3BFEA

Crystal structure of the class a beta-lactamase sed-1 from citrobacter sedlakii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGAGDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfeA00
1ESUA 2DRWA 1EI5A 1DY6A 2VGKA 3CJMA 3G31A 3CG5A 1ZG4A 4XUXA 2C6WB 3N4IA 4OPYA 4ZJ1A 3SH8A 1KE0A 1BULA 2XK1A 4QHCA 1PYYA 5FQMA 3Q81A 4S2KA 3UPPA 1DJBA 4NETA 2H0YA 5CHMA 5HAQA 4WYYA 5G18A 1MKIA 3M2KA 1LL5A 3M2JA 3UNWA 2HP5A 1FR1A 4EQIA 3AGEA 3LO7A 4OOLA 1ZC2A 4E3NA 4OH0A 2R9XA 2WGVA 3FV7A 3UPOA 3HLBA 3BFDA 2ZQ8A 2H10A 3JYIA 2Y2HA 3FWLA 4JF5A 3ZHHA 5M18A 3IWQA 4R0QA 3W8KA 1W5DA 1E25A 1U60A 5GHZA 4A5RA 1QMEA 4F94A 4GKUA 3NY4A 4IEDA 3M6HA 1CI9A 3WRTA 4BD0A 5FDHA 2OV5A 3Q07A 1XXMA 2WGWB 2OLVA 4CJNA 5EE8A 2RCXA 1VM1A 1KGGA 2XQZA 3IWOA 4B4XA 1FCNA 5F82A 3PBSA 3A3DA 3AGDA 3MXRA 1NXYA 3ZG8B 5FAQA 3NI9A 3O87A 5DTSA 3RXXA 4IVIA 5HL1A 1PI5A 1K54C 1LI9A 4ZDXA 1SKFA 3OC2A 3ZCZA 3PTEA 1IKGA 1Z6FA 1LL9A 1XGJA 1K56A 5DF9A 5FA7A 5I94A 1I5QA 1W7FA 4OQ0A 2X02A 1SDNA 4E6XA 2WZZA 4ID4A 2EX9A 3ZG7B 4S2PA 1NJ4A 4MNRA 2UWXA 2HDUA 3A3JA 1N9BA 5EOOA 3IXHA 4PM5A 1HZOA 3MZFA 2DNSA 2EFUA 1GA0A 2WZXA 2XGNA 1PW1A 1WE4A 4KZ9A 1K54A 4GZBA 1GCEA 4OVDA 4N1XA 2GDNA 4OPZA 1I2SA 1MWSA 4HBUA 4GB7A 4KG5A 2WAFA 4Y0UA 3UE3A 4EBNA 5CGXA 2J8YA 4DE3A 1KE3A 2Z2LB 3O88A 1G6AA 3IXBA 4LCLA 4WMCD 3W4PA 5EUAA 5EECA 5KSCA 4X69A 3WS0A 4OKPA 2WADA 1K57C 2ZQAA 3IF6C 4KZ5A 2A49A 3C5AA 2PU2A 2PBYA 3VP2A 1RCJA 5CHUA 4KZBA 1XX2A 5U47A 4P87A 5EOEA 4UA6A 5E2HA 4DDYA 1S6RA 3HVFA 4ZBEA 4HESA 4RX3A 2CC1A 2Y2MA 4U0TA 3UDFA 5TR7A 2QMIA 4EBPA 3I7JA 3ZGAB 1K25A 2XFSA 4K0WA 2JE5A 5HAIA 1Q2QA 3ZG5A 3FZCA 4KENB 2EFXA 4JXVA 3Q7VA 2ZQCA 2XF3A 1ZKJA 1K57A 3IF6A 2XDMA 4QJGA 5CRFA 3HLGA 1PWGA 4WZ4A 5KZHA 3V50A 2J7VA 1BSGA 1VQQA 4KQRA 2HP9A 3G4PA 3GV9A 5IHVA 3LY3A 3UE0A 1NY0A 2H0TA 2HP6A 4GNUA 2FFYA 3WWXA 2JBFA 4B4ZA 2RL3A 3UDXA 4YINA 1LHYA 1BTLA 1KDWA 2XH9A 1DJCA 4X55A 2EX8A 5FQIA 3UO9A 2WK0A 4EV4A 2ZQ9A 1JWZA 4L0LA 4HBTA 1I2WA 3OPHA 4NK3A 1YMSA 4OQHA 3UE1A 4JKTA 3N7WA 4S2LA 3ZVTA 3BFEA 2XD1A 4DE0A 3SH9A 4EWFA 1M6KA 4GOGA 3ZG9B 1YMXA 2PU4A 3QNCA 2HDSA 4IBXA 4OP8A 5HARA 4R23A 1YQSA 2ZM0A 5AQ9A 4Y7PA 3VFFA 3DWKA 1RGZA 3RXWA 4MLLA 4DXBA 4KQQA 3HUMA 3O86A 5FSRA 2EX2A 1PZOA 3S22A 5M1AA 2ZC3B 1YT4A 4FCFA 1KGFA 1FOFA 4OQIA 2Z2MB 2G2UA 3BLMA 4RA7A 3N8SA 1H8ZA 3IXDA 2ZM2A 4KG2A 5FQKA 4GD6A 4IVKA 4JLFA 5EVID 4E3JA 3PBNA 1KDSA 4LV3A 4E3KA 4HEFA 1ES2A 4D2OA 1ONHA 1WYBA 2FFFB 4N9KA 3TSGA 3BLSA 3HREA 4PM9A 3A3FA 4E3MA 4WMCA 1GA9A 3BRMA 2WKHA 3W4QA 4WEJA 3V39A 2JC7A 3GQZA 1BLCA 1GHPA 2Y59A 4GDNA 1KE4A 2Y4AA 5FASA 1W8QA 2Y2NA 4N92A 3MBZA 3TOIA 4MBKA 4OLGA 3O3VA 1MY8A 4KZ4A 3S4XA 2V2FF 4ZTKA 4WEKA 1GHIA 5D3OA 5AQAA 4KZ6A 5FAPA 5A91A 3DWZA 3ZDJA 4S2JA 2P74A 2XLNA 1MWRA 3GMWA 2VGJA 5AQBA 5FI6A 3S1YA 4PM7A 1PWDA 1FSWA 1MWTA 3CZDA 2ZQ7A 2XFTA 1L2SA 1LLBA 1XA7A 4KZ7A 4LCMA 4P85A 4R4RA 3WRZA 4X53A 5TFQA 5BOHA 4BLMA 4LENA 3FKVA 4BL2A 1K4EA 4FH2A 2WYXA 3W4OA 3OPPA 5GLBA 5HX9A 3PBTA 2EX6A 3QNBA 5FQJA 1TVFA 2E8IA 5FI2A 1TDLA 5CHJA 2Y2PA 3GRJA 2ZQDA 4K91A 1OMEA 1NRFA 3LEZA 3AGFA 3QHYA 4BD1A 2I72A 2OLUA 5DVAA 3WS2A 1GHMA 3E2KA 3PBOA 4OPRA 3ZFZA 2QZ6A 1ALQA 3G2ZA 1K55C 1QMFA 1W8YA 4MBHA 1ES4A 4X56A 5EVIC 4DKIA 1MXOA 3HUNA 3UN7A 3HBRA 1XP4A 4C75A 5CECA 3VFHA 1FCOA 1ZG6A 4YFMA 2IWCA 3CMZA 1NYYA 3VOZA 4S2IA 4M3KA 4XXRA 2P9VA 2Y2JA 1K6RA 2IWBA 3NC8A 1K38A 2Y55A 1FR6A 3VSKA 2DCFA 2WKEA 5HAPA 5KMWA 1K55A 3B3XA 5GLCA 5CGSA 5EVIA 1YLJA 2WAEA 3BFFA 3ZG0A 4R1GA 2A3UA 4JXSA 2XD5A 3V5MA 1E3UD 1KGEA 4DXCA 5M19A 4FH4A 4JF6A 5GHYA 3UY6A 2WUQA 5DF8A 4R3JA 1ES5A 5CEBA 3VOYA 4QD4A 1EROA 2XEPA 4JPMA 3BECA 3HLCA 3PAGA 4N1HA 2ZM8A 5FI7A 4P6BA 1M40A 1AXBA 3A3EA 1FQGA 3BFCA 1JWPA 4OLDA 5FATA 3N8RA 4R3BA 3G35A 2Y2IA 4R4SA 3PAEA 1ERMA 4FD8A 2J9OA 3GSGA 4WELA 5KSHA 1XGIA 3WS4A 5CTNA 3UPNA 1JTGA 3ITBA 3MZEA 4UAAA 1L0FA 4DF6A 4JBFA 1MWUA 2Y2LA 1CK3A 3MZDA 4WZ5C 2XR0A 1SHVA 3G2YA 4Y0OA 2JCHA 4K0XA 4PPRA 2X71A 5J8XA 1XPBA 2WGWA 4RVAA 3TG9A 3SS5A 5E2EA 4OPQA 1RGYA 5DTKA 3IH9A 1BT5A 3IWIA 5A92A 2R9WA 3SS3A 2EXAA 4LV0A 1IEMA 1MBLA 4RYEA 3VP1A 3EQUA 5CEDA 1HD8A 4X68A 4DDSA 5E43A 3N6IA 3BFGA 1ERQA 3LCEA 4LV1A 4DRTA 3Q7VB 1W79A 1XKZA 3HLDA 4WZ5A 3RJUA 1NZOA 3D4FA 5E2GA 3C7VA 3IF6B 3IF5A 3OCLA 4UHUA 1PZPA 1JTDA 3OPLA 1YM1A 3NDEA 4FSFA 3HL9A 2X01A 3UDIA 2OSUA 1CEFA 3PBQA 4MEZA 3LY4A 4IBRA 3N8LA 5HFOA 3G30A 3BEBA 4ZJ3A 4Q8IA 2B5RA 1IYPA 1S0WA 2G2WA 3NCKA 5CERA 3IQAA 1RP5A 2Q9NA 1JWVA 5CTMA 4PM8A 1ESIA 1ES3A 4BJPA 4JXGA 1Y54A 3M6BA 4CPKA 1O7EA 5A93A 4O7DA 5F83A 4E3IA 3BM6A 1WYCA 4BL3A 3DTMA 3OPRA 5A90A 3SH7A 4PM6A 5TGFA 4MBFA 4OONA 3WS1A 5FAOA 5GHXA 1YLWA 5DTTA 4GN2A 3FKWA 4BENA 1E3UA 4E6WA 4E3LA 5JYPA 2ZC6B 3MFDA 2WGIA 3IT9A 3SOIA 1BLHA 4U3TA 3NIAA 3IHBA 3ITAA 4S2MA 3GVBA 1SCWA 1PIOA 3C7UA 4PMAA 3Q1FA 3ZNYA 4WM9A 1K4FA 3VP4A 1KVMA 1YLZA 2Y2QA 2ZC7A 4ZAMA 1PI4A 5GLAA 4E3OA 1YLPA 1PW8A 3C4OA 5CXWA 2HDRA 4KG6A 2ZC5B 4KZAA 2WKIA 4OP5A 1IKIA 1G68A 2Y2KA 3HUOA 3WS5A 3IHAA 4ZJ2A 2V20A 2Y2GA 3GTCA 5GLDA 3A3IA 1H5XA 4QY5A 4QY6A 5EVLA 2BG1A 1NZUA 3Q82A 3OCNA 4DE2A 2Q9MA 3V3SA 3EQVA 1ONGA 5CGWA 3SS4A 3FYZA 5L2FA 4OOMA 1Q2PA 2ZLYA 3VSLA 4KZ8A 1FCMA 4U0XA 4OOYA 1YLYA 2Y2OA 3PBRA 2V1ZA 3ZNTA 1CI8A 5AQ7A 4S2OA 3MKFA 2QPNA 4QU3A 1DJAA 1LI0A 3G32A 4KQOA 5DF7A 1FSYA 3MKEA 3VMAA 3IH8A 5FQ9A 1L0GA 2BLSA 4DE1A 1BUEA 1NYMA 1TEMA 4GD8A 4EUZA 1PWCA 5JYOA 1KVLA 4GDBA 3NDGA 4WBGA 4P0MA 2EXBA 4Y0TA 3V3RA 4XUZA 2HDQA 3HLWA 3GR2A 1SDEA 1BLSA 2H5SA 3OZHA 3MXSA 3P98A 4KZ3A 1H8YA 2ZD8A 4JXWA 4UA7A 4UA9A 4QB8A 5EPHA 1E4DA 1EWZA 3E2LA 1J9MA 5F1FA 3G34A 4BQMA 1C3BA 1K56D 5GL9A 4B88A 1BZAA 3HLEA 1BLPA 5F1GA 3VP3A 1XA1A 3BYDA 2J9PA 3ZVWA 4LV2A 1IELA 4EBLA 4S2NC 5FQQA 3ISGA 2IWDA 3Q7ZA 1HVBA 4Z9QA 1IYSA 1CEGA 3NBLA 2HPBA 4X6TA 4H8RA 4JF4A 4RX2A 1IYOA 1IYQA 1O07A 5E2FA 1MPLA 2ZC4B 4OQGA 2C5WB 5HW3A 2ZJ9A 2P9VB 1JVJA 1N4OA 2Y91A 3IXGA 3P09A 2ZMAA 3HLFA 3VP0A 4C3QA 1HTZA 5EVIB 1K6SA 4C6YA 4N9LA 1L0EA 3DW0A 3C4PA 4S2NA 1TDGA 1YLTA 1L0DA
chains in the Genus database with same CATH superfamily
