3VV4A

Crystal structure of cyanobacteriochrome tepixj gaf domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
153
Chain Sequence
b'LSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQCSEPRQWQEIEIDQFSELASTGSLVLERLHFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein
publication title Structures of cyanobacteriochromes from phototaxis regulators AnPixJ and TePixJ reveal general and specific photoconversion mechanism
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 48
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3vv4A00
2W3FA 2W3DA 2VJWA 4O8GA 4ETZA 3R4KA 5HPFA 4O0PA 1ZTUA 4PAUA 3NHQA 5DFYA 2XRNA 2ZMFA 3KSIA 3S7QA 3G6OA 3DBAA 3CITA 2LB9A 4CQHA 4GLQA 1TF1A 2O99A 2W1TB 3ZQ5A 4EUVA 4RQ9A 3HCYA 4ZRRA 3KSHA 4DMZA 5LBRA 3IBRA 4YOFA 3K2NA 3S7OA 5AJGA 3NOUC 3LFVA 4ME4A 5HL6A 2O9CA 1YSQA 2VEAA 1VHMA 5DFXA 2VKSA 4EU0A 2Y8HA 4Q0HA 2O9AA 4Y2FA 3W2ZA 2K2NA 4FOFA 3BJNA 3KSGA 4MMNA 3S7PA 3MF0A 3OOVA 1F5MA 1YSPA 3CI6A 4LRXC 2QYBA 2W3GA 4G3WA 1MC0A 1TD5A 4IUHA 4MN7A 2GX5A 3NOPC 2VZWA 5TJJA 5K5BA 3O5YA 4O01A 3KO6A 5I5LA 2KOIA 3D3OA 3KSFA 2HGVA 2XROA 3E0YA 4G3VA 3TRCA 4G3KA 4Y3IA 5HSQA 4MDZA 1YKDA 2W1TA 2W3HA 4Q0JA 4DN0A 3S7NA 4Z1WA 2XSSA 5L8MA 3EEAA 2Y79A 2W1RA 2O9BA 2KLIA 2O0YA 3RFBA 4E04A 4IJGA 3MQ0A 5C5KA 2W3EA 4Q0IA 4R6LA 4BWIA 2G7UA 2OOLA 4ETXA 4QPRA 2IA2A 2M7VA 4MCWA 4R70A 1STZA 3NOTC 3OBFA 2LB5A 2K31A 3IBJA 4LRZE 4LRYC 4IUKA 4Y5FA 2B18A 2M7UA 3E98A 4GW9A 3C2WA 3VV4A 1MKMA 4YNRA 5HPIA 3MMHA
chains in the Genus database with same CATH superfamily
4WBGA 3LEZA 2H0TA 4BL2A 1EWZA 2ZM0A 3G2ZA 2Y2LA 2M1CA 3IWIA 4P87A 3H82B 1TF1A 3SZTA 3MS6A 2QPNA 3MZFA 1OTDA 4JXSA 3V3RA 1MWRA 4HHDA 4LFUA 1KE0A 3W8KA 1G6AA 2P9VB 3V50A 5F83A 2PBDP 4IBRA 1QMEA 4HOIA 4LPZA 3VOYA 2JKTI 4FUWA 2Z6CA 1N9BA 4PM6A 2Y2PA 3FC7A 4I39A 4UA9A 4ZAMA 1NYYA 1PI5A 5D3OA 5GLAA 2IWCA 1K38A 2QJ5A 3MQQA 5TJJA 2V0UA 3UE3A 5CECA 3MXQA 1PZOA 1T1CA 3FG8A 3KYZA 5A91A 3HLCA 5HFOA 3HUNA 1T18A 3BLSA 1YLJA 2I9VA 4EV4A 4S2MA 1XXMA 4L9GA 2WZZA 4P6BA 2ZC5B 3HREA 4E3KA 4HNBA 3LR5A 1BYWA 3AGEA 1NLYA 1G6OA 3O88A 1PW1A 3HUMA 3IBJA 4YFMA 4X68A 3IH8A 1WE4A 3TJZC 1NWZA 1BLCA 2HDSA 3M2KA 2XQZA 3PBQA 4NETA 5HDSA 5EVIB 2Y2NA 3KSIA 1LL8A 5CHJA 2JN7A 4OPZA 2K7SA 4WEJA 4EUVA 5M1AA 3CWFA 2HJ9C 3LYXA 3K2NA 3HLEA 3IXHA 2Y2QA 5A90A 2QJ7A 3CLOA 5HL6A 3DWZA 1P9WA 1YSQA 3B33A 1BULA 3C7UA 3LCEA 1IYPA 5EM0A 1FQGA 4GN2A 1MZUA 4HESA 2UWXA 2HDRA 3A3DA 3T4QA 5FASA 4X25A 5CRFA 1K4EA 2NUPC 4MN7A 2Y2JA 4X69A 3ISGA 3B3XA 4IVKA 2HGVA 3F1PB 2WAFA 1EROA 1IKIA 4Y3IA 1WA9A 4ID4A 1HVBA 1DJBA 1OTBA 4WEKA 5FDSA 4JGOA 1FIKA 4Y15A 4WELA 2JKRM 1GSXA 1V9YA 1Z09A 2ZL1B 2P08A 5GLBA 3UB7A 1O07A 2IWBA 4L0LA 4R4SA 5E2FA 1SHVA 5KMWA 1S4SA 2M7VA 1IOUA 4ARZA 3OBFA 4H8RA 1ESUA 2XA7S 1YAXA 3IF6A 4UHUA 4HJ6A 1ZC2A 4ZBEA 3BYDA 5HPIA 1L2SA 1JWZA 2W3DA 5A92A 3GQZA 2Y2OA 3VFHA 1TS7A 1GA0A 2MJ6A 3K3CA 4IHQA 3NECA 3E2LA 5G18A 5AQBA 4UA7A 1ES5A 4EQIA 4P6ZS 3V39A 2EXBA 3JVVA 1GSWA 2EFXA 4JF6A 2WUQA 4FOFA 3D72A 4N1HA 2ZBBA 4X1LA 1CEFA 5CHMA 2QWSA 5HAQA 1NYMA 3CI6A 3BEBA 1IEMA 1Y4OA 2R9XA 1ES2A 3G31A 3LI8A 2VZWA 5CEDA 3MKFA 4N9LA 4HH2A 3H9WA 4WUJA 3GSGA 4FH4A 4E6XA 2ACGA 4II7A 3VE3A 4CLCA 3TRCA 4S2NC 1XKZA 2AVXA 2A3UA 2PD7A 2DNSA 4S2JA 2ZQ9A 4UEYA 5AVFA 4FH2A 1DJAA 5AVEA 3SH7A 1ZG6A 4R6LA 3PYPA 4GCZA 1CI8A 4E3OA 1STZA 1C3BA 4F3LA 2P04A 3E98A 4HY8A 3N8SA 5HWVA 1D7EA 5JYOA 5CHUA 3CG5A 3OC2A 3GVBA 1SZVA 4NXGA 1IKGA 5CEBA 3T4SA 3CITA 2WGWA 1T1AA 4PHTA 5CX7A 1F98A 2ZC4B 3R7WA 5EPHA 1F2KA 2V2FF 4NK3A 3Q7VA 2L0WA 1W7FA 1DY6A 4E3MA 4GDBA 4P0MA 1P9RA 4EEPA 2GDNA 3WS5A 2O9AA 5M18A 2Z2MB 1CI9A 3JPUA 3S7PA 3S22A 3ULFA 1IYOA 2Q9MA 4RX2A 4OOMA 3LY4A 3OOVA 4I5SA 3OLOA 4GB7A 2PU4A 4E3IA 4S2LA 5FSRA 2PT7A 1MXOA 3ZNYA 4O01A 3N6IA 3JYIA 4N9KA 1YQSA 3NC8A 4MBHA 1S67L 4MDZA 1YLTA 1IYSA 1UWNX 2G2UA 3SH9A 4KENB 2Y79A 1S66L 1AXBA 3PAEA 4FTXA 3ZG8B 3CPTB 5HWWA 4JF4A 4LV3A 3ZHHA 1FCOA 2JHEA 1W5DA 1NZOA 3ICYA 1OTAA 2ZQ7A 3D9YA 2EX2A 3RH8B 2OSUA 3C2WA 4DE2A 4NG2A 2D01A 1WYBA 3OZHA 2X02A 4AFIA 3T50A 4U3TA 4OP5A 3G6OA 2ZOHA 2DRWA 1HD8A 3IF6B 4KQRA 1FR1A 3QNBA 1NRJA 3QP8A 4KZ8A 3ZQ5A 4CLCE 1FILA 5GLCA 4DMZA 1KVMA 5E2EA 4EUZA 4Y13A 5AQAA 1KVLA 2Q9NA 1H3QA 1E25A 2VV6A 1K0KA 2J3TD 4I3JA 4K0WA 1VHMA 5CTNA 1FCNA 2QZ6A 3KSGA 3VOZA 2FZ0A 4QY5A 4LRXC 1BUEA 2QYBA 1FCMA 3OCLA 4OLDA 1MBLA 3DTMA 1PIOA 2CMNA 3RTYA 2KOIA 3D3OA 4NXFA 4OONA 2PRFA 4S2PA 2HPBA 1YM1A 5DTKA 3PHYA 5EE8A 3CMZA 2W1TA 1W79A 1JTDA 4HP4A 2L4RA 3EEAA 5FQ9A 2EFUA 3TG9A 4GD6A 2VX8A 1YLYA 3ZYTA 5F82A 1NRFA 3N8RA 3FPWA 1RCJA 1XA7A 1K55C 3A3EA 1FOFA 3CJMA 1W8QA 4RA7A 3F1NB 3P09A 4IUKA 1CQAA 2B18A 5BOHA 3C30A 1SKFA 3HL9A 2PD8A 4MN5A 2H0YA 2B02A 1L3LA 5FA7A 1MWSA 4N1XA 