3BFEA

Crystal structure of the class a beta-lactamase sed-1 from citrobacter sedlakii
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
262
structure length
262
Chain Sequence
b'VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGAGDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 92
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfeA00
2Y2OA 3C7UA 5CGXA 1BLSA 1SKFA 3VSKA 1PWCA 2Y59A 5KZHA 1XA7A 1C3BA 3GQZA 3WWXA 5CERA 2RCXA 3WS2A 1LI9A 3LY4A 1FCOA 2DRWA 1YLJA 4DE3A 5FATA 1E25A 4B88A 4WZ5A 3UE1A 4S2OA 4OOLA 5FDHA 3G34A 4B4ZA 4C3QA 3MBZA 3V3RA 5DF7A 5DTKA 3RJUA 5GL9A 1H5XA 2JE5A 3SS3A 4EBLA 1SHVA 3VP0A 1IYQA 3A3JA 3IF5A 5FAQA 1BZAA 1ESIA 1L2SA 3CMZA 1JWZA 4NETA 3CG5A 4WELA 3WS4A 3UPOA 3IF6B 2VGKA 1MPLA 3OC2A 4WM9A 4Z9QA 3BFDA 1PIOA 4R1GA 4OP8A 3IWIA 5JYPA 2Q9MA 3WS1A 2IWDA 4PPRA 4R0QA 1IKIA 4X6TA 5F1GA 4X69A 4EV4A 3UN7A 1G6AA 4JPMA 1RGYA 4BJPA 1K55A 5M19A 3O86A 4R4RA 3W4QA 1DJBA 1GHPA 2EX9A 3Q7VB 4PMAA 4S2LA 4E3JA 1ALQA 4XXRA 3RXXA 1W5DA 2G2UA 4LCMA 4KZAA 4S2IA 3V3SA 3O88A 2ZC4B 3N8RA 3Q7VA 2I72A 4N92A 1PW1A 1XP4A 4FCFA 3MKFA 4P85A 5EPHA 3W4OA 1ONGA 1KGFA 2HP6A 1FCMA 3IHBA 3UE0A 4BLMA 1NZOA 5CHJA 4UHUA 3M2KA 5EVLA 1K56D 1PYYA 2OV5A 4X53A 4E6WA 3ZNTA 1VQQA 1GHMA 1LHYA 1L0GA 2P9VB 3IWOA 4LV2A 5FA7A 5HARA 3UDFA 2EX6A 2X01A 3Q07A 4F94A 5A91A 4QY6A 1YMSA 3MZDA 5HAIA 5CECA 4JXGA 2P9VA 3ZG5A 4DF6A 4OQIA 4YFMA 4MNRA 3DW0A 1IELA 1K57A 1W79A 1K6SA 5FI2A 4QB8A 2ZJ9A 4S2NC 3GRJA 1SDNA 2ZQDA 4JF5A 1XA1A 5GHYA 1NXYA 3N8SA 3FZCA 4S2KA 1ERMA 3ZFZA 4FD8A 2DNSA 5L2FA 3HLDA 2J9PA 4S2JA 4OH0A 2HP5A 3I7JA 2PU4A 1KVMA 4U3TA 5HX9A 3ZDJA 3O87A 2ZMAA 1ES4A 2JC7A 3BYDA 3N7WA 4EBPA 3G4PA 3A3FA 5AQAA 2JBFA 2Q9NA 1KE3A 3OPRA 2OLVA 4XUZA 5CHUA 3MZEA 2E8IA 4WZ5C 4DXBA 1K54A 3HLCA 2Y2LA 5U47A 2CC1A 1JTDA 1RP5A 3PTEA 5E2GA 3IWQA 3UE3A 5FQJA 1MKIA 2Y2MA 1K6RA 4C75A 3VP4A 1BLHA 3PBOA 2WZXA 3ZG9B 4FH2A 5M1AA 3PAGA 3G31A 3ITBA 4ZJ1A 5EE8A 3QNCA 3V39A 3SOIA 4DE1A 1GA0A 3VFHA 3EQUA 2H0YA 2WGWA 3OPPA 2WKIA 5E2FA 3MZFA 2XQZA 4FH4A 4WEKA 3DWKA 3OCLA 4KG6A 3BFCA 4EQIA 4QJGA 1L0EA 2QMIA 5HW3A 1K4EA 2WAEA 1W8YA 4OLDA 2C6WB 3PBQA 2XFSA 4OOMA 3MXRA 4LV1A 4BL3A 3VOZA 1K55C 1Y54A 2Y2JA 3GTCA 3ZGAB 1KVLA 2XGNA 1PI5A 3SH7A 4C6YA 4UA6A 3Q82A 4U0XA 3TG9A 2IWBA 5EOOA 4GZBA 1MXOA 2Y2HA 1JVJA 3HLGA 3OZHA 4E3OA 4E3NA 2XR0A 1K56A 1LLBA 1ES5A 2PBYA 1RGZA 5TGFA 4X68A 4D2OA 2EFUA 1OMEA 2EXAA 5FI6A 2EFXA 2ZLYA 3HLEA 1XGJA 1E3UD 3ZNYA 2FFYA 4E3IA 2WKEA 1W7FA 4N9LA 5CEDA 2Y2IA 2WGIA 4JLFA 4HBUA 1K25A 4ID4A 1BLPA 4JXWA 3E2KA 4JBFA 5DF8A 2ZQAA 3NCKA 4A5RA 1ZG4A 1WYBA 1PWDA 2A3UA 3NIAA 3SS5A 5CGWA 3HLWA 4Y0TA 1EWZA 1LI0A 1PI4A 2QZ6A 1M40A 5EVIC 2BG1A 4Q8IA 2P74A 3IF6A 1MWUA 4OPYA 2J8YA 4ZJ2A 2WYXA 1CEFA 4K91A 4QHCA 2HP9A 2XH9A 4MBFA 1ZC2A 1NY0A 4GB7A 4WYYA 1U60A 3TOIA 5M18A 4P87A 4B4XA 4OPRA 3HUNA 1BT5A 1G68A 1YLWA 4R3BA 3VOYA 3ISGA 3A3IA 1CEGA 4CPKA 1LL5A 3VP2A 3NBLA 2FFFB 2EXBA 1MWSA 5FSRA 1ES2A 1I5QA 1HZOA 1YQSA 4DE0A 1XKZA 2OSUA 1FSWA 3NC8A 4KZ9A 4RVAA 5GHXA 1K54C 1SCWA 1PWGA 3UNWA 2XD1A 4DDSA 3C4OA 4NK3A 1IYOA 1XX2A 3G30A 3M6HA 4PM9A 3AGDA 2IWCA 4KZ8A 2ZQ9A 3PBTA 2XEPA 3CZDA 1YM1A 4FSFA 3WS5A 5G18A 1FR6A 1KGGA 1L0FA 4RX2A 1HTZA 2EX8A 4OQGA 3HVFA 5EECA 2WK0A 2XF3A 2Y2NA 1LL9A 3IT9A 4P0MA 4S2MA 2XDMA 1HVBA 2Y91A 5CTNA 1NYMA 1NJ4A 3D4FA 3VP1A 3UY6A 4E3KA 3IH8A 2J7VA 4UAAA 4DKIA 5F83A 1K4FA 5GLAA 1MBLA 5JYOA 1FR1A 4GD6A 5A90A 3IXHA 2V2FF 3QHYA 1YT4A 2RL3A 2ZC5B 4LCLA 3P98A 3UO9A 3G2YA 4CJNA 5KMWA 4OONA 4K0WA 1E3UA 2Y55A 1IYSA 2ZM0A 4S2PA 1XPBA 1YMXA 2XK1A 3BLSA 1KE0A 2V20A 3S4XA 4LV0A 4EUZA 3V50A 5AQ7A 4Y0UA 2X71A 3NI9A 4RA7A 2WADA 3P09A 4U0TA 4Y0OA 1DJCA 2JCHA 2C5WB 1WYCA 3JYIA 3AGEA 3BFEA 3N8LA 3BFFA 2B5RA 2ZQCA 3B3XA 4KZ6A 4BD0A 2Y4AA 3SH9A 3C5AA 4DE2A 1QMEA 3FV7A 5GLDA 4IVKA 5BOHA 4LV3A 3NDGA 1IKGA 4GOGA 4KZBA 1E4DA 4N1XA 1ZG6A 4GN2A 4P6BA 3MXSA 4BENA 5KSCA 3UPNA 3IF6C 3HUMA 4PM6A 4YINA 1FCNA 3IXDA 3W8KA 5GLCA 1Q2PA 3MFDA 3ZG0A 1L0DA 2H0TA 3WS0A 5E2HA 3N6IA 3SS4A 3DWZA 1BSGA 3C4PA 5DF9A 3Q1FA 3LO7A 3PBRA 1CI8A 3ZCZA 2J9OA 4GD8A 4E3MA 4EWFA 4XUXA 5FAPA 2WAFA 2Z2MB 2Y2QA 4OQ0A 1GHIA 3ITAA 2BLSA 1XXMA 2HDUA 1Z6FA 4JXSA 2ZC6B 2ZM2A 1BTLA 3CJMA 4PM8A 4ZJ3A 5F1FA 4S2NA 3NY4A 3A3EA 1TDGA 4KQQA 1YLPA 1O07A 1BULA 4HESA 2ZM8A 4H8RA 2HDSA 5EVID 4KG5A 4R3JA 4Y7PA 5KSHA 1MWRA 5CGSA 3ZVWA 3GMWA 4ZDXA 4E3LA 4OLGA 1RCJA 1DJAA 1XGIA 3VSLA 3G32A 3WRZA 1W8QA 2EX2A 4BD1A 3IHAA 4QU3A 1K57C 2H5SA 2Y2KA 4E6XA 5GHZA 1DY6A 4HEFA 3LCEA 4UA9A 3VMAA 1K38A 3BM6A 5CTMA 3Q81A 2XD5A 2H10A 5EUAA 5CRFA 3HUOA 5TR7A 4OOYA 4OPZA 4JKTA 5AQ9A 2QPNA 1H8ZA 3E2LA 3FWLA 4PM5A 3G2ZA 3MKEA 1NRFA 1N4OA 1TDLA 5A92A 3BLMA 3W4PA 4MBKA 2R9XA 1I2SA 5HAPA 1S0WA 1S6RA 1VM1A 1N9BA 2V1ZA 2XFTA 4UA7A 1KDSA 2HPBA 2UWXA 3RXWA 4PM7A 3OCNA 4LENA 4WMCD 4ZAMA 