  3W4O A;  5F5Y A;  4EU0 A;  5GHZ A;  3UE6 A;  1PWD A;  5MC7 A;  3ZG9 B;  3A3E A;  1YAX A;  4GDN A;  2Z2M B;  2D01 A;  4N1X A;  2YKH A;  4RX2 A;  3MQ0 A;  3NOP C;  3NC8 A;  2V8C A;  1S4R A;  2CMN A;  4FTX A;  1XJ3 A;  2OAP 1;  4E3M A;  4Q0J A;  3G32 A;  4DKI A;  4GNU A;  1F9I A;  2PD8 A;  4S2N A;  4C6Y A;  5KIZ A;  4K08 A;  1ODV A;  1D1J A;  3LUQ A;  4G3W A;  3UDI A;  3SZT A;  5E2G A;  5HAR A;  4II7 A;  2BTF P;  3B42 A;  2JHE A;  3KSH A;  5HAI A;  3S1Y A;  4BL2 A;  5EM1 A;  4YWZ A;  5A8B A;  4Q8I A;  1LL5 A;  3C30 A;  3N8S A;  4GJ4 A;  1UWN X;  3NUL A;  2PT7 A;  3BW6 A;  3E0Y A;  1GSW A;  3WS5 A;  2HGV A;  5CGS A;  4HP4 A;  4F94 A;  3WS4 A;  3C4P A;  3ICY A;  2Z6D A;  5FQ9 A;  3UNW A;  5E2H A;  4ZJ2 A;  2BG1 A;  2X01 A;  4R70 A;  2Y2J A;  4S2O A;  2IWD A;  2H10 A;  1P9W A;  3IX8 A;  1NJ4 A;  2J8Y A;  3FPV A;  3F1P A;  4Q0I A;  3OBF A;  2PU4 A;  3E2L A;  4NET A;  4OP5 A;  5KSH A;  2GDN A;  1WE4 A;  3BWL A;  5E2F A;  4Z9Q A;  3O3V A;  4DN0 A;  4KZ5 A;  2OOL A;  3GSG A;  5EVI D;  2KX6 A;  2FZ0 A;  4ZDX A;  5HL6 A;  2VV8 A;  2Y4A A;  3E98 A;  2W0N A;  1IEM A;  1K54 A;  1FIK A;  4UEY A;  4OQ0 A;  5G4Z A;  2XFT A;  1LL9 A;  1TDL A;  3ZGA B;  2VV6 A;  5CEC A;  5FQQ A;  4CLC B;  4K0W A;  3LY4 A;  5FAS A;  4ZBE A;  2PD7 A;  1N9L A;  4RQ9 A;  1P9R A;  1KOU A;  3BY9 A;  3ZG0 A;  3VP4 A;  2HP5 A;  1K0K A;  4NXB A;  3S7Q A;  1N4O A;  4WMC A;  3VSK A;  5AQ7 A;  3HLG A;  2ZLY A;  4HOI A;  5C5K A;  1SHV A;  5EEC A;  3HUO A;  1H8M A;  1XFQ A;  5J8X A;  5HSQ A;  4EET B;  5AQA A;  3CIT A;  1VQQ A;  2JBF A;  5FQK A;  3B3X A;  4XUZ A;  3T4O A;  1GHP A;  4KZ6 A;  3JVV A;  4ID4 A;  3SS5 A;  1G5U A;  4S2M A;  4ZRR A;  1SCW A;  2WGW B;  3BM6 A;  2QZ6 A;  2GX5 A;  2Y2H A;  3MZD A;  4S2I A;  2EFX A;  3M6B A;  5EFW A;  1DJB A;  3BQ8 A;  3PAG A;  1FSW A;  4AFI A;  4KZ3 A;  2HDR A;  2M1C A;  2GJ3 A;  3E4O A;  1OT6 A;  5DKL A;  1N9N A;  4MLL A;  4WEJ A;  4HY8 A;  5DVA A;  4IUK A;  3WS2 A;  3D4F A;  1OTA A;  3MJQ A;  1KGF A;  4X1L A;  4S2J