3BFEA

Crystal structure of the class a beta-lactamase sed-1 from citrobacter sedlakii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGAGDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfeA00
4NK3A 2J7VA 2WGVA 2ZMAA 2JCHA 1K54A 2ZC5B 3GRJA 1PZOA 2HPBA 1HD8A 3BRMA 4Z9QA 3HLFA 5D3OA 2WYXA 5IHVA 4N1HA 4S2JA 5AQ7A 2EXBA 3VMAA 3GVBA 2QMIA 3VP1A 3ZDJA 3LEZA 1XP4A 2XD1A 3IF5A 2C5WB 2XGNA 3G30A 2ZQCA 3UE0A 3M2KA 1FCNA 1K4FA 2B5RA 3A3DA 1QMFA 2OLUA 5CGSA 4E6WA 1G6AA 4UA9A 3ITBA 2Y59A 4WZ5C 4EQIA 3UDFA 1SDNA 3PTEA 4P6BA 3MXSA 1MPLA 1HZOA 3HUOA 3MKEA 4KQRA 4E3OA 3D4FA 3LY4A 1PYYA 4XUXA 3HUNA 2HP5A 3FKWA 3FV7A 4F94A 2X01A 3OZHA 4ZJ2A 4KZ4A 5EOEA 4EBNA 4GD8A 3IXHA 1ALQA 5FQIA 3E2LA 3IWQA 5TR7A 4QB8A 1I2SA 2G2UA 1EROA 1JVJA 1W8YA 1KGGA 2ZQDA 1MKIA 3VP4A 1DJCA 3ZHHA 4KZ3A 1YLJA 4H8RA 3PBQA 4IVIA 4DDSA 5M19A 3N7WA 4DXBA 4U3TA 3WRZA 3NCKA 1Q2QA 3VP3A 1K25A 1O7EA 1IYOA 3FZCA 3MZFA 1GHPA 4GOGA 5FAOA 1FCOA 2XH9A 4X56A 3S4XA 1AXBA 4S2MA 4KZBA 2PU2A 3PBNA 4ZJ3A 4BJPA 4E3NA 5EVIA 3W4OA 3IF6A 3UO9A 1K55C 1YLYA 5GLDA 4MLLA 5CGXA 4OONA 4JF5A 5KSHA 1L2SA 4LCMA 1BLPA 2XLNA 3BLSA 2I72A 1ESUA 1K56A 1MWTA 4ZTKA 2RL3A 4ZDXA 2Y2OA 5DTTA 3SS5A 3Q81A 2EX9A 1H8YA 3ZFZA 3NI9A 1Y54A 4OPRA 3BM6A 3CG5A 3W8KA 1ES2A 3WRTA 5E43A 3QHYA 3MZEA 1CEFA 2OV5A 3OCNA 1BLCA 4JF4A 3IH8A 3WS0A 3DTMA 3O3VA 2OLVA 4HEFA 4YFMA 1LI9A 1KDSA 3IXDA 4OLDA 2XFTA 2XFSA 5GLBA 1DJBA 4P0MA 5A93A 1QMEA 2Y2PA 4L0LA 5M1AA 2WZXA 3A3EA 4GD6A 3FYZA 1PI5A 1VQQA 4PM7A 1MWUA 2XQZA 3SH9A 3ZG5A 5HAPA 4BL3A 2IWDA 2PBYA 1CK3A 4KG5A 4WZ4A 4JBFA 3CJMA 2XEPA 3WS2A 5FQ9A 1BLHA 3SOIA 1E25A 3IHBA 1NZOA 3Q7VA 4BLMA 2H10A 5A91A 5HFOA 2V20A 4O7DA 4WBGA 1Z6FA 4S2PA 1NJ4A 2A49A 1C3BA 4OQ0A 1KGEA 3G35A 2EXAA 2DRWA 1ONGA 2ZM8A 3TSGA 4KG6A 3GQZA 1LL9A 3VP0A 3PAEA 1BLSA 1KE3A 2FFYA 3G2ZA 4BD1A 2ZLYA 1BTLA 4RYEA 2WGWA 3BFEA 3JYIA 1Q2PA 1L0GA 4GDBA 4B4XA 3PBTA 1K38A 4NETA 3UNWA 1EI5A 4LCLA 3N8SA 5I94A 3GR2A 3GTCA 1IEMA 2Q9MA 5KZHA 1VM1A 3ZCZA 4HESA 4E3LA 4KZ9A 3O87A 1YT4A 1PW1A 3ZVTA 1M40A 4E3JA 1ES5A 1ESIA 1JWVA 5AQ9A 4U0XA 1K54C 3ZG9B 4C3QA 1ZKJA 4FH4A 5E2GA 4IBXA 4GNUA 5FA7A 4OPZA 2HDQA 1TDGA 4DDYA 4OLGA 5AQBA 5GHXA 1BT5A 3C7UA 4GDNA 5CERA 4EUZA 3A3FA 2UWXA 2JC7A 4OPYA 4UHUA 3UE1A 1LI0A 3OPRA 1K6SA 1SCWA 3WWXA 2R9WA 4GKUA 2ZC6B 3PBRA 5HAQA 3HUMA 1W8QA 3BYDA 3E2KA 1L0FA 1MY8A 2Q9NA 1LLBA 4OKPA 2WAEA 3C7VA 3I7JA 3SH7A 3G32A 4PM9A 1BSGA 5DF8A 4KZ6A 1NXYA 3OPPA 5CECA 2XD5A 3P09A 3ZVWA 1PI4A 1MWSA 3RXWA 1ES3A 1GHMA 1GCEA 2JBFA 3N6IA 1GA0A 4LENA 1IYQA 5U47A 4X69A 1NYMA 3HREA 1FR1A 1K6RA 4WELA 5FQQA 3SS4A 4E3MA 1XA7A 2OSUA 4DF6A 3EQVA 4QJGA 4Y0UA 5EVID 1O07A 3NY4A 3HLDA 1YLTA 1BZAA 2H5SA 3OPHA 1YMSA 2J9PA 1EWZA 3EQUA 1SKFA 1IKGA 1H8ZA 4FD8A 1K56D 4X68A 5CEDA 3ZNTA 3UPOA 1PZPA 1TEMA 4OVDA 2QZ6A 2FFFB 4R4RA 4CJNA 1HTZA 3VSLA 5FI2A 2Y2GA 4S2IA 5JYPA 2J9OA 4CPKA 4LV2A 1K57C 1K57A 2ZM0A 4QD4A 3AGDA 5HAIA 3FKVA 2Y2QA 3HLCA 5FI6A 4JF6A 2BLSA 2H0TA 5DF7A 4QHCA 4WMCA 5JYOA 5EVIC 3IF6C 3SS3A 2WK0A 5F1GA 3IWIA 4PM8A 4MBFA 5GLAA 2CC1A 1PW8A 4KG2A 1HVBA 2X02A 4P85A 5FDHA 2QPNA 3VSKA 2EFXA 1KE0A 1RP5A 4BD0A 2Y2KA 3M6HA 3C4PA 4N9KA 3BEBA 5CGWA 1M6KA 3TG9A 2ZM2A 3NDGA 3VOZA 2P9VB 4OOLA 1XPBA 1YM1A 3IHAA 2DCFA 2PU4A 1N9BA 3OCLA 5KMWA 2ZD8A 4KZ8A 3IXBA 3FWLA 1FQGA 4PMAA 4RX3A 4BL2A 1E3UD 1YLWA 1N4OA 4D2OA 5HW3A 2ZC3B 4LV0A 2A3UA 2WAFA 1ZC2A 4B88A 5FAQA 3BFGA 4IEDA 4RVAA 4UA7A 5GHZA 1ZG4A 2ZQ7A 2IWCA 2ZJ9A 3NIAA 3GMWA 1XXMA 4MBKA 5DF9A 3AGEA 3BLMA 3NDEA 1W5DA 4KZAA 4WYYA 1FCMA 2EFUA 4DE2A 1XKZA 4C75A 4S2OA 4OOYA 4JXWA 4S2KA 1BUEA 4WEKA 1IYPA 3ISGA 3Q7ZA 4M3KA 5CTMA 3VFHA 3Q7VB 3N4IA 1IYSA 2Y55A 4KZ5A 4S2LA 3MZDA 5FQKA 3ZNYA 1YLPA 5TFQA 1S6RA 2R9XA 4PPRA 1E4DA 3O86A 4S2NA 5J8XA 4FCFA 5FATA 4X53A 4R23A 3S22A 3ZGAB 3C4OA 4HBTA 3GV9A 1L0EA 1WYCA 5FSRA 3V3SA 1GA9A 1CI8A 2GDNA 2VGKA 3RXXA 3IH9A 3VFFA 1I5QA 1S0WA 5FI7A 1MXOA 3O88A 4UA6A 3BFFA 3RJUA 3C5AA 4E3KA 5CXWA 4BQMA 3BFCA 3CMZA 1XGJA 4KQOA 4R4SA 4MNRA 4K0XA 2XK1A 4R0QA 5EUAA 3IQAA 3P98A 3Q07A 1ERMA 3VOYA 1XGIA 2P74A 1NRFA 1CI9A 2Y2HA 3IWOA 3BECA 4RA7A 4DKIA 4MBHA 3IXGA 5GL9A 1CEGA 1PWCA 1IELA 2RCXA 2WGIA 2WKEA 4WM9A 4A5RA 3IT9A 1LL5A 1RGZA 4OPQA 2Y4AA 3LO7A 4XUZA 1DY6A 5FAPA 5CHJA 3MBZA 3V39A 1SHVA 1IKIA 1MBLA 1JWPA 3MKFA 3N8RA 4JLFA 4JXVA 4GZBA 3UPPA 1G68A 1KVMA 3PAGA 4LV1A 4OP8A 4OH0A 5AQAA 3QNCA 4R3JA 4QY5A 4UAAA 4OQHA 5BOHA 4WMCD 2HP9A 4KQQA 5EE8A 1LHYA 5EVLA 4PM5A 3DWKA 3QNBA 3ZG8B 3M2JA 4QY6A 1KGFA 3HBRA 3HLGA 4WZ5A 5F83A 2V2FF 3AGFA 4JXGA 2IWBA 4K0WA 4JXSA 2HP6A 4X55A 4P87A 2HDUA 1GHIA 4Q8IA 4JPMA 2Y2JA 3LY3A 4Y7PA 4EBPA 4IBRA 5KSCA 3HLWA 4C6YA 3UN7A 5EOOA 4JKTA 4OP5A 3W4QA 2C6WB 4MEZA 5EECA 1K4EA 2X71A 5GHYA 4N1XA 1RGYA 2WUQA 4ID4A 5G18A 3MXRA 4E6XA 1FSYA 3M6BA 2Y91A 3WS1A 1XX2A 1BULA 1XA1A 2HDRA 2J8YA 3PBSA 5E2FA 3LCEA 4GB7A 2V1ZA 5F1FA 4GN2A 3NC8A 5FQJA 1FSWA 2EX8A 1KVLA 4B4ZA 1KDWA 2Z2MB 1NYYA 5EVIB 4EWFA 3IF6B 4IVKA 2Z2LB 1W7FA 2Y2NA 2ZQ9A 3OPLA 4K91A 4LV3A 3DW0A 2H0YA 4QU3A 5EPHA 3OC2A 1ZG6A 5HARA 1L0DA 3UPNA 4ZBEA 1K55A 5CHUA 4ZAMA 1RCJA 3ZG7B 1U60A 2Y2MA 2P9VA 4RX2A 5E2EA 1WE4A 4OQIA 3VP2A 2DNSA 5CEBA 1JTGA 4WEJA 3BFDA 1JWZA 1PIOA 1J9MA 2ZC4B 3HVFA 3NBLA 2XDMA 2WADA 1MWRA 4FH2A 4EBLA 3HL9A 2E8IA 3S1YA 2XF3A 4DXCA 1H5XA 5E2HA 3WS4A 5HL1A 2EX6A 3GSGA 2G2WA 3WS5A 4YINA 3ZG0A 3ITAA 2HDSA 3Q82A 1PWDA 2ZQAA 4R3BA 2VGJA 3G34A 1FOFA 3PBOA 5CTNA 5DVAA 3SH8A 4HBUA 1PWGA 4N92A 1NY0A 4XXRA 3W4PA 1DJAA 4N9LA 4DE0A 4ZJ1A 5DTKA 4S2NC 4BENA 4R1GA 4KZ7A 3UY6A 1WYBA 3CZDA 5FQMA 5GLCA 3G2YA 3UE3A 2WKIA 4PM6A 2WZZA 3UDXA 5TGFA 3A3IA 1ONHA 2ZQ8A 4Y0OA 1OMEA 1YMXA 3B3XA 1ES4A 5CRFA 5M18A 4X6TA 3MFDA 4DE1A 2WGWB 1YQSA 5CHMA 3V50A 5L2FA 4KENB 4OQGA 3HLEA 2WKHA 5DTSA 1TDLA 2ZC7A 5HX9A 3HLBA 3Q1FA 4E3IA 4DE3A 1YLZA 3V5MA 1E3UA 4U0TA 3A3JA 1TVFA 2XR0A 2JE5A 1I2WA 1KE4A 3V3RA 3G4PA 4EV4A 5A90A 2Y2LA 1FR6A 1NZUA 1SDEA 5A92A 2Y2IA 3TOIA 3N8LA 1W79A 3DWZA 4FSFA 3UDIA 1ERQA 2EX2A 3G31A 5FASA 5F82A 1JTDA 4DRTA 4OOMA 4Y0TA 2BG1A
chains in the Genus database with same CATH superfamily
