3BFEA

Crystal structure of the class a beta-lactamase sed-1 from citrobacter sedlakii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGAGDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfeA00
4RYEA 2ZC4B 4WZ5C 5L2FA 4OLGA 1XGJA 5GLBA 2H0TA 2X02A 4EV4A 4LV1A 1FSYA 3M2KA 4CJNA 4OOLA 4Y0UA 4DF6A 1FCOA 4FD8A 1K4EA 3E2LA 3FYZA 2XK1A 4H8RA 1ONGA 4U0XA 1WYCA 5E2FA 4WZ5A 1BLSA 2PU4A 1MY8A 3BFCA 4WELA 2XH9A 1O07A 1HD8A 2I72A 2H10A 3V50A 5AQ7A 3AGFA 3BM6A 1N4OA 2ZC3B 5CHUA 3TOIA 3C4PA 2ZM0A 3OPRA 2QZ6A 1NYYA 3ITAA 2WZXA 2P74A 4OPZA 1FR6A 2PU2A 5CEBA 1EROA 1YMSA 1WE4A 3D4FA 1MXOA 2WKEA 4RA7A 3ZVTA 1IYOA 3S4XA 4X56A 2C6WB 4E3MA 4M3KA 5EVLA 4R4RA 1XPBA 4EBLA 3PBOA 1LHYA 4S2PA 2XLNA 1YLWA 1DJAA 4U3TA 3VP2A 3HUOA 1XXMA 3MZFA 5FA7A 4GKUA 1K56D 1W8QA 1LI0A 1XP4A 3VOYA 4FH2A 4N1HA 3VFFA 2GDNA 1SHVA 3AGDA 1BUEA 2XFTA 1IKGA 3IHAA 3HLDA 3HL9A 3FKWA 1LI9A 3MZDA 1DJCA 3CZDA 3VP1A 5HFOA 1O7EA 1CK3A 5HAQA 3M6HA 1ES5A 2HDQA 1W7FA 1NXYA 1ZKJA 1BULA 5E43A 2Q9NA 4GDNA 4QJGA 4K0XA 3A3JA 1DY6A 4XXRA 2WGIA 4BL2A 2WADA 2EX9A 2Y2OA 3A3FA 4N1XA 4KZ6A 1IYQA 3A3DA 1KGGA 4JXVA 2OLUA 4MBHA 4RX3A 1MKIA 2WKHA 2Y2LA 3Q81A 1SDNA 1ALQA 3OPHA 4KQQA 4P85A 2IWBA 4E6XA 4OP5A 3PAEA 1I2WA 1W8YA 4X53A 5GHZA 1ZG4A 4S2NC 4DE2A 4UA9A 1K55A 1BT5A 3V5MA 4X6TA 3WS1A 5BOHA 5FAPA 4WEJA 5GHYA 5E2EA 1XKZA 5CTMA 4B4XA 2XFSA 2XDMA 1FSWA 1IYSA 2EXAA 5GLAA 3RXWA 3CG5A 5EUAA 4PM6A 4EQIA 3OZHA 4OQHA 3VP3A 3BFFA 2WAEA 2Y2JA 3N6IA 3FKVA 3HLEA 4KZBA 1E3UA 2XGNA 3LCEA 3DW0A 3LY3A 2R9XA 3IF5A 2ZJ9A 5DTKA 2PBYA 2BG1A 3C7UA 1YQSA 3G35A 5GL9A 5AQBA 4PM5A 2HP5A 3PTEA 3ZFZA 4DKIA 1L2SA 4F94A 2WGWB 4DDYA 1L0EA 1GA9A 1PWCA 4BL3A 4OQGA 3UPPA 4MEZA 3MXSA 4E6WA 1KGEA 3N8RA 4S2IA 3C5AA 3GV9A 2RL3A 4BJPA 1SKFA 4E3KA 2V2FF 3BFGA 1XA1A 4FSFA 1FOFA 5AQ9A 3HUNA 1TDGA 4DRTA 3CJMA 1TVFA 4JF4A 4OH0A 4B88A 5JYOA 4R0QA 4P87A 1SCWA 4R1GA 4WZ4A 5IHVA 2ZC5B 4HBUA 4UA6A 5CTNA 3NBLA 4KG6A 2ZMAA 3VP4A 2DRWA 3G2YA 3A3IA 2VGKA 1W79A 1JWZA 3G34A 4N92A 4XUZA 2RCXA 1L0FA 2WYXA 3VFHA 1YLZA 3BEBA 3IXGA 5E2GA 3IWQA 3TG9A 1MPLA 5FQ9A 3UNWA 4X68A 2X71A 4O7DA 3PBQA 4OOYA 3O3VA 4DXCA 5CHMA 1H8ZA 1FCNA 3WS2A 1PW8A 3M2JA 4S2LA 5U47A 3VSKA 2ZM2A 1PZOA 3P09A 4E3JA 1PI5A 4QU3A 1CEGA 4OP8A 3RJUA 1E4DA 1ERQA 3ZG0A 2J7VA 4C3QA 4N9LA 2V1ZA 4S2JA 4P0MA 5FQIA 4ZJ1A 2OV5A 1KVLA 1CEFA 4MNRA 4BLMA 3IWOA 4BD1A 3MKFA 3E2KA 2H0YA 4PPRA 3IWIA 2OSUA 3NCKA 4OLDA 4WM9A 3QNCA 4ZJ3A 1GHIA 5EOOA 1N9BA 1BLPA 1NY0A 3UDIA 2ZQ9A 1S6RA 1H8YA 4KZ7A 5FSRA 2OLVA 3GSGA 4IBXA 2WAFA 5TGFA 3W4PA 4WYYA 3UPOA 1RP5A 1L0DA 3DWKA 1JTGA 3HVFA 3IXHA 3PAGA 1C3BA 1LL5A 4D2OA 5KZHA 3IF6B 4PM9A 1HTZA 5FI2A 2CC1A 4MBKA 3RXXA 4WEKA 2WUQA 1GHMA 2FFFB 1NYMA 5CEDA 1QMFA 1K56A 2XQZA 4GD8A 4OQ0A 4U0TA 1ESIA 1NZOA 1K25A 4JXSA 1Z6FA 4BENA 2EXBA 3BECA 2JCHA 3NC8A 5F82A 4GOGA 1RGZA 4R3JA 5FI6A 4OPRA 1K57C 1AXBA 4JKTA 5FQKA 2XEPA 3UN7A 3Q82A 5DF7A 5HW3A 4IVIA 2HDSA 4IEDA 1K6SA 1IYPA 2P9VA 4KG2A 3FV7A 3EQVA 4OVDA 3OCNA 1K6RA 3G32A 3SOIA 1KDSA 5KMWA 2Y91A 3IXDA 4IBRA 4OKPA 4YINA 1K54C 3N8LA 3G2ZA 4Z9QA 2B5RA 1M40A 3NDGA 3N7WA 4EBPA 4K0WA 4GD6A 3UDFA 1NZUA 2Y2MA 4WBGA 5EVIC 3S1YA 1FCMA 3WS5A 2JBFA 2HPBA 1FR1A 3V3SA 3Q7VA 4DE1A 3NIAA 3TSGA 4ZTKA 3QNBA 3MFDA 4JXWA 3ZNTA 5EE8A 1SDEA 2ZM8A 4HESA 4Y0OA 4EWFA 4OONA 5FQMA 5DTSA 5EVID 1VM1A 1MWTA 2XD5A 3PBTA 3Q07A 5A92A 4R3BA 1GA0A 1K38A 4S2NA 1BLCA 3ZG7B 1WYBA 1CI9A 2V20A 2ZQCA 4E3NA 5CECA 3V39A 4QB8A 5A90A 4ZBEA 4E3IA 1G6AA 5KSCA 4Y7PA 2R9WA 1JWPA 1Q2PA 1OMEA 1S0WA 1YLJA 5HARA 3UDXA 4E3OA 1LL9A 4UAAA 3HLFA 3FZCA 1PYYA 3IH8A 1PIOA 1KE3A 3GRJA 5HX9A 4KG5A 5CXWA 2HDUA 4GNUA 1J9MA 2Y59A 3EQUA 3C4OA 4LCMA 5GLCA 2P9VB 2ZQ8A 2ZQDA 4JBFA 2XF3A 3WRTA 3ZVWA 1NJ4A 1TEMA 3NDEA 5FI7A 5HAIA 1QMEA 1K4FA 1E25A 3UE0A 5HL1A 1ESUA 2DNSA 3LEZA 4GB7A 1HZOA 4OOMA 3SH7A 2A3UA 3MZEA 4EUZA 5EECA 2QMIA 4P6BA 4NETA 4HBTA 4LENA 3GR2A 4BQMA 3Q7VB 1XX2A 4QY6A 1KGFA 5CGSA 1JVJA 5FAOA 3GVBA 4MLLA 4R4SA 3ZG9B 4PMAA 3IF6C 4A5RA 1FQGA 3W8KA 4ZAMA 1VQQA 1ES3A 4KZ8A 4PM7A 4JXGA 2JE5A 4C75A 4JLFA 2Y2HA 2Y2IA 3GMWA 3ZCZA 1EI5A 2Q9MA 2Y55A 2UWXA 3ITBA 3QHYA 4PM8A 2EX6A 5DF8A 3W4QA 3HUMA 4BD0A 2J9PA 4XUXA 3MKEA 1BTLA 2H5SA 3IXBA 2IWDA 3ISGA 5TR7A 4LCLA 1BSGA 4KZ9A 2Y2PA 1JWVA 3WS0A 1IEMA 3FWLA 3UE3A 3M6BA 1MWUA 1CI8A 4GZBA 5A91A 3N4IA 4UHUA 2BLSA 3N8SA 3SH9A 1ONHA 3ZG8B 5DTTA 2G2WA 4X55A 3ZGAB 5JYPA 2Y4AA 2HP9A 4ZDXA 2ZQ7A 3ZHHA 3SS3A 5AQAA 5M18A 3PBSA 2X01A 1PI4A 3P98A 3VSLA 4K91A 3BLSA 4RVAA 5FATA 4WMCD 3IH9A 4WMCA 4X69A 1YT4A 5FQJA 4Q8IA 4GN2A 1ZG6A 1XA7A 3NI9A 4OPQA 4C6YA 2QPNA 4MBFA 4JF5A 2WK0A 3VOZA 2Z2MB 4ZJ2A 3LO7A 5J8XA 2EX2A 2E8IA 2J8YA 3HLCA 1YMXA 3IHBA 5F83A 4KZ5A 5CERA 2VGJA 1I2SA 4KZ3A 1BLHA 3OC2A 2EX8A 3MXRA 5M19A 3G30A 1MBLA 2Z2LB 2Y2GA 2EFUA 4KZAA 4FH4A 5CGXA 3VMAA 3I7JA 1GHPA 4NK3A 3C7VA 1PWDA 2C5WB 5G18A 5M1AA 1K57A 2HP6A 4OQIA 4Y0TA 3O86A 1L0GA 4RX2A 2WGWA 3PBNA 5CRFA 3BYDA 3DTMA 3O88A 1XGIA 3NY4A 3OPLA 4S2MA 2ZQAA 3UE1A 3W4OA 3OPPA 1PWGA 4FCFA 1K54A 4DE3A 1ES4A 1U60A 4KQOA 2Y2NA 1Y54A 4EBNA 2WKIA 2ZD8A 3SS5A 5E2HA 1K55C 4OPYA 5EVIA 1PZPA 3V3RA 4DXBA 1YLPA 2Y2QA 2IWCA 5DF9A 1H5XA 4R23A 5F1GA 4S2OA 3UY6A 3G31A 1DJBA 2JC7A 4N9KA 1LLBA 1ES2A 1NRFA 3AGEA 3CMZA 3HLWA 3Q1FA 4LV3A 3UO9A 3UPNA 1EWZA 5GHXA 5HAPA 3OCLA 4JPMA 3WRZA 2WZZA 4KQRA 3ZDJA 1IKIA 1I5QA 2HDRA 2DCFA 1KVMA 2ZC7A 1YM1A 4DDSA 5TFQA 5CGWA 3JYIA 4ID4A 3HBRA 3WS4A 2Y2KA 3BLMA 1HVBA 4JF6A 4CPKA 5DVAA 3Q7ZA 1RGYA 4DE0A 2WGVA 1KE4A 2XD1A 1MWRA 3S22A 4GDBA 1E3UD 5FQQA 4B4ZA 3A3EA 4KZ4A 1M6KA 4QY5A 1PW1A 5D3OA 1RCJA 3G4PA 3BRMA 1ERMA 5FDHA 2XR0A 5CHJA 3BFEA 1GCEA 5EOEA 4IVKA 3SH8A 3SS4A 3DWZA 3O87A 1MWSA 1KE0A 3PBRA 4KENB 5F1FA 3GTCA 2ZC6B 4E3LA 4QHCA 2ZLYA 1KDWA 4UA7A 4S2KA 2J9OA 3LY4A 3GQZA 1W5DA 1YLYA 3IT9A 5A93A 4L0LA 2G2UA 4YFMA 3HLGA 5EVIB 3IQAA 3B3XA 2EFXA 3BFDA 3HREA 3HLBA 4HEFA 2A49A 3WWXA 2FFYA 4LV0A 3ZG5A 1ZC2A 3IF6A 3VP0A 1JTDA 5GLDA 3MBZA 4LV2A 4QD4A 1BZAA 5FASA 5FAQA 5EPHA 3ZNYA 5I94A 1G68A 5KSHA 1TDLA 1YLTA 1IELA 1Q2QA
chains in the Genus database with same CATH superfamily