2VGJA 2OLUA 2WGVA 5CEBA 1ERQA 1NZUA 2HDQA 3FKWA 4MEZA 1J9MA 4M3KA 4IBXA 5FQIA 3IXGA 3PAEA 2GDNA 2R9WA 3IXBA 4DRTA 2X02A 1SDEA 3GV9A 2Y2PA 3BEBA 1TEMA 4R4SA 3BECA 3G35A 5IHVA 5J8XA 2DCFA 3S22A 5FQMA 2G2WA 2HDRA 3V5MA 2Z2LB 5FI7A 3M2JA 1PW8A 4JXVA 3OPHA 1HD8A 3OPLA 4IBRA 2ZC7A 4OPQA 3PBNA 3IH9A 1JTGA 4ZBEA 3O3VA 3HLFA 1O7EA 3VFFA 2ZD8A 1EROA 3A3DA 3GR2A 2Y2GA 3ZHHA 4OP5A 1PZPA 5FAOA 4OVDA 5HFOA 3UDXA 3LY3A 3PBSA 1ESUA 5EOEA 3WRTA 1KGEA 5EVIB 1AXBA 2A49A 4BQMA 4QY5A 5FQQA 4EBNA 4IVIA 4QD4A 4ZTKA 1EI5A 3Q7ZA 5FQ9A 4DDYA 5D3OA 1ES3A 1JWVA 5DVAA 4OKPA 2ZQ7A 5FQKA 4MBHA 5EVIA 1KDWA 4KZ4A 4R23A 4KQRA 3FYZA 3HREA 5DTTA 4JF6A 2ZQ8A 1YLTA 3IQAA 3ZG8B 4DXCA 3HLBA 5A93A 5CHMA 1GCEA 1TVFA 1FSYA 3HL9A 3BRMA 2WUQA 1YLYA 4X56A 4RX3A 3QNBA 1ONHA 1FOFA 4BL2A 3M6BA 5AQBA 4WEJA 4GNUA 2WZZA 4KENB 3HBRA 5F82A 5HL1A 3GSGA 4L0LA 4N9KA 4OQHA 5I94A 4O7DA 5FASA 1YLZA 3NDEA 4JF4A 5CXWA 2ZC3B 4GDNA 1IEMA 1CK3A 1MY8A 3S1YA 1Q2QA 3BFGA 1QMFA 3EQVA 3N4IA 4HBTA 3ZG7B 1M6KA 4N1HA 3GVBA 1WE4A 4KQOA 1NYYA 1PZOA 3UPPA 5TFQA 1BUEA 5DTSA 1ZKJA 2PU2A 4GDBA 2WGWB 4KG2A 5GLBA 4WMCA 3TSGA 5E2EA 1CI9A 1GA9A 1BLCA 3VP3A 5E43A 1MWTA 2XLNA 3LEZA 3SH8A 4WZ4A 3UDIA 4KZ5A 1I2WA 4KZ7A 1FQGA 1IYPA 4K0XA 4MLLA 3DTMA 1JWPA 4X55A 3AGFA 5HAQA 3FKVA 1KE4A 3ZVTA 4WBGA 4IEDA 4RYEA 2WKHA 3C7VA 4KZ3A 4GKUA 1H8YA
chains in the Genus database with same CATH superfamily
1OT9A 3C7UA 3SZTA 1XA7A 3WWXA 3UMDA 1CF0A 3E4QA 4IJGA 3UB9A 1YLJA 1E25A 3QP8A 4WZ5A 1OTAA 4OOLA 5FDHA 3G34A 4Q0HA 5DTKA 3KYEA 5L09A 4EBLA 3VP0A 5FAQA 4B93A 1BZAA 1ESIA 5HD3A 1JWZA 4NXFA 4NETA 4Y17A 2VGKA 3OC2A 1GSXA 4WM9A 4Z9QA 1MKMA 3BFDA 3OLOA 4R1GA 3IWIA 3CHWP 3LGOA 1FIKA 4R0QA 3LI8A 4X6TA 5F1GA 4EV4A 3UN7A 1G6AA 4JPMA 3CLOA 1K55A 3BJNA 3NOPC 2JHEA 1SKOB 4S2IA 2ZC4B 3N8RA 3D3OA 4E04A 2ZMVA 2Y79A 3MQ0A 3W4OA 2J80A 2VEAA 3UE0A 4HH2A 1XJ4A 1OTDA 4X53A 3IWOA 2H28A 4F94A 4QY6A 3MZDA 1OTEA 2P9VA 2O9BA 2ZJ9A 4S2NC 3GRJA 2VGLS 2ZQDA 3F1NA 1NXYA 3N8SA 4CLCE 3FZCA 2O9CA 1SZVA 1LT0A 4FD8A 2HP5A 3I7JA 2PU4A 1KVMA 4U3TA 5EFWA 4NEED 5HX9A 1TF1A 3ZDJA 4BMWA 3IX8A 3G4PA 4IHQA 4PKYA 4QPRA 5CHUA 1K54A 1JTDA 1RP5A 3IWQA 2XROA 1K6RA 4C75A 2QKPA 5M1AA 2PAVP 3ITBA 4ZJ1A 1P97A 3QNCA 4DE1A 3VFHA 2QWSA 4LRXC 2WKIA 3MZFA 3OCLA 4KG6A 4QJGA 1L0EA 2WAEA 4BL3A 3PBQA 3MXRA 3NJAA 3VOZA 1Y54A 5HPIA 4IUHA 3EGXC 1JVJA 3OZHA 3JVUA 5TGFA 2EFUA 1OMEA 5TJJA 3HLEA 2M7UA 4O8GA 4E3IA 3R4KA 2WGIA 4HBUA 1K25A 3LR0A 4JXWA 1ZG4A 2A3UA 3NIAA 2VLGA 2WKPA 3KSHA 2V1BA 3HLWA 4O0PA 3H9WA 4K91A 4QHCA 2HP9A 1U60A 1W63Q 3HUNA 1G68A 3ISGA 4FTXA 4NKPA 3T1SA 1MWSA 1ES2A 1XKZA 2OSUA 4AFIA 4KZ9A 2R78A 2XD1A 4DDSA 1DP9A 2JN7A 3E0YA 4PM9A 1HLUP 3CZDA 1L0FA 1G5UA 3T4TA 1K0KA 4OQGA 3HVFA 2V8FA 3IT9A 1NJ4A 1T19A 2J7VA 1G28A 3QP6A 1CJFA 5F83A 3BQAA 4Q0JA 5A90A 3IXHA 2V2FF 1YT4A 3G2YA 4X1LA 4Y2FA 5KMWA 4OONA 1E3UA 2Y55A 1IYSA 4JGRA 4HNBA 2ZL1B 3GECA 1NLZA 2X71A 4Y0UA 4RA7A 5G4ZA 4JGQA 2JCHA 2P08A 2C5WB 2ZQCA 3EEHA 3B3XA 2GJ3A 4KZ6A 3SH9A 5BOHA 3FV7A 3LR3A 5F68A 3MR0A 1P9WA 5HWTA 4GN2A 4P6BA 1FCNA 3FPVA 2NUPC 2H0TA 3Q1FA 4E3MA 4HH3A 3ITAA 2BLSA 4BBVA 2VA0A 3OBFA 2HDUA 4JXSA 5HDDA 3CJMA 5F1FA 3KSFA 4EEPA 2W3DA 5KSHA 4R3JA 4Y7PA 1MWRA 5CGSA 3HCYA 4OLGA 1RCJA 2PR6A 1XGIA 3WRZA 1K57C 3CUEC 1DY6A 5F6AA 2EWVA 1OPXA 2VKSA 3LIBA 2XD5A 1N9OA 4PM5A 3R7WA 3BLMA 4MBKA 1I2SA 3G6OA 2GNXA 5CX7A 1MC0A 2HPBA 3OCNA 4LENA 4ZAMA 2VGJA 5CEBA 1NZUA 3RFBA 3IXBA 2M7VA 4DRTA 2X02A 3LI9A 3GV9A 2Y2PA 4CLCA 1TEMA 3S22A 3F1OB 3T50A 3RH8B 3M2JA 3OPLA 4OPQA 2PRFA 4ZBEA 3O3VA 1O7EA 3HJIA 4H6JB 3A3DA 3KO6A 4OP5A 2ZOIA 2W1TB 1ESUA 5EOEA 1AXBA 2A49A 4L9EA 1ES3A 3LR5A 5FQKA 1KDWA 4MCWA 2HV1A 3A0VA 4JF6A 1YLTA 3ZG8B 5CHMA 1GCEA 3HL9A 5FEFA 1VEUA 5HPFA 4X56A 2J3WA 3M6BA 4WEJA 4KENB 4I39A 4O7DA 4Y15A 5CXWA 3NDEA 4JF4A 4Y13A 2ZC3B 1F5MA 3EQVA 4HBTA 1M6KA 4N1HA 1NYYA 3UPPA 1BUEA 5DTSA 1XFQA 4GDBA 3TSGA 4MN7A 1NLYA 5E2EA 1GA9A 1MWTA 4KZ5A 1FQGA 1IYPA 1H8MA 3FKVA 1KE4A 3ZVTA 2WKHA 4ZRRA 1BLSA 1SKFA 2XA7M 3VSKA 1IOUA 3TJZC 4JGOA 3H82A 3MS6A 1C3BA 4NG2A 3WS2A 1FCOA 2DRWA 4DE3A 3FC7A 4C3QA 3KYQA 3MBZA 4FOFA 3V3RA 4II7A 1SHVA 3A3JA 3CMZA 3UPOA 2O9AA 5JYPA 4X69A 4BJPA 3W4QA 1DJBA 1GHPA 4PMAA 3CI6A 1ALQA 4XXRA 5FL3A 1W5DA 3A0RA 4QWOA 3V67A 2PT7A 3O88A 2LB5A 3Q7VA 3PR6A 5HZHA 2VK3A 1T18A 2I72A 4N92A 1PW1A 5EVEA 3MKFA 5EPHA 1KGFA 3IHBA 3IS2A 1NZOA 5CHJA 2CMNA 3M2KA 1K56D 2OV5A 4EW7A 5HWWA 1VQQA 1GHMA 1L0GA 3CPTA 2XRNA 5HARA 3UDFA 2EX6A 3Q07A 3FG8A 4JXGA 3ZG5A 4OQIA 4YFMA 4MNRA 3T4LA 5FI2A 1SDNA 1S4SA 5GHYA 4S2KA 1ERMA 2O99A 4S2JA 2JKFA 1Y28A 2ZMAA 3BYDA 3N7WA 1G6OA 2JBFA 2Q9NA 3MSHA 3OPRA 3MZEA 2E8IA 4WZ5C 2PD7A 2FZ0A 2Y2LA 5E2GA 2HGVA 3P01A 2OAP1 2Y2MA 1BLHA 4FH2A 4GHIA 3PXPA 2QJ5A 3EQUA 2JKTI 3OPPA 3TRCA 2XQZA 3T1QB 5TBMB 3BFCA 3S7OA 1K4EA 4OOMA 3B47A 2W3EA 3ZGAB 