2J7VA 2ZMAA 2ZC5B 1PZOA 5HL6A 4Z9QA 4UQIM 2WYXA 1UGUA 3H82A 2EXBA 3VMAA 1XP4A 3IF5A 1FCNA 1H3QA 5I5LA 3UDFA 1V9YA 3R7WB 3CLOA 1PYYA 4XUXA 3FKWA 4EBNA 3EOIA 1I2SA 2PYPA 1FIKA 2G2UA 1EROA 1JVJA 3UB8A 3ZHHA 4U3TA 2V0WA 1Q2QA 3PR6A 1STZA 3VP3A 4X1MA 3FZCA 1O7EA 1FCOA 2XH9A 4S2MA 4EU0A 1VEUA 4HJ6A 2PBDP 2A24B 4E3NA 3UO9A 1ACFA 5GLDA 5L07A 3T50A 5CGXA 3LICA 4JF5A 4OONA 1L2SA 2I72A 1MWTA 2EX9A 3NI9A 1XJ3A 3CG5A 2NUPC 5FEFA 2VGLS 4BBUA 5E43A 2OV5A 3OCNA 4JF4A 1KDSA 3IXDA 4Y13A 3NOUC 2VGLM 4LGWA 3BW6A 2ZOIA 1CK3A 2Y8HA 3GECA 4WZ4A 3IHBA 1DP6A 1NJ4A 4GLQA 4OQ0A 2A49A 3F1NB 2ZL1A 1LSXA 2EXAA 1ONGA 3TSGA 3GQZA 5TBMA 1VETA 1KE3A 3TE8A 3BFEA 5G4YA 2W3FA 2OWHA 4B4XA 1F98A 1K38A 3PBTA 4NETA 3P01A 1DRMA 4L9GA 3N8SA 2Q9MA 1VM1A 3O87A 3UMEA 1JWVA 5AQ9A 4U0XA 3U2AA 4IBXA 4MN5A 1TDGA 5GHXA 3UE1A 3WWXA 4GKUA 5HAQA 3HUMA 1W8QA 3IX4A 3E2KA 2Q9NA 4OKPA 4PM9A 1BSGA 3OPPA 1D06A 3ZVWA 1MWSA 2HZ5A 1ES3A 4HJ4A 4LENA 1NYMA 5FQQA 1K6RA 3H9WA 4E3MA 1OJGA 3HLDA 3OPHA 1EWZA 1SKFA 1UWNX 1PZPA 1S4SA 1WA9A 1ZHHB 4CJNA 5CX7A 2QYBA 1NLYA 5HPFA 3K3DA 2Y2GA 4S2IA 3D72A 4CPKA 1K57C 1K57A 2ZM0A 4ESPA 5FI6A 2Y2QA 3HLCA 4JF6A 2JKGA 5EVIC 3G6OA 5F1GA 4PM8A 4KUKA 5HPIA 2JKFA 2ZOHA 2X02A 4JGPA 2PT7A 3TG9A 2E8JA 2P9VB 4OOLA 3IHAA 1AWIA 1CJFA 2ZD8A 4PHTA 4PMAA 3T1RA 4LV0A 4WN5A 1ZC2A 4B88A 4UA7A 3DTIA 1ZG4A 3S7OA 2ZJ9A 2VV8A 1TS7A 3NDEA 1W5DA 4WYYA 1BUEA 1OPXA 1D7EA 3Q7ZA 2Y55A 5TFQA 5J8XA 4FCFA 2P04A 1P9RA 1VHMA 2W27A 5FSRA 4PKYA 3V3SA 5J4EA 3IH9A 1DP9A 1MXOA 3O88A 1OTIA 3RJUA 2NUTC 2M7VA 3B47A 4R0QA 1W63M 3Q07A 1ERMA 2M1CA 4EEUA 2P74A 3F1OB 3BY8A 3IXGA 5GL9A 1CEGA 3EEAA 4A5RA 3MR0A 1S66L 3LO7A 4PAUA 3V39A 2LB9A 4I3AA 3KSGA 4JLFA 3LIFA 1G68A 5BOHA 4WMCD 1LHYA 4PM5A 3C38A 3QNBA 3ZG8B 1LSWA 1TS0A 3AGFA 3LIBA 4Z1WA 4P87A 4Q8IA 5DKKA 4IBRA 5KSCA 5EOOA 2X71A 1RGYA 2A2LA 4ID4A 3NOTC 4E6XA 3M6BA 2Y91A 3WS1A 3OBFA 3LCEA 4BBTA 2V1ZA 4GN2A 4B4ZA 2K31A 3IF6B 1W7FA 2ZQ9A 3KSHA 5EPHA 3OC2A 1ZG6A 1K55A 5CHUA 4NXBA 2INWA 3ZG7B 3S7QA 4OQIA 3T4JA 2DNSA 3EGXC 3K2NA 2HJ9C 4WEJA 1PIOA 5J3WA 4G3WA 3HVFA 4FH2A 4EBLA 4HJ3A 1H5XA 3ZG0A 1N9OA 3SH8A 4N92A 1NY0A 3U4LP 4N9LA 4DE0A 4S2NC 4KZ7A 1XFNA 1WYBA 3CZDA 5FQMA 4Y0OA 3B3XA 1ES4A 3MFDA 1YQSA 4Y5FA 5L2FA 1MC0A 3HLEA 3ZQ5A 1TDLA 3HLBA 3Q1FA 1G5UA 3V5MA 1TVFA 2JE5A 1KE4A 2Y2LA 1FR6A 2QHKA 4GHIA 2OOLA 2PD8A 3JPUA 3DWZA 3UDIA 5F6AA 4F3LB 5FASA 1JTDA 4Q0JA 5G4ZA 2WGVA 1K54A 3H7WA 3MMHA 4ME4A 3HLFA 2VKSA 2W3GA 2M7UA 4N1HA 4S2JA 5HDCA 3KYZA 2QMIA 3VP1A 3ZDJA 2XD1A 2XGNA 2OAP1 1K4FA 4ARZB 1G6AA 4UA9A 3ITBA 2Y59A 3MXSA 3D4FA 2W3DA 4QWOA 3FV7A 4IJGA 2X01A 4ZJ2A 4KZ4A 4DN0A 4MMNA 5FQIA 4M4XA 1KGGA 3LI9A 3VP4A 1DJCA 4KZ3A 3N7WA 4DXBA 3NCKA 3NOPC 1K25A 5L8MA 1IYOA 1GHPA 4X56A 3S7NA 2QJ5A 3B33A 5KSHA 2XLNA 4ZDXA 1K56A 2RL3A 3Q81A 1H8YA 3BM6A 3W8KA 3EEHA 3QHYA 1CEFA 4H6JA 1P97A 3E4OA 3IH8A 2OLVA 1LI9A 2MJ6A 4R70A 2XFTA 3UB5P 2Y2PA 4DMZA 4IHQA 4GD6A 3FYZA 1PI5A 1VQQA 3GDIA 1Y4OA 3ZG5A 2KOIA 4JBFA 3CJMA 3WS2A 5FQ9A 5HD3A 3QP4A 2H10A 5A91A 5HFOA 4WBGA 2ZMFA 1KGEA 3FG8A 3LEQA 2DRWA 2ZM8A 4KUOA 4LFUA 1BLSA 3G2ZA 4BD1A 3NECA 3JYIA 2Q0OA 3PXPA 2W1RA 4HH2A 3GTCA 1IEMA 3VV4A 3NJAA 5KZHA 3PHYA 3ZCZA 4E3LA 1YT4A 1ES5A 4FH4A 2IA2A 4CLCA 5AQBA 4GDNA 2VV6A 4EUZA 1LI0A 3PBRA 4X25A 5F69A 1L0FA 1H0MA 3G32A 3IBRA 5MC7A 2XD5A 3RXWA 2JBFA 1GCEA 1OTEA 3N6IA 4HQAA 1XJ6A 1NRJA 4QJGA 3LR5A 5EVID 3T1SA 3NY4A 4LPZA 1BZAA 2J9PA 3EQUA 1H8ZA 4X68A 1P9WA 3UPOA 3KYEA 5IU1A 2QWSA 4I3IA 5EVEA 1TEMA 2Z6DA 2R78A 1HTZA 1W63Q 4EEPA 2O9CA 5JYPA 4LV2A 3FKVA 5TJJA 2BLSA 5FL3A 1XFQA 2WK0A 3IWIA 4EW7A 1TS6A 3T4LA 3LYXA 1YSQA 3NHQA 4KG2A 1HVBA 4P85A 3C4PA 5CGWA 4EETB 2ZM2A 1G28A 2ZBBA 3KYQA 3ULFA 1YM1A 4EXOA 2DCFA 3SZTA 3FWLA 3CI6A 2EWVA 4D2OA 3CUEC 3CUEA 2A3UA 2WAFA 3OOVA 3A0RA 4BWIA 4RVAA 5GHZA 2PDRA 2ZQ7A 1YPRA 3GMWA 3AGEA 4S2OA 3KO6A 3RFBA 3VFHA 2VEAA 1IYSA 4KZ5A 3E0YA 3E4QA 4I5SA 2R9XA 1E4DA 2EWWA 2ZL1B 3ZGAB 3C4OA 4HBTA 3GV9A 5TBMB 1L0EA 1VETB 1GA9A 1CI8A 2GDNA 1T1BA 5F68A 2Z6CA 3VFFA 2JHEA 3BFFA 3LR3A 5IT5A 1XGJA 4KQOA 4MNRA 2O9AA 3P98A 4MDZA 3VOYA 2ACGA 2Y2HA 4Y15A 4HNBA 4RA7A 4MBHA 2I9VA 1D1JA 1SHVA 1IKIA 3N8RA 3MS6A 4GZBA 1KVMA 3PAGA 4LV1A 3OLOA 4OH0A 4QY5A 4UAAA 4JGRA 5EVLA 5EFWA 4QY6A 1ZTUA 3MJQA 4WZ5A 4K0WA 3KX0X 2HDUA 5HDDA 4JPMA 3LY3A 4EBPA 5HWTA 2W3HA 4JKTA 4OP5A 4EESA 4MEZA 5G18A 3MXRA 4II7A 1XX2A 1BULA 3BWLA 2HDRA 4ETXA 4GB7A 1F2KA 5FQJA 1FSWA 4HP9A 2Z2MB 5EVIB 4EWFA 3E4PA 2GJ3A 1OT6A 4K91A 2H0YA 4NKPA 4O0PA 3UPNA 1L0DA 4ZBEA 1RCJA 2P9VA 5CEBA 1JTGA 2VZWA 4MCWA 3VE4A 3BFDA 5L10A 1J9MA 2J3TC 3LR0A 2ZC4B 1KOUA 1XJ4A 1OJ5A 3HL9A 2E8IA 2O99A 3S1YA 4DXCA 3WS4A 2EX6A 3GSGA 3DTKA 1G6OA 3WS5A 3ITAA 2UV0E 1PWDA 2D01A 2VGJA 3PBOA 1J3WA 2OAQ1 1PWGA 4XXRA 3W4PA 2WKPA 3UE3A 3UDXA 5TGFA 1ONHA 5M18A 4R6LA 2WGWB 5CHMA 1T1AA 4GS9B 4KENB 2WKHA 5DTSA 2W1TA 3F1PB 5HX9A 3DAVA 3FC7A 4E3IA 4U0TA 1I2WA 5A90A 3G4PA 2V8CA 3CAXA 2Y2IA 2EX2A 2OWJA 3F1OA 4NK3A 3GRJA 2HPBA 3BRMA 3JVVA 5D3OA 3T4TA 3UE6A 4JGQA 2GX5A 3LEZA 3G30A 1LSVA 2ZQCA 4BBVA 1NLZA 3M2KA 2B5RA 3A3DA 1QMFA 2OLUA 5CGSA 5DFXA 3A0VA 3PTEA 4P6BA 1MPLA 1HZOA 3HUOA 3T12B 4KQRA 3CHWP 4HHDA 3HUNA 2HP5A 5EOEA 4GD8A 2H28A 1ALQA 3QP6A 3IWQA 5TR7A 4GCZA 4QB8A 1W8YA 2ZQDA 5AVEA 3MFXA 5M19A 2HGVA 4IUKA 2QKPA 3WRZA 1PNEA 4GOGA 3S4XA 1AXBA 4P6ZS 4ETZA 5HWVA 1N9LA 4BJPA 3W4OA 3IF6A 3LIDA 1K55C 4MLLA 3BY9A 4E04A 1BLPA 3BLSA 5HSQA 2Y2OA 3SS5A 4OPRA 3MQQA 3WRTA 3W2ZA 3MZEA 2VX8A 1BLCA 4YOFA 3O3VA 4YFMA 4HEFA 4OLDA 4WL9A 4L9FA 5A93A 4LLOB 1QMEA 5M1AA 3A3EA 4PM7A 3SH9A 5HAPA 4HOIA 2IWDA 2PBYA 4KG5A 3HCYA 2P08A 4G3KA 1BLHA 3SOIA 1E25A 3Q7VA 1NZOA 2D02A 4HP4A 4LRYC 2BASA 1LL9A 3VP0A 2XRNA 5K5BA 1SKOA 3CPTB 1EI5A 3L9KA 2XSSA 3GR2A 4HESA 4KZ9A 3HJIA 1PW1A 3VOLA 1M40A 3ZVTA 4GHIB 1K54C 4F3LA 4EERA 1CQAA 3UB6A 1PFLA 4MN6A 2HDQA 4OLGA 5CERA 3A3FA 2UWXA 4OPYA 4UHUA 3OPRA 1K0KA 1K6SA 1L3LA 2WKQA 2R9WA 2ZC6B 3H7WB 1MY8A 4R38A 3L7HA 2ZMVA 3C7VA 4L9EA 3I7JA 3SH7A 5DF8A 5CECA 2L0WA 3P09A 2PAVP 1GHMA 4ARZA 4HH3A 5HWWA 1GA0A 5U47A 1FR1A 4WELA 3CITA 3SS4A 4FOFA 3IX8A 5KIZA 2KX6A 5DJUA 3K3CA 1O07A 1YLTA 2H5SA 1YMSA 4FD8A 3UMDA 1IKGA 2XA7S 3ZNTA 2JN7A 4R4RA 4OVDA 2QZ6A 2O9BA 4QD4A 5HAIA 1GSXA 5DF7A 4QHCA 4WMCA 4WLAA 2K2NA 1OTAA 2V9AA 2CC1A 4WUJA 5FDHA 2QPNA 3VSKA 3T1XA 2EFXA 2HV1A 1KE0A 4BD0A 4AFIA 2PHYA 3M6HA 2QJ7A 4N9KA 1GSVA 1M6KA 3NDGA 4IUHA 3VOZA 4XT2B 1XPBA 3RH8B 1OTDA 2PU4A 1N9BA 5KMWA 3IS2B 4EQ1A 3S7PA 4H6JB 4BL2A 1E3UD 1VB6A 3LUQA 5HW3A 2ZC3B 5FAQA 2IWCA 3NIAA 1XXMA 4Y3IA 5DF9A 2VLGA 2EFUA 4DE2A 4C75A 3FPWA 4S2KA 1IYPA 3C30A 3ISGA 5A8BA 2DMWA 3KSFA 5CTMA 3LR4A 3N4IA 4S2LA 4NG2A 2VJWA 1S6RA 4PPRA 4X53A 2O0YA 1WYCA 2VGKA 3RXXA 1T1CA 1PRQA 4YNRA 5LBRA 3C5AA 4E3KA 5CXWA 5FDSA 5DFYA 4R4SA 4CLCC 2XK1A 5AJGA 5EUAA 1XGIA 3BQ8A 5EM1A 1CI9A 4UQIS 3BECA 4LRXC 4DKIA 3T4OA 3IT9A 1ODVA 3H82B 1RGZA 4OPQA 2Y4AA 4XUZA 5FAPA 2B18A 5CHJA 3MBZA 4LRZE 1MBLA 1T18A 1TD5A 1IOUA 2JKRI 1S67L 5AQAA 3QNCA 4OQHA 4FTXA 3R7WA 1N9NA 5FEGA 3DWKA 3HBRA 4JXGA 2GZAA 2JKTI 2V1BA 3TRCA 1GHIA 4Y7PA 2K7SA 4C6YA 3UN7A 5F5YA 3W4QA 1OT9A 5EECA 1K4EA 5GHYA 1FSYA 1XA1A 2P7JA 1V9ZA 5E2FA 1OTBA 1H8MA 5F1FA 3NC8A 2A24A 1NWZA 4KQDA 1VEUB 2EX8A 1KDWA 2J3TD 1CF0A 1NYYA 2Z2LB 3OPLA 2GNXA 4LV3A 4QU3A 4DJ2A 4ZAMA 1A0KA 3JVUA 2XDMA 1JNUA 1MWRA 2XF3A 5HL1A 1TS8A 2HDSA 3Q82A 4HY8A 4R3BA 1S4RA 4UEYA 1FOFA 3SW1A 4HBUA 3F1NA 4FUWA 4ZJ1A 5DTKA 3G2YA 2WKIA 3A3IA 1MZUA 1YMXA 4B9OA 3V50A 4OQGA 3IBJA 4K08A 2ZC7A 1TF1A 1E3UA 5IS1A 3A3JA 3V3RA 1NZUA 3MF0A 5A92A 1W79A 3T4KA 3G31A 4I38A 2G7UA 2V0UA 2VK3A 2JCHA 2V1AA 1HD8A 4Q0IA 4DJ3A 3T4SA 5IHVA 5AQ7A 3GVBA 2C5WB 3UE0A 