5EVID

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
352
Chain Sequence
NSAALDTLVQTEARVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDKQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNKTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 97
structure length 352
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviD00
2Y2IA 4KQOA 1HTZA 1ERQA 2EXAA 2EFUA 3ZVTA 4BL3A 4B88A 5GHXA 4JKTA 3IWIA 4ZJ3A 1KGEA 4UA6A 3Q7VA 2ZM0A 5I94A 1O07A 4U3TA 5GLDA 4E3JA 1RP5A 1M6KA 4KQRA 3RXWA 4Q8IA 1LLBA 1PZOA 3CG5A 1L2SA 3FKWA 4JBFA 4WMCD 1FSWA 2DCFA 2ZM2A 3Q81A 2OLUA 1SCWA 3V3SA 2HDRA 2X02A 5FQJA 3SOIA 4HBUA 1ESIA 2BLSA 4KZ7A 3VP3A 1TEMA 4KQQA 4PM6A 5DF7A 4LCLA 5KZHA 4FH2A 4KZ5A 2P9VB 3E2KA 4KZ9A 2CC1A 1GA9A 3BLMA 2R9WA 5CHJA 4HEFA 2ZD8A 1KVLA 4DDYA 1JWVA 4BL2A 4JXWA 1H8ZA 1NZUA 3N8SA 1GHIA 2WKEA 4Y0UA 4S2KA 1H5XA 3HLFA 4EV4A 1PZPA 2WYXA 1IKIA 3M6BA 1CEGA 5A90A 5EOEA 1DY6A 3I7JA 5D3OA 2A49A 3HLDA 1BUEA 1CI8A 2ZC5B 3FV7A 4JF6A 3WRTA 5HAQA 3A3DA 2JE5A 4EBNA 2XH9A 4FH4A 5L2FA 2WGWB 3A3FA 4DE1A 2HP9A 4LV1A 1TDLA 1WYBA 2H5SA 1MWUA 1RCJA 2XR0A 4S2LA 4ZDXA 1TVFA 4OKPA 1BT5A 2B5RA 4KZAA 2WKIA 3HLEA 5F82A 5FI7A 2HDUA 1YT4A 1Q2PA 1NZOA 2H0YA 1YMXA 3DWKA 4Z9QA 3Q7ZA 3UPNA 3UDFA 2ZQ8A 2Y2JA 5GLBA 4E3OA 2XDMA 3UDIA 1K4EA 3S22A 5E2HA 4GD6A 3ZNYA 4BENA 4S2PA 1N9BA 2V1ZA 5A93A 1G6AA 2Y2QA 3BM6A 2GDNA 4YFMA 2JCHA 2WZZA 3G2ZA 3N4IA 4X6TA 1K55A 1YLTA 3Q82A 3BRMA 1ONGA 3G2YA 5JYOA 1ES4A 4ZJ2A 2EX6A 5M1AA 4N1HA 5J8XA 4N92A 2IWBA 1BLHA 3B3XA 4WZ4A 4OP5A 5F1FA 1KE0A 3LY4A 3NDEA 4MBKA 3OPPA 5BOHA 1U60A 1ERMA 2C6WB 1E25A 4QY6A 5CHUA 2V20A 2Y2PA 3M2KA 5FATA 1ES5A 2EX8A 3HL9A 4GNUA 5FASA 5HW3A 1BTLA 3TG9A 4BD1A 4XUXA 4U0XA 3QNBA 4WZ5A 5DF9A 1HVBA 4GOGA 5FA7A 3IF6B 3GSGA 4IVIA 2H0TA 3VOYA 5U47A 4R3BA 2EX2A 5GLAA 3SS4A 1WE4A 1DJCA 3ZCZA 2Y2MA 4S2IA 4DDSA 4OVDA 4WEKA 2DNSA 2R9XA 3WS4A 5CGWA 5A91A 2IWDA 3G34A 3QHYA 3PBTA 3NI9A 3BLSA 5EUAA 2ZC3B 3P09A 3VP2A 4R4RA 4OOYA 1KVMA 4BJPA 4E3IA 5E43A 4GB7A 5DTKA 4QJGA 3AGFA 5CERA 2Z2MB 4BD0A 2ZC7A 4X68A 4F94A 3VP1A 1M40A 1GHPA 2XFSA 4JXGA 1KE4A 4X53A 1FCMA 1MKIA 4PMAA 5EVIA 5CEDA 4KZ3A 3N8RA 3ZGAB 1K6RA 3V39A 1C3BA 2XQZA 3HUMA 4IVKA 2UWXA 4WEJA 5CEBA 2PU4A 5F1GA 3M6HA 2EX9A 1PI5A 3RJUA 1TDGA 3OPLA 3PBNA 4OH0A 3UNWA 1FCNA 3IXDA 3W8KA 3CMZA 3ZG9B 1MBLA 4OP8A 4WM9A 1N4OA 1VM1A 2G2UA 5FI6A 1DJBA 2A3UA 3ZHHA 1LI9A 3W4QA 1MPLA 3W4OA 1W8YA 1K56A 3N7WA 3WWXA 1HD8A 1SDEA 1L0EA 1K57A 3LCEA 1WYCA 3IF6C 3GV9A 3PBSA 4E3NA 4PPRA 3ZG0A 5IHVA 3IH9A 5HAIA 3Q1FA 1O7EA 2ZQAA 4DE3A 2DRWA 4WELA 1XKZA 1ES3A 1PWGA 4O7DA 3PBRA 1BLCA 5FAPA 3C4OA 2I72A 1YQSA 3S4XA 3MZDA 1IYOA 1NY0A 2J9OA 3HLBA 3QNCA 5HAPA 4FSFA 1EWZA 3MBZA 1PWCA 3ITAA 3TOIA 3ZDJA 5EVLA 3A3JA 4CPKA 2Q9NA 4DXCA 3HLGA 5GHZA 3UN7A 4EUZA 2P74A 3IXHA 4KZ6A 2XGNA 4RX2A 4C6YA 2WAFA 1I5QA 3FKVA 3O86A 4JLFA 3M2JA 1IELA 2Z2LB 2V2FF 4QY5A 1JTGA 5AQ9A 4JXVA 5M19A 2J7VA 1YLWA 3UY6A 2Y2KA 1K55C 1YM1A 4P87A 3MZEA 4DXBA 4UAAA 2WK0A 4GDNA 4IBRA 4JF5A 5FAOA 3Q7VB 3OPHA 3LEZA 4R1GA 1JTDA 2JC7A 1IKGA 3G31A 5GL9A 2ZC6B 4DRTA 1JVJA 4S2MA 4EBLA 2ZQCA 5AQ7A 1K6SA 3NCKA 3ZG7B 1XA1A 3FZCA 1OMEA 1YLPA 3A3EA 3C5AA 1MWRA 4KENB 4N9KA 5DVAA 1EI5A 5FQQA 3NBLA 5DTTA 1J9MA 2H10A 4WZ5C 3S1YA 3SH8A 4PM9A 1XP4A 3OC2A 1NXYA 3GQZA 4R0QA 1EROA 4LV3A 4OQ0A 1ZKJA 1ZG4A 4Y0TA 3C4PA 4RVAA 2OLVA 1PWDA 2QZ6A 4DKIA 3NC8A 1DJAA 1SKFA 2E8IA 3MKFA 4PM5A 1CI9A 1LHYA 1K4FA 2WKHA 3BECA 2VGKA 2J8YA 4DE2A 4EWFA 1HZOA 2XD5A 3JYIA 1CEFA 4FCFA 4LENA 5HX9A 2XLNA 2RL3A 4S2JA 5EOOA 1XPBA 3ZNTA 1ALQA 4KZBA 5CRFA 4U0TA 4PM7A 3BFEA 1YLYA 2ZJ9A 1PYYA 4GZBA 4KZ8A 1E3UA 4N1XA 3ZFZA 1FCOA 3HVFA 4A5RA 2ZLYA 4UHUA 1ESUA 1YLZA 3IXGA 3MKEA 3GRJA 4GD8A 4LCMA 1L0FA 1JWZA 1FR6A 2G2WA 4OOLA 5CXWA 2PU2A 3WS1A 5FDHA 4C3QA 3NDGA 4K0WA 4OLGA 2XK1A 1IYSA 3GTCA 3IWOA 3NIAA 3PTEA 3Q07A 2P9VA 3MZFA 4H8RA 4ID4A 4OQIA 3MXSA 4B4ZA 5HL1A 3D4FA 4WMCA 1W8QA 1KGGA 2ZC4B 5TFQA 3NY4A 2HPBA 4QB8A 4UA7A 4BLMA 4DE0A 5KSHA 4QHCA 4XUZA 3WS0A 1ES2A 3VOZA 3ZG8B 1K54A 3IHAA 3N6IA 2Q9MA 5EECA 3HLCA 4Y7PA 2ZMAA 3P98A 1LL9A 3VMAA 4QU3A 4C75A 4D2OA 5DF8A 3DWZA 2QMIA 3GVBA 3HUNA 1XGJA 1YLJA 4RX3A 5AQBA 5FQMA 3UDXA 4JF4A 2WGWA 5EPHA 4FD8A 1K38A 2RCXA 5FAQA 2QPNA 3UE3A 2ZM8A 3OPRA 3HREA 4HBTA 4S2NA 4R4SA 1W7FA 4WYYA 3RXXA 3SS5A 4ZTKA 2EFXA 1K25A 2JBFA 2Y91A 3HUOA 1PW8A 1NYMA 2OSUA 1MXOA 1AXBA 1ZG6A 3SH7A 3VSLA 1H8YA 5M18A 4QD4A 1FQGA 5CGXA 3ITBA 4OQHA 3LO7A 1FOFA 3IH8A 2ZQ9A 4CJNA 4OOMA 4K0XA 5CTNA 1I2WA 1QMFA 5TGFA 3OCNA 4JXSA 1BZAA 1IEMA 1S0WA 4S2OA 3MFDA 2FFYA 4K91A 1PW1A 4MNRA 1W5DA 5E2GA 1BULA 5EVID 4YINA 4M3KA 4ZAMA 4KG6A 1G68A 1GHMA 1XA7A 5FQIA 3DTMA 2XEPA 5CTMA 3EQUA 2FFFB 4ZJ1A 1NJ4A 5EVIB 3WRZA 4KZ4A 1XXMA 4E3KA 1GA0A 4Y0OA 1S6RA 3FWLA 1LL5A 2HDQA 3BFGA 3O87A 3FYZA 2C5WB 3IF6A 3UE0A 1Y54A 3IXBA 4MEZA 4N9LA 1ZC2A 1CK3A 1MY8A 4IEDA 3EQVA 1MWTA 3AGEA 3BYDA 3O88A 4XXRA 5GHYA 1K56D 2PBYA 4GN2A 3UE1A 2WGVA 3VSKA 1L0GA 5GLCA 1FR1A 1NYYA 3IF5A 5F83A 3O3VA 1W79A 3UPPA 5TR7A 3N8LA 2Y59A 4P85A 3G30A 3GMWA 4E3LA 3IQAA 3G35A 3UO9A 4GKUA 2WAEA 4NETA 1BLSA 3V3RA 2Y2NA 1SHVA 5FQKA 4BQMA 5HFOA 4LV0A 1SDNA 2OV5A 2XFTA 4R23A 3UPOA 2WUQA 4IBXA 1Z6FA 3TSGA 1QMEA 3HBRA 2Y2HA 4GDBA 4NK3A 2HP6A 3BEBA 4MBFA 1BSGA 1IYQA 1L0DA 3GR2A 3PBQA 1IYPA 3C7VA 5E2EA 3ISGA 3G32A 3IT9A 3ZG5A 4RA7A 5G18A 2WZXA 3SS3A 4OPQA 5E2FA 3PAGA 3DW0A 4OPRA 3LY3A 4ZBEA 3CJMA 4MLLA 1Q2QA 4KG2A 2EXBA 1BLPA 1XGIA 3IHBA 4PM8A 4MBHA 1KDWA 4WBGA 1VQQA 4OLDA 1RGYA 4OPYA 2ZQ7A 3SH9A 4OPZA 3A3IA 4EQIA 3AGDA 4KG5A 2XF3A 5EVIC 5FI2A 4R3JA 1YMSA 3VP4A 2X01A 1GCEA 3VFFA 3E2LA 2HP5A 4E3MA 5JYPA 1K54C 2Y4AA 2BG1A 2HDSA 5CECA 4X69A 4OONA 1LI0A 4EBPA 3PBOA 4E6XA 2VGJA 3BFCA 4P6BA 5CHMA 1E4DA 3OZHA 4HESA 1ONHA 3VP0A 3IWQA 3ZVWA 4E6WA 3BFFA 4DF6A 1MWSA 3G4PA 3V50A 1I2SA 4L0LA 5DTSA 5FSRA 3V5MA 2WADA 5HARA 1KDSA 1RGZA 4RYEA 3WS2A 3MXRA 5A92A 3OCLA 1FSYA 1KGFA 2X71A 2Y2LA 1JWPA 3C7UA 2J9PA 4OQGA 3W4PA 4S2NC 5KMWA 3HLWA 4UA9A 1PIOA 5AQAA 2XD1A 5CGSA 5EE8A 1PI4A 4JPMA 2Y55A 2Y2OA 5FQ9A 4X56A 1NRFA 1XX2A 4X55A 1K57C 2IWCA 4P0MA 5KSCA 3BFDA 4B4XA 4LV2A 2ZQDA 2Y2GA 3VFHA 3CZDA 2WGIA 3PAEA 3WS5A 1KE3A 1E3UD
chains in the Genus database with same CATH superfamily