4UQIS 2FH5A 1XJ6A 5FDHA 4F3LB 4GLQA 4R3AA 3O86A 1K57C 3T4TA 4DJ3A 4R3BA 3FYZA 4H6JB 4OOYA 3W4OA 3EGDC 1JNUA 2G2WA 5EECA 4X6TA 1E3UD 4KZ4A 2V8CA 5HAIA 1TS8A 4DRTA 1H8YA 4DXBA 3WS1A 3UB6A 1K25A 2XH9A 3IHAA 1W63Q 4BBVA 1K54C 5FEFA 2WKPA 1TD5A 4XT2A 4HH3A 5TBMA 3ZVTA 1XFNA 3IS2B 2V9AA 2XFSA 2A2LA 3T1RA 3TW8A 3OPRA 2VK3A 2WGIA 5TFQA 4Y0UA 2JBFA 1MWTA 3SS5A 3FWLA 5J4EA 3WRTA 4GDNA 3CUEC 5FAQA 2O0YA 3A3FA 3GECA 3IH9A 1S0WA 1GHMA 2G7UA 3MKEA 4B93A 3M6HA 5FAPA 3LIDA 2OLVA 4PKYA 3N7WA 3NIAA 1LI9A 1LSVA 4KUOA 4GS9A 3L7HA 5E2GA 3DW0A 3N8LA 5CXWA 1ONGA 1LT0A 1XA1A 4R1GA 5GL9A 4CQHA 3EGXC 3ZGAB 5EV0A 2Q0OA 4Z9QA 1ESIA 1XJ3A 3LFVA 5HZHA 4CLCD 3IX4A 3Q81A 4PPRA 1OPXA 2J9PA 2HF6A 2ZQ8A 2WGVA 2VEAA 2Y2IA 5FQIA 3C4PA 3P98A 1XPBA 4FSFA 4PKYG 5TR7A 2VV8A 3VMAA 1DRMA 1DP9A 1UGUA 3PTEA 1HZOA 1G28A 3IXGA 1YPRA 4WZ5C 1OMEA 1BLSA 1NZUA 2PR5A 1YLPA 5EUAA 1RP5A 1KE3A 3DAVA 4DE1A 3QHYA 2A24B 1N4OA 1DP6A 5F5YA 1LI0A 4K0XA 1VEUA 5J3WA 5FEGA 4S2IA 4M3KA 2XSSA 4KG5A 2OWHA 2WKQA 3RFBA 1CK3A 2YKFA 4E04A 3FKWA 5C5KA 2W3EA 3WS2A 3VP4A 2OOLA 4JXGA 3T1XA 4R70A 4FD8A 3NY4A 4MEZA 2A49A 3C38A 3N4IA 4JPMA 4C3QA 1E3UA 1GHIA 3UMDA 3UE6A 1MKMA 3MMHA 4Z1WA 2W3FA 4O8GA 3R4KA 3SH8A 2J7VA 5L2FA 2WYXA 3HLWA 1CF0A 2XD1A 5KSHA 2R78A 2O99A 4E3JA 2XEPA 3EOIA 2Y2MA 1DP8A 1PWGA 2OV5A 3TSGA 2B95A 2L1MA 2B5RA 3OPHA 3IXBA 3RXXA 4UAAA 4HQAA 1K4FA 3HBRA 3A0RA 4XUZA 2ZMVA 4EU0A 4IVIA 3LICA 4Y2FA 1AWIA 4HI4A 4JGPA 4LV0A 4ZTKA 3SOIA 3UY6A 1F5MA 1GHPA 1EW0A 1K56A 1MC0A 5DF9A 5DF8A 2BG1A 3G4PA 3BLMA 3EEHA 4R23A 4EW7A 5HL1A 4S2KA 3UDIA 1LSWA 5EOOA 1X0OA 2ZC7A 1JVJA 3LIBA 3VP1A 5EVIC 2VLGA 4XT2B 2BTFP 1TDLA 4EWFA 4KZBA 5HW3A 2KDKA 2UV0E 4I3AA 1PWCA 5EVLA 4D2OA 3UB9A 5FQMA 4BWIA 4BBTA 4X53A 2LB5A 4JGRA 3PBNA 4ZJ3A 4LRYC 4Y0TA 4E3LA 4BBUA 3GTCA 1TS0A 3VV4A 1ODVA 1GCEA 4WZ4A 2XRNA 4R38A 2ZQAA 4KQQA 2WKHA 4ZJ2A 2RCXA 2JKFA 3VP0A 1T1BA 3Q07A 4LENA 1U60A 3KYEA 3ITBA 4GS9B 1P0ZA 2VGLS 4KQDA 3FKVA 1LL5A 1NJ4A 3BQ8A 1N9NA 5HX9A 3BY9A 5HDCA 3MSHA 4Q0HA 4GKUA 4KZ9A 5G4YA 3PBSA 4UQIM 3P01A 2JKRI 3KX0X 4IUHA 2R9WA 2Y59A 2VV7A 2ZD8A 1MY8A 2P74A 2HDUA 5K5BA 2DCFA 4JKTA 2GZAA 3UPOA 2ZLYA 3E0YA 5TGFA 4DDSA 3BWLA 2PBYA 5F69A 4IEDA 4ZDXA 2WKRA 2XGNA 1PWDA 4PM7A 1YMSA 4WMCD 1D06A 2XK1A 4F94A 1E4DA 2O9BA 4P85A 3ITAA 4KQOA 3ZDJA 4PM9A 3VE4A 3LGOA 4U0TA 3FZCA 2ZM8A 4Y7PA 2OWJA 3BFFA 3E4PA 2EWVA 2EXAA 2M7UA 4NEED 2V1ZA 4YNRA 4EESA 2XF3A 4B4XA 4D60A 2NUTC 5IS1A 3V3SA 1ZKJA 4DXCA 3NDEA 4KZ3A 4HP9A 2XDMA 2PR6A 1IELA 4BJPA 3UB5P 2V8FA 1HLUP 1RGYA 1ERQA 3O3VA 3BY8A 5GLDA 4C6YA 1M40A 4L9EA 3DTIA 5AJGA 3NOUC 3P7NA 3ZNTA 3BFDA 2H5SA 3UN7A 5L07A 3Q7ZA 1IYQA 2Y2GA 1XP4A 5EOEA 3W2ZA 4ARZB 2ZM2A 2Y55A 4X55A 3E4QA 2Y2HA 3V5MA 3ZG9B 4CPKA 2PDRA 4JF5A 3O5YA 4DF6A 2Z2LB 3MXSA 1ALQA 4PMAA 2JKTM 5A8BA 3B42A 4M4XA 3RXWA 5HSQA 4UA6A 3BW6A 3BRMA 4S2NA 5HD3A 4XUXA 1N9OA 4HJ4A 4U0XA 3MQ0A 2RL3A 1NY0A 4Q0IA 3HUOA 4K08A 1KDSA 1FSWA 4QU3A 4DE0A 2ZOIA 4BD1A 5DTTA 1GSVA 3GR2A 2VGJA 4MN6A 4GD8A 3UNWA 1ZTUA 3LR4A 4PAUA 3S4XA 2ZMFA 3T1QB 4OLGA 3UB8A 1J9MA 4CLCB 2I72A 4S2OA 4Q8IA 4DKIA 3KSHA 5LBRA 4YOFA 5KZHA 3BQAA 2ZL1A 3NDGA 3ZVWA 5DF7A 4OQHA 3O87A 4QJGA 2GJ3A 5FATA 3QP1A 3C4OA 3MJQA 2VKSA 2EX9A 4E3NA 2Y8HA 4WMCA 4JLFA 4HBTA 4MBFA 1A0KA 3LI9A 4QHCA 2Y91A 4GOGA 3NOPC 2EA9A 2V20A 4WM9A 1TS6A 1BSGA 1LHYA 2XA7M 1YMXA 4LCLA 1XJ2A 5F6AA 4EXOA 3H7WA 2HP5A 5I5LA 2HV1A 3WWXA 1SKOA 1XFQA 2WGWB 4JXWA 2ZJ9A 4KG6A 2X01A 4GZBA 2W3HA 4MLLA 5EVEA 3UE1A 3R7WB 3VFFA 3Q7VB 1HTZA 1SCWA 4RVAA 3VSKA 4EBPA 3MZDA 5CTMA 3IF6C 5HWTA 4BL3A 3PBOA 4EBNA 4OOLA 4DDYA 4P6ZM 2FFYA 1J3WA 1OTIA 1KOUA 5IT5A 4A5RA 3DWKA 2QMIA 5F1FA 4JXVA 3EQVA 1VETA 1BZAA 3LUQA 2VJWA 4ETZA 4O0PA 5AQ7A 2HDQA 4OQ0A 5GHZA 1K56D 4B9OA 3S7QA 2EWWA 1ES4A 1I2SA 3U2AA 2ZC6B 3SW1A 3T1SA 1F9IA 3EWKA 4JGQA 4IBXA 3NULA 3QNCA 5FI7A 3LIAA 5G4ZA 3WS0A 4XXRA 4MBKA 3T4JA 2CC1A 1YLWA 3A0SA 1Y54A 1S4RA 2W27A 4O7DA 3TE8A 4ESPA 2K2NA 4HEFA 1BTLA 3MQOA 1I2WA 3UDFA 3G30A 2W3GA 4G3WA 1DJCA 3BFGA 1KGEA 5L09A 3U4LP 4CLCC 1YLZA 3A3IA 4L9FA 4RX3A 5CGWA 3Q1FA 1RGZA 1PNEA 2VGLM 1EI5A 5GHXA 4FCFA 1OJGA 5FQJA 1IFQA 2VA0A 1VB6A 1L0DA 4EEUA 4OKPA 1PI4A 3C8CA 3MFDA 4LCMA 3ZG0A 3WRZA 2X71A 3DTEA 3G35A 1Q2PA 1V9ZA 3AGFA 4ETXA 5F1GA 4EBLA 3NOTC 2HZ5A 2Z6DA 3DTKA 3A3JA 4OQGA 2H10A 4Y5FA 1KE4A 4PM5A 1K55A 2XD5A 3ZG5A 4BD0A 5DTSA 3GMWA 3GDIA 3QP2A 4LV1A 5HPFA 1S1ZA 4WF0A 2WADA 5E2HA 3DBAA 5EFWA 1Q2QA 2D02A 2LB9A 3CHWP 1L0EA 2W1TB 3IT9A 3RJUA 3IXDA 3HCYA 4OVDA 2FFFB 2HJEA 4N92A 4BLMA 2E8IA 1KDWA 4JBFA 2O9CA 3CPTA 3PAGA 1K57A 2INWA 4RYEA 3M6BA 1D1JA 1K6SA 2OAQ1 3MR0A 3BM6A 4GHIA 4DE3A 3E2KA 3F1OA 3VP3A 3BJNA 3MF0A 1SDNA 1MKIA 1YSPA 3T12B 3G32A 2HP9A 2EX8A 5IU1A 3UDXA 2PYPA 3G34A 4NKPA 1L0GA 1PZPA 2ZC3B 