2DRWA 1EI5A 1ZG4A 3BQAA 4LFUA 1BULA 3V67A 4WLAA 4QHCA 1PYYA 4D60A 2LB9A 2PBDP 3Q81A 1VHMA 4NETA 4LLOB 2W1TA 2ZBBA 3M2KA 1LL5A 3M2JA 2HP5A 3MR0A 3AGEA 3LO7A 1LSWA 5HDDA 3BFDA 4I3JA 3ZHHA 4IHQA 4R0QA 1W5DA 1E25A 2GX5A 4MDZA 1QMEA 4F94A 3M6HA 3IS2A 3Q07A 1XXMA 4CJNA 2V8CA 4H6JA 3PBSA 3FPVA 3A3DA 5HL1A 4MCWA 1IKGA 1MZUA 4E6XA 3TJZC 5G4ZA 2EX9A 4S2PA 3KYQA 1NJ4A 2UWXA 1N9BA 5L8MA 4PAUA 1HZOA 4LRYC 2DNSA 2EFUA 2XGNA 2KOIA 5HDSA 4OVDA 4N1XA 3KSHA 4OPZA 1I2SA 1MWSA 4GB7A 2YKHA 3UE3A 4M4XA 4DE3A 2Z2LB 3W4PA 5EUAA 2W0NA 2PBYA 3VP2A 5CHUA 4DJ2A 3CI6A 4P87A 2VGLS 2A24B 2ZL1A 5E2HA 4GLQA 3HVFA 4ZBEA 4U0TA 5J7EA 3ZGAB 2JE5A 5HD5A 3T1QB 3NULA 2EFXA 1HLUP 3HLGA 5L07A 1PWGA 1VEUB 3OLOA 2J7VA 1BSGA 3UB9A 3G4PA 5F5YA 1G28A 3LY3A 4WN5A 2HP6A 4GNUA 2W1RA 4YINA 1BTLA 1KDWA 4X55A 2WK0A 4NK3A 4RQ9A 4OQHA 4S2LA 3ZVTA 4DE0A 1M6KA 3F1OB 4GOGA 4IBXA 5HARA 2HDSA 5AQ9A 5DFXA 2O9BA 4ESPA 3QP4A 5DFYA 4FCFA 1KGFA 1FOFA 4OQIA 2Z2MB 4ETZA 3BLMA 3T4OA 4X1LA 1H8ZA 3PBNA 1KDSA 1ZHHB 2VZWA 4E3KA 1NLYA 3TSGA 3JVVA 3H7WB 4WMCA 3BRMA 4GHIB 4HH2A 1FILA 1GHPA 4GDNA 1KE4A 3IX8A 3LI8A 2Y2NA 4N92A 2E8JA 4F3LA 5D3OA 4KZ6A 3T4TA 1FSWA 1MWTA 4KZ7A 1XA7A 4BLMA 1K4EA 5J4EA 2EWVA 1Z09A 2EX6A 3QNBA 2W1TB 1T1BA 2Y2PA 1OMEA 3AGFA 3E2KA 1K55C 1QMFA 3KX0X 4X56A 3HUNA 3UN7A 3HBRA 5CECA 2A2LA 3VFHA 3IS2B 3T50A 3CMZA 1TS8A 3VOZA 3MXQA 4H6JB 2QWSA 4XXRA 2Y2JA 1K38A 2WKEA 5KMWA 1K55A 1T1CA 3S7QA 2ZMVA 4JXSA 2PDRA 1E3UD 5L10A 1LSVA 5AVFA 4FH4A 3IBJA 1Y4OA 2WUQA 1N9LA 4EEUA 5CEBA 1H0MA 4JPMA 3CLOA 2GJ3A 3HLCA 1YPRA 4Y5FA 1IOUA 1IFQA 4P6BA 1M40A 1JWPA 4OLDA 1F9IA 2V0UA 3MZEA 2ZOHA 3LICA 4Q0JA 1SHVA 4Y0OA 2JCHA 4PPRA 5J8XA 1XPBA 4RVAA 2ZL1B 2CMNA 1BT5A 3VP1A 1SKOA 3EQUA 4NEED 4DDSA 5E43A 1OT9A 1ERQA 5EM0A 3FC7A 1VB6A 3OCLA 1F98A 1P0ZA 2XA7S 4FSFA 1YM1A 4MEZA 3N8LA 4NXBA 4NXGA 2VGLM 2G2WA 4R3AA 1ESIA 4JXGA 4Y2FA 4CLCE 2YKFA 4BL3A 3DTMA 2VJWA 3SH7A 5TGFA 3T4JA 4GS9A 1NWZA 5GHXA 3LIAA 2D01A 4E6WA 3MFDA 5HPIA 1H3QA 3LIDA 3C7UA 3ZNYA 3E4OA 2I9VA 4WM9A 1KVMA 2V9AA 2VK3A 1S4RA 1YLPA 5C5KA 4E3OA 4ZRRA 4R6LA 3HUOA 3IHAA 2Y2GA 4Z1WA 5GLDA 2HF6A 1H5XA 3A3IA 2BG1A 3Q82A 1FIKA 2VV8A 3CITA 3EQVA 5F68A 1ONGA 1Q2PA 2ZLYA 3F1PA 3VSLA 1FCMA 2JKGA 3MFXA 1YSPA 4F3LB 3PBRA 3MKFA 3G32A 4KQOA 5DF7A 3MKEA 1BUEA 3T1SA 3QP1A 5HD3A 1LSXA 2ZMFA 1ACFA 3H9WA 4DN0A 2HDQA 3HLWA 3OZHA 5EVEA 5FDSA 2ZD8A 2NUTC 4UA7A 3E2LA 1J9MA 3DTIA 5GL9A 1BZAA 1BLPA 3T4SA 3VV4A 1IELA 4EBLA 1IYSA 1LT0A 4X6TA 4H8RA 4RX2A 1IYQA 4EUVA 3EEAA 4FUWA 2ZJ9A 4EXOA 3IXGA 3HLFA 3VP0A 4R38A 3NHQA 4C6YA 1D7EA 1DP6A 1YLTA 3CG5A 4XUXA 4HP4A 4X25A 4S2KA 3UPPA 1DJBA 2H0YA 5CHMA 3DAVA 2DMWA 3UNWA 1FR1A 1ZC2A 4G3WA 2WGVA 2J3TD 4JF5A 3W8KA 5GHZA 4A5RA 4GKUA 3NY4A 4IEDA 1CI9A 2OV5A 2OLVA 1OTAA 1TF1A 4YNRA 1VM1A 1KGGA 3LIBA 2OAP1 1TD5A 4R70A 4CLCD 1SKOB 3MXRA 1G6OA 1NXYA 1EW0A 3RXXA 5DTSA 1K54C 2W3FA 2HV1A 2QJ7A 2XROA 5FA7A 1LL9A 1I5QA 1W7FA 2X02A 1SDNA 2HDUA 3IXHA 3MZFA 4FTXA 3UE6A 1OTIA 1GA0A 1WE4A 1K54A 3ZYTA 3OOVA 2WAFA 2XA7M 5CGXA 3HJIA 4GS9B 4OKPA 4NXEA 1S1ZA 3IX4A 4WUJA 3TE8A 3NOPC 4YWZA 3ZG5A 4O8GA 1ZKJA 5FEFA 5KZHA 5A93A 1VQQA 3GV9A 3BQ8A 3UDXA 3F1PB 4MN6A 4CQHA 4IUKA 2P04A 1DJCA 4I3IA 1MKMA 2ZQ9A 4L0LA 2HJEA 1YMSA 2B18A 4JKTA 4EWFA 2PU4A 1YQSA 2ZM0A 4DXBA 4MLLA 2EX2A 3RFBA 3EOIA 2JKTI 4RA7A 3N8SA 3IXDA 3T1XA 4KG2A 3B47A 4JLFA 5EVID 1H8MA 2ZOIA 4LV3A 4HEFA 1ONHA 1WYBA 2FFFB 3BLSA 3MF0A 4IJGA 3HJKA 5TJJA 4UEYA 3DBAA 3T1RA 3V39A 2J3WA 2JC7A 3GQZA 2PR5A 1W8QA 4OLGA 3O3VA 4KZ4A 3T4LA 3S4XA 4WEKA 5FAPA 5A91A 2P74A 5FI6A 2VGJA 3S1YA 1PWDA 1L2SA 4P85A 4R4RA 5TFQA 5BOHA 1AWIA 4LENA 4BL2A 3OPPA 5GLBA 1OTDA 4Y3IA 5HX9A 1S4SA 1TVFA 2E8IA 5FI2A 3QHYA 3LEZA 4BD1A 2OLUA 5DVAA 1ALQA 3G2ZA 1W8YA 4MBHA 1ES4A 1YKDA 1XP4A 3MMHA 4C75A 1FCOA 1ZG6A 4YFMA 2V0WA 1V9YA 3KSIA 3LI9A 3UMEA 2K31A 3MQQA 1K6RA 2JKRI 3NC8A 1OJ5A 1OJGA 3ZG0A 5AVEA 5LBRA 3U2AA 1KGEA 4QPRA 4DXCA 5M19A 4JF6A 2OAQ1 3UB8A 5DF8A 1EROA 1G5UA 4N1HA 2INWA 2ZM8A 3VE4A 5FATA 3A3EA 3N8RA 3QP5A 2Y2IA 1L3LA 4R4SA 1XGIA 3WS4A 5CTNA 1JTGA 3KYEA 5HWWA 2KLIA 4JBFA 2Y2LA 1CK3A 3MZDA 2XR0A 2M1CA 4HJ3A 1VETA 3G2YA 4K0XA 2X71A 2WGWA 5EM1A 3IH9A 3SS3A 1IEMA 4X68A 3LCEA 4DRTA 2PR6A 2L4RA 3D4FA 4Y17A 1JTDA 2X01A 3PBQA 1UWNX 2B02A 4Q8IA 1K0KA 1S0WA 3IQAA 1ZTUA 1Y54A 1O7EA 4LRZE 3OPRA 4HI4A 4PM6A 4OONA 4GN2A 5JYPA 4MN5A 4E3LA 2ZC6B 3SOIA 1BLHA 4U3TA 3IHBA 3ITAA 3F1NA 4S2MA 1PNEA 3D72A 1SCWA 1PIOA 4PMAA 2AVXA 5HL6A 1K4FA 3VP4A 2ZC7A 3R4KA 1PI4A 2BTFP 1PW8A 3C4OA 5CXWA 2HDRA 3SW1A 2WKIA 1IKIA 4QWOA 4HNBA 2V20A 1MC0A 1NZUA 3OCNA 2M7UA 2Q9MA 2QYBA 5CGWA 2JKRM 5HWTA 4U0XA 1YLYA 2V1ZA 1CI8A 5AQ7A 1DJAA 4EUZA 4GD8A 1TEMA 5JYOA 1KVLA 4WBGA 2EXBA 4O0PA 4HJ4A 5HDCA 3MXSA 3P98A 4KZ3A 3HCYA 2FZ0A 4ME4A 4JGRA 1E4DA 3K3CA 1EWZA 1YSQA 4L9EA 3CWFA 4LV2A 3R7WA 5FQQA 3Q7ZA 1HVBA 4Z9QA 3E4PA 2Z6DA 5J3WA 5E2FA 1MPLA 4JGOA 1TS6A 1JVJA 2WKRA 2ZMAA 3UMDA 1HTZA 1K6SA 4N9LA 3C4PA 2PYPA 1DY6A 2VGKA 3CJMA 3G31A 2C6WB 2XRNA 3N4IA 5FL3A 1NRJA 2PHYA 3SH8A 1KE0A 3FPWA 4DJ3A 2XK1A 5DKKA 5HAQA 1MKIA 1YAXA 3PXPA 2EWWA 2Y8HA 1UGUA 4OOLA 5F6AA 2R9XA 3HLBA 2ZQ8A 2H10A 3FWLA 4PHTA 3ICYA 3IWQA 2D02A 1VETB 4BD0A 5FDHA 2WGWB 5EE8A 3UB6A 2XQZA 1WA9A 1ODVA 1FCNA 5F82A 4FOFA 4EQ1A 3AGDA 3ZG8B 5FAQA 3O87A 4DMZA 2O0YA 4IVIA 1LI9A 2VV6A 3PR6A 4ZDXA 3OC2A 5I5LA 3ZCZA 3PTEA 1XGJA 1K56A 5DF9A 2VLGA 4ID4A 3ZG7B 1P9RA 4MNRA 3A3JA 4PM5A 1W63M 2WZXA 4KZ9A 4GZBA 3S7OA 2NUPC 2VX8A 4HBUA 1A0KA 2Q0OA 4KG5A 4EBNA 3TW8A 4Y13A 3O88A 1G6AA 3IXBA 4LCLA 4WMCD 5EECA 5KSCA 1K57C 2WKQA 2A49A 1N9NA 3F1NB 2JKFA 4KZBA 5U47A 3RH8B 1S6RA 4HESA 4RX3A 4I5SA 2XFSA 5HAIA 4K0WA 1Q2QA 4JXVA 4UQIS 3LR0A 1K57A 4QJGA 5CRFA 5IU1A 3LIEA 3V50A 1GSXA 4WL9A 2HP9A 3UE0A 1NY0A 2H0TA 4Q0IA 2KDKA 3C30A 2Z6CA 3ULFA 5FQIA 3UO9A 3VE3A 4EV4A 4HBTA 3OPHA 2B95A 3UE1A 3N7WA 3BFEA 3LR4A 3QNCA 1OTBA 4OP8A 4R23A 3DWKA 3RXWA 4MMNA 3HUMA 3O86A 1PZOA 3PHYA 5M1AA 1YT4A 2G2UA 4L9FA 2EA9A 5FQKA 4GD6A 4IVKA 4E3JA 5K5BA 1KOUA 1ES2A 2Y79A 4D2OA 4PM9A 4E3MA 3R7WB 3KSFA 1BLCA 2Y59A 2Y4AA 4XT2A 3MJQA 3TOIA 1D1JA 3DTKA 2V2FF 3L9KA 4ZTKA 1GHIA 4EEPA 3DWZA 2XLNA 1MWRA 3GMWA 4HH3A 4NG2A 3T4QA 4GCZA 3CZDA 5HWVA 2ZQ7A 3P7NA 2XFTA 1LLBA 1F5MA 4LCMA 3WRZA 4X53A 3FKVA 2WYXA 3W4OA 1OPXA 3PBTA 1XJ6A 2GNXA 2L0WA 1TDLA 3C38A 5CHJA 4JGQA 1NRFA 2QZ6A 4DKIA 5EFWA 5EV0A 1W63Q 1MXOA 3G6OA 1DRMA 3S7PA 3TRCA 5IT5A 1S1YA 4IUHA 2IWCA 2LB5A 2OWJA 4S2IA 4M3KA 2IWBA 3VSKA 5HAPA 5GLCA 2WAEA 2QKPA 3E0YA 2A3UA 1V9ZA 2XD5A 3V5MA 3BW6A 3UY6A 5TBMA 1ES5A 3VOYA 3BECA 3LR3A 3PAGA 3A0RA 1XJ2A 5FI7A 1OT6A 3O5YA 1FQGA 3BFCA 2VKSA 2HJ9C 4R3BA 1ERMA 1NLZA 3GSGA 4FD8A 4WELA 3ITBA 4UAAA 1L0FA 3CUEC 1MWUA 4I3AA 5AJGA 1RGYA 5DTKA 3IWIA 3ZQ5A 2R9WA 4LV0A 5CEDA 1HD8A 2UV0E 2W27A 3N6IA 3NOTC 1JNUA 4LV1A 3CUEA 3RJUA 3LGOA 2R78A 4ETXA 3EWKA 1PZPA 3OPLA 3NDEA 3UDIA 2OSUA 2WKPA 1CF0A 1CEFA 3LY4A 5DJTA 5HFOA 3G30A 4ZJ3A 2B5RA 3LEQA 3H82A 3KYZA 1RP5A 2Q9NA 1JWVA 2PT7A 3GECA 4PM8A 4BJPA 4CPKA 1X0OA 4UQIM 5F83A 3EGDC 3BM6A 4EERA 3MQOA 4MBFA 5FAOA 3BWLA 4BENA 1P9WA 1E3UA 3GVBA 2OWHA 3A0VA 1YLZA 2Y2QA 2PD8A 4ZAMA 1UWPX 4KG6A 1G68A 4LPZA 2Y2KA 3WS5A 4ZJ2A 3GTCA 4QY6A 1CJFA 3SS4A 5L2FA 3MSHA 4OOMA 4XT2B 4EETB 4OOYA 2Y2OA 3ZNTA 3LIFA 2QPNA 2G7UA 1LI0A 1FSYA 5FQ9A 2BLSA 3CPTA 3C2WA 5A8BA 4GW9A 4NXFA 4P0MA 4LRXC 4AFIA 4Y0TA 1XFNA 2QJ5A 4BBVA 4XUZA 1DP8A 3GR2A 1SDEA 3T4KA 1H8YA 4JXWA 4QB8A 5EPHA 4BWIA 5F1FA 3G34A 4BQMA 1C3BA 4B88A 5F1GA 4KQDA 4S2NC 3ISGA 2IWDA 3VOLA 3P01A 1CEGA 3NBLA 2HPBA 1BYWA 1IYOA 1O07A 2JKTM 2H28A 5HSQA 2Y91A 1OTEA 3P09A 3SZTA 1L0EA 3DW0A 4S2NA 2K2NA 1TDGA 1L0DA 1ESUA 2O9CA 2P7JA 2FH5A 4OPYA 