4E6WA 4WZ5C 3LFVA 4EQIA 1SDNA 4CQHA 1EW0A 3MKEA 2L4RA 4E3OA 3LY4A 3CWFA 4Y17A 4F94A 3T4QA 3OZHA 3IXHA 1MKMA 3E2LA 2FZ0A 1MKIA 1S1ZA 3ICYA 4DDSA 1YLJA 4H8RA 3PBQA 4IVIA 2LB5A 3MZFA 5FAOA 4KZBA 2PU2A 3PBNA 4ZJ3A 4Q0HA 5EVIA 1YLYA 2PRFA 4LCMA 1ESUA 4ZTKA 1T19A 5DTTA 3ZFZA 1P0ZA 1Y54A 1LT0A 1ES2A 5HZHA 4HIAA 3QP1A 4O01A 2CMNA 2PR6A 3WS0A 3DTMA 2JKRM 5L09A 2XROA 2XFSA 5GLBA 1DJBA 4P0MA 1GSWA 3NULA 4L0LA 2WZXA 5EM0A 3BQAA 1MWUA 2XQZA 4BL3A 4I39A 2XEPA 2JKTM 3IX3A 1DP8A 4BLMA 2V20A 4O7DA 1FILA 1Z6FA 3LI8A 4S2PA 4RQ9A 1C3BA 4JGOA 3G35A 2BTFP 4KG6A 3PAEA 2FFYA 2ZLYA 1BTLA 4RYEA 2WGWA 1Q2PA 4GS9A 1L0GA 2J80A 1YKDA 4GDBA 3UNWA 3F1PA 4LCLA 2W1TB 3RTYA 5I94A 4NEED 4E3JA 1ESIA 2HJEA 3ZG9B 4C3QA 1ZKJA 5E2GA 4GNUA 5FA7A 4OPZA 4DDYA 1BT5A 3C7UA 2JC7A 1SCWA 4Y2FA 3BYDA 4NXEA 1LLBA 2WAEA 5C5KA 2AVXA 1HLUP 4KZ6A 1NXYA 3R4KA 1PI4A 1IYQA 3D3OA 4X69A 4I3JA 3HREA 1XA7A 2OSUA 4DF6A 3EQVA 2HF6A 4Y0UA 3V67A 4PKYG 2B95A 2Y79A 4KZAA 5HD5A 1K56D 5CEDA 2FFFB 3A0SA 3VSLA 5FI2A 2J9OA 2PD7A 2J3WA 3AGDA 2H0TA 5JYOA 3IF6C 3SS3A 3ZYTA 4YWZA 4MBFA 5GLAA 1PW8A 3EGDC 1RP5A 1SZVA 2Y2KA 4P6ZM 5EV0A 1UWPX 3TW8A 3MQOA 3BEBA 5HDSA 1BYWA 3KSIA 3OCLA 3MQ0A 4KZ8A 3IXBA 2V8FA 1F9IA 1FQGA 4RX3A 3T1QB 1LL8A 4WF0A 1YLWA 1N4OA 2PR5A 4R3AA 3BFGA 4IEDA 3LIAA 3EWKA 2VV7A 4MBKA 3BLMA 1FCMA 1XKZA 3VE3A 4OOYA 4JXWA 3C8CA 3DTEA 4WEKA 3E98A 1XJ2A 4M3KA 3Q7VB 3MZDA 5FQKA 3ZNYA 1YLPA 1IFQA 4CLCD 3O86A 4S2NA 5FATA 4R23A 3S22A 3P7NA 4B93A 4ZRRA 2L1MA 3QP5A 3HJKA 3CPTA 1SKOB 1I5QA 5DKLA 1S0WA 5FI7A 2YKHA 4UA6A 2W3EA 4BQMA 3BFCA 3CMZA 3B42A 4K0XA 3IQAA 1NRFA 3BJNA 4EUVA 1Z09A 3IWOA 3D9YA 2KLIA 4G3VA 1PWCA 4WM9A 1IELA 2RCXA 2WGIA 2WKEA 3MXQA 4HI4A 1LL5A 1DY6A 4QPRA 3MKFA 1JWPA 2W0NA 4JXVA 3UPPA 4OP8A 4R3JA 2HP9A 4KQQA 5EE8A 3M2JA 1KGFA 5J7EA 3HLGA 5F83A 2V2FF 3DBAA 2IWBA 4BMWA 4D60A 4JXSA 4X55A 2KDKA 2HP6A 1S1YA 2Y2JA 3HLWA 1Y28A 2WKRA 2C6WB 3PYPA 4N1XA 4GJ4A 2XA7M 5AVFA 2WUQA 4X1LA 3QP2A 4CLCE 2J8YA 3PBSA 2VA0A 1YAXA 3C2WA 3FPVA 1KVLA 3MSHA 4IVKA 2Y2NA 5DJTA 3DW0A 4NXGA 3LIEA 5HARA 3UB7A 2EA9A 4GW9A 1U60A 2Y2MA 4XT2A 4RX2A 5E2EA 1WE4A 3VP2A 3QP8A 1JWZA 3NBLA 2WADA 3IS2A 2YKFA 5E2HA 3TJZC 2B02A 2G2WA 4YINA 2ZQAA 3G34A 5CTNA 5DVAA 1DJAA 3UB9A 2FH5A 4R1GA 3UY6A 4BENA 5GLCA 4MN7A 4PM6A 2WZZA 2ZQ8A 5CRFA 1OMEA 4X6TA 4DE1A 4O8GA 4NXFA 1YSPA 4DE3A 1YLZA 2PYRA 2XR0A 4EV4A 3O5YA 1SDEA 3TOIA 3N8LA 4FSFA 1F5MA 1ERQA 5F82A 4DRTA 4OOMA 4Y0TA 1X0OA 3LGOA 4CLCB 2BG1A
chains in the Genus database with same CATH topology
4NK3A 2J7VA 2WGVA 2ZMAA 2JCHA 1K54A 2ZC5B 3GRJA 1PZOA 2HPBA 1HD8A 3BRMA 4Z9QA 3HLFA 5D3OA 2WYXA 5IHVA 4N1HA 4S2JA 5AQ7A 2EXBA 3VMAA 3GVBA 2QMIA 3VP1A 3ZDJA 3LEZA 1XP4A 2XD1A 3IF5A 2C5WB 2XGNA 3G30A 2ZQCA 3UE0A 3M2KA 1FCNA 1K4FA 2B5RA 3A3DA 1QMFA 2OLUA 5CGSA 4E6WA 1G6AA 4UA9A 3ITBA 2Y59A 4WZ5C 4EQIA 3UDFA 1SDNA 3PTEA 4P6BA 3MXSA 1MPLA 1HZOA 3HUOA 3MKEA 4KQRA 4E3OA 3D4FA 3LY4A 1PYYA 4XUXA 3HUNA 2HP5A 3FKWA 3FV7A 4F94A 2X01A 3OZHA 4ZJ2A 4KZ4A 5EOEA 4EBNA 4GD8A 3IXHA 1ALQA 5FQIA 3E2LA 3IWQA 5TR7A 4QB8A 1I2SA 2G2UA 1EROA 1JVJA 1W8YA 1KGGA 2ZQDA 1MKIA 3VP4A 1DJCA 3ZHHA 4KZ3A 1YLJA 4H8RA 3PBQA 4IVIA 4DDSA 5M19A 3N7WA 4DXBA 4U3TA 3WRZA 3NCKA 1Q2QA 3VP3A 1K25A 1O7EA 1IYOA 3FZCA 3MZFA 1GHPA 4GOGA 5FAOA 1FCOA 2XH9A 4X56A 3S4XA 1AXBA 4S2MA 4KZBA 2PU2A 3PBNA 4ZJ3A 4BJPA 4E3NA 5EVIA 3W4OA 3IF6A 3UO9A 1K55C 1YLYA 5GLDA 4MLLA 5CGXA 4OONA 4JF5A 5KSHA 1L2SA 4LCMA 1BLPA 2XLNA 3BLSA 2I72A 1ESUA 1K56A 1MWTA 4ZTKA 2RL3A 4ZDXA 2Y2OA 5DTTA 3SS5A 3Q81A 2EX9A 1H8YA 3ZFZA 3NI9A 1Y54A 4OPRA 3BM6A 3CG5A 3W8KA 1ES2A 3WRTA 5E43A 3QHYA 3MZEA 1CEFA 2OV5A 3OCNA 1BLCA 4JF4A 3IH8A 3WS0A 3DTMA 3O3VA 2OLVA 4HEFA 4YFMA 1LI9A 1KDSA 3IXDA 4OLDA 2XFTA 2XFSA 5GLBA 1DJBA 4P0MA 5A93A 1QMEA 2Y2PA 4L0LA 5M1AA 2WZXA 3A3EA 4GD6A 3FYZA 1PI5A 1VQQA 4PM7A 1MWUA 2XQZA 3SH9A 3ZG5A 5HAPA 4BL3A 2IWDA 2PBYA 1CK3A 4KG5A 4WZ4A 4JBFA 3CJMA 2XEPA 3WS2A 5FQ9A 1BLHA 3SOIA 1E25A 3IHBA 1NZOA 3Q7VA 4BLMA 2H10A 5A91A 5HFOA 2V20A 4O7DA 4WBGA 1Z6FA 4S2PA 1NJ4A 2A49A 1C3BA 4OQ0A 1KGEA 3G35A 2EXAA 2DRWA 1ONGA 2ZM8A 3TSGA 4KG6A 3GQZA 1LL9A 3VP0A 3PAEA 1BLSA 1KE3A 2FFYA 3G2ZA 4BD1A 2ZLYA 1BTLA 4RYEA 2WGWA 3BFEA 3JYIA 1Q2PA 1L0GA 4GDBA 4B4XA 3PBTA 1K38A 4NETA 3UNWA 1EI5A 4LCLA 3N8SA 5I94A 3GR2A 3GTCA 1IEMA 2Q9MA 5KZHA 1VM1A 3ZCZA 4HESA 4E3LA 4KZ9A 3O87A 1YT4A 1PW1A 3ZVTA 1M40A 4E3JA 1ES5A 1ESIA 1JWVA 5AQ9A 4U0XA 1K54C 3ZG9B 4C3QA 1ZKJA 4FH4A 5E2GA 4IBXA 4GNUA 5FA7A 4OPZA 2HDQA 1TDGA 4DDYA 4OLGA 5AQBA 5GHXA 1BT5A 3C7UA 4GDNA 5CERA 4EUZA 3A3FA 2UWXA 2JC7A 4OPYA 4UHUA 3UE1A 1LI0A 3OPRA 1K6SA 1SCWA 3WWXA 2R9WA 4GKUA 2ZC6B 3PBRA 5HAQA 3HUMA 1W8QA 3BYDA 3E2KA 1L0FA 1MY8A 2Q9NA 1LLBA 4OKPA 2WAEA 3C7VA 3I7JA 3SH7A 3G32A 4PM9A 1BSGA 5DF8A 4KZ6A 1NXYA 3OPPA 5CECA 2XD5A 3P09A 3ZVWA 1PI4A 1MWSA 3RXWA 1ES3A 1GHMA 1GCEA 2JBFA 3N6IA 1GA0A 4LENA 1IYQA 5U47A 4X69A 1NYMA 3HREA 1FR1A 1K6RA 4WELA 5FQQA 3SS4A 4E3MA 1XA7A 2OSUA 4DF6A 3EQVA 4QJGA 4Y0UA 5EVID 1O07A 3NY4A 3HLDA 1YLTA 1BZAA 2H5SA 3OPHA 1YMSA 2J9PA 1EWZA 3EQUA 1SKFA 1IKGA 1H8ZA 4FD8A 1K56D 4X68A 5CEDA 3ZNTA 3UPOA 1PZPA 1TEMA 4OVDA 2QZ6A 2FFFB 4R4RA 4CJNA 1HTZA 3VSLA 5FI2A 2Y2GA 4S2IA 5JYPA 2J9OA 4CPKA 4LV2A 1K57C 1K57A 2ZM0A 4QD4A 3AGDA 5HAIA 3FKVA 2Y2QA 3HLCA 5FI6A 4JF6A 2BLSA 2H0TA 5DF7A 4QHCA 4WMCA 5JYOA 5EVIC 3IF6C 3SS3A 2WK0A 5F1GA 3IWIA 4PM8A 4MBFA 5GLAA 2CC1A 1PW8A 4KG2A 1HVBA 2X02A 4P85A 5FDHA 2QPNA 3VSKA 2EFXA 1KE0A 1RP5A 4BD0A 2Y2KA 3M6HA 3C4PA 4N9KA 3BEBA 5CGWA 1M6KA 3TG9A 2ZM2A 3NDGA 3VOZA 2P9VB 4OOLA 1XPBA 1YM1A 3IHAA 2DCFA 2PU4A 1N9BA 3OCLA 5KMWA 2ZD8A 4KZ8A 3IXBA 3FWLA 1FQGA 4PMAA 4RX3A 4BL2A 1E3UD 1YLWA 1N4OA 4D2OA 5HW3A 2ZC3B 4LV0A 2A3UA 2WAFA 1ZC2A 4B88A 5FAQA 3BFGA 4IEDA 4RVAA 4UA7A 5GHZA 1ZG4A 2ZQ7A 2IWCA 2ZJ9A 3NIAA 3GMWA 1XXMA 4MBKA 5DF9A 3AGEA 3BLMA 3NDEA 1W5DA 4KZAA 4WYYA 1FCMA 2EFUA 4DE2A 1XKZA 4C75A 4S2OA 4OOYA 4JXWA 4S2KA 1BUEA 4WEKA 1IYPA 3ISGA 3Q7ZA 4M3KA 5CTMA 3VFHA 3Q7VB 3N4IA 1IYSA 2Y55A 4KZ5A 4S2LA 3MZDA 5FQKA 3ZNYA 1YLPA 5TFQA 1S6RA 2R9XA 4PPRA 1E4DA 3O86A 4S2NA 5J8XA 4FCFA 5FATA 4X53A 4R23A 3S22A 3ZGAB 3C4OA 4HBTA 3GV9A 1L0EA 1WYCA 5FSRA 3V3SA 1GA9A 1CI8A 2GDNA 2VGKA 3RXXA 3IH9A 3VFFA 1I5QA 1S0WA 5FI7A 1MXOA 3O88A 4UA6A 3BFFA 3RJUA 3C5AA 4E3KA 5CXWA 4BQMA 3BFCA 3CMZA 1XGJA 4KQOA 4R4SA 4MNRA 4K0XA 2XK1A 4R0QA 5EUAA 3IQAA 3P98A 3Q07A 1ERMA 3VOYA 1XGIA 2P74A 1NRFA 1CI9A 2Y2HA 3IWOA 3BECA 4RA7A 4DKIA 4MBHA 3IXGA 5GL9A 1CEGA 1PWCA 1IELA 2RCXA 2WGIA 2WKEA 4WM9A 4A5RA 3IT9A 1LL5A 1RGZA 4OPQA 2Y4AA 3LO7A 4XUZA 1DY6A 5FAPA 5CHJA 3MBZA 3V39A 1SHVA 1IKIA 1MBLA 1JWPA 3MKFA 3N8RA 4JLFA 4JXVA 4GZBA 3UPPA 1G68A 1KVMA 3PAGA 4LV1A 4OP8A 4OH0A 5AQAA 3QNCA 4R3JA 4QY5A 4UAAA 4OQHA 5BOHA 4WMCD 2HP9A 4KQQA 5EE8A 1LHYA 5EVLA 4PM5A 3DWKA 3QNBA 3ZG8B 3M2JA 4QY6A 1KGFA 3HBRA 3HLGA 4WZ5A 5F83A 2V2FF 3AGFA 4JXGA 