A;  4R4S A;  3UB8 A;  1SKF A;  4NXG A;  3SH8 A;  4KQQ A;  5E2E A;  1FIL A;  2ZL1 B;  3CJM A;  3MQO A;  1Z6F A;  2VGL S;  1WYC A;  4JF6 A;  4JF5 A;  1VM1 A;  4WZ4 A;  4ME4 A;  3KSF A;  1YPR A;  2QJ7 A;  1L0D A;  3NDG A;  2A24 A;  4WYY A;  2KOI A;  1G68 A;  3C38 A;  3HJK A;  2G2U A;  4NG2 A;  4CLC D;  3ZG7 B;  1H8Z A;  3T1X A;  4HH2 A;  1XJ6 A;  2W1T B;  2P7J A;  1BYW A;  4C75 A;  2INW A;  3R7W A;  4HES A;  5FL3 A;  3V5M A;  2PBD P;  2VGJ A;  5AQ9 A;  4MDZ A;  3Q81 A;  5FSR A;  2QKP A;  3IH9 A;  2J7V A;  3LR4 A;  3SS3 A;  3UN7 A;  2ZM8 A;  1L2S A;  2WKP A;  3ZHH A;  4OPQ A;  4E3N A;  5FQJ A;  4B93 A;  5L2F A;  4R4R A;  4I5S A;  5FI2 A;  3LIA A;  1T19 A;  1KGG A;  2J80 A;  1YLZ A;  2EX9 A;  4IVK A;  2XA7 S;  2Q9M A;  2LB9 A;  3HRE A;  4S2P A;  5BOH A;  2EA9 A;  2CC1 A;  3WWX A;  2W27 A;  3IS2 B;  1D7E A;  1PRQ A;  1MZU A;  2V1B A;  1H5X A;  1Y28 A;  4EBL A;  1G28 A;  4HBT A;  2L0W A;  2NUP C;  2ZQ8 A;  3LEQ A;  4JF4 A;  1BLP A;  3HLE A;  4BD1 A;  1OTD A;  4R3J A;  3UO9 A;  3UPN A;  4LV3 A;  1FCM A;  1FQG A;  3FG8 A;  2ZQ9 A;  1W8Y A;  2VX8 A;  2OLU A;  3NCK A;  5DFY A;  2W3G A;  2HDS A;  4KUK A;  3MFD A;  5HD3 A;  3LYX A;  5EOE A;  4Y15 A;  4DXB A;  2E8J A;  3IT9 A;  5I94 A;  4JGQ A;  4HBU A;  1S1Z A;  4GLQ A;  3DTI A;  3UPP A;  3UDF A;  5GLA A;  4EV4 A;  2XD5 A;  2YKF A;  5FDH A;  1M40 A;  2Y2M A;  3TOI A;  4OON A;  1BLS A;  4DMZ A;  4MCW A;  3ZQ5 A;  2P08 A;  4OOY A;  2PHY A;  3IS2 A;  2ZD8 A;  4PM8 A;  5JYP A;  1MKM A;  1DJA A;  4WZ5 C;  2OAQ 1;  4X56 A;  4FSF A;  2Y91 A;  1YLJ A;  3T4T A;  1BSG A;  4DRT A;  3QP2 A;  4DDS A;  5CX7 A;  4R6L A;  1L0G A;  3CZD A;  3VP3 A;  4FOF A;  1WYB A;  3S4X A;  2P04 A;  1TS6 A;  3VE3 A;  3EOI A;  5F83 A;  2HPB A;  1YQS A;  4EBN A;  4RYE A;  2OV5 A;  4E6W A;  4YOF A;  3ZG5 A;  4IJG A;  1PI5 A;  2ZOH A;  1KDS A;  1PWC A;  3TW8 A;  5GLB A;  4QY6 A;  3GQZ A;  2R9W A;  4E3L A;  3O5Y A;  3WRT A;  4U3T A;  1ZC2 A;  4NEE D;  1NWZ A;  2A24 B;  5HDS A;  4JXG A;  3L7H A;  2XFS A;  