3GV9A 3FV7A 1S6RA 3HJIA 1K54A 1H8ZA 2OAP1 3MBZA 1K6RA 5HAPA 2V1BA 2QHKA 3PBRA 1YKDA 2QKPA 4I3IA 4QB8A 1GA9A 1N9LA 2Y4AA 2J9OA 5KIZA 1T19A 1OT6A 3E4OA 5KSCA 5L8MA 4GNUA 3IWOA 2W1RA 3K3DA 1TDGA 1PRQA 3H7WB 4R4RA 4YWZA 1ERMA 1VQQA 1SKOB 4NXEA 3CUEA 3LIFA 3T4OA 2XLNA 3I7JA 5DKLA 1H0MA 1VM1A 1CJFA 4LRZE 1TEMA 3SS4A 4HIAA 5DJTA 3G2YA 5TBMB 3Q82A 3L9KA 3VSLA 5DKKA 3T4LA 4OH0A 1JTGA 3VOLA 2ZQDA 2PHYA 5EVID 5MC7A 4RQ9A 3IBRA 3IF5A 2ZQCA 3HLBA 3CAXA 1KGGA 2KX6A 3C5AA 1VETB 1H5XA 3LO7A 4HBUA 4WN5A 4B88A 4C75A 3C7VA 5E43A 4GJ4A 3IX8A 3QP6A 4WL9A 5U47A 1BLHA 3PBTA 5HARA 2XFTA 3HJKA 4KZ6A 2VGKA 3D4FA 2C5WB 2V1AA 3SS3A 5CGSA 3F1NA 1XJ4A 3LEQA 2JE5A 5FI6A 1SDEA 3PXPA 5IHVA 3GRJA 4WZ5A 1L0FA 1XGJA 3KSFA 5JYPA 3ZG7B 1CEGA 4G3KA 3QP5A 4OPYA 4OPQA 4HJ3A 3S7NA 1PFLA 3IQAA 1P97A 4WYYA 1MWUA 4H6JA 5L10A 4IJGA 4NXBA 1M6KA 3M2JA 4QPRA 2K31A 3H82A 4KZ5A 3A0VA 3FPVA 4ZJ1A 1WYCA 4GW9A 4WLAA 2P9VA 1TVFA 3UMEA 1MPLA 3IS2A 2JCHA 1S1YA 5DFYA 3NHQA 4LGWA 1XX2A 1ES3A 1H8MA 2YKHA 2EX6A 1VEUB 5F68A 3LY3A 4ZRRA 2Y2KA 3CZDA 2IWDA 3NJAA 1LSXA 1BLPA 1OTEA 2JC7A 1Y28A 2GNXA 2P7JA 2WKIA 4OPRA 1QMFA 4MMNA 4LLOB 4BQMA 4EQ1A 1I5QA 1XGIA 3OPPA 3OCNA 1O7EA 4X56A 2E8JA 3EQUA 2WK0A 4R3JA 1JWPA 1Z6FA 5DJUA 1G68A 1OT9A 4BMWA 3WS4A 3NBLA 2W0NA 3KO6A 3MFXA 4QWOA 4GHIB 4LV2A 3F1OB 2XROA 3ZFZA 4OQIA 2BLSA 3BECA 3VP2A 5I94A 4B4ZA 5A93A 3NI9A 4Q0JA 2J8YA 2C6WB 3LIEA 5FQQA 1ONHA 3T4KA 3JVUA 4CJNA 1BT5A 3HLDA 3OPLA 2KLIA 3IHBA 5HD5A 5EVIA 3UE0A 2J3WA 2J3TC 3HLGA 4PM8A 4KZ7A 4MCWA 1ACFA 4MNRA 3UO9A 4DJ2A 4KZAA 2PYRA 2PU2A 2ZMAA 3W4PA 4OP8A 2XR0A 1OJ5A 5CERA 3AGDA 4QY6A 2A24A 1JWVA 3HLFA 2WZXA 1ZHHB 1W63M 5GHYA 1KGFA 2PAVP 3S7OA 5FL3A 4EETB 3QP4A 4ME4A 2V0WA 5AQ9A 3PR6A 3TOIA 4KUKA 1NXYA 4EERA 2WKEA 1LLBA 3MZEA 2J80A 5DFXA 3NCKA 2DMWA 3F1PA 4BENA 5J8XA 3BFCA 1NLZA 5DVAA 3UPPA 3HVFA 5EM1A 3ZCZA 3BFEA 5M19A 3S1YA 5CGXA 3V67A 4QD4A 2GX5A 3LR0A 3IX3A 3LR3A 2OLUA 4X1MA 4G3VA 3UPNA 1G5UA 1LL9A 3MXRA 1FSYA 1ZG4A 4Y0OA 2HP6A 5FAOA 5FI2A 4DN0A 4KG2A 2JKGA 1FR6A 4E6WA 5J7EA 5HDDA 5FQKA 3KYQA 1UWPX 1W8YA 3B47A 4K91A 1YT4A 4YINA 1PYYA 4R0QA 2BASA 1PW8A 2H28A 2IA2A 4Y17A 2WAEA 3IWQA 3W4QA 4I38A
chains in the Genus database with same CATH topology
3GDIA 5HPFA 4AFIA 3T50A 1S1ZA 2XRNA 4WF0A 4R38A 3G6OA 3DBAA 5EFWA 2ZOHA 2M1CA 2D02A 2LB9A 3H82B 1TF1A 2W1TB 1NRJA 1OTDA 3ZQ5A 4CLCE 3HCYA 4HHDA 1T1BA 4DMZA 2HJEA 4GS9B 1H3QA 1P0ZA 2O9CA 2VGLS 4HOIA 2VV6A 2J3TD 4KQDA 2INWA 2JKTI 4LPZA 4I3JA 2Z6CA 1VHMA 3BQ8A 1N9NA 2OAQ1 3MR0A 3FC7A 3BY9A 4GHIA 4I39A 5HDCA 3F1OA 4Q0HA 3BJNA 3KSGA 2FZ0A 3MF0A 5G4YA 3PBSA 4UQIM 1YSPA 4LRXC 2QYBA 3OCLA 3P01A 2JKRI 3KX0X 4IUHA 5IU1A 2PYPA 4NKPA 2QJ5A 3MQQA 2VV7A 5TJJA 2V0UA 5K5BA 3UE3A 3HJIA 2CMNA 3RTYA 2KOIA 3D3OA 4NXFA 3MXQA 2OAP1 1T1CA 2GZAA 3FG8A 3E0YA 3KYZA 2V1BA 2QHKA 3PBRA 3PHYA 1YKDA 2QKPA 2W1TA 4I3IA 3BWLA 1N9LA 5F69A 5KIZA 1T19A 2WKRA 1OT6A 4HP4A 3E4OA 1T18A 1D06A 2L4RA 5L8MA 3EEAA 2I9VA 2W1RA 2O9BA 3K3DA 2VX8A 3H7WB 4YWZA 4L9GA 4KQOA 3VE4A 3ZYTA 4NXEA 4HNBA 3LR5A 3FPWA 1BYWA 3CUEA 3LIFA 3T4OA 2OWJA 5DKLA 1NLYA 1G6OA 3IBJA 3E4PA 4LRZE 2EWVA 3F1NB 4HIAA 4IUKA 2B18A 2M7UA 4NEED 3C30A 5DJTA 4YNRA 3TJZC 1NWZA 5TBMB 4EESA 2PD8A 4MN5A 2B02A 3PBQA 5HDSA 2NUTC 5IS1A 3KSIA 4UQIS 5DKKA 3T4LA 2FH5A 4HP9A 1LL8A 1XJ6A 2PR6A 2JN7A 4BJPA 4F3LB 4GLQA 4R3AA 2K7SA 4WEJA 3VOLA 3BY8A 2PHYA 4EUVA 5MC7A 4RQ9A 3CWFA 2HJ9C 3LYXA 4L9EA 3IBRA 3K2NA 3T4TA 5AJGA 3NOUC 3CAXA 4DJ3A 2KX6A 3P7NA 4H6JB 3EGDC 1JNUA 4WN5A 2QJ7A 3CLOA 5HL6A 4GJ4A 1P9WA 1YSQA 3B33A 4WL9A 1TS8A 3PBTA 1MZUA 3W2ZA 3HJKA 4ARZB 3UB6A 2V1AA 1W63Q 3E4QA 4BBVA 3F1NA 3T4QA 1XJ4A 2WKPA 2NUPC 1TD5A 4XT2A 4MN7A 4HH3A 2PDRA 3PXPA 5TBMA 1XFNA 3IS2B 3O5YA 2JKTM 5A8BA 2V9AA 3KSFA 3B42A 2HGVA 3F1PB 4M4XA 2A2LA 4G3KA 4Y3IA 5HSQA 3TW8A 1WA9A 1OTBA 4WEKA 3BW6A 4HJ3A 4JGOA 3S7NA 1P97A 5HD3A 5J4EA 4WELA 2JKRM 1V9YA 1GSXA 4H6JA 2P08A 1N9OA 3CUEC 2O0YA 3UB7A 4HJ4A 3GECA 4IJGA 3MQ0A 4NXBA 4L0LA 4Q0IA 2G7UA 4B93A 4K08A 3LIDA 1S4SA 4QPRA 2M7VA 1IOUA 4ARZA 3OBFA 2K31A 2ZOIA 2XA7S 1YAXA 3H82A 4HJ6A 3A0VA 4PKYA 3FPVA 1LSVA 4KUOA 4GW9A 1GSVA 4WLAA 5HPIA 3UMEA 4MN6A 2W3DA 4GS9A 3IS2A 1S1YA 1ZTUA 3LR4A 3NHQA 4PAUA 5DFYA 1TS7A 2ZMFA 1H8MA 3UB8A 2YKHA 1LT0A 4CLCB 2MJ6A 4CQHA 3EGXC 3K3CA 4IHQA 5F68A 4ZRRA 1XJ3A 3KSHA 5LBRA 4YOFA 3LFVA 5HZHA 4CLCD 3NJAA 3BQAA 1LSXA 1OTEA 1Y28A 2GNXA 4P6ZS 2P7JA 2GJ3A 1OPXA 2HF6A 2VEAA 3JVVA 3MJQA 2VKSA 1GSWA 2Y8HA 4FOFA 4LLOB 4MMNA 4EQ1A 4FSFA 3D72A 4PKYG 2VV8A 2ZBBA 3OCNA 1DRMA 1DP9A 1UGUA 3LI9A 2QWSA 1G28A 3CI6A 3EQUA 5DJUA 1OT9A 3LI8A 4BMWA 3NOPC 2EA9A 2VZWA 1TS6A 2W0NA 2XA7M 2PR5A 5F6AA 1XJ2A 4EXOA 3H7WA 3KO6A 4HH2A 3H9WA 3MFXA 2HV1A 4WUJA 5I5LA 4GHIB 1XFQA 3F1OB 4II7A 3VE3A 