1HTZA 2W27A 4UQIS 4BL3A 3B42A 4XT2A 4B88A 5GHXA 2K7SA 4E3JA 3RXWA 2VX8A 1L2SA 1EW0A 3E4QA 2DCFA 4CLCE 3V3SA 2HDRA 1P97A 5FQJA 2BLSA 4PM6A 5DF7A 3C38A 2B95A 4KZ5A 2O0YA 1H8ZA 1BYWA 1DP9A 4S2KA 3KYZA 1CEGA 3EEHA 1DY6A 4RQ9A 5D3OA 3HLDA 1BUEA 4EBNA 4FH4A 2HP9A 1WYBA 1MWUA 3CLOA 4S2LA 1TVFA 4OKPA 1T19A 3W2ZA 1YT4A 1Q2PA 1TS8A 4Y15A 3E98A 2M7VA 5HPFA 3UPNA 3UDFA 2Y2JA 2XDMA 3UDIA 3S22A 3LUQA 4YFMA 1HLUP 3CPTA 1K55A 3BRMA 3BY9A 2ACGA 5M1AA 5J8XA 1YAXA 4MBKA 1MZUA 4QY6A 1E25A 3T4QA 1UWNX 5FASA 2EX8A 3TG9A 4WZ5A 1HVBA 5FA7A 4R3AA 3IF6B 3GSGA 3VOYA 3HJKA 1H3QA 5U47A 3SS4A 3ZCZA 4WEKA 2R9XA 3V67A 3WS4A 3G34A 5HL6A 5L10A 3U4LP 4CQHA 5E43A 2I9VA 2JHEA 2ZC7A 4X68A 1M40A 4JXGA 1X0OA 2UV0E 4HY8A 1FCMA 3KSFA 4PMAA 3FG8A 4LLOB 3B47A 1LSWA 3A0RA 2PU4A 5F1GA 3M6HA 3RJUA 3PBNA 1UWPX 3CMZA 3D9YA 1DJBA 3ZHHA 1K56A 4H6JB 5CX7A 4Y5FA 3TE8A 4EERA 5HAIA 4IUHA 3IX4A 2V0UA 2HV1A 2DRWA 3KSIA 3T4KA 1ES3A 2KOIA 4JGOA 3BQ8A 3PBRA 3EEAA 2J9OA 3TOIA 5GHZA 2P74A 4ARZA 1STZA 3O86A 2GX5A 4JLFA 3M2JA 3BJNA 2V2FF 1JTGA 4JXVA 3UY6A 1K55C 2ZBBA 3MZEA 4GDNA 5FL3A 3T4SA 5EFWA 3OPHA 1CQAA 5HDCA 3LEZA 4R1GA 1JTDA 1H8MA 2JC7A 2QJ7A 3G31A 1JVJA 4EBLA 1S4SA 3T4OA 3IX8A 3ZG7B 2W3GA 3FZCA 1YLPA 3C5AA 1MWRA 5DVAA 3R7WA 3NBLA 4WZ5C 1EROA 4LV3A 4OQ0A 2GNXA 1ZG4A 4KUOA 3NC8A 2ZOHA 2J3WA 2XA7M 3PXPA 4PM5A 5HZHA 1K4FA 2J8YA 4EWFA 3JYIA 4Q0JA 2RL3A 3ZNTA 2LB9A 4ETXA 5CRFA 4MN7A 4PM7A 1PYYA 4N1XA 3ZFZA 3C30A 3IXGA 3MKEA 4GD8A 1JWZA 4K08A 3UMDA 5CXWA 2PU2A 3DTKA 3LI8A 2XK1A 2KDKA 2O9AA 4HQAA 3D4FA 4WMCA 2ZC4B 3NY4A 4QHCA 3ZG8B 1ES2A 1V9ZA 3KSHA 2ZMAA 1V9YA 3GVBA 1XFQA 1XGJA 3HUNA 3UDXA 2PYPA 5EPHA 3LGOA 3OPRA 4FUWA 4HBTA 4R4SA 4WYYA 2EFXA 1PW8A 1NYMA 3SH7A 3EGDC 3VSLA 1H8YA 3T4TA 4MMNA 3LO7A 4Q0HA 4K0XA 5CTNA 2XRNA 5TGFA 1QMFA 3L9KA 2E8JA 1IEMA 1S0WA 3MS6A 4CLCB 2EA9A 1OJGA 2FFYA 3LR3A 5TBMA 3OLOA 3S7PA 1SZVA 5EVID 4M3KA 3EWKA 1G68A 1GHMA 3ZQ5A 5CTMA 2VK3A 3EQUA 3JVVA 2PAVP 4E3KA 1GA0A 4HJ6A 4DJ3A 3IF6A 3UE0A 3IXBA 3EQVA 1MWTA 3BYDA 4XXRA 2WKPA 4GN2A 2WGVA 5GLCA 1W79A 3UPPA 3N8LA 3G30A 3G35A 1SDNA 4R23A 5FEGA 5EM1A 5J7EA 3UB7A 3HBRA 4Y3IA 3H9WA 3GR2A 1IYPA 2B18A 2XA7S 4LRXC 4HP9A 2OAQ1 3DW0A 4OPRA 3LY3A 4R38A 3MFXA 1VETB 4KG2A 4MBHA 2QKPA 4OPYA 2ZQ7A 1NWZA 3HJIA 3AGDA 4H6JA 5EVIC 1YMSA 1GCEA 2HP5A 2GJ3A 2PT7A 2HZ5A 2VGJA 1ONHA 4KQDA 3ZVWA 4E6WA 2VV6A 1OJ5A 1MWSA 3G4PA 1IOUA 3V5MA 1W63M 5HARA 1RGZA 4RYEA 3MXRA 3B33A 4EESA 1N9OA 2J9PA 5KMWA 4UA9A 2V0WA 3NECA 4O0PA 4X56A 1XX2A 4X55A 4BWIA 4O8GA 5KSCA 3BFDA 2ZQDA 2P04A 3VFHA 3CZDA 1DRMA 3ZVTA 1ERQA 2EFUA 3G6OA 3CUEA 4HJ4A 3H7WA 1P9WA 4HP4A 2ZM0A 4U3TA 3MQ0A 4KQRA 2D01A 4UEYA 3Q81A 2OLUA 1SCWA 3ZYTA 4Y13A 4KZ7A 1TS6A 2P9VB 1GA9A 4HEFA 1NZUA 1GHIA 2WKEA 4Y0UA 1H5XA 1PZPA 2L4RA 3F1PB 2EWWA 4EU0A 3I7JA 2A49A 1CI8A 3WRTA 1PRQA 2JE5A 5L2FA 4B93A 4LV1A 1TDLA 3UB6A 1RCJA 4ZDXA 3E4OA 2B5RA 5FI7A 2INWA 4LPZA 1NZOA 1YMXA 2ZQ8A 5F6AA 3GECA 4GD6A 5DJTA 2V1ZA 3BY8A 4BMWA 4X6TA 3NOUC 5JYOA 1ONGA 3G2YA 4NXBA 1ES4A 4WN5A 3LIDA 2HF6A 2EX6A 2EWVA 3IBRA 5F1FA 3OPPA 1U60A 3LEQA 2Y2PA 3M2KA 1ES5A 4GNUA 5HW3A 2R78A 3QP1A 5DF9A 3QNBA 5I5LA 5L8MA 3RFBA 5MC7A 2H0TA 3VV4A 4R3BA 4HH2A 1DJCA 4DDSA 4S2IA 5AJGA 2V1AA 4CLCA 5A91A 3NI9A 3S7NA 3BLSA 1LSVA 2BTFP 4OOYA 1KVMA 1YPRA 5DTKA 4BD0A 2Z2MB 3VP1A 1GHPA 4JGQA 4X53A 1MKIA 3IS2B 1C3BA 2UWXA 5CEBA 1PI5A 4OH0A 3W8KA 3LR4A 1GSVA 3ZG9B 1MBLA 4OP8A 1VM1A 2G2UA 3S7OA 1LI9A 3FPWA 3W4OA 3EOIA 3WWXA 1XJ2A 3LCEA 1WYCA 3GV9A 4EQ1A 3ZG0A 5IHVA 3LR5A 3Q1FA 1FIKA 4DE3A 1N9LA 3D72A 1BLCA 1VETA 1FILA 2K2NA 3MZDA 3QNCA 1PWCA 3ITAA 2AVXA 2VGLM 5EVLA 3A3JA 2Q9NA 4FOFA 3IXHA 4KZ6A 4L9GA 4Q0IA 2XGNA 1ODVA 4RX2A 1I5QA 3LICA 1D1JA 3OBFA 1TS0A 2YKFA 5AQ9A 2J7VA 1F5MA 4DXBA 4UAAA 2WK0A 2A24B 4JF5A 2ZC6B 4S2MA 4I39A 3S7QA 1OMEA 3A3EA 4N9KA 1EI5A 5DTTA 3OC2A 1NXYA 2OLVA 4GS9B 2VZWA 1W63Q 2WKHA 5IU1A 3BECA 4DN0A 2XD5A 2HJEA 4GHIB 4FCFA 5AVFA 2LB5A 5HX9A 2XLNA 4S2JA 1ALQA 4G3KA 4PKYG 1T1BA 4BBVA 1S66L 1F9IA 3HVFA 4A5RA 5EV0A 1YLZA 4IJGA 1L0FA 2P7JA 2PBDP 2G2WA 1NRJA 3T12B 3WS1A 5FDHA 4K0WA 4I38A 4OLGA 4QPRA 3Q07A 2B02A 2P9VA 3MZFA 4H8RA 1H0MA 3MXSA 1DP8A 4MN6A 3LIBA 4QB8A 4BLMA 2ZL1B 2ZMVA 3N6IA 3P7NA 2Q9MA 3HLCA 5DF8A 5J4EA 2QMIA 5FQMA 1G28A 5AQBA 2RCXA 3HREA 1ACFA 1W7FA 3SS5A 1K25A 2JBFA 2XSSA 2OSUA 1ZG6A 1AXBA 1FQGA 5CGXA 3ITBA 4OQHA 3KSGA 4CJNA 1I2WA 2DMWA 1BZAA 4S2OA 3MFDA 4K91A 3UB5P 1MKMA 1BULA 1A0KA 1CJFA 1VEUB 4FTXA 4WF0A 4NXEA 2VGLS 3WRZA 2KLIA 3A0SA 1XXMA 2PHYA 1LL5A 3BFGA 3O87A 2C5WB 3VE4A 4MEZA 1K0KA 3AGEA 1K56D 3VSKA 1FR1A 3IF5A 3O3VA 1OTAA 3GMWA 3IQAA 4X25A 5EVEA 4NETA 1BLSA 5FQKA 1SHVA 4LV0A 2OV5A 2WUQA 3H82B 4IBXA 1Z6FA 4GDBA 2HP6A 4MBFA 2W0NA 3PYPA 3IS2A 5G4YA 4G3WA 3ZG5A 5G18A 2WZXA 1XFNA 1Q2QA 1BLPA 4EETB 3QP2A 2M1CA 1RGYA 3F1NB 4EQIA 4QWOA 1OTDA 2XF3A 4ZRRA 5FI2A 2X01A 2FH5A 4E3MA 2HGVA 2BG1A 2HDSA 3LIAA 4EBPA 3PBOA 4EXOA 4P6BA 3VE3A 5L09A 2PD7A 3BFFA 2VJWA 5DTSA 1KDSA 3RTYA 1KGFA 1UGUA 1PIOA 5AQAA 3K3CA 5EE8A 1PI4A 4JPMA 1Y28A 2Y2OA 1NRFA 4P0MA 5FEFA 2Y2GA 2WGIA 3PAEA 4JGRA 3WS5A 2Y2IA 3QP6A 4PAUA 4JKTA 3IWIA 4ZJ3A 3FPVA 4UA6A 5GLDA 4Q8IA 1M6KA 1LLBA 2L1MA 1P9RA 4WMCD 2X02A 3SOIA 4HBUA 3VP3A 1TEMA 4LCLA 3MMHA 1OTBA 3E2KA 4KZ9A 4GS9A 2ZD8A 4DDYA 1JWVA 4JXWA 2Y79A 5DFYA 3HLFA 4GHIA 5A90A 2WYXA 1IKIA 3M6BA 2D02A 5LBRA 3FV7A 4JF6A 3F1OB 2XH9A 2WGWB 4DE1A 2V1BA 2XR0A 1D06A 2PDRA 3BWLA 1BT5A 4KZAA 2WKIA 5F82A 2H0YA 3KYQA 4BBTA 4Z9QA 5GLBA 4E3OA 3NOPC 3C2WA 2JKFA 2NUPC 3FC7A 2ZL1A 5A93A 1G6AA 2Y2QA 3BM6A 3JVUA 4NXFA 2WZZA 3CAXA 3Q82A 4N92A 2IWBA 3B3XA 1YSQA 4WZ4A 1KE0A 3NDEA 1OTEA 1MC0A 1ERMA 2V20A 1TS7A 2W1TB 3IBJA 5FATA 1BTLA 4XUXA 4U0XA 2ZOIA 2V8FA 2VKSA 4IVIA 2W3EA 4EEUA 3QP5A 2EX2A 5GLAA 1WE4A 2DNSA 1NLZA 5CGWA 2IWDA 1LL8A 2O99A 5EUAA 2ZC3B 4L9FA 4WL9A 4E3IA 4GB7A 4QJGA 3AGFA 5CERA 1VEUA 3VOLA 1OTIA 4ETZA 4IUKA 2XFSA 5TJJA 4LRYC 1KE4A 2J80A 4HIAA 3ZGAB 1K6RA 2VLGA 2XQZA 3CPTB 2EX9A 1TDGA 1FCNA 3IXDA 3JPUA 1SKOB 2Q0OA 4Z1WA 4PHTA 1N4OA 1TF1A 3MF0A 1MPLA 3N7WA 1HD8A 4HH3A 1L0EA 1K57A 3IF6C 4LFUA 3PBSA 4E3NA 3TJZC 1KOUA 1O7EA 3RH8B 2W3HA 2ZQAA 1XKZA 3HCYA 5FAPA 2BASA 3C4OA 2I72A 1YQSA 1IYOA 5HAPA 1CF0A 3PR6A 3MBZA 2JKRM 3EGXC 3F1NA 4EUZA 3HLGA 3UN7A 1ZTUA 4C6YA 1XJ6A 2WAFA 4MN5A 2Z2LB 2M7UA 1YSPA 4QY5A 4IHQA 1GSXA 1YLWA 2Y2KA 1YM1A 4P87A 3DTEA 5FAOA 3MXQA 2A2LA 3Q7VB 1IKGA 4X1LA 5GL9A 2ZQCA 2W3DA 1K6SA 1GSWA 1XA1A 3K2NA 2H10A 2P08A 3SH8A 4PM9A 4R0QA 5L07A 5DKLA 4Y0TA 4RVAA 1PWDA 4DKIA 1DJAA 3L7HA 3LYXA 1CI9A 1LHYA 4DE2A 3O5YA 1XPBA 4U0TA 3BFEA 5IS1A 2ZJ9A 1E3UA 2V8CA 4UHUA 2J3TD 1ESUA 2HJ9C 3GRJA 4LCMA 4C3QA 4E04A 3NIAA 1IYSA 5DJUA 2PRFA 3CUEC 3MSHA 1G5UA 4F3LB 4DE0A 5KSHA 3WS0A 2QJ5A 3IHAA 5HSQA 5A8BA 5EECA 1S1ZA 4Y7PA 3P98A 2FZ0A 4M4XA 3KYEA 1DP6A 4QU3A 4WUJA 4C75A 4D2OA 1PNEA 3F1OA 1YLJA 2L0WA 4RX3A 2WGWA 3E4PA 4FD8A 5FAQA 2QPNA 3UE3A 2ZM8A 1IFQA 4S2NA 2YKHA 4ZTKA 3U2AA 2Y91A 4HJ3A 4CLCD 5M18A 3KX0X 3UE6A 1FOFA 2G7UA 3IH8A 1T1AA 1N9NA 4JXSA 2OWJA 1PW1A 4MNRA 2WKRA 4R6LA 4YINA 5HDSA 4KUKA 2XEPA 2J3TC 2W1TA 1NJ4A 1D7EA 5EVIB 3FWLA 3FYZA 1Y54A 4N9LA 1MY8A 4IEDA 5GHYA 2JN7A 1NYYA 5F83A 2JKRI 5TR7A 2XROA 2Y59A 1XJ3A 3UO9A 2WAEA 3V3RA 5HFOA 3BQAA 2XFTA 4NK3A 4MCWA 3BEBA 1BSGA 1IYQA 1L0DA 3G32A 3IT9A 4RA7A 5TBMB 4CLCC 2JKGA 4HOIA 1SKOA 4MLLA 3BW6A 2IA2A 4PM8A 4WBGA 1VQQA 3A3IA 5F69A 2Z6CA 1S67L 4KG5A 4R3JA 3VFFA 2PR5A 5JYPA 3DAVA 3C8CA 3DBAA 5CECA 4OONA 1LI0A 4E6XA 2VA0A 3BFCA 1E4DA 3OZHA 4HESA 3VP0A 4I3IA 4DF6A 1VHMA 4L0LA 3WS2A 2WADA 4ME4A 3OCLA 