5EVID

Crystal structure of beta-lactamase/d-alanine carboxypeptidase from pseudomonas syringae
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
352
Chain Sequence
NSAALDTLVQTEARVMQENNITGLSIAITRHGQQFYNYGVASATGQPVSSDTLFELGSISKTFTATLATWAQANGRLSLTQSIDTYMPPLRDTRLGKIPVFHLGTHTAGGFPIQVPEKVQNTRQLMDYFAWQPEYLPGTHRTYANPSIGLLGVIAARSMNMPFQEAMQQRLFPALGLNSTYVNVPDDKQTLYAQGYNTLDEPVRVNPGILAAEAYGVSSSRDLIRFVEANIGLGQYDAPLQRALSDTRIGYFKVGGMTQDLAWEQYPTPIHLDVLLAGNASAMLNTQKADAIEPPLAAQPTAWVNKTGSTNGFGGYVAFIAQQLGIVILANNYPNEERVKLAYRILQHAEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-Lactamase/D-Alanine Carboxypeptidase
publication title Crystal Structure of Beta-Lactamase/D-Alanine Carboxypeptidase from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 97
structure length 352
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eviD00
3LO7A 4KZ4A 5FAOA 5M19A 4K91A 1YM1A 4EUZA 3WWXA 3ZG8B 1MKIA 2CC1A 5DTKA 1XX2A 2J8YA 3W4PA 4E6XA 2UWXA 3IHAA 3IF6B 3MXSA 3PBQA 4WEKA 4Z9QA 3NDGA 4X56A 1IYOA 2PBYA 2WGVA 3VOZA 1BTLA 5G18A 1O7EA 2ZC5B 3O87A 1IYPA 3E2KA 5KSCA 4IBXA 2V2FF 5L2FA 2WKEA 3FWLA 4MBHA 4JF5A 2EX8A 3N7WA 3Q7VA 3HLGA 2EFUA 2ZJ9A 4GN2A 4GZBA 3UDIA 3BRMA 1BULA 5HAQA 4UAAA 4LENA 2ZC7A 1W79A 4QU3A 3G31A 4E3MA 4KENB 1EWZA 1Q2QA 2XF3A 4FH2A 3JYIA 1MWUA 3UY6A 4RA7A 3VP2A 4B4ZA 1NXYA 1BLPA 4DE2A 1CEFA 1ES4A 1TVFA 1K56A 2ZM0A 4WELA 5HW3A 3NDEA 4PM9A 4EV4A 1U60A 5CHUA 1K55A 3EQVA 3VFHA 2Y2JA 4BENA 1K57A 1WE4A 1DY6A 4XUXA 1MWTA 3GVBA 3LY4A 4Y0OA 2ZC4B 1PWGA 1XXMA 5CHMA 4BLMA 3BFGA 4U0XA 4BD0A 3ZNTA 4QHCA 3Q07A 3HLEA 1IKGA 4ID4A 5F1FA 3GV9A 3WS2A 3VSKA 3N6IA 3BECA 3BFDA 4GOGA 1CK3A 4KQOA 3ZDJA 3AGFA 2V20A 3PBNA 3ZG0A 3O3VA 3HUNA 5TFQA 3HLDA 1E3UA 3G2ZA 5CTMA 5FQQA 1IYSA 1ES2A 1S0WA 2PU2A 3UO9A 1YLZA 4OQGA 3PBTA 1E4DA 2WKHA 3MBZA 3N8RA 4N9LA 4R4SA 2WADA 4P85A 2WGWB 2OLVA 2XGNA 2XFTA 4JXSA 4S2PA 1HZOA 2Q9MA 5FI7A 1BUEA 2BLSA 5FQMA 1LHYA 1FCMA 1HD8A 1XA1A 5EVID 4EBNA 1GCEA 2WYXA 4CPKA 2ZQ9A 3BYDA 4OVDA 4WMCA 2Y4AA 3HBRA 2IWBA 4DF6A 4R1GA 4C3QA 3ZGAB 3A3JA 1MWSA 1SCWA 2Z2LB 4PM6A 3SH8A 4E3IA 4X68A 3NC8A 3C7VA 4OOLA 5GHXA 1ESUA 5FI2A 1WYCA 1OMEA 4KZAA 4QJGA 2C6WB 4KZ5A 1XGJA 3GQZA 2J9OA 4M3KA 1BZAA 3Q81A 1NYMA 4XUZA 3VP0A 1TEMA 2HDRA 4UHUA 3G34A 5CEDA 2BG1A 1QMEA 5A91A 4N1HA 5GLBA 4E3JA 1IYQA 3ISGA 2C5WB 3MZEA 3UDFA 4ZDXA 2Y2IA 3M2KA 5HAIA 3S1YA 4OH0A 3PBRA 4X55A 3P98A 1FR6A 4R3JA 3IHBA 1L0FA 3G2YA 2Y2HA 5E2GA 5IHVA 1GHPA 3AGDA 3MKFA 4S2IA 3N8LA 4FH4A 1KDWA 3ZNYA 5J8XA 1K56D 2P9VA 1SHVA 3IWIA 3WRTA 2H0YA 4S2OA 3LCEA 1FOFA 4K0XA 4GDBA 3OPHA 3ZCZA 1IELA 2XD5A 2Y2NA 4KZ8A 5GHYA 4JKTA 3DWKA 3MKEA 3MXRA 1BLSA 4YFMA 4WZ5C 1M6KA 3GRJA 1L0GA 3V3SA 4OQHA 4DE3A 4EBPA 1J9MA 3HLBA 2H10A 1ONHA 2R9XA 4OQIA 3N8SA 4RX2A 2WK0A 4ZJ1A 1EI5A 1JWVA 1PIOA 3G4PA 3OPRA 1H5XA 5F83A 3FKWA 5FAPA 3PBSA 1M40A 3SH9A 4E3LA 1DJBA 4X53A 3NIAA 4X6TA 4BL3A 5A93A 3RXWA 1E3UD 2HDUA 4C6YA 3IQAA 3VSLA 2WZXA 1PZOA 4A5RA 3QNCA 4B4XA 2ZMAA 2H5SA 4R4RA 5FQIA 5DF7A 4LV1A 1GHIA 1SDEA 2QPNA 1IEMA 1MWRA 1RP5A 3GR2A 3DWZA 4S2LA 3CZDA 1N9BA 4DXCA 1PW1A 3A3DA 2Y2PA 4LCMA 1KGFA 5E2EA 5GLCA 4JXVA 1L0DA 2XEPA 3BFCA 2VGJA 2H0TA 2Z2MB 3VOYA 1LLBA 4NETA 5FSRA 3C4PA 3TG9A 1LI0A 1K38A 3BM6A 2PU4A 2QMIA 2XD1A 1K25A 4WMCD 4HBTA 3WRZA 5KZHA 1HTZA 1JTGA 1XKZA 1MBLA 4KZ7A 3SS3A 2ZM2A 4QD4A 1YQSA 3MZFA 5EVIB 1BLCA 4K0WA 1JVJA 4P87A 4KG6A 5FQKA 4KZBA 2E8IA 1XP4A 1HVBA 5EUAA 2Y2LA 1KDSA 2XQZA 3TOIA 3ZG9B 1N4OA 3GTCA 1XA7A 4LCLA 2FFYA 1ERMA 1BSGA 3HL9A 3WS5A 4H8RA 4XXRA 3ZG7B 4DKIA 3G30A 3UDXA 2OLUA 3HUMA 3OZHA 3DTMA 4Q8IA 3AGEA 4Y0UA 5CGWA 4U0TA 1PWCA 2OV5A 4P0MA 4JBFA 1NZOA 5HARA 1XGIA 5AQ9A 1KGEA 1CI8A 4N1XA 2JC7A 4BQMA 3NI9A 4S2NA 3BLSA 4PM8A 1LI9A 1ZG6A 4ZJ2A 2Y91A 2WUQA 2WZZA 2X01A 1VM1A 1RGZA 2XR0A 3CJMA 3Q7VB 4OLGA 3RXXA 5AQAA 3WS4A 3BLMA 2RL3A 3A3IA 4OKPA 4R23A 2XDMA 5EVLA 4KQQA 3OCLA 5TR7A 1GHMA 1W8QA 3SH7A 3IXBA 4IEDA 5AQBA 4LV0A 1XPBA 3V39A 4BD1A 3HLCA 3HVFA 3W4QA 5FQJA 1K4FA 1K55C 1H8ZA 4OPYA 1I5QA 1K57C 4N9KA 3UPOA 5GLAA 5KSHA 1KGGA 4BL2A 4DRTA 1K6SA 3IWOA 4IBRA 4FSFA 4N92A 3V5MA 1YLPA 4RVAA 3UE0A 5KMWA 1BLHA 2Y2QA 3UE1A 2WKIA 1H8YA 4EBLA 2B5RA 1W8YA 1QMFA 4WEJA 4HESA 4PM7A 3A3EA 4UA9A 3IF6A 3BFEA 3G32A 2Q9NA 4OOMA 2P74A 2Y2GA 1NZUA 3BFFA 3P09A 3VP3A 2ZC6B 3OPPA 2ZC3B 1NY0A 2R9WA 3W4OA 2G2WA 1DJAA 4JXGA 3NCKA 4WM9A 4RYEA 4P6BA 3TSGA 3GSGA 4GD6A 5FA7A 4ZBEA 5M1AA 4MBKA 1KVLA 2EX6A 1W7FA 3IXDA 1CEGA 1ESIA 5EPHA 3V3RA 4OONA 4X69A 1KE3A 3ZVWA 2VGKA 3V50A 4GB7A 4C75A 5HL1A 1K4EA 4EWFA 3M6HA 4ZAMA 4OOYA 2HPBA 4LV3A 5E2HA 5FDHA 3HUOA 5JYPA 2ZLYA 1Q2PA 1ES5A 3C4OA 4D2OA 4WBGA 4R3BA 4OPRA 4F94A 3FYZA 3Q7ZA 1K54C 2V1ZA 1RGYA 1KE0A 1MY8A 3EQUA 4QY6A 2A49A 5EE8A 2DNSA 3LEZA 3NY4A 2Y55A 3MZDA 1KE4A 4MEZA 4U3TA 1FR1A 4HEFA 2IWCA 4E3KA 3A3FA 4QB8A 5CERA 3E2LA 4E3NA 1ALQA 1K6RA 5CTNA 1YLWA 2I72A 4GKUA 4S2JA 3HLFA 5CECA 2ZD8A 3M6BA 4FCFA 1FQGA 1YLYA 1WYBA 1ZC2A 2ZQAA 1PW8A 3PAGA 3PBOA 3ZVTA 5EVIC 2ZM8A 4JXWA 3ZFZA 4MLLA 1PI4A 1FSYA 1TDLA 1VQQA 2WGWA 2HP6A 2JCHA 4FD8A 3QHYA 1Z6FA 4DDYA 4Y0TA 2A3UA 2WAFA 3UPPA 3IXHA 1JWPA 1LL5A 4KZ6A 3WS1A 1NRFA 2P9VB 2X02A 2EXBA 5E43A 1BT5A 3FV7A 2HDSA 3B3XA 4JLFA 3UNWA 3M2JA 3IT9A 4GD8A 1ES3A 4UA6A 5EOOA 3IF5A 3SS4A 4B88A 3IH8A 4JF4A 5GLDA 4QY5A 4Y7PA 3RJUA 3VP4A 1E25A 3HREA 1IKIA 4L0LA 5CHJA 4KG2A 4NK3A 3I7JA 5BOHA 5HAPA 4BJPA 1ONGA 3QNBA 4RX3A 4DE1A 2Y59A 4O7DA 3SOIA 5HX9A 2J7VA 1C3BA 5HFOA 3S4XA 5A92A 1MPLA 4KQRA 4KZ9A 2OSUA 1PWDA 4R0QA 5FASA 5DVAA 4OPQA 1S6RA 1JWZA 1I2SA 5M18A 2G2UA 4OLDA 2FFFB 5CRFA 5EOEA 5F82A 5JYOA 2ZQCA 3UE3A 3VFFA 3FZCA 2WAEA 3OPLA 5DTSA 5FQ9A 2ZQ8A 2HP9A 2XFSA 4IVKA 4MNRA 2Y2OA 5GL9A 1ERQA 1TDGA 3ITBA 1G6AA 1ZKJA 2EFXA 3PTEA 4S2KA 2XLNA 2EXAA 5E2FA 2RCXA 1YLJA 3MFDA 2XH9A 5GHZA 1SKFA 4OP8A 1L0EA 2EX2A 2QZ6A 4GNUA 3N4IA 5TGFA 1Y54A 2J9PA 5U47A 3UN7A 3VMAA 2Y2KA 4OPZA 3OC2A 3GMWA 1CI9A 3G35A 3CG5A 5DF8A 1KVMA 1YMXA 5EECA 2IWDA 3NBLA 1RCJA 4OP5A 1YMSA 3O88A 3CMZA 3O86A 4KG5A 1AXBA 5DTTA 5F1GA 3DW0A 1FSWA 1PI5A 3UPNA 3ZG5A 4JF6A 1ZG4A 1L2SA 3C5AA 4S2NC 5FI6A 5AQ7A 5CXWA 4WZ5A 1YT4A 4IVIA 5CGSA 5CEBA 2ZQDA 5DF9A 5CGXA 4DE0A 1LL9A 2HP5A 4S2MA 2Y2MA 3C7UA 4UA7A 4ZTKA 1PYYA 5A90A 1NJ4A 1DJCA 3VP1A 3D4FA 2GDNA 2EX9A 4PPRA 1K54A 1PZPA 3W8KA 4EQIA 1I2WA 1MXOA 4WZ4A 1JTDA 3SS5A 3IXGA 3ITAA 4PM5A 5FATA 1W5DA 4JPMA 3LY3A 4LV2A 1FCNA 4CJNA 4ZJ3A 1GA0A 5D3OA 2JBFA 3FKVA 3IWQA 2HDQA 3HLWA 1O07A 4MBFA 1GA9A 4OQ0A 1G68A 1EROA 2X71A 3WS0A 4E6WA 4E3OA 3Q82A 1SDNA 3BEBA 4HBUA 1YLTA 2DRWA 1NYYA 4YINA 2DCFA 4PMAA 3PAEA 1FCOA 4WYYA 3ZHHA 4GDNA 2XK1A 3Q1FA 4DDSA 2WGIA 5I94A 2JE5A 5EVIA 5FAQA 4DXBA 3IH9A 3OCNA 3IF6C 4KZ3A 2ZQ7A 3S22A
chains in the Genus database with same CATH superfamily