2IWBA 4K0WA 4JXSA 2HP6A 4X55A 4P87A 2HDUA 1GHIA 4Q8IA 4JPMA 2Y2JA 3LY3A 4Y7PA 4EBPA 4IBRA 5KSCA 3HLWA 4C6YA 3UN7A 5EOOA 4JKTA 4OP5A 3W4QA 2C6WB 4MEZA 5EECA 1K4EA 2X71A 5GHYA 4N1XA 1RGYA 2WUQA 4ID4A 5G18A 3MXRA 4E6XA 1FSYA 3M6BA 2Y91A 3WS1A 1XX2A 1BULA 1XA1A 2HDRA 2J8YA 3PBSA 5E2FA 3LCEA 4GB7A 2V1ZA 5F1FA 4GN2A 3NC8A 5FQJA 1FSWA 2EX8A 1KVLA 4B4ZA 1KDWA 2Z2MB 1NYYA 5EVIB 4EWFA 3IF6B 4IVKA 2Z2LB 1W7FA 2Y2NA 2ZQ9A 3OPLA 4K91A 4LV3A 3DW0A 2H0YA 4QU3A 5EPHA 3OC2A 1ZG6A 5HARA 1L0DA 3UPNA 4ZBEA 1K55A 5CHUA 4ZAMA 1RCJA 3ZG7B 1U60A 2Y2MA 2P9VA 4RX2A 5E2EA 1WE4A 4OQIA 3VP2A 2DNSA 5CEBA 1JTGA 4WEJA 3BFDA 1JWZA 1PIOA 1J9MA 2ZC4B 3HVFA 3NBLA 2XDMA 2WADA 1MWRA 4FH2A 4EBLA 3HL9A 2E8IA 3S1YA 2XF3A 4DXCA 1H5XA 5E2HA 3WS4A 5HL1A 2EX6A 3GSGA 2G2WA 3WS5A 4YINA 3ZG0A 3ITAA 2HDSA 3Q82A 1PWDA 2ZQAA 4R3BA 2VGJA 3G34A 1FOFA 3PBOA 5CTNA 5DVAA 3SH8A 4HBUA 1PWGA 4N92A 1NY0A 4XXRA 3W4PA 1DJAA 4N9LA 4DE0A 4ZJ1A 5DTKA 4S2NC 4BENA 4R1GA 4KZ7A 3UY6A 1WYBA 3CZDA 5FQMA 5GLCA 3G2YA 3UE3A 2WKIA 4PM6A 2WZZA 3UDXA 5TGFA 3A3IA 1ONHA 2ZQ8A 4Y0OA 1OMEA 1YMXA 3B3XA 1ES4A 5CRFA 5M18A 4X6TA 3MFDA 4DE1A 2WGWB 1YQSA 5CHMA 3V50A 5L2FA 4KENB 4OQGA 3HLEA 2WKHA 5DTSA 1TDLA 2ZC7A 5HX9A 3HLBA 3Q1FA 4E3IA 4DE3A 1YLZA 3V5MA 1E3UA 4U0TA 3A3JA 1TVFA 2XR0A 2JE5A 1I2WA 1KE4A 3V3RA 3G4PA 4EV4A 5A90A 2Y2LA 1FR6A 1NZUA 1SDEA 5A92A 2Y2IA 3TOIA 3N8LA 1W79A 3DWZA 4FSFA 3UDIA 1ERQA 2EX2A 3G31A 5FASA 5F82A 1JTDA 4DRTA 4OOMA 4Y0TA 2BG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NK3 A;  2J7V A;  2WGV A;  2ZMA A;  2JCH A;  1K54 A;  2ZC5 B;  3GRJ A;  1PZO A;  2HPB A;  1HD8 A;  3BRM A;  4Z9Q A;  3HLF A;  5D3O A;  2WYX A;  5IHV A;  4N1H A;  4S2J A;  5AQ7 A;  2EXB A;  3VMA A;  3GVB A;  2QMI A;  3VP1 A;  3ZDJ A;  3LEZ A;  1XP4 A;  2XD1 A;  3IF5 A;  2C5W B;  2XGN A;  3G30 A;  2ZQC A;  3UE0 A;  3M2K A;  1FCN A;  1K4F A;  2B5R A;  3A3D A;  1QMF A;  2OLU A;  5CGS A;  4E6W A;  1G6A A;  4UA9 A;  3ITB A;  2Y59 A;  4WZ5 C;  4EQI A;  3UDF A;  1SDN A;  3PTE A;  4P6B A;  3MXS A;  1MPL A;  1HZO A;  3HUO A;  3MKE A;  4KQR A;  4E3O A;  3D4F A;  3LY4 A;  1PYY A;  4XUX A;  3HUN A;  2HP5 A;  3FKW A;  3FV7 A;  4F94 A;  2X01 A;  3OZH A;  4ZJ2 A;  4KZ4 A;  5EOE A;  4EBN A;  4GD8 A;  3IXH A;  1ALQ A;  5FQI A;  3E2L A;  3IWQ A;  5TR7 A;  4QB8 A;  1I2S A;  2G2U A;  1ERO A;  1JVJ A;  1W8Y A;  1KGG A;  2ZQD A;  1MKI A;  3VP4 A;  1DJC A;  3ZHH A;  4KZ3 A;  1YLJ A;  4H8R A;  3PBQ A;  4IVI A;  4DDS A;  5M19 A;  3N7W A;  4DXB A;  4U3T A;  3WRZ A;  3NCK A;  1Q2Q A;  3VP3 A;  1K25 A;  1O7E A;  1IYO A;  3FZC A;  3MZF A;  1GHP A;  4GOG A;  5FAO A;  1FCO A;  2XH9 A;  4X56 A;  3S4X A;  1AXB A;  4S2M A;  4KZB A;  2PU2 A;  3PBN A;  4ZJ3 A;  4BJP A;  4E3N A;  5EVI A;  3W4O A;  3IF6 A;  3UO9 A;  1K55 C;  1YLY A;  5GLD A;  4MLL A;  5CGX A;  4OON A;  4JF5 A;  5KSH A;  1L2S A;  4LCM A;  1BLP A;  2XLN A;  3BLS A;  2I72 A;  1ESU A;  1K56 A;  1MWT A;  4ZTK A;  2RL3 A;  4ZDX A;  2Y2O A;  5DTT A;  3SS5 A;  3Q81 A;  2EX9 A;  1H8Y A;  3ZFZ A;  3NI9 A;  1Y54 A;  4OPR A;  3BM6 A;  3CG5 A;  3W8K A;  1ES2 A;  3WRT A;  5E43 A;  3QHY A;  3MZE A;  1CEF A;  2OV5 A;  3OCN A;  1BLC A;  4JF4 A;  3IH8 A;  3WS0 A;  3DTM A;  3O3V A;  2OLV A;  4HEF A;  4YFM A;  1LI9 A;  1KDS A;  3IXD A;  4OLD A;  2XFT A;  2XFS A;  5GLB A;  1DJB A;  4P0M A;  5A93 A;  1QME A;  2Y2P A;  4L0L A;  5M1A A;  2WZX A;  3A3E A;  4GD6 A;  3FYZ A;  1PI5 A;  1VQQ A;  4PM7 A;  1MWU A;  2XQZ A;  3SH9 A;  3ZG5 A;  5HAP A;  4BL3 A;  2IWD A;  2PBY A;  1CK3 A;  4KG5 A;  4WZ4 A;  4JBF A;  3CJM A;  2XEP A;  3WS2 A;  5FQ9 A;  1BLH A;  3SOI A;  1E25 A;  3IHB A;  1NZO A;  3Q7V A;  4BLM A;  2H10 A;  5A91 A;  5HFO A;  2V20 A;  4O7D A;  4WBG A;  1Z6F A;  4S2P A;  1NJ4 A;  2A49 A;  1C3B A;  4OQ0 A;  1KGE A;  3G35 A;  2EXA A;  2DRW A;  1ONG A;  2ZM8 A;  3TSG A;  4KG6 A;  3GQZ A;  1LL9 A;  3VP0 A;  3PAE A;  1BLS A;  1KE3 A;  2FFY A;  3G2Z A;  4BD1 A;  2ZLY A;  1BTL A;  4RYE A;  2WGW A;  3BFE A;  3JYI A;  1Q2P A;  1L0G A;  4GDB A;  4B4X A;  3PBT A;  1K38 A;  4NET A;  3UNW A;  1EI5 A;  4LCL A;  3N8S A;  5I94 A;  3GR2 A;  3GTC A;  1IEM A;  2Q9M A;  5KZH A;  1VM1 A;  3ZCZ A;  4HES A;  4E3L A;  4KZ9 A;  3O87 A;  1YT4 A;  1PW1 A;  3ZVT A;  1M40 A;  4E3J A;  1ES5 A;  1ESI A;  1JWV A;  5AQ9 A;  4U0X A;  1K54 C;  3ZG9 B;  4C3Q A;  1ZKJ A;  4FH4 A;  5E2G A;  4IBX A;  4GNU A;  5FA7 A;  4OPZ A;  2HDQ A;  1TDG A;  4DDY A;  4OLG A;  5AQB A;  5GHX A;  1BT5 A;  3C7U A;  4GDN A;  5CER A;  4EUZ A;  3A3F A;  2UWX A;  2JC7 A;  4OPY A;  4UHU A;  3UE1 A;  1LI0 A;  3OPR A;  1K6S A;  1SCW A;  3WWX A;  2R9W A;  4GKU A;  2ZC6 B;  3PBR A;  5HAQ A;  3HUM A;  1W8Q A;  3BYD A;  3E2K A;  1L0F A;  1MY8 A;  2Q9N A;  1LLB A;  4OKP A;  2WAE A;  3C7V A;  3I7J A;  3SH7 A;  3G32 A;  4PM9 A;  1BSG A;  5DF8 A;  4KZ6 A;  1NXY A;  3OPP A;  5CEC A;  2XD5 A;  3P09 A;  3ZVW A;  1PI4 A;  1MWS A;  3RXW A;  1ES3 A;  1GHM A;  1GCE A;  2JBF A;  3N6I A;  1GA0 A;  4LEN A;  1IYQ A;  5U47 A;  4X69 A;  1NYM A;  3HRE A;  1FR1 A;  1K6R A;  4WEL A;  5FQQ A;  3SS4 A;  4E3M A;  1XA7 A;  2OSU A;  4DF6 A;  3EQV A;  4QJG A;  4Y0U A;  5EVI D;  1O07 A;  3NY4 A;  3HLD A;  1YLT A;  1BZA A;  2H5S A;  3OPH A;  1YMS A;  2J9P A;  1EWZ A;  3EQU A;  1SKF A;  1IKG A;  1H8Z A;  4FD8 A;  1K56 D;  4X68 A;  5CED A;  3ZNT A;  3UPO A;  1PZP A;  1TEM A;  4OVD A;  2QZ6 A;  2FFF B;  4R4R A;  4CJN A;  1HTZ A;  3VSL A;  5FI2 A;  2Y2G A;  4S2I A;  5JYP A;  2J9O A;  4CPK A;  4LV2 A;  1K57 C;  1K57 A;  2ZM0 A;  4QD4 A;  3AGD A;  5HAI A;  3FKV A;  2Y2Q A;  3HLC A;  5FI6 A;  4JF6 A;  2BLS A;  2H0T A;  5DF7 A;  4QHC A;  4WMC A;  5JYO A;  5EVI C;  3IF6 C;  3SS3 A;  2WK0 A;  5F1G A;  3IWI A;  4PM8 A;  4MBF A;  5GLA A;  2CC1 A;  1PW8 A;  4KG2 A;  1HVB A;  2X02 A;  4P85 A;  5FDH A;  2QPN A;  3VSK A;  2EFX A;  1KE0 A;  1RP5 A;  4BD0 A;  2Y2K A;  3M6H A;  3C4P A;  4N9K A;  3BEB A;  5CGW A;  1M6K A;  3TG9 A;  2ZM2 A;  3NDG A;  3VOZ A;  2P9V B;  4OOL A;  1XPB A;  1YM1 A;  3IHA A;  2DCF A;  2PU4 A;  1N9B A;  3OCL A;  5KMW A;  2ZD8 A;  4KZ8 A;  3IXB A;  3FWL A;  1FQG A;  4PMA A;  4RX3 A;  4BL2 A;  1E3U D;  1YLW A;  1N4O A;  4D2O A;  5HW3 A;  2ZC3 B;  4LV0 A;  2A3U A;  2WAF A;  1ZC2 A;  4B88 A;  5FAQ A;  3BFG A;  4IED A;  4RVA A;  4UA7 A;  5GHZ A;  1ZG4 A;  2ZQ7 A;  2IWC A;  2ZJ9 A;  3NIA A;  3GMW A;  1XXM A;  4MBK A;  5DF9 A;  3AGE A;  3BLM A;  3NDE A;  1W5D A;  4KZA A;  4WYY A;  1FCM A;  2EFU A;  4DE2 A;  1XKZ A;  4C75 A;  4S2O A;  4OOY A;  4JXW A;  4S2K A;  1BUE A;  4WEK A;  1IYP A;  3ISG A;  3Q7Z A;  4M3K A;  5CTM A;  3VFH A;  3Q7V B;  3N4I A;  1IYS A;  2Y55 A;  4KZ5 A;  4S2L A;  3MZD A;  5FQK A;  3ZNY A;  1YLP A;  5TFQ A;  1S6R A;  2R9X A;  4PPR A;  1E4D A;  3O86 A;  4S2N A;  5J8X A;  4FCF A;  