4RYEA 4WZ5C 3C38A 4Y0UA 3F1PA 1FCOA 1TS0A 5IT5A 4H8RA 4U0XA 1STZA 4WZ5A 5EVEA 1OTIA 2PHYA 1MY8A 2B95A 4WELA 1HD8A 1NLZA 1VETB 3JVUA 4IUHA 3V50A 5AQ7A 3BM6A 2ZM0A 2QJ7A 4YWZA 1TS6A 3A0SA 3D4FA 2E8JA 2WKEA 4RA7A 3S4XA 4X56A 2C6WB 3QP8A 4M3KA 5DFYA 4R4RA 3PBOA 4S2PA 4GKUA 1XP4A 1V9ZA 1LSWA 1SHVA 1BUEA 3IHAA 3FKWA 1LI9A 4LRZE 1O7EA 2HDQA 4X25A 1W7FA 1NXYA 4L9EA 5E43A 2Q9NA 4QJGA 4K0XA 4I3JA 4BL2A 2R78A 4KZ6A 2WKHA 4NXFA 3OPHA 1ALQA 3R4KA 4KQQA 4P85A 2IWBA 4GJ4A 4E6XA 1ZHHB 1W8YA 3E4OA 4X6TA 4H6JA 1FILA 1XKZA 3CPTB 1IYSA 5EUAA 3E4PA 5AVFA 1GSXA 1T1CA 3N6IA 3KYQA 4P6ZM 3HLEA 3DW0A 3HJKA 4I5SA 2HP5A 4F94A 2WGWB 4GW9A 3C30A 1GA9A 4MN6A 4BL3A 4WN5A 4E6WA 1KGEA 3N8RA 3FPWA 4BJPA 3EEAA 5DKKA 1FOFA 4DN0A 1TDGA 1FIKA 5JYOA 4R0QA 1T18A 4R1GA 4HOIA 3LICA 2ZC5B 1DP8A 3T50A 3VP4A 2WKQA 4QPRA 3A3IA 2VGKA 4N92A 2RCXA 3VFHA 1YLZA 4HJ3A 3IWQA 3UNWA 2VV6A 3O3VA 1H8ZA 1MC0A 1PW8A 3M2JA 3T4QA 3W2ZA 3VSKA 1PZOA 2P7JA 4OP8A 4BMWA 2V0UA 1NLYA 2OWJA 5FQIA 4P0MA 4ZJ1A 2OV5A 2H0YA 3IWIA 2OSUA 4WM9A 2PRFA 1GHIA 5EOOA 3MMHA 1N9NA 1CF0A 2L0WA 4GLQA 1SKOB 3W4PA 4WYYA 3UPOA 3C8CA 1JTGA 3BW6A 3IXHA 4D2OA 4HI4A 1XJ4A 3SZTA 2J3WA 5KIZA 4WEKA 2WUQA 1QMFA 1K56A 2XQZA 4EW7A 1ESIA 2J80A 2YKHA 1IOUA 5CX7A 3V67A 2PR5A 2B18A 2VV8A 3IX3A 4JKTA 1EW0A 5HW3A 4OVDA 4HJ6A 1KDSA 2LB9A 4R6LA 3IXDA 4IBRA 4OKPA 1NWZA 4NXGA 3NDGA 1NZUA 2Y2MA 1FCMA 4DE1A 3NIAA 3MFDA 2O99A 4AFIA 4NG2A 4OONA 4II7A 4KUOA 5EVID 1VM1A 1MWTA 2XD5A 1K38A 4S2NA 3CWFA 2V20A 2ZQCA 3V39A 5A90A 2R9WA 3RH8B 3IH8A 5CXWA 2O9AA 2PYRA 4GNUA 4WUJA 4LPZA 5HL6A 4JBFA 3MR0A 3ZVWA 1TEMA 3UB8A 1QMEA 1K4FA 5EM1A 3UE0A 3LEZA 2DNSA 5EECA 4HBTA 4LENA 4QY6A 2EWWA 5CGSA 3IF6C 1VQQA 3NOPC 4R38A 2JN7A 3HUMA 4Y17A 4BD0A 1BTLA 5HPIA 1BSGA 2KOIA 2B02A 4GZBA 2BLSA 3N8SA 3EGDC 2G2WA 3KSGA 2Y4AA 4ZDXA 2X01A 1PI4A 3OBFA 3P98A 3VSLA 3JPUA 4K91A 2M1CA 4WMCD 1VHMA 3HCYA 4Q8IA 4OPQA 5EM0A 1D7EA 4QWOA 2J8YA 3GDIA 1T19A 4ESPA 2EX8A 4L9FA 4JGPA 2Z2LB 3I7JA 4DJ2A 4R3AA 1K57A 4OQIA 4RX2A 5HDDA 3NY4A 2YKFA 1PWGA 4DE3A 1ODVA 2OOLA 1Y54A 1PZPA 2IWCA 5DF9A 2VZWA 3TE8A 4N9KA 1NRFA 3Q1FA 3UPNA 1H0MA 5HAPA 2I9VA 4JPMA 3WRZA 1T1AA 1F9IA 5DJTA 4DDSA 3H9WA 2DMWA 4JF6A 5DVAA 1RGYA 3EGXC 2WGVA 3A0RA 5FQQA 3LUQA 1UGUA 4QY5A 1PW1A 3P01A 3LEQA 3KYZA 4JGQA 2XR0A 3BFEA 5EOEA 3SS4A 1TS7A 3O87A 2ZLYA 4S2KA 3H7WA 3LY4A 3IT9A 2G2UA 3HLGA 3IQAA 2JKRI 4Y3IA 2EFXA 4HEFA 5IU1A 3ZG5A 1ZC2A 1JTDA 4LV2A 3PXPA 5FASA 2L4RA 5FAQA 5EPHA 5KSHA 4FTXA 1Q2QA 4MN7A 4CLCB 5L2FA 4LV1A 1FSYA 2NUPC 4LRYC 2PAVP 3PYPA 3FYZA 3B47A 4NXBA 4I39A 1BLSA 2PU4A 3S7NA 2V9AA 3LGOA 4I3IA 4JGRA 4YNRA 5DKLA 3H7WB 2QZ6A 3B42A 1WE4A 2D01A 2L1MA 4E3MA 3ZVTA 1GSWA 3H82B 1XPBA 4EBLA 4EU0A 1YLWA 1DJAA 4U3TA 1XXMA 1Y4OA 1W8QA 2K31A 3VOYA 2PYPA 1CQAA 2XA7S 5L8MA 3AGDA 2K7SA 1IKGA 3HLDA 3HL9A 4XT2B 5HFOA 3M6HA 2AVXA 3OOVA 1BULA 2A2LA 1DY6A 2WGIA 3A3FA 4N1XA 1KGGA 2OLUA 4RX3A 2Y2LA 3Q81A 4Q0HA 3MSHA 5GHZA 4DE2A 1S1YA 4WEJA 1FSWA 5GLAA 3CG5A 3OZHA 3BFFA 2W1RA 4KZBA 2R9XA 3LIEA 1F98A 2BG1A 1YQSA 3G35A 1K0KA 4DKIA 1L2SA 4MDZA 3T1RA 3D72A 4CLCD 4EETB 4MEZA 3MXSA 3C5AA 2HJ9C 1G6OA 3C2WA 1SKFA 4E3KA 5AQ9A 3HUNA 1TVFA 4JF4A 4OH0A 3VE4A 2QYBA 4P87A 1SCWA 3DAVA 5F5YA 5CTNA 3NBLA 4KG6A 2ZMAA 3ZQ5A 1JWZA 3G34A 3QP6A 5HD5A 5E2GA 1YPRA 4O7DA 4DXCA 1FCNA 4F3LB 2W27A 2ZL1A 4S2LA 3ICYA 4E3JA 2ZM2A 3TW8A 2JKRM 3ZG0A 4PAUA 3FG8A 4KQDA 2V1ZA 4MNRA 4BD1A 5I5LA 4MMNA 3QNCA 1BLPA 5HDCA 3UDIA 1S6RA 1H8YA 5FSRA 3EEHA 2ZMVA 3LI8A 1HLUP 1L0DA 5TBMA 3HVFA 1LL5A 5HDSA 5FI2A 3TJZC 3IS2A 2ZMFA 5CEDA 2PD8A 1NZOA 1K25A 4BENA 3DTKA 3NC8A 1RGZA 3F1PB 2OAQ1 5F68A 2ZL1B 5FQKA 2XEPA 4IUKA 4X1MA 3UN7A 2HDSA 3K3DA 4IEDA 1IYPA 2VGLS 3G32A 3SOIA 2VKSA 5KMWA 2JKFA 4EESA 4Y2FA 3VV4A 3BJNA 2B5RA 3N7WA 4G3VA 4GD6A 4WBGA 4D60A 5EVIC 2JBFA 4ETXA 4ZTKA 5TBMB 4HH2A 5FQMA 3KSIA 3PBTA 4R3BA 1F5MA 1MZUA 3IS2B 4WL9A 3LIAA 4E3NA 4QB8A 1N9LA 4ZBEA 4E3IA 5KSCA 1Q2PA 1OMEA 1YLJA 3UDXA 4E3OA 1LL9A 3BWLA 1ZTUA 1J9MA 3EQUA 3MFXA 3C4OA 5GLCA 5HZHA 5HAIA 2XROA 4ZRRA 4EUZA 2A3UA 3MZEA 2H28A 2QMIA 4NETA 1JVJA 1OPXA 5FAOA 4IHQA 4H6JB 1FQGA 3F1OA 3MJQA 4KZ8A 4PM7A 4JXGA 2A24A 2JE5A 5HSQA 3ZCZA 2Y2IA 3GMWA 2XSSA 2V0WA 3ITBA 3QHYA 2EX6A 2J9PA 3MKEA 2H5SA 3WS0A 4HP9A 2HV1A 3FWLA 1OTEA 4B9OA 5A91A 3N4IA 3CUEC 4UHUA 3SH9A 1ONHA 2BASA 3BY9A 3ZG8B 1TF1A 3IX8A 3ZHHA 1TD5A 4EXOA 3BLSA 5FATA 3F1NA 4WMCA 2QHKA 1YT4A 5FQJA 1ZG6A 4C6YA 3LIDA 4JF5A 2WK0A 1S66L 4GS9A 2A24B 4BBTA 1W63M 5CERA 3OC2A 3BQAA 3MXRA 4Y15A 1MBLA 4KZAA 1BYWA 4FH4A 5CGXA 3P7NA 4NK3A 4Q0JA 5M1AA 4Z1WA 4Y0TA 2Y8HA 2W3DA 1L0GA 3LIBA 3PBNA 1XGIA 4HQAA 1OTAA 3OPPA 3E0YA 1U60A 2Y2NA 4G3WA 1K55C 1H5XA 5F1GA 2FH5A 2HF6A 3RTYA 5FDSA 3CMZA 1ES2A 4LV3A 4RQ9A 2HDRA 1UWNX 5CGWA 3JYIA 4ID4A 3HBRA 2ACGA 3Q7ZA 1GSVA 3LIFA 4WF0A 4DE0A 1JNUA 1KE4A 1MWRA 3A3EA 1XJ6A 3BRMA 2NUTC 4QHCA 5LBRA 4LFUA 4UA7A 3DTIA 2J9OA 5L09A 1G28A 1SZVA 4L0LA 4EQ1A 3B3XA 3HREA 3IF6A 3MQ0A 3VP0A 3TRCA 2PDRA 1TDLA 1YLTA 1IELA 3T4SA 5TJJA 4OLGA 1XGJA 5GLBA 1LSVA 5HWTA 2H0TA 2X02A 4CJNA 1K4EA 3NOTC 2XK1A 2VV7A 5E2FA 1WYCA 1OJGA 1LT0A 4LRXC 3BFCA 2XH9A 4M4XA 1O07A 2I72A 2W3HA 3AGFA 1N4OA 2ZC3B 2Z6CA 5CHUA 4KUKA 3TOIA 3UB5P 5J4EA 3UE6A 3ITAA 2WZXA 5CEBA 1EROA 1YMSA 2WKPA 1H3QA 1LHYA 2V8FA 3VP2A 3MZFA 1K56D 5L07A 1DRMA 3VFFA 2GDNA 3ZYTA 3S7PA 1DJCA 3CZDA 3LR5A 3UB9A 1CK3A 5HAQA 2HJEA 5AJGA 4HH3A 3A3JA 4XXRA 4ARZA 4B93A 3A3DA 4MBHA 1MKIA 5L10A 2ZOIA 1Y28A 1LSXA 4OP5A 1V9YA 4X53A 1ZG4A 4UA9A 1BT5A 5HPFA 3K3CA 3T4KA 5FAPA 3NOUC 5CTMA 4B4XA 2XFSA 2XDMA 2EXAA 4R70A 4EQIA 2WAEA 2Y2JA 4CLCC 3FKVA 1E3UA 3LY3A 1L3LA 2PBYA 5GL9A 5AQBA 4PM5A 3PTEA 3ZFZA 4DDYA 1L0EA 3UPPA 1PNEA 4S2IA 3BFGA 1XA1A 5EFWA 1W63Q 1AWIA 5IHVA 3DTEA 2DRWA 3G2YA 1W79A 1L0FA 1YAXA 3K2NA 3BEBA 3IXGA 4HIAA 4X68A 2X71A 4OOYA 4UQIS 2V1BA 5CHMA 5U47A 2VJWA 1PI5A 4QU3A 1ERQA 3PHYA 2J7VA 1S4SA 4N9LA 4S2JA 1KVLA 3E2KA 1G5UA 3D9YA 2P08A 1UWPX 2OLVA 3GSGA 2W0NA 5TGFA 2WAFA 1VEUA 1RP5A 3DWKA 3PAGA 5KZHA 3GECA 4PM9A 2CC1A 1A0KA 1GHMA 5AVEA 4U0TA 1OTDA 1D06A 4JXSA 3BECA 5F82A 4GOGA 2JKTI 4R3JA 5FI6A 4HHDA 3LYXA 4OPRA 1AXBA 3Q82A 5DF7A 4IVIA 1K6SA 3OCNA 1K6RA 1IFQA 1K54C 3N8LA 1F2KA 2J3TD 4EBPA 4K0WA 2KLIA 3S1YA 1KOUA 3WS5A 2HPBA 3EOIA 1FR1A 2GZAA 3TSGA 3QNBA 3ZNTA 5EE8A 1SDEA 2ZM8A 4EWFA 4PKYG 5DTSA 5A92A 3Q07A 3QP5A 1GA0A 1CI9A 4I38A 1G6AA 1JWPA 3HLFA 1PYYA 1KE3A 3GRJA 4KG5A 2Y59A 3L9KA 2ZQ8A 2ZQDA 2GX5A 3MQQA 5FEFA 2XF3A 1NJ4A 4X1LA 3NDEA 5FI7A 3KSHA 1E25A 1ESUA 4NXEA 1HZOA 2K2NA 3QP1A 1VETA 1XX2A 4MLLA 3ZG9B 4PMAA 4PHTA 3W8KA 1ES3A 3CITA 4C75A 1EI5A 5DF8A 3R7WA 3IXBA 2IWDA 3ISGA 5TR7A 2Y2PA 1JWVA 3E4QA 4GCZA 3UE3A 2VX8A 1CI8A 3L7HA 1P97A 2WKRA 2XRNA 5C5KA 1D1JA 5DFXA 3ZGAB 2HP9A 5AQAA 4RVAA 3UMDA 3IH9A 4X69A 4GN2A 2QPNA 4MBFA 2Z2MB 4ZJ2A 3LO7A 2M7UA 3CPTA 2EX2A 2E8IA 3IHBA 5F83A 4BBVA 4KZ5A 2VGJA 1I2SA 4KZ3A 3IBRA 3R7WB 3VMAA 1S67L 2Z6DA 2C5WB 5G18A 2HP6A 2GJ3A 2QWSA 3O86A 2O9CA 4O8GA 4IJGA 3D3OA 2WGWA 5CRFA 3BYDA 3DTMA 1XFQA 4S2MA 3S7QA 3UE1A 4O0PA 4FCFA 5DJUA 4KQOA 2JKTM 2WKIA 3SS5A 5EVIA 4DXBA 4OPYA 1OT9A 4R23A 4WLAA 4S2OA 3UY6A 3G31A 1DJBA 5GHXA 3OCLA 2WZZA 4KQRA 2UV0E 1IKIA 1I5QA 3ZDJA 2Q0OA 3UMEA 2ZC7A 1KVMA 1YM1A 5TFQA 2FZ0A 3LR3A 3WS4A 2Y2KA 1HVBA 4CPKA 3FPVA 3VOLA 3S22A 4GDBA 3LFVA 4B4ZA 3FC7A 5FL3A 1M6KA 1OTBA 1RCJA 2QJ5A 1T1BA 1CJFA 5CHJA 3DWZA 1MWSA 1KE0A 2ZC6B 3CHWP 1OJ5A 4ETZA 1W5DA 1YLYA 5A93A 4YFMA 1SKOA 5EVIB 2CMNA 3BFDA 2FFYA 4LV0A 5GLDA 4QD4A 2JHEA 1G68A 4FUWA 2ZC4B 3S7OA 1XFNA 4EV4A 5J7EA 3M2KA 4OOLA 4DF6A 4FD8A 3E2LA 3T1QB 1NRJA 1ONGA 1MKMA 3KYEA 3CUEA 2H10A 5HWVA 3T4TA 3C4PA 2LB5A 3OPRA 3F1OB 1TS8A 1NYYA 1PFLA 