3LR5A 4EUZA 1MKIA 4I3AA 2CC1A 4E6XA 4MN7A 2WKPA 5HL6A 4FUWA 1IYOA 2WGVA 3IS2B 3T12B 3CWFA 1V9YA 2V2FF 2WKEA 4JF5A 5EVEA 1LL8A 3G31A 4KENB 1EWZA 4FH2A 3JYIA 4KUOA 4DE2A 3QP5A 4HH2A 2JKFA 2ZM0A 1P9RA 3NDEA 2INWA 4PM9A 4H6JA 3EQVA 4EW7A 3VFHA 1K57A 3PR6A 1ZHHB 1S1ZA 1PWGA 4BLMA 3BFGA 3T50A 3ZNTA 4QHCA 2O99A 1LT0A 3GV9A 3VSKA 3BECA 1CK3A 3AGFA 2V20A 3ZG0A 3O3VA 3HUNA 1E3UA 3MF0A 4Y3IA 3LIBA 2PU2A 1S0WA 3UO9A 3MBZA 1JNUA 4N9LA 4CLCD 3BY8A 2HJ9C 4ARZA 2XGNA 2XFTA 5FI7A 1GSXA 3U2AA 4NG2A 2ZQ9A 4WMCA 3JVUA 2Z6CA 5HPFA 2VX8A 4C3QA 3CPTA 1SCWA 3C7VA 4OOLA 5GHXA 2ZL1B 3PYPA 4UEYA 1NYMA 4XUZA 3VP0A 4MN5A 1T19A 2BG1A 2C5WB 2Y2IA 3M2KA 5HAIA 3T1QB 5F5YA 3ZQ5A 1NWZA 4NXGA 1D7EA 1L0FA 2ZOHA 5IHVA 3N8LA 2G7UA 5J8XA 2P9VA 3KSGA 5HD5A 2VGLS 3LCEA 4GDBA 1YKDA 1ODVA 2BTFP 2Y2NA 3NOPC 3BJNA 3MKEA 1BLSA 4YFMA 1L0GA 4OQHA 4DE3A 5DKLA 4ETZA 2MJ6A 3MMHA 3HLBA 2H10A 3DAVA 4OQIA 3MS6A 1JWVA 5F83A 5FAPA 4X6TA 2B18A 1E3UD 3IQAA 1HLUP 2K7SA 4NXBA 2H5SA 5DF7A 1GHIA 4Y5FA 1MWRA 2L1MA 4DXCA 3A3DA 3LIFA 1KGFA 5E2EA 1L0DA 2XEPA 3BFCA 1VHMA 2H0TA 2W0NA 3C4PA 4MCWA 1LI0A 1K38A 3RTYA 1K25A 1W63M 4WMCD 1LSWA 1MBLA 1BLCA 3K3CA 1JVJA 4P87A 4EQ1A 2IA2A 3TOIA 1KDSA 3UDXA 5IT5A 4Y0UA 3A0VA 1KGEA 1T1CA 1LI9A 1ZG6A 4CQHA 2Y91A 4DJ2A 2WZZA 2X01A 1RGZA 3RXXA 2PAVP 2PD8A 5DJUA 4II7A 4KQQA 4LV0A 1XPBA 3GECA 3W4QA 4OPYA 5HSQA 4N9KA 3UPOA 1MZUA 1LSVA 4GJ4A 3C8CA 4BWIA 4KUKA 1IOUA 3DBAA 3KSIA 3C2WA 4P6ZM 4HH3A 3QP8A 2Y2GA 3BFFA 3P09A 2ZC6B 3F1OA 3OPPA 2ZC3B 3BY9A 2R9WA 4ZRRA 3JPUA 1Z09A 2XRNA 3TSGA 4ZBEA 3LI8A 4MBKA 2EX6A 1W7FA 1ESIA 3V3RA 3ZVWA 4HHDA 3D72A 1YSPA 1GSVA 4C75A 4EWFA 3EGDC 4ZAMA 5DFXA 4LV3A 5JYPA 2E8JA 5FDHA 2ZLYA 4OPRA 3Q7ZA 4Q0HA 2DNSA 3MZDA 1KE4A 1DP9A 2J3WA 2IWCA 4HJ4A 3E2LA 1ALQA 2LB5A 5AVFA 4BL3A 1YLYA 4DJ3A 2ZQAA 4DMZA 2OAP1 4JXWA 3QP2A 2WGWA 2W1TB 3K2NA 1OTBA 2A3UA 3IXHA 2EXBA 1OTAA 3M2JA 3ICYA 1ES3A 4UA6A 3SS4A 3IF5A 3CUEA 3QP6A 4Y7PA 1E25A 5BOHA 5CHJA 4BJPA 3MQQA 3E4PA 4RX3A 4KQRA 2HZ5A 3F1NA 4KZ9A 5L8MA 4OPQA 1S6RA 2G2UA 1OTEA 5G4ZA 1F2KA 2P7JA 2PR5A 2HGVA 3S7QA 2EXAA 4G3VA 2RCXA 2AVXA 3T4OA 2QZ6A 1UGUA 3T4KA 1FILA 2PR6A 3VMAA 3OC2A 3UMDA 5G4YA 3CG5A 5EECA 2IWDA 1SZVA 1RCJA 3LFVA 3MJQA 1AXBA 1ZG4A 3C5AA 5AQ7A 1D06A 5CXWA 4WZ5A 1YT4A 4HJ3A 5CGXA 3UB8A 5TBMA 5HWWA 4PHTA 2K31A 1PZPA 3PHYA 3W8KA 4EQIA 1F9IA 4BBUA 1OJGA 4JPMA 4LV2A 2OWJA 3JVVA 5HDCA 4ZJ3A 3FKVA 3IWQA 2ACGA 2HDQA 1GA9A 1G68A 3BEBA 2PYRA 2DRWA 2V1BA 2PDRA 3PAEA 1FCOA 1OT9A 2JE5A 2Y8HA 3IF6C 3S22A 5FAOA 5M19A 1YM1A 3ZG8B 2V1AA 2D01A 1XX2A 3UB7A 2J8YA 3PBQA 4P6ZS 4Z9QA 2B02A 4WEKA 4X56A 1VEUB 1BTLA 4DN0A 1IYPA 2PBDP 4CLCE 1S4SA 3LR0A 1H0MA 5I5LA 1L3LA 3C38A 4FOFA 1BULA 3QP1A 2D02A 4LENA 3H7WA 4E3MA 2XF3A 4UQIS 1BLPA 3KX0X 5CHUA 1K55A 4B93A 2Y2JA 5EV0A 2VZWA 4XUXA 3GVBA 3LY4A 4Y0OA 4LPZA 1TS6A 3KSFA 4NKPA 3HLEA 2ZMFA 4ID4A 3LICA 4EUVA 3ZDJA 3B42A 3PBNA 2GNXA 1IYSA 1YLZA 3PBTA 2PT7A 2WKHA 2WADA 3VV4A 4P85A 4JXSA 1HZOA 4ME4A 2J3TD 1HD8A 2WYXA 5HD3A 3BYDA 1G6OA 2Y4AA 3HBRA 5HWVA 4JGOA 3A3JA 1MWSA 4O8GA 5AJGA 3NJAA 3MSHA 5FDSA 1ESUA 5FI2A 1OMEA 3U4LP 4KZAA 5F6AA 4QJGA 4KZ5A 1XGJA 1PFLA 2J9OA 1PRQA 1TEMA 3G34A 1QMEA 5A91A 4Y17A 3UDFA 4ZDXA 2H28A 3PBRA 4CLCA 3P98A 2O9BA 1UWNX 4LRZE 1GHPA 3AGDA 3MKFA 3EEAA 4HJ6A 3H82B 2P04A 3ZCZA 4Y2FA 1IELA 4KZ8A 5GHYA 1Y4OA 3V3SA 4AFIA 4EBPA 1TF1A 5HZHA 1J9MA 1ONHA 4ZJ1A 4WN5A 1PIOA 3QP4A 1M40A 3SH9A 4E3LA 1BYWA 4C6YA 4A5RA 2WKQA 1XFQA 4R4RA 3GR2A 3CZDA 1N9BA 1XJ6A 2P08A 4NETA 3TG9A 1TS7A 4FTXA 3T4SA 3WRZA 5KZHA 1SKOA 3LUQA 1HTZA 4PKYG 1YQSA 3MZFA 5EVIB 4RQ9A 2E8IA 1XP4A 5EUAA 3ZG9B 1BSGA 4KQDA 4H8RA 3A0RA 3HUMA 3E0YA 3RFBA 2OV5A 4GS9A 5HDDA 4N1XA 2JC7A 4BQMA 1H3QA 3NI9A 3LR4A 4IUKA 4PM8A 2A24A 2WUQA 3SW1A 5DKKA 1VM1A 3CJMA 4OLGA 3Q7VB 5AQAA 3EGXC 3BLMA 2XDMA 4O0PA 3OCLA 4GHIB 3SH7A 3IXBA 4BD1A 1P9WA 3HVFA 1XJ3A 1H8ZA 1K57C 5GLAA 4XT2B 5KSHA 1KGGA 4BL2A 3IWOA 4IBRA 4FSFA 1TD5A 3V5MA 4Y13A 2Y2QA 2WKIA 1K0KA 1W8YA 3UB9A 4PM7A 3A3EA 3G32A 3IS2A 3MQOA 2V0UA 3VP3A 1NY0A 5CX7A 1T1BA 1DJAA 2NUTC 1VB6A 5F69A 2I9VA 4P6BA 5K5BA 4GD6A 4L9EA 1KVLA 5DJTA 1CEGA 3RH8B 2J80A 5EPHA 2PD7A 4X69A 1IFQA 1KOUA 2VGKA 3V50A 3M6HA 4OOYA 3HUOA 2Q0OA 3MQ0A 3FC7A 5J3WA 4D2OA 4WBGA 5L10A 3T4LA 4F94A 3FYZA 1K54C 1OTDA 3O5YA 3LEZA 3IBRA 3DTKA 4E3KA 1K6RA 5CTNA 1YLWA 4S2JA 3LR3A 1ZC2A 1DP6A 3PAGA 3ZVTA 5EVIC 2ZM8A 3ZFZA 4MLLA 1FSYA 2HP6A 4FD8A 4EXOA 1LL5A 1VETB 3WS1A 5E43A 2HDSA 3B3XA 4B88A 3IH8A 3K3DA 5HWTA 3VP4A 3HREA 4L0LA 5HAPA 4O7DA 2QYBA 3S4XA 2ZL1A 3F1PB 1OJ5A 4R0QA 2V8FA 3NOTC 1JWZA 1YSQA 5EOEA 3FZCA 2XFSA 2EA9A 4NXEA 5GL9A 1TDGA 3ITBA 1G6AA 3PTEA 2XLNA 3OBFA 1YLJA 5GHZA 2JHEA 4IUHA 3D9YA 3VE4A 1Y54A 5U47A 3UN7A 3D3OA 3G35A 5DF8A 4K08A 1KVMA 1S66L 3NBLA 4HP4A 3O88A 3CMZA 5DTTA 5F1GA 3H9WA 1FSWA 2VKSA 2QHKA 4Z1WA 5FL3A 3E4OA 4IVIA 5CGSA 5CEBA 5DF9A 4ZTKA 2ZMVA 2Y2MA 5A90A 2UV0E 1T18A 3D4FA 2GDNA 4WZ4A 1JTDA 3SS5A 3IXGA 3ITAA 5FATA 1ZTUA 3LY3A 2OWHA 3G6OA 3TW8A 4MBFA 3WS0A 4OQ0A 4E3OA 3Q82A 1SDNA 4HBUA 4HIAA 1YLTA 2DCFA 3ZHHA 4GDNA 2WGIA 2HJEA 1PNEA 4HNBA 3LO7A 4KZ4A 1W63Q 4K91A 1XJ2A 3WWXA 3MXQA 5DTKA 3MXSA 3IHAA 3IF6B 2PYPA 3NDGA 2PBYA 3VOZA 4M4XA 5G18A 3E2KA 5KSCA 2EWVA 3FWLA 3HLGA 2WKRA 4ETXA 4NEED 4GN2A 1EW0A 3UDIA 3VOLA 4G3KA 2ZC7A 2Z6DA 1MWUA 4I38A 2VJWA 1CEFA 4LLOB 1TVFA 3TJZC 1K56A 2VV7A 4EV4A 1U60A 1WE4A 1DY6A 2LB9A 2ZC4B 2W3FA 5CHMA 4Q0IA 4U0XA 3Q07A 1NLZA 2DMWA 3N6IA 3BFDA 4GOGA 4KQOA 3BQAA 5TFQA 3HLDA 4R6LA 5FQQA 2QKPA 4OQGA 2W1RA 1E4DA 3T1XA 4F3LB 1TS0A 3IBJA 2OLVA 4S2PA 2Q9MA 5FQMA 3R4KA 1LHYA 1FCMA 1XA1A 3E4QA 1GCEA 4CPKA 2VA0A 3R7WB 4DF6A 4R1GA 4B9OA 1STZA 3IX4A 2Z2LB 4PM6A 3NC8A 1WA9A 3GQZA 1BZAA 4YNRA 2L4RA 2HDRA 5CEDA 1DRMA 3CITA 4N1HA 5GLBA 4E3JA 2VEAA 4X55A 1FR6A 4R3JA 3IHBA 2W1TA 3TRCA 2YKFA 3G2YA 2Y2HA 5E2GA 5EFWA 4I3JA 4S2IA 1KDWA 3NHQA 1K56D 1N9OA 4WLAA 4K0XA 3T1RA 4JKTA 3DWKA 1S1YA 4WZ5C 2K2NA 2GX5A 1H5XA 3FKWA 2QJ7A 5A93A 3DTIA 3VSLA 4B4XA 2ZMAA 4Y15A 5FQIA 1D1JA 2QPNA 1IEMA 1RP5A 1PW1A 2Y2PA 4LCMA 2BASA 5GLCA 4JXVA 3VOYA 4L9GA 3PXPA 2KOIA 3MFXA 4GW9A 2XD1A 2QMIA 3V67A 4HBTA 3KYQA 4GLQA 4MN6A 4KZ7A 3SS3A 1CF0A 1YPRA 4KG6A 5FQKA 4KZBA 2Y2LA 4PM5A 1N4OA 1XA7A 4LCLA 2FFYA 1ERMA 3HL9A 4XXRA 4DKIA 1FIKA 3UMEA 3OZHA 1G28A 1PWCA 4JBFA 5HARA 1XGIA 4S2NA 2M7UA 2XR0A 2RL3A 3A3IA 4OKPA 1NLYA 5TR7A 1GHMA 1W8QA 4IEDA 5EM1A 5FQJA 1K55C 3LI9A 1T1AA 3CLOA 3UB5P 1K6SA 2VGLM 3MR0A 3LIDA 4H6JB 4RVAA 1BLHA 3ULFA 4EBLA 2B5RA 1P97A 1QMFA 4LRXC 1OT6A 4WEJA 4UA9A 2Q9NA 1VEUA 2V8CA 4L9FA 3NOUC 4EEUA 4OOMA 2XSSA 2P74A 1NZUA 2O9CA 2G2WA 3NCKA 4RYEA 5FA7A 5M1AA 2V0WA 3UE6A 4BMWA 5FEFA 3IXDA 4ARZB 4OONA 1KE3A 4X1LA 3CHWP 1G5UA 5HL1A 1K4EA 4MDZA 5LBRA 3T4QA 2HPBA 4IHQA 1ES5A 3L9KA 4R3BA 3CPTB 3NECA 2V1ZA 5EE8A 4U3TA 3T4JA 1P0ZA 4HEFA 2FZ0A 4QB8A 5CERA 4E3NA 4CLCC 2I72A 3P01A 3KO6A 3HLFA 2ZD8A 3M6BA 4FCFA 1FQGA 1PW8A 2XROA 4LRYC 1PI4A 2JCHA 1Z6FA 4Y0TA 1XJ4A 3UPPA 1NRFA 2P9VB 2X02A 3A0SA 3FV7A 5EOOA 4GD8A 4JF4A 5GLDA 3RJUA 2VLGA 2W3HA 3C30A 1IKIA 4KG2A 3SOIA 1C3BA 2V9AA 2R78A 5A92A 1MPLA 1UWPX 1PWDA 5FASA 5DVAA 1I2SA 5M18A 4OLDA 5CRFA 5JYOA 2ZQCA 3OPLA 3T1SA 2HP9A 3EOIA 1ZKJA 2EFXA 4S2KA 1S4RA 2XH9A 1SKFA 2JKRI 1L0EA 2EX2A 1DP8A 4GNUA 2Y2KA 4OPZA 4WF0A 3GMWA 3H82A 3B47A 5KIZA 4MMNA 1YMSA 1OPXA 3UPNA 3ZG5A 4JF6A 3ZYTA 5FI6A 3HJKA 4X1MA 3S7OA 2ZQDA 4WUJA 4O01A 2HP5A 4S2MA 1PYYA 3VP1A 2EX9A 2XA7M 1K54A 2OAQ1 1F98A 1FCNA 4CJNA 3HLWA 1O07A 4E6WA 1NYYA 4YINA 4PMAA 3HJIA 4WYYA 3LYXA 2FH5A 3Q1FA 4DDSA 3EEHA 5EVIA 5FAQA 4DXBA 3OCNA 4KZ3A 2ZQ7A 2L0WA 3HCYA 2JKRM 3W4PA 2UWXA 4R38A 4R70A 1O7EA 2ZC5B 3F1OB 3O87A 2M7VA 5FEGA 4IBXA 5L2FA 4MBHA 1LSXA 2EX8A 1CQAA 3N7WA 3Q7VA 2EFUA 2ZJ9A 4GZBA 2W27A 2Y79A 3BRMA 3KYEA 5MC7A 5HAQA 4GHIA 4UAAA 1W79A 4QU3A 1Q2QA 4WL9A 5IU1A 3UY6A 4RA7A 3VP2A 4B4ZA 1NXYA 3SZTA 2OOLA 2W3GA 1ES4A 2O0YA 4XT2A 3KYZA 4WELA 4HQAA 5HW3A 3OOVA 4BENA 3LIEA 1MWTA 2GZAA 1XXMA 4BD0A 1IKGA 5F1FA 3WS2A 4ESPA 3G2ZA 5CTMA 1ES2A 3NULA 3IX3A 3N8RA 3KSHA 4R4SA 5EM0A 2WGWB 1BUEA 2BLSA 5EVID 4EBNA 2JKTI 4EEPA 3FG8A 2IWBA 4OVDA 2ZOIA 3ZGAB 3SH8A 4E3IA 4X68A 1WYCA 2C6WB 3F1NB 4M3KA 3Q81A 3S7NA 4UHUA 4X25A 1V9ZA 1GSWA 1IYQA 3ISGA 4BBTA 3MZEA 5IS1A 3S1YA 4OH0A 2GJ3A 4JGQA 4HP9A 4FH4A 1VETA 3ZNYA 1SHVA 3IWIA 3WRTA 2H0YA 2CMNA 4S2OA 1FOFA 3OPHA 2XD5A 1ACFA 3LEQA 3BQ8A 4UQIM 3MXRA 3OLOA 1M6KA 3GRJA 3BW6A 2R9XA 3N8SA 4RX2A 2WK0A 1EI5A 3G4PA 3F1PA 3OPRA 3PBSA 3L7HA 1DJBA 4X53A 3NIAA 5L07A 3RXWA 2HDUA 2WZXA 1PZOA 5TJJA 3QNCA 1YAXA 5TBMB 4E04A 4LV1A 1SDEA 2JKTM 3DWZA 1N9NA 2XA7S 4S2LA 2HV1A 2VGJA 2Z2MB 1LLBA 5FSRA 3BM6A 4G3WA 2PU4A 4R3AA 5J7EA 1JTGA 1XKZA 3LGOA 2ZM2A 4QD4A 5J4EA 4K0WA 5AVEA 1HVBA 2XQZA 3WS5A 3GTCA 3LIAA 3ZG7B 3G30A 2OLUA 3W2ZA 4EESA 3DTMA 4Q8IA 3AGEA 5CGWA 4U0TA 4P0MA 1NZOA 5C5KA 5AQ9A 3TE8A 1CI8A 1Y28A 2QJ5A 3BLSA 4ZJ2A 3VE3A 3CAXA 2W3DA 1NRJA 4JGPA 3WS4A 2PRFA 3CUEC 5HPIA 4R23A 5EVLA 5AQBA 3EWKA 3V39A 3HLCA 3H7WB 1K4FA 2KLIA 1I5QA 4LGWA 1OTIA 4LFUA 4DRTA 2ZBBA 4N92A 1YLPA 3UE0A 5KMWA 3UE1A 1H8YA 1X0OA 4I5SA 4HESA 2QWSA 3IF6A 3BFEA 1S67L 5HDSA 3W4OA 4BBVA 4QWOA 4JXGA 4WM9A 2NUPC 3GSGA 3CI6A 4GB7A 4YWZA 4I3IA 4JGRA 5E2HA 4NXFA 4D60A 1Q2PA 3C4OA 2VV8A 4QPRA 3FPVA 1RGYA 1KE0A 1MY8A 3EQUA 3FPWA 2VV6A 2A49A 4QY6A 3IX8A 4PAUA 3NY4A 2Y55A 4MEZA 4HI4A 5L09A 1FR1A 3A3FA 5DFYA 3DTEA 2PHYA 1XFNA 4GKUA 4IJGA 5CECA 1WYBA 3PBOA 2J3TC 2KDKA 3T4TA 4CLCB 4F3LA 3B33A 1TDLA 2HF6A 1VQQA 3QHYA 4DDYA 1H8MA 2YKHA 5F68A 2WAFA 1JWPA 4KZ6A 1A0KA 4GCZA 4HOIA 1BT5A 3R7WA 4JLFA 3UNWA 3IT9A 2W3EA 4QY5A 4NK3A 3I7JA 1MC0A 1ONGA 3QNBA 3E98A 2Y59A 4DE1A 2JKGA 5HX9A 2J7VA 5HFOA 3BWLA 2OSUA 1N9LA 4Q0JA 2EWWA 2FFFB 4I39A 5F82A 3UE3A 3VFFA 2WAEA 4EETB 5DTSA 5FQ9A 2ZQ8A 4IVKA 4MNRA 2Y2OA 2O9AA 1ERQA 4EU0A 5E2FA 3MFDA 4OP8A 1J3WA 3N4IA 5TGFA 2J9PA 1SKOB 1CI9A 1YMXA 4OP5A 2KX6A 1AWIA 3O86A 4KG5A 3DW0A 1PI5A 4PKYA 4YOFA 1L2SA 2A2LA 4S2NC 3GDIA 2M1CA 4GS9B 4DE0A 1LL9A 4UA7A 3C7UA 1NJ4A 1DJCA 4PPRA 2B95A 2A24B 1I2WA 1MXOA 3UB6A 3S7PA 1W5DA 1MKMA 1GA0A 5D3OA 2JBFA 1CJFA 1EROA 2X71A 4EERA 1TS8A 1F5MA 5A8BA 2VK3A 2XK1A 4HY8A 5I94A 2JN7A 3IH9A 3P7NA
chains in the Genus database with same CATH topology
3LO7A 4KZ4A 5FAOA 5M19A 4K91A 1YM1A 4EUZA 3WWXA 3ZG8B 1MKIA 2CC1A 5DTKA 1XX2A 2J8YA 3W4PA 4E6XA 2UWXA 3IHAA 3IF6B 3MXSA 3PBQA 4WEKA 4Z9QA 3NDGA 4X56A 1IYOA 2PBYA 2WGVA 3VOZA 1BTLA 5G18A 1O7EA 2ZC5B 3O87A 1IYPA 3E2KA 5KSCA 4IBXA 2V2FF 5L2FA 2WKEA 3FWLA 4MBHA 4JF5A 2EX8A 3N7WA 3Q7VA 3HLGA 2EFUA 2ZJ9A 4GN2A 4GZBA 3UDIA 3BRMA 1BULA 5HAQA 4UAAA 4LENA 2ZC7A 1W79A 4QU3A 3G31A 4E3MA 4KENB 1EWZA 1Q2QA 2XF3A 4FH2A 3JYIA 1MWUA 3UY6A 4RA7A 3VP2A 4B4ZA 1NXYA 1BLPA 4DE2A 1CEFA 1ES4A 1TVFA 1K56A 2ZM0A 4WELA 5HW3A 3NDEA 4PM9A 4EV4A 1U60A 5CHUA 1K55A 3EQVA 3VFHA 2Y2JA 4BENA 1K57A 1WE4A 1DY6A 4XUXA 1MWTA 3GVBA 3LY4A 4Y0OA 2ZC4B 1PWGA 1XXMA 5CHMA 4BLMA 3BFGA 4U0XA 4BD0A 3ZNTA 4QHCA 3Q07A 3HLEA 1IKGA 4ID4A 5F1FA 3GV9A 3WS2A 3VSKA 3N6IA 3BECA 3BFDA 4GOGA 1CK3A 4KQOA 3ZDJA 3AGFA 2V20A 3PBNA 3ZG0A 3O3VA 3HUNA 5TFQA 3HLDA 1E3UA 3G2ZA 5CTMA 5FQQA 1IYSA 1ES2A 1S0WA 2PU2A 3UO9A 1YLZA 4OQGA 3PBTA 1E4DA 2WKHA 3MBZA 3N8RA 4N9LA 4R4SA 2WADA 4P85A 2WGWB 2OLVA 2XGNA 2XFTA 4JXSA 4S2PA 1HZOA 2Q9MA 5FI7A 1BUEA 2BLSA 5FQMA 1LHYA 1FCMA 1HD8A 1XA1A 5EVID 4EBNA 1GCEA 2WYXA 4CPKA 2ZQ9A 3BYDA 4OVDA 4WMCA 2Y4AA 3HBRA 2IWBA 4DF6A 4R1GA 4C3QA 3ZGAB 3A3JA 1MWSA 1SCWA 2Z2LB 4PM6A 3SH8A 4E3IA 4X68A 3NC8A 3C7VA 4OOLA 5GHXA 1ESUA 5FI2A 1WYCA 1OMEA 4KZAA 4QJGA 2C6WB 4KZ5A 1XGJA 3GQZA 2J9OA 4M3KA 1BZAA 3Q81A 1NYMA 4XUZA 3VP0A 1TEMA 2HDRA 4UHUA 3G34A 5CEDA 2BG1A 1QMEA 5A91A 4N1HA 5GLBA 4E3JA 1IYQA 3ISGA 2C5WB 3MZEA 3UDFA 4ZDXA 2Y2IA 3M2KA 5HAIA 3S1YA 4OH0A 3PBRA 4X55A 3P98A 1FR6A 4R3JA 3IHBA 1L0FA 3G2YA 2Y2HA 5E2GA 5IHVA 1GHPA 3AGDA 3MKFA 4S2IA 3N8LA 4FH4A 1KDWA 3ZNYA 5J8XA 1K56D 2P9VA 1SHVA 3IWIA 3WRTA 2H0YA 4S2OA 3LCEA 1FOFA 4K0XA 4GDBA 3OPHA 3ZCZA 1IELA 2XD5A 2Y2NA 4KZ8A 5GHYA 4JKTA 3DWKA 3MKEA 3MXRA 1BLSA 4YFMA 4WZ5C 1M6KA 3GRJA 1L0GA 3V3SA 4OQHA 4DE3A 4EBPA 1J9MA 3HLBA 2H10A 1ONHA 2R9XA 4OQIA 3N8SA 4RX2A 2WK0A 4ZJ1A 1EI5A 1JWVA 1PIOA 3G4PA 3OPRA 1H5XA 5F83A 3FKWA 5FAPA 3PBSA 1M40A 3SH9A 4E3LA 1DJBA 4X53A 3NIAA 4X6TA 4BL3A 5A93A 3RXWA 1E3UD 2HDUA 4C6YA 3IQAA 3VSLA 2WZXA 1PZOA 4A5RA 3QNCA 4B4XA 2ZMAA 2H5SA 4R4RA 5FQIA 5DF7A 4LV1A 1GHIA 1SDEA 2QPNA 1IEMA 1MWRA 1RP5A 3GR2A 3DWZA 4S2LA 3CZDA 1N9BA 4DXCA 1PW1A 3A3DA 2Y2PA 4LCMA 1KGFA 5E2EA 5GLCA 4JXVA 1L0DA 2XEPA 3BFCA 2VGJA 2H0TA 2Z2MB 3VOYA 1LLBA 4NETA 5FSRA 3C4PA 3TG9A 1LI0A 1K38A 3BM6A 2PU4A 2QMIA 2XD1A 1K25A 4WMCD 4HBTA 3WRZA 5KZHA 1HTZA 1JTGA 1XKZA 1MBLA 4KZ7A 3SS3A 2ZM2A 4QD4A 1YQSA 3MZFA 5EVIB 1BLCA 4K0WA 1JVJA 4P87A 4KG6A 5FQKA 4KZBA 2E8IA 1XP4A 1HVBA 5EUAA 2Y2LA 1KDSA 2XQZA 3TOIA 3ZG9B 1N4OA 3GTCA 1XA7A 4LCLA 2FFYA 1ERMA 1BSGA 3HL9A 3WS5A 4H8RA 4XXRA 3ZG7B 4DKIA 3G30A 3UDXA 2OLUA 3HUMA 3OZHA 3DTMA 4Q8IA 3AGEA 4Y0UA 5CGWA 4U0TA 1PWCA 2OV5A 4P0MA 4JBFA 1NZOA 5HARA 1XGIA 5AQ9A 1KGEA 1CI8A 4N1XA 2JC7A 4BQMA 3NI9A 4S2NA 3BLSA 4PM8A 1LI9A 1ZG6A 4ZJ2A 2Y91A 2WUQA 2WZZA 2X01A 1VM1A 1RGZA 2XR0A 3CJMA 3Q7VB 4OLGA 3RXXA 5AQAA 3WS4A 3BLMA 2RL3A 3A3IA 4OKPA 4R23A 2XDMA 5EVLA 4KQQA 3OCLA 5TR7A 1GHMA 1W8QA 3SH7A 3IXBA 4IEDA 5AQBA 4LV0A 1XPBA 3V39A 4BD1A 3HLCA 3HVFA 3W4QA 5FQJA 1K4FA 1K55C 1H8ZA 4OPYA 1I5QA 1K57C 4N9KA 3UPOA 5GLAA 5KSHA 1KGGA 4BL2A 4DRTA 1K6SA 3IWOA 4IBRA 4FSFA 4N92A 3V5MA 1YLPA 4RVAA 3UE0A 5KMWA 1BLHA 2Y2QA 3UE1A 2WKIA 1H8YA 4EBLA 2B5RA 1W8YA 1QMFA 4WEJA 4HESA 4PM7A 3A3EA 4UA9A 3IF6A 3BFEA 3G32A 2Q9NA 4OOMA 2P74A 2Y2GA 1NZUA 3BFFA 3P09A 3VP3A 2ZC6B 3OPPA 2ZC3B 1NY0A 2R9WA 3W4OA 2G2WA 1DJAA 4JXGA 3NCKA 4WM9A 4RYEA 4P6BA 3TSGA 3GSGA 4GD6A 5FA7A 4ZBEA 5M1AA 4MBKA 1KVLA 2EX6A 1W7FA 3IXDA 1CEGA 1ESIA 5EPHA 3V3RA 4OONA 4X69A 1KE3A 3ZVWA 2VGKA 3V50A 4GB7A 4C75A 5HL1A 1K4EA 4EWFA 3M6HA 4ZAMA 4OOYA 2HPBA 4LV3A 5E2HA 5FDHA 3HUOA 5JYPA 2ZLYA 1Q2PA 1ES5A 3C4OA 4D2OA 4WBGA 4R3BA 4OPRA 4F94A 3FYZA 3Q7ZA 1K54C 2V1ZA 1RGYA 1KE0A 1MY8A 3EQUA 4QY6A 2A49A 5EE8A 2DNSA 3LEZA 3NY4A 2Y55A 3MZDA 1KE4A 4MEZA 4U3TA 