1FSYA 3F1PA 1JWPA 4OQGA 3W4PA 4S2NC 2Y8HA 3QP8A 2XD1A 5CGSA 5FQ9A 3DTIA 1S1YA 4B4XA 4LV2A 2V9AA 3OOVA 1KE3A 5DKKA 4KQOA 2EXAA 4BBUA 1KGEA 5HD3A 3Q7VA 4G3VA 5I94A 1O07A 1RP5A 3MQQA 5AVEA 4HNBA 1PZOA 3CG5A 3FKWA 4JBFA 2PD8A 1FSWA 2ZM2A 2CMNA 1ESIA 4KQQA 4L9EA 5KZHA 1G6OA 4FH2A 2CC1A 3BLMA 2R9WA 5CHJA 3T1SA 3UB8A 1KVLA 4BL2A 3N8SA 4EV4A 4LGWA 3CI6A 5EOEA 3MQOA 4NG2A 4HHDA 3CITA 1E3UD 2ZC5B 2GZAA 5HAQA 3A3DA 3A3FA 3CWFA 2H5SA 5HWWA 3HLEA 4I5SA 2HDUA 5DFXA 4HI4A 3DWKA 1T18A 3Q7ZA 3NJAA 3UMEA 1P0ZA 3H7WB 5J3WA 4NKPA 3ULFA 1K4EA 5E2HA 1Z09A 3ZNYA 4BENA 4S2PA 2VV8A 1N9BA 1OPXA 3T4JA 4F3LA 2PYRA 2GDNA 2JCHA 4DMZA 3G2ZA 3N4IA 1YLTA 4ZJ2A 2QHKA 4N1HA 1Y4OA 1BLHA 4OP5A 3LY4A 5BOHA 2C6WB 2O9BA 5CHUA 4D60A 3LFVA 3HL9A 2ZMFA 1F98A 4BD1A 4GOGA 3T1RA 4NEED 3SZTA 2Y2MA 4OVDA 4I3JA 3QHYA 3PBTA 2O9CA 3P09A 3VP2A 4R4RA 1YKDA 4BJPA 5HDDA 5KIZA 3IX3A 4F94A 4YWZA 4PKYA 4ESPA 5EVIA 5CEDA 5G4ZA 4KZ3A 3N8RA 3V39A 3HUMA 4IVKA 4WEJA 3K3DA 2WKQA 3OPLA 3UNWA 3LIEA 3D3OA 2A24A 4WM9A 5IT5A 5FI6A 1F2KA 2A3UA 3W4QA 2JKTM 1W8YA 2OOLA 1ZHHB 3MJQA 1SDEA 4P6ZM 1PFLA 4PPRA 3TRCA 3IH9A 2Z6DA 4WELA 4YOFA 1PWGA 4O7DA 3S4XA 1NY0A 3HLBA 4FSFA 1EWZA 3ZDJA 4CPKA 4DXCA 1TD5A 4B9OA 3FKVA 1IELA 2VEAA 4GJ4A 5M19A 4XT2B 1J3WA 2MJ6A 4IBRA 3A0VA 5HD5A 4DRTA 5AQ7A 3P01A 3NCKA 4KENB 5FQQA 3ICYA 1OT9A 4GLQA 4I3AA 1J9MA 2QWSA 3S1YA 1XP4A 3GQZA 4II7A 1ZKJA 4WLAA 3C4PA 2QZ6A 1SKFA 5F68A 2E8IA 3MKFA 3NULA 4EEPA 2QYBA 2VGKA 1HZOA 1CEFA 1S4RA 4LENA 5EOOA 4KZBA 4MDZA 2H28A 1YLYA 4GZBA 4KZ8A 4R70A 1FCOA 2NUTC 2ZLYA 4EW7A 4Y17A 1FR6A 4OOLA 3NDGA 3IWOA 3GTCA 3GDIA 3PTEA 4ID4A 4EUVA 3SW1A 4OQIA 4DJ2A 1WA9A 4B4ZA 5HL1A 1W8QA 1KGGA 5TFQA 2HPBA 4UA7A 4XUZA 3VOZA 3PHYA 1K54A 3QP4A 3NHQA 1LL9A 4GCZA 3VMAA 1LSXA 3NOTC 3DWZA 4JF4A 1K38A 5EM0A 3RXXA 1T1CA 1JNUA 3HUOA 4O01A 1MXOA 4QD4A 4UQIM 3T50A 3H82A 4P6ZS 2ZQ9A 4OOMA 3OCNA 2JKTI 1W5DA 5E2GA 1NLYA 4ZAMA 4KG6A 1XA7A 5FQIA 3DTMA 2FFFB 4ZJ1A 3MR0A 4KZ4A 4Y0OA 5HWVA 2VV7A 1S6RA 1AWIA 2HDQA 2K31A 4X1MA 1ZC2A 1CK3A 3O88A 2PBYA 3UE1A 1L0GA 3CHWP 1VB6A 4P85A 3T1XA 4E3LA 5FDSA 4GKUA 2Y2NA 4BQMA 3UPOA 3TSGA 3T4LA 1QMEA 2Y2HA 3PBQA 3C7VA 3LIFA 5E2EA 3ISGA 1LT0A 3SS3A 4OPQA 5E2FA 3PAGA 3UB9A 2OWHA 4ZBEA 3CJMA 4GW9A 5K5BA 2EXBA 1XGIA 3IHBA 3KO6A 3TW8A 1KDWA 4OLDA 3SH9A 4OPZA 5HPIA 4AFIA 4ARZB 3E0YA 3VP4A 3E2LA 1K54C 2Y4AA 4X69A 3LI9A 5CHMA 3IWQA 1XJ4A 3V50A 1I2SA 5FSRA 5A92A 2Y2LA 2X71A 3C7UA 3HLWA 4LRZE 1L3LA 2W1RA 4JGPA 4YNRA 5F5YA 4Y2FA 3R7WB 5HWTA 2Y55A 1K57C 2IWCA 3T1QB 2OAP1 1OT6A 2W3FA 5C5KA 2KX6A 4NXGA 3R4KA 3LR0A 2PR6A
chains in the Genus database with same CATH topology
2Y2IA 4KQOA 1HTZA 1ERQA 2EXAA 2EFUA 3ZVTA 4BL3A 4B88A 5GHXA 4JKTA 3IWIA 4ZJ3A 1KGEA 4UA6A 3Q7VA 2ZM0A 5I94A 1O07A 4U3TA 5GLDA 4E3JA 1RP5A 1M6KA 4KQRA 3RXWA 4Q8IA 1LLBA 1PZOA 3CG5A 1L2SA 3FKWA 4JBFA 4WMCD 1FSWA 2DCFA 2ZM2A 3Q81A 2OLUA 1SCWA 3V3SA 2HDRA 2X02A 5FQJA 3SOIA 4HBUA 1ESIA 2BLSA 4KZ7A 3VP3A 1TEMA 4KQQA 4PM6A 5DF7A 4LCLA 5KZHA 4FH2A 4KZ5A 2P9VB 3E2KA 4KZ9A 2CC1A 1GA9A 3BLMA 2R9WA 5CHJA 4HEFA 2ZD8A 1KVLA 4DDYA 1JWVA 4BL2A 4JXWA 1H8ZA 1NZUA 3N8SA 1GHIA 2WKEA 4Y0UA 4S2KA 1H5XA 3HLFA 4EV4A 1PZPA 2WYXA 1IKIA 3M6BA 1CEGA 5A90A 5EOEA 1DY6A 3I7JA 5D3OA 2A49A 3HLDA 1BUEA 1CI8A 2ZC5B 3FV7A 4JF6A 3WRTA 5HAQA 3A3DA 2JE5A 4EBNA 2XH9A 4FH4A 5L2FA 2WGWB 3A3FA 4DE1A 2HP9A 4LV1A 1TDLA 1WYBA 2H5SA 1MWUA 1RCJA 2XR0A 4S2LA 4ZDXA 1TVFA 4OKPA 1BT5A 2B5RA 4KZAA 2WKIA 3HLEA 5F82A 5FI7A 2HDUA 1YT4A 1Q2PA 1NZOA 2H0YA 1YMXA 3DWKA 4Z9QA 3Q7ZA 3UPNA 3UDFA 2ZQ8A 2Y2JA 5GLBA 4E3OA 2XDMA 3UDIA 1K4EA 3S22A 5E2HA 4GD6A 3ZNYA 4BENA 4S2PA 1N9BA 2V1ZA 5A93A 1G6AA 2Y2QA 3BM6A 2GDNA 4YFMA 2JCHA 2WZZA 3G2ZA 3N4IA 4X6TA 1K55A 1YLTA 3Q82A 3BRMA 1ONGA 3G2YA 5JYOA 1ES4A 4ZJ2A 2EX6A 5M1AA 4N1HA 5J8XA 4N92A 2IWBA 1BLHA 3B3XA 4WZ4A 4OP5A 5F1FA 1KE0A 3LY4A 3NDEA 4MBKA 3OPPA 5BOHA 1U60A 1ERMA 2C6WB 1E25A 4QY6A 5CHUA 2V20A 2Y2PA 3M2KA 5FATA 1ES5A 2EX8A 3HL9A 4GNUA 5FASA 5HW3A 1BTLA 3TG9A 4BD1A 4XUXA 4U0XA 3QNBA 4WZ5A 5DF9A 1HVBA 4GOGA 5FA7A 3IF6B 3GSGA 4IVIA 2H0TA 3VOYA 5U47A 4R3BA 2EX2A 5GLAA 3SS4A 1WE4A 1DJCA 3ZCZA 2Y2MA 4S2IA 4DDSA 4OVDA 4WEKA 2DNSA 2R9XA 3WS4A 5CGWA 5A91A 2IWDA 3G34A 3QHYA 3PBTA 3NI9A 3BLSA 5EUAA 2ZC3B 3P09A 3VP2A 4R4RA 4OOYA 1KVMA 4BJPA 4E3IA 5E43A 4GB7A 5DTKA 4QJGA 3AGFA 5CERA 2Z2MB 4BD0A 2ZC7A 4X68A 4F94A 3VP1A 1M40A 1GHPA 2XFSA 4JXGA 1KE4A 4X53A 1FCMA 1MKIA 4PMAA 5EVIA 5CEDA 4KZ3A 3N8RA 3ZGAB 1K6RA 3V39A 1C3BA 2XQZA 3HUMA 4IVKA 2UWXA 4WEJA 5CEBA 2PU4A 5F1GA 3M6HA 2EX9A 1PI5A 3RJUA 1TDGA 3OPLA 3PBNA 4OH0A 3UNWA 1FCNA 3IXDA 3W8KA 3CMZA 3ZG9B 1MBLA 4OP8A 4WM9A 1N4OA 1VM1A 2G2UA 5FI6A 1DJBA 2A3UA 3ZHHA 1LI9A 3W4QA 1MPLA 3W4OA 1W8YA 1K56A 3N7WA 3WWXA 1HD8A 1SDEA 1L0EA 1K57A 3LCEA 1WYCA 3IF6C 3GV9A 3PBSA 4E3NA 4PPRA 3ZG0A 5IHVA 3IH9A 5HAIA 3Q1FA 1O7EA 2ZQAA 4DE3A 2DRWA 4WELA 1XKZA 1ES3A 1PWGA 4O7DA 3PBRA 1BLCA 5FAPA 3C4OA 2I72A 1YQSA 3S4XA 3MZDA 1IYOA 1NY0A 2J9OA 3HLBA 3QNCA 5HAPA 4FSFA 1EWZA 3MBZA 1PWCA 3ITAA 3TOIA 3ZDJA 5EVLA 3A3JA 4CPKA 2Q9NA 4DXCA 3HLGA 5GHZA 3UN7A 4EUZA 2P74A 3IXHA 4KZ6A 2XGNA 4RX2A 4C6YA 2WAFA 1I5QA 3FKVA 3O86A 4JLFA 3M2JA 1IELA 2Z2LB 2V2FF 4QY5A 1JTGA 5AQ9A 4JXVA 5M19A 2J7VA 1YLWA 3UY6A 2Y2KA 1K55C 1YM1A 4P87A 3MZEA 4DXBA 4UAAA 2WK0A 4GDNA 4IBRA 4JF5A 5FAOA 3Q7VB 3OPHA 3LEZA 4R1GA 1JTDA 2JC7A 1IKGA 3G31A 5GL9A 2ZC6B 4DRTA 1JVJA 4S2MA 4EBLA 2ZQCA 5AQ7A 1K6SA 3NCKA 3ZG7B 1XA1A 3FZCA 1OMEA 1YLPA 3A3EA 3C5AA 1MWRA 4KENB 4N9KA 5DVAA 1EI5A 5FQQA 3NBLA 5DTTA 1J9MA 2H10A 4WZ5C 3S1YA 3SH8A 4PM9A 1XP4A 3OC2A 1NXYA 3GQZA 4R0QA 1EROA 4LV3A 4OQ0A 1ZKJA 1ZG4A 4Y0TA 3C4PA 4RVAA 2OLVA 1PWDA 2QZ6A 4DKIA 3NC8A 1DJAA 1SKFA 2E8IA 3MKFA 4PM5A 1CI9A 1LHYA 1K4FA 2WKHA 3BECA 2VGKA 2J8YA 4DE2A 4EWFA 1HZOA 2XD5A 3JYIA 1CEFA 4FCFA 4LENA 5HX9A 2XLNA 2RL3A 4S2JA 5EOOA 1XPBA 3ZNTA 1ALQA 4KZBA 5CRFA 4U0TA 4PM7A 3BFEA 1YLYA 2ZJ9A 1PYYA 4GZBA 4KZ8A 1E3UA 4N1XA 3ZFZA 1FCOA 3HVFA 4A5RA 2ZLYA 4UHUA 1ESUA 1YLZA 3IXGA 3MKEA 3GRJA 4GD8A 4LCMA 1L0FA 1JWZA 1FR6A 2G2WA 4OOLA 5CXWA 2PU2A 3WS1A 5FDHA 4C3QA 3NDGA 4K0WA 4OLGA 2XK1A 1IYSA 3GTCA 3IWOA 3NIAA 3PTEA 3Q07A 2P9VA 3MZFA 4H8RA 4ID4A 4OQIA 3MXSA 4B4ZA 5HL1A 3D4FA 4WMCA 1W8QA 1KGGA 2ZC4B 5TFQA 3NY4A 2HPBA 4QB8A 4UA7A 4BLMA 4DE0A 5KSHA 4QHCA 4XUZA 3WS0A 1ES2A 3VOZA 3ZG8B 1K54A 3IHAA 3N6IA 2Q9MA 5EECA 3HLCA 4Y7PA 2ZMAA 3P98A 1LL9A 3VMAA 4QU3A 4C75A 4D2OA 5DF8A 3DWZA 2QMIA 3GVBA 3HUNA 1XGJA 1YLJA 4RX3A 5AQBA 5FQMA 3UDXA 4JF4A 2WGWA 5EPHA 4FD8A 1K38A 2RCXA 5FAQA 2QPNA 3UE3A 2ZM8A 3OPRA 3HREA 4HBTA 4S2NA 4R4SA 1W7FA 4WYYA 3RXXA 3SS5A 4ZTKA 2EFXA 1K25A 2JBFA 2Y91A 3HUOA 1PW8A 1NYMA 2OSUA 1MXOA 1AXBA 1ZG6A 3SH7A 3VSLA 1H8YA 5M18A 4QD4A 1FQGA 5CGXA 3ITBA 4OQHA 3LO7A 1FOFA 3IH8A 2ZQ9A 4CJNA 4OOMA 4K0XA 5CTNA 1I2WA 1QMFA 5TGFA 3OCNA 4JXSA 1BZAA 1IEMA 1S0WA 4S2OA 3MFDA 2FFYA 4K91A 1PW1A 4MNRA 1W5DA 