5FAT A;  4X53 A;  4R23 A;  3S22 A;  3ZGA B;  3C4O A;  4HBT A;  3GV9 A;  1L0E A;  1WYC A;  5FSR A;  3V3S A;  1GA9 A;  1CI8 A;  2GDN A;  2VGK A;  3RXX A;  3IH9 A;  3VFF A;  1I5Q A;  1S0W A;  5FI7 A;  1MXO A;  3O88 A;  4UA6 A;  3BFF A;  3RJU A;  3C5A A;  4E3K A;  5CXW A;  4BQM A;  3BFC A;  3CMZ A;  1XGJ A;  4KQO A;  4R4S A;  4MNR A;  4K0X A;  2XK1 A;  4R0Q A;  5EUA A;  3IQA A;  3P98 A;  3Q07 A;  1ERM A;  3VOY A;  1XGI A;  2P74 A;  1NRF A;  1CI9 A;  2Y2H A;  3IWO A;  3BEC A;  4RA7 A;  4DKI A;  4MBH A;  3IXG A;  5GL9 A;  1CEG A;  1PWC A;  1IEL A;  2RCX A;  2WGI A;  2WKE A;  4WM9 A;  4A5R A;  3IT9 A;  1LL5 A;  1RGZ A;  4OPQ A;  2Y4A A;  3LO7 A;  4XUZ A;  1DY6 A;  5FAP A;  5CHJ A;  3MBZ A;  3V39 A;  1SHV A;  1IKI A;  1MBL A;  1JWP A;  3MKF A;  3N8R A;  4JLF A;  4JXV A;  4GZB A;  3UPP A;  1G68 A;  1KVM A;  3PAG A;  4LV1 A;  4OP8 A;  4OH0 A;  5AQA A;  3QNC A;  4R3J A;  4QY5 A;  4UAA A;  4OQH A;  5BOH A;  4WMC D;  2HP9 A;  4KQQ A;  5EE8 A;  1LHY A;  5EVL A;  4PM5 A;  3DWK A;  3QNB A;  3ZG8 B;  3M2J A;  4QY6 A;  1KGF A;  3HBR A;  3HLG A;  4WZ5 A;  5F83 A;  2V2F F;  3AGF A;  4JXG A;  2IWB A;  4K0W A;  4JXS A;  2HP6 A;  4X55 A;  4P87 A;  2HDU A;  1GHI A;  4Q8I A;  4JPM A;  2Y2J A;  3LY3 A;  4Y7P A;  4EBP A;  4IBR A;  5KSC A;  3HLW A;  4C6Y A;  3UN7 A;  5EOO A;  4JKT A;  4OP5 A;  3W4Q A;  2C6W B;  4MEZ A;  5EEC A;  1K4E A;  2X71 A;  5GHY A;  4N1X A;  1RGY A;  2WUQ A;  4ID4 A;  5G18 A;  3MXR A;  4E6X A;  1FSY A;  3M6B A;  2Y91 A;  3WS1 A;  1XX2 A;  1BUL A;  1XA1 A;  2HDR A;  2J8Y A;  3PBS A;  5E2F A;  3LCE A;  4GB7 A;  2V1Z A;  5F1F A;  4GN2 A;  3NC8 A;  5FQJ A;  1FSW A;  2EX8 A;  1KVL A;  4B4Z A;  1KDW A;  2Z2M B;  1NYY A;  5EVI B;  4EWF A;  3IF6 B;  4IVK A;  2Z2L B;  1W7F A;  2Y2N A;  2ZQ9 A;  3OPL A;  4K91 A;  4LV3 A;  3DW0 A;  2H0Y A;  4QU3 A;  5EPH A;  3OC2 A;  1ZG6 A;  5HAR A;  1L0D A;  3UPN A;  4ZBE A;  1K55 A;  5CHU A;  4ZAM A;  1RCJ A;  3ZG7 B;  1U60 A;  2Y2M A;  2P9V A;  4RX2 A;  5E2E A;  1WE4 A;  4OQI A;  3VP2 A;  2DNS A;  5CEB A;  1JTG A;  4WEJ A;  3BFD A;  1JWZ A;  1PIO A;  1J9M A;  2ZC4 B;  3HVF A;  3NBL A;  2XDM A;  2WAD A;  1MWR A;  4FH2 A;  4EBL A;  3HL9 A;  2E8I A;  3S1Y A;  2XF3 A;  4DXC A;  1H5X A;  5E2H A;  3WS4 A;  5HL1 A;  2EX6 A;  3GSG A;  2G2W A;  3WS5 A;  4YIN A;  3ZG0 A;  3ITA A;  2HDS A;  3Q82 A;  1PWD A;  2ZQA A;  4R3B A;  2VGJ A;  3G34 A;  1FOF A;  3PBO A;  5CTN A;  5DVA A;  3SH8 A;  4HBU A;  1PWG A;  4N92 A;  1NY0 A;  4XXR A;  3W4P A;  1DJA A;  4N9L A;  4DE0 A;  4ZJ1 A;  5DTK A;  4S2N C;  4BEN A;  4R1G A;  4KZ7 A;  3UY6 A;  1WYB A;  3CZD A;  5FQM A;  5GLC A;  3G2Y A;  3UE3 A;  2WKI A;  4PM6 A;  2WZZ A;  3UDX A;  5TGF A;  3A3I A;  1ONH A;  2ZQ8 A;  4Y0O A;  1OME A;  1YMX A;  3B3X A;  1ES4 A;  5CRF A;  5M18 A;  4X6T A;  3MFD A;  4DE1 A;  2WGW B;  1YQS A;  5CHM A;  3V50 A;  5L2F A;  4KEN B;  4OQG A;  3HLE A;  2WKH A;  5DTS A;  1TDL A;  2ZC7 A;  5HX9 A;  3HLB A;  3Q1F A;  4E3I A;  4DE3 A;  1YLZ A;  3V5M A;  1E3U A;  4U0T A;  3A3J A;  1TVF A;  2XR0 A;  2JE5 A;  1I2W A;  1KE4 A;  3V3R A;  3G4P A;  4EV4 A;  5A90 A;  2Y2L A;  1FR6 A;  1NZU A;  1SDE A;  5A92 A;  2Y2I A;  3TOI A;  3N8L A;  1W79 A;  3DWZ A;  4FSF A;  3UDI A;  1ERQ A;  2EX2 A;  3G31 A;  5FAS A;  5F82 A;  1JTD A;  4DRT A;  4OOM A;  4Y0T A;  2BG1 A; 
#chains in the Genus database with same CATH topology
 2J7V A;  2ZMA A;  2ZC5 B;  1PZO A;  5HL6 A;  4Z9Q A;  4UQI M;  2WYX A;  1UGU A;  3H82 A;  2EXB A;  3VMA A;  1XP4 A;  3IF5 A;  1FCN A;  1H3Q A;  5I5L A;  3UDF A;  1V9Y A;  3R7W B;  3CLO A;  1PYY A;  4XUX A;  3FKW A;  4EBN A;  3EOI A;  1I2S A;  2PYP A;  1FIK A;  2G2U A;  1ERO A;  1JVJ A;  3UB8 A;  3ZHH A;  4U3T A;  2V0W A;  1Q2Q A;  3PR6 A;  1STZ A;  3VP3 A;  4X1M A;  3FZC A;  1O7E A;  1FCO A;  2XH9 A;  4S2M A;  4EU0 A;  1VEU A;  4HJ6 A;  2PBD P;  2A24 B;  4E3N A;  3UO9 A;  1ACF A;  5GLD A;  5L07 A;  3T50 A;  5CGX A;  3LIC A;  4JF5 A;  4OON A;  1L2S A;  2I72 A;  1MWT A;  2EX9 A;  3NI9 A;  1XJ3 A;  3CG5 A;  2NUP C;  5FEF A;  2VGL S;  4BBU A;  5E43 A;  2OV5 A;  3OCN A;  4JF4 A;  1KDS A;  3IXD A;  4Y13 A;  3NOU C;  2VGL M;  4LGW A;  3BW6 A;  2ZOI A;  1CK3 A;  2Y8H A;  3GEC A;  4WZ4 A;  3IHB A;  1DP6 A;  1NJ4 A;  4GLQ A;  4OQ0 A;  2A49 A;  3F1N B;  2ZL1 A;  1LSX A;  2EXA A;  1ONG A;  3TSG A;  3GQZ A;  5TBM A;  1VET A;  1KE3 A;  3TE8 A;  3BFE A;  5G4Y A;  2W3F A;  2OWH A;  4B4X A;  1F98 A;  1K38 A;  3PBT A;  4NET A;  3P01 A;  1DRM A;  4L9G A;  3N8S A;  2Q9M A;  1VM1 A;  3O87 A;  3UME A;  1JWV A;  5AQ9 A;  4U0X A;  3U2A A;  4IBX A;  4MN5 A;  1TDG A;  5GHX A;  3UE1 A;  3WWX A;  4GKU A;  5HAQ A;  3HUM A;  1W8Q A;  3IX4 A;  3E2K A;  2Q9N A;  4OKP A;  4PM9 A;  1BSG A;  3OPP A;  1D06 A;  3ZVW A;  1MWS A;  2HZ5 A;  1ES3 A;  4HJ4 A;  4LEN A;  1NYM A;  5FQQ A;  1K6R A;  3H9W A;  4E3M A;  1OJG A;  3HLD A;  3OPH A;  1EWZ A;  1SKF A;  1UWN X;  1PZP A;  1S4S A;  1WA9 A;  1ZHH B;  4CJN A;  5CX7 A;  2QYB A;  1NLY A;  5HPF A;  3K3D A;  2Y2G A;  4S2I A;  3D72 A;  4CPK A;  1K57 C;  1K57 A;  2ZM0 A;  4ESP A;  5FI6 A;  2Y2Q A;  3HLC A;  4JF6 A;  2JKG A;  5EVI C;  3G6O A;  5F1G A;  4PM8 A;  4KUK A;  5HPI A;  2JKF A;  2ZOH A;  2X02 A;  4JGP A;  2PT7 A;  3TG9 A;  2E8J A;  2P9V B;  4OOL A;  3IHA A;  1AWI A;  1CJF A;  2ZD8 A;  4PHT A;  4PMA A;  3T1R A;  4LV0 A;  4WN5 A;  1ZC2 A;  4B88 A;  4UA7 A;  3DTI A;  1ZG4 A;  3S7O A;  2ZJ9 A;  2VV8 A;  1TS7 A;  3NDE A;  1W5D A;  4WYY A;  1BUE A;  1OPX A;  1D7E A;  3Q7Z A;  2Y55 A;  5TFQ A;  5J8X A;  4FCF A;  2P04 A;  1P9R A;  1VHM A;  2W27 A;  5FSR A;  4PKY A;  3V3S A;  5J4E A;  3IH9 A;  1DP9 A;  1MXO A;  3O88 A;  1OTI A;  3RJU A;  2NUT C;  2M7V A;  3B47 A;  4R0Q A;  1W63 M;  3Q07 A;  1ERM A;  2M1C A;  4EEU A;  2P74 A;  3F1O B;  3BY8 A;  3IXG A;  5GL9 A;  1CEG A;  3EEA A;  4A5R A;  3MR0 A;  1S66 L;  3LO7 A;  4PAU A;  3V39 A;  2LB9 A;  4I3A A;  3KSG A;  4JLF A;  3LIF A;  1G68 A;  5BOH A;  4WMC D;  1LHY A;  4PM5 A;  3C38 A;  3QNB A;  3ZG8 B;  1LSW A;  1TS0 A;  3AGF A;  3LIB A;  4Z1W A;  4P87 A;  4Q8I A;  5DKK A;  4IBR A;  5KSC A;  5EOO A;  2X71 A;  1RGY A;  2A2L A;  4ID4 A;  3NOT C;  4E6X A;  3M6B A;  2Y91 A;  3WS1 A;  3OBF A;  3LCE A;  4BBT A;  2V1Z A;  4GN2 A;  4B4Z A;  2K31 A;  3IF6 B;  1W7F A;  2ZQ9 A;  3KSH A;  5EPH A;  3OC2 A;  1ZG6 A;  1K55 A;  5CHU A;  4NXB A;  2INW A;  3ZG7 B;  3S7Q A;  4OQI A;  3T4J A;  2DNS A;  3EGX C;  3K2N A;  2HJ9 C;  4WEJ A;  1PIO A;  5J3W A;  4G3W A;  3HVF A;  4FH2 A;  4EBL A;  4HJ3 A;  1H5X A;  3ZG0 A;  1N9O A;  3SH8 A;  4N92 A;  1NY0 A;  3U4L P;  4N9L A;  4DE0 A;  4S2N C;  4KZ7 A;  1XFN A;  1WYB A;  3CZD A;  5FQM A;  4Y0O A;  3B3X A;  1ES4 A;  3MFD A;  1YQS A;  4Y5F A;  5L2F A;  1MC0 A;  3HLE A;  3ZQ5 A;  1TDL A;  