1FR1A 4HEFA 2IWCA 4E3KA 3A3FA 4QB8A 5CERA 3E2LA 4E3NA 1ALQA 1K6RA 5CTNA 1YLWA 2I72A 4GKUA 4S2JA 3HLFA 5CECA 2ZD8A 3M6BA 4FCFA 1FQGA 1YLYA 1WYBA 1ZC2A 2ZQAA 1PW8A 3PAGA 3PBOA 3ZVTA 5EVIC 2ZM8A 4JXWA 3ZFZA 4MLLA 1PI4A 1FSYA 1TDLA 1VQQA 2WGWA 2HP6A 2JCHA 4FD8A 3QHYA 1Z6FA 4DDYA 4Y0TA 2A3UA 2WAFA 3UPPA 3IXHA 1JWPA 1LL5A 4KZ6A 3WS1A 1NRFA 2P9VB 2X02A 2EXBA 5E43A 1BT5A 3FV7A 2HDSA 3B3XA 4JLFA 3UNWA 3M2JA 3IT9A 4GD8A 1ES3A 4UA6A 5EOOA 3IF5A 3SS4A 4B88A 3IH8A 4JF4A 5GLDA 4QY5A 4Y7PA 3RJUA 3VP4A 1E25A 3HREA 1IKIA 4L0LA 5CHJA 4KG2A 4NK3A 3I7JA 5BOHA 5HAPA 4BJPA 1ONGA 3QNBA 4RX3A 4DE1A 2Y59A 4O7DA 3SOIA 5HX9A 2J7VA 1C3BA 5HFOA 3S4XA 5A92A 1MPLA 4KQRA 4KZ9A 2OSUA 1PWDA 4R0QA 5FASA 5DVAA 4OPQA 1S6RA 1JWZA 1I2SA 5M18A 2G2UA 4OLDA 2FFFB 5CRFA 5EOEA 5F82A 5JYOA 2ZQCA 3UE3A 3VFFA 3FZCA 2WAEA 3OPLA 5DTSA 5FQ9A 2ZQ8A 2HP9A 2XFSA 4IVKA 4MNRA 2Y2OA 5GL9A 1ERQA 1TDGA 3ITBA 1G6AA 1ZKJA 2EFXA 3PTEA 4S2KA 2XLNA 2EXAA 5E2FA 2RCXA 1YLJA 3MFDA 2XH9A 5GHZA 1SKFA 4OP8A 1L0EA 2EX2A 2QZ6A 4GNUA 3N4IA 5TGFA 1Y54A 2J9PA 5U47A 3UN7A 3VMAA 2Y2KA 4OPZA 3OC2A 3GMWA 1CI9A 3G35A 3CG5A 5DF8A 1KVMA 1YMXA 5EECA 2IWDA 3NBLA 1RCJA 4OP5A 1YMSA 3O88A 3CMZA 3O86A 4KG5A 1AXBA 5DTTA 5F1GA 3DW0A 1FSWA 1PI5A 3UPNA 3ZG5A 4JF6A 1ZG4A 1L2SA 3C5AA 4S2NC 5FI6A 5AQ7A 5CXWA 4WZ5A 1YT4A 4IVIA 5CGSA 5CEBA 2ZQDA 5DF9A 5CGXA 4DE0A 1LL9A 2HP5A 4S2MA 2Y2MA 3C7UA 4UA7A 4ZTKA 1PYYA 5A90A 1NJ4A 1DJCA 3VP1A 3D4FA 2GDNA 2EX9A 4PPRA 1K54A 1PZPA 3W8KA 4EQIA 1I2WA 1MXOA 4WZ4A 1JTDA 3SS5A 3IXGA 3ITAA 4PM5A 5FATA 1W5DA 4JPMA 3LY3A 4LV2A 1FCNA 4CJNA 4ZJ3A 1GA0A 5D3OA 2JBFA 3FKVA 3IWQA 2HDQA 3HLWA 1O07A 4MBFA 1GA9A 4OQ0A 1G68A 1EROA 2X71A 3WS0A 4E6WA 4E3OA 3Q82A 1SDNA 3BEBA 4HBUA 1YLTA 2DRWA 1NYYA 4YINA 2DCFA 4PMAA 3PAEA 1FCOA 4WYYA 3ZHHA 4GDNA 2XK1A 3Q1FA 4DDSA 2WGIA 5I94A 2JE5A 5EVIA 5FAQA 4DXBA 3IH9A 3OCNA 3IF6C 4KZ3A 2ZQ7A 3S22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LO7 A;  4KZ4 A;  5FAO A;  5M19 A;  4K91 A;  1YM1 A;  4EUZ A;  3WWX A;  3ZG8 B;  1MKI A;  2CC1 A;  5DTK A;  1XX2 A;  2J8Y A;  3W4P A;  4E6X A;  2UWX A;  3IHA A;  3IF6 B;  3MXS A;  3PBQ A;  4WEK A;  4Z9Q A;  3NDG A;  4X56 A;  1IYO A;  2PBY A;  2WGV A;  3VOZ A;  1BTL A;  5G18 A;  1O7E A;  2ZC5 B;  3O87 A;  1IYP A;  3E2K A;  5KSC A;  4IBX A;  2V2F F;  5L2F A;  2WKE A;  3FWL A;  4MBH A;  4JF5 A;  2EX8 A;  3N7W A;  3Q7V A;  3HLG A;  2EFU A;  2ZJ9 A;  4GN2 A;  4GZB A;  3UDI A;  3BRM A;  1BUL A;  5HAQ A;  4UAA A;  4LEN A;  2ZC7 A;  1W79 A;  4QU3 A;  3G31 A;  4E3M A;  4KEN B;  1EWZ A;  1Q2Q A;  2XF3 A;  4FH2 A;  3JYI A;  1MWU A;  3UY6 A;  4RA7 A;  3VP2 A;  4B4Z A;  1NXY A;  1BLP A;  4DE2 A;  1CEF A;  1ES4 A;  1TVF A;  1K56 A;  2ZM0 A;  4WEL A;  5HW3 A;  3NDE A;  4PM9 A;  4EV4 A;  1U60 A;  5CHU A;  1K55 A;  3EQV A;  3VFH A;  2Y2J A;  4BEN A;  1K57 A;  1WE4 A;  1DY6 A;  4XUX A;  1MWT A;  3GVB A;  3LY4 A;  4Y0O A;  2ZC4 B;  1PWG A;  1XXM A;  5CHM A;  4BLM A;  3BFG A;  4U0X A;  4BD0 A;  3ZNT A;  4QHC A;  3Q07 A;  3HLE A;  1IKG A;  4ID4 A;  5F1F A;  3GV9 A;  3WS2 A;  3VSK A;  3N6I A;  3BEC A;  3BFD A;  4GOG A;  1CK3 A;  4KQO A;  3ZDJ A;  3AGF A;  2V20 A;  3PBN A;  3ZG0 A;  3O3V A;  3HUN A;  5TFQ A;  3HLD A;  1E3U A;  3G2Z A;  5CTM A;  5FQQ A;  1IYS A;  1ES2 A;  1S0W A;  2PU2 A;  3UO9 A;  1YLZ A;  4OQG A;  3PBT A;  1E4D A;  2WKH A;  3MBZ A;  3N8R A;  4N9L A;  4R4S A;  2WAD A;  4P85 A;  2WGW B;  2OLV A;  2XGN A;  2XFT A;  4JXS A;  4S2P A;  1HZO A;  2Q9M A;  5FI7 A;  1BUE A;  2BLS A;  5FQM A;  1LHY A;  1FCM A;  1HD8 A;  1XA1 A;  5EVI D;  4EBN A;  1GCE A;  2WYX A;  4CPK A;  2ZQ9 A;  3BYD A;  4OVD A;  4WMC A;  2Y4A A;  3HBR A;  2IWB A;  4DF6 A;  4R1G A;  4C3Q A;  3ZGA B;  3A3J A;  1MWS A;  1SCW A;  2Z2L B;  4PM6 A;  3SH8 A;  4E3I A;  4X68 A;  3NC8 A;  3C7V A;  4OOL A;  5GHX A;  1ESU A;  5FI2 A;  1WYC A;  1OME A;  4KZA A;  4QJG A;  2C6W B;  4KZ5 A;  1XGJ A;  3GQZ A;  2J9O A;  4M3K A;  1BZA A;  3Q81 A;  1NYM A;  4XUZ A;  3VP0 A;  1TEM A;  2HDR A;  4UHU A;  3G34 A;  5CED A;  2BG1 A;  1QME A;  5A91 A;  4N1H A;  5GLB A;  4E3J A;  1IYQ A;  3ISG A;  2C5W B;  3MZE A;  3UDF A;  4ZDX A;  2Y2I A;  3M2K A;  5HAI A;  3S1Y A;  4OH0 A;  3PBR A;  4X55 A;  3P98 A;  1FR6 A;  4R3J A;  3IHB A;  1L0F A;  3G2Y A;  2Y2H A;  5E2G A;  5IHV A;  1GHP A;  3AGD A;  3MKF A;  4S2I A;  3N8L A;  4FH4 A;  1KDW A;  3ZNY A;  5J8X A;  1K56 D;  2P9V A;  1SHV A;  3IWI A;  3WRT A;  2H0Y A;  4S2O A;  3LCE A;  1FOF A;  4K0X A;  4GDB A;  3OPH A;  3ZCZ A;  1IEL A;  2XD5 A;  2Y2N A;  4KZ8 A;  5GHY A;  4JKT A;  3DWK A;  3MKE A;  3MXR A;  1BLS A;  4YFM A;  4WZ5 C;  1M6K A;  3GRJ A;  1L0G A;  3V3S A;  4OQH A;  4DE3 A;  4EBP A;  1J9M A;  3HLB A;  2H10 A;  1ONH A;  2R9X A;  4OQI A;  3N8S A;  4RX2 A;  2WK0 A;  4ZJ1 A;  1EI5 A;  1JWV A;  1PIO A;  3G4P A;  3OPR A;  1H5X A;  5F83 A;  3FKW A;  5FAP A;  3PBS A;  1M40 A;  3SH9 A;  4E3L A;  1DJB A;  4X53 A;  3NIA A;  4X6T A;  4BL3 A;  5A93 A;  3RXW A;  1E3U D;  2HDU A;  4C6Y A;  3IQA A;  3VSL A;  2WZX A;  1PZO A;  4A5R A;  3QNC A;  4B4X A;  2ZMA A;  2H5S A;  4R4R A;  5FQI A;  5DF7 A;  4LV1 A;  1GHI A;  1SDE A;  2QPN A;  1IEM A;  1MWR A;  1RP5 A;  3GR2 A;  3DWZ A;  4S2L A;  3CZD A;  1N9B A;  4DXC A;  1PW1 A;  3A3D A;  2Y2P A;  4LCM A;  1KGF A;  5E2E A;  5GLC A;  4JXV A;  1L0D A;  2XEP A;  3BFC A;  2VGJ A;  2H0T A;  2Z2M B;  3VOY A;  1LLB A;  4NET A;  5FSR A;  3C4P A;  3TG9 A;  1LI0 A;  1K38 A;  3BM6 A;  2PU4 A;  2QMI A;  2XD1 A;  1K25 A;  4WMC D;  4HBT A;  3WRZ A;  5KZH A;  1HTZ A;  1JTG A;  1XKZ A;  1MBL A;  4KZ7 A;  3SS3 A;  2ZM2 A;  4QD4 A;  1YQS A;  3MZF A;  5EVI B;  1BLC A;  4K0W A;  1JVJ A;  4P87 A;  4KG6 A;  5FQK A;  4KZB A;  2E8I A;  1XP4 A;  1HVB A;  5EUA A;  2Y2L A;  1KDS A;  2XQZ A;  3TOI A;  3ZG9 B;  1N4O A;  3GTC A;  1XA7 A;  4LCL A;  2FFY A;  1ERM A;  1BSG A;  3HL9 A;  3WS5 A;  4H8R A;  4XXR A;  3ZG7 B;  4DKI A;  3G30 A;  3UDX A;  2OLU A;  3HUM A;  3OZH A;  3DTM A;  4Q8I A;  3AGE A;  4Y0U A;  5CGW A;  4U0T A;  1PWC A;  2OV5 A;  4P0M A;  4JBF A;  1NZO A;  5HAR A;  1XGI A;  5AQ9 A;  1KGE A;  1CI8 A;  4N1X A;  2JC7 A;  4BQM A;  3NI9 A;  4S2N A;  3BLS A;  4PM8 A;  1LI9 A;  1ZG6 A;  4ZJ2 A;  2Y91 A;  2WUQ A;  2WZZ A;  2X01 A;  1VM1 A;  1RGZ A;  2XR0 A;  3CJM A;  3Q7V B;  4OLG A;  3RXX A;  5AQA A;  3WS4 A;  3BLM A;  2RL3 A;  3A3I A;  4OKP A;  4R23 A;  2XDM A;  5EVL A;  4KQQ A;  3OCL A;  5TR7 A;  1GHM A;  1W8Q A;  3SH7 A;  3IXB A;  4IED A;  5AQB A;  4LV0 A;  1XPB A;  3V39 A;  4BD1 A;  3HLC A;  3HVF A;  3W4Q A;  5FQJ A;  1K4F A;  1K55 C;  1H8Z A;  4OPY A;  1I5Q A;  1K57 C;  4N9K A;  3UPO A;  5GLA A;  5KSH A;  1KGG A;  4BL2 A;  4DRT A;  1K6S A;  3IWO A;  4IBR A;  4FSF A;  4N92 A;  3V5M A;  1YLP A;  4RVA A;  3UE0 A;  5KMW A;  1BLH A;  2Y2Q A;  3UE1 A;  2WKI A;  1H8Y A;  4EBL A;  2B5R A;  1W8Y A;  1QMF A;  4WEJ A;  4HES A;  