4ZJ1A 5TBMB 3KSGA 5FQMA 4HP9A 1P97A 5MC7A 4WYYA 5G18A 2V1BA 4EQIA 4E3NA 2MJ6A 3FV7A 4OH0A 3UPOA 3JYIA 2Y2HA 5M18A 4BBTA 1U60A 4G3VA 3WRTA 4Y15A 2RCXA 3U4LP 3IWOA 1XJ4A 4B4XA 1S66L 2P08A 4P6ZS 3NI9A 3OBFA 1T19A 1PI5A 1SKFA 4KUOA 4BMWA 1Z6FA 5I94A 4OQ0A 2W3DA 1DP9A 4E04A 2WZZA 4ARZA 5EOOA 3BJNA 4KUKA 3H82B 3EGXC 4NKPA 1PW1A 4GJ4A 1T1AA 1GCEA 2GDNA 2VV7A 4Y0UA 3JVUA 2J8YA 1KE3A 1STZA 4X69A 3WS0A 2WADA 4LGWA 2ZQAA 3IF6C 4KZ5A 2J3TC 3C5AA 2PU2A 1RCJA 3W2ZA 1XX2A 5EOEA 2BASA 4UA6A 2IA2A 2O99A 3LYXA 4DDYA 2CC1A 2Y2MA 3UDFA 5TR7A 2QMIA 4EBPA 3I7JA 1K25A 3NECA 3FZCA 4KENB 3KO6A 3Q7VA 2ZQCA 4CLCC 2XF3A 3IF6A 2XDMA 4L9GA 2PRFA 4WZ4A 5IHVA 4KQRA 3E98A 3WWXA 4B93A 2FFYA 3LUQA 2JBFA 4B4ZA 2RL3A 1S67L 1LHYA 2XH9A 2EX8A 4CLCA 1JWZA 1I2WA 2XD1A 3SH9A 4I39A 3CPTB 3ZG9B 1YMXA 4Y7PA 5DJUA 3VFFA 1RGZA 5HZHA 4KQQA 5FSRA 3S22A 1CQAA 2ZC3B 3JPUA 4X1MA 4B9OA 3CHWP 2ZM2A 4N9KA 2L1MA 5CX7A 5L09A 3HREA 3A3FA 1GA9A 2WKHA 3W4QA 4WEJA 2QHKA 3QP8A 1XFQA 5FASA 1LL8A 3MBZA 4MBKA 3K3DA 1MY8A 5IS1A 2GZAA 5AQAA 3ZDJA 4S2JA 5AQBA 4PM7A 2JN7A 3QP6A 1D06A 5FEGA 5G4YA 4FH2A 4EESA 4EU0A 2V1AA 4II7A 4PKYG 5FQJA 4O01A 3T12B 4HY8A 3D9YA 3DTEA 3B42A 2ZQDA 3GRJA 4K91A 2I72A 3WS2A 1GHMA 3PBOA 3B33A 4OPRA 3ZFZA 2ACGA 5EVIC 3UB7A 4EW7A 1NYYA 4PKYA 3EEHA 3MQ0A 2P9VA 2Y55A 1FR6A 2DCFA 3B3XA 5CGSA 5EVIA 1YLJA 3BFFA 4R1GA 4I38A 4ARZB 5GHYA 4R3JA 3NJAA 4QD4A 2XEPA 3UB5P 3IBRA 5HPFA 4HOIA 4BBUA 4P6ZM 1TS0A 1AXBA 2PAVP 3G35A 5F69A 3PAEA 2J9OA 5KSHA 3UPNA 4DF6A 2HZ5A 4WZ5C 4HIAA 3IX3A 3L7HA 3BY8A 3TG9A 3SS5A 5E2EA 4OPQA 5A92A 2EXAA 3QP2A 4WF0A 1MBLA 4RYEA 2W3GA 2V8FA 2HGVA 3BFGA 5KIZA 3Q7VB 1W79A 1XKZA 3HLDA 4WZ5A 3A0SA 1NZOA 5E2GA 3C7VA 3IF6B 3IF5A 4UHUA 2VA0A 4HQAA 1T18A 1F2KA 3HL9A 1GSWA 4IBRA 3BEBA 1IYPA 1PRQA 3NCKA 5CERA 5CTMA 1ES3A 3C8CA 4G3KA 4CLCB 3M6BA 3D3OA 4O7DA 4E3IA 3NOUC 1WYCA 5A90A 1XJ3A 3WS1A 1YLWA 5DTTA 3FKWA 2WGIA 3IT9A 3GDIA 3NIAA 1N9OA 4Q0HA 2M7VA 2A24A 3Q1FA 3MS6A 1TS7A 5GLAA 5DKLA 4KZAA 2ZC5B 4OP5A 2O9AA 4QY5A 5EVLA 1VEUA 2XSSA 4DE2A 3V3SA 2VEAA 4HHDA 3FYZA 2OOLA 3BY9A 4KZ8A 4HJ6A 2W3HA 4S2OA 4QU3A 1SZVA 3VMAA 3F1OA 3IH8A 1L0GA 4DE1A 1NYMA 1PWCA 4GDBA 4JGPA 3NDGA 2KX6A 2PD7A 4YOFA 3V3RA 1BLSA 2H5SA 2JHEA 4MN7A 4UA9A 1GSVA 3FG8A 3S7NA 2J80A 1K56D 1PFLA 3HLEA 3VP3A 3H7WA 1XA1A 3BYDA 3K2NA 2J9PA 4K08A 3ZVWA 4GHIA 2K7SA 1Y28A 3LFVA 3PYPA 4JF4A 3LR5A 2ZC4B 4OQGA 2C5WB 2W3EA 5HW3A 3CAXA 2P9VB 1N4OA 3E4QA 4C3QA 5EVIB 3RTYA 1J3WA 2PYRA
chains in the Genus database with same CATH topology
1ESUA 2DRWA 1EI5A 1DY6A 2VGKA 3CJMA 3G31A 3CG5A 1ZG4A 4XUXA 2C6WB 3N4IA 4OPYA 4ZJ1A 3SH8A 1KE0A 1BULA 2XK1A 4QHCA 1PYYA 5FQMA 3Q81A 4S2KA 3UPPA 1DJBA 4NETA 2H0YA 5CHMA 5HAQA 4WYYA 5G18A 1MKIA 3M2KA 1LL5A 3M2JA 3UNWA 2HP5A 1FR1A 4EQIA 3AGEA 3LO7A 4OOLA 1ZC2A 4E3NA 4OH0A 2R9XA 2WGVA 3FV7A 3UPOA 3HLBA 3BFDA 2ZQ8A 2H10A 3JYIA 2Y2HA 3FWLA 4JF5A 3ZHHA 5M18A 3IWQA 4R0QA 3W8KA 1W5DA 1E25A 1U60A 5GHZA 4A5RA 1QMEA 4F94A 4GKUA 3NY4A 4IEDA 3M6HA 1CI9A 3WRTA 4BD0A 5FDHA 2OV5A 3Q07A 1XXMA 2WGWB 2OLVA 4CJNA 5EE8A 2RCXA 1VM1A 1KGGA 2XQZA 3IWOA 4B4XA 1FCNA 5F82A 3PBSA 3A3DA 3AGDA 3MXRA 1NXYA 3ZG8B 5FAQA 3NI9A 3O87A 5DTSA 3RXXA 4IVIA 5HL1A 1PI5A 1K54C 1LI9A 4ZDXA 1SKFA 3OC2A 3ZCZA 3PTEA 1IKGA 1Z6FA 1LL9A 1XGJA 1K56A 5DF9A 5FA7A 5I94A 1I5QA 1W7FA 4OQ0A 2X02A 1SDNA 4E6XA 2WZZA 4ID4A 2EX9A 3ZG7B 4S2PA 1NJ4A 4MNRA 2UWXA 2HDUA 3A3JA 1N9BA 5EOOA 3IXHA 4PM5A 1HZOA 3MZFA 2DNSA 2EFUA 1GA0A 2WZXA 2XGNA 1PW1A 1WE4A 4KZ9A 1K54A 4GZBA 1GCEA 4OVDA 4N1XA 2GDNA 4OPZA 1I2SA 1MWSA 4HBUA 4GB7A 4KG5A 2WAFA 4Y0UA 3UE3A 4EBNA 5CGXA 2J8YA 4DE3A 1KE3A 2Z2LB 3O88A 1G6AA 3IXBA 4LCLA 4WMCD 3W4PA 5EUAA 5EECA 5KSCA 4X69A 3WS0A 4OKPA 2WADA 1K57C 2ZQAA 3IF6C 4KZ5A 2A49A 3C5AA 2PU2A 2PBYA 3VP2A 1RCJA 5CHUA 4KZBA 1XX2A 5U47A 4P87A 5EOEA 4UA6A 5E2HA 4DDYA 1S6RA 3HVFA 4ZBEA 4HESA 4RX3A 2CC1A 2Y2MA 4U0TA 3UDFA 5TR7A 2QMIA 4EBPA 3I7JA 3ZGAB 1K25A 2XFSA 4K0WA 2JE5A 5HAIA 1Q2QA 3ZG5A 3FZCA 4KENB 2EFXA 4JXVA 3Q7VA 2ZQCA 2XF3A 1ZKJA 1K57A 3IF6A 2XDMA 4QJGA 5CRFA 3HLGA 1PWGA 4WZ4A 5KZHA 3V50A 2J7VA 1BSGA 1VQQA 4KQRA 2HP9A 3G4PA 3GV9A 5IHVA 3LY3A 3UE0A 1NY0A 2H0TA 2HP6A 4GNUA 2FFYA 3WWXA 2JBFA 4B4ZA 2RL3A 3UDXA 4YINA 1LHYA 1BTLA 1KDWA 2XH9A 1DJCA 4X55A 2EX8A 5FQIA 3UO9A 2WK0A 4EV4A 2ZQ9A 1JWZA 4L0LA 4HBTA 1I2WA 3OPHA 4NK3A 1YMSA 4OQHA 3UE1A 4JKTA 3N7WA 4S2LA 3ZVTA 3BFEA 2XD1A 4DE0A 3SH9A 4EWFA 1M6KA 4GOGA 3ZG9B 1YMXA 2PU4A 3QNCA 2HDSA 4IBXA 4OP8A 5HARA 4R23A 1YQSA 2ZM0A 5AQ9A 4Y7PA 3VFFA 3DWKA 1RGZA 3RXWA 4MLLA 4DXBA 4KQQA 3HUMA 3O86A 5FSRA 2EX2A 1PZOA 3S22A 5M1AA 2ZC3B 1YT4A 4FCFA 1KGFA 1FOFA 4OQIA 2Z2MB 2G2UA 3BLMA 4RA7A 3N8SA 1H8ZA 3IXDA 2ZM2A 4KG2A 5FQKA 4GD6A 4IVKA 4JLFA 5EVID 4E3JA 3PBNA 1KDSA 4LV3A 4E3KA 4HEFA 1ES2A 4D2OA 1ONHA 1WYBA 2FFFB 4N9KA 3TSGA 3BLSA 3HREA 4PM9A 3A3FA 4E3MA 4WMCA 1GA9A 3BRMA 2WKHA 3W4QA 4WEJA 3V39A 2JC7A 3GQZA 1BLCA 1GHPA 2Y59A 4GDNA 1KE4A 2Y4AA 5FASA 1W8QA 2Y2NA 4N92A 3MBZA 3TOIA 4MBKA 4OLGA 3O3VA 1MY8A 4KZ4A 3S4XA 2V2FF 4ZTKA 4WEKA 1GHIA 5D3OA 5AQAA 4KZ6A 5FAPA 5A91A 3DWZA 3ZDJA 4S2JA 2P74A 2XLNA 1MWRA 3GMWA 2VGJA 5AQBA 5FI6A 3S1YA 4PM7A 1PWDA 1FSWA 1MWTA 3CZDA 2ZQ7A 2XFTA 1L2SA 1LLBA 1XA7A 4KZ7A 4LCMA 4P85A 4R4RA 3WRZA 4X53A 5TFQA 5BOHA 4BLMA 4LENA 3FKVA 4BL2A 1K4EA 4FH2A 2WYXA 3W4OA 3OPPA 5GLBA 5HX9A 3PBTA 2EX6A 3QNBA 5FQJA 1TVFA 2E8IA 5FI2A 1TDLA 5CHJA 2Y2PA 3GRJA 2ZQDA 4K91A 1OMEA 1NRFA 3LEZA 3AGFA 3QHYA 4BD1A 2I72A 2OLUA 5DVAA 3WS2A 1GHMA 3E2KA 3PBOA 4OPRA 3ZFZA 2QZ6A 1ALQA 3G2ZA 1K55C 1QMFA 1W8YA 4MBHA 1ES4A 4X56A 5EVIC 4DKIA 1MXOA 3HUNA 3UN7A 3HBRA 1XP4A 4C75A 5CECA 3VFHA 1FCOA 1ZG6A 4YFMA 2IWCA 3CMZA 1NYYA 3VOZA 4S2IA 4M3KA 4XXRA 2P9VA 2Y2JA 1K6RA 2IWBA 3NC8A 1K38A 2Y55A 1FR6A 3VSKA 2DCFA 2WKEA 5HAPA 5KMWA 1K55A 3B3XA 5GLCA 5CGSA 5EVIA 1YLJA 2WAEA 3BFFA 3ZG0A 4R1GA 2A3UA 4JXSA 2XD5A 3V5MA 1E3UD 1KGEA 4DXCA 5M19A 4FH4A 4JF6A 5GHYA 3UY6A 2WUQA 5DF8A 4R3JA 1ES5A 5CEBA 3VOYA 4QD4A 1EROA 2XEPA 4JPMA 3BECA 3HLCA 3PAGA 4N1HA 2ZM8A 5FI7A 4P6BA 1M40A 1AXBA 3A3EA 1FQGA 3BFCA 1JWPA 4OLDA 5FATA 3N8RA 4R3BA 3G35A 2Y2IA 4R4SA 3PAEA 1ERMA 4FD8A 2J9OA 3GSGA 4WELA 5KSHA 1XGIA 3WS4A 5CTNA 3UPNA 1JTGA 3ITBA 3MZEA 4UAAA 1L0FA 4DF6A 4JBFA 1MWUA 2Y2LA 1CK3A 3MZDA 4WZ5C 2XR0A 1SHVA 3G2YA 4Y0OA 2JCHA 4K0XA 4PPRA 2X71A 5J8XA 1XPBA 2WGWA 4RVAA 3TG9A 3SS5A 5E2EA 4OPQA 1RGYA 5DTKA 3IH9A 1BT5A 3IWIA 5A92A 2R9WA 3SS3A 2EXAA 4LV0A 1IEMA 1MBLA 4RYEA 3VP1A 3EQUA 5CEDA 1HD8A 4X68A 4DDSA 5E43A 3N6IA 3BFGA 1ERQA 3LCEA 4LV1A 4DRTA 3Q7VB 1W79A 1XKZA 3HLDA 4WZ5A 3RJUA 1NZOA 3D4FA 5E2GA 3C7VA 3IF6B 3IF5A 3OCLA 4UHUA 1PZPA 1JTDA 3OPLA 1YM1A 3NDEA 4FSFA 3HL9A 2X01A 3UDIA 2OSUA 1CEFA 3PBQA 4MEZA 3LY4A 4IBRA 3N8LA 5HFOA 3G30A 3BEBA 4ZJ3A 4Q8IA 2B5RA 1IYPA 1S0WA 2G2WA 3NCKA 5CERA 3IQAA 1RP5A 2Q9NA 1JWVA 5CTMA 4PM8A 1ESIA 1ES3A 4BJPA 4JXGA 1Y54A 3M6BA 