1K55C 2Y2JA 3GTCA 1KVLA 1PI5A 4C6YA 4UA6A 3Q82A 5DJUA 2IWBA 4DN0A 1MXOA 1F98A 4E3OA 2XR0A 1LLBA 1ES5A 1RGZA 1S1YA 4NXBA 3F1PA 1XGJA 3ZNYA 2WKEA 1W7FA 4N9LA 4JLFA 4EXOA 4DJ2A 3E2KA 4JBFA 3NCKA 4K08A 1WYBA 4Y0TA 1LI0A 1PI4A 3DAVA 4MMNA 1MWUA 4OPYA 2J8YA 1AWIA 4ZJ2A 4MBFA 5DKLA 3T12B 1NY0A 4IUKA 4LRYC 3R7WB 1PNEA 4P87A 5HDSA 4OPRA 4B4XA 2PD8A 3VOYA 5FDSA 1LL5A 3NBLA 4WUJA 5HSQA 5FSRA 1I5QA 1T1BA 5A8BA 2EA9A 1FSWA 5GHXA 1K54C 1SCWA 4CLCB 3M6HA 3AGDA 2IWCA 4KZ8A 3PBTA 4Q0IA 2INWA 1OTBA 1KGGA 1HTZA 4BWIA 2A24A 1TS7A 2WK0A 4S2MA 1LL9A 4P0MA 4LRZE 3D4FA 2EWWA 3UY6A 4E3KA 3IH8A 4HJ3A 5GLAA 1MBLA 5JYOA 4GW9A 3P98A 1D1JA 4S2PA 4EUZA 1VEUB 4U0TA 4Y0OA 3C8CA 1DJCA 1WYCA 2KX6A 4BD0A 4DE2A 1QMEA 2B95A 4LV3A 1IKGA 4KZBA 4HY8A 3UPNA 4PM6A 4YINA 3IXDA 1YSPA 1Q2PA 2XSSA 3ZG0A 1L0DA 2V1AA 3N6IA 1BSGA 5DF9A 1VHMA 4OQ0A 1GHIA 1XXMA 2VJWA 4FUWA 1BTLA 3EEAA 4S2NA 3H82B 3NY4A 4EEUA 1YLPA 1GSVA 4HESA 3MF0A 3K3CA 4G3VA 4KG5A 3GMWA 2ACGA 3LEQA 1DJAA 3G32A 4BD1A 1XJ3A 2H5SA 4E6XA 5GHZA 4HEFA 3IX3A 3LCEA 4UA9A 3VMAA 3Q81A 1YSQA 4WN5A 5EUAA 5CRFA 3HUOA 3CAXA 4OOYA 4PAUA 2QPNA 3LUQA 3G2ZA 1T1CA 5FEGA 1N4OA 4I3IA 5HAPA 1S0WA 1S6RA 3NOUC 2V1ZA 2XFTA 1KDSA 2UWXA 2HDQA 4ARZB 2GX5A 5IS1A 3DTKA 3IXGA 5EM0A 3TE8A 2NUTC 4MN5A 1CQAA 1SDEA 3BEBA 4R4SA 4YWZA 5J8XA 5IHVA 2JKRM 2G2WA 2Z2LB 1PW8A 4JXVA 3IS2B 4X1MA 2ZC7A 1V9ZA 3O5YA 3BQ8A 1EROA 3GR2A 3ZHHA 2W3FA 3LY3A 3WRTA 5EVIB 4BQMA 4QY5A 4EBNA 4IVIA 4Y5FA 4QD4A 2P04A 1EI5A 2L1MA 4OKPA 2ZQ7A 2YKHA 3HREA 3BY8A 5DTTA 3IQAA 2VV6A 4DXCA 5A93A 1FSYA 3BRMA 1YLYA 1T1AA 1FOFA 4BL2A 4GNUA 4HP4A 5F82A 5I94A 3H7WA 1YLZA 1IEMA 1MY8A 3VV4A 3BFGA 2J3TC 4XT2A 3ZG7B 4BBTA 5TFQA 3LIAA 4ESPA 2PU2A 4MDZA 4EETB 1W63M 1GSWA 4G3WA 3SH8A 3LEZA 2V0WA 4K0XA 3DTMA 3AGFA 4HJ4A 3E98A 3OOVA 3UMEA 3ICYA 1OT6A 3U2AA 1L3LA 3C7VA 1H8YA 2Y2OA 5CGXA 4CLCC 1J3WA 5KZHA 3GQZA 1Z09A 3ZYTA 5FATA 5K5BA 3UE1A 4S2OA 4I5SA 4B4ZA 2UV0E 3QP2A 3RJUA 4R6LA 5GL9A 2JE5A 3IF5A 2W3GA 3CG5A 4WELA 3WS4A 5J4EA 3MMHA 1MPLA 3L7HA 1PIOA 4OP8A 1N9NA 3WS1A 4PPRA 5AVEA 1A0KA 4EERA 1RGYA 5M19A 3O86A 4S2LA 1STZA 3EGDC 3RXXA 3V3SA 1DRMA 3B33A 1DP6A 1XP4A 2JKRI 4FCFA 4BBUA 2HP6A 1FCMA 2KOIA 4BLMA 2IA2A 4UHUA 2A24B 5EVLA 1LSVA 3ZNTA 3IX4A 2P9VB 4LV2A 2X01A 5A91A 2ZBBA 3F1NB 3DW0A 1IELA 1K57A 1KOUA 1TD5A 4QB8A 1XA1A 1P0ZA 5L8MA 1S67L 3ZFZA 2DNSA 1ZHHB 5L2FA 3HLDA 2J9PA 4OH0A 2W0NA 2J3TD 5F69A 4EBPA 3A3FA 3T1XA 3DTEA 4XUZA 4DXBA 4Y3IA 5U47A 3NOTC 3UE3A 3PBOA 3ZG9B 3EOIA 3PAGA 3T4SA 3SOIA 1VETA 2H0YA 4HP9A 4FH4A 4WEKA 4EQIA 2LB9A 4OLDA 1W8YA 2XFSA 3TG9A 4U0XA 2V9AA 5EOOA 4GLQA 3KSIA 3HLGA 3QP4A 1K56A 3UB8A 2PBYA 2WKRA 4D2OA 5FI6A 2EFXA 2I9VA 5CEDA 2W1RA 4ID4A 1BLPA 3PHYA 5DF8A 4A5RA 1PWDA 5CGWA 4F3LA 2QZ6A 1M40A 5EVIC 2BG1A 2L4RA 3IF6A 2PYRA 2WYXA 4GB7A 4WYYA 3TOIA 4UQIS 1YLWA 4R3BA 3LIFA 3A3IA 2D02A 3VP2A 2FFFB 3IBRA 5AJGA 4RVAA 3NC8A 1PWGA 3UNWA 4P6ZS 4CQHA 3C4OA 2ZQ9A 2XEPA 2K31A 2PBDP 1FR6A 2V8CA 4RX2A 1MZUA 5EECA 2XF3A 2XDMA 5AVFA 2VV8A 1HVBA 1NYMA 1OJGA 4UAAA 2VV7A 1FR1A 3UO9A 4LCLA 4CJNA 2RL3A 2ZC5B 3QP1A 2ZM0A 1XPBA 1YMXA 2XK1A 3LFVA 3LR4A 3BLSA 4PHTA 1KE0A 2V20A 1H3QA 3P09A 2HF6A 2QHKA 2OAQ1 3IBJA 3BFEA 3H7WB 4WF0A 2Y4AA 3QP5A 3C5AA 4G3KA 3NDGA 4XT2B 4N1XA 1E4DA 1XJ2A 3MFDA 3WS0A 5E2HA 3SS4A 3DWZA 4YNRA 3LO7A 3PBRA 1CI8A 2O0YA 2KLIA 3P7NA 2OOLA 3T4QA 4EQ1A 1Z6FA 2QYBA 4YOFA 4ZJ3A 3A3EA 1TDGA 1O07A 4H8RA 2HDSA 5EVID 4PKYG 3ZVWA 4ZDXA 2WKQA 1DP8A 3NHQA 3VSLA 2EX2A 3B42A 1YAXA 2HJEA 1TS8A 1K38A 3BM6A 4HJ6A 5MC7A 2H10A 4OPZA 1NRFA 1TDLA 4R3AA 5A92A 4RQ9A 2VGLM 2V0UA 1VM1A 3MXQA 4WMCD 3C2WA 2WGVA 3FKWA 4MEZA 1J9MA 4M3KA 3VE3A 4IBXA 3PAEA 4GS9A 3BECA 3UB6A 4LGWA 5G4YA 4R70A 3F1OA 4IBRA 3IH9A 1JTGA 3VFFA 2ZD8A 2Y2GA 1PZPA 3KX0X 5HFOA 3MQOA 3PBSA 4H6JA 1KGEA 2QJ7A 3UE6A 3W2ZA 3Q7ZA 1UWPX 4DDYA 5D3OA 2W1TA 1JWVA 4MBHA 4KZ4A 4R23A 4KQRA 1JNUA 2ZQ8A 1Y4OA 1TVFA 3QNBA 2BTFP 1ONHA 1V9YA 3PYPA 4HHDA 5HL1A 4L0LA 5FASA 5DFYA 4GDNA 2Q0OA 1VB6A 1QMFA 4L9GA 2PHYA 4KQOA 5KIZA 1PZOA 1VETB 3MQQA 3C30A 4KQDA 1D06A 1EW0A 2XLNA 3UDIA 5HL6A 4MLLA 4X55A 4WBGA 4IEDA 4RYEA 4KZ3A 4GKUA 3BWLA 1PWCA 2Y59A 5IT5A 3TW8A 3LIDA 2PR5A 5CERA 2RCXA 1LI9A 3LY4A 2A2LA 4EESA 2W3HA 4B88A 4WL9A 1S4RA 4L9FA 4NXEA 5DF7A 3U4LP 1H5XA 3SS3A 5LBRA 4F3LB 1IYQA 1L2SA 4I3JA 3DTIA 3IF6B 3S7PA 2OWJA 2Q9MA 3ZQ5A 2IWDA 2Z6DA 1IKIA 5HWVA 3L9KA 2FH5A 4R4RA 2EX9A 3Q7VB 4E3JA 2OWHA 5DJTA 2G2UA 4LCMA 4KZAA 4O01A 4EUVA 4ME4A 1XJ6A 4DMZA 1NRJA 4P85A 4GJ4A 1ONGA 2PYPA 4M4XA 3CPTB 3T4OA 1UWNX 4ETZA 1PYYA 4E6WA 1LHYA 4HQAA 1ODVA 5FA7A 4D60A 1ACFA 1YMSA 3JVVA 3SW1A 5HAIA 5CECA 4KUKA 4DF6A 1W79A 1K6SA 4JF5A 2VX8A 3A0SA 3KYZA 3O87A 1ES4A 1LSWA 2JC7A 5AQAA 3EWKA 1KE3A 2OLVA 4R38A 3HLCA 2CC1A 4GHIB 3PTEA 5FQJA 1MKIA 1S66L 3E4PA 3VP4A 2WZXA 3MJQA 3G31A 5EE8A 3V39A 3BW6A 1GA0A 