3HLB A;  3Q1F A;  1G5U A;  3V5M A;  1TVF A;  2JE5 A;  1KE4 A;  2Y2L A;  1FR6 A;  2QHK A;  4GHI A;  2OOL A;  2PD8 A;  3JPU A;  3DWZ A;  3UDI A;  5F6A A;  4F3L B;  5FAS A;  1JTD A;  4Q0J A;  5G4Z A;  2WGV A;  1K54 A;  3H7W A;  3MMH A;  4ME4 A;  3HLF A;  2VKS A;  2W3G A;  2M7U A;  4N1H A;  4S2J A;  5HDC A;  3KYZ A;  2QMI A;  3VP1 A;  3ZDJ A;  2XD1 A;  2XGN A;  2OAP 1;  1K4F A;  4ARZ B;  1G6A A;  4UA9 A;  3ITB A;  2Y59 A;  3MXS A;  3D4F A;  2W3D A;  4QWO A;  3FV7 A;  4IJG A;  2X01 A;  4ZJ2 A;  4KZ4 A;  4DN0 A;  4MMN A;  5FQI A;  4M4X A;  1KGG A;  3LI9 A;  3VP4 A;  1DJC A;  4KZ3 A;  3N7W A;  4DXB A;  3NCK A;  3NOP C;  1K25 A;  5L8M A;  1IYO A;  1GHP A;  4X56 A;  3S7N A;  2QJ5 A;  3B33 A;  5KSH A;  2XLN A;  4ZDX A;  1K56 A;  2RL3 A;  3Q81 A;  1H8Y A;  3BM6 A;  3W8K A;  3EEH A;  3QHY A;  1CEF A;  4H6J A;  1P97 A;  3E4O A;  3IH8 A;  2OLV A;  1LI9 A;  2MJ6 A;  4R70 A;  2XFT A;  3UB5 P;  2Y2P A;  4DMZ A;  4IHQ A;  4GD6 A;  3FYZ A;  1PI5 A;  1VQQ A;  3GDI A;  1Y4O A;  3ZG5 A;  2KOI A;  4JBF A;  3CJM A;  3WS2 A;  5FQ9 A;  5HD3 A;  3QP4 A;  2H10 A;  5A91 A;  5HFO A;  4WBG A;  2ZMF A;  1KGE A;  3FG8 A;  3LEQ A;  2DRW A;  2ZM8 A;  4KUO A;  4LFU A;  1BLS A;  3G2Z A;  4BD1 A;  3NEC A;  3JYI A;  2Q0O A;  3PXP A;  2W1R A;  4HH2 A;  3GTC A;  1IEM A;  3VV4 A;  3NJA A;  5KZH A;  3PHY A;  3ZCZ A;  4E3L A;  1YT4 A;  1ES5 A;  4FH4 A;  2IA2 A;  4CLC A;  5AQB A;  4GDN A;  2VV6 A;  4EUZ A;  1LI0 A;  3PBR A;  4X25 A;  5F69 A;  1L0F A;  1H0M A;  3G32 A;  3IBR A;  5MC7 A;  2XD5 A;  3RXW A;  2JBF A;  1GCE A;  1OTE A;  3N6I A;  4HQA A;  1XJ6 A;  1NRJ A;  4QJG A;  3LR5 A;  5EVI D;  3T1S A;  3NY4 A;  4LPZ A;  1BZA A;  2J9P A;  3EQU A;  1H8Z A;  4X68 A;  1P9W A;  3UPO A;  3KYE A;  5IU1 A;  2QWS A;  4I3I A;  5EVE A;  1TEM A;  2Z6D A;  2R78 A;  1HTZ A;  1W63 Q;  4EEP A;  2O9C A;  5JYP A;  4LV2 A;  3FKV A;  5TJJ A;  2BLS A;  5FL3 A;  1XFQ A;  2WK0 A;  3IWI A;  4EW7 A;  1TS6 A;  3T4L A;  3LYX A;  1YSQ A;  3NHQ A;  4KG2 A;  1HVB A;  4P85 A;  3C4P A;  5CGW A;  4EET B;  2ZM2 A;  1G28 A;  2ZBB A;  3KYQ A;  3ULF A;  1YM1 A;  4EXO A;  2DCF A;  3SZT A;  3FWL A;  3CI6 A;  2EWV A;  4D2O A;  3CUE C;  3CUE A;  2A3U A;  2WAF A;  3OOV A;  3A0R A;  4BWI A;  4RVA A;  5GHZ A;  2PDR A;  2ZQ7 A;  1YPR A;  3GMW A;  3AGE A;  4S2O A;  3KO6 A;  3RFB A;  3VFH A;  2VEA A;  1IYS A;  4KZ5 A;  3E0Y A;  3E4Q A;  4I5S A;  2R9X A;  1E4D A;  2EWW A;  2ZL1 B;  3ZGA B;  3C4O A;  4HBT A;  3GV9 A;  5TBM B;  1L0E A;  1VET B;  1GA9 A;  1CI8 A;  2GDN A;  1T1B A;  5F68 A;  2Z6C A;  3VFF A;  2JHE A;  3BFF A;  3LR3 A;  5IT5 A;  1XGJ A;  4KQO A;  4MNR A;  2O9A A;  3P98 A;  4MDZ A;  3VOY A;  2ACG A;  2Y2H A;  4Y15 A;  4HNB A;  4RA7 A;  4MBH A;  2I9V A;  1D1J A;  1SHV A;  1IKI A;  3N8R A;  3MS6 A;  4GZB A;  1KVM A;  3PAG A;  4LV1 A;  3OLO A;  4OH0 A;  4QY5 A;  4UAA A;  4JGR A;  5EVL A;  5EFW A;  4QY6 A;  1ZTU A;  3MJQ A;  4WZ5 A;  4K0W A;  3KX0 X;  2HDU A;  5HDD A;  4JPM A;  3LY3 A;  4EBP A;  5HWT A;  2W3H A;  4JKT A;  4OP5 A;  4EES A;  4MEZ A;  5G18 A;  3MXR A;  4II7 A;  1XX2 A;  1BUL A;  3BWL A;  2HDR A;  4ETX A;  4GB7 A;  1F2K A;  5FQJ A;  1FSW A;  4HP9 A;  2Z2M B;  5EVI B;  4EWF A;  3E4P A;  2GJ3 A;  1OT6 A;  4K91 A;  2H0Y A;  4NKP A;  4O0P A;  3UPN A;  1L0D A;  4ZBE A;  1RCJ A;  2P9V A;  5CEB A;  1JTG A;  2VZW A;  4MCW A;  3VE4 A;  3BFD A;  5L10 A;  1J9M A;  2J3T C;  3LR0 A;  2ZC4 B;  1KOU A;  1XJ4 A;  1OJ5 A;  3HL9 A;  2E8I A;  2O99 A;  3S1Y A;  4DXC A;  3WS4 A;  2EX6 A;  3GSG A;  3DTK A;  1G6O A;  3WS5 A;  3ITA A;  2UV0 E;  1PWD A;  2D01 A;  2VGJ A;  3PBO A;  1J3W A;  2OAQ 1;  1PWG A;  4XXR A;  3W4P A;  2WKP A;  3UE3 A;  3UDX A;  5TGF A;  1ONH A;  5M18 A;  4R6L A;  2WGW B;  5CHM A;  1T1A A;  4GS9 B;  4KEN B;  2WKH A;  5DTS A;  2W1T A;  3F1P B;  5HX9 A;  3DAV A;  3FC7 A;  4E3I A;  4U0T A;  1I2W A;  5A90 A;  3G4P A;  2V8C A;  3CAX A;  2Y2I A;  2EX2 A;  2OWJ A;  3F1O A;  4NK3 A;  3GRJ A;  2HPB A;  3BRM A;  3JVV A;  5D3O A;  3T4T A;  3UE6 A;  4JGQ A;  2GX5 A;  3LEZ A;  3G30 A;  1LSV A;  2ZQC A;  4BBV A;  1NLZ A;  3M2K A;  2B5R A;  3A3D A;  1QMF A;  2OLU A;  5CGS A;  5DFX A;  3A0V A;  3PTE A;  4P6B A;  1MPL A;  1HZO A;  3HUO A;  3T12 B;  4KQR A;  3CHW P;  4HHD A;  3HUN A;  2HP5 A;  5EOE A;  4GD8 A;  2H28 A;  1ALQ A;  3QP6 A;  3IWQ A;  5TR7 A;  4GCZ A;  4QB8 A;  1W8Y A;  2ZQD A;  5AVE A;  3MFX A;  5M19 A;  2HGV A;  4IUK A;  2QKP A;  3WRZ A;  1PNE A;  4GOG A;  3S4X A;  1AXB A;  4P6Z S;  4ETZ A;  5HWV A;  1N9L A;  4BJP A;  3W4O A;  3IF6 A;  3LID A;  1K55 C;  4MLL A;  3BY9 A;  4E04 A;  1BLP A;  3BLS A;  5HSQ A;  2Y2O A;  3SS5 A;  4OPR A;  3MQQ A;  3WRT A;  3W2Z A;  3MZE A;  2VX8 A;  1BLC A;  4YOF A;  3O3V A;  4YFM A;  4HEF A;  4OLD A;  4WL9 A;  4L9F A;  5A93 A;  4LLO B;  1QME A;  5M1A A;  3A3E A;  4PM7 A;  3SH9 A;  5HAP A;  4HOI A;  2IWD A;  2PBY A;  4KG5 A;  3HCY A;  2P08 A;  4G3K A;  1BLH A;  3SOI A;  1E25 A;  3Q7V A;  1NZO A;  2D02 A;  4HP4 A;  4LRY C;  2BAS A;  1LL9 A;  3VP0 A;  2XRN A;  5K5B A;  1SKO A;  3CPT B;  1EI5 A;  3L9K A;  2XSS A;  3GR2 A;  4HES A;  4KZ9 A;  3HJI A;  1PW1 A;  3VOL A;  1M40 A;  3ZVT A;  4GHI B;  1K54 C;  4F3L A;  4EER A;  1CQA A;  3UB6 A;  1PFL A;  4MN6 A;  2HDQ A;  4OLG A;  5CER A;  3A3F A;  2UWX A;  4OPY A;  4UHU A;  3OPR A;  1K0K A;  1K6S A;  1L3L A;  2WKQ A;  2R9W A;  2ZC6 B;  3H7W B;  1MY8 A;  4R38 A;  3L7H A;  2ZMV A;  3C7V A;  4L9E A;  3I7J A;  3SH7 A;  5DF8 A;  5CEC A;  2L0W A;  3P09 A;  2PAV P;  1GHM A;  4ARZ A;  4HH3 A;  5HWW A;  1GA0 A;  5U47 A;  1FR1 A;  4WEL A;  3CIT A;  3SS4 A;  4FOF A;  3IX8 A;  5KIZ A;  2KX6 A;  5DJU A;  3K3C A;  1O07 A;  1YLT A;  2H5S A;  1YMS A;  4FD8 A;  3UMD A;  1IKG A;  2XA7 S;  3ZNT A;  2JN7 A;  4R4R A;  4OVD A;  2QZ6 A;  2O9B A;  4QD4 A;  5HAI A;  1GSX A;  5DF7 A;  4QHC A;  4WMC A;  4WLA A;  2K2N A;  1OTA A;  2V9A A;  2CC1 A;  4WUJ A;  5FDH A;  2QPN A;  3VSK A;  3T1X A;  2EFX A;  2HV1 A;  1KE0 A;  4BD0 A;  4AFI A;  2PHY A;  3M6H A;  2QJ7 A;  4N9K A;  1GSV A;  1M6K A;  3NDG A;  4IUH A;  3VOZ A;  4XT2 B;  1XPB A;  3RH8 B;  1OTD A;  2PU4 A;  1N9B A;  5KMW A;  3IS2 B;  4EQ1 A;  3S7P A;  4H6J B;  4BL2 A;  1E3U D;  1VB6 A;  3LUQ A;  5HW3 A;  2ZC3 B;  5FAQ A;  2IWC A;  3NIA A;  1XXM A;  4Y3I A;  5DF9 A;  2VLG A;  2EFU A;  4DE2 A;  4C75 A;  3FPW A;  4S2K A;  1IYP A;  3C30 A;  3ISG A;  5A8B A;  2DMW A;  3KSF A;  5CTM A;  3LR4 A;  3N4I A;  4S2L A;  4NG2 A;  2VJW A;  1S6R A;  4PPR A;  4X53 A;  2O0Y A;  1WYC A;  2VGK A;  3RXX A;  1T1C A;  1PRQ A;  4YNR A;  5LBR A;  3C5A A;  4E3K A;  5CXW A;  5FDS A;  5DFY A;  4R4S A;  4CLC C;  2XK1 A;  5AJG A;  5EUA A;  1XGI A;  3BQ8 A;  5EM1 A;  1CI9 A;  4UQI S;  3BEC A;  4LRX C;  4DKI A;  3T4O A;  3IT9 A;  1ODV A;  3H82 