4CPKA 1O7EA 5A93A 4O7DA 5F83A 4E3IA 3BM6A 1WYCA 4BL3A 3DTMA 3OPRA 5A90A 3SH7A 4PM6A 5TGFA 4MBFA 4OONA 3WS1A 5FAOA 5GHXA 1YLWA 5DTTA 4GN2A 3FKWA 4BENA 1E3UA 4E6WA 4E3LA 5JYPA 2ZC6B 3MFDA 2WGIA 3IT9A 3SOIA 1BLHA 4U3TA 3NIAA 3IHBA 3ITAA 4S2MA 3GVBA 1SCWA 1PIOA 3C7UA 4PMAA 3Q1FA 3ZNYA 4WM9A 1K4FA 3VP4A 1KVMA 1YLZA 2Y2QA 2ZC7A 4ZAMA 1PI4A 5GLAA 4E3OA 1YLPA 1PW8A 3C4OA 5CXWA 2HDRA 4KG6A 2ZC5B 4KZAA 2WKIA 4OP5A 1IKIA 1G68A 2Y2KA 3HUOA 3WS5A 3IHAA 4ZJ2A 2V20A 2Y2GA 3GTCA 5GLDA 3A3IA 1H5XA 4QY5A 4QY6A 5EVLA 2BG1A 1NZUA 3Q82A 3OCNA 4DE2A 2Q9MA 3V3SA 3EQVA 1ONGA 5CGWA 3SS4A 3FYZA 5L2FA 4OOMA 1Q2PA 2ZLYA 3VSLA 4KZ8A 1FCMA 4U0XA 4OOYA 1YLYA 2Y2OA 3PBRA 2V1ZA 3ZNTA 1CI8A 5AQ7A 4S2OA 3MKFA 2QPNA 4QU3A 1DJAA 1LI0A 3G32A 4KQOA 5DF7A 1FSYA 3MKEA 3VMAA 3IH8A 5FQ9A 1L0GA 2BLSA 4DE1A 1BUEA 1NYMA 1TEMA 4GD8A 4EUZA 1PWCA 5JYOA 1KVLA 4GDBA 3NDGA 4WBGA 4P0MA 2EXBA 4Y0TA 3V3RA 4XUZA 2HDQA 3HLWA 3GR2A 1SDEA 1BLSA 2H5SA 3OZHA 3MXSA 3P98A 4KZ3A 1H8YA 2ZD8A 4JXWA 4UA7A 4UA9A 4QB8A 5EPHA 1E4DA 1EWZA 3E2LA 1J9MA 5F1FA 3G34A 4BQMA 1C3BA 1K56D 5GL9A 4B88A 1BZAA 3HLEA 1BLPA 5F1GA 3VP3A 1XA1A 3BYDA 2J9PA 3ZVWA 4LV2A 1IELA 4EBLA 4S2NC 5FQQA 3ISGA 2IWDA 3Q7ZA 1HVBA 4Z9QA 1IYSA 1CEGA 3NBLA 2HPBA 4X6TA 4H8RA 4JF4A 4RX2A 1IYOA 1IYQA 1O07A 5E2FA 1MPLA 2ZC4B 4OQGA 2C5WB 5HW3A 2ZJ9A 2P9VB 1JVJA 1N4OA 2Y91A 3IXGA 3P09A 2ZMAA 3HLFA 3VP0A 4C3QA 1HTZA 5EVIB 1K6SA 4C6YA 4N9LA 1L0EA 3DW0A 3C4PA 4S2NA 1TDGA 1YLTA 1L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESU A;  2DRW A;  1EI5 A;  1DY6 A;  2VGK A;  3CJM A;  3G31 A;  3CG5 A;  1ZG4 A;  4XUX A;  2C6W B;  3N4I A;  4OPY A;  4ZJ1 A;  3SH8 A;  1KE0 A;  1BUL A;  2XK1 A;  4QHC A;  1PYY A;  5FQM A;  3Q81 A;  4S2K A;  3UPP A;  1DJB A;  4NET A;  2H0Y A;  5CHM A;  5HAQ A;  4WYY A;  5G18 A;  1MKI A;  3M2K A;  1LL5 A;  3M2J A;  3UNW A;  2HP5 A;  1FR1 A;  4EQI A;  3AGE A;  3LO7 A;  4OOL A;  1ZC2 A;  4E3N A;  4OH0 A;  2R9X A;  2WGV A;  3FV7 A;  3UPO A;  3HLB A;  3BFD A;  2ZQ8 A;  2H10 A;  3JYI A;  2Y2H A;  3FWL A;  4JF5 A;  3ZHH A;  5M18 A;  3IWQ A;  4R0Q A;  3W8K A;  1W5D A;  1E25 A;  1U60 A;  5GHZ A;  4A5R A;  1QME A;  4F94 A;  4GKU A;  3NY4 A;  4IED A;  3M6H A;  1CI9 A;  3WRT A;  4BD0 A;  5FDH A;  2OV5 A;  3Q07 A;  1XXM A;  2WGW B;  2OLV A;  4CJN A;  5EE8 A;  2RCX A;  1VM1 A;  1KGG A;  2XQZ A;  3IWO A;  4B4X A;  1FCN A;  5F82 A;  3PBS A;  3A3D A;  3AGD A;  3MXR A;  1NXY A;  3ZG8 B;  5FAQ A;  3NI9 A;  3O87 A;  5DTS A;  3RXX A;  4IVI A;  5HL1 A;  1PI5 A;  1K54 C;  1LI9 A;  4ZDX A;  1SKF A;  3OC2 A;  3ZCZ A;  3PTE A;  1IKG A;  1Z6F A;  1LL9 A;  1XGJ A;  1K56 A;  5DF9 A;  5FA7 A;  5I94 A;  1I5Q A;  1W7F A;  4OQ0 A;  2X02 A;  1SDN A;  4E6X A;  2WZZ A;  4ID4 A;  2EX9 A;  3ZG7 B;  4S2P A;  1NJ4 A;  4MNR A;  2UWX A;  2HDU A;  3A3J A;  1N9B A;  5EOO A;  3IXH A;  4PM5 A;  1HZO A;  3MZF A;  2DNS A;  2EFU A;  1GA0 A;  2WZX A;  2XGN A;  1PW1 A;  1WE4 A;  4KZ9 A;  1K54 A;  4GZB A;  1GCE A;  4OVD A;  4N1X A;  2GDN A;  4OPZ A;  1I2S A;  1MWS A;  4HBU A;  4GB7 A;  4KG5 A;  2WAF A;  4Y0U A;  3UE3 A;  4EBN A;  5CGX A;  2J8Y A;  4DE3 A;  1KE3 A;  2Z2L B;  3O88 A;  1G6A A;  3IXB A;  4LCL A;  4WMC D;  3W4P A;  5EUA A;  5EEC A;  5KSC A;  4X69 A;  3WS0 A;  4OKP A;  2WAD A;  1K57 C;  2ZQA A;  3IF6 C;  4KZ5 A;  2A49 A;  3C5A A;  2PU2 A;  2PBY A;  3VP2 A;  1RCJ A;  5CHU A;  4KZB A;  1XX2 A;  5U47 A;  4P87 A;  5EOE A;  4UA6 A;  5E2H A;  4DDY A;  1S6R A;  3HVF A;  4ZBE A;  4HES A;  4RX3 A;  2CC1 A;  2Y2M A;  4U0T A;  3UDF A;  5TR7 A;  2QMI A;  4EBP A;  3I7J A;  3ZGA B;  1K25 A;  2XFS A;  4K0W A;  2JE5 A;  5HAI A;  1Q2Q A;  3ZG5 A;  3FZC A;  4KEN B;  2EFX A;  4JXV A;  3Q7V A;  2ZQC A;  2XF3 A;  1ZKJ A;  1K57 A;  3IF6 A;  2XDM A;  4QJG A;  5CRF A;  3HLG A;  1PWG A;  4WZ4 A;  5KZH A;  3V50 A;  2J7V A;  1BSG A;  1VQQ A;  4KQR A;  2HP9 A;  3G4P A;  3GV9 A;  5IHV A;  3LY3 A;  3UE0 A;  1NY0 A;  2H0T A;  2HP6 A;  4GNU A;  2FFY A;  3WWX A;  2JBF A;  4B4Z A;  2RL3 A;  3UDX A;  4YIN A;  1LHY A;  1BTL A;  1KDW A;  2XH9 A;  1DJC A;  4X55 A;  2EX8 A;  5FQI A;  3UO9 A;  2WK0 A;  4EV4 A;  2ZQ9 A;  1JWZ A;  4L0L A;  4HBT A;  1I2W A;  3OPH A;  4NK3 A;  1YMS A;  4OQH A;  3UE1 A;  4JKT A;  3N7W A;  4S2L A;  3ZVT A;  3BFE A;  2XD1 A;  4DE0 A;  3SH9 A;  4EWF A;  1M6K A;  4GOG A;  3ZG9 B;  1YMX A;  2PU4 A;  3QNC A;  2HDS A;  4IBX A;  4OP8 A;  5HAR A;  4R23 A;  1YQS A;  2ZM0 A;  5AQ9 A;  4Y7P A;  3VFF A;  3DWK A;  1RGZ A;  3RXW A;  4MLL A;  4DXB A;  4KQQ A;  3HUM A;  3O86 A;  5FSR A;  2EX2 A;  1PZO A;  3S22 A;  5M1A A;  2ZC3 B;  1YT4 A;  4FCF A;  1KGF A;  1FOF A;  4OQI A;  2Z2M B;  2G2U A;  3BLM A;  4RA7 A;  3N8S A;  1H8Z A;  3IXD A;  2ZM2 A;  4KG2 A;  5FQK A;  4GD6 A;  4IVK A;  4JLF A;  5EVI D;  4E3J A;  3PBN A;  1KDS A;  4LV3 A;  4E3K A;  4HEF A;  1ES2 A;  4D2O A;  1ONH A;  1WYB A;  2FFF B;  4N9K A;  3TSG A;  3BLS A;  3HRE A;  4PM9 A;  3A3F A;  4E3M A;  4WMC A;  1GA9 A;  3BRM A;  2WKH A;  3W4Q A;  4WEJ A;  3V39 A;  2JC7 A;  3GQZ A;  1BLC A;  1GHP A;  2Y59 A;  4GDN A;  1KE4 A;  2Y4A A;  5FAS A;  1W8Q A;  2Y2N A;  4N92 A;  3MBZ A;  3TOI A;  4MBK A;  4OLG A;  3O3V A;  1MY8 A;  4KZ4 A;  3S4X A;  2V2F F;  4ZTK A;  4WEK A;  1GHI A;  5D3O A;  5AQA A;  4KZ6 A;  5FAP A;  5A91 A;  3DWZ A;  3ZDJ A;  4S2J A;  2P74 A;  2XLN A;  1MWR A;  3GMW A;  2VGJ A;  5AQB A;  5FI6 A;  3S1Y A;  4PM7 A;  1PWD A;  1FSW A;  1MWT A;  3CZD A;  2ZQ7 A;  2XFT A;  1L2S A;  1LLB A;  1XA7 A;  4KZ7 A;  4LCM A;  4P85 A;  4R4R A;  3WRZ A;  4X53 A;  5TFQ A;  5BOH A;  4BLM A;  4LEN A;  3FKV A;  4BL2 A;  1K4E A;  4FH2 A;  2WYX A;  3W4O A;  3OPP A;  5GLB A;  5HX9 A;  3PBT A;  2EX6 A;  3QNB A;  5FQJ A;  1TVF A;  2E8I A;  5FI2 A;  1TDL A;  5CHJ A;  2Y2P A;  3GRJ A;  2ZQD A;  4K91 A;  1OME A;  1NRF A;  3LEZ A;  3AGF A;  3QHY A;  4BD1 A;  2I72 A;  2OLU A;  5DVA A;  3WS2 A;  1GHM A;  3E2K A;  3PBO A;  4OPR A;  3ZFZ A;  2QZ6 A;  1ALQ A;  3G2Z A;  1K55 C;  1QMF A;  1W8Y A;  4MBH A;  1ES4 A;  4X56 A;  5EVI C;  4DKI A;  1MXO A;  3HUN A;  3UN7 A;  3HBR A;  1XP4 A;  4C75 A;  5CEC A;  3VFH A;  1FCO A;  1ZG6 A;  4YFM A;  2IWC A;  3CMZ A;  1NYY A;  3VOZ A;  4S2I A;  4M3K A;  4XXR A;  2P9V A;  2Y2J A;  1K6R A;  2IWB A;  3NC8 A;  1K38 A;  2Y55 A;  1FR6 A;  3VSK A;  2DCF A;  2WKE A;  5HAP A;  5KMW A;  1K55 A;  3B3X A;  5GLC A;  5CGS A;  5EVI A;  1YLJ A;  2WAE A;  3BFF A;  3ZG0 A;  4R1G A;  2A3U A;  4JXS A;  2XD5 A;  3V5M A;  1E3U D;  1KGE A;  4DXC A;  5M19 A;  4FH4 A;  4JF6 A;  5GHY A;  3UY6 A;  2WUQ A;  5DF8 A;  4R3J A;  1ES5 A;  5CEB A;  3VOY A;  4QD4 A;  1ERO A;  2XEP A;  4JPM A;  3BEC A;  3HLC A;  3PAG A;  4N1H A;  2ZM8 A;  5FI7 A;  4P6B A;  1M40 A;  1AXB A;  3A3E A;  1FQG A;  3BFC A;  1JWP A;  4OLD A;  5FAT A;  3N8R A;  4R3B A;  