2P74A 1FR6A 2PU2A 4OPZA 4CLCE 4PKYA 3CLOA 1MXOA 1IYOA 5EVLA 2XLNA 2OWHA 3HUOA 5FA7A 1LI0A 4FH2A 4N1HA 2PD7A 1J3WA 2XFTA 3BQ8A 3MZDA 3VP1A 3JVVA 1X0OA 1ES5A 4HY8A 1YKDA 1ZKJA 4HJ4A 4UQIM 4GDNA 2ZOHA 2WADA 2EX9A 2Y2OA 1IYQA 3QP2A 4JXVA 4EERA 5FEGA 1SDNA 3F1NB 3PAEA 2V8CA 1I2WA 1LL8A 5A8BA 4S2NC 4YOFA 1K55A 4GS9B 3V5MA 3WS1A 5BOHA 5GHYA 4NEED 5E2EA 3RXWA 1S1ZA 4PM6A 3MXQA 4OQHA 3VP3A 4EUVA 4MCWA 2XGNA 3LCEA 5F6AA 3IF5A 2ZJ9A 5DTKA 3C7UA 1Z09A 2ZBBA 2W3FA 2XA7M 1PWCA 3HJIA 2O0YA 4OQGA 3GV9A 2RL3A 2V2FF 3LR0A 4FSFA 4DRTA 3CJMA 4B88A 3VE3A 3U4LP 1N9OA 1PRQA 4WZ4A 4HBUA 4UA6A 4UEYA 1S4RA 4XUZA 2WYXA 3BY8A 3TG9A 1MPLA 5FQ9A 3PBQA 3WS2A 2BTFP 1P9WA 2PBDP 3NULA 3P09A 3RJUA 1CEGA 1E4DA 4C3QA 4BLMA 1CEFA 4HNBA 3IWOA 3MKFA 2EA9A 4PPRA 3NCKA 4OLDA 4ZJ3A 1N9BA 1YSQA 1NY0A 2ZQ9A 3UB7A 3KSFA 4KZ7A 1WA9A 2GNXA 2VK3A 4IBXA 3E98A 3T1SA 1C3BA 3IF6B 4P6ZS 1HTZA 5K5BA 4MBKA 3RXXA 2FFFB 1YSPA 1NYMA 1XJ2A 4OQ0A 3ULFA 4GD8A 5HL1A 2JKGA 1Z6FA 2EXBA 2IA2A 2JCHA 2G7UA 5IS1A 3NHQA 1K57C 2J3TC 2VA0A 2P9VA 4KG2A 3FV7A 3EQVA 3LI9A 5MC7A 2Y91A 1H8MA 4YINA 4DMZA 2Y79A 3SW1A 3MQOA 3G2ZA 4Z9QA 1M40A 2W3GA 3UDFA 3PR6A 3V3SA 3Q7VA 1P9RA 4JXWA 4HESA 4Y0OA 1BLCA 3ZG7B 1WYBA 4Y5FA 5CECA 4LGWA 3QP4A 4Y7PA 4CQHA 1S0WA 5HARA 4UAAA 4Y13A 3FZCA 3T1XA 2W1TA 4E04A 1PIOA 2PR6A 1OT6A 4NKPA 5HX9A 4CLCA 2HDUA 2KX6A 3CI6A 4LCMA 2P9VB 4GHIA 4ARZB 3WRTA 2VGLM 3T4OA 2INWA 3O5YA 4OOMA 4GB7A 3SH7A 3DBAA 4P6BA 3GR2A 4BQMA 3Q7VB 1KGFA 1VB6A 3GVBA 4ME4A 4R4SA 5HWWA 5G4ZA 2M7VA 1P0ZA 3EWKA 4A5RA 4ZAMA 2QKPA 4EEPA 3MF0A 4I3AA 3NJAA 4Q0IA 4JLFA 2Y2HA 3H82A 2Q9MA 2Y55A 2UWXA 1ACFA 4PM8A 3W4QA 4BWIA 4XUXA 2W3EA 2W1TB 4LCLA 4BBUA 4KZ9A 1IEMA 3T4JA 3M6BA 2OAP1 1MWUA 1XJ3A 4XT2A 4GHIB 3G6OA 4K08A 5DTTA 4X55A 5JYPA 2ZQ7A 3IBJA 3SS3A 5M18A 3PBSA 2EWVA 5HD3A 3T4LA 2VLGA 2MJ6A 1XA7A 3NI9A 2P04A 3VOZA 5J8XA 3HLCA 1YMXA 1BLHA 3LR4A 5M19A 3G30A 2Y2GA 2EFUA 4MN5A 1GHPA 3IX4A 4FOFA 3C7VA 1PWDA 5G4YA 5J3WA 3RFBA 3OLOA 4HP4A 3O88A 1VEUB 3OPLA 2ZQAA 3W4OA 1K54A 3CAXA 1ES4A 2HZ5A 2KDKA 3KX0X 4EBNA 2ZD8A 2D02A 5E2HA 3V3RA 1YLPA 2Y2QA 3U2AA 3B33A 3KO6A 4LLOB 2JC7A 3MS6A 1LLBA 3HLWA 3UO9A 3AGEA 3NECA 1EWZA 4EEUA 2DCFA 2O9BA 3BLMA 3A0VA 2XD1A 4F3LA 1E3UD 4KZ4A 1DP6A 5D3OA 2PT7A 4JGOA 3G4PA 2HGVA 2V1AA 1ERMA 5FDHA 4L9GA 1GCEA 4IVKA 3SH8A 4KENB 5F1FA 3PBRA 3GTCA 4E3LA 1KDWA 3GQZA 3UB6A 5F69A 4DJ3A 3HLBA 4O01A 3T12B 2A49A 3WWXA 1DP9A 3MBZA 1BZAA 3ZNYA 2VEAA 5I94A 4G3KA 5EV0A
chains in the Genus database with same CATH topology
4RYEA 2ZC4B 4WZ5C 5L2FA 4OLGA 1XGJA 5GLBA 2H0TA 2X02A 4EV4A 4LV1A 1FSYA 3M2KA 4CJNA 4OOLA 4Y0UA 4DF6A 1FCOA 4FD8A 1K4EA 3E2LA 3FYZA 2XK1A 4H8RA 1ONGA 4U0XA 1WYCA 5E2FA 4WZ5A 1BLSA 2PU4A 1MY8A 3BFCA 4WELA 2XH9A 1O07A 1HD8A 2I72A 2H10A 3V50A 5AQ7A 3AGFA 3BM6A 1N4OA 2ZC3B 5CHUA 3TOIA 3C4PA 2ZM0A 3OPRA 2QZ6A 1NYYA 3ITAA 2WZXA 2P74A 4OPZA 1FR6A 2PU2A 5CEBA 1EROA 1YMSA 1WE4A 3D4FA 1MXOA 2WKEA 4RA7A 3ZVTA 1IYOA 3S4XA 4X56A 2C6WB 4E3MA 4M3KA 5EVLA 4R4RA 1XPBA 4EBLA 3PBOA 1LHYA 4S2PA 2XLNA 1YLWA 1DJAA 4U3TA 3VP2A 3HUOA 1XXMA 3MZFA 5FA7A 4GKUA 1K56D 1W8QA 1LI0A 1XP4A 3VOYA 4FH2A 4N1HA 3VFFA 2GDNA 1SHVA 3AGDA 1BUEA 2XFTA 1IKGA 3IHAA 3HLDA 3HL9A 3FKWA 1LI9A 3MZDA 1DJCA 3CZDA 3VP1A 5HFOA 1O7EA 1CK3A 5HAQA 3M6HA 1ES5A 2HDQA 1W7FA 1NXYA 1ZKJA 1BULA 5E43A 2Q9NA 4GDNA 4QJGA 4K0XA 3A3JA 1DY6A 4XXRA 2WGIA 4BL2A 2WADA 2EX9A 2Y2OA 3A3FA 4N1XA 4KZ6A 1IYQA 3A3DA 1KGGA 4JXVA 2OLUA 4MBHA 4RX3A 1MKIA 2WKHA 2Y2LA 3Q81A 1SDNA 1ALQA 3OPHA 4KQQA 4P85A 2IWBA 4E6XA 4OP5A 3PAEA 1I2WA 1W8YA 4X53A 5GHZA 1ZG4A 4S2NC 4DE2A 4UA9A 1K55A 1BT5A 3V5MA 4X6TA 3WS1A 5BOHA 5FAPA 4WEJA 5GHYA 5E2EA 1XKZA 5CTMA 4B4XA 2XFSA 2XDMA 1FSWA 1IYSA 2EXAA 5GLAA 3RXWA 3CG5A 5EUAA 4PM6A 4EQIA 3OZHA 4OQHA 3VP3A 3BFFA 2WAEA 2Y2JA 3N6IA 3FKVA 3HLEA 4KZBA 1E3UA 2XGNA 3LCEA 3DW0A 3LY3A 2R9XA 3IF5A 2ZJ9A 5DTKA 2PBYA 2BG1A 3C7UA 1YQSA 3G35A 5GL9A 5AQBA 4PM5A 2HP5A 3PTEA 3ZFZA 4DKIA 1L2SA 4F94A 2WGWB 4DDYA 1L0EA 1GA9A 1PWCA 4BL3A 4OQGA 3UPPA 4MEZA 3MXSA 4E6WA 1KGEA 3N8RA 4S2IA 3C5AA 3GV9A 2RL3A 4BJPA 1SKFA 4E3KA 2V2FF 3BFGA 1XA1A 4FSFA 1FOFA 5AQ9A 3HUNA 1TDGA 4DRTA 3CJMA 1TVFA 4JF4A 4OH0A 4B88A 5JYOA 4R0QA 4P87A 1SCWA 4R1GA 4WZ4A 5IHVA 2ZC5B 4HBUA 4UA6A 5CTNA 3NBLA 4KG6A 2ZMAA 3VP4A 2DRWA 3G2YA 3A3IA 2VGKA 1W79A 1JWZA 3G34A 4N92A 4XUZA 2RCXA 1L0FA 2WYXA 3VFHA 1YLZA 3BEBA 3IXGA 5E2GA 3IWQA 3TG9A 1MPLA 5FQ9A 3UNWA 4X68A 2X71A 4O7DA 3PBQA 4OOYA 3O3VA 4DXCA 5CHMA 1H8ZA 1FCNA 3WS2A 1PW8A 3M2JA 4S2LA 5U47A 3VSKA 2ZM2A 1PZOA 3P09A 4E3JA 1PI5A 4QU3A 1CEGA 4OP8A 3RJUA 1E4DA 1ERQA 3ZG0A 2J7VA 4C3QA 4N9LA 2V1ZA 4S2JA 4P0MA 5FQIA 4ZJ1A 2OV5A 1KVLA 1CEFA 4MNRA 4BLMA 3IWOA 4BD1A 3MKFA 3E2KA 2H0YA 4PPRA 3IWIA 2OSUA 3NCKA 4OLDA 4WM9A 3QNCA 4ZJ3A 1GHIA 5EOOA 1N9BA 1BLPA 1NY0A 3UDIA 2ZQ9A 1S6RA 1H8YA 4KZ7A 5FSRA 2OLVA 3GSGA 4IBXA 2WAFA 5TGFA 3W4PA 4WYYA 3UPOA 1RP5A 1L0DA 3DWKA 1JTGA 3HVFA 3IXHA 3PAGA 1C3BA 1LL5A 4D2OA 5KZHA 3IF6B 4PM9A 1HTZA 5FI2A 2CC1A 4MBKA 3RXXA 4WEKA 2WUQA 1GHMA 2FFFB 1NYMA 5CEDA 1QMFA 1K56A 2XQZA 4GD8A 4OQ0A 4U0TA 1ESIA 1NZOA 1K25A 4JXSA 1Z6FA 4BENA 2EXBA 3BECA 2JCHA 3NC8A 5F82A 4GOGA 1RGZA 4R3JA 5FI6A 4OPRA 1K57C 1AXBA 4JKTA 5FQKA 2XEPA 3UN7A 3Q82A 5DF7A 5HW3A 4IVIA 2HDSA 4IEDA 1K6SA 1IYPA 2P9VA 4KG2A 3FV7A 3EQVA 4OVDA 3OCNA 1K6RA 3G32A 3SOIA 1KDSA 5KMWA 2Y91A 3IXDA 4IBRA 4OKPA 4YINA 1K54C 3N8LA 3G2ZA 4Z9QA 2B5RA 1M40A 3NDGA 3N7WA 4EBPA 4K0WA 4GD6A 3UDFA 1NZUA 2Y2MA 4WBGA 5EVIC 3S1YA 1FCMA 3WS5A 2JBFA 2HPBA 1FR1A 3V3SA 3Q7VA 4DE1A 3NIAA 3TSGA 4ZTKA 3QNBA 3MFDA 4JXWA 3ZNTA 5EE8A 1SDEA 2ZM8A 4HESA 4Y0OA 4EWFA 4OONA 5FQMA 5DTSA 5EVID 1VM1A 1MWTA 2XD5A 3PBTA 3Q07A 5A92A 4R3BA 1GA0A 1K38A 4S2NA 1BLCA 3ZG7B 1WYBA 1CI9A 2V20A 2ZQCA 4E3NA 5CECA 3V39A 4QB8A 5A90A 4ZBEA 4E3IA 1G6AA 5KSCA 4Y7PA 2R9WA 1JWPA 1Q2PA 1OMEA 1S0WA 1YLJA 5HARA 3UDXA 4E3OA 1LL9A 4UAAA 3HLFA 3FZCA 1PYYA 3IH8A 1PIOA 1KE3A 3GRJA 5HX9A 4KG5A 5CXWA 2HDUA 4GNUA 1J9MA 2Y59A 3EQUA 3C4OA 4LCMA 5GLCA 2P9VB 2ZQ8A 2ZQDA 4JBFA 2XF3A 3WRTA 3ZVWA 1NJ4A 1TEMA 3NDEA 5FI7A 5HAIA 1QMEA 1K4FA 1E25A 3UE0A 5HL1A 1ESUA 2DNSA 3LEZA 4GB7A 1HZOA 4OOMA 3SH7A 2A3UA 3MZEA 4EUZA 5EECA 2QMIA 4P6BA 4NETA 4HBTA 4LENA 3GR2A 4BQMA 3Q7VB 1XX2A 4QY6A 1KGFA 5CGSA 1JVJA 5FAOA 3GVBA 4MLLA 4R4SA 3ZG9B 4PMAA 3IF6C 4A5RA 1FQGA 3W8KA 4ZAMA 1VQQA 1ES3A 4KZ8A 4PM7A 4JXGA 2JE5A 4C75A 4JLFA 2Y2HA 2Y2IA 3GMWA 3ZCZA 1EI5A 2Q9MA 2Y55A 2UWXA 3ITBA 3QHYA 4PM8A 2EX6A 5DF8A 3W4QA 3HUMA 4BD0A 2J9PA 4XUXA 3MKEA 1BTLA 2H5SA 3IXBA 2IWDA 3ISGA 5TR7A 4LCLA 1BSGA 4KZ9A 2Y2PA 1JWVA 3WS0A 1IEMA 3FWLA 3UE3A 3M6BA 1MWUA 1CI8A 4GZBA 5A91A 3N4IA 4UHUA 2BLSA 3N8SA 3SH9A 1ONHA 3ZG8B 5DTTA 2G2WA 4X55A 3ZGAB 5JYPA 2Y4AA 2HP9A 4ZDXA 2ZQ7A 3ZHHA 3SS3A 5AQAA 5M18A 3PBSA 2X01A 1PI4A 3P98A 3VSLA 4K91A 3BLSA 4RVAA 5FATA 4WMCD 3IH9A 4WMCA 4X69A 1YT4A 5FQJA 4Q8IA 