B;  1RGZ A;  4OPQ A;  2Y4A A;  4XUZ A;  5FAP A;  2B18 A;  5CHJ A;  3MBZ A;  4LRZ E;  1MBL A;  1T18 A;  1TD5 A;  1IOU A;  2JKR I;  1S67 L;  5AQA A;  3QNC A;  4OQH A;  4FTX A;  3R7W A;  1N9N A;  5FEG A;  3DWK A;  3HBR A;  4JXG A;  2GZA A;  2JKT I;  2V1B A;  3TRC A;  1GHI A;  4Y7P A;  2K7S A;  4C6Y A;  3UN7 A;  5F5Y A;  3W4Q A;  1OT9 A;  5EEC A;  1K4E A;  5GHY A;  1FSY A;  1XA1 A;  2P7J A;  1V9Z A;  5E2F A;  1OTB A;  1H8M A;  5F1F A;  3NC8 A;  2A24 A;  1NWZ A;  4KQD A;  1VEU B;  2EX8 A;  1KDW A;  2J3T D;  1CF0 A;  1NYY A;  2Z2L B;  3OPL A;  2GNX A;  4LV3 A;  4QU3 A;  4DJ2 A;  4ZAM A;  1A0K A;  3JVU A;  2XDM A;  1JNU A;  1MWR A;  2XF3 A;  5HL1 A;  1TS8 A;  2HDS A;  3Q82 A;  4HY8 A;  4R3B A;  1S4R A;  4UEY A;  1FOF A;  3SW1 A;  4HBU A;  3F1N A;  4FUW A;  4ZJ1 A;  5DTK A;  3G2Y A;  2WKI A;  3A3I A;  1MZU A;  1YMX A;  4B9O A;  3V50 A;  4OQG A;  3IBJ A;  4K08 A;  2ZC7 A;  1TF1 A;  1E3U A;  5IS1 A;  3A3J A;  3V3R A;  1NZU A;  3MF0 A;  5A92 A;  1W79 A;  3T4K A;  3G31 A;  4I38 A;  2G7U A;  2V0U A;  2VK3 A;  2JCH A;  2V1A A;  1HD8 A;  4Q0I A;  4DJ3 A;  3T4S A;  5IHV A;  5AQ7 A;  3GVB A;  2C5W B;  3UE0 A;  4E6W A;  4WZ5 C;  3LFV A;  4EQI A;  1SDN A;  4CQH A;  1EW0 A;  3MKE A;  2L4R A;  4E3O A;  3LY4 A;  3CWF A;  4Y17 A;  4F94 A;  3T4Q A;  3OZH A;  3IXH A;  1MKM A;  3E2L A;  2FZ0 A;  1MKI A;  1S1Z A;  3ICY A;  4DDS A;  1YLJ A;  4H8R A;  3PBQ A;  4IVI A;  2LB5 A;  3MZF A;  5FAO A;  4KZB A;  2PU2 A;  3PBN A;  4ZJ3 A;  4Q0H A;  5EVI A;  1YLY A;  2PRF A;  4LCM A;  1ESU A;  4ZTK A;  1T19 A;  5DTT A;  3ZFZ A;  1P0Z A;  1Y54 A;  1LT0 A;  1ES2 A;  5HZH A;  4HIA A;  3QP1 A;  4O01 A;  2CMN A;  2PR6 A;  3WS0 A;  3DTM A;  2JKR M;  5L09 A;  2XRO A;  2XFS A;  5GLB A;  1DJB A;  4P0M A;  1GSW A;  3NUL A;  4L0L A;  2WZX A;  5EM0 A;  3BQA A;  1MWU A;  2XQZ A;  4BL3 A;  4I39 A;  2XEP A;  2JKT M;  3IX3 A;  1DP8 A;  4BLM A;  2V20 A;  4O7D A;  1FIL A;  1Z6F A;  3LI8 A;  4S2P A;  4RQ9 A;  1C3B A;  4JGO A;  3G35 A;  2BTF P;  4KG6 A;  3PAE A;  2FFY A;  2ZLY A;  1BTL A;  4RYE A;  2WGW A;  1Q2P A;  4GS9 A;  1L0G A;  2J80 A;  1YKD A;  4GDB A;  3UNW A;  3F1P A;  4LCL A;  2W1T B;  3RTY A;  5I94 A;  4NEE D;  4E3J A;  1ESI A;  2HJE A;  3ZG9 B;  4C3Q A;  1ZKJ A;  5E2G A;  4GNU A;  5FA7 A;  4OPZ A;  4DDY A;  1BT5 A;  3C7U A;  2JC7 A;  1SCW A;  4Y2F A;  3BYD A;  4NXE A;  1LLB A;  2WAE A;  5C5K A;  2AVX A;  1HLU P;  4KZ6 A;  1NXY A;  3R4K A;  1PI4 A;  1IYQ A;  3D3O A;  4X69 A;  4I3J A;  3HRE A;  1XA7 A;  2OSU A;  4DF6 A;  3EQV A;  2HF6 A;  4Y0U A;  3V67 A;  4PKY G;  2B95 A;  2Y79 A;  4KZA A;  5HD5 A;  1K56 D;  5CED A;  2FFF B;  3A0S A;  3VSL A;  5FI2 A;  2J9O A;  2PD7 A;  2J3W A;  3AGD A;  2H0T A;  5JYO A;  3IF6 C;  3SS3 A;  3ZYT A;  4YWZ A;  4MBF A;  5GLA A;  1PW8 A;  3EGD C;  1RP5 A;  1SZV A;  2Y2K A;  4P6Z M;  5EV0 A;  1UWP X;  3TW8 A;  3MQO A;  3BEB A;  5HDS A;  1BYW A;  3KSI A;  3OCL A;  3MQ0 A;  4KZ8 A;  3IXB A;  2V8F A;  1F9I A;  1FQG A;  4RX3 A;  3T1Q B;  1LL8 A;  4WF0 A;  1YLW A;  1N4O A;  2PR5 A;  4R3A A;  3BFG A;  4IED A;  3LIA A;  3EWK A;  2VV7 A;  4MBK A;  3BLM A;  1FCM A;  1XKZ A;  3VE3 A;  4OOY A;  4JXW A;  3C8C A;  3DTE A;  4WEK A;  3E98 A;  1XJ2 A;  4M3K A;  3Q7V B;  3MZD A;  5FQK A;  3ZNY A;  1YLP A;  1IFQ A;  4CLC D;  3O86 A;  4S2N A;  5FAT A;  4R23 A;  3S22 A;  3P7N A;  4B93 A;  4ZRR A;  2L1M A;  3QP5 A;  3HJK A;  3CPT A;  1SKO B;  1I5Q A;  5DKL A;  1S0W A;  5FI7 A;  2YKH A;  4UA6 A;  2W3E A;  4BQM A;  3BFC A;  3CMZ A;  3B42 A;  4K0X A;  3IQA A;  1NRF A;  3BJN A;  4EUV A;  1Z09 A;  3IWO A;  3D9Y A;  2KLI A;  4G3V A;  1PWC A;  4WM9 A;  1IEL A;  2RCX A;  2WGI A;  2WKE A;  3MXQ A;  4HI4 A;  1LL5 A;  1DY6 A;  4QPR A;  3MKF A;  1JWP A;  2W0N A;  4JXV A;  3UPP A;  4OP8 A;  4R3J A;  2HP9 A;  4KQQ A;  5EE8 A;  3M2J A;  1KGF A;  5J7E A;  3HLG A;  5F83 A;  2V2F F;  3DBA A;  2IWB A;  4BMW A;  4D60 A;  4JXS A;  4X55 A;  2KDK A;  2HP6 A;  1S1Y A;  2Y2J A;  3HLW A;  1Y28 A;  2WKR A;  2C6W B;  3PYP A;  4N1X A;  4GJ4 A;  2XA7 M;  5AVF A;  2WUQ A;  4X1L A;  3QP2 A;  4CLC E;  2J8Y A;  3PBS A;  2VA0 A;  1YAX A;  3C2W A;  3FPV A;  1KVL A;  3MSH A;  4IVK A;  2Y2N A;  5DJT A;  3DW0 A;  4NXG A;  3LIE A;  5HAR A;  3UB7 A;  2EA9 A;  4GW9 A;  1U60 A;  2Y2M A;  4XT2 A;  4RX2 A;  5E2E A;  1WE4 A;  3VP2 A;  3QP8 A;  1JWZ A;  3NBL A;  2WAD A;  3IS2 A;  2YKF A;  5E2H A;  3TJZ C;  2B02 A;  2G2W A;  4YIN A;  2ZQA A;  3G34 A;  5CTN A;  5DVA A;  1DJA A;  3UB9 A;  2FH5 A;  4R1G A;  3UY6 A;  4BEN A;  5GLC A;  4MN7 A;  4PM6 A;  2WZZ A;  2ZQ8 A;  5CRF A;  1OME A;  4X6T A;  4DE1 A;  4O8G A;  4NXF A;  1YSP A;  4DE3 A;  1YLZ A;  2PYR A;  2XR0 A;  4EV4 A;  3O5Y A;  1SDE A;  3TOI A;  3N8L A;  4FSF A;  1F5M A;  1ERQ A;  5F82 A;  4DRT A;  4OOM A;  4Y0T A;  1X0O A;  3LGO A;  4CLC B;  2BG1 A; 
#chains in the Genus database with same CATH homology
 4NK3 A;  2J7V A;  2WGV A;  2ZMA A;  2JCH A;  1K54 A;  2ZC5 B;  3GRJ A;  1PZO A;  2HPB A;  1HD8 A;  3BRM A;  4Z9Q A;  3HLF A;  5D3O A;  2WYX A;  5IHV A;  4N1H A;  4S2J A;  5AQ7 A;  2EXB A;  3VMA A;  3GVB A;  2QMI A;  3VP1 A;  3ZDJ A;  3LEZ A;  1XP4 A;  2XD1 A;  3IF5 A;  2C5W B;  2XGN A;  3G30 A;  2ZQC A;  3UE0 A;  3M2K A;  1FCN A;  1K4F A;  2B5R A;  3A3D A;  1QMF A;  2OLU A;  5CGS A;  4E6W A;  1G6A A;  4UA9 A;  3ITB A;  2Y59 A;  4WZ5 C;  4EQI A;  3UDF A;  1SDN A;  3PTE A;  4P6B A;  3MXS A;  1MPL A;  1HZO A;  3HUO A;  3MKE A;  4KQR A;  4E3O A;  3D4F A;  3LY4 A;  1PYY A;  4XUX A;  3HUN A;  2HP5 A;  3FKW A;  3FV7 A;  4F94 A;  2X01 A;  3OZH A;  4ZJ2 A;  4KZ4 A;  5EOE A;  4EBN A;  4GD8 A;  3IXH A;  1ALQ A;  5FQI A;  3E2L A;  3IWQ A;  5TR7 A;  4QB8 A;  1I2S A;  2G2U A;  1ERO A;  1JVJ A;  1W8Y A;  1KGG A;  2ZQD A;  1MKI A;  3VP4 A;  1DJC A;  3ZHH A;  4KZ3 A;  1YLJ A;  4H8R A;  3PBQ A;  4IVI A;  4DDS A;  5M19 A;  3N7W A;  4DXB A;  4U3T A;  3WRZ A;  3NCK A;  1Q2Q A;  3VP3 A;  1K25 A;  1O7E A;  1IYO A;  3FZC A;  3MZF A;  1GHP A;  4GOG A;  5FAO A;  1FCO A;  2XH9 A;  4X56 A;  3S4X A;  1AXB A;  4S2M A;  4KZB A;  2PU2 A;  3PBN A;  4ZJ3 A;  4BJP A;  4E3N A;  5EVI A;  3W4O A;  3IF6 A;  3UO9 A;  1K55 C;  1YLY A;  5GLD A;  4MLL A;  5CGX A;  4OON A;  4JF5 A;  5KSH A;  1L2S A;  4LCM A;  1BLP A;  2XLN A;  3BLS A;  2I72 A;  1ESU A;  1K56 A;  1MWT A;  4ZTK A;  2RL3 A;  4ZDX A;  2Y2O A;  5DTT A;  3SS5 A;  3Q81 A;  2EX9 A;  1H8Y A;  3ZFZ A;  3NI9 A;  1Y54 A;  4OPR A;  3BM6 A;  3CG5 A;  3W8K A;  1ES2 A;  3WRT A;  5E43 A;  3QHY A;  3MZE A;  1CEF A;  2OV5 A;  3OCN A;  1BLC A;  4JF4 A;  3IH8 A;  3WS0 A;  3DTM A;  3O3V A;  2OLV A;  4HEF A;  4YFM A;  1LI9 A;  1KDS A;  3IXD A;  4OLD A;  2XFT A;  2XFS A;  5GLB A;  1DJB A;  4P0M A;  5A93 A;  1QME A;  2Y2P A;  4L0L A;  5M1A A;  2WZX A;  3A3E