4PM7 A;  3A3E A;  4UA9 A;  3IF6 A;  3BFE A;  3G32 A;  2Q9N A;  4OOM A;  2P74 A;  2Y2G A;  1NZU A;  3BFF A;  3P09 A;  3VP3 A;  2ZC6 B;  3OPP A;  2ZC3 B;  1NY0 A;  2R9W A;  3W4O A;  2G2W A;  1DJA A;  4JXG A;  3NCK A;  4WM9 A;  4RYE A;  4P6B A;  3TSG A;  3GSG A;  4GD6 A;  5FA7 A;  4ZBE A;  5M1A A;  4MBK A;  1KVL A;  2EX6 A;  1W7F A;  3IXD A;  1CEG A;  1ESI A;  5EPH A;  3V3R A;  4OON A;  4X69 A;  1KE3 A;  3ZVW A;  2VGK A;  3V50 A;  4GB7 A;  4C75 A;  5HL1 A;  1K4E A;  4EWF A;  3M6H A;  4ZAM A;  4OOY A;  2HPB A;  4LV3 A;  5E2H A;  5FDH A;  3HUO A;  5JYP A;  2ZLY A;  1Q2P A;  1ES5 A;  3C4O A;  4D2O A;  4WBG A;  4R3B A;  4OPR A;  4F94 A;  3FYZ A;  3Q7Z A;  1K54 C;  2V1Z A;  1RGY A;  1KE0 A;  1MY8 A;  3EQU A;  4QY6 A;  2A49 A;  5EE8 A;  2DNS A;  3LEZ A;  3NY4 A;  2Y55 A;  3MZD A;  1KE4 A;  4MEZ A;  4U3T A;  1FR1 A;  4HEF A;  2IWC A;  4E3K A;  3A3F A;  4QB8 A;  5CER A;  3E2L A;  4E3N A;  1ALQ A;  1K6R A;  5CTN A;  1YLW A;  2I72 A;  4GKU A;  4S2J A;  3HLF A;  5CEC A;  2ZD8 A;  3M6B A;  4FCF A;  1FQG A;  1YLY A;  1WYB A;  1ZC2 A;  2ZQA A;  1PW8 A;  3PAG A;  3PBO A;  3ZVT A;  5EVI C;  2ZM8 A;  4JXW A;  3ZFZ A;  4MLL A;  1PI4 A;  1FSY A;  1TDL A;  1VQQ A;  2WGW A;  2HP6 A;  2JCH A;  4FD8 A;  3QHY A;  1Z6F A;  4DDY A;  4Y0T A;  2A3U A;  2WAF A;  3UPP A;  3IXH A;  1JWP A;  1LL5 A;  4KZ6 A;  3WS1 A;  1NRF A;  2P9V B;  2X02 A;  2EXB A;  5E43 A;  1BT5 A;  3FV7 A;  2HDS A;  3B3X A;  4JLF A;  3UNW A;  3M2J A;  3IT9 A;  4GD8 A;  1ES3 A;  4UA6 A;  5EOO A;  3IF5 A;  3SS4 A;  4B88 A;  3IH8 A;  4JF4 A;  5GLD A;  4QY5 A;  4Y7P A;  3RJU A;  3VP4 A;  1E25 A;  3HRE A;  1IKI A;  4L0L A;  5CHJ A;  4KG2 A;  4NK3 A;  3I7J A;  5BOH A;  5HAP A;  4BJP A;  1ONG A;  3QNB A;  4RX3 A;  4DE1 A;  2Y59 A;  4O7D A;  3SOI A;  5HX9 A;  2J7V A;  1C3B A;  5HFO A;  3S4X A;  5A92 A;  1MPL A;  4KQR A;  4KZ9 A;  2OSU A;  1PWD A;  4R0Q A;  5FAS A;  5DVA A;  4OPQ A;  1S6R A;  1JWZ A;  1I2S A;  5M18 A;  2G2U A;  4OLD A;  2FFF B;  5CRF A;  5EOE A;  5F82 A;  5JYO A;  2ZQC A;  3UE3 A;  3VFF A;  3FZC A;  2WAE A;  3OPL A;  5DTS A;  5FQ9 A;  2ZQ8 A;  2HP9 A;  2XFS A;  4IVK A;  4MNR A;  2Y2O A;  5GL9 A;  1ERQ A;  1TDG A;  3ITB A;  1G6A A;  1ZKJ A;  2EFX A;  3PTE A;  4S2K A;  2XLN A;  2EXA A;  5E2F A;  2RCX A;  1YLJ A;  3MFD A;  2XH9 A;  5GHZ A;  1SKF A;  4OP8 A;  1L0E A;  2EX2 A;  2QZ6 A;  4GNU A;  3N4I A;  5TGF A;  1Y54 A;  2J9P A;  5U47 A;  3UN7 A;  3VMA A;  2Y2K A;  4OPZ A;  3OC2 A;  3GMW A;  1CI9 A;  3G35 A;  3CG5 A;  5DF8 A;  1KVM A;  1YMX A;  5EEC A;  2IWD A;  3NBL A;  1RCJ A;  4OP5 A;  1YMS A;  3O88 A;  3CMZ A;  3O86 A;  4KG5 A;  1AXB A;  5DTT A;  5F1G A;  3DW0 A;  1FSW A;  1PI5 A;  3UPN A;  3ZG5 A;  4JF6 A;  1ZG4 A;  1L2S A;  3C5A A;  4S2N C;  5FI6 A;  5AQ7 A;  5CXW A;  4WZ5 A;  1YT4 A;  4IVI A;  5CGS A;  5CEB A;  2ZQD A;  5DF9 A;  5CGX A;  4DE0 A;  1LL9 A;  2HP5 A;  4S2M A;  2Y2M A;  3C7U A;  4UA7 A;  4ZTK A;  1PYY A;  5A90 A;  1NJ4 A;  1DJC A;  3VP1 A;  3D4F A;  2GDN A;  2EX9 A;  4PPR A;  1K54 A;  1PZP A;  3W8K A;  4EQI A;  1I2W A;  1MXO A;  4WZ4 A;  1JTD A;  3SS5 A;  3IXG A;  3ITA A;  4PM5 A;  5FAT A;  1W5D A;  4JPM A;  3LY3 A;  4LV2 A;  1FCN A;  4CJN A;  4ZJ3 A;  1GA0 A;  5D3O A;  2JBF A;  3FKV A;  3IWQ A;  2HDQ A;  3HLW A;  1O07 A;  4MBF A;  1GA9 A;  4OQ0 A;  1G68 A;  1ERO A;  2X71 A;  3WS0 A;  4E6W A;  4E3O A;  3Q82 A;  1SDN A;  3BEB A;  4HBU A;  1YLT A;  2DRW A;  1NYY A;  4YIN A;  2DCF A;  4PMA A;  3PAE A;  1FCO A;  4WYY A;  3ZHH A;  4GDN A;  2XK1 A;  3Q1F A;  4DDS A;  2WGI A;  5I94 A;  2JE5 A;  5EVI A;  5FAQ A;  4DXB A;  3IH9 A;  3OCN A;  3IF6 C;  4KZ3 A;  2ZQ7 A;  3S22 A; 
#chains in the Genus database with same CATH topology
 3LR5 A;  4EUZ A;  1MKI A;  4I3A A;  2CC1 A;  4E6X A;  4MN7 A;  2WKP A;  5HL6 A;  4FUW A;  1IYO A;  2WGV A;  3IS2 B;  3T12 B;  3CWF A;  1V9Y A;  2V2F F;  2WKE A;  4JF5 A;  5EVE A;  1LL8 A;  3G31 A;  4KEN B;  1EWZ A;  4FH2 A;  3JYI A;  4KUO A;  4DE2 A;  3QP5 A;  4HH2 A;  2JKF A;  2ZM0 A;  1P9R A;  3NDE A;  2INW A;  4PM9 A;  4H6J A;  3EQV A;  4EW7 A;  3VFH A;  1K57 A;  3PR6 A;  1ZHH B;  1S1Z A;  1PWG A;  4BLM A;  3BFG A;  3T50 A;  3ZNT A;  4QHC A;  2O99 A;  1LT0 A;  3GV9 A;  3VSK A;  3BEC A;  1CK3 A;  3AGF A;  2V20 A;  3ZG0 A;  3O3V A;  3HUN A;  1E3U A;  3MF0 A;  4Y3I A;  3LIB A;  2PU2 A;  1S0W A;  3UO9 A;  3MBZ A;  1JNU A;  4N9L A;  4CLC D;  3BY8 A;  2HJ9 C;  4ARZ A;  2XGN A;  2XFT A;  5FI7 A;  1GSX A;  3U2A A;  4NG2 A;  2ZQ9 A;  4WMC A;  3JVU A;  2Z6C A;  5HPF A;  2VX8 A;  4C3Q A;  3CPT A;  1SCW A;  3C7V A;  4OOL A;  5GHX A;  2ZL1 B;  3PYP A;  4UEY A;  1NYM A;  4XUZ A;  3VP0 A;  4MN5 A;  1T19 A;  2BG1 A;  2C5W B;  2Y2I A;  3M2K A;  5HAI A;  3T1Q B;  5F5Y A;  3ZQ5 A;  1NWZ A;  4NXG A;  1D7E A;  1L0F A;  2ZOH A;  5IHV A;  3N8L A;  2G7U A;  5J8X A;  2P9V A;  3KSG A;  5HD5 A;  2VGL S;  3LCE A;  4GDB A;  1YKD A;  1ODV A;  2BTF P;  2Y2N A;  3NOP C;  3BJN A;  3MKE A;  1BLS A;  4YFM A;  1L0G A;  4OQH A;  4DE3 A;  5DKL A;  4ETZ A;  2MJ6 A;  3MMH A;  3HLB A;  2H10 A;  3DAV A;  4OQI A;  3MS6 A;  1JWV A;  5F83 A;  5FAP A;  4X6T A;  2B18 A;  1E3U D;  3IQA A;  1HLU P;  2K7S A;  4NXB A;  2H5S A;  5DF7 A;  1GHI A;  4Y5F A;  1MWR A;  2L1M A;  4DXC A;  3A3D A;  3LIF A;  1KGF A;  5E2E A;  1L0D A;  2XEP A;  3BFC A;  1VHM A;  2H0T A;  2W0N A;  3C4P A;  4MCW A;  1LI0 A;  1K38 A;  3RTY A;  1K25 A;  1W63 M;  4WMC D;  1LSW A;  1MBL A;  1BLC A;  3K3C A;  1JVJ A;  4P87 A;  4EQ1 A;  2IA2 A;  3TOI A;  1KDS A;  3UDX A;  5IT5 A;  4Y0U A;  3A0V A;  1KGE A;  1T1C A;  1LI9 A;  1ZG6 A;  4CQH A;  2Y91 A;  4DJ2 A;  2WZZ A;  2X01 A;  1RGZ A;  3RXX A;  2PAV P;  2PD8 A;  5DJU A;  4II7 A;  4KQQ A;  4LV0 A;  1XPB A;  3GEC A;  3W4Q A;  4OPY A;  5HSQ A;  4N9K A;  3UPO A;  1MZU A;  1LSV A;  4GJ4 A;  3C8C A;  4BWI A;  4KUK A;  1IOU A;  3DBA A;  3KSI A;  3C2W A;  4P6Z M;  4HH3 A;  3QP8 A;  2Y2G A;  3BFF A;  3P09 A;  2ZC6 B;  3F1O A;  3OPP A;  2ZC3 B;  3BY9 A;  2R9W A;  4ZRR A;  3JPU A;  1Z09 A;  2XRN A;  3TSG A;  4ZBE A;  3LI8 A;  4MBK A;  2EX6 A;  1W7F A;  1ESI A;  3V3R A;  3ZVW A;  4HHD A;  3D72 A;  1YSP A;  1GSV A;  4C75 A;  4EWF A;  3EGD C;  4ZAM A;  5DFX A;  4LV3 A;  5JYP A;  2E8J A;  5FDH A;  2ZLY A;  4OPR A;  3Q7Z A;  4Q0H A;  2DNS A;  3MZD A;  1KE4 A;  1DP9 A;  2J3W A;  2IWC A;  4HJ4 A;  3E2L A;  1ALQ A;  2LB5 A;  5AVF A;  4BL3 A;  1YLY A;  4DJ3 A;  2ZQA A;  4DMZ A;  2OAP 1;  4JXW A;  3QP2 A;  2WGW A;  2W1T B;  3K2N A;  1OTB A;  2A3U A;  3IXH A;  2EXB A;  1OTA A;  3M2J A;  3ICY A;  1ES3 A;  4UA6 A;  3SS4 A;  3IF5 A;  3CUE A;  3QP6 A;  4Y7P A;  1E25 A;  5BOH A;  5CHJ A;  4BJP A;  3MQQ A;  3E4P A;  4RX3 A;  4KQR A;  2HZ5 A;  3F1N A;  4KZ9 A;  5L8M A;  4OPQ A;  1S6R A;  2G2U A;  1OTE A;  5G4Z A;  1F2K A;  2P7J A;  2PR5 A;  2HGV A;  3S7Q A;  2EXA A;  4G3V A;  2RCX A;  