4GN2A 1ZG6A 1XA7A 3NI9A 4OPQA 4C6YA 2QPNA 4MBFA 4JF5A 2WK0A 3VOZA 2Z2MB 4ZJ2A 3LO7A 5J8XA 2EX2A 2E8IA 2J8YA 3HLCA 1YMXA 3IHBA 5F83A 4KZ5A 5CERA 2VGJA 1I2SA 4KZ3A 1BLHA 3OC2A 2EX8A 3MXRA 5M19A 3G30A 1MBLA 2Z2LB 2Y2GA 2EFUA 4KZAA 4FH4A 5CGXA 3VMAA 3I7JA 1GHPA 4NK3A 3C7VA 1PWDA 2C5WB 5G18A 5M1AA 1K57A 2HP6A 4OQIA 4Y0TA 3O86A 1L0GA 4RX2A 2WGWA 3PBNA 5CRFA 3BYDA 3DTMA 3O88A 1XGIA 3NY4A 3OPLA 4S2MA 2ZQAA 3UE1A 3W4OA 3OPPA 1PWGA 4FCFA 1K54A 4DE3A 1ES4A 1U60A 4KQOA 2Y2NA 1Y54A 4EBNA 2WKIA 2ZD8A 3SS5A 5E2HA 1K55C 4OPYA 5EVIA 1PZPA 3V3RA 4DXBA 1YLPA 2Y2QA 2IWCA 5DF9A 1H5XA 4R23A 5F1GA 4S2OA 3UY6A 3G31A 1DJBA 2JC7A 4N9KA 1LLBA 1ES2A 1NRFA 3AGEA 3CMZA 3HLWA 3Q1FA 4LV3A 3UO9A 3UPNA 1EWZA 5GHXA 5HAPA 3OCLA 4JPMA 3WRZA 2WZZA 4KQRA 3ZDJA 1IKIA 1I5QA 2HDRA 2DCFA 1KVMA 2ZC7A 1YM1A 4DDSA 5TFQA 5CGWA 3JYIA 4ID4A 3HBRA 3WS4A 2Y2KA 3BLMA 1HVBA 4JF6A 4CPKA 5DVAA 3Q7ZA 1RGYA 4DE0A 2WGVA 1KE4A 2XD1A 1MWRA 3S22A 4GDBA 1E3UD 5FQQA 4B4ZA 3A3EA 4KZ4A 1M6KA 4QY5A 1PW1A 5D3OA 1RCJA 3G4PA 3BRMA 1ERMA 5FDHA 2XR0A 5CHJA 3BFEA 1GCEA 5EOEA 4IVKA 3SH8A 3SS4A 3DWZA 3O87A 1MWSA 1KE0A 3PBRA 4KENB 5F1FA 3GTCA 2ZC6B 4E3LA 4QHCA 2ZLYA 1KDWA 4UA7A 4S2KA 2J9OA 3LY4A 3GQZA 1W5DA 1YLYA 3IT9A 5A93A 4L0LA 2G2UA 4YFMA 3HLGA 5EVIB 3IQAA 3B3XA 2EFXA 3BFDA 3HREA 3HLBA 4HEFA 2A49A 3WWXA 2FFYA 4LV0A 3ZG5A 1ZC2A 3IF6A 3VP0A 1JTDA 5GLDA 3MBZA 4LV2A 4QD4A 1BZAA 5FASA 5FAQA 5EPHA 3ZNYA 5I94A 1G68A 5KSHA 1TDLA 1YLTA 1IELA 1Q2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RYE A;  2ZC4 B;  4WZ5 C;  5L2F A;  4OLG A;  1XGJ A;  5GLB A;  2H0T A;  2X02 A;  4EV4 A;  4LV1 A;  1FSY A;  3M2K A;  4CJN A;  4OOL A;  4Y0U A;  4DF6 A;  1FCO A;  4FD8 A;  1K4E A;  3E2L A;  3FYZ A;  2XK1 A;  4H8R A;  1ONG A;  4U0X A;  1WYC A;  5E2F A;  4WZ5 A;  1BLS A;  2PU4 A;  1MY8 A;  3BFC A;  4WEL A;  2XH9 A;  1O07 A;  1HD8 A;  2I72 A;  2H10 A;  3V50 A;  5AQ7 A;  3AGF A;  3BM6 A;  1N4O A;  2ZC3 B;  5CHU A;  3TOI A;  3C4P A;  2ZM0 A;  3OPR A;  2QZ6 A;  1NYY A;  3ITA A;  2WZX A;  2P74 A;  4OPZ A;  1FR6 A;  2PU2 A;  5CEB A;  1ERO A;  1YMS A;  1WE4 A;  3D4F A;  1MXO A;  2WKE A;  4RA7 A;  3ZVT A;  1IYO A;  3S4X A;  4X56 A;  2C6W B;  4E3M A;  4M3K A;  5EVL A;  4R4R A;  1XPB A;  4EBL A;  3PBO A;  1LHY A;  4S2P A;  2XLN A;  1YLW A;  1DJA A;  4U3T A;  3VP2 A;  3HUO A;  1XXM A;  3MZF A;  5FA7 A;  4GKU A;  1K56 D;  1W8Q A;  1LI0 A;  1XP4 A;  3VOY A;  4FH2 A;  4N1H A;  3VFF A;  2GDN A;  1SHV A;  3AGD A;  1BUE A;  2XFT A;  1IKG A;  3IHA A;  3HLD A;  3HL9 A;  3FKW A;  1LI9 A;  3MZD A;  1DJC A;  3CZD A;  3VP1 A;  5HFO A;  1O7E A;  1CK3 A;  5HAQ A;  3M6H A;  1ES5 A;  2HDQ A;  1W7F A;  1NXY A;  1ZKJ A;  1BUL A;  5E43 A;  2Q9N A;  4GDN A;  4QJG A;  4K0X A;  3A3J A;  1DY6 A;  4XXR A;  2WGI A;  4BL2 A;  2WAD A;  2EX9 A;  2Y2O A;  3A3F A;  4N1X A;  4KZ6 A;  1IYQ A;  3A3D A;  1KGG A;  4JXV A;  2OLU A;  4MBH A;  4RX3 A;  1MKI A;  2WKH A;  2Y2L A;  3Q81 A;  1SDN A;  1ALQ A;  3OPH A;  4KQQ A;  4P85 A;  2IWB A;  4E6X A;  4OP5 A;  3PAE A;  1I2W A;  1W8Y A;  4X53 A;  5GHZ A;  1ZG4 A;  4S2N C;  4DE2 A;  4UA9 A;  1K55 A;  1BT5 A;  3V5M A;  4X6T A;  3WS1 A;  5BOH A;  5FAP A;  4WEJ A;  5GHY A;  5E2E A;  1XKZ A;  5CTM A;  4B4X A;  2XFS A;  2XDM A;  1FSW A;  1IYS A;  2EXA A;  5GLA A;  3RXW A;  3CG5 A;  5EUA A;  4PM6 A;  4EQI A;  3OZH A;  4OQH A;  3VP3 A;  3BFF A;  2WAE A;  2Y2J A;  3N6I A;  3FKV A;  3HLE A;  4KZB A;  1E3U A;  2XGN A;  3LCE A;  3DW0 A;  3LY3 A;  2R9X A;  3IF5 A;  2ZJ9 A;  5DTK A;  2PBY A;  2BG1 A;  3C7U A;  1YQS A;  3G35 A;  5GL9 A;  5AQB A;  4PM5 A;  2HP5 A;  3PTE A;  3ZFZ A;  4DKI A;  1L2S A;  4F94 A;  2WGW B;  4DDY A;  1L0E A;  1GA9 A;  1PWC A;  4BL3 A;  4OQG A;  3UPP A;  4MEZ A;  3MXS A;  4E6W A;  1KGE A;  3N8R A;  4S2I A;  3C5A A;  3GV9 A;  2RL3 A;  4BJP A;  1SKF A;  4E3K A;  2V2F F;  3BFG A;  1XA1 A;  4FSF A;  1FOF A;  5AQ9 A;  3HUN A;  1TDG A;  4DRT A;  3CJM A;  1TVF A;  4JF4 A;  4OH0 A;  4B88 A;  5JYO A;  4R0Q A;  4P87 A;  1SCW A;  4R1G A;  4WZ4 A;  5IHV A;  2ZC5 B;  4HBU A;  4UA6 A;  5CTN A;  3NBL A;  4KG6 A;  2ZMA A;  3VP4 A;  2DRW A;  3G2Y A;  3A3I A;  2VGK A;  1W79 A;  1JWZ A;  3G34 A;  4N92 A;  4XUZ A;  2RCX A;  1L0F A;  2WYX A;  3VFH A;  1YLZ A;  3BEB A;  3IXG A;  5E2G A;  3IWQ A;  3TG9 A;  1MPL A;  5FQ9 A;  3UNW A;  4X68 A;  2X71 A;  4O7D A;  3PBQ A;  4OOY A;  3O3V A;  4DXC A;  5CHM A;  1H8Z A;  1FCN A;  3WS2 A;  1PW8 A;  3M2J A;  4S2L A;  5U47 A;  3VSK A;  2ZM2 A;  1PZO A;  3P09 A;  4E3J A;  1PI5 A;  4QU3 A;  1CEG A;  4OP8 A;  3RJU A;  1E4D A;  1ERQ A;  3ZG0 A;  2J7V A;  4C3Q A;  4N9L A;  2V1Z A;  4S2J A;  4P0M A;  5FQI A;  4ZJ1 A;  2OV5 A;  1KVL A;  1CEF A;  4MNR A;  4BLM A;  3IWO A;  4BD1 A;  3MKF A;  3E2K A;  2H0Y A;  4PPR A;  3IWI A;  2OSU A;  3NCK A;  4OLD A;  4WM9 A;  3QNC A;  4ZJ3 A;  1GHI A;  5EOO A;  1N9B A;  1BLP A;  1NY0 A;  3UDI A;  2ZQ9 A;  1S6R A;  1H8Y A;  4KZ7 A;  5FSR A;  2OLV A;  3GSG A;  4IBX A;  2WAF A;  5TGF A;  3W4P A;  4WYY A;  3UPO A;  1RP5 A;  1L0D A;  3DWK A;  1JTG A;  3HVF A;  3IXH A;  3PAG A;  1C3B A;  1LL5 A;  4D2O A;  5KZH A;  3IF6 B;  4PM9 A;  1HTZ A;  5FI2 A;  2CC1 A;  4MBK A;  3RXX A;  4WEK A;  2WUQ A;  1GHM A;  2FFF B;  1NYM A;  5CED A;  1QMF A;  1K56 A;  2XQZ A;  4GD8 A;  4OQ0 A;  4U0T A;  1ESI A;  1NZO A;  1K25 A;  4JXS A;  1Z6F A;  4BEN A;  2EXB A;  3BEC A;  2JCH A;  3NC8 A;  5F82 A;  4GOG A;  1RGZ A;  4R3J A;  5FI6 A;  4OPR A;  1K57 C;  1AXB A;  4JKT A;  5FQK A;  2XEP A;  3UN7 A;  3Q82 A;  5DF7 A;  5HW3 A;  4IVI A;  2HDS A;  4IED A;  1K6S A;  1IYP A;  2P9V A;  4KG2 A;  3FV7 A;  3EQV A;  4OVD A;  3OCN A;  1K6R A;  3G32 A;  3SOI A;  1KDS A;  5KMW A;  2Y91 A;  3IXD A;  4IBR A;  4OKP A;  4YIN A;  1K54 C;  3N8L A;  3G2Z A;  4Z9Q A;  2B5R A;  1M40 A;  3NDG A;  3N7W A;  4EBP A;  4K0W A;  4GD6 A;  3UDF A;  1NZU A;  2Y2M A;  4WBG A;  5EVI C;  3S1Y A;  1FCM A;  3WS5 A;  2JBF A;  2HPB A;  1FR1 A;  3V3S A;  3Q7V A;  4DE1 A;  3NIA A;  3TSG A;  4ZTK A;  3QNB A;  3MFD A;  4JXW A;  3ZNT A;  5EE8 A;  1SDE A;  2ZM8 A;  4HES A;  4Y0O A;  4EWF A;  4OON A;  5FQM A;  5DTS A;  5EVI D;  1VM1 A;  1MWT A;  2XD5 A;  3PBT A;  3Q07 A;  5A92 A;  4R3B A;  1GA0 A;  1K38 A;  4S2N A;  1BLC A;  3ZG7 B;  1WYB A;  1CI9 A;  2V20 A;  2ZQC A;  4E3N A;  5CEC A;  3V39 A;  4QB8 A;  5A90 A;  4ZBE A;  4E3I A;  1G6A A;  5KSC A;  4Y7P A;  2R9W A;  1JWP A;  1Q2P A;  1OME A;  1S0W A;  1YLJ A;  5HAR A;  3UDX A;  4E3O A;  1LL9 A;  4UAA A;  3HLF A;  3FZC A;  1PYY A;  3IH8 A;  1PIO A;  1KE3 A;  3GRJ A;  5HX9 A;  4KG5 A;  5CXW A;  2HDU A;  4GNU A;  1J9M A;  2Y59 A;  3EQU A;  3C4O A;  4LCM A;  5GLC A;  2P9V B;  2ZQ8 A;  2ZQD A;  4JBF A;  2XF3 A;  3WRT A;  3ZVW A;  1NJ4 A;  1TEM A;  3NDE A;  5FI7 A;  5HAI A;  1QME A;  1K4F A;  