3G35 A;  2Y2I A;  4R4S A;  3PAE A;  1ERM A;  4FD8 A;  2J9O A;  3GSG A;  4WEL A;  5KSH A;  1XGI A;  3WS4 A;  5CTN A;  3UPN A;  1JTG A;  3ITB A;  3MZE A;  4UAA A;  1L0F A;  4DF6 A;  4JBF A;  1MWU A;  2Y2L A;  1CK3 A;  3MZD A;  4WZ5 C;  2XR0 A;  1SHV A;  3G2Y A;  4Y0O A;  2JCH A;  4K0X A;  4PPR A;  2X71 A;  5J8X A;  1XPB A;  2WGW A;  4RVA A;  3TG9 A;  3SS5 A;  5E2E A;  4OPQ A;  1RGY A;  5DTK A;  3IH9 A;  1BT5 A;  3IWI A;  5A92 A;  2R9W A;  3SS3 A;  2EXA A;  4LV0 A;  1IEM A;  1MBL A;  4RYE A;  3VP1 A;  3EQU A;  5CED A;  1HD8 A;  4X68 A;  4DDS A;  5E43 A;  3N6I A;  3BFG A;  1ERQ A;  3LCE A;  4LV1 A;  4DRT A;  3Q7V B;  1W79 A;  1XKZ A;  3HLD A;  4WZ5 A;  3RJU A;  1NZO A;  3D4F A;  5E2G A;  3C7V A;  3IF6 B;  3IF5 A;  3OCL A;  4UHU A;  1PZP A;  1JTD A;  3OPL A;  1YM1 A;  3NDE A;  4FSF A;  3HL9 A;  2X01 A;  3UDI A;  2OSU A;  1CEF A;  3PBQ A;  4MEZ A;  3LY4 A;  4IBR A;  3N8L A;  5HFO A;  3G30 A;  3BEB A;  4ZJ3 A;  4Q8I A;  2B5R A;  1IYP A;  1S0W A;  2G2W A;  3NCK A;  5CER A;  3IQA A;  1RP5 A;  2Q9N A;  1JWV A;  5CTM A;  4PM8 A;  1ESI A;  1ES3 A;  4BJP A;  4JXG A;  1Y54 A;  3M6B A;  4CPK A;  1O7E A;  5A93 A;  4O7D A;  5F83 A;  4E3I A;  3BM6 A;  1WYC A;  4BL3 A;  3DTM A;  3OPR A;  5A90 A;  3SH7 A;  4PM6 A;  5TGF A;  4MBF A;  4OON A;  3WS1 A;  5FAO A;  5GHX A;  1YLW A;  5DTT A;  4GN2 A;  3FKW A;  4BEN A;  1E3U A;  4E6W A;  4E3L A;  5JYP A;  2ZC6 B;  3MFD A;  2WGI A;  3IT9 A;  3SOI A;  1BLH A;  4U3T A;  3NIA A;  3IHB A;  3ITA A;  4S2M A;  3GVB A;  1SCW A;  1PIO A;  3C7U A;  4PMA A;  3Q1F A;  3ZNY A;  4WM9 A;  1K4F A;  3VP4 A;  1KVM A;  1YLZ A;  2Y2Q A;  2ZC7 A;  4ZAM A;  1PI4 A;  5GLA A;  4E3O A;  1YLP A;  1PW8 A;  3C4O A;  5CXW A;  2HDR A;  4KG6 A;  2ZC5 B;  4KZA A;  2WKI A;  4OP5 A;  1IKI A;  1G68 A;  2Y2K A;  3HUO A;  3WS5 A;  3IHA A;  4ZJ2 A;  2V20 A;  2Y2G A;  3GTC A;  5GLD A;  3A3I A;  1H5X A;  4QY5 A;  4QY6 A;  5EVL A;  2BG1 A;  1NZU A;  3Q82 A;  3OCN A;  4DE2 A;  2Q9M A;  3V3S A;  3EQV A;  1ONG A;  5CGW A;  3SS4 A;  3FYZ A;  5L2F A;  4OOM A;  1Q2P A;  2ZLY A;  3VSL A;  4KZ8 A;  1FCM A;  4U0X A;  4OOY A;  1YLY A;  2Y2O A;  3PBR A;  2V1Z A;  3ZNT A;  1CI8 A;  5AQ7 A;  4S2O A;  3MKF A;  2QPN A;  4QU3 A;  1DJA A;  1LI0 A;  3G32 A;  4KQO A;  5DF7 A;  1FSY A;  3MKE A;  3VMA A;  3IH8 A;  5FQ9 A;  1L0G A;  2BLS A;  4DE1 A;  1BUE A;  1NYM A;  1TEM A;  4GD8 A;  4EUZ A;  1PWC A;  5JYO A;  1KVL A;  4GDB A;  3NDG A;  4WBG A;  4P0M A;  2EXB A;  4Y0T A;  3V3R A;  4XUZ A;  2HDQ A;  3HLW A;  3GR2 A;  1SDE A;  1BLS A;  2H5S A;  3OZH A;  3MXS A;  3P98 A;  4KZ3 A;  1H8Y A;  2ZD8 A;  4JXW A;  4UA7 A;  4UA9 A;  4QB8 A;  5EPH A;  1E4D A;  1EWZ A;  3E2L A;  1J9M A;  5F1F A;  3G34 A;  4BQM A;  1C3B A;  1K56 D;  5GL9 A;  4B88 A;  1BZA A;  3HLE A;  1BLP A;  5F1G A;  3VP3 A;  1XA1 A;  3BYD A;  2J9P A;  3ZVW A;  4LV2 A;  1IEL A;  4EBL A;  4S2N C;  5FQQ A;  3ISG A;  2IWD A;  3Q7Z A;  1HVB A;  4Z9Q A;  1IYS A;  1CEG A;  3NBL A;  2HPB A;  4X6T A;  4H8R A;  4JF4 A;  4RX2 A;  1IYO A;  1IYQ A;  1O07 A;  5E2F A;  1MPL A;  2ZC4 B;  4OQG A;  2C5W B;  5HW3 A;  2ZJ9 A;  2P9V B;  1JVJ A;  1N4O A;  2Y91 A;  3IXG A;  3P09 A;  2ZMA A;  3HLF A;  3VP0 A;  4C3Q A;  1HTZ A;  5EVI B;  1K6S A;  4C6Y A;  4N9L A;  1L0E A;  3DW0 A;  3C4P A;  4S2N A;  1TDG A;  1YLT A;  1L0D A; 
#chains in the Genus database with same CATH topology
 2DRW A;  1EI5 A;  1ZG4 A;  3BQA A;  4LFU A;  1BUL A;  3V67 A;  4WLA A;  4QHC A;  1PYY A;  4D60 A;  2LB9 A;  2PBD P;  3Q81 A;  1VHM A;  4NET A;  4LLO B;  2W1T A;  2ZBB A;  3M2K A;  1LL5 A;  3M2J A;  2HP5 A;  3MR0 A;  3AGE A;  3LO7 A;  1LSW A;  5HDD A;  3BFD A;  4I3J A;  3ZHH A;  4IHQ A;  4R0Q A;  1W5D A;  1E25 A;  2GX5 A;  4MDZ A;  1QME A;  4F94 A;  3M6H A;  3IS2 A;  3Q07 A;  1XXM A;  4CJN A;  2V8C A;  4H6J A;  3PBS A;  3FPV A;  3A3D A;  5HL1 A;  4MCW A;  1IKG A;  1MZU A;  4E6X A;  3TJZ C;  5G4Z A;  2EX9 A;  4S2P A;  3KYQ A;  1NJ4 A;  2UWX A;  1N9B A;  5L8M A;  4PAU A;  1HZO A;  4LRY C;  2DNS A;  2EFU A;  2XGN A;  2KOI A;  5HDS A;  4OVD A;  4N1X A;  3KSH A;  4OPZ A;  1I2S A;  1MWS A;  4GB7 A;  2YKH A;  3UE3 A;  4M4X A;  4DE3 A;  2Z2L B;  3W4P A;  5EUA A;  2W0N A;  2PBY A;  3VP2 A;  5CHU A;  4DJ2 A;  3CI6 A;  4P87 A;  2VGL S;  2A24 B;  2ZL1 A;  5E2H A;  4GLQ A;  3HVF A;  4ZBE A;  4U0T A;  5J7E A;  3ZGA B;  2JE5 A;  5HD5 A;  3T1Q B;  3NUL A;  2EFX A;  1HLU P;  3HLG A;  5L07 A;  1PWG A;  1VEU B;  3OLO A;  2J7V A;  1BSG A;  3UB9 A;  3G4P A;  5F5Y A;  1G28 A;  3LY3 A;  4WN5 A;  2HP6 A;  4GNU A;  2W1R A;  4YIN A;  1BTL A;  1KDW A;  4X55 A;  2WK0 A;  4NK3 A;  4RQ9 A;  4OQH A;  4S2L A;  3ZVT A;  4DE0 A;  1M6K A;  3F1O B;  4GOG A;  4IBX A;  5HAR A;  2HDS A;  5AQ9 A;  5DFX A;  2O9B A;  4ESP A;  3QP4 A;  5DFY A;  4FCF A;  1KGF A;  1FOF A;  4OQI A;  2Z2M B;  4ETZ A;  3BLM A;  3T4O A;  4X1L A;  1H8Z A;  3PBN A;  1KDS A;  1ZHH B;  2VZW A;  4E3K A;  1NLY A;  3TSG A;  3JVV A;  3H7W B;  4WMC A;  3BRM A;  4GHI B;  4HH2 A;  1FIL A;  1GHP A;  4GDN A;  1KE4 A;  3IX8 A;  3LI8 A;  2Y2N A;  4N92 A;  2E8J A;  4F3L A;  5D3O A;  4KZ6 A;  3T4T A;  1FSW A;  1MWT A;  4KZ7 A;  1XA7 A;  4BLM A;  1K4E A;  5J4E A;  2EWV A;  1Z09 A;  2EX6 A;  3QNB A;  2W1T B;  1T1B A;  2Y2P A;  1OME A;  3AGF A;  3E2K A;  1K55 C;  1QMF A;  3KX0 X;  4X56 A;  3HUN A;  3UN7 A;  3HBR A;  5CEC A;  2A2L A;  3VFH A;  3IS2 B;  3T50 A;  3CMZ A;  1TS8 A;  3VOZ A;  3MXQ A;  4H6J B;  2QWS A;  4XXR A;  2Y2J A;  1K38 A;  2WKE A;  5KMW A;  1K55 A;  1T1C A;  3S7Q A;  2ZMV A;  4JXS A;  2PDR A;  1E3U D;  5L10 A;  1LSV A;  5AVF A;  4FH4 A;  3IBJ A;  1Y4O A;  2WUQ A;  1N9L A;  4EEU A;  5CEB A;  1H0M A;  4JPM A;  3CLO A;  2GJ3 A;  3HLC A;  1YPR A;  4Y5F A;  1IOU A;  1IFQ A;  4P6B A;  1M40 A;  1JWP A;  4OLD A;  1F9I A;  2V0U A;  3MZE A;  2ZOH A;  3LIC A;  4Q0J A;  1SHV A;  4Y0O A;  2JCH A;  4PPR A;  5J8X A;  1XPB A;  4RVA A;  2ZL1 B;  2CMN A;  1BT5 A;  3VP1 A;  1SKO A;  3EQU A;  4NEE D;  4DDS A;  5E43 A;  1OT9 A;  1ERQ A;  5EM0 A;  3FC7 A;  1VB6 A;  3OCL A;  1F98 A;  1P0Z A;  2XA7 S;  4FSF A;  1YM1 A;  4MEZ A;  3N8L A;  4NXB A;  4NXG A;  2VGL M;  2G2W A;  4R3A A;  1ESI A;  4JXG A;  4Y2F A;  4CLC E;  2YKF A;  4BL3 A;  3DTM A;  2VJW A;  3SH7 A;  5TGF A;  3T4J A;  4GS9 A;  1NWZ A;  5GHX A;  3LIA A;  2D01 A;  4E6W A;  3MFD A;  5HPI A;  1H3Q A;  3LID A;  3C7U A;  3ZNY A;  3E4O A;  2I9V A;  4WM9 A;  1KVM A;  2V9A A;  2VK3 A;  1S4R A;  1YLP A;  5C5K A;  4E3O A;  4ZRR A;  4R6L A;  3HUO A;  3IHA A;  2Y2G A;  4Z1W A;  5GLD A;  2HF6 A;  1H5X A;  3A3I A;  2BG1 A;  3Q82 A;  1FIK A;  2VV8 A;  3CIT A;  3EQV A;  5F68 A;  1ONG A;  1Q2P A;  2ZLY A;  3F1P A;  3VSL A;  1FCM A;  2JKG A;  3MFX A;  1YSP A;  4F3L B;  3PBR A;  3MKF A;  3G32 A;  4KQO A;  