2AVX A;  3T4O A;  2QZ6 A;  1UGU A;  3T4K A;  1FIL A;  2PR6 A;  3VMA A;  3OC2 A;  3UMD A;  5G4Y A;  3CG5 A;  5EEC A;  2IWD A;  1SZV A;  1RCJ A;  3LFV A;  3MJQ A;  1AXB A;  1ZG4 A;  3C5A A;  5AQ7 A;  1D06 A;  5CXW A;  4WZ5 A;  1YT4 A;  4HJ3 A;  5CGX A;  3UB8 A;  5TBM A;  5HWW A;  4PHT A;  2K31 A;  1PZP A;  3PHY A;  3W8K A;  4EQI A;  1F9I A;  4BBU A;  1OJG A;  4JPM A;  4LV2 A;  2OWJ A;  3JVV A;  5HDC A;  4ZJ3 A;  3FKV A;  3IWQ A;  2ACG A;  2HDQ A;  1GA9 A;  1G68 A;  3BEB A;  2PYR A;  2DRW A;  2V1B A;  2PDR A;  3PAE A;  1FCO A;  1OT9 A;  2JE5 A;  2Y8H A;  3IF6 C;  3S22 A;  5FAO A;  5M19 A;  1YM1 A;  3ZG8 B;  2V1A A;  2D01 A;  1XX2 A;  3UB7 A;  2J8Y A;  3PBQ A;  4P6Z S;  4Z9Q A;  2B02 A;  4WEK A;  4X56 A;  1VEU B;  1BTL A;  4DN0 A;  1IYP A;  2PBD P;  4CLC E;  1S4S A;  3LR0 A;  1H0M A;  5I5L A;  1L3L A;  3C38 A;  4FOF A;  1BUL A;  3QP1 A;  2D02 A;  4LEN A;  3H7W A;  4E3M A;  2XF3 A;  4UQI S;  1BLP A;  3KX0 X;  5CHU A;  1K55 A;  4B93 A;  2Y2J A;  5EV0 A;  2VZW A;  4XUX A;  3GVB A;  3LY4 A;  4Y0O A;  4LPZ A;  1TS6 A;  3KSF A;  4NKP A;  3HLE A;  2ZMF A;  4ID4 A;  3LIC A;  4EUV A;  3ZDJ A;  3B42 A;  3PBN A;  2GNX A;  1IYS A;  1YLZ A;  3PBT A;  2PT7 A;  2WKH A;  2WAD A;  3VV4 A;  4P85 A;  4JXS A;  1HZO A;  4ME4 A;  2J3T D;  1HD8 A;  2WYX A;  5HD3 A;  3BYD A;  1G6O A;  2Y4A A;  3HBR A;  5HWV A;  4JGO A;  3A3J A;  1MWS A;  4O8G A;  5AJG A;  3NJA A;  3MSH A;  5FDS A;  1ESU A;  5FI2 A;  1OME A;  3U4L P;  4KZA A;  5F6A A;  4QJG A;  4KZ5 A;  1XGJ A;  1PFL A;  2J9O A;  1PRQ A;  1TEM A;  3G34 A;  1QME A;  5A91 A;  4Y17 A;  3UDF A;  4ZDX A;  2H28 A;  3PBR A;  4CLC A;  3P98 A;  2O9B A;  1UWN X;  4LRZ E;  1GHP A;  3AGD A;  3MKF A;  3EEA A;  4HJ6 A;  3H82 B;  2P04 A;  3ZCZ A;  4Y2F A;  1IEL A;  4KZ8 A;  5GHY A;  1Y4O A;  3V3S A;  4AFI A;  4EBP A;  1TF1 A;  5HZH A;  1J9M A;  1ONH A;  4ZJ1 A;  4WN5 A;  1PIO A;  3QP4 A;  1M40 A;  3SH9 A;  4E3L A;  1BYW A;  4C6Y A;  4A5R A;  2WKQ A;  1XFQ A;  4R4R A;  3GR2 A;  3CZD A;  1N9B A;  1XJ6 A;  2P08 A;  4NET A;  3TG9 A;  1TS7 A;  4FTX A;  3T4S A;  3WRZ A;  5KZH A;  1SKO A;  3LUQ A;  1HTZ A;  4PKY G;  1YQS A;  3MZF A;  5EVI B;  4RQ9 A;  2E8I A;  1XP4 A;  5EUA A;  3ZG9 B;  1BSG A;  4KQD A;  4H8R A;  3A0R A;  3HUM A;  3E0Y A;  3RFB A;  2OV5 A;  4GS9 A;  5HDD A;  4N1X A;  2JC7 A;  4BQM A;  1H3Q A;  3NI9 A;  3LR4 A;  4IUK A;  4PM8 A;  2A24 A;  2WUQ A;  3SW1 A;  5DKK A;  1VM1 A;  3CJM A;  4OLG A;  3Q7V B;  5AQA A;  3EGX C;  3BLM A;  2XDM A;  4O0P A;  3OCL A;  4GHI B;  3SH7 A;  3IXB A;  4BD1 A;  1P9W A;  3HVF A;  1XJ3 A;  1H8Z A;  1K57 C;  5GLA A;  4XT2 B;  5KSH A;  1KGG A;  4BL2 A;  3IWO A;  4IBR A;  4FSF A;  1TD5 A;  3V5M A;  4Y13 A;  2Y2Q A;  2WKI A;  1K0K A;  1W8Y A;  3UB9 A;  4PM7 A;  3A3E A;  3G32 A;  3IS2 A;  3MQO A;  2V0U A;  3VP3 A;  1NY0 A;  5CX7 A;  1T1B A;  1DJA A;  2NUT C;  1VB6 A;  5F69 A;  2I9V A;  4P6B A;  5K5B A;  4GD6 A;  4L9E A;  1KVL A;  5DJT A;  1CEG A;  3RH8 B;  2J80 A;  5EPH A;  2PD7 A;  4X69 A;  1IFQ A;  1KOU A;  2VGK A;  3V50 A;  3M6H A;  4OOY A;  3HUO A;  2Q0O A;  3MQ0 A;  3FC7 A;  5J3W A;  4D2O A;  4WBG A;  5L10 A;  3T4L A;  4F94 A;  3FYZ A;  1K54 C;  1OTD A;  3O5Y A;  3LEZ A;  3IBR A;  3DTK A;  4E3K A;  1K6R A;  5CTN A;  1YLW A;  4S2J A;  3LR3 A;  1ZC2 A;  1DP6 A;  3PAG A;  3ZVT A;  5EVI C;  2ZM8 A;  3ZFZ A;  4MLL A;  1FSY A;  2HP6 A;  4FD8 A;  4EXO A;  1LL5 A;  1VET B;  3WS1 A;  5E43 A;  2HDS A;  3B3X A;  4B88 A;  3IH8 A;  3K3D A;  5HWT A;  3VP4 A;  3HRE A;  4L0L A;  5HAP A;  4O7D A;  2QYB A;  3S4X A;  2ZL1 A;  3F1P B;  1OJ5 A;  4R0Q A;  2V8F A;  3NOT C;  1JWZ A;  1YSQ A;  5EOE A;  3FZC A;  2XFS A;  2EA9 A;  4NXE A;  5GL9 A;  1TDG A;  3ITB A;  1G6A A;  3PTE A;  2XLN A;  3OBF A;  1YLJ A;  5GHZ A;  2JHE A;  4IUH A;  3D9Y A;  3VE4 A;  1Y54 A;  5U47 A;  3UN7 A;  3D3O A;  3G35 A;  5DF8 A;  4K08 A;  1KVM A;  1S66 L;  3NBL A;  4HP4 A;  3O88 A;  3CMZ A;  5DTT A;  5F1G A;  3H9W A;  1FSW A;  2VKS A;  2QHK A;  4Z1W A;  5FL3 A;  3E4O A;  4IVI A;  5CGS A;  5CEB A;  5DF9 A;  4ZTK A;  2ZMV A;  2Y2M A;  5A90 A;  2UV0 E;  1T18 A;  3D4F A;  2GDN A;  4WZ4 A;  1JTD A;  3SS5 A;  3IXG A;  3ITA A;  5FAT A;  1ZTU A;  3LY3 A;  2OWH A;  3G6O A;  3TW8 A;  4MBF A;  3WS0 A;  4OQ0 A;  4E3O A;  3Q82 A;  1SDN A;  4HBU A;  4HIA A;  1YLT A;  2DCF A;  3ZHH A;  4GDN A;  2WGI A;  2HJE A;  1PNE A;  4HNB A;  3LO7 A;  4KZ4 A;  1W63 Q;  4K91 A;  1XJ2 A;  3WWX A;  3MXQ A;  5DTK A;  3MXS A;  3IHA A;  3IF6 B;  2PYP A;  3NDG A;  2PBY A;  3VOZ A;  4M4X A;  5G18 A;  3E2K A;  5KSC A;  2EWV A;  3FWL A;  3HLG A;  2WKR A;  4ETX A;  4NEE D;  4GN2 A;  1EW0 A;  3UDI A;  3VOL A;  4G3K A;  2ZC7 A;  2Z6D A;  1MWU A;  4I38 A;  2VJW A;  1CEF A;  4LLO B;  1TVF A;  3TJZ C;  1K56 A;  2VV7 A;  4EV4 A;  1U60 A;  1WE4 A;  1DY6 A;  2LB9 A;  2ZC4 B;  2W3F A;  5CHM A;  4Q0I A;  4U0X A;  3Q07 A;  1NLZ A;  2DMW A;  3N6I A;  3BFD A;  4GOG A;  4KQO A;  3BQA A;  5TFQ A;  3HLD A;  4R6L A;  5FQQ A;  2QKP A;  4OQG A;  2W1R A;  1E4D A;  3T1X A;  4F3L B;  1TS0 A;  3IBJ A;  2OLV A;  4S2P A;  2Q9M A;  5FQM A;  3R4K A;  1LHY A;  1FCM A;  1XA1 A;  3E4Q A;  1GCE A;  4CPK A;  2VA0 A;  3R7W B;  4DF6 A;  4R1G A;  4B9O A;  1STZ A;  3IX4 A;  2Z2L B;  4PM6 A;  3NC8 A;  1WA9 A;  3GQZ A;  1BZA A;  4YNR A;  2L4R A;  2HDR A;  5CED A;  1DRM A;  3CIT A;  4N1H A;  5GLB A;  4E3J A;  2VEA A;  4X55 A;  1FR6 A;  4R3J A;  3IHB A;  2W1T A;  3TRC A;  2YKF A;  3G2Y A;  2Y2H A;  5E2G A;  5EFW A;  4I3J A;  4S2I A;  1KDW A;  3NHQ A;  1K56 D;  1N9O A;  4WLA A;  4K0X A;  3T1R A;  4JKT A;  3DWK A;  1S1Y A;  4WZ5 C;  2K2N A;  2GX5 A;  1H5X A;  3FKW A;  2QJ7 A;  5A93 A;  3DTI A;  3VSL A;  4B4X A;  2ZMA A;  4Y15 A;  5FQI A;  1D1J A;  2QPN A;  1IEM A;  1RP5 A;  1PW1 A;  2Y2P A;  4LCM A;  2BAS A;  5GLC A;  4JXV A;  3VOY A;  4L9G A;  3PXP A;  2KOI A;  3MFX A;  4GW9 A;  2XD1 A;  2QMI A;  3V67 A;  4HBT A;  3KYQ A;  4GLQ A;  4MN6 A;  4KZ7 A;  3SS3 A;  1CF0 A;  1YPR A;  4KG6 A;  5FQK A;  4KZB A;  2Y2L A;  4PM5 A;  1N4O A;  1XA7 A;  4LCL A;  2FFY A;  1ERM A;  3HL9 A;  4XXR A;  4DKI A;  1FIK A;  3UME A;  3OZH A;  1G28 A;  1PWC A;  4JBF A;  5HAR A;  1XGI A;  4S2N A;  2M7U A;  2XR0 A;  2RL3 A;  3A3I A;  4OKP A;  1NLY A;  5TR7 A;  1GHM A;  1W8Q A;  4IED A;  5EM1 A;  5FQJ A;  1K55 C;  3LI9 A;  1T1A A;  3CLO A;  3UB5 P;  1K6S A;  2VGL M;  3MR0 A;  3LID A;  4H6J B;  4RVA A;  1BLH A;  3ULF A;  4EBL A;  2B5R A;  1P97 A;  1QMF A;  4LRX C;  1OT6 A;  4WEJ A;  4UA9 A;  2Q9N A;  1VEU A;  2V8C A;  4L9F A;  3NOU C;  4EEU A;  4OOM A;  2XSS A;  2P74 A;  1NZU A;  2O9C A;  2G2W A;  3NCK A;  4RYE A;  5FA7 A;  5M1A A;  2V0W A;  3UE6 A;  4BMW A;  5FEF A;  3IXD A;  4ARZ B;  4OON A;  1KE3 A;  4X1L A;  3CHW P;  1G5U A;  5HL1 A;  1K4E A;  4MDZ A;  5LBR A;  3T4Q A;  2HPB A;  4IHQ A;  1ES5 A;  3L9K A;  4R3B A;  