2WGWA 5E2FA 1F9IA 2ZOHA 3DWKA 3RTYA 2QMIA 5HW3A 2PDRA 2C6WB 4LV1A 5DKKA 5TBMA 3NULA 2GZAA 2XGNA 3SH7A 4LPZA 3T4JA 4GZBA 2Y2HA 3F1PB 2E8JA 4E3NA 4X68A 1X0OA 2EXAA 5I5LA 2ZLYA 1E3UD 2FFYA 2Y2IA 4I3AA 2ZQAA 1F2KA 3SS5A 1EWZA 3MFXA 3S7NA 4Q8IA 2P74A 1WA9A 1CEFA 3LIEA 2XH9A 1ZC2A 3HJKA 3UB5P 5M18A 3CITA 1BT5A 3T1RA 1S1ZA 1CEGA 4CPKA 2EXBA 1HZOA 3T4KA 1YQSA 4DE0A 1SKOA 4GS9B 4NK3A 1IYOA 1PRQA 4WLAA 1XX2A 3G30A 4FSFA 1YM1A 3WS5A 5G18A 4HOIA 3K2NA 3D9YA 1IFQA 2EX8A 3VE4A 2K7SA 3CWFA 5IU1A 2Y2NA 2Y91A 5CTNA 3CUEA 3VP1A 3ULFA 4DKIA 1K4FA 1N9LA 4GD6A 3KSGA 4B9OA 3QHYA 1PFLA 5J3WA 4K0WA 1BYWA 1TS6A 1OTIA 3S4XA 4LV0A 2HZ5A 3V50A 5AQ7A 3NI9A 2M1CA 2WADA 4HI4A 4LFUA 3JYIA 3N8LA 3AGEA 3S7QA 3BFFA 2B5RA 2JKGA 1LL8A 5GLDA 4IVKA 4X25A 3D72A 3GDIA 2KDKA 4JGPA 4GOGA 4LLOB 2L0WA 4I38A 5HDCA 1ZG6A 2B18A 3MXSA 4BENA 5KSCA 3IF6C 3HUMA 5J7EA 4CLCD 3LYXA 3W8KA 5EV0A 5GLCA 1TS0A 2JKTM 3C4PA 3ZCZA 2J9OA 4GD8A 2B02A 4EWFA 4XUXA 5FAPA 2WAFA 3JPUA 2Z2MB 2Y2QA 4UQIM 3BY9A 5EM1A 1LSXA 2ZC6B 2ZM2A 2BASA 4PM8A 4KQQA 1BULA 3E4OA 2ZM8A 4P6ZM 2VZWA 1NWZA 3FPWA 4E3LA 1W8QA 3IHAA 4QU3A 2Y2KA 5L07A 2P7JA 5CTMA 4HIAA 4DJ3A 5TR7A 4ETXA 4JKTA 5AQ9A 1H8ZA 2K2NA 3E2LA 3FWLA 3MKEA 1P9RA 2HJ9C 3W4PA 4KUOA 2R9XA 1N9BA 4GCZA 4UA7A 1H0MA 2XA7S 3RXWA 4PM7A 5DFXA 2OLUA 1ERQA 1YPRA 3NECA 5FQIA 2AVXA 2GDNA 2R9WA 2MJ6A 4ARZA 3G35A 3VOLA 2DCFA 5FQMA 2HDRA 3V5MA 1OJ5A 5FI7A 3OPHA 1HD8A 1YKDA 3UB7A 3PBNA 1D7EA 3HLFA 5L10A 5FAOA 4OVDA 3UDXA 4MN6A 5FQQA 4ZTKA 5FQ9A 1ZTUA 5DVAA 5EVIA 2Y8HA 3FYZA 2Z6CA 3HLBA 2ZL1A 2WUQA 3C38A 4RX3A 4EU0A 5AQBA 1XFNA 1FILA 2WZZA 3HBRA 3GSGA 4N9KA 4OQHA 1CK3A 2D01A 3S1YA 1Q2QA 3N4IA 1UGUA 1WE4A 3GVBA 2ZMFA 3K3DA 1ZKJA 4KG2A 2WGWB 4UEYA 5GLBA 4WMCA 5C5KA 2DMWA 1CI9A 1BLCA 2W27A 3VP3A 5E43A 2YKFA 3DBAA 4WZ4A 4NXGA 5F5YA 1I2WA 4KZ7A 4Z1WA 1JWPA 2G7UA 5HAQA 3LICA 5HD5A
chains in the Genus database with same CATH topology
2Y2OA 3C7UA 5CGXA 1BLSA 1SKFA 3VSKA 1PWCA 2Y59A 5KZHA 1XA7A 1C3BA 3GQZA 3WWXA 5CERA 2RCXA 3WS2A 1LI9A 3LY4A 1FCOA 2DRWA 1YLJA 4DE3A 5FATA 1E25A 4B88A 4WZ5A 3UE1A 4S2OA 4OOLA 5FDHA 3G34A 4B4ZA 4C3QA 3MBZA 3V3RA 5DF7A 5DTKA 3RJUA 5GL9A 1H5XA 2JE5A 3SS3A 4EBLA 1SHVA 3VP0A 1IYQA 3A3JA 3IF5A 5FAQA 1BZAA 1ESIA 1L2SA 3CMZA 1JWZA 4NETA 3CG5A 4WELA 3WS4A 3UPOA 3IF6B 2VGKA 1MPLA 3OC2A 4WM9A 4Z9QA 3BFDA 1PIOA 4R1GA 4OP8A 3IWIA 5JYPA 2Q9MA 3WS1A 2IWDA 4PPRA 4R0QA 1IKIA 4X6TA 5F1GA 4X69A 4EV4A 3UN7A 1G6AA 4JPMA 1RGYA 4BJPA 1K55A 5M19A 3O86A 4R4RA 3W4QA 1DJBA 1GHPA 2EX9A 3Q7VB 4PMAA 4S2LA 4E3JA 1ALQA 4XXRA 3RXXA 1W5DA 2G2UA 4LCMA 4KZAA 4S2IA 3V3SA 3O88A 2ZC4B 3N8RA 3Q7VA 2I72A 4N92A 1PW1A 1XP4A 4FCFA 3MKFA 4P85A 5EPHA 3W4OA 1ONGA 1KGFA 2HP6A 1FCMA 3IHBA 3UE0A 4BLMA 1NZOA 5CHJA 4UHUA 3M2KA 5EVLA 1K56D 1PYYA 2OV5A 4X53A 4E6WA 3ZNTA 1VQQA 1GHMA 1LHYA 1L0GA 2P9VB 3IWOA 4LV2A 5FA7A 5HARA 3UDFA 2EX6A 2X01A 3Q07A 4F94A 5A91A 4QY6A 1YMSA 3MZDA 5HAIA 5CECA 4JXGA 2P9VA 3ZG5A 4DF6A 4OQIA 4YFMA 4MNRA 3DW0A 1IELA 1K57A 1W79A 1K6SA 5FI2A 4QB8A 2ZJ9A 4S2NC 3GRJA 1SDNA 2ZQDA 4JF5A 1XA1A 5GHYA 1NXYA 3N8SA 3FZCA 4S2KA 1ERMA 3ZFZA 4FD8A 2DNSA 5L2FA 3HLDA 2J9PA 4S2JA 4OH0A 2HP5A 3I7JA 2PU4A 1KVMA 4U3TA 5HX9A 3ZDJA 3O87A 2ZMAA 1ES4A 2JC7A 3BYDA 3N7WA 4EBPA 3G4PA 3A3FA 5AQAA 2JBFA 2Q9NA 1KE3A 3OPRA 2OLVA 4XUZA 5CHUA 3MZEA 2E8IA 4WZ5C 4DXBA 1K54A 3HLCA 2Y2LA 5U47A 2CC1A 1JTDA 1RP5A 3PTEA 5E2GA 3IWQA 3UE3A 5FQJA 1MKIA 2Y2MA 1K6RA 4C75A 3VP4A 1BLHA 3PBOA 2WZXA 3ZG9B 4FH2A 5M1AA 3PAGA 3G31A 3ITBA 4ZJ1A 5EE8A 3QNCA 3V39A 3SOIA 4DE1A 1GA0A 3VFHA 3EQUA 2H0YA 2WGWA 3OPPA 2WKIA 5E2FA 3MZFA 2XQZA 4FH4A 4WEKA 3DWKA 3OCLA 4KG6A 3BFCA 4EQIA 4QJGA 1L0EA 2QMIA 5HW3A 1K4EA 2WAEA 1W8YA 4OLDA 2C6WB 3PBQA 2XFSA 4OOMA 3MXRA 4LV1A 4BL3A 3VOZA 1K55C 1Y54A 2Y2JA 3GTCA 3ZGAB 1KVLA 2XGNA 1PI5A 3SH7A 4C6YA 4UA6A 3Q82A 4U0XA 3TG9A 2IWBA 5EOOA 4GZBA 1MXOA 2Y2HA 1JVJA 3HLGA 3OZHA 4E3OA 4E3NA 2XR0A 1K56A 1LLBA 1ES5A 2PBYA 1RGZA 5TGFA 4X68A 4D2OA 2EFUA 1OMEA 2EXAA 5FI6A 2EFXA 2ZLYA 3HLEA 1XGJA 1E3UD 3ZNYA 2FFYA 4E3IA 2WKEA 1W7FA 4N9LA 5CEDA 2Y2IA 2WGIA 4JLFA 4HBUA 1K25A 4ID4A 1BLPA 4JXWA 3E2KA 4JBFA 5DF8A 2ZQAA 3NCKA 4A5RA 1ZG4A 1WYBA 1PWDA 2A3UA 3NIAA 3SS5A 5CGWA 3HLWA 4Y0TA 1EWZA 1LI0A 1PI4A 2QZ6A 1M40A 5EVIC 2BG1A 4Q8IA 2P74A 3IF6A 1MWUA 4OPYA 2J8YA 4ZJ2A 2WYXA 1CEFA 4K91A 4QHCA 2HP9A 2XH9A 4MBFA 1ZC2A 1NY0A 4GB7A 4WYYA 1U60A 3TOIA 5M18A 4P87A 4B4XA 4OPRA 3HUNA 1BT5A 1G68A 1YLWA 4R3BA 3VOYA 3ISGA 3A3IA 1CEGA 4CPKA 1LL5A 3VP2A 3NBLA 2FFFB 2EXBA 1MWSA 5FSRA 1ES2A 1I5QA 1HZOA 1YQSA 4DE0A 1XKZA 2OSUA 1FSWA 3NC8A 4KZ9A 4RVAA 5GHXA 1K54C 1SCWA 1PWGA 3UNWA 2XD1A 4DDSA 3C4OA 4NK3A 1IYOA 1XX2A 3G30A 3M6HA 4PM9A 3AGDA 2IWCA 4KZ8A 2ZQ9A 3PBTA 2XEPA 3CZDA 1YM1A 4FSFA 3WS5A 5G18A 1FR6A 1KGGA 1L0FA 4RX2A 1HTZA 2EX8A 4OQGA 3HVFA 5EECA 2WK0A 2XF3A 