5E2GA 1BULA 5EVID 4YINA 4M3KA 4ZAMA 4KG6A 1G68A 1GHMA 1XA7A 5FQIA 3DTMA 2XEPA 5CTMA 3EQUA 2FFFB 4ZJ1A 1NJ4A 5EVIB 3WRZA 4KZ4A 1XXMA 4E3KA 1GA0A 4Y0OA 1S6RA 3FWLA 1LL5A 2HDQA 3BFGA 3O87A 3FYZA 2C5WB 3IF6A 3UE0A 1Y54A 3IXBA 4MEZA 4N9LA 1ZC2A 1CK3A 1MY8A 4IEDA 3EQVA 1MWTA 3AGEA 3BYDA 3O88A 4XXRA 5GHYA 1K56D 2PBYA 4GN2A 3UE1A 2WGVA 3VSKA 1L0GA 5GLCA 1FR1A 1NYYA 3IF5A 5F83A 3O3VA 1W79A 3UPPA 5TR7A 3N8LA 2Y59A 4P85A 3G30A 3GMWA 4E3LA 3IQAA 3G35A 3UO9A 4GKUA 2WAEA 4NETA 1BLSA 3V3RA 2Y2NA 1SHVA 5FQKA 4BQMA 5HFOA 4LV0A 1SDNA 2OV5A 2XFTA 4R23A 3UPOA 2WUQA 4IBXA 1Z6FA 3TSGA 1QMEA 3HBRA 2Y2HA 4GDBA 4NK3A 2HP6A 3BEBA 4MBFA 1BSGA 1IYQA 1L0DA 3GR2A 3PBQA 1IYPA 3C7VA 5E2EA 3ISGA 3G32A 3IT9A 3ZG5A 4RA7A 5G18A 2WZXA 3SS3A 4OPQA 5E2FA 3PAGA 3DW0A 4OPRA 3LY3A 4ZBEA 3CJMA 4MLLA 1Q2QA 4KG2A 2EXBA 1BLPA 1XGIA 3IHBA 4PM8A 4MBHA 1KDWA 4WBGA 1VQQA 4OLDA 1RGYA 4OPYA 2ZQ7A 3SH9A 4OPZA 3A3IA 4EQIA 3AGDA 4KG5A 2XF3A 5EVIC 5FI2A 4R3JA 1YMSA 3VP4A 2X01A 1GCEA 3VFFA 3E2LA 2HP5A 4E3MA 5JYPA 1K54C 2Y4AA 2BG1A 2HDSA 5CECA 4X69A 4OONA 1LI0A 4EBPA 3PBOA 4E6XA 2VGJA 3BFCA 4P6BA 5CHMA 1E4DA 3OZHA 4HESA 1ONHA 3VP0A 3IWQA 3ZVWA 4E6WA 3BFFA 4DF6A 1MWSA 3G4PA 3V50A 1I2SA 4L0LA 5DTSA 5FSRA 3V5MA 2WADA 5HARA 1KDSA 1RGZA 4RYEA 3WS2A 3MXRA 5A92A 3OCLA 1FSYA 1KGFA 2X71A 2Y2LA 1JWPA 3C7UA 2J9PA 4OQGA 3W4PA 4S2NC 5KMWA 3HLWA 4UA9A 1PIOA 5AQAA 2XD1A 5CGSA 5EE8A 1PI4A 4JPMA 2Y55A 2Y2OA 5FQ9A 4X56A 1NRFA 1XX2A 4X55A 1K57C 2IWCA 4P0MA 5KSCA 3BFDA 4B4XA 4LV2A 2ZQDA 2Y2GA 3VFHA 3CZDA 2WGIA 3PAEA 3WS5A 1KE3A 1E3UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2I A;  4KQO A;  1HTZ A;  1ERQ A;  2EXA A;  2EFU A;  3ZVT A;  4BL3 A;  4B88 A;  5GHX A;  4JKT A;  3IWI A;  4ZJ3 A;  1KGE A;  4UA6 A;  3Q7V A;  2ZM0 A;  5I94 A;  1O07 A;  4U3T A;  5GLD A;  4E3J A;  1RP5 A;  1M6K A;  4KQR A;  3RXW A;  4Q8I A;  1LLB A;  1PZO A;  3CG5 A;  1L2S A;  3FKW A;  4JBF A;  4WMC D;  1FSW A;  2DCF A;  2ZM2 A;  3Q81 A;  2OLU A;  1SCW A;  3V3S A;  2HDR A;  2X02 A;  5FQJ A;  3SOI A;  4HBU A;  1ESI A;  2BLS A;  4KZ7 A;  3VP3 A;  1TEM A;  4KQQ A;  4PM6 A;  5DF7 A;  4LCL A;  5KZH A;  4FH2 A;  4KZ5 A;  2P9V B;  3E2K A;  4KZ9 A;  2CC1 A;  1GA9 A;  3BLM A;  2R9W A;  5CHJ A;  4HEF A;  2ZD8 A;  1KVL A;  4DDY A;  1JWV A;  4BL2 A;  4JXW A;  1H8Z A;  1NZU A;  3N8S A;  1GHI A;  2WKE A;  4Y0U A;  4S2K A;  1H5X A;  3HLF A;  4EV4 A;  1PZP A;  2WYX A;  1IKI A;  3M6B A;  1CEG A;  5A90 A;  5EOE A;  1DY6 A;  3I7J A;  5D3O A;  2A49 A;  3HLD A;  1BUE A;  1CI8 A;  2ZC5 B;  3FV7 A;  4JF6 A;  3WRT A;  5HAQ A;  3A3D A;  2JE5 A;  4EBN A;  2XH9 A;  4FH4 A;  5L2F A;  2WGW B;  3A3F A;  4DE1 A;  2HP9 A;  4LV1 A;  1TDL A;  1WYB A;  2H5S A;  1MWU A;  1RCJ A;  2XR0 A;  4S2L A;  4ZDX A;  1TVF A;  4OKP A;  1BT5 A;  2B5R A;  4KZA A;  2WKI A;  3HLE A;  5F82 A;  5FI7 A;  2HDU A;  1YT4 A;  1Q2P A;  1NZO A;  2H0Y A;  1YMX A;  3DWK A;  4Z9Q A;  3Q7Z A;  3UPN A;  3UDF A;  2ZQ8 A;  2Y2J A;  5GLB A;  4E3O A;  2XDM A;  3UDI A;  1K4E A;  3S22 A;  5E2H A;  4GD6 A;  3ZNY A;  4BEN A;  4S2P A;  1N9B A;  2V1Z A;  5A93 A;  1G6A A;  2Y2Q A;  3BM6 A;  2GDN A;  4YFM A;  2JCH A;  2WZZ A;  3G2Z A;  3N4I A;  4X6T A;  1K55 A;  1YLT A;  3Q82 A;  3BRM A;  1ONG A;  3G2Y A;  5JYO A;  1ES4 A;  4ZJ2 A;  2EX6 A;  5M1A A;  4N1H A;  5J8X A;  4N92 A;  2IWB A;  1BLH A;  3B3X A;  4WZ4 A;  4OP5 A;  5F1F A;  1KE0 A;  3LY4 A;  3NDE A;  4MBK A;  3OPP A;  5BOH A;  1U60 A;  1ERM A;  2C6W B;  1E25 A;  4QY6 A;  5CHU A;  2V20 A;  2Y2P A;  3M2K A;  5FAT A;  1ES5 A;  2EX8 A;  3HL9 A;  4GNU A;  5FAS A;  5HW3 A;  1BTL A;  3TG9 A;  4BD1 A;  4XUX A;  4U0X A;  3QNB A;  4WZ5 A;  5DF9 A;  1HVB A;  4GOG A;  5FA7 A;  3IF6 B;  3GSG A;  4IVI A;  2H0T A;  3VOY A;  5U47 A;  4R3B A;  2EX2 A;  5GLA A;  3SS4 A;  1WE4 A;  1DJC A;  3ZCZ A;  2Y2M A;  4S2I A;  4DDS A;  4OVD A;  4WEK A;  2DNS A;  2R9X A;  3WS4 A;  5CGW A;  5A91 A;  2IWD A;  3G34 A;  3QHY A;  3PBT A;  3NI9 A;  3BLS A;  5EUA A;  2ZC3 B;  3P09 A;  3VP2 A;  4R4R A;  4OOY A;  1KVM A;  4BJP A;  4E3I A;  5E43 A;  4GB7 A;  5DTK A;  4QJG A;  3AGF A;  5CER A;  2Z2M B;  4BD0 A;  2ZC7 A;  4X68 A;  4F94 A;  3VP1 A;  1M40 A;  1GHP A;  2XFS A;  4JXG A;  1KE4 A;  4X53 A;  1FCM A;  1MKI A;  4PMA A;  5EVI A;  5CED A;  4KZ3 A;  3N8R A;  3ZGA B;  1K6R A;  3V39 A;  1C3B A;  2XQZ A;  3HUM A;  4IVK A;  2UWX A;  4WEJ A;  5CEB A;  2PU4 A;  5F1G A;  3M6H A;  2EX9 A;  1PI5 A;  3RJU A;  1TDG A;  3OPL A;  3PBN A;  4OH0 A;  3UNW A;  1FCN A;  3IXD A;  3W8K A;  3CMZ A;  3ZG9 B;  1MBL A;  4OP8 A;  4WM9 A;  1N4O A;  1VM1 A;  2G2U A;  5FI6 A;  1DJB A;  2A3U A;  3ZHH A;  1LI9 A;  3W4Q A;  1MPL A;  3W4O A;  1W8Y A;  1K56 A;  3N7W A;  3WWX A;  1HD8 A;  1SDE A;  1L0E A;  1K57 A;  3LCE A;  1WYC A;  3IF6 C;  3GV9 A;  3PBS A;  4E3N A;  4PPR A;  3ZG0 A;  5IHV A;  3IH9 A;  5HAI A;  3Q1F A;  1O7E A;  2ZQA A;  4DE3 A;  2DRW A;  4WEL A;  1XKZ A;  1ES3 A;  1PWG A;  4O7D A;  3PBR A;  1BLC A;  5FAP A;  3C4O A;  2I72 A;  1YQS A;  3S4X A;  3MZD A;  1IYO A;  1NY0 A;  2J9O A;  3HLB A;  3QNC A;  5HAP A;  4FSF A;  1EWZ A;  3MBZ A;  1PWC A;  3ITA A;  3TOI A;  3ZDJ A;  5EVL A;  3A3J A;  4CPK A;  2Q9N A;  4DXC A;  3HLG A;  5GHZ A;  3UN7 A;  4EUZ A;  2P74 A;  3IXH A;  4KZ6 A;  2XGN A;  4RX2 A;  4C6Y A;  2WAF A;  1I5Q A;  3FKV A;  3O86 A;  4JLF A;  3M2J A;  1IEL A;  2Z2L B;  2V2F F;  4QY5 A;  1JTG A;  5AQ9 A;  4JXV A;  5M19 A;  2J7V A;  1YLW A;  3UY6 A;  2Y2K A;  1K55 C;  1YM1 A;  4P87 A;  3MZE A;  4DXB A;  4UAA A;  2WK0 A;  4GDN A;  4IBR A;  4JF5 A;  5FAO A;  3Q7V B;  3OPH A;  3LEZ A;  4R1G A;  1JTD A;  2JC7 A;  1IKG A;  3G31 A;  5GL9 A;  2ZC6 B;  4DRT A;  1JVJ A;  4S2M A;  4EBL A;  2ZQC A;  5AQ7 A;  1K6S A;  3NCK A;  3ZG7 B;  1XA1 A;  3FZC A;  1OME A;  1YLP A;  3A3E A;  3C5A A;  1MWR A;  4KEN B;  4N9K A;  5DVA A;  1EI5 A;  5FQQ A;  3NBL A;  5DTT A;  1J9M A;  2H10 A;  4WZ5 C;  3S1Y A;  3SH8 A;  4PM9 A;  1XP4 A;  3OC2 A;  1NXY A;  3GQZ A;  4R0Q A;  1ERO A;  4LV3 A;  4OQ0 A;  1ZKJ A;  1ZG4 A;  4Y0T A;  3C4P A;  4RVA A;  2OLV A;  1PWD A;  2QZ6 A;  4DKI A;  3NC8 A;  1DJA A;  1SKF A;  2E8I A;  3MKF A;  4PM5 A;  1CI9 A;  1LHY A;  1K4F A;  2WKH A;  3BEC A;  2VGK A;  2J8Y A;  4DE2 A;  4EWF A;  1HZO A;  2XD5 A;  3JYI A;  1CEF A;  4FCF A;  4LEN A;  5HX9 A;  2XLN A;  2RL3 A;  4S2J A;  5EOO A;  1XPB A;  3ZNT A;  1ALQ A;  4KZB A;  5CRF A;  4U0T A;  4PM7 A;  3BFE A;  1YLY A;  2ZJ9 A;  1PYY A;  4GZB A;  4KZ8 A;  1E3U A;  4N1X A;  3ZFZ A;  1FCO A;  3HVF A;  4A5R A;  2ZLY A;  4UHU A;  1ESU A;  1YLZ A;  3IXG A;  3MKE A;  3GRJ A;  4GD8 A;  4LCM A;  1L0F A;  1JWZ A;  1FR6 A;  2G2W A;  4OOL A;  5CXW A;  2PU2 A;  3WS1 A;  5FDH A;  4C3Q A;  3NDG A;  4K0W A;  4OLG A;  2XK1 A;  1IYS A;  3GTC A;  3IWO A;  3NIA A;  3PTE A;  3Q07 A;  2P9V A;  