1E25 A;  3UE0 A;  5HL1 A;  1ESU A;  2DNS A;  3LEZ A;  4GB7 A;  1HZO A;  4OOM A;  3SH7 A;  2A3U A;  3MZE A;  4EUZ A;  5EEC A;  2QMI A;  4P6B A;  4NET A;  4HBT A;  4LEN A;  3GR2 A;  4BQM A;  3Q7V B;  1XX2 A;  4QY6 A;  1KGF A;  5CGS A;  1JVJ A;  5FAO A;  3GVB A;  4MLL A;  4R4S A;  3ZG9 B;  4PMA A;  3IF6 C;  4A5R A;  1FQG A;  3W8K A;  4ZAM A;  1VQQ A;  1ES3 A;  4KZ8 A;  4PM7 A;  4JXG A;  2JE5 A;  4C75 A;  4JLF A;  2Y2H A;  2Y2I A;  3GMW A;  3ZCZ A;  1EI5 A;  2Q9M A;  2Y55 A;  2UWX A;  3ITB A;  3QHY A;  4PM8 A;  2EX6 A;  5DF8 A;  3W4Q A;  3HUM A;  4BD0 A;  2J9P A;  4XUX A;  3MKE A;  1BTL A;  2H5S A;  3IXB A;  2IWD A;  3ISG A;  5TR7 A;  4LCL A;  1BSG A;  4KZ9 A;  2Y2P A;  1JWV A;  3WS0 A;  1IEM A;  3FWL A;  3UE3 A;  3M6B A;  1MWU A;  1CI8 A;  4GZB A;  5A91 A;  3N4I A;  4UHU A;  2BLS A;  3N8S A;  3SH9 A;  1ONH A;  3ZG8 B;  5DTT A;  2G2W A;  4X55 A;  3ZGA B;  5JYP A;  2Y4A A;  2HP9 A;  4ZDX A;  2ZQ7 A;  3ZHH A;  3SS3 A;  5AQA A;  5M18 A;  3PBS A;  2X01 A;  1PI4 A;  3P98 A;  3VSL A;  4K91 A;  3BLS A;  4RVA A;  5FAT A;  4WMC D;  3IH9 A;  4WMC A;  4X69 A;  1YT4 A;  5FQJ A;  4Q8I A;  4GN2 A;  1ZG6 A;  1XA7 A;  3NI9 A;  4OPQ A;  4C6Y A;  2QPN A;  4MBF A;  4JF5 A;  2WK0 A;  3VOZ A;  2Z2M B;  4ZJ2 A;  3LO7 A;  5J8X A;  2EX2 A;  2E8I A;  2J8Y A;  3HLC A;  1YMX A;  3IHB A;  5F83 A;  4KZ5 A;  5CER A;  2VGJ A;  1I2S A;  4KZ3 A;  1BLH A;  3OC2 A;  2EX8 A;  3MXR A;  5M19 A;  3G30 A;  1MBL A;  2Z2L B;  2Y2G A;  2EFU A;  4KZA A;  4FH4 A;  5CGX A;  3VMA A;  3I7J A;  1GHP A;  4NK3 A;  3C7V A;  1PWD A;  2C5W B;  5G18 A;  5M1A A;  1K57 A;  2HP6 A;  4OQI A;  4Y0T A;  3O86 A;  1L0G A;  4RX2 A;  2WGW A;  3PBN A;  5CRF A;  3BYD A;  3DTM A;  3O88 A;  1XGI A;  3NY4 A;  3OPL A;  4S2M A;  2ZQA A;  3UE1 A;  3W4O A;  3OPP A;  1PWG A;  4FCF A;  1K54 A;  4DE3 A;  1ES4 A;  1U60 A;  4KQO A;  2Y2N A;  1Y54 A;  4EBN A;  2WKI A;  2ZD8 A;  3SS5 A;  5E2H A;  1K55 C;  4OPY A;  5EVI A;  1PZP A;  3V3R A;  4DXB A;  1YLP A;  2Y2Q A;  2IWC A;  5DF9 A;  1H5X A;  4R23 A;  5F1G A;  4S2O A;  3UY6 A;  3G31 A;  1DJB A;  2JC7 A;  4N9K A;  1LLB A;  1ES2 A;  1NRF A;  3AGE A;  3CMZ A;  3HLW A;  3Q1F A;  4LV3 A;  3UO9 A;  3UPN A;  1EWZ A;  5GHX A;  5HAP A;  3OCL A;  4JPM A;  3WRZ A;  2WZZ A;  4KQR A;  3ZDJ A;  1IKI A;  1I5Q A;  2HDR A;  2DCF A;  1KVM A;  2ZC7 A;  1YM1 A;  4DDS A;  5TFQ A;  5CGW A;  3JYI A;  4ID4 A;  3HBR A;  3WS4 A;  2Y2K A;  3BLM A;  1HVB A;  4JF6 A;  4CPK A;  5DVA A;  3Q7Z A;  1RGY A;  4DE0 A;  2WGV A;  1KE4 A;  2XD1 A;  1MWR A;  3S22 A;  4GDB A;  1E3U D;  5FQQ A;  4B4Z A;  3A3E A;  4KZ4 A;  1M6K A;  4QY5 A;  1PW1 A;  5D3O A;  1RCJ A;  3G4P A;  3BRM A;  1ERM A;  5FDH A;  2XR0 A;  5CHJ A;  3BFE A;  1GCE A;  5EOE A;  4IVK A;  3SH8 A;  3SS4 A;  3DWZ A;  3O87 A;  1MWS A;  1KE0 A;  3PBR A;  4KEN B;  5F1F A;  3GTC A;  2ZC6 B;  4E3L A;  4QHC A;  2ZLY A;  1KDW A;  4UA7 A;  4S2K A;  2J9O A;  3LY4 A;  3GQZ A;  1W5D A;  1YLY A;  3IT9 A;  5A93 A;  4L0L A;  2G2U A;  4YFM A;  3HLG A;  5EVI B;  3IQA A;  3B3X A;  2EFX A;  3BFD A;  3HRE A;  3HLB A;  4HEF A;  2A49 A;  3WWX A;  2FFY A;  4LV0 A;  3ZG5 A;  1ZC2 A;  3IF6 A;  3VP0 A;  1JTD A;  5GLD A;  3MBZ A;  4LV2 A;  4QD4 A;  1BZA A;  5FAS A;  5FAQ A;  5EPH A;  3ZNY A;  5I94 A;  1G68 A;  5KSH A;  1TDL A;  1YLT A;  1IEL A;  1Q2Q A; 
#chains in the Genus database with same CATH topology
 4RYE A;  4WZ5 C;  3C38 A;  4Y0U A;  3F1P A;  1FCO A;  1TS0 A;  5IT5 A;  4H8R A;  4U0X A;  1STZ A;  4WZ5 A;  5EVE A;  1OTI A;  2PHY A;  1MY8 A;  2B95 A;  4WEL A;  1HD8 A;  1NLZ A;  1VET B;  3JVU A;  4IUH A;  3V50 A;  5AQ7 A;  3BM6 A;  2ZM0 A;  2QJ7 A;  4YWZ A;  1TS6 A;  3A0S A;  3D4F A;  2E8J A;  2WKE A;  4RA7 A;  3S4X A;  4X56 A;  2C6W B;  3QP8 A;  4M3K A;  5DFY A;  4R4R A;  3PBO A;  4S2P A;  4GKU A;  1XP4 A;  1V9Z A;  1LSW A;  1SHV A;  1BUE A;  3IHA A;  3FKW A;  1LI9 A;  4LRZ E;  1O7E A;  2HDQ A;  4X25 A;  1W7F A;  1NXY A;  4L9E A;  5E43 A;  2Q9N A;  4QJG A;  4K0X A;  4I3J A;  4BL2 A;  2R78 A;  4KZ6 A;  2WKH A;  4NXF A;  3OPH A;  1ALQ A;  3R4K A;  4KQQ A;  4P85 A;  2IWB A;  4GJ4 A;  4E6X A;  1ZHH B;  1W8Y A;  3E4O A;  4X6T A;  4H6J A;  1FIL A;  1XKZ A;  3CPT B;  1IYS A;  5EUA A;  3E4P A;  5AVF A;  1GSX A;  1T1C A;  3N6I A;  3KYQ A;  4P6Z M;  3HLE A;  3DW0 A;  3HJK A;  4I5S A;  2HP5 A;  4F94 A;  2WGW B;  4GW9 A;  3C30 A;  1GA9 A;  4MN6 A;  4BL3 A;  4WN5 A;  4E6W A;  1KGE A;  3N8R A;  3FPW A;  4BJP A;  3EEA A;  5DKK A;  1FOF A;  4DN0 A;  1TDG A;  1FIK A;  5JYO A;  4R0Q A;  1T18 A;  4R1G A;  4HOI A;  3LIC A;  2ZC5 B;  1DP8 A;  3T50 A;  3VP4 A;  2WKQ A;  4QPR A;  3A3I A;  2VGK A;  4N92 A;  2RCX A;  3VFH A;  1YLZ A;  4HJ3 A;  3IWQ A;  3UNW A;  2VV6 A;  3O3V A;  1H8Z A;  1MC0 A;  1PW8 A;  3M2J A;  3T4Q A;  3W2Z A;  3VSK A;  1PZO A;  2P7J A;  4OP8 A;  4BMW A;  2V0U A;  1NLY A;  2OWJ A;  5FQI A;  4P0M A;  4ZJ1 A;  2OV5 A;  2H0Y A;  3IWI A;  2OSU A;  4WM9 A;  2PRF A;  1GHI A;  5EOO A;  3MMH A;  1N9N A;  1CF0 A;  2L0W A;  4GLQ A;  1SKO B;  3W4P A;  4WYY A;  3UPO A;  3C8C A;  1JTG A;  3BW6 A;  3IXH A;  4D2O A;  4HI4 A;  1XJ4 A;  3SZT A;  2J3W A;  5KIZ A;  4WEK A;  2WUQ A;  1QMF A;  1K56 A;  2XQZ A;  4EW7 A;  1ESI A;  2J80 A;  2YKH A;  1IOU A;  5CX7 A;  3V67 A;  2PR5 A;  2B18 A;  2VV8 A;  3IX3 A;  4JKT A;  1EW0 A;  5HW3 A;  4OVD A;  4HJ6 A;  1KDS A;  2LB9 A;  4R6L A;  3IXD A;  4IBR A;  4OKP A;  1NWZ A;  4NXG A;  3NDG A;  1NZU A;  2Y2M A;  1FCM A;  4DE1 A;  3NIA A;  3MFD A;  2O99 A;  4AFI A;  4NG2 A;  4OON A;  4II7 A;  4KUO A;  5EVI D;  1VM1 A;  1MWT A;  2XD5 A;  1K38 A;  4S2N A;  3CWF A;  2V20 A;  2ZQC A;  3V39 A;  5A90 A;  2R9W A;  3RH8 B;  3IH8 A;  5CXW A;  2O9A A;  2PYR A;  4GNU A;  4WUJ A;  4LPZ A;  5HL6 A;  4JBF A;  3MR0 A;  3ZVW A;  1TEM A;  3UB8 A;  1QME A;  1K4F A;  5EM1 A;  3UE0 A;  3LEZ A;  2DNS A;  5EEC A;  4HBT A;  4LEN A;  4QY6 A;  2EWW A;  5CGS A;  3IF6 C;  1VQQ A;  3NOP C;  4R38 A;  2JN7 A;  3HUM A;  4Y17 A;  4BD0 A;  1BTL A;  5HPI A;  1BSG A;  2KOI A;  2B02 A;  4GZB A;  2BLS A;  3N8S A;  3EGD C;  2G2W A;  3KSG A;  2Y4A A;  4ZDX A;  2X01 A;  1PI4 A;  3OBF A;  3P98 A;  3VSL A;  3JPU A;  4K91 A;  2M1C A;  4WMC D;  1VHM A;  3HCY A;  4Q8I A;  4OPQ A;  5EM0 A;  1D7E A;  4QWO A;  2J8Y A;  3GDI A;  1T19 A;  4ESP A;  2EX8 A;  4L9F A;  4JGP A;  2Z2L B;  3I7J A;  4DJ2 A;  4R3A A;  1K57 A;  4OQI A;  4RX2 A;  5HDD A;  3NY4 A;  2YKF A;  1PWG A;  4DE3 A;  1ODV A;  2OOL A;  1Y54 A;  1PZP A;  2IWC A;  5DF9 A;  2VZW A;  3TE8 A;  4N9K A;  1NRF A;  3Q1F A;  3UPN A;  1H0M A;  5HAP A;  2I9V A;  4JPM A;  3WRZ A;  1T1A A;  1F9I A;  5DJT A;  4DDS A;  3H9W A;  2DMW A;  4JF6 A;  5DVA A;  1RGY A;  3EGX C;  2WGV A;  3A0R A;  5FQQ A;  3LUQ A;  1UGU A;  4QY5 A;  1PW1 A;  3P01 A;  