3CPT B;  3NEC A;  2V1Z A;  5EE8 A;  4U3T A;  3T4J A;  1P0Z A;  4HEF A;  2FZ0 A;  4QB8 A;  5CER A;  4E3N A;  4CLC C;  2I72 A;  3P01 A;  3KO6 A;  3HLF A;  2ZD8 A;  3M6B A;  4FCF A;  1FQG A;  1PW8 A;  2XRO A;  4LRY C;  1PI4 A;  2JCH A;  1Z6F A;  4Y0T A;  1XJ4 A;  3UPP A;  1NRF A;  2P9V B;  2X02 A;  3A0S A;  3FV7 A;  5EOO A;  4GD8 A;  4JF4 A;  5GLD A;  3RJU A;  2VLG A;  2W3H A;  3C30 A;  1IKI A;  4KG2 A;  3SOI A;  1C3B A;  2V9A A;  2R78 A;  5A92 A;  1MPL A;  1UWP X;  1PWD A;  5FAS A;  5DVA A;  1I2S A;  5M18 A;  4OLD A;  5CRF A;  5JYO A;  2ZQC A;  3OPL A;  3T1S A;  2HP9 A;  3EOI A;  1ZKJ A;  2EFX A;  4S2K A;  1S4R A;  2XH9 A;  1SKF A;  2JKR I;  1L0E A;  2EX2 A;  1DP8 A;  4GNU A;  2Y2K A;  4OPZ A;  4WF0 A;  3GMW A;  3H82 A;  3B47 A;  5KIZ A;  4MMN A;  1YMS A;  1OPX A;  3UPN A;  3ZG5 A;  4JF6 A;  3ZYT A;  5FI6 A;  3HJK A;  4X1M A;  3S7O A;  2ZQD A;  4WUJ A;  4O01 A;  2HP5 A;  4S2M A;  1PYY A;  3VP1 A;  2EX9 A;  2XA7 M;  1K54 A;  2OAQ 1;  1F98 A;  1FCN A;  4CJN A;  3HLW A;  1O07 A;  4E6W A;  1NYY A;  4YIN A;  4PMA A;  3HJI A;  4WYY A;  3LYX A;  2FH5 A;  3Q1F A;  4DDS A;  3EEH A;  5EVI A;  5FAQ A;  4DXB A;  3OCN A;  4KZ3 A;  2ZQ7 A;  2L0W A;  3HCY A;  2JKR M;  3W4P A;  2UWX A;  4R38 A;  4R70 A;  1O7E A;  2ZC5 B;  3F1O B;  3O87 A;  2M7V A;  5FEG A;  4IBX A;  5L2F A;  4MBH A;  1LSX A;  2EX8 A;  1CQA A;  3N7W A;  3Q7V A;  2EFU A;  2ZJ9 A;  4GZB A;  2W27 A;  2Y79 A;  3BRM A;  3KYE A;  5MC7 A;  5HAQ A;  4GHI A;  4UAA A;  1W79 A;  4QU3 A;  1Q2Q A;  4WL9 A;  5IU1 A;  3UY6 A;  4RA7 A;  3VP2 A;  4B4Z A;  1NXY A;  3SZT A;  2OOL A;  2W3G A;  1ES4 A;  2O0Y A;  4XT2 A;  3KYZ A;  4WEL A;  4HQA A;  5HW3 A;  3OOV A;  4BEN A;  3LIE A;  1MWT A;  2GZA A;  1XXM A;  4BD0 A;  1IKG A;  5F1F A;  3WS2 A;  4ESP A;  3G2Z A;  5CTM A;  1ES2 A;  3NUL A;  3IX3 A;  3N8R A;  3KSH A;  4R4S A;  5EM0 A;  2WGW B;  1BUE A;  2BLS A;  5EVI D;  4EBN A;  2JKT I;  4EEP A;  3FG8 A;  2IWB A;  4OVD A;  2ZOI A;  3ZGA B;  3SH8 A;  4E3I A;  4X68 A;  1WYC A;  2C6W B;  3F1N B;  4M3K A;  3Q81 A;  3S7N A;  4UHU A;  4X25 A;  1V9Z A;  1GSW A;  1IYQ A;  3ISG A;  4BBT A;  3MZE A;  5IS1 A;  3S1Y A;  4OH0 A;  2GJ3 A;  4JGQ A;  4HP9 A;  4FH4 A;  1VET A;  3ZNY A;  1SHV A;  3IWI A;  3WRT A;  2H0Y A;  2CMN A;  4S2O A;  1FOF A;  3OPH A;  2XD5 A;  1ACF A;  3LEQ A;  3BQ8 A;  4UQI M;  3MXR A;  3OLO A;  1M6K A;  3GRJ A;  3BW6 A;  2R9X A;  3N8S A;  4RX2 A;  2WK0 A;  1EI5 A;  3G4P A;  3F1P A;  3OPR A;  3PBS A;  3L7H A;  1DJB A;  4X53 A;  3NIA A;  5L07 A;  3RXW A;  2HDU A;  2WZX A;  1PZO A;  5TJJ A;  3QNC A;  1YAX A;  5TBM B;  4E04 A;  4LV1 A;  1SDE A;  2JKT M;  3DWZ A;  1N9N A;  2XA7 S;  4S2L A;  2HV1 A;  2VGJ A;  2Z2M B;  1LLB A;  5FSR A;  3BM6 A;  4G3W A;  2PU4 A;  4R3A A;  5J7E A;  1JTG A;  1XKZ A;  3LGO A;  2ZM2 A;  4QD4 A;  5J4E A;  4K0W A;  5AVE A;  1HVB A;  2XQZ A;  3WS5 A;  3GTC A;  3LIA A;  3ZG7 B;  3G30 A;  2OLU A;  3W2Z A;  4EES A;  3DTM A;  4Q8I A;  3AGE A;  5CGW A;  4U0T A;  4P0M A;  1NZO A;  5C5K A;  5AQ9 A;  3TE8 A;  1CI8 A;  1Y28 A;  2QJ5 A;  3BLS A;  4ZJ2 A;  3VE3 A;  3CAX A;  2W3D A;  1NRJ A;  4JGP A;  3WS4 A;  2PRF A;  3CUE C;  5HPI A;  4R23 A;  5EVL A;  5AQB A;  3EWK A;  3V39 A;  3HLC A;  3H7W B;  1K4F A;  2KLI A;  1I5Q A;  4LGW A;  1OTI A;  4LFU A;  4DRT A;  2ZBB A;  4N92 A;  1YLP A;  3UE0 A;  5KMW A;  3UE1 A;  1H8Y A;  1X0O A;  4I5S A;  4HES A;  2QWS A;  3IF6 A;  3BFE A;  1S67 L;  5HDS A;  3W4O A;  4BBV A;  4QWO A;  4JXG A;  4WM9 A;  2NUP C;  3GSG A;  3CI6 A;  4GB7 A;  4YWZ A;  4I3I A;  4JGR A;  5E2H A;  4NXF A;  4D60 A;  1Q2P A;  3C4O A;  2VV8 A;  4QPR A;  3FPV A;  1RGY A;  1KE0 A;  1MY8 A;  3EQU A;  3FPW A;  2VV6 A;  2A49 A;  4QY6 A;  3IX8 A;  4PAU A;  3NY4 A;  2Y55 A;  4MEZ A;  4HI4 A;  5L09 A;  1FR1 A;  3A3F A;  5DFY A;  3DTE A;  2PHY A;  1XFN A;  4GKU A;  4IJG A;  5CEC A;  1WYB A;  3PBO A;  2J3T C;  2KDK A;  3T4T A;  4CLC B;  4F3L A;  3B33 A;  1TDL A;  2HF6 A;  1VQQ A;  3QHY A;  4DDY A;  1H8M A;  2YKH A;  5F68 A;  2WAF A;  1JWP A;  4KZ6 A;  1A0K A;  4GCZ A;  4HOI A;  1BT5 A;  3R7W A;  4JLF A;  3UNW A;  3IT9 A;  2W3E A;  4QY5 A;  4NK3 A;  3I7J A;  1MC0 A;  1ONG A;  3QNB A;  3E98 A;  2Y59 A;  4DE1 A;  2JKG A;  5HX9 A;  2J7V A;  5HFO A;  3BWL A;  2OSU A;  1N9L A;  4Q0J A;  2EWW A;  2FFF B;  4I39 A;  5F82 A;  3UE3 A;  3VFF A;  2WAE A;  4EET B;  5DTS A;  5FQ9 A;  2ZQ8 A;  4IVK A;  4MNR A;  2Y2O A;  2O9A A;  1ERQ A;  4EU0 A;  5E2F A;  3MFD A;  4OP8 A;  1J3W A;  3N4I A;  5TGF A;  2J9P A;  1SKO B;  1CI9 A;  1YMX A;  4OP5 A;  2KX6 A;  1AWI A;  3O86 A;  4KG5 A;  3DW0 A;  1PI5 A;  4PKY A;  4YOF A;  1L2S A;  2A2L A;  4S2N C;  3GDI A;  2M1C A;  4GS9 B;  4DE0 A;  1LL9 A;  4UA7 A;  3C7U A;  1NJ4 A;  1DJC A;  4PPR A;  2B95 A;  2A24 B;  1I2W A;  1MXO A;  3UB6 A;  3S7P A;  1W5D A;  1MKM A;  1GA0 A;  5D3O A;  2JBF A;  1CJF A;  1ERO A;  2X71 A;  4EER A;  1TS8 A;  1F5M A;  5A8B A;  2VK3 A;  2XK1 A;  4HY8 A;  5I94 A;  2JN7 A;  3IH9 A;  3P7N A; 
#chains in the Genus database with same CATH homology
 3LO7 A;  4KZ4 A;  5FAO A;  5M19 A;  4K91 A;  1YM1 A;  4EUZ A;  3WWX A;  3ZG8 B;  1MKI A;  2CC1 A;  5DTK A;  1XX2 A;  2J8Y A;  3W4P A;  4E6X A;  2UWX A;  3IHA A;  3IF6 B;  3MXS A;  3PBQ A;  4WEK A;  4Z9Q A;  3NDG A;  4X56 A;  1IYO A;  2PBY A;  2WGV A;  3VOZ A;  1BTL A;  5G18 A;  1O7E A;  2ZC5 B;  3O87 A;  1IYP A;  3E2K A;  5KSC A;  4IBX A;  2V2F F;  5L2F A;  2WKE A;  3FWL A;  4MBH A;  4JF5 A;  2EX8 A;  3N7W A;  3Q7V A;  3HLG A;  2EFU A;  2ZJ9 A;  4GN2 A;  4GZB A;  3UDI A;  3BRM A;  1BUL A;  5HAQ A;  4UAA A;  4LEN A;  2ZC7 A;  1W79 A;  4QU3 A;  3G31 A;  4E3M A;  4KEN B;  1EWZ A;  1Q2Q A;  2XF3 A;  4FH2 A;  3JYI A;  1MWU A;  3UY6 A;  4RA7 A;  3VP2 A;  4B4Z A;  1NXY A;  1BLP A;  4DE2 A;  1CEF A;  1ES4 A;  1TVF A;  1K56 A;  2ZM0 A;  4WEL A;  5HW3 A;  3NDE A;  4PM9 A;  4EV4 A;  1U60 A;  5CHU A;  1K55 A;  3EQV A;  3VFH A;  2Y2J A;  4BEN A;  1K57 A;  1WE4 A;  1DY6 A;  4XUX A;  1MWT A;  3GVB A;  3LY4 A;  4Y0O A;  2ZC4 B;  1PWG A;  1XXM A;  5CHM A;  4BLM A;  3BFG A;  4U0X A;  4BD0 A;  3ZNT A;  4QHC A;  3Q07 A;  3HLE A;  1IKG A;  4ID4 A;  5F1F A;  3GV9 A;  3WS2 A;  3VSK A;  3N6I A;  3BEC A;  3BFD A;  4GOG A;  1CK3 A;  4KQO A;  3ZDJ A;  3AGF A;  2V20 A;  3PBN A;  3ZG0 A;  3O3V A;  3HUN A;  5TFQ A;  3HLD A;  1E3U A;  3G2Z A;  5CTM A;  5FQQ A;  1IYS A;  1ES2 A;  1S0W A;  2PU2 A;  3UO9 A;  1YLZ A;  4OQG A;  3PBT A;  1E4D A;  2WKH A;  3MBZ A;  3N8R A;  4N9L A;  4R4S A;  2WAD A;  4P85 A;  2WGW B;  2OLV A;  2XGN A;  2XFT A;  4JXS A;  4S2P A;  1HZO A;  2Q9M A;  5FI7 A;  1BUE A;  2BLS A;  5FQM A;  1LHY A;  1FCM A;  1HD8 A;  1XA1 A;  5EVI D;  4EBN A;  1GCE A;  2WYX A;  4CPK A;  2ZQ9 A;  3BYD A;  4OVD A;  4WMC A;  2Y4A A;  3HBR A;  2IWB A;  4DF6 A;  4R1G A;  4C3Q A;  3ZGA B;  3A3J A;  1MWS A;  1SCW