3H7W A;  2J3T D;  4H6J A;  1MWU A;  2J3T C;  1M6K A;  2WKH A;  4GD8 A;  1IYP A;  5IHV A;  2R78 A;  2Y55 A;  2EWV A;  1LLB A;  1STZ A;  2Q9N A;  3IH8 A;  3GMW A;  4OLD A;  4M3K A;  3MKE A;  3F1O B;  2A3U A;  4XT2 A;  3LI8 A;  4Y5F A;  1LSW A;  3M2K A;  4JLF A;  3CG5 A;  4JBF A;  4DF6 A;  4OPR A;  3IXB A;  1ZKJ A;  1S4S A;  4KG2 A;  3WS1 A;  1MC0 A;  1UWP X;  1NZU A;  1XA1 A;  3EGD C;  3MSH A;  3HVF A;  5EUA A;  5F69 A;  1KGE A;  4KZ7 A;  1XPB A;  1IYO A;  3GDI A;  3MZF A;  1OTB A;  2JKR M;  3CLO A;  1KE4 A;  3PTE A;  4OVD A;  2XLN A;  2MJ6 A;  5M18 A;  3D3O A;  2K31 A;  1N9B A;  4EQ1 A;  1HTZ A;  1IFQ A;  2IWC A;  3EGX C;  5F68 A;  4B4X A;  5AVE A;  1OJG A;  3AGF A;  3K3D A;  4BD0 A;  3MXQ A;  1ERM A;  5J7E A;  1GCE A;  3IWO A;  1HVB A;  4IVI A;  1JWP A;  5L07 A;  5FI7 A;  1PI4 A;  1ZTU A;  3OZH A;  1IYQ A;  4MBF A;  1K54 C;  4UA7 A;  4LEN A;  2ZC4 B;  1JWZ A;  2A49 A;  2XA7 M;  1ERO A;  5J4E A;  1YT4 A;  2GZA A;  3BEC A;  4BLM A;  4UQI S;  4E6X A;  4JGO A;  2H28 A;  2J9P A;  1KE0 A;  2PU2 A;  2B02 A;  3V39 A;  3PYP A;  5A92 A;  4KG6 A;  1K6S A;  1K55 A;  1O07 A;  3BFE A;  4HJ6 A;  3VE4 A;  1HD8 A;  4MBH A;  3E2K A;  2Y2O A;  5AQB A;  4JXV A;  5L09 A;  3IHA A;  2PBY A;  3RXX A;  4UQI M;  4P0M A;  1MY8 A;  3TSG A;  4HQA A;  4WUJ A;  3VP2 A;  4MN7 A;  5TGF A;  1FR6 A;  3ISG A;  3F1P B;  5GL9 A;  2O9C A;  3K2N A;  3O87 A;  4DJ2 A;  2UWX A;  3SW1 A;  3LID A;  1YLT A;  4PM6 A;  2H0T A;  1IKI A;  4EEP A;  1MKI A;  4ZTK A;  3H82 B;  1Y54 A;  1NZO A;  4BWI A;  2ZMA A;  2BLS A;  4WLA A;  2JKG A;  1XJ4 A;  4IBR A;  2JKF A;  5HW3 A;  3WRZ A;  4WMC D;  1K6R A;  4BQM A;  1X0O A;  3PHY A;  4P6Z M;  2V9A A;  5A93 A;  2OLV A;  5FEG A;  3NJA A;  4CJN A;  2XR0 A;  1NYM A;  3ZG8 B;  3I7J A;  3F1N B;  2E8I A;  5D3O A;  3PBQ A;  2JC7 A;  2Z2L B;  4I3J A;  3RFB A;  3G35 A;  1CK3 A;  3O88 A;  2Y2L A;  4YFM A;  2QYB A;  3S7P A;  3N4I A;  1L3L A;  1JTG A;  4QD4 A;  4P6B A;  2PRF A;  2VGL M;  3NI9 A;  3RH8 B;  4OH0 A;  3W4Q A;  4XXR