A;  4GD6 A;  3FYZ A;  1PI5 A;  1VQQ A;  4PM7 A;  1MWU A;  2XQZ A;  3SH9 A;  3ZG5 A;  5HAP A;  4BL3 A;  2IWD A;  2PBY A;  1CK3 A;  4KG5 A;  4WZ4 A;  4JBF A;  3CJM A;  2XEP A;  3WS2 A;  5FQ9 A;  1BLH A;  3SOI A;  1E25 A;  3IHB A;  1NZO A;  3Q7V A;  4BLM A;  2H10 A;  5A91 A;  5HFO A;  2V20 A;  4O7D A;  4WBG A;  1Z6F A;  4S2P A;  1NJ4 A;  2A49 A;  1C3B A;  4OQ0 A;  1KGE A;  3G35 A;  2EXA A;  2DRW A;  1ONG A;  2ZM8 A;  3TSG A;  4KG6 A;  3GQZ A;  1LL9 A;  3VP0 A;  3PAE A;  1BLS A;  1KE3 A;  2FFY A;  3G2Z A;  4BD1 A;  2ZLY A;  1BTL A;  4RYE A;  2WGW A;  3BFE A;  3JYI A;  1Q2P A;  1L0G A;  4GDB A;  4B4X A;  3PBT A;  1K38 A;  4NET A;  3UNW A;  1EI5 A;  4LCL A;  3N8S A;  5I94 A;  3GR2 A;  3GTC A;  1IEM A;  2Q9M A;  5KZH A;  1VM1 A;  3ZCZ A;  4HES A;  4E3L A;  4KZ9 A;  3O87 A;  1YT4 A;  1PW1 A;  3ZVT A;  1M40 A;  4E3J A;  1ES5 A;  1ESI A;  1JWV A;  5AQ9 A;  4U0X A;  1K54 C;  3ZG9 B;  4C3Q A;  1ZKJ A;  4FH4 A;  5E2G A;  4IBX A;  4GNU A;  5FA7 A;  4OPZ A;  2HDQ A;  1TDG A;  4DDY A;  4OLG A;  5AQB A;  5GHX A;  1BT5 A;  3C7U A;  4GDN A;  5CER A;  4EUZ A;  3A3F A;  2UWX A;  2JC7 A;  4OPY A;  4UHU A;  3UE1 A;  1LI0 A;  3OPR A;  1K6S A;  1SCW A;  3WWX A;  2R9W A;  4GKU A;  2ZC6 B;  3PBR A;  5HAQ A;  3HUM A;  1W8Q A;  3BYD A;  3E2K A;  1L0F A;  1MY8 A;  2Q9N A;  1LLB A;  4OKP A;  2WAE A;  3C7V A;  3I7J A;  3SH7 A;  3G32 A;  4PM9 A;  1BSG A;  5DF8 A;  4KZ6 A;  1NXY A;  3OPP A;  5CEC A;  2XD5 A;  3P09 A;  3ZVW A;  1PI4 A;  1MWS A;  3RXW A;  1ES3 A;  1GHM A;  1GCE A;  2JBF A;  3N6I A;  1GA0 A;  4LEN A;  1IYQ A;  5U47 A;  4X69 A;  1NYM A;  3HRE A;  1FR1 A;  1K6R A;  4WEL A;  5FQQ A;  3SS4 A;  4E3M A;  1XA7 A;  2OSU A;  4DF6 A;  3EQV A;  4QJG A;  4Y0U A;  5EVI D;  1O07 A;  3NY4 A;  3HLD A;  1YLT A;  1BZA A;  2H5S A;  3OPH A;  1YMS A;  2J9P A;  1EWZ A;  3EQU A;  1SKF A;  1IKG A;  1H8Z A;  4FD8 A;  1K56 D;  4X68 A;  5CED A;  3ZNT A;  3UPO A;  1PZP A;  1TEM A;  4OVD A;  2QZ6 A;  2FFF B;  4R4R A;  4CJN A;  1HTZ A;  3VSL A;  5FI2 A;  2Y2G A;  4S2I A;  5JYP A;  2J9O A;  4CPK A;  4LV2 A;  1K57 C;  1K57 A;  2ZM0 A;  4QD4 A;  3AGD A;  5HAI A;  3FKV A;  2Y2Q A;  3HLC A;  5FI6 A;  4JF6 A;  2BLS A;  2H0T A;  5DF7 A;  4QHC A;  4WMC A;  5JYO A;  5EVI C;  3IF6 C;  3SS3 A;  2WK0 A;  5F1G A;  3IWI A;  4PM8 A;  4MBF A;  5GLA A;  2CC1 A;  1PW8 A;  4KG2 A;  1HVB A;  2X02 A;  4P85 A;  5FDH A;  2QPN A;  3VSK A;  2EFX A;  1KE0 A;  1RP5 A;  4BD0 A;  2Y2K A;  3M6H A;  3C4P A;  4N9K A;  3BEB A;  5CGW A;  1M6K A;  3TG9 A;  2ZM2 A;  3NDG A;  3VOZ A;  2P9V B;  4OOL A;  1XPB A;  1YM1 A;  3IHA A;  2DCF A;  2PU4 A;  1N9B A;  3OCL A;  5KMW A;  2ZD8 A;  4KZ8 A;  3IXB A;  3FWL A;  1FQG A;  4PMA A;  4RX3 A;  4BL2 A;  1E3U D;  1YLW A;  1N4O A;  4D2O A;  5HW3 A;  2ZC3 B;  4LV0 A;  2A3U A;  2WAF A;  1ZC2 A;  4B88 A;  5FAQ A;  3BFG A;  4IED A;  4RVA A;  4UA7 A;  5GHZ A;  1ZG4 A;  2ZQ7 A;  2IWC A;  2ZJ9 A;  3NIA A;  3GMW A;  1XXM A;  4MBK A;  5DF9 A;  3AGE A;  3BLM A;  3NDE A;  1W5D A;  4KZA A;  4WYY A;  1FCM A;  2EFU A;  4DE2 A;  1XKZ A;  4C75 A;  4S2O A;  4OOY A;  4JXW A;  4S2K A;  1BUE A;  4WEK A;  1IYP A;  3ISG A;  3Q7Z A;  4M3K A;  5CTM A;  3VFH A;  3Q7V B;  3N4I A;  1IYS A;  2Y55 A;  4KZ5 A;  4S2L A;  3MZD A;  5FQK A;  3ZNY A;  1YLP A;  5TFQ A;  1S6R A;  2R9X A;  4PPR A;  1E4D A;  3O86 A;  4S2N A;  5J8X A;  4FCF A;  5FAT A;  4X53 A;  4R23 A;  3S22 A;  3ZGA B;  3C4O A;  4HBT A;  3GV9 A;  1L0E A;  1WYC A;  5FSR A;  3V3S A;  1GA9 A;  1CI8 A;  2GDN A;  2VGK A;  3RXX A;  3IH9 A;  3VFF A;  1I5Q A;  1S0W A;  5FI7 A;  1MXO A;  3O88 A;  4UA6 A;  3BFF A;  3RJU A;  3C5A A;  4E3K A;  5CXW A;  4BQM A;  3BFC A;  3CMZ A;  1XGJ A;  4KQO A;  4R4S A;  4MNR A;  4K0X A;  2XK1 A;  4R0Q A;  5EUA A;  3IQA A;  3P98 A;  3Q07 A;  1ERM A;  3VOY A;  1XGI A;  2P74 A;  1NRF A;  1CI9 A;  2Y2H A;  3IWO A;  3BEC A;  4RA7 A;  4DKI A;  4MBH A;  3IXG A;  5GL9 A;  1CEG A;  1PWC A;  1IEL A;  2RCX A;  2WGI A;  2WKE A;  4WM9 A;  4A5R A;  3IT9 A;  1LL5 A;  1RGZ A;  4OPQ A;  2Y4A A;  3LO7 A;  4XUZ A;  1DY6 A;  5FAP A;  5CHJ A;  3MBZ A;  3V39 A;  1SHV A;  1IKI A;  1MBL A;  1JWP A;  3MKF A;  3N8R A;  4JLF A;  4JXV A;  4GZB A;  3UPP A;  1G68 A;  1KVM A;  3PAG A;  4LV1 A;  4OP8 A;  4OH0 A;  5AQA A;  3QNC A;  4R3J A;  4QY5 A;  4UAA A;  4OQH A;  5BOH A;  4WMC D;  2HP9 A;  4KQQ A;  5EE8 A;  1LHY A;  5EVL A;  4PM5 A;  3DWK A;  3QNB A;  3ZG8 B;  3M2J A;  4QY6 A;  1KGF A;  3HBR A;  3HLG A;  4WZ5 A;  5F83 A;  2V2F F;  3AGF A;  4JXG A;  2IWB A;  4K0W A;  4JXS A;  2HP6 A;  4X55 A;  4P87 A;  2HDU A;  1GHI A;  4Q8I A;  4JPM A;  2Y2J A;  3LY3 A;  4Y7P A;  4EBP A;  4IBR A;  5KSC A;  3HLW A;  4C6Y A;  3UN7 A;  5EOO A;  4JKT A;  4OP5 A;  3W4Q A;  2C6W B;  4MEZ A;  5EEC A;  1K4E A;  2X71 A;  5GHY A;  4N1X A;  1RGY A;  2WUQ A;  4ID4 A;  5G18 A;  3MXR A;  4E6X A;  1FSY A;  3M6B A;  2Y91 A;  3WS1 A;  1XX2 A;  1BUL A;  1XA1 A;  2HDR A;  2J8Y A;  3PBS A;  5E2F A;  3LCE A;  4GB7 A;  2V1Z A;  5F1F A;  4GN2 A;  3NC8 A;  5FQJ A;  1FSW A;  2EX8 A;  1KVL A;  4B4Z A;  1KDW A;  2Z2M B;  1NYY A;  5EVI B;  4EWF A;  3IF6 B;  4IVK A;  2Z2L B;  1W7F A;  2Y2N A;  2ZQ9 A;  3OPL A;  4K91 A;  4LV3 A;  3DW0 A;  2H0Y A;  4QU3 A;  5EPH A;  3OC2 A;  1ZG6 A;  5HAR A;  1L0D A;  3UPN A;  4ZBE A;  1K55 A;  5CHU A;  4ZAM A;  1RCJ A;  3ZG7 B;  1U60 A;  2Y2M A;  2P9V A;  4RX2 A;  5E2E A;  1WE4 A;  4OQI A;  3VP2 A;  2DNS A;  5CEB A;  1JTG A;  4WEJ A;  3BFD A;  1JWZ A;  1PIO A;  1J9M A;  2ZC4 B;  3HVF A;  3NBL A;  2XDM A;  2WAD A;  1MWR A;  4FH2 A;  4EBL A;  3HL9 A;  2E8I A;  3S1Y A;  2XF3 A;  4DXC A;  1H5X A;  5E2H A;  3WS4 A;  5HL1 A;  2EX6 A;  3GSG A;  2G2W A;  3WS5 A;  4YIN A;  3ZG0 A;  3ITA A;  2HDS A;  3Q82 A;  1PWD A;  2ZQA A;  4R3B A;  2VGJ A;  3G34 A;  1FOF A;  3PBO A;  5CTN A;  5DVA A;  3SH8 A;  4HBU A;  1PWG A;  4N92 A;  1NY0 A;  4XXR A;  3W4P A;  1DJA A;  4N9L A;  4DE0 A;  4ZJ1 A;  5DTK A;  4S2N C;  4BEN A;  4R1G A;  4KZ7 A;  3UY6 A;  1WYB A;  3CZD A;  5FQM A;  5GLC A;  3G2Y A;  3UE3 A;  2WKI A;  4PM6 A;  2WZZ A;  3UDX A;  5TGF A;  3A3I A;  1ONH A;  2ZQ8 A;  4Y0O A;  1OME A;  1YMX A;  3B3X A;  1ES4 A;  5CRF A;  5M18 A;  4X6T A;  3MFD A;  4DE1 A;  2WGW B;  1YQS A;  5CHM A;  3V50 A;  5L2F A;  4KEN B;  4OQG A;  3HLE A;  2WKH A;  5DTS A;  1TDL A;  2ZC7 A;  5HX9 A;  3HLB A;  3Q1F A;  4E3I A;  4DE3 A;  1YLZ A;  3V5M A;  1E3U A;  4U0T A;  3A3J A;  1TVF A;  2XR0 A;  2JE5 A;  1I2W A;  1KE4 A;  3V3R A;  3G4P A;  4EV4 A;  5A90 A;  2Y2L A;  1FR6 A;  1NZU A;  1SDE A;  5A92 A;  2Y2I A;  3TOI A;  3N8L A;  1W79 A;  3DWZ A;  4FSF A;  3UDI A;  1ERQ A;  2EX2 A;  3G31 A;  5FAS A;  5F82 A;  1JTD A;  4DRT A;  4OOM A;  4Y0T A;  2BG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...