2A24B 2XROA 1DP6A 4CLCA 3TRCA 5F5YA 5J3WA 2PD7A 2W3HA 4Q0JA 3LIEA 3R7WB 3T4KA 2XSSA 5AVFA 4UEYA 2OWHA 3JVUA 5AVEA 2KLIA 2WKQA 3RFBA 2YKFA 5HD5A 4E04A 5HWTA 2J3WA 5C5KA 2W3EA 4R6LA 3PBOA 3PYPA 4GCZA 2J3TC 4OOLA 2OOLA 4MCWA 4P6ZM 1STZA 4R70A 4F3LA 2P04A 3C38A 4DJ2A 1OTIA 1KOUA 3E98A 4HY8A 3UMDA 5IT5A 2PYRA 5HWVA 1D7EA 1MKMA 3UE6A 3MMHA 4Z1WA 2W3FA 3EQVA 3LUQA 2VJWA 4O8GA 4ETZA 3OC2A 1OJ5A 3R4KA 4O0PA 4NXGA 4B9OA 3S7QA 2A24A 3T4SA 3CITA 2EWWA 1T1AA 3U2AA 4PHTA 5KSHA 2R78A 3SW1A 2O99A 1F9IA 1ZHHB 3EWKA 5CX7A 3EOIA 1F98A 4JGQA 1W63M 1DP8A 3S7OA 5FL3A 3R7WA 4EETB 3LIAA 4ME4A 5G4ZA 2V0WA 2L0WA 2L1MA 3PR6A 4KUKA 4EERA 3T4JA 1P9RA 3A0SA 4EEPA 4HQAA 1S4RA 2J80A 5DFXA 2W27A 3A0RA 2ZMVA 4EU0A 3TE8A 2DMWA 3F1PA 2O9AA 3LICA 4Y2FA 2K2NA 3S7PA 4HI4A 4JGPA 1NLZA 3ULFA 4OOMA 4I5SA 3MQOA 3OOVA 3OLOA 1F5MA 1EW0A 2W3GA 4G3WA 1MC0A 3V67A 5DF9A 2PT7A 2GX5A 4CLCC 3LR0A 4L9FA 3LR3A 4O01A 3EEHA 4G3VA 4EW7A 2VGLM 1S67L 4MDZA 1LSWA 1UWNX 1OJGA 4DN0A 1X0OA 3LIBA 1IFQA 2VLGA 4XT2B 2VA0A 2Y79A 1S66L 1VB6A 5J7EA 4EEUA 5HDDA 2KDKA 3C8CA 5HWWA 3KYQA 1UWPX 3B47A 4I3AA 3UB9A 4BWIA 4BBTA 1V9ZA 2JHEA 2BASA 4ETXA 2H28A 2IA2A 3ICYA 3NOTC 2LB5A 1OTAA 4JGRA 2Z6DA 3PBNA 4LRYC 4Y5FA 3RH8B 4BBUA 1TS0A 3C2WA 3VV4A 4I38A 2D01A 1ODVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3F A;  2W3D A;  2VJW A;  4O8G A;  4ETZ A;  3R4K A;  5HPF A;  4O0P A;  1ZTU A;  4PAU A;  3NHQ A;  5DFY A;  2XRN A;  2ZMF A;  3KSI A;  3S7Q A;  3G6O A;  3DBA A;  3CIT A;  2LB9 A;  4CQH A;  4GLQ A;  1TF1 A;  2O99 A;  2W1T B;  3ZQ5 A;  4EUV A;  4RQ9 A;  3HCY A;  4ZRR A;  3KSH A;  4DMZ A;  5LBR A;  3IBR A;  4YOF A;  3K2N A;  3S7O A;  5AJG A;  3NOU C;  3LFV A;  4ME4 A;  5HL6 A;  2O9C A;  1YSQ A;  2VEA A;  1VHM A;  5DFX A;  2VKS A;  4EU0 A;  2Y8H A;  4Q0H A;  2O9A A;  4Y2F A;  3W2Z A;  2K2N A;  4FOF A;  3BJN A;  3KSG A;  4MMN A;  3S7P A;  3MF0 A;  3OOV A;  1F5M A;  1YSP A;  3CI6 A;  4LRX C;  2QYB A;  2W3G A;  4G3W A;  1MC0 A;  1TD5 A;  4IUH A;  4MN7 A;  2GX5 A;  3NOP C;  2VZW A;  5TJJ A;  5K5B A;  3O5Y A;  4O01 A;  3KO6 A;  5I5L A;  2KOI A;  3D3O A;  3KSF A;  2HGV A;  2XRO A;  3E0Y A;  4G3V A;  3TRC A;  4G3K A;  4Y3I A;  5HSQ A;  4MDZ A;  1YKD A;  2W1T A;  2W3H A;  4Q0J A;  4DN0 A;  3S7N A;  4Z1W A;  2XSS A;  5L8M A;  3EEA A;  2Y79 A;  2W1R A;  2O9B A;  2KLI A;  2O0Y A;  3RFB A;  4E04 A;  4IJG A;  3MQ0 A;  5C5K A;  2W3E A;  4Q0I A;  4R6L A;  4BWI A;  2G7U A;  2OOL A;  4ETX A;  4QPR A;  2IA2 A;  2M7V A;  4MCW A;  4R70 A;  1STZ A;  3NOT C;  3OBF A;  2LB5 A;  2K31 A;  3IBJ A;  4LRZ E;  4LRY C;  4IUK A;  4Y5F A;  2B18 A;  2M7U A;  3E98 A;  4GW9 A;  3C2W A;  3VV4 A;  1MKM A;  4YNR A;  5HPI A;  3MMH A; 
#chains in the Genus database with same CATH topology
 4WBG A;  3LEZ A;  2H0T A;  4BL2 A;  1EWZ A;  2ZM0 A;  3G2Z A;  2Y2L A;  2M1C A;  3IWI A;  4P87 A;  3H82 B;  1TF1 A;  3SZT A;  3MS6 A;  2QPN A;  3MZF A;  1OTD A;  4JXS A;  3V3R A;  1MWR A;  4HHD A;  4LFU A;  1KE0 A;  3W8K A;  1G6A A;  2P9V B;  3V50 A;  5F83 A;  2PBD P;  4IBR A;  1QME A;  4HOI A;  4LPZ A;  3VOY A;  2JKT I;  4FUW A;  2Z6C A;  1N9B A;  4PM6 A;  2Y2P A;  3FC7 A;  4I39 A;  4UA9 A;  4ZAM A;  1NYY A;  1PI5 A;  5D3O A;  5GLA A;  2IWC A;  1K38 A;  2QJ5 A;  3MQQ A;  5TJJ A;  2V0U A;  3UE3 A;  5CEC A;  3MXQ A;  1PZO A;  1T1C A;  3FG8 A;  3KYZ A;  5A91 A;  3HLC A;  5HFO A;  3HUN A;  1T18 A;  3BLS A;  1YLJ A;  2I9V A;  4EV4 A;  4S2M A;  1XXM A;  4L9G A;  2WZZ A;  4P6B A;  2ZC5 B;  3HRE A;  4E3K A;  4HNB A;  3LR5 A;  1BYW A;  3AGE A;  1NLY A;  1G6O A;  3O88 A;  1PW1 A;  3HUM A;  3IBJ A;  4YFM A;  4X68 A;  3IH8 A;  1WE4 A;  3TJZ C;  1NWZ A;  1BLC A;  2HDS A;  3M2K A;  2XQZ A;  3PBQ A;  4NET A;  5HDS A;  5EVI B;  2Y2N A;  3KSI A;  1LL8 A;  5CHJ A;  2JN7 A;  4OPZ A;  2K7S A;  4WEJ A;  4EUV A;  5M1A A;  3CWF A;  2HJ9 C;  3LYX A;  3K2N A;  3HLE A;  3IXH A;  2Y2Q A;  5A90 A;  2QJ7 A;  3CLO A;  5HL6 A;  3DWZ A;  1P9W A;  1YSQ A;  3B33 A;  1BUL A;  3C7U A;  3LCE A;  1IYP A;  5EM0 A;  1FQG A;  4GN2 A;  1MZU A;  4HES A;  2UWX A;  2HDR A;  3A3D A;  3T4Q A;  5FAS A;  4X25 A;  5CRF A;  1K4E A;  2NUP C;  4MN7 A;  2Y2J A;  4X69 A;  3ISG A;  3B3X A;  4IVK A;  2HGV A;  3F1P B;  2WAF A;  1ERO A;  1IKI A;  4Y3I A;  1WA9 A;  4ID4 A;  1HVB A;  1DJB A;  1OTB A;  4WEK A;  5FDS A;  4JGO A;  1FIK A;  4Y15 A;  4WEL A;  2JKR M;  1GSX A;  1V9Y A;  1Z09 A;  2ZL1 B;  2P08 A;  5GLB A;  3UB7 A;  1O07 A;  2IWB A;  4L0L A;  4R4S A;  5E2F A;  1SHV A;  5KMW A;  1S4S A;  2M7V A;  1IOU A;  4ARZ A;  3OBF A;  4H8R A;  1ESU A;  2XA7 S;  1YAX A;  3IF6 A;  4UHU A;  4HJ6 A;  1ZC2 A;  4ZBE A;  3BYD A;  5HPI A;  1L2S A;  1JWZ A;  2W3D A;  5A92 A;  3GQZ A;  2Y2O A;  3VFH A;  1TS7 A;  1GA0 A;  2MJ6 A;  3K3C A;  4IHQ A;  3NEC A;  3E2L A;  5G18 A;  5AQB A;  4UA7 A;  1ES5 A;  4EQI A;  4P6Z S;  3V39 A;  2EXB A;  3JVV A;  1GSW A;  2EFX A;  4JF6 A;  2WUQ A;  4FOF A;  3D72 A;  4N1H A;  2ZBB A;  4X1L A;  1CEF A;  5CHM A;  2QWS A;  5HAQ A;  1NYM A;  3CI6 A;  3BEB A;  1IEM A;  1Y4O A;  2R9X A;  1ES2 A;  3G31 A;  3LI8 A;  2VZW A;  5CED A;  3MKF A;  4N9L A;  4HH2 A;  3H9W A;  4WUJ A;  3GSG A;  4FH4 A;  4E6X A;  2ACG A;  4II7 A;  3VE3 A;  4CLC A;  3TRC A;  4S2N C;  1XKZ A;  2AVX A;  2A3U A;  2PD7 A;  2DNS A;  4S2J A;  2ZQ9 A;  4UEY A;  5AVF A;  4FH2 A;  1DJA A;  5AVE A;  3SH7 A;  1ZG6 A;  4R6L A;  3PYP A;  4GCZ A;  1CI8 A;  4E3O A;  1STZ A;  1C3B A;  4F3L A;  2P04 A;  3E98 A;  4HY8 A;  3N8S A;  5HWV A;  1D7E A;  5JYO A;  5CHU A;  3CG5 A;  3OC2 A;  3GVB A;  1SZV A;  4NXG A;  1IKG A;  5CEB A;  3T4S A;  3CIT A;  2WGW A;  1T1A A;  4PHT A;  5CX7 A;  1F98 A;  2ZC4 B;  3R7W A;  5EPH A;  1F2K A;  2V2F F;  4NK3 A;  3Q7V A;  2L0W A;  1W7F A;  1DY6 A;  4E3M A;  4GDB A;  4P0M A;  1P9R A;  4EEP A;  2GDN A;  3WS5 A;  2O9A A;  5M18 A;  2Z2M B;  1CI9 A;  3JPU A;  3S7P A;  3S22 A;  3ULF A;  1IYO A;  2Q9M A;  4RX2 A;  4OOM A;  3LY4 A;  3OOV A;  4I5S A;  3OLO A;  4GB7 A;  2PU4 A;  4E3I A;  4S2L A;  5FSR A;  2PT7 A;  1MXO A;  3ZNY A;  4O01 A;  3N6I A;  3JYI A;  4N9K A;  1YQS A;  3NC8 A;  4MBH A;  1S67 L;  4MDZ A;  1YLT A;  1IYS A;  1UWN X;  2G2U A;  3SH9 A;  4KEN B;  2Y79 A;  1S66 L;  1AXB A;  3PAE A;  4FTX A;  3ZG8 B;  3CPT B;  5HWW A;  4JF4 A;  4LV3 A;  3ZHH A;  1FCO A;  2JHE A;  1W5D A;  1NZO A;  3ICY A;  1OTA A;  2ZQ7 A;  3D9Y A;  2EX2 A;  3RH8 B;  2OSU A;  3C2W A;  4DE2 A;  4NG2 A;  2D01 A;  1WYB A;  3OZH A;  2X02 A;  4AFI A;  3T50 A;  4U3T A;  4OP5 A;  3G6O A;  2ZOH A;  2DRW A;  1HD8 A;  3IF6 B;  4KQR A;  1FR1 A;  3QNB A;  1NRJ A;  3QP8 A;  4KZ8 A;  3ZQ5 A;  4CLC E;  1FIL A;  5GLC A;  4DMZ A;  1KVM A;  5E2E A;  4EUZ A;  4Y13 A;  5AQA A;  1KVL A;  2Q9N A;  1H3Q A;  1E25 A;  2VV6 A;  1K0K A;  2J3T D;  4I3J A;  4K0W A;  1VHM A;  5CTN A;  1FCN A;  2QZ6 A;  3KSG A;  3VOZ A;  2FZ0 A;  4QY5 A;  4LRX C;  1BUE A;  2QYB A;  1FCM A;  3OCL A;  4OLD A;  1MBL A;  3DTM A;  1PIO A;  2CMN A;  3RTY A;  2KOI A;  3D3O A;  4NXF A;  4OON A;  2PRF A;  4S2P A;  2HPB A;  1YM1 A;  5DTK A;  3PHY A;  5EE8 A;  3CMZ A;  2W1T A;  1W79 A;  1JTD A;  4HP4 A;  2L4R A;  3EEA A;  5FQ9 A;  2EFU A;  3TG9 A;  4GD6 A;  2VX8 A;  1YLY A;  3ZYT A;  5F82 A;  1NRF A;  3N8R A;  3FPW A;  1RCJ A;  1XA7 A;  1K55 C;  3A3E A;  1FOF A;  3CJM A;  1W8Q A;  4RA7 A;  3F1N B;  3P09 A;  4IUK A;  1CQA A;  2B18 A;  5BOH A;  3C30 A;  1SKF A;  3HL9 A;  2PD8 A;  4MN5 A;  2H0Y A;  2B02 A;  1L3L A;  5FA7 A;  1MWS A;  4N1X A;  4UQI S;  2FH5 A;  1XJ6 A;  5FDH A;  4F3L B;  4GLQ A;  4R3A A;  3O86 A;  1K57 C;  3T4T A;  4DJ3 A;  4R3B A;  3FYZ A;  4H6J B;  4OOY A;  3W4O A;  3EGD C;  1JNU A;  2G2W A;  5EEC A;  4X6T A;  1E3U D;  4KZ4 A;  2V8C A;  5HAI A;  1TS8 A;  4DRT A;  1H8Y A;  4DXB A;  3WS1 A;  3UB6 A;  1K25 A;  2XH9 A;  3IHA A;  1W63 Q;  4BBV A;  1K54 C;  5FEF A;  2WKP A;  1TD5 A;  4XT2 A;  4HH3 A;  5TBM A;  3ZVT A;  1XFN A;  3IS2 B;  2V9A A;  2XFS A;  2A2L A;  3T1R A;  3TW8 A;  3OPR A;  2VK3 A;  2WGI A;  5TFQ A;  4Y0U A;  2JBF A;  1MWT A;  3SS5 A;  3FWL A;  5J4E A;  3WRT A;  4GDN A;  3CUE C;  5FAQ A;  2O0Y A;  3A3F A;  3GEC A;  3IH9 A;  1S0W A;  1GHM A;  2G7U A;  3MKE A;  4B93 A;  3M6H A;  5FAP A;  3LID A;  2OLV A;  4PKY A;  3N7W A;  3NIA A;  1LI9 A;  1LSV A;  4KUO A;  4GS9 A;  3L7H A;  5E2G A;  3DW0 A;  3N8L A;  5CXW A;  1ONG A;  1LT0 A;  1XA1 A;  4R1G A;  5GL9 A;  4CQH A;  3EGX C;  3ZGA B;  5EV0 A;  2Q0O A;  4Z9Q A;  1ESI A;  1XJ3 A;  3LFV A;  5HZH A;  4CLC D;  3IX4 A;  3Q81 A;  4PPR A;  1OPX A;  2J9P A;  2HF6 A;  2ZQ8 A;  2WGV A;  2VEA A;  2Y2I A;  5FQI A;  3C4P A;  3P98 A;  1XPB A;  4FSF A;  4PKY G;  5TR7 A;  2VV8 A;  3VMA A;  1DRM A;  1DP9 A;  1UGU A;  3PTE A;  1HZO A;  1G28 A;  3IXG A;  1YPR A;  4WZ5 C;  1OME A;  1BLS A;  1NZU A;  2PR5 A;  1YLP A;  5EUA A;  1RP5 A;  1KE3 A;  3DAV A;  4DE1 A;  3QHY A;  2A24 B;  1N4O A;  1DP6 A;  5F5Y A;  1LI0 A;  4K0X A;  1VEU A;  5J3W A;  5FEG A;  4S2I A;  4M3K A;  2XSS A;  4KG5 A;  2OWH A;  2WKQ A;  3RFB A;  1CK3 A;  2YKF A;  4E04 A;  3FKW A;  5C5K A;  2W3E A;  3WS2 A;  3VP4 A;  2OOL A;  4JXG A;  3T1X A;  4R70 A;  4FD8 A;  3NY4 A;  4MEZ A;  2A49 A;  3C38 A;  3N4I A;  4JPM A;  4C3Q A;  1E3U A;  1GHI A;  3UMD A;  3UE6 A;  1MKM A;  3MMH A;  4Z1W A;  2W3F A;  4O8G A;  3R4K A;  3SH8 A;  2J7V A;  5L2F A;  2WYX A;  3HLW A;  1CF0 A;  2XD1 A;  5KSH A;  2R78 A;  2O99 A;  4E3J A;  2XEP A;  3EOI A;  