3MZF A;  4H8R A;  4ID4 A;  4OQI A;  3MXS A;  4B4Z A;  5HL1 A;  3D4F A;  4WMC A;  1W8Q A;  1KGG A;  2ZC4 B;  5TFQ A;  3NY4 A;  2HPB A;  4QB8 A;  4UA7 A;  4BLM A;  4DE0 A;  5KSH A;  4QHC A;  4XUZ A;  3WS0 A;  1ES2 A;  3VOZ A;  3ZG8 B;  1K54 A;  3IHA A;  3N6I A;  2Q9M A;  5EEC A;  3HLC A;  4Y7P A;  2ZMA A;  3P98 A;  1LL9 A;  3VMA A;  4QU3 A;  4C75 A;  4D2O A;  5DF8 A;  3DWZ A;  2QMI A;  3GVB A;  3HUN A;  1XGJ A;  1YLJ A;  4RX3 A;  5AQB A;  5FQM A;  3UDX A;  4JF4 A;  2WGW A;  5EPH A;  4FD8 A;  1K38 A;  2RCX A;  5FAQ A;  2QPN A;  3UE3 A;  2ZM8 A;  3OPR A;  3HRE A;  4HBT A;  4S2N A;  4R4S A;  1W7F A;  4WYY A;  3RXX A;  3SS5 A;  4ZTK A;  2EFX A;  1K25 A;  2JBF A;  2Y91 A;  3HUO A;  1PW8 A;  1NYM A;  2OSU A;  1MXO A;  1AXB A;  1ZG6 A;  3SH7 A;  3VSL A;  1H8Y A;  5M18 A;  4QD4 A;  1FQG A;  5CGX A;  3ITB A;  4OQH A;  3LO7 A;  1FOF A;  3IH8 A;  2ZQ9 A;  4CJN A;  4OOM A;  4K0X A;  5CTN A;  1I2W A;  1QMF A;  5TGF A;  3OCN A;  4JXS A;  1BZA A;  1IEM A;  1S0W A;  4S2O A;  3MFD A;  2FFY A;  4K91 A;  1PW1 A;  4MNR A;  1W5D A;  5E2G A;  1BUL A;  5EVI D;  4YIN A;  4M3K A;  4ZAM A;  4KG6 A;  1G68 A;  1GHM A;  1XA7 A;  5FQI A;  3DTM A;  2XEP A;  5CTM A;  3EQU A;  2FFF B;  4ZJ1 A;  1NJ4 A;  5EVI B;  3WRZ A;  4KZ4 A;  1XXM A;  4E3K A;  1GA0 A;  4Y0O A;  1S6R A;  3FWL A;  1LL5 A;  2HDQ A;  3BFG A;  3O87 A;  3FYZ A;  2C5W B;  3IF6 A;  3UE0 A;  1Y54 A;  3IXB A;  4MEZ A;  4N9L A;  1ZC2 A;  1CK3 A;  1MY8 A;  4IED A;  3EQV A;  1MWT A;  3AGE A;  3BYD A;  3O88 A;  4XXR A;  5GHY A;  1K56 D;  2PBY A;  4GN2 A;  3UE1 A;  2WGV A;  3VSK A;  1L0G A;  5GLC A;  1FR1 A;  1NYY A;  3IF5 A;  5F83 A;  3O3V A;  1W79 A;  3UPP A;  5TR7 A;  3N8L A;  2Y59 A;  4P85 A;  3G30 A;  3GMW A;  4E3L A;  3IQA A;  3G35 A;  3UO9 A;  4GKU A;  2WAE A;  4NET A;  1BLS A;  3V3R A;  2Y2N A;  1SHV A;  5FQK A;  4BQM A;  5HFO A;  4LV0 A;  1SDN A;  2OV5 A;  2XFT A;  4R23 A;  3UPO A;  2WUQ A;  4IBX A;  1Z6F A;  3TSG A;  1QME A;  3HBR A;  2Y2H A;  4GDB A;  4NK3 A;  2HP6 A;  3BEB A;  4MBF A;  1BSG A;  1IYQ A;  1L0D A;  3GR2 A;  3PBQ A;  1IYP A;  3C7V A;  5E2E A;  3ISG A;  3G32 A;  3IT9 A;  3ZG5 A;  4RA7 A;  5G18 A;  2WZX A;  3SS3 A;  4OPQ A;  5E2F A;  3PAG A;  3DW0 A;  4OPR A;  3LY3 A;  4ZBE A;  3CJM A;  4MLL A;  1Q2Q A;  4KG2 A;  2EXB A;  1BLP A;  1XGI A;  3IHB A;  4PM8 A;  4MBH A;  1KDW A;  4WBG A;  1VQQ A;  4OLD A;  1RGY A;  4OPY A;  2ZQ7 A;  3SH9 A;  4OPZ A;  3A3I A;  4EQI A;  3AGD A;  4KG5 A;  2XF3 A;  5EVI C;  5FI2 A;  4R3J A;  1YMS A;  3VP4 A;  2X01 A;  1GCE A;  3VFF A;  3E2L A;  2HP5 A;  4E3M A;  5JYP A;  1K54 C;  2Y4A A;  2BG1 A;  2HDS A;  5CEC A;  4X69 A;  4OON A;  1LI0 A;  4EBP A;  3PBO A;  4E6X A;  2VGJ A;  3BFC A;  4P6B A;  5CHM A;  1E4D A;  3OZH A;  4HES A;  1ONH A;  3VP0 A;  3IWQ A;  3ZVW A;  4E6W A;  3BFF A;  4DF6 A;  1MWS A;  3G4P A;  3V50 A;  1I2S A;  4L0L A;  5DTS A;  5FSR A;  3V5M A;  2WAD A;  5HAR A;  1KDS A;  1RGZ A;  4RYE A;  3WS2 A;  3MXR A;  5A92 A;  3OCL A;  1FSY A;  1KGF A;  2X71 A;  2Y2L A;  1JWP A;  3C7U A;  2J9P A;  4OQG A;  3W4P A;  4S2N C;  5KMW A;  3HLW A;  4UA9 A;  1PIO A;  5AQA A;  2XD1 A;  5CGS A;  5EE8 A;  1PI4 A;  4JPM A;  2Y55 A;  2Y2O A;  5FQ9 A;  4X56 A;  1NRF A;  1XX2 A;  4X55 A;  1K57 C;  2IWC A;  4P0M A;  5KSC A;  3BFD A;  4B4X A;  4LV2 A;  2ZQD A;  2Y2G A;  3VFH A;  3CZD A;  2WGI A;  3PAE A;  3WS5 A;  1KE3 A;  1E3U D; 
#chains in the Genus database with same CATH topology
 1HTZ A;  2W27 A;  4UQI S;  4BL3 A;  3B42 A;  4XT2 A;  4B88 A;  5GHX A;  2K7S A;  4E3J A;  3RXW A;  2VX8 A;  1L2S A;  1EW0 A;  3E4Q A;  2DCF A;  4CLC E;  3V3S A;  2HDR A;  1P97 A;  5FQJ A;  2BLS A;  4PM6 A;  5DF7 A;  3C38 A;  2B95 A;  4KZ5 A;  2O0Y A;  1H8Z A;  1BYW A;  1DP9 A;  4S2K A;  3KYZ A;  1CEG A;  3EEH A;  1DY6 A;  4RQ9 A;  5D3O A;  3HLD A;  1BUE A;  4EBN A;  4FH4 A;  2HP9 A;  1WYB A;  1MWU A;  3CLO A;  4S2L A;  1TVF A;  4OKP A;  1T19 A;  3W2Z A;  1YT4 A;  1Q2P A;  1TS8 A;  4Y15 A;  3E98 A;  2M7V A;  5HPF A;  3UPN A;  3UDF A;  2Y2J A;  2XDM A;  3UDI A;  3S22 A;  3LUQ A;  4YFM A;  1HLU P;  3CPT A;  1K55 A;  3BRM A;  3BY9 A;  2ACG A;  5M1A A;  5J8X A;  1YAX A;  4MBK A;  1MZU A;  4QY6 A;  1E25 A;  3T4Q A;  1UWN X;  5FAS A;  2EX8 A;  3TG9 A;  4WZ5 A;  1HVB A;  5FA7 A;  4R3A A;  3IF6 B;  3GSG A;  3VOY A;  3HJK A;  1H3Q A;  5U47 A;  3SS4 A;  3ZCZ A;  4WEK A;  2R9X A;  3V67 A;  3WS4 A;  3G34 A;  5HL6 A;  5L10 A;  3U4L P;  4CQH A;  5E43 A;  2I9V A;  2JHE A;  2ZC7 A;  4X68 A;  1M40 A;  4JXG A;  1X0O A;  2UV0 E;  4HY8 A;  1FCM A;  3KSF A;  4PMA A;  3FG8 A;  4LLO B;  3B47 A;  1LSW A;  3A0R A;  2PU4 A;  5F1G A;  3M6H A;  3RJU A;  3PBN A;  1UWP X;  3CMZ A;  3D9Y A;  1DJB A;  3ZHH A;  1K56 A;  4H6J B;  5CX7 A;  4Y5F A;  3TE8 A;  4EER A;  5HAI A;  4IUH A;  3IX4 A;  2V0U A;  2HV1 A;  2DRW A;  3KSI A;  3T4K A;  1ES3 A;  2KOI A;  4JGO A;  3BQ8 A;  3PBR A;  3EEA A;  2J9O A;  3TOI A;  5GHZ A;  2P74 A;  4ARZ A;  1STZ A;  3O86 A;  2GX5 A;  4JLF A;  3M2J A;  3BJN A;  2V2F F;  1JTG A;  4JXV A;  3UY6 A;  1K55 C;  2ZBB A;  3MZE A;  4GDN A;  5FL3 A;  3T4S A;  5EFW A;  3OPH A;  1CQA A;  5HDC A;  3LEZ A;  4R1G A;  1JTD A;  1H8M A;  2JC7 A;  2QJ7 A;  3G31 A;  1JVJ A;  4EBL A;  1S4S A;  3T4O A;  3IX8 A;  3ZG7 B;  2W3G A;  3FZC A;  1YLP A;  3C5A A;  1MWR A;  5DVA A;  3R7W A;  3NBL A;  4WZ5 C;  1ERO A;  4LV3 A;  4OQ0 A;  2GNX A;  1ZG4 A;  4KUO A;  3NC8 A;  2ZOH A;  2J3W A;  2XA7 M;  3PXP A;  4PM5 A;  5HZH A;  1K4F A;  2J8Y A;  4EWF A;  3JYI A;  4Q0J A;  2RL3 A;  3ZNT A;  2LB9 A;  4ETX A;  5CRF A;  4MN7 A;  4PM7 A;  1PYY A;  4N1X A;  3ZFZ A;  3C30 A;  3IXG A;  3MKE A;  4GD8 A;  1JWZ A;  4K08 A;  3UMD A;  5CXW A;  2PU2 A;  3DTK A;  3LI8 A;  2XK1 A;  2KDK A;  2O9A A;  4HQA A;  3D4F A;  4WMC A;  2ZC4 B;  3NY4 A;  4QHC A;  3ZG8 B;  1ES2 A;  1V9Z A;  3KSH A;  2ZMA A;  1V9Y A;  3GVB A;  1XFQ A;  1XGJ A;  3HUN A;  3UDX A;  2PYP A;  5EPH A;  3LGO A;  3OPR A;  4FUW A;  4HBT A;  4R4S A;  4WYY A;  2EFX A;  1PW8 A;  1NYM A;  3SH7 A;  3EGD C;  3VSL A;  1H8Y A;  3T4T A;  4MMN A;  3LO7 A;  4Q0H A;  4K0X A;  5CTN A;  2XRN A;  5TGF A;  1QMF A;  3L9K A;  2E8J A;  1IEM A;  1S0W A;  3MS6 A;  4CLC B;  2EA9 A;  1OJG A;  2FFY A;  3LR3 A;  5TBM A;  3OLO A;  3S7P A;  1SZV A;  5EVI D;  4M3K A;  3EWK A;  1G68 A;  1GHM A;  3ZQ5 A;  5CTM A;  2VK3 A;  3EQU A;  3JVV A;  2PAV P;  4E3K A;  1GA0 A;  4HJ6 A;  4DJ3 A;  3IF6 A;  3UE0 A;  3IXB A;  3EQV A;  1MWT A;  3BYD A;  4XXR A;  2WKP A;  4GN2 A;  2WGV A;  5GLC A;  1W79 A;  3UPP A;  3N8L A;  3G30 A;  3G35 A;  1SDN A;  4R23 A;  5FEG A;  5EM1 A;  5J7E A;  3UB7 A;  3HBR A;  4Y3I A;  3H9W A;  3GR2 A;  1IYP A;  2B18 A;  2XA7 S;  4LRX C;  4HP9 A;  2OAQ 1;  3DW0 A;  4OPR A;  3LY3 A;  4R38 A;  3MFX A;  1VET B;  4KG2 A;  