2Y2NA 1LL9A 3IT9A 4P0MA 4S2MA 2XDMA 1HVBA 2Y91A 5CTNA 1NYMA 1NJ4A 3D4FA 3VP1A 3UY6A 4E3KA 3IH8A 2J7VA 4UAAA 4DKIA 5F83A 1K4FA 5GLAA 1MBLA 5JYOA 1FR1A 4GD6A 5A90A 3IXHA 2V2FF 3QHYA 1YT4A 2RL3A 2ZC5B 4LCLA 3P98A 3UO9A 3G2YA 4CJNA 5KMWA 4OONA 4K0WA 1E3UA 2Y55A 1IYSA 2ZM0A 4S2PA 1XPBA 1YMXA 2XK1A 3BLSA 1KE0A 2V20A 3S4XA 4LV0A 4EUZA 3V50A 5AQ7A 4Y0UA 2X71A 3NI9A 4RA7A 2WADA 3P09A 4U0TA 4Y0OA 1DJCA 2JCHA 2C5WB 1WYCA 3JYIA 3AGEA 3BFEA 3N8LA 3BFFA 2B5RA 2ZQCA 3B3XA 4KZ6A 4BD0A 2Y4AA 3SH9A 3C5AA 4DE2A 1QMEA 3FV7A 5GLDA 4IVKA 5BOHA 4LV3A 3NDGA 1IKGA 4GOGA 4KZBA 1E4DA 4N1XA 1ZG6A 4GN2A 4P6BA 3MXSA 4BENA 5KSCA 3UPNA 3IF6C 3HUMA 4PM6A 4YINA 1FCNA 3IXDA 3W8KA 5GLCA 1Q2PA 3MFDA 3ZG0A 1L0DA 2H0TA 3WS0A 5E2HA 3N6IA 3SS4A 3DWZA 1BSGA 3C4PA 5DF9A 3Q1FA 3LO7A 3PBRA 1CI8A 3ZCZA 2J9OA 4GD8A 4E3MA 4EWFA 4XUXA 5FAPA 2WAFA 2Z2MB 2Y2QA 4OQ0A 1GHIA 3ITAA 2BLSA 1XXMA 2HDUA 1Z6FA 4JXSA 2ZC6B 2ZM2A 1BTLA 3CJMA 4PM8A 4ZJ3A 5F1FA 4S2NA 3NY4A 3A3EA 1TDGA 4KQQA 1YLPA 1O07A 1BULA 4HESA 2ZM8A 4H8RA 2HDSA 5EVID 4KG5A 4R3JA 4Y7PA 5KSHA 1MWRA 5CGSA 3ZVWA 3GMWA 4ZDXA 4E3LA 4OLGA 1RCJA 1DJAA 1XGIA 3VSLA 3G32A 3WRZA 1W8QA 2EX2A 4BD1A 3IHAA 4QU3A 1K57C 2H5SA 2Y2KA 4E6XA 5GHZA 1DY6A 4HEFA 3LCEA 4UA9A 3VMAA 1K38A 3BM6A 5CTMA 3Q81A 2XD5A 2H10A 5EUAA 5CRFA 3HUOA 5TR7A 4OOYA 4OPZA 4JKTA 5AQ9A 2QPNA 1H8ZA 3E2LA 3FWLA 4PM5A 3G2ZA 3MKEA 1NRFA 1N4OA 1TDLA 5A92A 3BLMA 3W4PA 4MBKA 2R9XA 1I2SA 5HAPA 1S0WA 1S6RA 1VM1A 1N9BA 2V1ZA 2XFTA 4UA7A 1KDSA 2HPBA 2UWXA 3RXWA 4PM7A 3OCNA 4LENA 4WMCD 4ZAMA 2VGJA 2OLUA 2WGVA 5CEBA 1ERQA 1NZUA 2HDQA 3FKWA 4MEZA 1J9MA 4M3KA 4IBXA 5FQIA 3IXGA 3PAEA 2GDNA 2R9WA 3IXBA 4DRTA 2X02A 1SDEA 3GV9A 2Y2PA 3BEBA 1TEMA 4R4SA 3BECA 3G35A 5IHVA 5J8XA 2DCFA 3S22A 5FQMA 2G2WA 2HDRA 3V5MA 2Z2LB 5FI7A 3M2JA 1PW8A 4JXVA 3OPHA 1HD8A 3OPLA 4IBRA 2ZC7A 4OPQA 3PBNA 3IH9A 1JTGA 4ZBEA 3O3VA 3HLFA 1O7EA 3VFFA 2ZD8A 1EROA 3A3DA 3GR2A 2Y2GA 3ZHHA 4OP5A 1PZPA 5FAOA 4OVDA 5HFOA 3UDXA 3LY3A 3PBSA 1ESUA 5EOEA 3WRTA 1KGEA 5EVIB 1AXBA 2A49A 4BQMA 4QY5A 5FQQA 4EBNA 4IVIA 4QD4A 4ZTKA 1EI5A 3Q7ZA 5FQ9A 4DDYA 5D3OA 1ES3A 1JWVA 5DVAA 4OKPA 2ZQ7A 5FQKA 4MBHA 5EVIA 1KDWA 4KZ4A 4R23A 4KQRA 3FYZA 3HREA 5DTTA 4JF6A 2ZQ8A 1YLTA 3IQAA 3ZG8B 4DXCA 3HLBA 5A93A 5CHMA 1GCEA 1TVFA 1FSYA 3HL9A 3BRMA 2WUQA 1YLYA 4X56A 4RX3A 3QNBA 1ONHA 1FOFA 4BL2A 3M6BA 5AQBA 4WEJA 4GNUA 2WZZA 4KENB 3HBRA 5F82A 5HL1A 3GSGA 4L0LA 4N9KA 4OQHA 5I94A 4O7DA 5FASA 1YLZA 3NDEA 4JF4A 5CXWA 2ZC3B 4GDNA 1IEMA 1CK3A 1MY8A 3S1YA 1Q2QA 3BFGA 1QMFA 3EQVA 3N4IA 4HBTA 3ZG7B 1M6KA 4N1HA 3GVBA 1WE4A 4KQOA 1NYYA 1PZOA 3UPPA 5TFQA 1BUEA 5DTSA 1ZKJA 2PU2A 4GDBA 2WGWB 4KG2A 5GLBA 4WMCA 3TSGA 5E2EA 1CI9A 1GA9A 1BLCA 3VP3A 5E43A 1MWTA 2XLNA 3LEZA 3SH8A 4WZ4A 3UDIA 4KZ5A 1I2WA 4KZ7A 1FQGA 1IYPA 4K0XA 4MLLA 3DTMA 1JWPA 4X55A 3AGFA 5HAQA 3FKVA 1KE4A 3ZVTA 4WBGA 4IEDA 4RYEA 2WKHA 3C7VA 4KZ3A 4GKUA 1H8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2O A;  3C7U A;  5CGX A;  1BLS A;  1SKF A;  3VSK A;  1PWC A;  2Y59 A;  5KZH A;  1XA7 A;  1C3B A;  3GQZ A;  3WWX A;  5CER A;  2RCX A;  3WS2 A;  1LI9 A;  3LY4 A;  1FCO A;  2DRW A;  1YLJ A;  4DE3 A;  5FAT A;  1E25 A;  4B88 A;  4WZ5 A;  3UE1 A;  4S2O A;  4OOL A;  5FDH A;  3G34 A;  4B4Z A;  4C3Q A;  3MBZ A;  3V3R A;  5DF7 A;  5DTK A;  3RJU A;  5GL9 A;  1H5X A;  2JE5 A;  3SS3 A;  4EBL A;  1SHV A;  3VP0 A;  1IYQ A;  3A3J A;  3IF5 A;  5FAQ A;  1BZA A;  1ESI A;  1L2S A;  3CMZ A;  1JWZ A;  4NET A;  3CG5 A;  4WEL A;  3WS4 A;  3UPO A;  3IF6 B;  2VGK A;  1MPL A;  3OC2 A;  4WM9 A;  4Z9Q A;  3BFD A;  1PIO A;  4R1G A;  4OP8 A;  3IWI A;  5JYP A;  2Q9M A;  3WS1 A;  2IWD A;  4PPR A;  4R0Q A;  1IKI A;  4X6T A;  5F1G A;  4X69 A;  4EV4 A;  3UN7 A;  1G6A A;  4JPM A;  1RGY A;  4BJP A;  1K55 A;  5M19 A;  3O86 A;  4R4R A;  3W4Q A;  1DJB A;  1GHP A;  2EX9 A;  3Q7V B;  4PMA A;  4S2L A;  4E3J A;  1ALQ A;  4XXR A;  3RXX A;  1W5D A;  2G2U A;  4LCM A;  4KZA A;  4S2I A;  3V3S A;  3O88 A;  2ZC4 B;  3N8R A;  3Q7V A;  2I72 A;  4N92 A;  1PW1 A;  1XP4 A;  4FCF A;  3MKF A;  4P85 A;  5EPH A;  3W4O A;  1ONG A;  1KGF A;  2HP6 A;  1FCM A;  3IHB A;  3UE0 A;  4BLM A;  1NZO A;  5CHJ A;  4UHU A;  3M2K A;  5EVL A;  1K56 D;  1PYY A;  2OV5 A;  4X53 A;  4E6W A;  3ZNT A;  1VQQ A;  1GHM A;  1LHY A;  1L0G A;  2P9V B;  3IWO A;  4LV2 A;  5FA7 A;  5HAR A;  3UDF A;  2EX6 A;  2X01 A;  3Q07 A;  4F94 A;  5A91 A;  4QY6 A;  1YMS A;  3MZD A;  5HAI A;  5CEC A;  4JXG A;  2P9V A;  3ZG5 A;  4DF6 A;  4OQI A;  4YFM A;  4MNR A;  3DW0 A;  1IEL A;  1K57 A;  1W79 A;  1K6S A;  5FI2 A;  4QB8 A;  2ZJ9 A;  4S2N C;  3GRJ A;  1SDN A;  2ZQD A;  4JF5 A;  1XA1 A;  5GHY A;  1NXY A;  3N8S A;  3FZC A;  4S2K A;  1ERM A;  3ZFZ A;  4FD8 A;  2DNS A;  5L2F A;  3HLD A;  2J9P A;  4S2J A;  4OH0 A;  2HP5 A;  3I7J A;  