2Y2M A;  1DP8 A;  1PWG A;  2OV5 A;  3TSG A;  2B95 A;  2L1M A;  2B5R A;  3OPH A;  3IXB A;  3RXX A;  4UAA A;  4HQA A;  1K4F A;  3HBR A;  3A0R A;  4XUZ A;  2ZMV A;  4EU0 A;  4IVI A;  3LIC A;  4Y2F A;  1AWI A;  4HI4 A;  4JGP A;  4LV0 A;  4ZTK A;  3SOI A;  3UY6 A;  1F5M A;  1GHP A;  1EW0 A;  1K56 A;  1MC0 A;  5DF9 A;  5DF8 A;  2BG1 A;  3G4P A;  3BLM A;  3EEH A;  4R23 A;  4EW7 A;  5HL1 A;  4S2K A;  3UDI A;  1LSW A;  5EOO A;  1X0O A;  2ZC7 A;  1JVJ A;  3LIB A;  3VP1 A;  5EVI C;  2VLG A;  4XT2 B;  2BTF P;  1TDL A;  4EWF A;  4KZB A;  5HW3 A;  2KDK A;  2UV0 E;  4I3A A;  1PWC A;  5EVL A;  4D2O A;  3UB9 A;  5FQM A;  4BWI A;  4BBT A;  4X53 A;  2LB5 A;  4JGR A;  3PBN A;  4ZJ3 A;  4LRY C;  4Y0T A;  4E3L A;  4BBU A;  3GTC A;  1TS0 A;  3VV4 A;  1ODV A;  1GCE A;  4WZ4 A;  2XRN A;  4R38 A;  2ZQA A;  4KQQ A;  2WKH A;  4ZJ2 A;  2RCX A;  2JKF A;  3VP0 A;  1T1B A;  3Q07 A;  4LEN A;  1U60 A;  3KYE A;  3ITB A;  4GS9 B;  1P0Z A;  2VGL S;  4KQD A;  3FKV A;  1LL5 A;  1NJ4 A;  3BQ8 A;  1N9N A;  5HX9 A;  3BY9 A;  5HDC A;  3MSH A;  4Q0H A;  4GKU A;  4KZ9 A;  5G4Y A;  3PBS A;  4UQI M;  3P01 A;  2JKR I;  3KX0 X;  4IUH A;  2R9W A;  2Y59 A;  2VV7 A;  2ZD8 A;  1MY8 A;  2P74 A;  2HDU A;  5K5B A;  2DCF A;  4JKT A;  2GZA A;  3UPO A;  2ZLY A;  3E0Y A;  5TGF A;  4DDS A;  3BWL A;  2PBY A;  5F69 A;  4IED A;  4ZDX A;  2WKR A;  2XGN A;  1PWD A;  4PM7 A;  1YMS A;  4WMC D;  1D06 A;  2XK1 A;  4F94 A;  1E4D A;  2O9B A;  4P85 A;  3ITA A;  4KQO A;  3ZDJ A;  4PM9 A;  3VE4 A;  3LGO A;  4U0T A;  3FZC A;  2ZM8 A;  4Y7P A;  2OWJ A;  3BFF A;  3E4P A;  2EWV A;  2EXA A;  2M7U A;  4NEE D;  2V1Z A;  4YNR A;  4EES A;  2XF3 A;  4B4X A;  4D60 A;  2NUT C;  5IS1 A;  3V3S A;  1ZKJ A;  4DXC A;  3NDE A;  4KZ3 A;  4HP9 A;  2XDM A;  2PR6 A;  1IEL A;  4BJP A;  3UB5 P;  2V8F A;  1HLU P;  1RGY A;  1ERQ A;  3O3V A;  3BY8 A;  5GLD A;  4C6Y A;  1M40 A;  4L9E A;  3DTI A;  5AJG A;  3NOU C;  3P7N A;  3ZNT A;  3BFD A;  2H5S A;  3UN7 A;  5L07 A;  3Q7Z A;  1IYQ A;  2Y2G A;  1XP4 A;  5EOE A;  3W2Z A;  4ARZ B;  2ZM2 A;  2Y55 A;  4X55 A;  3E4Q A;  2Y2H A;  3V5M A;  3ZG9 B;  4CPK A;  2PDR A;  4JF5 A;  3O5Y A;  4DF6 A;  2Z2L B;  3MXS A;  1ALQ A;  4PMA A;  2JKT M;  5A8B A;  3B42 A;  4M4X A;  3RXW A;  5HSQ A;  4UA6 A;  3BW6 A;  3BRM A;  4S2N A;  5HD3 A;  4XUX A;  1N9O A;  4HJ4 A;  4U0X A;  3MQ0 A;  2RL3 A;  1NY0 A;  4Q0I A;  3HUO A;  4K08 A;  1KDS A;  1FSW A;  4QU3 A;  4DE0 A;  2ZOI A;  4BD1 A;  5DTT A;  1GSV A;  3GR2 A;  2VGJ A;  4MN6 A;  4GD8 A;  3UNW A;  1ZTU A;  3LR4 A;  4PAU A;  3S4X A;  2ZMF A;  3T1Q B;  4OLG A;  3UB8 A;  1J9M A;  4CLC B;  2I72 A;  4S2O A;  4Q8I A;  4DKI A;  3KSH A;  5LBR A;  4YOF A;  5KZH A;  3BQA A;  2ZL1 A;  3NDG A;  3ZVW A;  5DF7 A;  4OQH A;  3O87 A;  4QJG A;  2GJ3 A;  5FAT A;  3QP1 A;  3C4O A;  3MJQ A;  2VKS A;  2EX9 A;  4E3N A;  2Y8H A;  4WMC A;  4JLF A;  4HBT A;  4MBF A;  1A0K A;  3LI9 A;  4QHC A;  2Y91 A;  4GOG A;  3NOP C;  2EA9 A;  2V20 A;  4WM9 A;  1TS6 A;  1BSG A;  1LHY A;  2XA7 M;  1YMX A;  4LCL A;  1XJ2 A;  5F6A A;  4EXO A;  3H7W A;  2HP5 A;  5I5L A;  2HV1 A;  3WWX A;  1SKO A;  1XFQ A;  2WGW B;  4JXW A;  2ZJ9 A;  4KG6 A;  2X01 A;  4GZB A;  2W3H A;  4MLL A;  5EVE A;  3UE1 A;  3R7W B;  3VFF A;  3Q7V B;  1HTZ A;  1SCW A;  4RVA A;  3VSK A;  4EBP A;  3MZD A;  5CTM A;  3IF6 C;  5HWT A;  4BL3 A;  3PBO A;  4EBN A;  4OOL A;  4DDY A;  4P6Z M;  2FFY A;  1J3W A;  1OTI A;  1KOU A;  5IT5 A;  4A5R A;  3DWK A;  2QMI A;  5F1F A;  4JXV A;  3EQV A;  1VET A;  1BZA A;  3LUQ A;  2VJW A;  4ETZ A;  4O0P A;  5AQ7 A;  2HDQ A;  4OQ0 A;  5GHZ A;  1K56 D;  4B9O A;  3S7Q A;  2EWW A;  1ES4 A;  1I2S A;  3U2A A;  2ZC6 B;  3SW1 A;  3T1S A;  1F9I A;  3EWK A;  4JGQ A;  4IBX A;  3NUL A;  3QNC A;  5FI7 A;  3LIA A;  5G4Z A;  3WS0 A;  4XXR A;  4MBK A;  3T4J A;  2CC1 A;  1YLW A;  3A0S A;  1Y54 A;  1S4R A;  2W27 A;  4O7D A;  3TE8 A;  4ESP A;  2K2N A;  4HEF A;  1BTL A;  3MQO A;  1I2W A;  3UDF A;  3G30 A;  2W3G A;  4G3W A;  1DJC A;  3BFG A;  1KGE A;  5L09 A;  3U4L P;  4CLC C;  1YLZ A;  3A3I A;  4L9F A;  4RX3 A;  5CGW A;  3Q1F A;  1RGZ A;  1PNE A;  2VGL M;  1EI5 A;  5GHX A;  4FCF A;  1OJG A;  5FQJ A;  1IFQ A;  2VA0 A;  1VB6 A;  1L0D A;  4EEU A;  4OKP A;  1PI4 A;  3C8C A;  3MFD A;  4LCM A;  3ZG0 A;  3WRZ A;  2X71 A;  3DTE A;  3G35 A;  1Q2P A;  1V9Z A;  3AGF A;  4ETX A;  5F1G A;  4EBL A;  3NOT C;  2HZ5 A;  2Z6D A;  3DTK A;  3A3J A;  4OQG A;  2H10 A;  4Y5F A;  1KE4 A;  4PM5 A;  1K55 A;  2XD5 A;  3ZG5 A;  4BD0 A;  5DTS A;  3GMW A;  3GDI A;  3QP2 A;  4LV1 A;  5HPF A;  1S1Z A;  4WF0 A;  2WAD A;  5E2H A;  3DBA A;  5EFW A;  1Q2Q A;  2D02 A;  2LB9 A;  3CHW P;  1L0E A;  2W1T B;  3IT9 A;  