A;  3ZNT A;  2DMW A;  3LIB A;  4DDY A;  3LEZ A;  2ZQC A;  2EX2 A;  5HDC A;  3T4K A;  1ONH A;  3CUE A;  5J3W A;  2EWW A;  4PAU A;  2FFF B;  4H6J B;  1OME A;  3UME A;  4L9E A;  3NDE A;  2JKT I;  4E3I A;  3O86 A;  1K56 D;  4ZJ1 A;  1XFN A;  4X53 A;  3FKW A;  5CGW A;  3LIE A;  4KQR A;  4LFU A;  4CLC C;  4GOG A;  2AVX A;  1T1A A;  3G4P A;  5DF9 A;  1LSX A;  3ZYT A;  3G30 A;  1E3U A; 
#chains in the Genus database with same CATH homology
 3A0R A;  3EQV A;  3CAX A;  1OTD A;  3NHQ A;  1D06 A;  3R7W B;  3UE3 A;  3LR0 A;  1IOU A;  2QJ5 A;  3FG8 A;  2VX8 A;  4R3A A;  4LLO B;  2W3D A;  3LI9 A;  5DFY A;  2W3G A;  4KUK A;  5HD3 A;  3LYX A;  2IA2 A;  3PXP A;  1GSV A;  4JGQ A;  5HDD A;  1V9Z A;  1DP6 A;  1S1Z A;  5HD5 A;  4GLQ A;  4LPZ A;  4O0P A;  4WN5 A;  3RTY A;  2XRO A;  3KYZ A;  4WL9 A;  2YKF A;  4QPR A;  1DP9 A;  2K7S A;  4E04 A;  2KDK A;  4Y2F A;  1S67 L;  3BJN A;  4DMZ A;  4MCW A;  3ZQ5 A;  4ETZ A;  2P08 A;  1LT0 A;  5DJT A;  2V0U A;  1W63 M;  3C2W A;  2PHY A;  5HWW A;  4IUH A;  3UB7 A;  3MMH A;  3D72 A;  3PR6 A;  3P7N A;  3IS2 A;  2JKT M;  1T1B A;  2NUT C;  1MKM A;  4F3L A;  3H82 A;  3T4S A;  2V0W A;  1N9O A;  2L1M A;  2OAQ 1;  3DBA A;  2VV7 A;  4FSF A;  1LSV A;  3PBO A;  2OWH A;  5DJU A;  5TBM B;  4EU0 A;  5F5Y A;  3T4T A;  3H7W B;  3UE6 A;  5MC7 A;  2I9V A;  2PR6 A;  4Q0H A;  1YAX A;  2O9A A;  1VB6 A;  2QWS A;  2D01 A;  2HJ9 C;  2YKH A;  1JNU A;  3MQ0 A;  5G4Y A;  1G6O A;  3NOP C;  5CX7 A;  4GW9 A;  4R6L A;  5LBR A;  3OLO A;  1S4R A;  2CMN A;  3LIC A;  3KSI A;  4Y3I A;  2W3E A;  1XJ3 A;  2OAP 1;  4FOF A;  1DRM A;  4Q0J A;  1S66 L;  2P04 A;  4ARZ A;  1TS6 A;  3VE3 A;  3EOI A;  4NKP A;  3R4K A;  1F9I A;  2PD8 A;  4HJ3 A;  5KIZ A;  3V67 A;  1OPX A;  4CLC A;  4K08 A;  2L4R A;  4O8G A;  3PBT A;  1ODV A;  3CUE C;  3LUQ A;  4YOF A;  1OT9 A;  4G3W A;  4Z1W A;  5IU1 A;  4IJG A;  4O01 A;  4BJP A;  2ZOH A;  4II7 A;  3B42 A;  2JHE A;  3TW8 A;  3LFV A;  3LR3 A;  3KSH A;  3UB9 A;  4HHD A;  4ARZ B;  3S7O A;  3LIF A;  4OOL A;  5A8B