4MBH A;  2QKP A;  4OPY A;  2ZQ7 A;  1NWZ A;  3HJI A;  3AGD A;  4H6J A;  5EVI C;  1YMS A;  1GCE A;  2HP5 A;  2GJ3 A;  2PT7 A;  2HZ5 A;  2VGJ A;  1ONH A;  4KQD A;  3ZVW A;  4E6W A;  2VV6 A;  1OJ5 A;  1MWS A;  3G4P A;  1IOU A;  3V5M A;  1W63 M;  5HAR A;  1RGZ A;  4RYE A;  3MXR A;  3B33 A;  4EES A;  1N9O A;  2J9P A;  5KMW A;  4UA9 A;  2V0W A;  3NEC A;  4O0P A;  4X56 A;  1XX2 A;  4X55 A;  4BWI A;  4O8G A;  5KSC A;  3BFD A;  2ZQD A;  2P04 A;  3VFH A;  3CZD A;  1DRM A;  3ZVT A;  1ERQ A;  2EFU A;  3G6O A;  3CUE A;  4HJ4 A;  3H7W A;  1P9W A;  4HP4 A;  2ZM0 A;  4U3T A;  3MQ0 A;  4KQR A;  2D01 A;  4UEY A;  3Q81 A;  2OLU A;  1SCW A;  3ZYT A;  4Y13 A;  4KZ7 A;  1TS6 A;  2P9V B;  1GA9 A;  4HEF A;  1NZU A;  1GHI A;  2WKE A;  4Y0U A;  1H5X A;  1PZP A;  2L4R A;  3F1P B;  2EWW A;  4EU0 A;  3I7J A;  2A49 A;  1CI8 A;  3WRT A;  1PRQ A;  2JE5 A;  5L2F A;  4B93 A;  4LV1 A;  1TDL A;  3UB6 A;  1RCJ A;  4ZDX A;  3E4O A;  2B5R A;  5FI7 A;  2INW A;  4LPZ A;  1NZO A;  1YMX A;  2ZQ8 A;  5F6A A;  3GEC A;  4GD6 A;  5DJT A;  2V1Z A;  3BY8 A;  4BMW A;  4X6T A;  3NOU C;  5JYO A;  1ONG A;  3G2Y A;  4NXB A;  1ES4 A;  4WN5 A;  3LID A;  2HF6 A;  2EX6 A;  2EWV A;  3IBR A;  5F1F A;  3OPP A;  1U60 A;  3LEQ A;  2Y2P A;  3M2K A;  1ES5 A;  4GNU A;  5HW3 A;  2R78 A;  3QP1 A;  5DF9 A;  3QNB A;  5I5L A;  5L8M A;  3RFB A;  5MC7 A;  2H0T A;  3VV4 A;  4R3B A;  4HH2 A;  1DJC A;  4DDS A;  4S2I A;  5AJG A;  2V1A A;  4CLC A;  5A91 A;  3NI9 A;  3S7N A;  3BLS A;  1LSV A;  2BTF P;  4OOY A;  1KVM A;  1YPR A;  5DTK A;  4BD0 A;  2Z2M B;  3VP1 A;  1GHP A;  4JGQ A;  4X53 A;  1MKI A;  3IS2 B;  1C3B A;  2UWX A;  5CEB A;  1PI5 A;  4OH0 A;  3W8K A;  3LR4 A;  1GSV A;  3ZG9 B;  1MBL A;  4OP8 A;  1VM1 A;  2G2U A;  3S7O A;  1LI9 A;  3FPW A;  3W4O A;  3EOI A;  3WWX A;  1XJ2 A;  3LCE A;  1WYC A;  3GV9 A;  4EQ1 A;  3ZG0 A;  5IHV A;  3LR5 A;  3Q1F A;  1FIK A;  4DE3 A;  1N9L A;  3D72 A;  1BLC A;  1VET A;  1FIL A;  2K2N A;  3MZD A;  3QNC A;  1PWC A;  3ITA A;  2AVX A;  2VGL M;  5EVL A;  3A3J A;  2Q9N A;  4FOF A;  3IXH A;  4KZ6 A;  4L9G A;  4Q0I A;  2XGN A;  1ODV A;  4RX2 A;  1I5Q A;  3LIC A;  1D1J A;  3OBF A;  1TS0 A;  2YKF A;  5AQ9 A;  2J7V A;  1F5M A;  4DXB A;  4UAA A;  2WK0 A;  2A24 B;  4JF5 A;  2ZC6 B;  4S2M A;  4I39 A;  3S7Q A;  1OME A;  3A3E A;  4N9K A;  1EI5 A;  5DTT A;  3OC2 A;  1NXY A;  2OLV A;  4GS9 B;  2VZW A;  1W63 Q;  2WKH A;  5IU1 A;  3BEC A;  4DN0 A;  2XD5 A;  2HJE A;  4GHI B;  4FCF A;  5AVF A;  2LB5 A;  5HX9 A;  2XLN A;  4S2J A;  1ALQ A;  4G3K A;  4PKY G;  1T1B A;  4BBV A;  1S66 L;  1F9I A;  3HVF A;  4A5R A;  5EV0 A;  1YLZ A;  4IJG A;  1L0F A;  2P7J A;  2PBD P;  2G2W A;  1NRJ A;  3T12 B;  3WS1 A;  5FDH A;  4K0W A;  4I38 A;  4OLG A;  4QPR A;  3Q07 A;  2B02 A;  2P9V A;  3MZF A;  4H8R A;  1H0M A;  3MXS A;  1DP8 A;  4MN6 A;  3LIB A;  4QB8 A;  4BLM A;  2ZL1 B;  2ZMV A;  3N6I A;  3P7N A;  2Q9M A;  3HLC A;  5DF8 A;  5J4E A;  2QMI A;  5FQM A;  1G28 A;  5AQB A;  2RCX A;  3HRE A;  1ACF A;  1W7F A;  3SS5 A;  1K25 A;  2JBF A;  2XSS A;  2OSU A;  1ZG6 A;  1AXB A;  1FQG A;  5CGX A;  3ITB A;  4OQH A;  3KSG A;  4CJN A;  1I2W A;  2DMW A;  1BZA A;  4S2O A;  3MFD A;  4K91 A;  3UB5 P;  1MKM A;  1BUL A;  1A0K A;  1CJF A;  1VEU B;  4FTX A;  4WF0 A;  4NXE A;  2VGL S;  3WRZ A;  2KLI A;  3A0S A;  1XXM A;  2PHY A;  1LL5 A;  3BFG A;  3O87 A;  2C5W B;  3VE4 A;  4MEZ A;  1K0K A;  3AGE A;  1K56 D;  3VSK A;  1FR1 A;  3IF5 A;  3O3V A;  1OTA A;  3GMW A;  3IQA A;  4X25 A;  5EVE A;  4NET A;  1BLS A;  5FQK A;  1SHV A;  4LV0 A;  2OV5 A;  2WUQ A;  3H82 B;  4IBX A;  1Z6F A;  4GDB A;  2HP6 A;  4MBF A;  2W0N A;  3PYP A;  3IS2 A;  5G4Y A;  4G3W A;  3ZG5 A;  5G18 A;  2WZX A;  1XFN A;  1Q2Q A;  1BLP A;  4EET B;  3QP2 A;  2M1C A;  1RGY A;  3F1N B;  4EQI A;  4QWO A;  1OTD A;  2XF3 A;  4ZRR A;  5FI2 A;  2X01 A;  2FH5 A;  4E3M A;  2HGV A;  2BG1 A;  2HDS A;  3LIA A;  4EBP A;  3PBO A;  4EXO A;  4P6B A;  3VE3 A;  5L09 A;  2PD7 A;  3BFF A;  2VJW A;  5DTS A;  1KDS A;  3RTY A;  1KGF A;  1UGU A;  1PIO A;  5AQA A;  3K3C A;  5EE8 A;  1PI4 A;  4JPM A;  1Y28 A;  2Y2O A;  1NRF A;  4P0M A;  5FEF A;  2Y2G A;  2WGI A;  3PAE A;  4JGR A;  3WS5 A;  2Y2I A;  3QP6 A;  4PAU A;  4JKT A;  3IWI A;  4ZJ3 A;  3FPV A;  4UA6 A;  5GLD A;  4Q8I A;  1M6K A;  1LLB A;  2L1M A;  1P9R A;  4WMC D;  2X02 A;  3SOI A;  4HBU A;  3VP3 A;  1TEM A;  4LCL A;  3MMH A;  1OTB A;  3E2K A;  4KZ9 A;  4GS9 A;  2ZD8 A;  4DDY A;  1JWV A;  4JXW A;  2Y79 A;  5DFY A;  3HLF A;  4GHI A;  5A90 A;  2WYX A;  1IKI A;  3M6B A;  2D02 A;  5LBR A;  3FV7 A;  4JF6 A;  3F1O B;  2XH9 A;  2WGW B;  4DE1 A;  2V1B A;  2XR0 A;  1D06 A;  2PDR A;  3BWL A;  1BT5 A;  4KZA A;  2WKI A;  5F82 A;  2H0Y A;  3KYQ A;  4BBT A;  4Z9Q A;  5GLB A;  4E3O A;  3NOP C;  3C2W A;  2JKF A;  2NUP C;  3FC7 A;  2ZL1 A;  5A93 A;  1G6A A;  2Y2Q A;  3BM6 A;  3JVU A;  4NXF A;  2WZZ A;  3CAX A;  3Q82 A;  4N92 A;  2IWB A;  3B3X A;  1YSQ A;  4WZ4 A;  1KE0 A;  3NDE A;  1OTE A;  1MC0 A;  1ERM A;  2V20 A;  1TS7 A;  2W1T B;  3IBJ A;  5FAT A;  1BTL A;  4XUX A;  4U0X A;  2ZOI A;  2V8F A;  2VKS A;  4IVI A;  2W3E A;  4EEU A;  3QP5 A;  2EX2 A;  5GLA A;  1WE4 A;  2DNS A;  1NLZ A;  5CGW A;  2IWD A;  1LL8 A;  2O99 A;  5EUA A;  2ZC3 B;  4L9F A;  4WL9 A;  4E3I A;  4GB7 A;  4QJG A;  3AGF A;  5CER A;  1VEU A;  3VOL A;  1OTI A;  4ETZ A;  4IUK A;  2XFS A;  5TJJ A;  4LRY C;  1KE4 A;  2J80 A;  4HIA A;  3ZGA B;  1K6R A;  2VLG A;  2XQZ A;  3CPT B;  2EX9 A;  1TDG A;  1FCN A;  3IXD A;  3JPU A;  1SKO B;  2Q0O A;  4Z1W A;  4PHT A;  1N4O A;  1TF1 A;  3MF0 A;  1MPL A;  3N7W A;  1HD8 A;  4HH3 A;  1L0E A;  1K57 A;  3IF6 C;  4LFU A;  3PBS A;  4E3N A;  3TJZ C;  1KOU A;  1O7E A;  3RH8 B;  2W3H A;  2ZQA A;  1XKZ A;  3HCY A;  5FAP A;  2BAS A;  3C4O A;  2I72 A;  1YQS A;  1IYO A;  5HAP A;  1CF0 A;  3PR6 A;  3MBZ A;  2JKR M;  3EGX C;  3F1N A;  4EUZ A;  3HLG A;  3UN7 A;  1ZTU A;  4C6Y A;  1XJ6 A;  2WAF A;  4MN5 A;  2Z2L B;  2M7U A;  1YSP A;  4QY5 A;  4IHQ A;  1GSX A;  1YLW A;  2Y2K A;  1YM1 A;  4P87 A;  3DTE A;  5FAO A;  3MXQ A;  2A2L A;  3Q7V B;  1IKG A;  4X1L A;  5GL9 A;  2ZQC A;  2W3D A;  1K6S A;  1GSW A;  1XA1 A;  3K2N A;  2H10 A;  2P08 A;  3SH8 A;  4PM9 A;  4R0Q A;  5L07 A;  5DKL A;  4Y0T A;  4RVA A;  1PWD A;  4DKI A;  1DJA A;  3L7H A;  3LYX A;  1CI9 A;  1LHY A;  4DE2 A;  3O5Y A;  1XPB A;  4U0T A;  3BFE A;  5IS1 A;  2ZJ9 A;  1E3U A;  2V8C A;  4UHU A;  2J3T D;  1ESU A;  2HJ9 C;  3GRJ A;  4LCM A;  4C3Q A;  4E04 A;  3NIA A;  1IYS A;  5DJU A;  2PRF A;  3CUE C;  3MSH A;  1G5U A;  4F3L B;  4DE0 A;  5KSH A;  3WS0 A;  2QJ5 A;  3IHA A;  5HSQ A;  5A8B A;  5EEC A;  1S1Z A;  4Y7P A;  3P98 A;  2FZ0 A;  4M4X A;  3KYE A;  1DP6 A;  4QU3 A;  4WUJ A;  4C75 A;  4D2O A;  1PNE A;  3F1O A;  1YLJ A;  2L0W A;  4RX3 A;  2WGW A;  3E4P A;  4FD8 A;  5FAQ A;  2QPN A;  3UE3 A;  2ZM8 A;  1IFQ A;  4S2N A;  2YKH A;  4ZTK A;  3U2A A;  2Y91 A;  4HJ3 A;  4CLC D;  5M18 A;  3KX0 X;  3UE6 A;  1FOF A;  2G7U A;  3IH8 A;  1T1A A;  1N9N A;  4JXS A;  2OWJ A;  1PW1 A;  4MNR A;  2WKR A;  4R6L A;  4YIN A;  5HDS A;  4KUK A;  2XEP A;  2J3T C;  2W1T A;  1NJ4 A;  1D7E A;  5EVI B;  3FWL A;  3FYZ A;  1Y54 A;  4N9L A;  1MY8 A;  4IED A;  5GHY A;  2JN7 A;  1NYY A;  5F83 A;  2JKR I;  5TR7 A;  2XRO A;  2Y59 A;  1XJ3 A;  3UO9 A;  2WAE A;  3V3R A;  5HFO A;  3BQA A;  2XFT A;  4NK3 A;  4MCW A;  3BEB A;  1BSG A;  1IYQ A;  1L0D A;  3G32 A;  3IT9 A;  4RA7 A;  5TBM B;  4CLC C;  2JKG A;  4HOI A;  1SKO A;  4MLL A;  3BW6 A;  2IA2 A;  4PM8 A;  4WBG A;  1VQQ A;  3A3I A;  5F69 A;  2Z6C A;  1S67 L;  4KG5 A;  4R3J A;  3VFF A;  2PR5 A;  5JYP A;  3DAV A;  3C8C A;  3DBA A;  5CEC A;  4OON A;  1LI0 A;  4E6X A;  2VA0 A;  3BFC A;  1E4D A;  3OZH A;  4HES A;  3VP0 A;  4I3I A;  4DF6 A;  1VHM A;  4L0L A;  3WS2 A;  2WAD A;  4ME4 A;  3OCL A;  1FSY A;  3F1P A;  1JWP A;  4OQG A;  3W4P A;  4S2N C;  2Y8H A;  3QP8 A;  2XD1 A;  5CGS A;  5FQ9 A;  3DTI A;  1S1Y A;  4B4X A;  4LV2 A;  2V9A A;  3OOV A;  1KE3 A;  5DKK A;  4KQO A;  2EXA A;  4BBU A;  1KGE A;  5HD3 A;  3Q7V A;  4G3V A;  5I94 A;  1O07 A;  1RP5 A;  3MQQ A;  5AVE A;  4HNB A;  1PZO A;  3CG5 A;  3FKW A;  4JBF A;  2PD8 A;  1FSW A;  2ZM2 A;  2CMN A;  1ESI A;  4KQQ A;  4L9E A;  5KZH A;  1G6O A;  4FH2 A;  2CC1 A;  3BLM A;  2R9W A;  5CHJ A;  3T1S A;  3UB8 A;  1KVL A;  4BL2 A;  3N8S A;  4EV4 A;  4LGW A;  3CI6 A;  5EOE A;  3MQO A;  4NG2 A;  4HHD A;  3CIT A;  1E3U D;  2ZC5 B;  2GZA A;  5HAQ A;  3A3D A;  3A3F A;  3CWF A;  2H5S A;  5HWW A;  3HLE A;  4I5S A;  2HDU A;  5DFX A;  4HI4 A;  3DWK A;  1T18 A;  3Q7Z A;  3NJA A;  3UME A;  1P0Z A;  3H7W B;  5J3W A;  4NKP A;  3ULF A;  1K4E A;  5E2H A;  1Z09 A;  3ZNY A;  4BEN A;  4S2P A;  2VV8 A;  1N9B A;  1OPX A;  3T4J A;  4F3L A;  2PYR A;  2GDN A;  2JCH A;  4DMZ A;  3G2Z A;  3N4I A;  1YLT A;  4ZJ2 A;  2QHK A;  4N1H A;  1Y4O A;  1BLH A;  4OP5 A;  3LY4 A;  5BOH A;  2C6W B;  2O9B A;  5CHU A;  4D60 A;  3LFV A;  3HL9 A;  2ZMF A;  1F98 A;  4BD1 A;  4GOG A;  3T1R A;  4NEE D;  3SZT A;  2Y2M A;  4OVD A;  4I3J A;  3QHY A;  3PBT A;  2O9C A;  3P09 A;  3VP2 A;  4R4R A;  1YKD A;  4BJP A;  5HDD A;  5KIZ A;  3IX3 A;  4F94 A;  4YWZ A;  4PKY A;  4ESP A;  5EVI A;  5CED A;  5G4Z A;  4KZ3 A;  3N8R A;  3V39 A;  3HUM A;  4IVK A;  4WEJ A;  3K3D A;  2WKQ A;  3OPL A;  3UNW A;  3LIE A;  3D3O A;  2A24 A;  4WM9 A;  5IT5 A;  5FI6 A;  1F2K A;  2A3U A;  3W4Q A;  2JKT M;  1W8Y A;  2OOL A;  1ZHH B;  3MJQ A;  1SDE A;  4P6Z M;  1PFL A;  4PPR A;  3TRC A;  3IH9 A;  2Z6D A;  4WEL A;  4YOF A;  1PWG A;  4O7D A;  3S4X A;  1NY0 A;  3HLB A;  4FSF A;  1EWZ A;  3ZDJ A;  4CPK A;  4DXC A;  1TD5 A;  4B9O A;  3FKV A;  1IEL A;  2VEA A;  4GJ4 A;  5M19 A;  4XT2 B;  1J3W A;  2MJ6 A;  4IBR A;  3A0V A;  5HD5 A;  4DRT A;  5AQ7 A;  3P01 A;  3NCK A;  4KEN B;  5FQQ A;  3ICY A;  1OT9 A;  4GLQ A;  4I3A A;  1J9M A;  2QWS A;  3S1Y A;  1XP4 A;  3GQZ A;  4II7 A;  1ZKJ A;  4WLA A;  3C4P A;  2QZ6 A;  1SKF A;  5F68 A;  2E8I A;  3MKF A;  3NUL A;  4EEP A;  2QYB A;  2VGK A;  1HZO A;  1CEF A;  1S4R A;  4LEN A;  5EOO A;  4KZB A;  4MDZ A;  2H28 A;  1YLY A;  4GZB A;  4KZ8 A;  4R70 A;  1FCO A;  2NUT C;  2ZLY A;  4EW7 A;  4Y17 A;  1FR6 A;  4OOL A;  3NDG A;  3IWO A;  3GTC A;  3GDI A;  3PTE A;  4ID4 A;  4EUV A;  3SW1 A;  4OQI A;  4DJ2 A;  1WA9 A;  4B4Z A;  5HL1 A;  1W8Q A;  1KGG A;  5TFQ A;  2HPB A;  4UA7 A;  4XUZ A;  3VOZ A;  3PHY A;  1K54 A;  3QP4 A;  3NHQ A;  1LL9 A;  4GCZ A;  3VMA A;  1LSX A;  3NOT C;  3DWZ A;  4JF4 A;  1K38 A;  5EM0 A;  3RXX A;  1T1C A;  1JNU A;  3HUO A;  4O01 A;  1MXO A;  4QD4 A;  4UQI M;  3T50 A;  3H82 A;  4P6Z S;  2ZQ9 A;  4OOM A;  3OCN A;  2JKT I;  1W5D A;  5E2G A;  1NLY A;  4ZAM A;  4KG6 A;  1XA7 A;  5FQI A;  3DTM A;  2FFF B;  4ZJ1 A;  3MR0 A;  4KZ4 A;  4Y0O A;  5HWV A;  2VV7 A;  1S6R A;  1AWI A;  2HDQ A;  2K31 A;  4X1M A;  1ZC2 A;  1CK3 A;  3O88 A;  2PBY A;  3UE1 A;  1L0G A;  3CHW P;  1VB6 A;  4P85 A;  3T1X A;  4E3L A;  5FDS A;  4GKU A;  2Y2N A;  4BQM A;  3UPO A;  3TSG A;  3T4L A;  1QME A;  2Y2H A;  3PBQ A;  3C7V A;  3LIF A;  5E2E A;  3ISG A;  1LT0 A;  3SS3 A;  4OPQ A;  5E2F A;  3PAG A;  3UB9 A;  2OWH A;  4ZBE A;  3CJM A;  4GW9 A;  5K5B A;  2EXB A;  1XGI A;  3IHB A;  3KO6 A;  3TW8 A;  1KDW A;  4OLD A;  3SH9 A;  4OPZ A;  5HPI A;  4AFI A;  4ARZ B;  3E0Y A;  3VP4 A;  3E2L A;  1K54 C;  2Y4A A;  4X69 A;  3LI9 A;  5CHM A;  3IWQ A;  1XJ4 A;  3V50 A;  1I2S A;  5FSR A;  5A92 A;  2Y2L A;  2X71 A;  3C7U A;  3HLW A;  4LRZ E;  1L3L A;  2W1R A;  4JGP A;  4YNR A;  5F5Y A;  4Y2F A;  3R7W B;  5HWT A;  2Y55 A;  1K57 C;  2IWC A;  3T1Q B;  2OAP 1;  1OT6 A;  2W3F A;  5C5K A;  2KX6 A;  4NXG A;  3R4K A;  3LR0 A;  2PR6 A; 
#chains in the Genus database with same CATH homology
 2Y2I A;  4KQO A;  1HTZ A;  1ERQ A;  2EXA A;  2EFU A;  3ZVT A;  4BL3 A;  4B88 A;  5GHX A;  4JKT A;  3IWI A;  4ZJ3 A;  1KGE A;  4UA6 A;  3Q7V A;  2ZM0 A;  5I94 A;  1O07 A;  4U3T A;  5GLD A;  4E3J A;  1RP5 A;  1M6K A;  4KQR A;  3RXW A;  4Q8I A;  1LLB A;  1PZO A;  3CG5 A;  1L2S A;  3FKW A;  4JBF A;  4WMC D;  1FSW A;  2DCF A;  2ZM2 A;  3Q81 A;  2OLU A;  1SCW A;  3V3S A;  2HDR A;  2X02 A;  5FQJ A;  3SOI A;  4HBU A;  1ESI A;  2BLS A;  4KZ7 A;  3VP3 A;  1TEM A;  4KQQ A;  4PM6 A;  5DF7 A;  4LCL A;  5KZH A;  4FH2 A;  4KZ5 A;  2P9V B;  3E2K A;  4KZ9 A;  2CC1 A;  1GA9 A;  3BLM A;  2R9W A;  5CHJ A;  4HEF A;  2ZD8 A;  1KVL A;  4DDY A;  1JWV A;  4BL2 A;  4JXW A;  1H8Z A;  1NZU A;  3N8S A;  1GHI A;  2WKE A;  4Y0U A;  4S2K A;  1H5X A;  3HLF A;  4EV4 A;  1PZP A;  2WYX A;  1IKI A;  3M6B A;  1CEG A;  5A90 A;  5EOE A;  1DY6 A;  3I7J A;  5D3O A;  2A49 A;  3HLD A;  1BUE A;  1CI8 A;  2ZC5 B;  3FV7 A;  4JF6 A;  3WRT A;  5HAQ A;  3A3D A;  2JE5 A;  4EBN A;  2XH9 A;  4FH4 A;  5L2F A;  2WGW B;  3A3F A;  4DE1 A;  2HP9 A;  4LV1 A;  1TDL A;  1WYB A;  2H5S A;  1MWU A;  1RCJ A;  2XR0 A;  4S2L A;  4ZDX A;  1TVF A;  4OKP A;  1BT5 A;  2B5R A;  4KZA A;  2WKI A;  3HLE A;  5F82 A;  5FI7 A;  2HDU A;  1YT4 A;  1Q2P A;  1NZO A;  2H0Y A;  1YMX A;  3DWK A;  4Z9Q A;  3Q7Z A;  3UPN A;  3UDF A;  2ZQ8 A;  2Y2J A;  5GLB A;  4E3O A;  2XDM A;  3UDI A;  1K4E A;  3S22 A;  5E2H A;  4GD6 A;  3ZNY A;  4BEN A;  4S2P A;  1N9B A;  2V1Z A;  5A93 A;  1G6A A;  2Y2Q A;  3BM6 A;  2GDN A;  4YFM A;  2JCH A;  2WZZ A;  3G2Z A;  3N4I A;  4X6T A;  1K55 A;  1YLT A;  3Q82 A;  3BRM A;  1ONG A;  3G2Y A;  5JYO A;  1ES4 A;  4ZJ2 A;  2EX6 A;  5M1A A;  4N1H A;  5J8X A;  4N92 A;  2IWB A;  1BLH A;  3B3X A;  4WZ4 A;  4OP5 A;  5F1F A;  1KE0 A;  3LY4 A;  3NDE A;  4MBK A;  3OPP A;  5BOH A;  1U60 A;  1ERM A;  2C6W B;  1E25 