5DF7 A;  3MKE A;  1BUE A;  3T1S A;  3QP1 A;  5HD3 A;  1LSX A;  2ZMF A;  1ACF A;  3H9W A;  4DN0 A;  2HDQ A;  3HLW A;  3OZH A;  5EVE A;  5FDS A;  2ZD8 A;  2NUT C;  4UA7 A;  3E2L A;  1J9M A;  3DTI A;  5GL9 A;  1BZA A;  1BLP A;  3T4S A;  3VV4 A;  1IEL A;  4EBL A;  1IYS A;  1LT0 A;  4X6T A;  4H8R A;  4RX2 A;  1IYQ A;  4EUV A;  3EEA A;  4FUW A;  2ZJ9 A;  4EXO A;  3IXG A;  3HLF A;  3VP0 A;  4R38 A;  3NHQ A;  4C6Y A;  1D7E A;  1DP6 A;  1YLT A;  3CG5 A;  4XUX A;  4HP4 A;  4X25 A;  4S2K A;  3UPP A;  1DJB A;  2H0Y A;  5CHM A;  3DAV A;  2DMW A;  3UNW A;  1FR1 A;  1ZC2 A;  4G3W A;  2WGV A;  2J3T D;  4JF5 A;  3W8K A;  5GHZ A;  4A5R A;  4GKU A;  3NY4 A;  4IED A;  1CI9 A;  2OV5 A;  2OLV A;  1OTA A;  1TF1 A;  4YNR A;  1VM1 A;  1KGG A;  3LIB A;  2OAP 1;  1TD5 A;  4R70 A;  4CLC D;  1SKO B;  3MXR A;  1G6O A;  1NXY A;  1EW0 A;  3RXX A;  5DTS A;  1K54 C;  2W3F A;  2HV1 A;  2QJ7 A;  2XRO A;  5FA7 A;  1LL9 A;  1I5Q A;  1W7F A;  2X02 A;  1SDN A;  2HDU A;  3IXH A;  3MZF A;  4FTX A;  3UE6 A;  1OTI A;  1GA0 A;  1WE4 A;  1K54 A;  3ZYT A;  3OOV A;  2WAF A;  2XA7 M;  5CGX A;  3HJI A;  4GS9 B;  4OKP A;  4NXE A;  1S1Z A;  3IX4 A;  4WUJ A;  3TE8 A;  3NOP C;  4YWZ A;  3ZG5 A;  4O8G A;  1ZKJ A;  5FEF A;  5KZH A;  5A93 A;  1VQQ A;  3GV9 A;  3BQ8 A;  3UDX A;  3F1P B;  4MN6 A;  4CQH A;  4IUK A;  2P04 A;  1DJC A;  4I3I A;  1MKM A;  2ZQ9 A;  4L0L A;  2HJE A;  1YMS A;  2B18 A;  4JKT A;  4EWF A;  2PU4 A;  1YQS A;  2ZM0 A;  4DXB A;  4MLL A;  2EX2 A;  3RFB A;  3EOI A;  2JKT I;  4RA7 A;  3N8S A;  3IXD A;  3T1X A;  4KG2 A;  3B47 A;  4JLF A;  5EVI D;  1H8M A;  2ZOI A;  4LV3 A;  4HEF A;  1ONH A;  1WYB A;  2FFF B;  3BLS A;  3MF0 A;  4IJG A;  3HJK A;  5TJJ A;  4UEY A;  3DBA A;  3T1R A;  3V39 A;  2J3W A;  2JC7 A;  3GQZ A;  2PR5 A;  1W8Q A;  4OLG A;  3O3V A;  4KZ4 A;  3T4L A;  3S4X A;  4WEK A;  5FAP A;  5A91 A;  2P74 A;  5FI6 A;  2VGJ A;  3S1Y A;  1PWD A;  1L2S A;  4P85 A;  4R4R A;  5TFQ A;  5BOH A;  1AWI A;  4LEN A;  4BL2 A;  3OPP A;  5GLB A;  1OTD A;  4Y3I A;  5HX9 A;  1S4S A;  1TVF A;  2E8I A;  5FI2 A;  3QHY A;  3LEZ A;  4BD1 A;  2OLU A;  5DVA A;  1ALQ A;  3G2Z A;  1W8Y A;  4MBH A;  1ES4 A;  1YKD A;  1XP4 A;  3MMH A;  4C75 A;  1FCO A;  1ZG6 A;  4YFM A;  2V0W A;  1V9Y A;  3KSI A;  3LI9 A;  3UME A;  2K31 A;  3MQQ A;  1K6R A;  2JKR I;  3NC8 A;  1OJ5 A;  1OJG A;  3ZG0 A;  5AVE A;  5LBR A;  3U2A A;  1KGE A;  4QPR A;  4DXC A;  5M19 A;  4JF6 A;  2OAQ 1;  3UB8 A;  5DF8 A;  1ERO A;  1G5U A;  4N1H A;  2INW A;  2ZM8 A;  3VE4 A;  5FAT A;  3A3E A;  3N8R A;  3QP5 A;  2Y2I A;  1L3L A;  4R4S A;  1XGI A;  3WS4 A;  5CTN A;  1JTG A;  3KYE A;  5HWW A;  2KLI A;  4JBF A;  2Y2L A;  1CK3 A;  3MZD A;  2XR0 A;  2M1C A;  4HJ3 A;  1VET A;  3G2Y A;  4K0X A;  2X71 A;  2WGW A;  5EM1 A;  3IH9 A;  3SS3 A;  1IEM A;  4X68 A;  3LCE A;  4DRT A;  2PR6 A;  2L4R A;  3D4F A;  4Y17 A;  1JTD A;  2X01 A;  3PBQ A;  1UWN X;  2B02 A;  4Q8I A;  1K0K A;  1S0W A;  3IQA A;  1ZTU A;  1Y54 A;  1O7E A;  4LRZ E;  3OPR A;  4HI4 A;  4PM6 A;  4OON A;  4GN2 A;  5JYP A;  4MN5 A;  4E3L A;  2ZC6 B;  3SOI A;  1BLH A;  4U3T A;  3IHB A;  3ITA A;  3F1N A;  4S2M A;  1PNE A;  3D72 A;  1SCW A;  1PIO A;  4PMA A;  2AVX A;  5HL6 A;  1K4F A;  3VP4 A;  2ZC7 A;  3R4K A;  1PI4 A;  2BTF P;  1PW8 A;  3C4O A;  5CXW A;  2HDR A;  3SW1 A;  2WKI A;  1IKI A;  4QWO A;  4HNB A;  2V20 A;  1MC0 A;  1NZU A;  3OCN A;  2M7U A;  2Q9M A;  2QYB A;  5CGW A;  2JKR M;  5HWT A;  4U0X A;  1YLY A;  2V1Z A;  1CI8 A;  5AQ7 A;  1DJA A;  4EUZ A;  4GD8 A;  1TEM A;  5JYO A;  1KVL A;  4WBG A;  2EXB A;  4O0P A;  4HJ4 A;  5HDC A;  3MXS A;  3P98 A;  4KZ3 A;  3HCY A;  2FZ0 A;  4ME4 A;  4JGR A;  1E4D A;  3K3C A;  1EWZ A;  1YSQ A;  4L9E A;  3CWF A;  4LV2 A;  3R7W A;  5FQQ A;  3Q7Z A;  1HVB A;  4Z9Q A;  3E4P A;  2Z6D A;  5J3W A;  5E2F A;  1MPL A;  4JGO A;  1TS6 A;  1JVJ A;  2WKR A;  2ZMA A;  3UMD A;  1HTZ A;  1K6S A;  4N9L A;  3C4P A;  2PYP A;  1DY6 A;  2VGK A;  3CJM A;  3G31 A;  2C6W B;  2XRN A;  3N4I A;  5FL3 A;  1NRJ A;  2PHY A;  3SH8 A;  1KE0 A;  3FPW A;  4DJ3 A;  2XK1 A;  5DKK A;  5HAQ A;  1MKI A;  1YAX A;  3PXP A;  2EWW A;  2Y8H A;  1UGU A;  4OOL A;  5F6A A;  2R9X A;  3HLB A;  2ZQ8 A;  2H10 A;  3FWL A;  4PHT A;  3ICY A;  3IWQ A;  2D02 A;  1VET B;  4BD0 A;  5FDH A;  2WGW B;  5EE8 A;  3UB6 A;  2XQZ A;  1WA9 A;  1ODV A;  1FCN A;  5F82 A;  4FOF A;  4EQ1 A;  3AGD A;  3ZG8 B;  5FAQ A;  3O87 A;  4DMZ A;  2O0Y A;  4IVI A;  1LI9 A;  2VV6 A;  3PR6 A;  4ZDX A;  3OC2 A;  5I5L A;  3ZCZ A;  3PTE A;  1XGJ A;  1K56 A;  5DF9 A;  2VLG A;  4ID4 A;  3ZG7 B;  1P9R A;  4MNR A;  3A3J A;  4PM5 A;  1W63 M;  2WZX A;  4KZ9 A;  4GZB A;  3S7O A;  2NUP C;  2VX8 A;  4HBU A;  1A0K A;  2Q0O A;  4KG5 A;  4EBN A;  3TW8 A;  4Y13 A;  3O88 A;  1G6A A;  3IXB A;  4LCL A;  4WMC D;  5EEC A;  5KSC A;  1K57 C;  2WKQ A;  2A49 A;  1N9N A;  3F1N B;  2JKF A;  4KZB A;  5U47 A;  3RH8 B;  1S6R A;  4HES A;  4RX3 A;  4I5S A;  2XFS A;  5HAI A;  4K0W A;  1Q2Q A;  4JXV A;  4UQI S;  3LR0 A;  1K57 A;  4QJG A;  5CRF A;  5IU1 A;  3LIE A;  3V50 A;  1GSX A;  4WL9 A;  2HP9 A;  3UE0 A;  1NY0 A;  2H0T A;  4Q0I A;  2KDK A;  3C30 A;  2Z6C A;  3ULF A;  5FQI A;  3UO9 A;  3VE3 A;  4EV4 A;  4HBT A;  3OPH A;  2B95 A;  3UE1 A;  3N7W A;  3BFE A;  3LR4 A;  3QNC A;  1OTB A;  4OP8 A;  4R23 A;  3DWK A;  3RXW A;  4MMN A;  3HUM A;  3O86 A;  1PZO A;  3PHY A;  5M1A A;  1YT4 A;  2G2U A;  4L9F A;  2EA9 A;  5FQK A;  4GD6 A;  4IVK A;  4E3J A;  5K5B A;  1KOU A;  1ES2 A;  2Y79 A;  4D2O A;  4PM9 A;  4E3M A;  3R7W B;  3KSF A;  1BLC A;  2Y59 A;  2Y4A A;  4XT2 A;  3MJQ A;  3TOI A;  1D1J A;  3DTK A;  2V2F F;  3L9K A;  4ZTK A;  1GHI A;  4EEP A;  3DWZ A;  2XLN A;  1MWR A;  3GMW A;  4HH3 A;  4NG2 A;  3T4Q A;  4GCZ A;  3CZD A;  5HWV A;  2ZQ7 A;  3P7N A;  2XFT A;  1LLB A;  1F5M A;  4LCM A;  3WRZ A;  4X53 A;  3FKV A;  2WYX A;  3W4O A;  1OPX A;  3PBT A;  1XJ6 A;  2GNX A;  2L0W A;  1TDL A;  3C38 A;  5CHJ A;  4JGQ A;  1NRF A;  2QZ6 A;  4DKI A;  5EFW A;  5EV0 A;  1W63 Q;  1MXO A;  3G6O A;  1DRM A;  3S7P A;  3TRC A;  5IT5 A;  1S1Y A;  4IUH A;  2IWC A;  2LB5 A;  2OWJ A;  4S2I A;  4M3K A;  2IWB A;  3VSK A;  5HAP A;  5GLC A;  2WAE A;  2QKP A;  3E0Y A;  2A3U A;  1V9Z A;  2XD5 A;  3V5M A;  3BW6 A;  3UY6 A;  5TBM A;  1ES5 A;  3VOY A;  3BEC A;  3LR3 A;  3PAG A;  3A0R A;  1XJ2 A;  5FI7 A;  1OT6 A;  3O5Y A;  1FQG A;  3BFC A;  2VKS A;  2HJ9 C;  4R3B A;  1ERM A;  1NLZ A;  3GSG A;  4FD8 A;  4WEL A;  3ITB A;  4UAA A;  1L0F A;  3CUE C;  1MWU A;  4I3A A;  5AJG A;  1RGY A;  5DTK A;  3IWI A;  3ZQ5 A;  2R9W A;  4LV0 A;  5CED A;  1HD8 A;  2UV0 E;  2W27 A;  3N6I A;  3NOT C;  1JNU A;  4LV1 A;  3CUE A;  3RJU A;  3LGO A;  2R78 A;  4ETX A;  3EWK A;  1PZP A;  3OPL A;  3NDE A;  3UDI A;  2OSU A;  2WKP A;  