A;  2Z2L B;  4PM6 A;  3SH8 A;  4E3I A;  4X68 A;  3NC8 A;  3C7V A;  4OOL A;  5GHX A;  1ESU A;  5FI2 A;  1WYC A;  1OME A;  4KZA A;  4QJG A;  2C6W B;  4KZ5 A;  1XGJ A;  3GQZ A;  2J9O A;  4M3K A;  1BZA A;  3Q81 A;  1NYM A;  4XUZ A;  3VP0 A;  1TEM A;  2HDR A;  4UHU A;  3G34 A;  5CED A;  2BG1 A;  1QME A;  5A91 A;  4N1H A;  5GLB A;  4E3J A;  1IYQ A;  3ISG A;  2C5W B;  3MZE A;  3UDF A;  4ZDX A;  2Y2I A;  3M2K A;  5HAI A;  3S1Y A;  4OH0 A;  3PBR A;  4X55 A;  3P98 A;  1FR6 A;  4R3J A;  3IHB A;  1L0F A;  3G2Y A;  2Y2H A;  5E2G A;  5IHV A;  1GHP A;  3AGD A;  3MKF A;  4S2I A;  3N8L A;  4FH4 A;  1KDW A;  3ZNY A;  5J8X A;  1K56 D;  2P9V A;  1SHV A;  3IWI A;  3WRT A;  2H0Y A;  4S2O A;  3LCE A;  1FOF A;  4K0X A;  4GDB A;  3OPH A;  3ZCZ A;  1IEL A;  2XD5 A;  2Y2N A;  4KZ8 A;  5GHY A;  4JKT A;  3DWK A;  3MKE A;  3MXR A;  1BLS A;  4YFM A;  4WZ5 C;  1M6K A;  3GRJ A;  1L0G A;  3V3S A;  4OQH A;  4DE3 A;  4EBP A;  1J9M A;  3HLB A;  2H10 A;  1ONH A;  2R9X A;  4OQI A;  3N8S A;  4RX2 A;  2WK0 A;  4ZJ1 A;  1EI5 A;  1JWV A;  1PIO A;  3G4P A;  3OPR A;  1H5X A;  5F83 A;  3FKW A;  5FAP A;  3PBS A;  1M40 A;  3SH9 A;  4E3L A;  1DJB A;  4X53 A;  3NIA A;  4X6T A;  4BL3 A;  5A93 A;  3RXW A;  1E3U D;  2HDU A;  4C6Y A;  3IQA A;  3VSL A;  2WZX A;  1PZO A;  4A5R A;  3QNC A;  4B4X A;  2ZMA A;  2H5S A;  4R4R A;  5FQI A;  5DF7 A;  4LV1 A;  1GHI A;  1SDE A;  2QPN A;  1IEM A;  1MWR A;  1RP5 A;  3GR2 A;  3DWZ A;  4S2L A;  3CZD A;  1N9B A;  4DXC A;  1PW1 A;  3A3D A;  2Y2P A;  4LCM A;  1KGF A;  5E2E A;  5GLC A;  4JXV A;  1L0D A;  2XEP A;  3BFC A;  2VGJ A;  2H0T A;  2Z2M B;  3VOY A;  1LLB A;  4NET A;  5FSR A;  3C4P A;  3TG9 A;  1LI0 A;  1K38 A;  3BM6 A;  2PU4 A;  2QMI A;  2XD1 A;  1K25 A;  4WMC D;  4HBT A;  3WRZ A;  5KZH A;  1HTZ A;  1JTG A;  1XKZ A;  1MBL A;  4KZ7 A;  3SS3 A;  2ZM2 A;  4QD4 A;  1YQS A;  3MZF A;  5EVI B;  1BLC A;  4K0W A;  1JVJ A;  4P87 A;  4KG6 A;  5FQK A;  4KZB A;  2E8I A;  1XP4 A;  1HVB A;  5EUA A;  2Y2L A;  1KDS A;  2XQZ A;  3TOI A;  3ZG9 B;  1N4O A;  3GTC A;  1XA7 A;  4LCL A;  2FFY A;  1ERM A;  1BSG A;  3HL9 A;  3WS5 A;  4H8R A;  4XXR A;  3ZG7 B;  4DKI A;  3G30 A;  3UDX A;  2OLU A;  3HUM A;  3OZH A;  3DTM A;  4Q8I A;  3AGE A;  4Y0U A;  5CGW A;  4U0T A;  1PWC A;  2OV5 A;  4P0M A;  4JBF A;  1NZO A;  5HAR A;  1XGI A;  5AQ9 A;  1KGE A;  1CI8 A;  4N1X A;  2JC7 A;  4BQM A;  3NI9 A;  4S2N A;  3BLS A;  4PM8 A;  1LI9 A;  1ZG6 A;  4ZJ2 A;  2Y91 A;  2WUQ A;  2WZZ A;  2X01 A;  1VM1 A;  1RGZ A;  2XR0 A;  3CJM A;  3Q7V B;  4OLG A;  3RXX A;  5AQA A;  3WS4 A;  3BLM A;  2RL3 A;  3A3I A;  4OKP A;  4R23 A;  2XDM A;  5EVL A;  4KQQ A;  3OCL A;  5TR7 A;  1GHM A;  1W8Q A;  3SH7 A;  3IXB A;  4IED A;  5AQB A;  4LV0 A;  1XPB A;  3V39 A;  4BD1 A;  3HLC A;  3HVF A;  3W4Q A;  5FQJ A;  1K4F A;  1K55 C;  1H8Z A;  4OPY A;  1I5Q A;  1K57 C;  4N9K A;  3UPO A;  5GLA A;  5KSH A;  1KGG A;  4BL2 A;  4DRT A;  1K6S A;  3IWO A;  4IBR A;  4FSF A;  4N92 A;  3V5M A;  1YLP A;  4RVA A;  3UE0 A;  5KMW A;  1BLH A;  2Y2Q A;  3UE1 A;  2WKI A;  1H8Y A;  4EBL A;  2B5R A;  1W8Y A;  1QMF A;  4WEJ A;  4HES A;  4PM7 A;  3A3E A;  4UA9 A;  3IF6 A;  3BFE A;  3G32 A;  2Q9N A;  4OOM A;  2P74 A;  2Y2G A;  1NZU A;  3BFF A;  3P09 A;  3VP3 A;  2ZC6 B;  3OPP A;  2ZC3 B;  1NY0 A;  2R9W A;  3W4O A;  2G2W A;  1DJA A;  4JXG A;  3NCK A;  4WM9 A;  4RYE A;  4P6B A;  3TSG A;  3GSG A;  4GD6 A;  5FA7 A;  4ZBE A;  5M1A A;  4MBK A;  1KVL A;  2EX6 A;  1W7F A;  3IXD A;  1CEG A;  1ESI A;  5EPH A;  3V3R A;  4OON A;  4X69 A;  1KE3 A;  3ZVW A;  2VGK A;  3V50 A;  4GB7 A;  4C75 A;  5HL1 A;  1K4E A;  4EWF A;  3M6H A;  4ZAM A;  4OOY A;  2HPB A;  4LV3 A;  5E2H A;  5FDH A;  3HUO A;  5JYP A;  2ZLY A;  1Q2P A;  1ES5 A;  3C4O A;  4D2O A;  4WBG A;  4R3B A;  4OPR A;  4F94 A;  3FYZ A;  3Q7Z A;  1K54 C;  2V1Z A;  1RGY A;  1KE0 A;  1MY8 A;  3EQU A;  4QY6 A;  2A49 A;  5EE8 A;  2DNS A;  3LEZ A;  3NY4 A;  2Y55 A;  3MZD A;  1KE4 A;  4MEZ A;  4U3T A;  1FR1 A;  4HEF A;  2IWC A;  4E3K A;  3A3F A;  4QB8 A;  5CER A;  3E2L A;  4E3N A;  1ALQ A;  1K6R A;  5CTN A;  1YLW A;  2I72 A;  4GKU A;  4S2J A;  3HLF A;  5CEC A;  2ZD8 A;  3M6B A;  4FCF A;  1FQG A;  1YLY A;  1WYB A;  1ZC2 A;  2ZQA A;  1PW8 A;  3PAG A;  3PBO A;  3ZVT A;  5EVI C;  2ZM8 A;  4JXW A;  3ZFZ A;  4MLL A;  1PI4 A;  1FSY A;  1TDL A;  1VQQ A;  2WGW A;  2HP6 A;  2JCH A;  4FD8 A;  3QHY A;  1Z6F A;  4DDY A;  4Y0T A;  2A3U A;  2WAF A;  3UPP A;  3IXH A;  1JWP A;  1LL5 A;  4KZ6 A;  3WS1 A;  1NRF A;  2P9V B;  2X02 A;  2EXB A;  5E43 A;  1BT5 A;  3FV7 A;  2HDS A;  3B3X A;  4JLF A;  3UNW A;  3M2J A;  3IT9 A;  4GD8 A;  1ES3 A;  4UA6 A;  5EOO A;  3IF5 A;  3SS4 A;  4B88 A;  3IH8 A;  4JF4 A;  5GLD A;  4QY5 A;  4Y7P A;  3RJU A;  3VP4 A;  1E25 A;  3HRE A;  1IKI A;  4L0L A;  5CHJ A;  4KG2 A;  4NK3 A;  3I7J A;  5BOH A;  5HAP A;  4BJP A;  1ONG A;  3QNB A;  4RX3 A;  4DE1 A;  2Y59 A;  4O7D A;  3SOI A;  5HX9 A;  2J7V A;  1C3B A;  5HFO A;  3S4X A;  5A92 A;  1MPL A;  4KQR A;  4KZ9 A;  2OSU A;  1PWD A;  4R0Q A;  5FAS A;  5DVA A;  4OPQ A;  1S6R A;  1JWZ A;  1I2S A;  5M18 A;  2G2U A;  4OLD A;  2FFF B;  5CRF A;  5EOE A;  5F82 A;  5JYO A;  2ZQC A;  3UE3 A;  3VFF A;  3FZC A;  2WAE A;  3OPL A;  5DTS A;  5FQ9 A;  2ZQ8 A;  2HP9 A;  2XFS A;  4IVK A;  4MNR A;  2Y2O A;  5GL9 A;  1ERQ A;  1TDG A;  3ITB A;  1G6A A;  1ZKJ A;  2EFX A;  3PTE A;  4S2K A;  2XLN A;  2EXA A;  5E2F A;  2RCX A;  1YLJ A;  3MFD A;  2XH9 A;  5GHZ A;  1SKF A;  4OP8 A;  1L0E A;  2EX2 A;  2QZ6 A;  4GNU A;  3N4I A;  5TGF A;  1Y54 A;  2J9P A;  5U47 A;  3UN7 A;  3VMA A;  2Y2K A;  4OPZ A;  3OC2 A;  3GMW A;  1CI9 A;  3G35 A;  3CG5 A;  5DF8 A;  1KVM A;  1YMX A;  5EEC A;  2IWD A;  3NBL A;  1RCJ A;  4OP5 A;  1YMS A;  3O88 A;  3CMZ A;  3O86 A;  4KG5 A;  1AXB A;  5DTT A;  5F1G A;  3DW0 A;  1FSW A;  1PI5 A;  3UPN A;  3ZG5 A;  4JF6 A;  1ZG4 A;  1L2S A;  3C5A A;  4S2N C;  5FI6 A;  5AQ7 A;  5CXW A;  4WZ5 A;  1YT4 A;  4IVI A;  5CGS A;  5CEB A;  2ZQD A;  5DF9 A;  5CGX A;  4DE0 A;  1LL9 A;  2HP5 A;  4S2M A;  2Y2M A;  3C7U A;  4UA7 A;  4ZTK A;  1PYY A;  5A90 A;  1NJ4 A;  1DJC A;  3VP1 A;  3D4F A;  2GDN A;  2EX9 A;  4PPR A;  1K54 A;  1PZP A;  3W8K A;  4EQI A;  1I2W A;  1MXO A;  4WZ4 A;  1JTD A;  3SS5 A;  3IXG A;  3ITA A;  4PM5 A;  5FAT A;  1W5D A;  4JPM A;  3LY3 A;  4LV2 A;  1FCN A;  4CJN A;  4ZJ3 A;  1GA0 A;  5D3O A;  2JBF A;  3FKV A;  3IWQ A;  2HDQ A;  3HLW A;  1O07 A;  4MBF A;  1GA9 A;  4OQ0 A;  1G68 A;  1ERO A;  2X71 A;  3WS0 A;  4E6W A;  4E3O A;  3Q82 A;  1SDN A;  3BEB A;  4HBU A;  1YLT A;  2DRW A;  1NYY A;  4YIN A;  2DCF A;  4PMA A;  3PAE A;  1FCO A;  4WYY A;  3ZHH A;  4GDN A;  2XK1 A;  3Q1F A;  4DDS A;  2WGI A;  5I94 A;  2JE5 A;  5EVI A;  5FAQ A;  4DXB A;  3IH9 A;  3OCN A;  3IF6 C;  4KZ3 A;  2ZQ7 A;  3S22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...