A;  4YWZ A;  3O5Y A;  4LRX C;  3E4Q A;  4NEE D;  3C30 A;  1NWZ A;  2A24 B;  5HDS A;  4MN6 A;  2XSS A;  3HJI A;  4GJ4 A;  4WF0 A;  1UWN X;  2HV1 A;  3H7W A;  2PT7 A;  3BW6 A;  3E0Y A;  2J3T D;  1GSW A;  1S1Y A;  1W63 Q;  4H6J A;  4OOM A;  2VLG A;  4MN5 A;  2PYR A;  3B33 A;  2HGV A;  3BQA A;  2J3T C;  4MMN A;  4KQO A;  1LL8 A;  4HP4 A;  4NXE A;  3KX0 X;  3ICY A;  2Z6D A;  4JGP A;  4WEK A;  1V9Y A;  2R78 A;  2EWV A;  1STZ A;  4L0L A;  2W3F A;  4BBU A;  3KO6 A;  4GHI B;  4R70 A;  2A2L A;  2HJE A;  1XJ2 A;  1EW0 A;  3F1O B;  4Y5F A;  4XT2 A;  3LI8 A;  2M7U A;  3KYQ A;  1LSW A;  1P9W A;  2O9B A;  3FPV A;  3F1P A;  2PR5 A;  2W1T A;  4Q0I A;  3OBF A;  1S4S A;  3UMD A;  4HIA A;  4EER A;  4BBT A;  1OTI A;  4EEU A;  1MC0 A;  5KSH A;  3BWL A;  1UWP X;  1DP8 A;  4DN0 A;  2OOL A;  3EGD C;  2HF6 A;  5F69 A;  2KX6 A;  3B47 A;  3GDI A;  2FZ0 A;  1TD5 A;  1OTB A;  2JKR M;  3CLO A;  5HL6 A;  3TRC A;  2VV8 A;  3E98 A;  2W0N A;  2MJ6 A;  3D3O A;  2K31 A;  4UEY A;  4EQ1 A;  1IFQ A;  3F1O A;  5G4Z A;  5F68 A;  3EGX C;  1YKD A;  4NXF A;  5AVE A;  3UB6 A;  1OJG A;  3K3D A;  2VEA A;  3KSG A;  2VV6 A;  4GCZ A;  3MXQ A;  4LRZ E;  1ZHH B;  3S7N A;  4CLC B;  2VJW A;  4R38 A;  5J7E A;  1OTE A;  3EQU A;  2VZW A;  2VA0 A;  4GHI A;  1TS0 A;  2M7V A;  3GEC A;  1TS8 A;  5HWV A;  2PD7 A;  5HZH A;  3T4J A;  3IBR A;  1N9L A;  2O99 A;  1ZTU A;  3OC2 A;  4RQ9 A;  1P9R A;  1KOU A;  3BY9 A;  3MQQ A;  5AJG A;  4NXB A;  3S7Q A;  2PDR A;  2WKR A;  5DFX A;  4I3I A;  2XA7 M;  3IBJ A;  3JVU A;  2G7U A;  4HOI A;  4IHQ A;  5C5K A;  4EES A;  5J4E A;  5TJJ A;  3K3C A;  1H8M A;  2GZA A;  4UQI S;  1UGU A;  1XFQ A;  4JGO A;  5L8M A;  2H28 A;  4F3L B;  5HSQ A;  4LRY C;  2B02 A;  4EET B;  1T18 A;  3PYP A;  1OJ5 A;  3CIT A;  1GSX A;  3T4O A;  3JVV A;  1P0Z A;  2V1A A;  2B18 A;  4HJ6 A;  3VE4 A;  4DJ3 A;  3VV4 A;  4ZRR A;  4EUV A;  1P97 A;  4JGR A;  4EW7 A;  2GX5 A;  4CLC E;  4PKY A;  4KUO A;  4I38 A;  1YSP A;  2QHK A;  4CQH A;  3F1N A;  5EFW A;  3BQ8 A;  5HWT A;  