3LEQ A;  3KYZ A;  4JGQ A;  2XR0 A;  3BFE A;  5EOE A;  3SS4 A;  1TS7 A;  3O87 A;  2ZLY A;  4S2K A;  3H7W A;  3LY4 A;  3IT9 A;  2G2U A;  3HLG A;  3IQA A;  2JKR I;  4Y3I A;  2EFX A;  4HEF A;  5IU1 A;  3ZG5 A;  1ZC2 A;  1JTD A;  4LV2 A;  3PXP A;  5FAS A;  2L4R A;  5FAQ A;  5EPH A;  5KSH A;  4FTX A;  1Q2Q A;  4MN7 A;  4CLC B;  5L2F A;  4LV1 A;  1FSY A;  2NUP C;  4LRY C;  2PAV P;  3PYP A;  3FYZ A;  3B47 A;  4NXB A;  4I39 A;  1BLS A;  2PU4 A;  3S7N A;  2V9A A;  3LGO A;  4I3I A;  4JGR A;  4YNR A;  5DKL A;  3H7W B;  2QZ6 A;  3B42 A;  1WE4 A;  2D01 A;  2L1M A;  4E3M A;  3ZVT A;  1GSW A;  3H82 B;  1XPB A;  4EBL A;  4EU0 A;  1YLW A;  1DJA A;  4U3T A;  1XXM A;  1Y4O A;  1W8Q A;  2K31 A;  3VOY A;  2PYP A;  1CQA A;  2XA7 S;  5L8M A;  3AGD A;  2K7S A;  1IKG A;  3HLD A;  3HL9 A;  4XT2 B;  5HFO A;  3M6H A;  2AVX A;  3OOV A;  1BUL A;  2A2L A;  1DY6 A;  2WGI A;  3A3F A;  4N1X A;  1KGG A;  2OLU A;  4RX3 A;  2Y2L A;  3Q81 A;  4Q0H A;  3MSH A;  5GHZ A;  4DE2 A;  1S1Y A;  4WEJ A;  1FSW A;  5GLA A;  3CG5 A;  3OZH A;  3BFF A;  2W1R A;  4KZB A;  2R9X A;  3LIE A;  1F98 A;  2BG1 A;  1YQS A;  3G35 A;  1K0K A;  4DKI A;  1L2S A;  4MDZ A;  3T1R A;  3D72 A;  4CLC D;  4EET B;  4MEZ A;  3MXS A;  3C5A A;  2HJ9 C;  1G6O A;  3C2W A;  1SKF A;  4E3K A;  5AQ9 A;  3HUN A;  1TVF A;  4JF4 A;  4OH0 A;  3VE4 A;  2QYB A;  4P87 A;  1SCW A;  3DAV A;  5F5Y A;  5CTN A;  3NBL A;  4KG6 A;  2ZMA A;  3ZQ5 A;  1JWZ A;  3G34 A;  3QP6 A;  5HD5 A;  5E2G A;  1YPR A;  4O7D A;  4DXC A;  1FCN A;  4F3L B;  2W27 A;  2ZL1 A;  4S2L A;  3ICY A;  4E3J A;  2ZM2 A;  3TW8 A;  2JKR M;  3ZG0 A;  4PAU A;  3FG8 A;  4KQD A;  2V1Z A;  4MNR A;  4BD1 A;  5I5L A;  4MMN A;  3QNC A;  1BLP A;  5HDC A;  3UDI A;  1S6R A;  1H8Y A;  5FSR A;  3EEH A;  2ZMV A;  3LI8 A;  1HLU P;  1L0D A;  5TBM A;  3HVF A;  1LL5 A;  5HDS A;  5FI2 A;  3TJZ C;  3IS2 A;  2ZMF A;  5CED A;  2PD8 A;  1NZO A;  1K25 A;  4BEN A;  3DTK A;  3NC8 A;  1RGZ A;  3F1P B;  2OAQ 1;  5F68 A;  2ZL1 B;  5FQK A;  2XEP A;  4IUK A;  4X1M A;  3UN7 A;  2HDS A;  3K3D A;  4IED A;  1IYP A;  2VGL S;  3G32 A;  3SOI A;  2VKS A;  5KMW A;  2JKF A;  4EES A;  4Y2F A;  3VV4 A;  3BJN A;  2B5R A;  3N7W A;  4G3V A;  4GD6 A;  4WBG A;  4D60 A;  5EVI C;  2JBF A;  4ETX A;  4ZTK A;  5TBM B;  4HH2 A;  5FQM A;  3KSI A;  3PBT A;  4R3B A;  1F5M A;  1MZU A;  3IS2 B;  4WL9 A;  3LIA A;  4E3N A;  4QB8 A;  1N9L A;  4ZBE A;  4E3I A;  5KSC A;  1Q2P A;  1OME A;  1YLJ A;  3UDX A;  4E3O A;  1LL9 A;  3BWL A;  1ZTU A;  1J9M A;  3EQU A;  3MFX A;  3C4O A;  5GLC A;  5HZH A;  5HAI A;  2XRO A;  4ZRR A;  4EUZ A;  2A3U A;  3MZE A;  2H28 A;  2QMI A;  4NET A;  1JVJ A;  1OPX A;  5FAO A;  4IHQ A;  4H6J B;  1FQG A;  3F1O A;  3MJQ A;  4KZ8 A;  4PM7 A;  4JXG A;  2A24 A;  2JE5 A;  5HSQ A;  3ZCZ A;  2Y2I A;  3GMW A;  2XSS A;  2V0W A;  3ITB A;  3QHY A;  2EX6 A;  2J9P A;  3MKE A;  2H5S A;  3WS0 A;  4HP9 A;  2HV1 A;  3FWL A;  1OTE A;  4B9O A;  5A91 A;  3N4I A;  3CUE C;  4UHU A;  3SH9 A;  1ONH A;  2BAS A;  3BY9 A;  3ZG8 B;  1TF1 A;  3IX8 A;  3ZHH A;  1TD5 A;  4EXO A;  3BLS A;  5FAT A;  3F1N A;  4WMC A;  2QHK A;  1YT4 A;  5FQJ A;  1ZG6 A;  4C6Y A;  3LID A;  4JF5 A;  2WK0 A;  1S66 L;  4GS9 A;  2A24 B;  4BBT A;  1W63 M;  5CER A;  3OC2 A;  3BQA A;  3MXR A;  4Y15 A;  1MBL A;  4KZA A;  1BYW A;  4FH4 A;  5CGX A;  3P7N A;  4NK3 A;  4Q0J A;  5M1A A;  4Z1W A;  4Y0T A;  2Y8H A;  2W3D A;  1L0G A;  3LIB A;  3PBN A;  1XGI A;  4HQA A;  1OTA A;  3OPP A;  3E0Y A;  1U60 A;  2Y2N A;  4G3W A;  1K55 C;  1H5X A;  5F1G A;  2FH5 A;  2HF6 A;  3RTY A;  5FDS A;  3CMZ A;  1ES2 A;  4LV3 A;  4RQ9 A;  2HDR A;  1UWN X;  5CGW A;  3JYI A;  4ID4 A;  3HBR A;  2ACG A;  3Q7Z A;  1GSV A;  3LIF A;  4WF0 A;  4DE0 A;  1JNU A;  1KE4 A;  1MWR A;  3A3E A;  1XJ6 A;  3BRM A;  2NUT C;  4QHC A;  5LBR A;  4LFU A;  4UA7 A;  3DTI A;  2J9O A;  5L09 A;  1G28 A;  1SZV A;  4L0L A;  4EQ1 A;  3B3X A;  3HRE A;  3IF6 A;  3MQ0 A;  3VP0 A;  3TRC A;  2PDR A;  1TDL A;  1YLT A;  1IEL A;  3T4S A;  5TJJ A;  4OLG A;  1XGJ A;  5GLB A;  1LSV A;  5HWT A;  2H0T A;  2X02 A;  4CJN A;  1K4E A;  3NOT C;  2XK1 A;  2VV7 A;  5E2F A;  1WYC A;  1OJG A;  1LT0 A;  4LRX C;  3BFC A;  2XH9 A;  4M4X A;  1O07 A;  2I72 A;  2W3H A;  3AGF A;  1N4O A;  2ZC3 B;  2Z6C A;  5CHU A;  4KUK A;  3TOI A;  3UB5 P;  5J4E A;  3UE6 A;  3ITA A;  2WZX A;  5CEB A;  1ERO A;  1YMS A;  2WKP A;  1H3Q A;  1LHY A;  2V8F A;  3VP2 A;  3MZF A;  1K56 D;  5L07 A;  1DRM A;  3VFF A;  2GDN A;  3ZYT A;  3S7P A;  1DJC A;  3CZD A;  3LR5 A;  3UB9 A;  1CK3 A;  5HAQ A;  2HJE A;  5AJG A;  4HH3 A;  3A3J A;  4XXR A;  4ARZ A;  4B93 A;  3A3D A;  4MBH A;  1MKI A;  5L10 A;  2ZOI A;  1Y28 A;  1LSX A;  4OP5 A;  1V9Y A;  4X53 A;  1ZG4 A;  4UA9 A;  1BT5 A;  5HPF A;  3K3C A;  3T4K A;  5FAP A;  3NOU C;  5CTM A;  4B4X A;  2XFS A;  2XDM A;  2EXA A;  4R70 A;  4EQI A;  2WAE A;  2Y2J A;  4CLC C;  3FKV A;  1E3U A;  3LY3 A;  1L3L A;  2PBY A;  5GL9 A;  5AQB A;  4PM5 A;  3PTE A;  3ZFZ A;  4DDY A;  1L0E A;  3UPP A;  1PNE A;  4S2I A;  3BFG A;  1XA1 A;  5EFW A;  1W63 Q;  1AWI A;  5IHV A;  3DTE A;  2DRW A;  3G2Y A;  1W79 A;  1L0F A;  1YAX A;  3K2N A;  3BEB A;  3IXG A;  4HIA A;  4X68 A;  2X71 A;  4OOY A;  4UQI S;  2V1B A;  5CHM A;  5U47 A;  2VJW A;  1PI5 A;  4QU3 A;  1ERQ A;  3PHY A;  2J7V A;  1S4S A;  4N9L A;  4S2J A;  1KVL A;  3E2K A;  1G5U A;  3D9Y A;  2P08 A;  1UWP X;  2OLV A;  3GSG A;  2W0N A;  5TGF A;  2WAF A;  1VEU A;  1RP5 A;  3DWK A;  3PAG A;  5KZH A;  3GEC A;  4PM9 A;  2CC1 A;  1A0K A;  1GHM A;  5AVE A;  4U0T A;  1OTD A;  1D06 A;  4JXS A;  3BEC A;  5F82 A;  4GOG A;  2JKT I;  4R3J A;  5FI6 A;  4HHD A;  3LYX A;  4OPR A;  1AXB A;  3Q82 A;  5DF7 A;  4IVI A;  1K6S A;  3OCN A;  1K6R A;  1IFQ A;  1K54 C;  3N8L A;  1F2K A;  2J3T D;  4EBP A;  4K0W A;  2KLI A;  3S1Y A;  1KOU A;  3WS5 A;  2HPB A;  3EOI A;  1FR1 A;  2GZA A;  3TSG A;  3QNB A;  3ZNT A;  5EE8 A;  1SDE A;  2ZM8 A;  4EWF A;  4PKY G;  5DTS A;  5A92 A;  3Q07 A;  3QP5 A;  1GA0 A;  1CI9 A;  4I38 A;  1G6A A;  1JWP A;  3HLF A;  1PYY A;  1KE3 A;  3GRJ A;  4KG5 A;  2Y59 A;  3L9K A;  2ZQ8 A;  2ZQD A;  2GX5 A;  3MQQ A;  5FEF A;  2XF3 A;  1NJ4 A;  4X1L A;  3NDE A;  5FI7 A;  3KSH A;  1E25 A;  1ESU A;  4NXE A;  1HZO A;  2K2N A;  3QP1 A;  1VET A;  1XX2 A;  4MLL A;  3ZG9 B;  4PMA A;  4PHT A;  3W8K A;  1ES3 A;  3CIT A;  4C75 A;  1EI5 A;  5DF8 A;  3R7W A;  3IXB A;  2IWD A;  3ISG A;  5TR7 A;  2Y2P A;  1JWV A;  3E4Q A;  4GCZ A;  3UE3 A;  2VX8 A;  1CI8 A;  3L7H A;  1P97 A;  2WKR A;  2XRN A;  5C5K A;  1D1J A;  5DFX A;  3ZGA B;  2HP9 A;  5AQA A;  4RVA A;  3UMD A;  3IH9 A;  4X69 A;  4GN2 A;  2QPN A;  4MBF A;  2Z2M B;  4ZJ2 A;  3LO7 A;  2M7U A;  3CPT A;  2EX2 A;  2E8I A;  3IHB A;  5F83 A;  4BBV A;  4KZ5 A;  2VGJ A;  1I2S A;  4KZ3 