3RJU A;  3IXD A;  3HCY A;  4OVD A;  2FFF B;  2HJE A;  4N92 A;  4BLM A;  2E8I A;  1KDW A;  4JBF A;  2O9C A;  3CPT A;  3PAG A;  1K57 A;  2INW A;  4RYE A;  3M6B A;  1D1J A;  1K6S A;  2OAQ 1;  3MR0 A;  3BM6 A;  4GHI A;  4DE3 A;  3E2K A;  3F1O A;  3VP3 A;  3BJN A;  3MF0 A;  1SDN A;  1MKI A;  1YSP A;  3T12 B;  3G32 A;  2HP9 A;  2EX8 A;  5IU1 A;  3UDX A;  2PYP A;  3G34 A;  4NKP A;  1L0G A;  1PZP A;  2ZC3 B;  3GV9 A;  3FV7 A;  1S6R A;  3HJI A;  1K54 A;  1H8Z A;  2OAP 1;  3MBZ A;  1K6R A;  5HAP A;  2V1B A;  2QHK A;  3PBR A;  1YKD A;  2QKP A;  4I3I A;  4QB8 A;  1GA9 A;  1N9L A;  2Y4A A;  2J9O A;  5KIZ A;  1T19 A;  1OT6 A;  3E4O A;  5KSC A;  5L8M A;  4GNU A;  3IWO A;  2W1R A;  3K3D A;  1TDG A;  1PRQ A;  3H7W B;  4R4R A;  4YWZ A;  1ERM A;  1VQQ A;  1SKO B;  4NXE A;  3CUE A;  3LIF A;  3T4O A;  2XLN A;  3I7J A;  5DKL A;  1H0M A;  1VM1 A;  1CJF A;  4LRZ E;  1TEM A;  3SS4 A;  4HIA A;  5DJT A;  3G2Y A;  5TBM B;  3Q82 A;  3L9K A;  3VSL A;  5DKK A;  3T4L A;  4OH0 A;  1JTG A;  3VOL A;  2ZQD A;  2PHY A;  5EVI D;  5MC7 A;  4RQ9 A;  3IBR A;  3IF5 A;  2ZQC A;  3HLB A;  3CAX A;  1KGG A;  2KX6 A;  3C5A A;  1VET B;  1H5X A;  3LO7 A;  4HBU A;  4WN5 A;  4B88 A;  4C75 A;  3C7V A;  5E43 A;  4GJ4 A;  3IX8 A;  3QP6 A;  4WL9 A;  5U47 A;  1BLH A;  3PBT A;  5HAR A;  2XFT A;  3HJK A;  4KZ6 A;  2VGK A;  3D4F A;  2C5W B;  2V1A A;  3SS3 A;  5CGS A;  3F1N A;  1XJ4 A;  3LEQ A;  2JE5 A;  5FI6 A;  1SDE A;  3PXP A;  5IHV A;  3GRJ A;  4WZ5 A;  1L0F A;  1XGJ A;  3KSF A;  5JYP A;  3ZG7 B;  1CEG A;  4G3K A;  3QP5 A;  4OPY A;  4OPQ A;  4HJ3 A;  3S7N A;  1PFL A;  3IQA A;  1P97 A;  4WYY A;  1MWU A;  4H6J A;  5L10 A;  4IJG A;  4NXB A;  1M6K A;  3M2J A;  4QPR A;  2K31 A;  3H82 A;  4KZ5 A;  3A0V A;  3FPV A;  4ZJ1 A;  1WYC A;  4GW9 A;  4WLA A;  2P9V A;  1TVF A;  3UME A;  1MPL A;  3IS2 A;  2JCH A;  1S1Y A;  5DFY A;  3NHQ A;  4LGW A;  1XX2 A;  1ES3 A;  1H8M A;  2YKH A;  2EX6 A;  1VEU B;  5F68 A;  3LY3 A;  4ZRR A;  2Y2K A;  3CZD A;  2IWD A;  3NJA A;  1LSX A;  1BLP A;  1OTE A;  2JC7 A;  1Y28 A;  2GNX A;  2P7J A;  2WKI A;  4OPR A;  1QMF A;  4MMN A;  4LLO B;  4BQM A;  4EQ1 A;  1I5Q A;  1XGI A;  3OPP A;  3OCN A;  1O7E A;  4X56 A;  2E8J A;  3EQU A;  2WK0 A;  4R3J A;  1JWP A;  1Z6F A;  5DJU A;  1G68 A;  1OT9 A;  4BMW A;  3WS4 A;  3NBL A;  2W0N A;  3KO6 A;  3MFX A;  4QWO A;  4GHI B;  4LV2 A;  3F1O B;  2XRO A;  3ZFZ A;  4OQI A;  2BLS A;  3BEC A;  3VP2 A;  5I94 A;  4B4Z A;  5A93 A;  3NI9 A;  4Q0J A;  2J8Y A;  2C6W B;  3LIE A;  5FQQ A;  1ONH A;  3T4K A;  3JVU A;  4CJN A;  1BT5 A;  3HLD A;  3OPL A;  2KLI A;  3IHB A;  5HD5 A;  5EVI A;  3UE0 A;  2J3W A;  2J3T C;  3HLG A;  4PM8 A;  4KZ7 A;  4MCW A;  1ACF A;  4MNR A;  3UO9 A;  4DJ2 A;  4KZA A;  2PYR A;  2PU2 A;  2ZMA A;  3W4P A;  4OP8 A;  2XR0 A;  1OJ5 A;  5CER A;  3AGD A;  4QY6 A;  2A24 A;  1JWV A;  3HLF A;  2WZX A;  1ZHH B;  1W63 M;  5GHY A;  1KGF A;  2PAV P;  3S7O A;  5FL3 A;  4EET B;  3QP4 A;  4ME4 A;  2V0W A;  5AQ9 A;  3PR6 A;  3TOI A;  4KUK A;  1NXY A;  4EER A;  2WKE A;  1LLB A;  3MZE A;  2J80 A;  5DFX A;  3NCK A;  2DMW A;  3F1P A;  4BEN A;  5J8X A;  3BFC A;  1NLZ A;  5DVA A;  3UPP A;  3HVF A;  5EM1 A;  3ZCZ A;  3BFE A;  5M19 A;  3S1Y A;  5CGX A;  3V67 A;  4QD4 A;  2GX5 A;  3LR0 A;  3IX3 A;  3LR3 A;  2OLU A;  4X1M A;  4G3V A;  3UPN A;  1G5U A;  1LL9 A;  3MXR A;  1FSY A;  1ZG4 A;  4Y0O A;  2HP6 A;  5FAO A;  5FI2 A;  4DN0 A;  4KG2 A;  2JKG A;  1FR6 A;  4E6W A;  5J7E A;  5HDD A;  5FQK A;  3KYQ A;  1UWP X;  1W8Y A;  3B47 A;  4K91 A;  1YT4 A;  4YIN A;  1PYY A;  4R0Q A;  2BAS A;  1PW8 A;  2H28 A;  2IA2 A;  4Y17 A;  2WAE A;  3IWQ A;  3W4Q A;  4I38 A; 
#chains in the Genus database with same CATH homology
 3GDI A;  5HPF A;  4AFI A;  3T50 A;  1S1Z A;  2XRN A;  4WF0 A;  4R38 A;  3G6O A;  3DBA A;  5EFW A;  2ZOH A;  2M1C A;  2D02 A;  2LB9 A;  3H82 B;  1TF1 A;  2W1T B;  1NRJ A;  1OTD A;  3ZQ5 A;  4CLC E;  3HCY A;  4HHD A;  1T1B A;  4DMZ A;  2HJE A;  4GS9 B;  1H3Q A;  1P0Z A;  2O9C A;  2VGL S;  4HOI A;  2VV6 A;  2J3T D;  4KQD A;  2INW A;  2JKT I;  4LPZ A;  4I3J A;  2Z6C A;  1VHM A;  3BQ8 A;  1N9N A;  2OAQ 1;  3MR0 A;  3FC7 A;  3BY9 A;  4GHI A;  4I39 A;  5HDC A;  3F1O A;  4Q0H A;  3BJN A;  3KSG A;  2FZ0 A;  3MF0 A;  5G4Y A;  3PBS A;  4UQI M;  1YSP A;  4LRX C;  2QYB A;  3OCL A;  3P01 A;  2JKR I;  3KX0 X;  4IUH A;  5IU1 A;  2PYP A;  4NKP A;  2QJ5 A;  3MQQ A;  2VV7 A;  5TJJ A;  2V0U A;  5K5B A;  3UE3 A;  3HJI A;  2CMN A;  3RTY A;  2KOI A;  3D3O A;  4NXF A;  3MXQ A;  2OAP 1;  1T1C A;  2GZA A;  3FG8 A;  3E0Y A;  3KYZ A;  2V1B A;  2QHK A;  3PBR A;  3PHY A;  1YKD A;  2QKP A;  2W1T A;  4I3I A;  3BWL A;  1N9L A;  5F69 A;  5KIZ A;  1T19 A;  2WKR A;  1OT6 A;  4HP4 A;  3E4O A;  1T18 A;  1D06 A;  2L4R A;  5L8M A;  3EEA A;  2I9V A;  2W1R A;  2O9B A;  3K3D A;  2VX8 A;  3H7W B;  4YWZ A;  4L9G A;  4KQO A;  3VE4 A;  3ZYT A;  4NXE A;  4HNB A;  3LR5 A;  3FPW A;  1BYW A;  3CUE A;  3LIF A;  3T4O A;  2OWJ A;  5DKL A;  1NLY A;  1G6O A;  3IBJ A;  3E4P A;  4LRZ E;  2EWV A;  3F1N B;  4HIA A;  4IUK A;  2B18 A;  2M7U A;  4NEE D;  3C30 A;  5DJT A;  4YNR A;  3TJZ C;  1NWZ A;  5TBM B;  4EES A;  2PD8 A;  4MN5 A;  2B02 A;  3PBQ A;  5HDS A;  2NUT C;  5IS1 A;  3KSI A;  4UQI S;  5DKK A;  3T4L A;  2FH5 A;  4HP9 A;  1LL8 A;  1XJ6 A;  2PR6 A;  2JN7 A;  4BJP A;  4F3L B;  4GLQ A;  4R3A A;  2K7S A;  4WEJ A;  3VOL A;  3BY8 A;  2PHY A;  4EUV A;  5MC7 A;  4RQ9 A;  3CWF A;  2HJ9 C;  3LYX A;  4L9E A;  3IBR A;  3K2N A;  3T4T A;  5AJG A;  3NOU C;  3CAX A;  4DJ3 A;  2KX6 A;  3P7N A;  4H6J B;  3EGD C;  1JNU A;  4WN5 A;  2QJ7 A;  3CLO A;  5HL6 A;  4GJ4 A;  1P9W A;  1YSQ A;  3B33 A;  4WL9 A;  1TS8 A;  3PBT A;  1MZU A;  3W2Z A;  3HJK A;  4ARZ B;  3UB6 A;  2V1A A;  1W63 Q;  3E4Q A;  4BBV A;  3F1N A;  3T4Q A;  1XJ4 A;  2WKP A;  2NUP C;  1TD5 A;  4XT2 A;  4MN7 A;  4HH3 A;  2PDR A;  3PXP A;  5TBM A;  1XFN A;  3IS2 B;  3O5Y A;  2JKT M;  5A8B A;  2V9A A;  3KSF A;  3B42 A;  2HGV A;  3F1P B;  4M4X A;  2A2L A;  4G3K A;  4Y3I A;  5HSQ A;  3TW8 A;  1WA9 A;  1OTB A;  4WEK A;  3BW6 A;  4HJ3 A;  4JGO A;  3S7N A;  1P97 A;  5HD3 A;  5J4E A;  4WEL A;  2JKR M;  1V9Y A;  1GSX A;  4H6J A;  2P08 A;  1N9O A;  3CUE C;  2O0Y A;  3UB7 A;  4HJ4 A;  3GEC A;  4IJG A;  3MQ0 A;  4NXB A;  4L0L A;  4Q0I A;  2G7U A;  4B93 A;  4K08 A;  3LID A;  1S4S A;  4QPR A;  2M7V A;  1IOU A;  4ARZ A;  3OBF A;  2K31 A;  2ZOI A;  2XA7 S;  1YAX A;  3H82 A;  4HJ6 A;  3A0V A;  4PKY A;  3FPV A;  1LSV A;  4KUO A;  4GW9 A;  1GSV A;  4WLA A;  5HPI A;  3UME A;  4MN6 A;  2W3D A;  4GS9 A;  3IS2 A;  1S1Y A;  1ZTU A;  3LR4 A;  3NHQ A;  4PAU A;  5DFY A;  1TS7 A;  2ZMF A;  1H8M A;  3UB8 A;  2YKH A;  1LT0 A;  4CLC B;  2MJ6 A;  4CQH A;  3EGX C;  3K3C A;  4IHQ A;  5F68 A;  4ZRR A;  1XJ3 A;  3KSH A;  5LBR A;  4YOF A;  3LFV A;  5HZH A;  4CLC D;  3NJA A;  3BQA A;  1LSX A;  1OTE A;  1Y28 A;  2GNX A;  4P6Z S;  2P7J A;  2GJ3 A;  1OPX A;  2HF6 A;  2VEA A;  3JVV A;  3MJQ A;  2VKS A;  1GSW A;  2Y8H A;  4FOF A;  4LLO B;  4MMN A;  4EQ1 A;  4FSF A;  3D72 A;  4PKY G;  2VV8 A;  2ZBB A;  3OCN A;  1DRM A;  1DP9 A;  1UGU A;  3LI9 A;  2QWS A;  1G28 A;  3CI6 A;  3EQU A;  5DJU A;  1OT9 A;  3LI8 A;  4BMW A;  3NOP C;  2EA9 A;  2VZW A;  1TS6 A;  2W0N A;  2XA7 M;  2PR5 A;  5F6A A;  1XJ2 A;  4EXO A;  3H7W A;  3KO6 A;  4HH2 A;  3H9W A;  3MFX A;  2HV1 A;  4WUJ A;  5I5L A;  4GHI B;  1XFQ A;  3F1O B;  4II7 A;  3VE3 A;  2A24 B;  2XRO A;  1DP6 A;  4CLC A;  3TRC A;  5F5Y A;  5J3W A;  2PD7 A;  2W3H A;  4Q0J A;  3LIE A;  3R7W B;  3T4K A;  2XSS A;  5AVF A;  4UEY A;  2OWH A;  3JVU A;  5AVE A;  2KLI A;  2WKQ A;  3RFB A;  2YKF A;  5HD5 A;  4E04 A;  5HWT A;  2J3W A;  5C5K A;  2W3E A;  4R6L A;  3PBO A;  3PYP A;  4GCZ A;  2J3T C;  4OOL A;  2OOL A;  4MCW A;  4P6Z M;  1STZ A;  4R70 A;  4F3L A;  2P04 A;  3C38 A;  4DJ2 A;  1OTI A;  1KOU A;  3E98 A;  4HY8 A;  3UMD A;  5IT5 A;  2PYR A;  5HWV A;  1D7E A;  1MKM A;  3UE6 A;  3MMH A;  4Z1W A;  2W3F A;  3EQV A;  3LUQ A;  2VJW A;  4O8G A;  4ETZ A;  3OC2 A;  1OJ5 A;  3R4K A;  4O0P A;  4NXG A;  4B9O A;  3S7Q A;  2A24 A;  3T4S A;  3CIT A;  2EWW A;  1T1A A;  3U2A A;  4PHT A;  5KSH A;  2R78 A;  3SW1 A;  2O99 A;  1F9I A;  1ZHH B;  3EWK A;  5CX7 A;  3EOI A;  1F98 A;  4JGQ A;  1W63 M;  1DP8 A;  3S7O A;  5FL3 A;  3R7W A;  4EET B;  3LIA A;  4ME4 A;  5G4Z A;  2V0W A;  2L0W A;  2L1M A;  3PR6 A;  4KUK A;  4EER A;  3T4J A;  1P9R A;  3A0S A;  4EEP A;  4HQA A;  1S4R A;  2J80 A;  5DFX A;  2W27 A;  3A0R A;  2ZMV A;  4EU0 A;  3TE8 A;  2DMW A;  3F1P A;  2O9A A;  3LIC A;  4Y2F A;  2K2N A;  3S7P A;  4HI4 A;  4JGP A;  1NLZ A;  3ULF A;  4OOM A;  4I5S A;  3MQO A;  3OOV A;  3OLO A;  1F5M A;  1EW0 A;  2W3G A;  4G3W A;  1MC0 A;  3V67 A;  5DF9 A;  2PT7 A;  2GX5 A;  4CLC C;  3LR0 A;  4L9F A;  3LR3 A;  4O01 A;  3EEH A;  4G3V A;  4EW7 A;  2VGL M;  1S67 L;  4MDZ A;  1LSW A;  1UWN X;  1OJG A;  4DN0 A;  1X0O A;  3LIB A;  1IFQ A;  2VLG A;  4XT2 B;  2VA0 A;  2Y79 A;  1S66 L;  1VB6 A;  5J7E A;  4EEU A;  5HDD A;  2KDK A;  3C8C A;  5HWW A;  3KYQ A;  1UWP X;  3B47 A;  4I3A A;  3UB9 A;  4BWI A;  4BBT A;  1V9Z A;  2JHE A;  2BAS A;  4ETX A;  2H28 A;  2IA2 A;  3ICY A;  3NOT C;  2LB5 A;  1OTA A;  4JGR A;  2Z6D A;  3PBN A;  4LRY C;  4Y5F A;  3RH8 B;  4BBU A;  1TS0 A;  3C2W A;  3VV4 A;  4I38 A;  2D01 A;  1ODV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...