2PU4 A;  1KVM A;  4U3T A;  5HX9 A;  3ZDJ A;  3O87 A;  2ZMA A;  1ES4 A;  2JC7 A;  3BYD A;  3N7W A;  4EBP A;  3G4P A;  3A3F A;  5AQA A;  2JBF A;  2Q9N A;  1KE3 A;  3OPR A;  2OLV A;  4XUZ A;  5CHU A;  3MZE A;  2E8I A;  4WZ5 C;  4DXB A;  1K54 A;  3HLC A;  2Y2L A;  5U47 A;  2CC1 A;  1JTD A;  1RP5 A;  3PTE A;  5E2G A;  3IWQ A;  3UE3 A;  5FQJ A;  1MKI A;  2Y2M A;  1K6R A;  4C75 A;  3VP4 A;  1BLH A;  3PBO A;  2WZX A;  3ZG9 B;  4FH2 A;  5M1A A;  3PAG A;  3G31 A;  3ITB A;  4ZJ1 A;  5EE8 A;  3QNC A;  3V39 A;  3SOI A;  4DE1 A;  1GA0 A;  3VFH A;  3EQU A;  2H0Y A;  2WGW A;  3OPP A;  2WKI A;  5E2F A;  3MZF A;  2XQZ A;  4FH4 A;  4WEK A;  3DWK A;  3OCL A;  4KG6 A;  3BFC A;  4EQI A;  4QJG A;  1L0E A;  2QMI A;  5HW3 A;  1K4E A;  2WAE A;  1W8Y A;  4OLD A;  2C6W B;  3PBQ A;  2XFS A;  4OOM A;  3MXR A;  4LV1 A;  4BL3 A;  3VOZ A;  1K55 C;  1Y54 A;  2Y2J A;  3GTC A;  3ZGA B;  1KVL A;  2XGN A;  1PI5 A;  3SH7 A;  4C6Y A;  4UA6 A;  3Q82 A;  4U0X A;  3TG9 A;  2IWB A;  5EOO A;  4GZB A;  1MXO A;  2Y2H A;  1JVJ A;  3HLG A;  3OZH A;  4E3O A;  4E3N A;  2XR0 A;  1K56 A;  1LLB A;  1ES5 A;  2PBY A;  1RGZ A;  5TGF A;  4X68 A;  4D2O A;  2EFU A;  1OME A;  2EXA A;  5FI6 A;  2EFX A;  2ZLY A;  3HLE A;  1XGJ A;  1E3U D;  3ZNY A;  2FFY A;  4E3I A;  2WKE A;  1W7F A;  4N9L A;  5CED A;  2Y2I A;  2WGI A;  4JLF A;  4HBU A;  1K25 A;  4ID4 A;  1BLP A;  4JXW A;  3E2K A;  4JBF A;  5DF8 A;  2ZQA A;  3NCK A;  4A5R A;  1ZG4 A;  1WYB A;  1PWD A;  2A3U A;  3NIA A;  3SS5 A;  5CGW A;  3HLW A;  4Y0T A;  1EWZ A;  1LI0 A;  1PI4 A;  2QZ6 A;  1M40 A;  5EVI C;  2BG1 A;  4Q8I A;  2P74 A;  3IF6 A;  1MWU A;  4OPY A;  2J8Y A;  4ZJ2 A;  2WYX A;  1CEF A;  4K91 A;  4QHC A;  2HP9 A;  2XH9 A;  4MBF A;  1ZC2 A;  1NY0 A;  4GB7 A;  4WYY A;  1U60 A;  3TOI A;  5M18 A;  4P87 A;  4B4X A;  4OPR A;  3HUN A;  1BT5 A;  1G68 A;  1YLW A;  4R3B A;  3VOY A;  3ISG A;  3A3I A;  1CEG A;  4CPK A;  1LL5 A;  3VP2 A;  3NBL A;  2FFF B;  2EXB A;  1MWS A;  5FSR A;  1ES2 A;  1I5Q A;  1HZO A;  1YQS A;  4DE0 A;  1XKZ A;  2OSU A;  1FSW A;  3NC8 A;  4KZ9 A;  4RVA A;  5GHX A;  1K54 C;  1SCW A;  1PWG A;  3UNW A;  2XD1 A;  4DDS A;  3C4O A;  4NK3 A;  1IYO A;  1XX2 A;  3G30 A;  3M6H A;  4PM9 A;  3AGD A;  2IWC A;  4KZ8 A;  2ZQ9 A;  3PBT A;  2XEP A;  3CZD A;  1YM1 A;  4FSF A;  3WS5 A;  5G18 A;  1FR6 A;  1KGG A;  1L0F A;  4RX2 A;  1HTZ A;  2EX8 A;  4OQG A;  3HVF A;  5EEC A;  2WK0 A;  2XF3 A;  2Y2N A;  1LL9 A;  3IT9 A;  4P0M A;  4S2M A;  2XDM A;  1HVB A;  2Y91 A;  5CTN A;  1NYM A;  1NJ4 A;  3D4F A;  3VP1 A;  3UY6 A;  4E3K A;  3IH8 A;  2J7V A;  4UAA A;  4DKI A;  5F83 A;  1K4F A;  5GLA A;  1MBL A;  5JYO A;  1FR1 A;  4GD6 A;  5A90 A;  3IXH A;  2V2F F;  3QHY A;  1YT4 A;  2RL3 A;  2ZC5 B;  4LCL A;  3P98 A;  3UO9 A;  3G2Y A;  4CJN A;  5KMW A;  4OON A;  4K0W A;  1E3U A;  2Y55 A;  1IYS A;  2ZM0 A;  4S2P A;  1XPB A;  1YMX A;  2XK1 A;  3BLS A;  1KE0 A;  2V20 A;  3S4X A;  4LV0 A;  4EUZ A;  3V50 A;  5AQ7 A;  4Y0U A;  2X71 A;  3NI9 A;  4RA7 A;  2WAD A;  3P09 A;  4U0T A;  4Y0O A;  1DJC A;  2JCH A;  2C5W B;  1WYC A;  3JYI A;  3AGE A;  3BFE A;  3N8L A;  3BFF A;  2B5R A;  2ZQC A;  3B3X A;  4KZ6 A;  4BD0 A;  2Y4A A;  3SH9 A;  3C5A A;  4DE2 A;  1QME A;  3FV7 A;  5GLD A;  4IVK A;  5BOH A;  4LV3 A;  3NDG A;  1IKG A;  4GOG A;  4KZB A;  1E4D A;  4N1X A;  1ZG6 A;  4GN2 A;  4P6B A;  3MXS A;  4BEN A;  5KSC A;  3UPN A;  3IF6 C;  3HUM A;  4PM6 A;  4YIN A;  1FCN A;  3IXD A;  3W8K A;  5GLC A;  1Q2P A;  3MFD A;  3ZG0 A;  1L0D A;  2H0T A;  3WS0 A;  5E2H A;  3N6I A;  3SS4 A;  3DWZ A;  1BSG A;  3C4P A;  5DF9 A;  3Q1F A;  3LO7 A;  3PBR A;  1CI8 A;  3ZCZ A;  2J9O A;  4GD8 A;  4E3M A;  4EWF A;  4XUX A;  5FAP A;  2WAF A;  2Z2M B;  2Y2Q A;  4OQ0 A;  1GHI A;  3ITA A;  2BLS A;  1XXM A;  2HDU A;  1Z6F A;  4JXS A;  2ZC6 B;  2ZM2 A;  1BTL A;  3CJM A;  4PM8 A;  4ZJ3 A;  5F1F A;  4S2N A;  3NY4 A;  3A3E A;  1TDG A;  4KQQ A;  1YLP A;  1O07 A;  1BUL A;  4HES A;  2ZM8 A;  4H8R A;  2HDS A;  5EVI D;  4KG5 A;  4R3J A;  4Y7P A;  5KSH A;  1MWR A;  5CGS A;  3ZVW A;  3GMW A;  4ZDX A;  4E3L A;  4OLG A;  1RCJ A;  1DJA A;  1XGI A;  3VSL A;  3G32 A;  3WRZ A;  1W8Q A;  2EX2 A;  4BD1 A;  3IHA A;  4QU3 A;  1K57 C;  2H5S A;  2Y2K A;  4E6X A;  5GHZ A;  1DY6 A;  4HEF A;  3LCE A;  4UA9 A;  3VMA A;  1K38 A;  3BM6 A;  5CTM A;  3Q81 A;  2XD5 A;  2H10 A;  5EUA A;  5CRF A;  3HUO A;  5TR7 A;  4OOY A;  4OPZ A;  4JKT A;  5AQ9 A;  2QPN A;  1H8Z A;  3E2L A;  3FWL A;  4PM5 A;  3G2Z A;  3MKE A;  1NRF A;  1N4O A;  1TDL A;  5A92 A;  3BLM A;  3W4P A;  4MBK A;  2R9X A;  1I2S A;  5HAP A;  1S0W A;  1S6R A;  1VM1 A;  1N9B A;  2V1Z A;  2XFT A;  4UA7 A;  1KDS A;  2HPB A;  2UWX A;  3RXW A;  4PM7 A;  3OCN A;  4LEN A;  4WMC D;  4ZAM A;  2VGJ A;  2OLU A;  