A;  4QY6 A;  5CHU A;  2V20 A;  2Y2P A;  3M2K A;  5FAT A;  1ES5 A;  2EX8 A;  3HL9 A;  4GNU A;  5FAS A;  5HW3 A;  1BTL A;  3TG9 A;  4BD1 A;  4XUX A;  4U0X A;  3QNB A;  4WZ5 A;  5DF9 A;  1HVB A;  4GOG A;  5FA7 A;  3IF6 B;  3GSG A;  4IVI A;  2H0T A;  3VOY A;  5U47 A;  4R3B A;  2EX2 A;  5GLA A;  3SS4 A;  1WE4 A;  1DJC A;  3ZCZ A;  2Y2M A;  4S2I A;  4DDS A;  4OVD A;  4WEK A;  2DNS A;  2R9X A;  3WS4 A;  5CGW A;  5A91 A;  2IWD A;  3G34 A;  3QHY A;  3PBT A;  3NI9 A;  3BLS A;  5EUA A;  2ZC3 B;  3P09 A;  3VP2 A;  4R4R A;  4OOY A;  1KVM A;  4BJP A;  4E3I A;  5E43 A;  4GB7 A;  5DTK A;  4QJG A;  3AGF A;  5CER A;  2Z2M B;  4BD0 A;  2ZC7 A;  4X68 A;  4F94 A;  3VP1 A;  1M40 A;  1GHP A;  2XFS A;  4JXG A;  1KE4 A;  4X53 A;  1FCM A;  1MKI A;  4PMA A;  5EVI A;  5CED A;  4KZ3 A;  3N8R A;  3ZGA B;  1K6R A;  3V39 A;  1C3B A;  2XQZ A;  3HUM A;  4IVK A;  2UWX A;  4WEJ A;  5CEB A;  2PU4 A;  5F1G A;  3M6H A;  2EX9 A;  1PI5 A;  3RJU A;  1TDG A;  3OPL A;  3PBN A;  4OH0 A;  3UNW A;  1FCN A;  3IXD A;  3W8K A;  3CMZ A;  3ZG9 B;  1MBL A;  4OP8 A;  4WM9 A;  1N4O A;  1VM1 A;  2G2U A;  5FI6 A;  1DJB A;  2A3U A;  3ZHH A;  1LI9 A;  3W4Q A;  1MPL A;  3W4O A;  1W8Y A;  1K56 A;  3N7W A;  3WWX A;  1HD8 A;  1SDE A;  1L0E A;  1K57 A;  3LCE A;  1WYC A;  3IF6 C;  3GV9 A;  3PBS A;  4E3N A;  4PPR A;  3ZG0 A;  5IHV A;  3IH9 A;  5HAI A;  3Q1F A;  1O7E A;  2ZQA A;  4DE3 A;  2DRW A;  4WEL A;  1XKZ A;  1ES3 A;  1PWG A;  4O7D A;  3PBR A;  1BLC A;  5FAP A;  3C4O A;  2I72 A;  1YQS A;  3S4X A;  3MZD A;  1IYO A;  1NY0 A;  2J9O A;  3HLB A;  3QNC A;  5HAP A;  4FSF A;  1EWZ A;  3MBZ A;  1PWC A;  3ITA A;  3TOI A;  3ZDJ A;  5EVL A;  3A3J A;  4CPK A;  2Q9N A;  4DXC A;  3HLG A;  5GHZ A;  3UN7 A;  4EUZ A;  2P74 A;  3IXH A;  4KZ6 A;  2XGN A;  4RX2 A;  4C6Y A;  2WAF A;  1I5Q A;  3FKV A;  3O86 A;  4JLF A;  3M2J A;  1IEL A;  2Z2L B;  2V2F F;  4QY5 A;  1JTG A;  5AQ9 A;  4JXV A;  5M19 A;  2J7V A;  1YLW A;  3UY6 A;  2Y2K A;  1K55 C;  1YM1 A;  4P87 A;  3MZE A;  4DXB A;  4UAA A;  2WK0 A;  4GDN A;  4IBR A;  4JF5 A;  5FAO A;  3Q7V B;  3OPH A;  3LEZ A;  4R1G A;  1JTD A;  2JC7 A;  1IKG A;  3G31 A;  5GL9 A;  2ZC6 B;  4DRT A;  1JVJ A;  4S2M A;  4EBL A;  2ZQC A;  5AQ7 A;  1K6S A;  3NCK A;  3ZG7 B;  1XA1 A;  3FZC A;  1OME A;  1YLP A;  3A3E A;  3C5A A;  1MWR A;  4KEN B;  4N9K A;  5DVA A;  1EI5 A;  5FQQ A;  3NBL A;  5DTT A;  1J9M A;  2H10 A;  4WZ5 C;  3S1Y A;  3SH8 A;  4PM9 A;  1XP4 A;  3OC2 A;  1NXY A;  3GQZ A;  4R0Q A;  1ERO A;  4LV3 A;  4OQ0 A;  1ZKJ A;  1ZG4 A;  4Y0T A;  3C4P A;  4RVA A;  2OLV A;  1PWD A;  2QZ6 A;  4DKI A;  3NC8 A;  1DJA A;  1SKF A;  2E8I A;  3MKF A;  4PM5 A;  1CI9 A;  1LHY A;  1K4F A;  2WKH A;  3BEC A;  2VGK A;  2J8Y A;  4DE2 A;  4EWF A;  1HZO A;  2XD5 A;  3JYI A;  1CEF A;  4FCF A;  4LEN A;  5HX9 A;  2XLN A;  2RL3 A;  4S2J A;  5EOO A;  1XPB A;  3ZNT A;  1ALQ A;  4KZB A;  5CRF A;  4U0T A;  4PM7 A;  3BFE A;  1YLY A;  2ZJ9 A;  1PYY A;  4GZB A;  4KZ8 A;  1E3U A;  4N1X A;  3ZFZ A;  1FCO A;  3HVF A;  4A5R A;  2ZLY A;  4UHU A;  1ESU A;  1YLZ A;  3IXG A;  3MKE A;  3GRJ A;  4GD8 A;  4LCM A;  1L0F A;  1JWZ A;  1FR6 A;  2G2W A;  4OOL A;  5CXW A;  2PU2 A;  3WS1 A;  5FDH A;  4C3Q A;  3NDG A;  4K0W A;  4OLG A;  2XK1 A;  1IYS A;  3GTC A;  3IWO A;  3NIA A;  3PTE A;  3Q07 A;  2P9V A;  3MZF A;  4H8R A;  4ID4 A;  4OQI A;  3MXS A;  4B4Z A;  5HL1 A;  3D4F A;  4WMC A;  1W8Q A;  1KGG A;  2ZC4 B;  5TFQ A;  3NY4 A;  2HPB A;  4QB8 A;  4UA7 A;  4BLM A;  4DE0 A;  5KSH A;  4QHC A;  4XUZ A;  3WS0 A;  1ES2 A;  3VOZ A;  3ZG8 B;  1K54 A;  3IHA A;  3N6I A;  2Q9M A;  5EEC A;  3HLC A;  4Y7P A;  2ZMA A;  3P98 A;  1LL9 A;  3VMA A;  4QU3 A;  4C75 A;  4D2O A;  5DF8 A;  3DWZ A;  2QMI A;  3GVB A;  3HUN A;  1XGJ A;  1YLJ A;  4RX3 A;  5AQB A;  5FQM A;  3UDX A;  4JF4 A;  2WGW A;  5EPH A;  4FD8 A;  1K38 A;  2RCX A;  5FAQ A;  2QPN A;  3UE3 A;  2ZM8 A;  3OPR A;  3HRE A;  4HBT A;  4S2N A;  4R4S A;  1W7F A;  4WYY A;  3RXX A;  3SS5 A;  4ZTK A;  2EFX A;  1K25 A;  2JBF A;  2Y91 A;  3HUO A;  1PW8 A;  1NYM A;  2OSU A;  1MXO A;  1AXB A;  1ZG6 A;  3SH7 A;  3VSL A;  1H8Y A;  5M18 A;  4QD4 A;  1FQG A;  5CGX A;  3ITB A;  4OQH A;  3LO7 A;  1FOF A;  3IH8 A;  2ZQ9 A;  4CJN A;  4OOM A;  4K0X A;  5CTN A;  1I2W A;  1QMF A;  5TGF A;  3OCN A;  4JXS A;  1BZA A;  1IEM A;  1S0W A;  4S2O A;  3MFD A;  2FFY A;  4K91 A;  1PW1 A;  4MNR A;  1W5D A;  5E2G A;  1BUL A;  5EVI D;  4YIN A;  4M3K A;  4ZAM A;  4KG6 A;  1G68 A;  1GHM A;  1XA7 A;  5FQI A;  3DTM A;  2XEP A;  5CTM A;  3EQU A;  2FFF B;  4ZJ1 A;  1NJ4 A;  5EVI B;  3WRZ A;  4KZ4 A;  1XXM A;  4E3K A;  1GA0 A;  4Y0O A;  1S6R A;  3FWL A;  1LL5 A;  2HDQ A;  3BFG A;  3O87 A;  3FYZ A;  2C5W B;  3IF6 A;  3UE0 A;  1Y54 A;  3IXB A;  4MEZ A;  4N9L A;  1ZC2 A;  1CK3 A;  1MY8 A;  4IED A;  3EQV A;  1MWT A;  3AGE A;  3BYD A;  3O88 A;  4XXR A;  5GHY A;  1K56 D;  2PBY A;  4GN2 A;  3UE1 A;  2WGV A;  3VSK A;  1L0G A;  5GLC A;  1FR1 A;  1NYY A;  3IF5 A;  5F83 A;  3O3V A;  1W79 A;  3UPP A;  5TR7 A;  3N8L A;  2Y59 A;  4P85 A;  3G30 A;  3GMW A;  4E3L A;  3IQA A;  3G35 A;  3UO9 A;  4GKU A;  2WAE A;  4NET A;  1BLS A;  3V3R A;  2Y2N A;  1SHV A;  5FQK A;  4BQM A;  5HFO A;  4LV0 A;  1SDN A;  2OV5 A;  2XFT A;  4R23 A;  3UPO A;  2WUQ A;  4IBX A;  1Z6F A;  3TSG A;  1QME A;  3HBR A;  2Y2H A;  4GDB A;  4NK3 A;  2HP6 A;  3BEB A;  4MBF A;  1BSG A;  1IYQ A;  1L0D A;  3GR2 A;  3PBQ A;  1IYP A;  3C7V A;  5E2E A;  3ISG A;  3G32 A;  3IT9 A;  3ZG5 A;  4RA7 A;  5G18 A;  2WZX A;  3SS3 A;  4OPQ A;  5E2F A;  3PAG A;  3DW0 A;  4OPR A;  3LY3 A;  4ZBE A;  3CJM A;  4MLL A;  1Q2Q A;  4KG2 A;  2EXB A;  1BLP A;  1XGI A;  3IHB A;  4PM8 A;  4MBH A;  1KDW A;  4WBG A;  1VQQ A;  4OLD A;  1RGY A;  4OPY A;  2ZQ7 A;  3SH9 A;  4OPZ A;  3A3I A;  4EQI A;  3AGD A;  4KG5 A;  2XF3 A;  5EVI C;  5FI2 A;  4R3J A;  1YMS A;  3VP4 A;  2X01 A;  1GCE A;  3VFF A;  3E2L A;  2HP5 A;  4E3M A;  5JYP A;  1K54 C;  2Y4A A;  2BG1 A;  2HDS A;  5CEC A;  4X69 A;  4OON A;  1LI0 A;  4EBP A;  3PBO A;  4E6X A;  2VGJ A;  3BFC A;  4P6B A;  5CHM A;  1E4D A;  3OZH A;  4HES A;  1ONH A;  3VP0 A;  3IWQ A;  3ZVW A;  4E6W A;  3BFF A;  4DF6 A;  1MWS A;  3G4P A;  3V50 A;  1I2S A;  4L0L A;  5DTS A;  5FSR A;  3V5M A;  2WAD A;  5HAR A;  1KDS A;  1RGZ A;  4RYE A;  3WS2 A;  3MXR A;  5A92 A;  3OCL A;  1FSY A;  1KGF A;  2X71 A;  2Y2L A;  1JWP A;  3C7U A;  2J9P A;  4OQG A;  3W4P A;  4S2N C;  5KMW A;  3HLW A;  4UA9 A;  1PIO A;  5AQA A;  2XD1 A;  5CGS A;  5EE8 A;  1PI4 A;  4JPM A;  2Y55 A;  2Y2O A;  5FQ9 A;  4X56 A;  1NRF A;  1XX2 A;  4X55 A;  1K57 C;  2IWC A;  4P0M A;  5KSC A;  3BFD A;  4B4X A;  4LV2 A;  2ZQD A;  2Y2G A;  3VFH A;  3CZD A;  2WGI A;  3PAE A;  3WS5 A;  1KE3 A;  1E3U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...