A;  3IBR A;  3R7W B;  3VMA A;  1S67 L;  2Z6D A;  2C5W B;  5G18 A;  2HP6 A;  2GJ3 A;  2QWS A;  3O86 A;  2O9C A;  4O8G A;  4IJG A;  3D3O A;  2WGW A;  5CRF A;  3BYD A;  3DTM A;  1XFQ A;  4S2M A;  3S7Q A;  3UE1 A;  4O0P A;  4FCF A;  5DJU A;  4KQO A;  2JKT M;  2WKI A;  3SS5 A;  5EVI A;  4DXB A;  4OPY A;  1OT9 A;  4R23 A;  4WLA A;  4S2O A;  3UY6 A;  3G31 A;  1DJB A;  5GHX A;  3OCL A;  2WZZ A;  4KQR A;  2UV0 E;  1IKI A;  1I5Q A;  3ZDJ A;  2Q0O A;  3UME A;  2ZC7 A;  1KVM A;  1YM1 A;  5TFQ A;  2FZ0 A;  3LR3 A;  3WS4 A;  2Y2K A;  1HVB A;  4CPK A;  3FPV A;  3VOL A;  3S22 A;  4GDB A;  3LFV A;  4B4Z A;  3FC7 A;  5FL3 A;  1M6K A;  1OTB A;  1RCJ A;  2QJ5 A;  1T1B A;  1CJF A;  5CHJ A;  3DWZ A;  1MWS A;  1KE0 A;  2ZC6 B;  3CHW P;  1OJ5 A;  4ETZ A;  1W5D A;  1YLY A;  5A93 A;  4YFM A;  1SKO A;  5EVI B;  2CMN A;  3BFD A;  2FFY A;  4LV0 A;  5GLD A;  4QD4 A;  2JHE A;  1G68 A;  4FUW A;  2ZC4 B;  3S7O A;  1XFN A;  4EV4 A;  5J7E A;  3M2K A;  4OOL A;  4DF6 A;  4FD8 A;  3E2L A;  3T1Q B;  1NRJ A;  1ONG A;  1MKM A;  3KYE A;  3CUE A;  2H10 A;  5HWV A;  3T4T A;  3C4P A;  2LB5 A;  3OPR A;  3F1O B;  1TS8 A;  1NYY A;  1PFL A;  2P74 A;  1FR6 A;  2PU2 A;  4OPZ A;  4CLC E;  4PKY A;  3CLO A;  1MXO A;  1IYO A;  5EVL A;  2XLN A;  2OWH A;  3HUO A;  5FA7 A;  1LI0 A;  4FH2 A;  4N1H A;  2PD7 A;  1J3W A;  2XFT A;  3BQ8 A;  3MZD A;  3VP1 A;  3JVV A;  1X0O A;  1ES5 A;  4HY8 A;  1YKD A;  1ZKJ A;  4HJ4 A;  4UQI M;  4GDN A;  2ZOH A;  2WAD A;  2EX9 A;  2Y2O A;  1IYQ A;  3QP2 A;  4JXV A;  4EER A;  5FEG A;  1SDN A;  3F1N B;  3PAE A;  2V8C A;  1I2W A;  1LL8 A;  5A8B A;  4S2N C;  4YOF A;  1K55 A;  4GS9 B;  3V5M A;  3WS1 A;  5BOH A;  5GHY A;  4NEE D;  5E2E A;  3RXW A;  1S1Z A;  4PM6 A;  3MXQ A;  4OQH A;  3VP3 A;  4EUV A;  4MCW A;  2XGN A;  3LCE A;  5F6A A;  3IF5 A;  2ZJ9 A;  5DTK A;  3C7U A;  1Z09 A;  2ZBB A;  2W3F A;  2XA7 M;  1PWC A;  3HJI A;  2O0Y A;  4OQG A;  3GV9 A;  2RL3 A;  2V2F F;  3LR0 A;  4FSF A;  4DRT A;  3CJM A;  4B88 A;  3VE3 A;  3U4L P;  1N9O A;  1PRQ A;  4WZ4 A;  4HBU A;  4UA6 A;  4UEY A;  1S4R A;  4XUZ A;  2WYX A;  3BY8 A;  3TG9 A;  1MPL A;  5FQ9 A;  3PBQ A;  3WS2 A;  2BTF P;  1P9W A;  2PBD P;  3NUL A;  3P09 A;  3RJU A;  1CEG A;  1E4D A;  4C3Q A;  4BLM A;  1CEF A;  4HNB A;  3IWO A;  3MKF A;  2EA9 A;  4PPR A;  3NCK A;  4OLD A;  4ZJ3 A;  1N9B A;  1YSQ A;  1NY0 A;  2ZQ9 A;  3UB7 A;  3KSF A;  4KZ7 A;  1WA9 A;  2GNX A;  2VK3 A;  4IBX A;  3E98 A;  3T1S A;  1C3B A;  3IF6 B;  4P6Z S;  1HTZ A;  5K5B A;  4MBK A;  3RXX A;  2FFF B;  1YSP A;  1NYM A;  1XJ2 A;  4OQ0 A;  3ULF A;  4GD8 A;  5HL1 A;  2JKG A;  1Z6F A;  2EXB A;  2IA2 A;  2JCH A;  2G7U A;  5IS1 A;  3NHQ A;  1K57 C;  2J3T C;  2VA0 A;  2P9V A;  4KG2 A;  3FV7 A;  3EQV A;  3LI9 A;  5MC7 A;  2Y91 A;  1H8M A;  4YIN A;  4DMZ A;  2Y79 A;  3SW1 A;  3MQO A;  3G2Z A;  4Z9Q A;  1M40 A;  2W3G A;  3UDF A;  3PR6 A;  3V3S A;  3Q7V A;  1P9R A;  4JXW A;  4HES A;  4Y0O A;  1BLC A;  3ZG7 B;  1WYB A;  4Y5F A;  5CEC A;  4LGW A;  3QP4 A;  4Y7P A;  4CQH A;  1S0W A;  5HAR A;  4UAA A;  4Y13 A;  3FZC A;  3T1X A;  2W1T A;  4E04 A;  1PIO A;  2PR6 A;  1OT6 A;  4NKP A;  5HX9 A;  4CLC A;  2HDU A;  2KX6 A;  3CI6 A;  4LCM A;  2P9V B;  4GHI A;  4ARZ B;  3WRT A;  2VGL M;  3T4O A;  2INW A;  3O5Y A;  4OOM A;  4GB7 A;  3SH7 A;  3DBA A;  4P6B A;  3GR2 A;  4BQM A;  3Q7V B;  1KGF A;  1VB6 A;  3GVB A;  4ME4 A;  4R4S A;  5HWW A;  5G4Z A;  2M7V A;  1P0Z A;  3EWK A;  4A5R A;  4ZAM A;  2QKP A;  4EEP A;  3MF0 A;  4I3A A;  3NJA A;  4Q0I A;  4JLF A;  2Y2H A;  3H82 A;  2Q9M A;  2Y55 A;  2UWX A;  1ACF A;  4PM8 A;  3W4Q A;  4BWI A;  4XUX A;  2W3E A;  2W1T B;  4LCL A;  4BBU A;  4KZ9 A;  1IEM A;  3T4J A;  3M6B A;  2OAP 1;  1MWU A;  1XJ3 A;  4XT2 A;  4GHI B;  3G6O A;  4K08 A;  5DTT A;  4X55 A;  5JYP A;  2ZQ7 A;  3IBJ A;  3SS3 A;  5M18 A;  3PBS A;  2EWV A;  5HD3 A;  3T4L A;  2VLG A;  2MJ6 A;  1XA7 A;  3NI9 A;  2P04 A;  3VOZ A;  5J8X A;  3HLC A;  1YMX A;  1BLH A;  3LR4 A;  5M19 A;  3G30 A;  2Y2G A;  2EFU A;  4MN5 A;  1GHP A;  3IX4 A;  4FOF A;  3C7V A;  1PWD A;  5G4Y A;  5J3W A;  3RFB A;  3OLO A;  4HP4 A;  3O88 A;  1VEU B;  3OPL A;  2ZQA A;  3W4O A;  1K54 A;  3CAX A;  1ES4 A;  2HZ5 A;  2KDK A;  3KX0 X;  4EBN A;  2ZD8 A;  2D02 A;  5E2H A;  3V3R A;  1YLP A;  2Y2Q A;  3U2A A;  3B33 A;  3KO6 A;  4LLO B;  2JC7 A;  3MS6 A;  1LLB A;  3HLW A;  3UO9 A;  3AGE A;  3NEC A;  1EWZ A;  4EEU A;  2DCF A;  2O9B A;  3BLM A;  3A0V A;  2XD1 A;  4F3L A;  1E3U D;  4KZ4 A;  1DP6 A;  5D3O A;  2PT7 A;  4JGO A;  3G4P A;  2HGV A;  2V1A A;  1ERM A;  5FDH A;  4L9G A;  1GCE A;  4IVK A;  3SH8 A;  4KEN B;  5F1F A;  3PBR A;  3GTC A;  4E3L A;  1KDW A;  3GQZ A;  3UB6 A;  5F69 A;  4DJ3 A;  3HLB A;  4O01 A;  3T12 B;  2A49 A;  3WWX A;  1DP9 A;  3MBZ A;  1BZA A;  3ZNY A;  2VEA A;  5I94 A;  4G3K A;  5EV0 A; 
#chains in the Genus database with same CATH homology
 4RYE A;  2ZC4 B;  4WZ5 C;  5L2F A;  4OLG A;  1XGJ A;  5GLB A;  2H0T A;  2X02 A;  4EV4 A;  4LV1 A;  1FSY A;  3M2K A;  4CJN A;  4OOL A;  4Y0U A;  4DF6 A;  1FCO A;  4FD8 A;  1K4E A;  3E2L A;  3FYZ A;  2XK1 A;  4H8R A;  1ONG A;  4U0X A;  1WYC A;  5E2F A;  4WZ5 A;  1BLS A;  2PU4 A;  1MY8 A;  3BFC A;  4WEL A;  2XH9 A;  1O07 A;  1HD8 A;  2I72 A;  2H10 A;  3V50 A;  5AQ7 A;  3AGF A;  3BM6 A;  1N4O A;  2ZC3 B;  5CHU A;  3TOI A;  3C4P A;  2ZM0 A;  3OPR A;  2QZ6 A;  1NYY A;  3ITA A;  2WZX A;  2P74 A;  4OPZ A;  1FR6 A;  2PU2 A;  5CEB A;  1ERO A;  1YMS A;  1WE4 A;  3D4F A;  1MXO A;  2WKE A;  4RA7 A;  3ZVT A;  1IYO A;  3S4X A;  4X56 A;  2C6W B;  4E3M A;  4M3K A;  5EVL A;  4R4R A;  1XPB A;  4EBL A;  3PBO A;  1LHY A;  4S2P A;  2XLN A;  1YLW A;  1DJA A;  4U3T A;  3VP2 A;  3HUO A;  1XXM A;  3MZF A;  5FA7 A;  4GKU A;  1K56 D;  1W8Q A;  1LI0 A;  1XP4 A;  3VOY A;  4FH2 A;  4N1H A;  3VFF A;  2GDN A;  1SHV A;  3AGD A;  1BUE A;  2XFT A;  1IKG A;  3IHA A;  3HLD A;  3HL9 A;  3FKW A;  1LI9 A;  3MZD A;  1DJC A;  3CZD A;  3VP1 A;  5HFO A;  1O7E A;  1CK3 A;  5HAQ A;  3M6H A;  1ES5 A;  2HDQ A;  1W7F A;  1NXY A;  1ZKJ A;  1BUL A;  5E43 A;  2Q9N A;  4GDN A;  4QJG A;  4K0X A;  3A3J A;  1DY6 A;  4XXR A;  2WGI A;  4BL2 A;  2WAD A;  2EX9 A;  2Y2O A;  3A3F A;  4N1X A;  4KZ6 A;  1IYQ A;  3A3D A;  1KGG A;  4JXV A;  2OLU A;  4MBH A;  4RX3 A;  1MKI A;  2WKH A;  2Y2L A;  3Q81 A;  1SDN A;  1ALQ A;  3OPH A;  4KQQ A;  4P85 A;  2IWB A;  4E6X A;  4OP5 A;  3PAE A;  1I2W A;  1W8Y A;  4X53 A;  5GHZ A;  1ZG4 A;  4S2N C;  4DE2 A;  4UA9 A;  1K55 A;  1BT5 A;  3V5M A;  4X6T A;  3WS1 A;  5BOH A;  5FAP A;  4WEJ A;  5GHY A;  5E2E A;  1XKZ A;  5CTM A;  4B4X A;  2XFS A;  2XDM A;  1FSW A;  1IYS A;  2EXA A;  5GLA A;  3RXW A;  3CG5 A;  5EUA A;  4PM6 A;  4EQI A;  3OZH A;  4OQH A;  3VP3 A;  3BFF A;  2WAE A;  2Y2J A;  3N6I