2WGV A;  5CEB A;  1ERQ A;  1NZU A;  2HDQ A;  3FKW A;  4MEZ A;  1J9M A;  4M3K A;  4IBX A;  5FQI A;  3IXG A;  3PAE A;  2GDN A;  2R9W A;  3IXB A;  4DRT A;  2X02 A;  1SDE A;  3GV9 A;  2Y2P A;  3BEB A;  1TEM A;  4R4S A;  3BEC A;  3G35 A;  5IHV A;  5J8X A;  2DCF A;  3S22 A;  5FQM A;  2G2W A;  2HDR A;  3V5M A;  2Z2L B;  5FI7 A;  3M2J A;  1PW8 A;  4JXV A;  3OPH A;  1HD8 A;  3OPL A;  4IBR A;  2ZC7 A;  4OPQ A;  3PBN A;  3IH9 A;  1JTG A;  4ZBE A;  3O3V A;  3HLF A;  1O7E A;  3VFF A;  2ZD8 A;  1ERO A;  3A3D A;  3GR2 A;  2Y2G A;  3ZHH A;  4OP5 A;  1PZP A;  5FAO A;  4OVD A;  5HFO A;  3UDX A;  3LY3 A;  3PBS A;  1ESU A;  5EOE A;  3WRT A;  1KGE A;  5EVI B;  1AXB A;  2A49 A;  4BQM A;  4QY5 A;  5FQQ A;  4EBN A;  4IVI A;  4QD4 A;  4ZTK A;  1EI5 A;  3Q7Z A;  5FQ9 A;  4DDY A;  5D3O A;  1ES3 A;  1JWV A;  5DVA A;  4OKP A;  2ZQ7 A;  5FQK A;  4MBH A;  5EVI A;  1KDW A;  4KZ4 A;  4R23 A;  4KQR A;  3FYZ A;  3HRE A;  5DTT A;  4JF6 A;  2ZQ8 A;  1YLT A;  3IQA A;  3ZG8 B;  4DXC A;  3HLB A;  5A93 A;  5CHM A;  1GCE A;  1TVF A;  1FSY A;  3HL9 A;  3BRM A;  2WUQ A;  1YLY A;  4X56 A;  4RX3 A;  3QNB A;  1ONH A;  1FOF A;  4BL2 A;  3M6B A;  5AQB A;  4WEJ A;  4GNU A;  2WZZ A;  4KEN B;  3HBR A;  5F82 A;  5HL1 A;  3GSG A;  4L0L A;  4N9K A;  4OQH A;  5I94 A;  4O7D A;  5FAS A;  1YLZ A;  3NDE A;  4JF4 A;  5CXW A;  2ZC3 B;  4GDN A;  1IEM A;  1CK3 A;  1MY8 A;  3S1Y A;  1Q2Q A;  3BFG A;  1QMF A;  3EQV A;  3N4I A;  4HBT A;  3ZG7 B;  1M6K A;  4N1H A;  3GVB A;  1WE4 A;  4KQO A;  1NYY A;  1PZO A;  3UPP A;  5TFQ A;  1BUE A;  5DTS A;  1ZKJ A;  2PU2 A;  4GDB A;  2WGW B;  4KG2 A;  5GLB A;  4WMC A;  3TSG A;  5E2E A;  1CI9 A;  1GA9 A;  1BLC A;  3VP3 A;  5E43 A;  1MWT A;  2XLN A;  3LEZ A;  3SH8 A;  4WZ4 A;  3UDI A;  4KZ5 A;  1I2W A;  4KZ7 A;  1FQG A;  1IYP A;  4K0X A;  4MLL A;  3DTM A;  1JWP A;  4X55 A;  3AGF A;  5HAQ A;  3FKV A;  1KE4 A;  3ZVT A;  4WBG A;  4IED A;  4RYE A;  2WKH A;  3C7V A;  4KZ3 A;  4GKU A;  1H8Y A; 
#chains in the Genus database with same CATH topology
 1OT9 A;  3C7U A;  3SZT A;  1XA7 A;  3WWX A;  3UMD A;  1CF0 A;  3E4Q A;  4IJG A;  3UB9 A;  1YLJ A;  1E25 A;  3QP8 A;  4WZ5 A;  1OTA A;  4OOL A;  5FDH A;  3G34 A;  4Q0H A;  5DTK A;  3KYE A;  5L09 A;  4EBL A;  3VP0 A;  5FAQ A;  4B93 A;  1BZA A;  1ESI A;  5HD3 A;  1JWZ A;  4NXF A;  4NET A;  4Y17 A;  2VGK A;  3OC2 A;  1GSX A;  4WM9 A;  4Z9Q A;  1MKM A;  3BFD A;  3OLO A;  4R1G A;  3IWI A;  3CHW P;  3LGO A;  1FIK A;  4R0Q A;  3LI8 A;  4X6T A;  5F1G A;  4EV4 A;  3UN7 A;  1G6A A;  4JPM A;  3CLO A;  1K55 A;  3BJN A;  3NOP C;  2JHE A;  1SKO B;  4S2I A;  2ZC4 B;  3N8R A;  3D3O A;  4E04 A;  2ZMV A;  2Y79 A;  3MQ0 A;  3W4O A;  2J80 A;  2VEA A;  3UE0 A;  4HH2 A;  1XJ4 A;  1OTD A;  4X53 A;  3IWO A;  2H28 A;  4F94 A;  4QY6 A;  3MZD A;  1OTE A;  2P9V A;  2O9B A;  2ZJ9 A;  4S2N C;  3GRJ A;  2VGL S;  2ZQD A;  3F1N A;  1NXY A;  3N8S A;  4CLC E;  3FZC A;  2O9C A;  1SZV A;  1LT0 A;  4FD8 A;  2HP5 A;  3I7J A;  2PU4 A;  1KVM A;  4U3T A;  5EFW A;  4NEE D;  5HX9 A;  1TF1 A;  3ZDJ A;  4BMW A;  3IX8 A;  3G4P A;  4IHQ A;  4PKY A;  4QPR A;  5CHU A;  1K54 A;  1JTD A;  1RP5 A;  3IWQ A;  2XRO A;  1K6R A;  4C75 A;  2QKP A;  5M1A A;  2PAV P;  3ITB A;  4ZJ1 A;  1P97 A;  3QNC A;  4DE1 A;  3VFH A;  2QWS A;  4LRX C;  2WKI A;  3MZF A;  3OCL A;  4KG6 A;  4QJG A;  1L0E A;  2WAE A;  4BL3 A;  3PBQ A;  3MXR A;  3NJA A;  3VOZ A;  1Y54 A;  5HPI A;  4IUH A;  3EGX C;  1JVJ A;  3OZH A;  3JVU A;  5TGF A;  2EFU A;  1OME A;  5TJJ A;  3HLE A;  2M7U A;  4O8G A;  4E3I A;  3R4K A;  2WGI A;  4HBU A;  1K25 A;  3LR0 A;  4JXW A;  1ZG4 A;  2A3U A;  3NIA A;  2VLG A;  2WKP A;  3KSH A;  2V1B A;  3HLW A;  4O0P A;  3H9W A;  4K91 A;  4QHC A;  2HP9 A;  1U60 A;  1W63 Q;  3HUN A;  1G68 A;  3ISG A;  4FTX A;  4NKP A;  3T1S A;  1MWS A;  1ES2 A;  1XKZ A;  2OSU A;  4AFI A;  4KZ9 A;  2R78 A;  2XD1 A;  4DDS A;  1DP9 A;  2JN7 A;  3E0Y A;  4PM9 A;  1HLU P;  3CZD A;  1L0F A;  1G5U A;  3T4T A;  1K0K A;  4OQG A;  3HVF A;  2V8F A;  3IT9 A;  1NJ4 A;  1T19 A;  2J7V A;  1G28 A;  3QP6 A;  1CJF A;  5F83 A;  3BQA A;  4Q0J A;  5A90 A;  3IXH A;  2V2F F;  1YT4 A;  3G2Y A;  4X1L A;  4Y2F A;  5KMW A;  4OON A;  1E3U A;  2Y55 A;  1IYS A;  4JGR A;  4HNB A;  2ZL1 B;  3GEC A;  1NLZ A;  2X71 A;  4Y0U A;  4RA7 A;  5G4Z A;  4JGQ A;  2JCH A;  2P08 A;  2C5W B;  2ZQC A;  3EEH A;  3B3X A;  2GJ3 A;  4KZ6 A;  3SH9 A;  5BOH A;  3FV7 A;  3LR3 A;  5F68 A;  3MR0 A;  1P9W A;  5HWT A;  4GN2 A;  4P6B A;  1FCN A;  3FPV A;  2NUP C;  2H0T A;  3Q1F A;  4E3M A;  4HH3 A;  3ITA A;  2BLS A;  4BBV A;  2VA0 A;  3OBF A;  2HDU A;  4JXS A;  5HDD A;  3CJM A;  5F1F A;  3KSF A;  4EEP A;  2W3D A;  5KSH A;  4R3J A;  4Y7P A;  1MWR A;  5CGS A;  3HCY A;  4OLG A;  1RCJ A;  2PR6 A;  