3A0V A;  3NOT C;  5AVF A;  1F5M A;  2OWJ A;  2PYP A;  4UQI M;  4AFI A;  4HQA A;  4WUJ A;  2M1C A;  4KQD A;  2GJ3 A;  3E4O A;  1T1C A;  5HPI A;  1OT6 A;  1VHM A;  3FPW A;  4MN7 A;  5DKL A;  1N9N A;  5TBM A;  4WEJ A;  2LB5 A;  4HY8 A;  5HPF A;  3NOU C;  3F1P B;  4G3V A;  4B9O A;  4IUK A;  2O9C A;  3K2N A;  1OTA A;  3MJQ A;  4P6Z S;  4DJ2 A;  3UB8 A;  3H9W A;  4XT2 B;  3SW1 A;  3LID A;  4G3K A;  4BBV A;  1H3Q A;  4NXG A;  1TS7 A;  3ULF A;  3MFX A;  4EEP A;  3H82 B;  2W1R A;  4PKY G;  3MQO A;  2VGL S;  4HI4 A;  4BWI A;  1F98 A;  4I3A A;  4WLA A;  4HNB A;  4BMW A;  1XJ4 A;  3LR5 A;  3A0S A;  3KSF A;  3OOV A;  4ME4 A;  3CWF A;  4GS9 B;  2QJ7 A;  3OCL A;  3CI6 A;  1X0O A;  4YNR A;  3PHY A;  4P6Z M;  2V9A A;  2ZMV A;  3PBR A;  2A24 A;  1NLZ A;  3NJA A;  3F1N B;  2KOI A;  3T50 A;  5DKK A;  3C38 A;  3PBQ A;  2BAS A;  4I3J A;  3U2A A;  3OCN A;  3RFB A;  3TE8 A;  2ZOI A;  3HJK A;  3EEA A;  4CLC D;  2ZMF A;  3MR0 A;  4L9G A;  2XRN A;  2QYB A;  4HH2 A;  1XJ6 A;  3S7P A;  2W1T B;  2P7J A;  1BYW A;  2INW A;  3R7W A;  2VGL M;  3FC7 A;  3RH8 B;  5FL3 A;  2O0Y A;  4MDZ A;  2DMW A;  3LIB A;  2Z6C A;  2W3H A;  3E4P A;  3PBN A;  2QKP A;  3G6O A;  3LR4 A;  5I5L A;  4ETX A;  2WKQ A;  3HCY A;  4WEL A;  3TJZ C;  5HDC A;  2WKP A;  4PHT A;  1YSQ A;  4HJ4 A;  3T4K A;  4EXO A;  3VOL A;  4B93 A;  3EWK A;  3CUE A;  5J3W A;  2EWW A;  4PAU A;  3BY8 A;  2D02 A;  4H6J B;  3T4L A;  4I5S A;  1NRJ A;  3LIA A;  5IT5 A;  3PBS A;  1T19 A;  3UME A;  4L9E A;  2J80 A;  2JKT I;  2KLI A;  4HP9 A;  4GS9 A;  2XA7 S;  3P01 A;  4I39 A;  1XFN A;  2JN7 A;  4M4X A;  2FH5 A;  3T4Q A;  1NLY A;  2LB9 A;  3LIE A;  4L9F A;  3W2Z A;  2K2N A;  3C8C A;  3EEH A;  4CLC C;  2J3W A;  2EA9 A;  4HH3 A;  1T1A A;  2W27 A;  5F6A A;  5K5B A;  3IS2 B;  1D7E A;  2VKS A;  5DF9 A;  2Y79 A;  2GNX A;  3MF0 A;  1LSX A;  2ZBB A;  1MZU A;  1WA9 A;  2V1B A;  3ZYT A;  1Y28 A;  5IS1 A;  1G28 A;  1TF1 A;  2Y8H A;  2L0W A;  2NUP C;  2JKR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...