1CF0 A;  1CEF A;  3LY4 A;  5DJT A;  5HFO A;  3G30 A;  4ZJ3 A;  2B5R A;  3LEQ A;  3H82 A;  3KYZ A;  1RP5 A;  2Q9N A;  1JWV A;  2PT7 A;  3GEC A;  4PM8 A;  4BJP A;  4CPK A;  1X0O A;  4UQI M;  5F83 A;  3EGD C;  3BM6 A;  4EER A;  3MQO A;  4MBF A;  5FAO A;  3BWL A;  4BEN A;  1P9W A;  1E3U A;  3GVB A;  2OWH A;  3A0V A;  1YLZ A;  2Y2Q A;  2PD8 A;  4ZAM A;  1UWP X;  4KG6 A;  1G68 A;  4LPZ A;  2Y2K A;  3WS5 A;  4ZJ2 A;  3GTC A;  4QY6 A;  1CJF A;  3SS4 A;  5L2F A;  3MSH A;  4OOM A;  4XT2 B;  4EET B;  4OOY A;  2Y2O A;  3ZNT A;  3LIF A;  2QPN A;  2G7U A;  1LI0 A;  1FSY A;  5FQ9 A;  2BLS A;  3CPT A;  3C2W A;  5A8B A;  4GW9 A;  4NXF A;  4P0M A;  4LRX C;  4AFI A;  4Y0T A;  1XFN A;  2QJ5 A;  4BBV A;  4XUZ A;  1DP8 A;  3GR2 A;  1SDE A;  3T4K A;  1H8Y A;  4JXW A;  4QB8 A;  5EPH A;  4BWI A;  5F1F A;  3G34 A;  4BQM A;  1C3B A;  4B88 A;  5F1G A;  4KQD A;  4S2N C;  3ISG A;  2IWD A;  3VOL A;  3P01 A;  1CEG A;  3NBL A;  2HPB A;  1BYW A;  1IYO A;  1O07 A;  2JKT M;  2H28 A;  5HSQ A;  2Y91 A;  1OTE A;  3P09 A;  3SZT A;  1L0E A;  3DW0 A;  4S2N A;  2K2N A;  1TDG A;  1L0D A;  1ESU A;  2O9C A;  2P7J A;  2FH5 A;  4OPY A;  4ZJ1 A;  5TBM B;  3KSG A;  5FQM A;  4HP9 A;  1P97 A;  5MC7 A;  4WYY A;  5G18 A;  2V1B A;  4EQI A;  4E3N A;  2MJ6 A;  3FV7 A;  4OH0 A;  3UPO A;  3JYI A;  2Y2H A;  5M18 A;  4BBT A;  1U60 A;  4G3V A;  3WRT A;  4Y15 A;  2RCX A;  3U4L P;  3IWO A;  1XJ4 A;  4B4X A;  1S66 L;  2P08 A;  4P6Z S;  3NI9 A;  3OBF A;  1T19 A;  1PI5 A;  1SKF A;  4KUO A;  4BMW A;  1Z6F A;  5I94 A;  4OQ0 A;  2W3D A;  1DP9 A;  4E04 A;  2WZZ A;  4ARZ A;  5EOO A;  3BJN A;  4KUK A;  3H82 B;  3EGX C;  4NKP A;  1PW1 A;  4GJ4 A;  1T1A A;  1GCE A;  2GDN A;  2VV7 A;  4Y0U A;  3JVU A;  2J8Y A;  1KE3 A;  1STZ A;  4X69 A;  3WS0 A;  2WAD A;  4LGW A;  2ZQA A;  3IF6 C;  4KZ5 A;  2J3T C;  3C5A A;  2PU2 A;  1RCJ A;  3W2Z A;  1XX2 A;  5EOE A;  2BAS A;  4UA6 A;  2IA2 A;  2O99 A;  3LYX A;  4DDY A;  2CC1 A;  2Y2M A;  3UDF A;  5TR7 A;  2QMI A;  4EBP A;  3I7J A;  1K25 A;  3NEC A;  3FZC A;  4KEN B;  3KO6 A;  3Q7V A;  2ZQC A;  4CLC C;  2XF3 A;  3IF6 A;  2XDM A;  4L9G A;  2PRF A;  4WZ4 A;  5IHV A;  4KQR A;  3E98 A;  3WWX A;  4B93 A;  2FFY A;  3LUQ A;  2JBF A;  4B4Z A;  2RL3 A;  1S67 L;  1LHY A;  2XH9 A;  2EX8 A;  4CLC A;  1JWZ A;  1I2W A;  2XD1 A;  3SH9 A;  4I39 A;  3CPT B;  3ZG9 B;  1YMX A;  4Y7P A;  5DJU A;  3VFF A;  1RGZ A;  5HZH A;  4KQQ A;  5FSR A;  3S22 A;  1CQA A;  2ZC3 B;  3JPU A;  4X1M A;  4B9O A;  3CHW P;  2ZM2 A;  4N9K A;  2L1M A;  5CX7 A;  5L09 A;  3HRE A;  3A3F A;  1GA9 A;  2WKH A;  3W4Q A;  4WEJ A;  2QHK A;  3QP8 A;  1XFQ A;  5FAS A;  1LL8 A;  3MBZ A;  4MBK A;  3K3D A;  1MY8 A;  5IS1 A;  2GZA A;  5AQA A;  3ZDJ A;  4S2J A;  5AQB A;  4PM7 A;  2JN7 A;  3QP6 A;  1D06 A;  5FEG A;  5G4Y A;  4FH2 A;  4EES A;  4EU0 A;  2V1A A;  4II7 A;  4PKY G;  5FQJ A;  4O01 A;  3T12 B;  4HY8 A;  3D9Y A;  3DTE A;  3B42 A;  2ZQD A;  3GRJ A;  4K91 A;  2I72 A;  3WS2 A;  1GHM A;  3PBO A;  3B33 A;  4OPR A;  3ZFZ A;  2ACG A;  5EVI C;  3UB7 A;  4EW7 A;  1NYY A;  4PKY A;  3EEH A;  3MQ0 A;  2P9V A;  2Y55 A;  1FR6 A;  2DCF A;  3B3X A;  5CGS A;  5EVI A;  1YLJ A;  3BFF A;  4R1G A;  4I38 A;  4ARZ B;  5GHY A;  4R3J A;  3NJA A;  4QD4 A;  2XEP A;  3UB5 P;  3IBR A;  5HPF A;  4HOI A;  4BBU A;  4P6Z M;  1TS0 A;  1AXB A;  2PAV P;  3G35 A;  5F69 A;  3PAE A;  2J9O A;  5KSH A;  3UPN A;  4DF6 A;  2HZ5 A;  4WZ5 C;  4HIA A;  3IX3 A;  3L7H A;  3BY8 A;  3TG9 A;  3SS5 A;  5E2E A;  4OPQ A;  5A92 A;  2EXA A;  3QP2 A;  4WF0 A;  1MBL A;  4RYE A;  2W3G A;  2V8F A;  2HGV A;  3BFG A;  5KIZ A;  3Q7V B;  1W79 A;  1XKZ A;  3HLD A;  4WZ5 A;  3A0S A;  1NZO A;  5E2G A;  3C7V A;  3IF6 B;  3IF5 A;  4UHU A;  2VA0 A;  4HQA A;  1T18 A;  1F2K A;  3HL9 A;  1GSW A;  4IBR A;  3BEB A;  1IYP A;  1PRQ A;  3NCK A;  5CER A;  5CTM A;  1ES3 A;  3C8C A;  4G3K A;  4CLC B;  3M6B A;  3D3O A;  4O7D A;  4E3I A;  3NOU C;  1WYC A;  5A90 A;  1XJ3 A;  3WS1 A;  1YLW A;  5DTT A;  3FKW A;  2WGI A;  3IT9 A;  3GDI A;  3NIA A;  1N9O A;  4Q0H A;  2M7V A;  2A24 A;  3Q1F A;  3MS6 A;  1TS7 A;  5GLA A;  5DKL A;  4KZA A;  2ZC5 B;  4OP5 A;  2O9A A;  4QY5 A;  5EVL A;  1VEU A;  2XSS A;  4DE2 A;  3V3S A;  2VEA A;  4HHD A;  3FYZ A;  2OOL A;  3BY9 A;  4KZ8 A;  4HJ6 A;  2W3H A;  4S2O A;  4QU3 A;  1SZV A;  3VMA A;  3F1O A;  3IH8 A;  1L0G A;  4DE1 A;  1NYM A;  1PWC A;  4GDB A;  4JGP A;  3NDG A;  2KX6 A;  2PD7 A;  4YOF A;  3V3R A;  1BLS A;  2H5S A;  2JHE A;  4MN7 A;  4UA9 A;  1GSV A;  3FG8 A;  3S7N A;  2J80 A;  1K56 D;  1PFL A;  3HLE A;  3VP3 A;  3H7W A;  1XA1 A;  3BYD A;  3K2N A;  2J9P A;  4K08 A;  3ZVW A;  4GHI A;  2K7S A;  1Y28 A;  3LFV A;  3PYP A;  4JF4 A;  3LR5 A;  2ZC4 B;  4OQG A;  2C5W B;  2W3E A;  5HW3 A;  3CAX A;  2P9V B;  1N4O A;  3E4Q A;  4C3Q A;  5EVI B;  3RTY A;  1J3W A;  2PYR A; 
#chains in the Genus database with same CATH homology
 1ESU A;  2DRW A;  1EI5 A;  1DY6 A;  2VGK A;  3CJM A;  3G31 A;  3CG5 A;  1ZG4 A;  4XUX A;  2C6W B;  3N4I A;  4OPY A;  4ZJ1 A;  3SH8 A;  1KE0 A;  1BUL A;  2XK1 A;  4QHC A;  1PYY A;  5FQM A;  3Q81 A;  4S2K A;  3UPP A;  1DJB A;  4NET A;  2H0Y A;  5CHM A;  5HAQ A;  4WYY A;  5G18 A;  1MKI A;  3M2K A;  1LL5 A;  3M2J A;  3UNW A;  2HP5 A;  1FR1 A;  4EQI A;  3AGE A;  3LO7 A;  4OOL A;  1ZC2 A;  4E3N A;  4OH0 A;  2R9X A;  2WGV A;  3FV7 A;  3UPO A;  3HLB A;  3BFD A;  2ZQ8 A;  2H10 A;  3JYI A;  2Y2H A;  3FWL A;  4JF5 A;  3ZHH A;  5M18 A;  3IWQ A;  4R0Q A;  3W8K A;  1W5D A;  1E25 A;  1U60 A;  5GHZ A;  4A5R A;  1QME A;  4F94 A;  4GKU A;  3NY4 A;  4IED A;  3M6H A;  1CI9 A;  3WRT A;  4BD0 A;  5FDH A;  2OV5 A;  3Q07 A;  1XXM A;  2WGW B;  2OLV A;  4CJN A;  5EE8 A;  2RCX A;  1VM1 A;  1KGG A;  2XQZ A;  3IWO A;  4B4X A;  1FCN A;  5F82 A;  3PBS A;  3A3D A;  3AGD A;  3MXR A;  1NXY A;  3ZG8 B;  5FAQ A;  3NI9 A;  3O87 A;  5DTS A;  3RXX A;  4IVI A;  5HL1 A;  1PI5 A;  1K54 C;  1LI9 A;  4ZDX A;  1SKF A;  3OC2 A;  3ZCZ A;  3PTE A;  1IKG A;  1Z6F A;  1LL9 A;  1XGJ A;  1K56 A;  5DF9 A;  5FA7 A;  5I94 A;  1I5Q A;  1W7F A;  4OQ0 A;  2X02 A;  1SDN A;  4E6X A;  2WZZ A;  4ID4 A;  2EX9 A;  3ZG7 B;  4S2P A;  1NJ4 A;  4MNR A;  2UWX A;  2HDU A;  3A3J A;  1N9B A;  5EOO A;  3IXH A;  4PM5 A;  1HZO A;  3MZF A;  2DNS A;  2EFU A;  1GA0 A;  2WZX A;  2XGN A;  1PW1 A;  1WE4 A;  4KZ9 A;  1K54 A;  4GZB A;  1GCE A;  4OVD A;  4N1X A;  2GDN A;  4OPZ A;  1I2S A;  1MWS A;  4HBU A;  4GB7 A;  4KG5 A;  2WAF A;  4Y0U A;  3UE3 A;  4EBN A;  5CGX A;  2J8Y A;  4DE3 A;  1KE3 A;  2Z2L B;  3O88 A;  1G6A A;  3IXB A;  4LCL A;  4WMC D;  3W4P A;  5EUA A;  5EEC A;  5KSC A;  4X69 A;  3WS0 A;  4OKP A;  2WAD A;  1K57 C;  2ZQA A;  3IF6 C;  4KZ5 A;  2A49 A;  3C5A A;  2PU2 A;  2PBY A;  3VP2 A;  1RCJ A;  5CHU A;  4KZB A;  1XX2 A;  5U47 