A;  3FKV A;  3HLE A;  4KZB A;  1E3U A;  2XGN A;  3LCE A;  3DW0 A;  3LY3 A;  2R9X A;  3IF5 A;  2ZJ9 A;  5DTK A;  2PBY A;  2BG1 A;  3C7U A;  1YQS A;  3G35 A;  5GL9 A;  5AQB A;  4PM5 A;  2HP5 A;  3PTE A;  3ZFZ A;  4DKI A;  1L2S A;  4F94 A;  2WGW B;  4DDY A;  1L0E A;  1GA9 A;  1PWC A;  4BL3 A;  4OQG A;  3UPP A;  4MEZ A;  3MXS A;  4E6W A;  1KGE A;  3N8R A;  4S2I A;  3C5A A;  3GV9 A;  2RL3 A;  4BJP A;  1SKF A;  4E3K A;  2V2F F;  3BFG A;  1XA1 A;  4FSF A;  1FOF A;  5AQ9 A;  3HUN A;  1TDG A;  4DRT A;  3CJM A;  1TVF A;  4JF4 A;  4OH0 A;  4B88 A;  5JYO A;  4R0Q A;  4P87 A;  1SCW A;  4R1G A;  4WZ4 A;  5IHV A;  2ZC5 B;  4HBU A;  4UA6 A;  5CTN A;  3NBL A;  4KG6 A;  2ZMA A;  3VP4 A;  2DRW A;  3G2Y A;  3A3I A;  2VGK A;  1W79 A;  1JWZ A;  3G34 A;  4N92 A;  4XUZ A;  2RCX A;  1L0F A;  2WYX A;  3VFH A;  1YLZ A;  3BEB A;  3IXG A;  5E2G A;  3IWQ A;  3TG9 A;  1MPL A;  5FQ9 A;  3UNW A;  4X68 A;  2X71 A;  4O7D A;  3PBQ A;  4OOY A;  3O3V A;  4DXC A;  5CHM A;  1H8Z A;  1FCN A;  3WS2 A;  1PW8 A;  3M2J A;  4S2L A;  5U47 A;  3VSK A;  2ZM2 A;  1PZO A;  3P09 A;  4E3J A;  1PI5 A;  4QU3 A;  1CEG A;  4OP8 A;  3RJU A;  1E4D A;  1ERQ A;  3ZG0 A;  2J7V A;  4C3Q A;  4N9L A;  2V1Z A;  4S2J A;  4P0M A;  5FQI A;  4ZJ1 A;  2OV5 A;  1KVL A;  1CEF A;  4MNR A;  4BLM A;  3IWO A;  4BD1 A;  3MKF A;  3E2K A;  2H0Y A;  4PPR A;  3IWI A;  2OSU A;  3NCK A;  4OLD A;  4WM9 A;  3QNC A;  4ZJ3 A;  1GHI A;  5EOO A;  1N9B A;  1BLP A;  1NY0 A;  3UDI A;  2ZQ9 A;  1S6R A;  1H8Y A;  4KZ7 A;  5FSR A;  2OLV A;  3GSG A;  4IBX A;  2WAF A;  5TGF A;  3W4P A;  4WYY A;  3UPO A;  1RP5 A;  1L0D A;  3DWK A;  1JTG A;  3HVF A;  3IXH A;  3PAG A;  1C3B A;  1LL5 A;  4D2O A;  5KZH A;  3IF6 B;  4PM9 A;  1HTZ A;  5FI2 A;  2CC1 A;  4MBK A;  3RXX A;  4WEK A;  2WUQ A;  1GHM A;  2FFF B;  1NYM A;  5CED A;  1QMF A;  1K56 A;  2XQZ A;  4GD8 A;  4OQ0 A;  4U0T A;  1ESI A;  1NZO A;  1K25 A;  4JXS A;  1Z6F A;  4BEN A;  2EXB A;  3BEC A;  2JCH A;  3NC8 A;  5F82 A;  4GOG A;  1RGZ A;  4R3J A;  5FI6 A;  4OPR A;  1K57 C;  1AXB A;  4JKT A;  5FQK A;  2XEP A;  3UN7 A;  3Q82 A;  5DF7 A;  5HW3 A;  4IVI A;  2HDS A;  4IED A;  1K6S A;  1IYP A;  2P9V A;  4KG2 A;  3FV7 A;  3EQV A;  4OVD A;  3OCN A;  1K6R A;  3G32 A;  3SOI A;  1KDS A;  5KMW A;  2Y91 A;  3IXD A;  4IBR A;  4OKP A;  4YIN A;  1K54 C;  3N8L A;  3G2Z A;  4Z9Q A;  2B5R A;  1M40 A;  3NDG A;  3N7W A;  4EBP A;  4K0W A;  4GD6 A;  3UDF A;  1NZU A;  2Y2M A;  4WBG A;  5EVI C;  3S1Y A;  1FCM A;  3WS5 A;  2JBF A;  2HPB A;  1FR1 A;  3V3S A;  3Q7V A;  4DE1 A;  3NIA A;  3TSG A;  4ZTK A;  3QNB A;  3MFD A;  4JXW A;  3ZNT A;  5EE8 A;  1SDE A;  2ZM8 A;  4HES A;  4Y0O A;  4EWF A;  4OON A;  5FQM A;  5DTS A;  5EVI D;  1VM1 A;  1MWT A;  2XD5 A;  3PBT A;  3Q07 A;  5A92 A;  4R3B A;  1GA0 A;  1K38 A;  4S2N A;  1BLC A;  3ZG7 B;  1WYB A;  1CI9 A;  2V20 A;  2ZQC A;  4E3N A;  5CEC A;  3V39 A;  4QB8 A;  5A90 A;  4ZBE A;  4E3I A;  1G6A A;  5KSC A;  4Y7P A;  2R9W A;  1JWP A;  1Q2P A;  1OME A;  1S0W A;  1YLJ A;  5HAR A;  3UDX A;  4E3O A;  1LL9 A;  4UAA A;  3HLF A;  3FZC A;  1PYY A;  3IH8 A;  1PIO A;  1KE3 A;  3GRJ A;  5HX9 A;  4KG5 A;  5CXW A;  2HDU A;  4GNU A;  1J9M A;  2Y59 A;  3EQU A;  3C4O A;  4LCM A;  5GLC A;  2P9V B;  2ZQ8 A;  2ZQD A;  4JBF A;  2XF3 A;  3WRT A;  3ZVW A;  1NJ4 A;  1TEM A;  3NDE A;  5FI7 A;  5HAI A;  1QME A;  1K4F A;  1E25 A;  3UE0 A;  5HL1 A;  1ESU A;  2DNS A;  3LEZ A;  4GB7 A;  1HZO A;  4OOM A;  3SH7 A;  2A3U A;  3MZE A;  4EUZ A;  5EEC A;  2QMI A;  4P6B A;  4NET A;  4HBT A;  4LEN A;  3GR2 A;  4BQM A;  3Q7V B;  1XX2 A;  4QY6 A;  1KGF A;  5CGS A;  1JVJ A;  5FAO A;  3GVB A;  4MLL A;  4R4S A;  3ZG9 B;  4PMA A;  3IF6 C;  4A5R A;  1FQG A;  3W8K A;  4ZAM A;  1VQQ A;  1ES3 A;  4KZ8 A;  4PM7 A;  4JXG A;  2JE5 A;  4C75 A;  4JLF A;  2Y2H A;  2Y2I A;  3GMW A;  3ZCZ A;  1EI5 A;  2Q9M A;  2Y55 A;  2UWX A;  3ITB A;  3QHY A;  4PM8 A;  2EX6 A;  5DF8 A;  3W4Q A;  3HUM A;  4BD0 A;  2J9P A;  4XUX A;  3MKE A;  1BTL A;  2H5S A;  3IXB A;  2IWD A;  3ISG A;  5TR7 A;  4LCL A;  1BSG A;  4KZ9 A;  2Y2P A;  1JWV A;  3WS0 A;  1IEM A;  3FWL A;  3UE3 A;  3M6B A;  1MWU A;  1CI8 A;  4GZB A;  5A91 A;  3N4I A;  4UHU A;  2BLS A;  3N8S A;  3SH9 A;  1ONH A;  3ZG8 B;  5DTT A;  2G2W A;  4X55 A;  3ZGA B;  5JYP A;  2Y4A A;  2HP9 A;  4ZDX A;  2ZQ7 A;  3ZHH A;  3SS3 A;  5AQA A;  5M18 A;  3PBS A;  2X01 A;  1PI4 A;  3P98 A;  3VSL A;  4K91 A;  3BLS A;  4RVA A;  5FAT A;  4WMC D;  3IH9 A;  4WMC A;  4X69 A;  1YT4 A;  5FQJ A;  4Q8I A;  4GN2 A;  1ZG6 A;  1XA7 A;  3NI9 A;  4OPQ A;  4C6Y A;  2QPN A;  4MBF A;  4JF5 A;  2WK0 A;  3VOZ A;  2Z2M B;  4ZJ2 A;  3LO7 A;  5J8X A;  2EX2 A;  2E8I A;  2J8Y A;  3HLC A;  1YMX A;  3IHB A;  5F83 A;  4KZ5 A;  5CER A;  2VGJ A;  1I2S A;  4KZ3 A;  1BLH A;  3OC2 A;  2EX8 A;  3MXR A;  5M19 A;  3G30 A;  1MBL A;  2Z2L B;  2Y2G A;  2EFU A;  4KZA A;  4FH4 A;  5CGX A;  3VMA A;  3I7J A;  1GHP A;  4NK3 A;  3C7V A;  1PWD A;  2C5W B;  5G18 A;  5M1A A;  1K57 A;  2HP6 A;  4OQI A;  4Y0T A;  3O86 A;  1L0G A;  4RX2 A;  2WGW A;  3PBN A;  5CRF A;  3BYD A;  3DTM A;  3O88 A;  1XGI A;  3NY4 A;  3OPL A;  4S2M A;  2ZQA A;  3UE1 A;  3W4O A;  3OPP A;  1PWG A;  4FCF A;  1K54 A;  4DE3 A;  1ES4 A;  1U60 A;  4KQO A;  2Y2N A;  1Y54 A;  4EBN A;  2WKI A;  2ZD8 A;  3SS5 A;  5E2H A;  1K55 C;  4OPY A;  5EVI A;  1PZP A;  3V3R A;  4DXB A;  1YLP A;  2Y2Q A;  2IWC A;  5DF9 A;  1H5X A;  4R23 A;  5F1G A;  4S2O A;  3UY6 A;  3G31 A;  1DJB A;  2JC7 A;  4N9K A;  1LLB A;  1ES2 A;  1NRF A;  3AGE A;  3CMZ A;  3HLW A;  3Q1F A;  4LV3 A;  3UO9 A;  3UPN A;  1EWZ A;  5GHX A;  5HAP A;  3OCL A;  4JPM A;  3WRZ A;  2WZZ A;  4KQR A;  3ZDJ A;  1IKI A;  1I5Q A;  2HDR A;  2DCF A;  1KVM A;  2ZC7 A;  1YM1 A;  4DDS A;  5TFQ A;  5CGW A;  3JYI A;  4ID4 A;  3HBR A;  3WS4 A;  2Y2K A;  3BLM A;  1HVB A;  4JF6 A;  4CPK A;  5DVA A;  3Q7Z A;  1RGY A;  4DE0 A;  2WGV A;  1KE4 A;  2XD1 A;  1MWR A;  3S22 A;  4GDB A;  1E3U D;  5FQQ A;  4B4Z A;  3A3E A;  4KZ4 A;  1M6K A;  4QY5 A;  1PW1 A;  5D3O A;  1RCJ A;  3G4P A;  3BRM A;  1ERM A;  5FDH A;  2XR0 A;  5CHJ A;  3BFE A;  1GCE A;  5EOE A;  4IVK A;  3SH8 A;  3SS4 A;  3DWZ A;  3O87 A;  1MWS A;  1KE0 A;  3PBR A;  4KEN B;  5F1F A;  3GTC A;  2ZC6 B;  4E3L A;  4QHC A;  2ZLY A;  1KDW A;  4UA7 A;  4S2K A;  2J9O A;  3LY4 A;  3GQZ A;  1W5D A;  1YLY A;  3IT9 A;  5A93 A;  4L0L A;  2G2U A;  4YFM A;  3HLG A;  5EVI B;  3IQA A;  3B3X A;  2EFX A;  3BFD A;  3HRE A;  3HLB A;  4HEF A;  2A49 A;  3WWX A;  2FFY A;  4LV0 A;  3ZG5 A;  1ZC2 A;  3IF6 A;  3VP0 A;  1JTD A;  5GLD A;  3MBZ A;  4LV2 A;  4QD4 A;  1BZA A;  5FAS A;  5FAQ A;  5EPH A;  3ZNY A;  5I94 A;  1G68 A;  5KSH A;  1TDL A;  1YLT A;  1IEL A;  1Q2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...