A;  4P87 A;  5EOE A;  4UA6 A;  5E2H A;  4DDY A;  1S6R A;  3HVF A;  4ZBE A;  4HES A;  4RX3 A;  2CC1 A;  2Y2M A;  4U0T A;  3UDF A;  5TR7 A;  2QMI A;  4EBP A;  3I7J A;  3ZGA B;  1K25 A;  2XFS A;  4K0W A;  2JE5 A;  5HAI A;  1Q2Q A;  3ZG5 A;  3FZC A;  4KEN B;  2EFX A;  4JXV A;  3Q7V A;  2ZQC A;  2XF3 A;  1ZKJ A;  1K57 A;  3IF6 A;  2XDM A;  4QJG A;  5CRF A;  3HLG A;  1PWG A;  4WZ4 A;  5KZH A;  3V50 A;  2J7V A;  1BSG A;  1VQQ A;  4KQR A;  2HP9 A;  3G4P A;  3GV9 A;  5IHV A;  3LY3 A;  3UE0 A;  1NY0 A;  2H0T A;  2HP6 A;  4GNU A;  2FFY A;  3WWX A;  2JBF A;  4B4Z A;  2RL3 A;  3UDX A;  4YIN A;  1LHY A;  1BTL A;  1KDW A;  2XH9 A;  1DJC A;  4X55 A;  2EX8 A;  5FQI A;  3UO9 A;  2WK0 A;  4EV4 A;  2ZQ9 A;  1JWZ A;  4L0L A;  4HBT A;  1I2W A;  3OPH A;  4NK3 A;  1YMS A;  4OQH A;  3UE1 A;  4JKT A;  3N7W A;  4S2L A;  3ZVT A;  3BFE A;  2XD1 A;  4DE0 A;  3SH9 A;  4EWF A;  1M6K A;  4GOG A;  3ZG9 B;  1YMX A;  2PU4 A;  3QNC A;  2HDS A;  4IBX A;  4OP8 A;  5HAR A;  4R23 A;  1YQS A;  2ZM0 A;  5AQ9 A;  4Y7P A;  3VFF A;  3DWK A;  1RGZ A;  3RXW A;  4MLL A;  4DXB A;  4KQQ A;  3HUM A;  3O86 A;  5FSR A;  2EX2 A;  1PZO A;  3S22 A;  5M1A A;  2ZC3 B;  1YT4 A;  4FCF A;  1KGF A;  1FOF A;  4OQI A;  2Z2M B;  2G2U A;  3BLM A;  4RA7 A;  3N8S A;  1H8Z A;  3IXD A;  2ZM2 A;  4KG2 A;  5FQK A;  4GD6 A;  4IVK A;  4JLF A;  5EVI D;  4E3J A;  3PBN A;  1KDS A;  4LV3 A;  4E3K A;  4HEF A;  1ES2 A;  4D2O A;  1ONH A;  1WYB A;  2FFF B;  4N9K A;  3TSG A;  3BLS A;  3HRE A;  4PM9 A;  3A3F A;  4E3M A;  4WMC A;  1GA9 A;  3BRM A;  2WKH A;  3W4Q A;  4WEJ A;  3V39 A;  2JC7 A;  3GQZ A;  1BLC A;  1GHP A;  2Y59 A;  4GDN A;  1KE4 A;  2Y4A A;  5FAS A;  1W8Q A;  2Y2N A;  4N92 A;  3MBZ A;  3TOI A;  4MBK A;  4OLG A;  3O3V A;  1MY8 A;  4KZ4 A;  3S4X A;  2V2F F;  4ZTK A;  4WEK A;  1GHI A;  5D3O A;  5AQA A;  4KZ6 A;  5FAP A;  5A91 A;  3DWZ A;  3ZDJ A;  4S2J A;  2P74 A;  2XLN A;  1MWR A;  3GMW A;  2VGJ A;  5AQB A;  5FI6 A;  3S1Y A;  4PM7 A;  1PWD A;  1FSW A;  1MWT A;  3CZD A;  2ZQ7 A;  2XFT A;  1L2S A;  1LLB A;  1XA7 A;  4KZ7 A;  4LCM A;  4P85 A;  4R4R A;  3WRZ A;  4X53 A;  5TFQ A;  5BOH A;  4BLM A;  4LEN A;  3FKV A;  4BL2 A;  1K4E A;  4FH2 A;  2WYX A;  3W4O A;  3OPP A;  5GLB A;  5HX9 A;  3PBT A;  2EX6 A;  3QNB A;  5FQJ A;  1TVF A;  2E8I A;  5FI2 A;  1TDL A;  5CHJ A;  2Y2P A;  3GRJ A;  2ZQD A;  4K91 A;  1OME A;  1NRF A;  3LEZ A;  3AGF A;  3QHY A;  4BD1 A;  2I72 A;  2OLU A;  5DVA A;  3WS2 A;  1GHM A;  3E2K A;  3PBO A;  4OPR A;  3ZFZ A;  2QZ6 A;  1ALQ A;  3G2Z A;  1K55 C;  1QMF A;  1W8Y A;  4MBH A;  1ES4 A;  4X56 A;  5EVI C;  4DKI A;  1MXO A;  3HUN A;  3UN7 A;  3HBR A;  1XP4 A;  4C75 A;  5CEC A;  3VFH A;  1FCO A;  1ZG6 A;  4YFM A;  2IWC A;  3CMZ A;  1NYY A;  3VOZ A;  4S2I A;  4M3K A;  4XXR A;  2P9V A;  2Y2J A;  1K6R A;  2IWB A;  3NC8 A;  1K38 A;  2Y55 A;  1FR6 A;  3VSK A;  2DCF A;  2WKE A;  5HAP A;  5KMW A;  1K55 A;  3B3X A;  5GLC A;  5CGS A;  5EVI A;  1YLJ A;  2WAE A;  3BFF A;  3ZG0 A;  4R1G A;  2A3U A;  4JXS A;  2XD5 A;  3V5M A;  1E3U D;  1KGE A;  4DXC A;  5M19 A;  4FH4 A;  4JF6 A;  5GHY A;  3UY6 A;  2WUQ A;  5DF8 A;  4R3J A;  1ES5 A;  5CEB A;  3VOY A;  4QD4 A;  1ERO A;  2XEP A;  4JPM A;  3BEC A;  3HLC A;  3PAG A;  4N1H A;  2ZM8 A;  5FI7 A;  4P6B A;  1M40 A;  1AXB A;  3A3E A;  1FQG A;  3BFC A;  1JWP A;  4OLD A;  5FAT A;  3N8R A;  4R3B A;  3G35 A;  2Y2I A;  4R4S A;  3PAE A;  1ERM A;  4FD8 A;  2J9O A;  3GSG A;  4WEL A;  5KSH A;  1XGI A;  3WS4 A;  5CTN A;  3UPN A;  1JTG A;  3ITB A;  3MZE A;  4UAA A;  1L0F A;  4DF6 A;  4JBF A;  1MWU A;  2Y2L A;  1CK3 A;  3MZD A;  4WZ5 C;  2XR0 A;  1SHV A;  3G2Y A;  4Y0O A;  2JCH A;  4K0X A;  4PPR A;  2X71 A;  5J8X A;  1XPB A;  2WGW A;  4RVA A;  3TG9 A;  3SS5 A;  5E2E A;  4OPQ A;  1RGY A;  5DTK A;  3IH9 A;  1BT5 A;  3IWI A;  5A92 A;  2R9W A;  3SS3 A;  2EXA A;  4LV0 A;  1IEM A;  1MBL A;  4RYE A;  3VP1 A;  3EQU A;  5CED A;  1HD8 A;  4X68 A;  4DDS A;  5E43 A;  3N6I A;  3BFG A;  1ERQ A;  3LCE A;  4LV1 A;  4DRT A;  3Q7V B;  1W79 A;  1XKZ A;  3HLD A;  4WZ5 A;  3RJU A;  1NZO A;  3D4F A;  5E2G A;  3C7V A;  3IF6 B;  3IF5 A;  3OCL A;  4UHU A;  1PZP A;  1JTD A;  3OPL A;  1YM1 A;  3NDE A;  4FSF A;  3HL9 A;  2X01 A;  3UDI A;  2OSU A;  1CEF A;  3PBQ A;  4MEZ A;  3LY4 A;  4IBR A;  3N8L A;  5HFO A;  3G30 A;  3BEB A;  4ZJ3 A;  4Q8I A;  2B5R A;  1IYP A;  1S0W A;  2G2W A;  3NCK A;  5CER A;  3IQA A;  1RP5 A;  2Q9N A;  1JWV A;  5CTM A;  4PM8 A;  1ESI A;  1ES3 A;  4BJP A;  4JXG A;  1Y54 A;  3M6B A;  4CPK A;  1O7E A;  5A93 A;  4O7D A;  5F83 A;  4E3I A;  3BM6 A;  1WYC A;  4BL3 A;  3DTM A;  3OPR A;  5A90 A;  3SH7 A;  4PM6 A;  5TGF A;  4MBF A;  4OON A;  3WS1 A;  5FAO A;  5GHX A;  1YLW A;  5DTT A;  4GN2 A;  3FKW A;  4BEN A;  1E3U A;  4E6W A;  4E3L A;  5JYP A;  2ZC6 B;  3MFD A;  2WGI A;  3IT9 A;  3SOI A;  1BLH A;  4U3T A;  3NIA A;  3IHB A;  3ITA A;  4S2M A;  3GVB A;  1SCW A;  1PIO A;  3C7U A;  4PMA A;  3Q1F A;  3ZNY A;  4WM9 A;  1K4F A;  3VP4 A;  1KVM A;  1YLZ A;  2Y2Q A;  2ZC7 A;  4ZAM A;  1PI4 A;  5GLA A;  4E3O A;  1YLP A;  1PW8 A;  3C4O A;  5CXW A;  2HDR A;  4KG6 A;  2ZC5 B;  4KZA A;  2WKI A;  4OP5 A;  1IKI A;  1G68 A;  2Y2K A;  3HUO A;  3WS5 A;  3IHA A;  4ZJ2 A;  2V20 A;  2Y2G A;  3GTC A;  5GLD A;  3A3I A;  1H5X A;  4QY5 A;  4QY6 A;  5EVL A;  2BG1 A;  1NZU A;  3Q82 A;  3OCN A;  4DE2 A;  2Q9M A;  3V3S A;  3EQV A;  1ONG A;  5CGW A;  3SS4 A;  3FYZ A;  5L2F A;  4OOM A;  1Q2P A;  2ZLY A;  3VSL A;  4KZ8 A;  1FCM A;  4U0X A;  4OOY A;  1YLY A;  2Y2O A;  3PBR A;  2V1Z A;  3ZNT A;  1CI8 A;  5AQ7 A;  4S2O A;  3MKF A;  2QPN A;  4QU3 A;  1DJA A;  1LI0 A;  3G32 A;  4KQO A;  5DF7 A;  1FSY A;  3MKE A;  3VMA A;  3IH8 A;  5FQ9 A;  1L0G A;  2BLS A;  4DE1 A;  1BUE A;  1NYM A;  1TEM A;  4GD8 A;  4EUZ A;  1PWC A;  5JYO A;  1KVL A;  4GDB A;  3NDG A;  4WBG A;  4P0M A;  2EXB A;  4Y0T A;  3V3R A;  4XUZ A;  2HDQ A;  3HLW A;  3GR2 A;  1SDE A;  1BLS A;  2H5S A;  3OZH A;  3MXS A;  3P98 A;  4KZ3 A;  1H8Y A;  2ZD8 A;  4JXW A;  4UA7 A;  4UA9 A;  4QB8 A;  5EPH A;  1E4D A;  1EWZ A;  3E2L A;  1J9M A;  5F1F A;  3G34 A;  4BQM A;  1C3B A;  1K56 D;  5GL9 A;  4B88 A;  1BZA A;  3HLE A;  1BLP A;  5F1G A;  3VP3 A;  1XA1 A;  3BYD A;  2J9P A;  3ZVW A;  4LV2 A;  1IEL A;  4EBL A;  4S2N C;  5FQQ A;  3ISG A;  2IWD A;  3Q7Z A;  1HVB A;  4Z9Q A;  1IYS A;  1CEG A;  3NBL A;  2HPB A;  4X6T A;  4H8R A;  4JF4 A;  4RX2 A;  1IYO A;  1IYQ A;  1O07 A;  5E2F A;  1MPL A;  2ZC4 B;  4OQG A;  2C5W B;  5HW3 A;  2ZJ9 A;  2P9V B;  1JVJ A;  1N4O A;  2Y91 A;  3IXG A;  3P09 A;  2ZMA A;  3HLF A;  3VP0 A;  4C3Q A;  1HTZ A;  5EVI B;  1K6S A;  4C6Y A;  4N9L A;  1L0E A;  3DW0 A;  3C4P A;  4S2N A;  1TDG A;  1YLT A;  1L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...