1XGI A;  3WRZ A;  1K57 C;  3CUE C;  1DY6 A;  5F6A A;  2EWV A;  1OPX A;  2VKS A;  3LIB A;  2XD5 A;  1N9O A;  4PM5 A;  3R7W A;  3BLM A;  4MBK A;  1I2S A;  3G6O A;  2GNX A;  5CX7 A;  1MC0 A;  2HPB A;  3OCN A;  4LEN A;  4ZAM A;  2VGJ A;  5CEB A;  1NZU A;  3RFB A;  3IXB A;  2M7V A;  4DRT A;  2X02 A;  3LI9 A;  3GV9 A;  2Y2P A;  4CLC A;  1TEM A;  3S22 A;  3F1O B;  3T50 A;  3RH8 B;  3M2J A;  3OPL A;  4OPQ A;  2PRF A;  4ZBE A;  3O3V A;  1O7E A;  3HJI A;  4H6J B;  3A3D A;  3KO6 A;  4OP5 A;  2ZOI A;  2W1T B;  1ESU A;  5EOE A;  1AXB A;  2A49 A;  4L9E A;  1ES3 A;  3LR5 A;  5FQK A;  1KDW A;  4MCW A;  2HV1 A;  3A0V A;  4JF6 A;  1YLT A;  3ZG8 B;  5CHM A;  1GCE A;  3HL9 A;  5FEF A;  1VEU A;  5HPF A;  4X56 A;  2J3W A;  3M6B A;  4WEJ A;  4KEN B;  4I39 A;  4O7D A;  4Y15 A;  5CXW A;  3NDE A;  4JF4 A;  4Y13 A;  2ZC3 B;  1F5M A;  3EQV A;  4HBT A;  1M6K A;  4N1H A;  1NYY A;  3UPP A;  1BUE A;  5DTS A;  1XFQ A;  4GDB A;  3TSG A;  4MN7 A;  1NLY A;  5E2E A;  1GA9 A;  1MWT A;  4KZ5 A;  1FQG A;  1IYP A;  1H8M A;  3FKV A;  1KE4 A;  3ZVT A;  2WKH A;  4ZRR A;  1BLS A;  1SKF A;  2XA7 M;  3VSK A;  1IOU A;  3TJZ C;  4JGO A;  3H82 A;  3MS6 A;  1C3B A;  4NG2 A;  3WS2 A;  1FCO A;  2DRW A;  4DE3 A;  3FC7 A;  4C3Q A;  3KYQ A;  3MBZ A;  4FOF A;  3V3R A;  4II7 A;  1SHV A;  3A3J A;  3CMZ A;  3UPO A;  2O9A A;  5JYP A;  4X69 A;  4BJP A;  3W4Q A;  1DJB A;  1GHP A;  4PMA A;  3CI6 A;  1ALQ A;  4XXR A;  5FL3 A;  1W5D A;  3A0R A;  4QWO A;  3V67 A;  2PT7 A;  3O88 A;  2LB5 A;  3Q7V A;  3PR6 A;  5HZH A;  2VK3 A;  1T18 A;  2I72 A;  4N92 A;  1PW1 A;  5EVE A;  3MKF A;  5EPH A;  1KGF A;  3IHB A;  3IS2 A;  1NZO A;  5CHJ A;  2CMN A;  3M2K A;  1K56 D;  2OV5 A;  4EW7 A;  5HWW A;  1VQQ A;  1GHM A;  1L0G A;  3CPT A;  2XRN A;  5HAR A;  3UDF A;  2EX6 A;  3Q07 A;  3FG8 A;  4JXG A;  3ZG5 A;  4OQI A;  4YFM A;  4MNR A;  3T4L A;  5FI2 A;  1SDN A;  1S4S A;  5GHY A;  4S2K A;  1ERM A;  2O99 A;  4S2J A;  2JKF A;  1Y28 A;  2ZMA A;  3BYD A;  3N7W A;  1G6O A;  2JBF A;  2Q9N A;  3MSH A;  3OPR A;  3MZE A;  2E8I A;  4WZ5 C;  2PD7 A;  2FZ0 A;  2Y2L A;  5E2G A;  2HGV A;  3P01 A;  2OAP 1;  2Y2M A;  1BLH A;  4FH2 A;  4GHI A;  3PXP A;  2QJ5 A;  3EQU A;  2JKT I;  3OPP A;  3TRC A;  2XQZ A;  3T1Q B;  5TBM B;  3BFC A;  3S7O A;  1K4E A;  4OOM A;  3B47 A;  2W3E A;  3ZGA B;  1K55 C;  2Y2J A;  3GTC A;  1KVL A;  1PI5 A;  4C6Y A;  4UA6 A;  3Q82 A;  5DJU A;  2IWB A;  4DN0 A;  1MXO A;  1F98 A;  4E3O A;  2XR0 A;  1LLB A;  1ES5 A;  1RGZ A;  1S1Y A;  4NXB A;  3F1P A;  1XGJ A;  3ZNY A;  2WKE A;  1W7F A;  4N9L A;  4JLF A;  4EXO A;  4DJ2 A;  3E2K A;  4JBF A;  3NCK A;  4K08 A;  1WYB A;  4Y0T A;  1LI0 A;  1PI4 A;  3DAV A;  4MMN A;  1MWU A;  4OPY A;  2J8Y A;  1AWI A;  4ZJ2 A;  4MBF A;  5DKL A;  3T12 B;  1NY0 A;  4IUK A;  4LRY C;  3R7W B;  1PNE A;  4P87 A;  5HDS A;  4OPR A;  4B4X A;  2PD8 A;  3VOY A;  5FDS A;  1LL5 A;  3NBL A;  4WUJ A;  5HSQ A;  5FSR A;  1I5Q A;  1T1B A;  5A8B A;  2EA9 A;  1FSW A;  5GHX A;  1K54 C;  1SCW A;  4CLC B;  3M6H A;  3AGD A;  2IWC A;  4KZ8 A;  3PBT A;  4Q0I A;  2INW A;  1OTB A;  1KGG A;  1HTZ A;  4BWI A;  2A24 A;  1TS7 A;  2WK0 A;  4S2M A;  1LL9 A;  4P0M A;  4LRZ E;  3D4F A;  2EWW A;  3UY6 A;  4E3K A;  3IH8 A;  4HJ3 A;  5GLA A;  1MBL A;  5JYO A;  4GW9 A;  3P98 A;  1D1J A;  4S2P A;  4EUZ A;  1VEU B;  4U0T A;  4Y0O A;  3C8C A;  1DJC A;  1WYC A;  2KX6 A;  4BD0 A;  4DE2 A;  1QME A;  2B95 A;  4LV3 A;  1IKG A;  4KZB A;  4HY8 A;  3UPN A;  4PM6 A;  4YIN A;  3IXD A;  1YSP A;  1Q2P A;  2XSS A;  3ZG0 A;  1L0D A;  2V1A A;  3N6I A;  1BSG A;  5DF9 A;  1VHM A;  4OQ0 A;  1GHI A;  1XXM A;  2VJW A;  4FUW A;  1BTL A;  3EEA A;  4S2N A;  3H82 B;  3NY4 A;  4EEU A;  1YLP A;  1GSV A;  4HES A;  3MF0 A;  3K3C A;  4G3V A;  4KG5 A;  3GMW A;  2ACG A;  3LEQ A;  1DJA A;  3G32 A;  4BD1 A;  1XJ3 A;  2H5S A;  4E6X A;  5GHZ A;  4HEF A;  3IX3 A;  3LCE A;  4UA9 A;  3VMA A;  3Q81 A;  1YSQ A;  4WN5 A;  5EUA A;  5CRF A;  3HUO A;  3CAX A;  4OOY A;  4PAU A;  2QPN A;  3LUQ A;  3G2Z A;  1T1C A;  5FEG A;  1N4O A;  4I3I A;  5HAP A;  1S0W A;  1S6R A;  3NOU C;  2V1Z A;  2XFT A;  1KDS A;  2UWX A;  2HDQ A;  4ARZ B;  2GX5 A;  5IS1 A;  3DTK A;  3IXG A;  5EM0 A;  3TE8 A;  2NUT C;  4MN5 A;  1CQA A;  1SDE A;  3BEB A;  4R4S A;  4YWZ A;  5J8X A;  5IHV A;  2JKR M;  2G2W A;  2Z2L B;  1PW8 A;  4JXV A;  3IS2 B;  4X1M A;  2ZC7 A;  1V9Z A;  3O5Y A;  3BQ8 A;  1ERO A;  3GR2 A;  3ZHH A;  2W3F A;  3LY3 A;  3WRT A;  5EVI B;  4BQM A;  4QY5 A;  4EBN A;  4IVI A;  4Y5F A;  4QD4 A;  2P04 A;  1EI5 A;  2L1M A;  4OKP A;  2ZQ7 A;  2YKH A;  3HRE A;  3BY8 A;  5DTT A;  3IQA A;  2VV6 A;  4DXC A;  5A93 A;  1FSY A;  3BRM A;  1YLY A;  1T1A A;  1FOF A;  4BL2 A;  4GNU A;  4HP4 A;  5F82 A;  5I94 A;  3H7W A;  1YLZ A;  1IEM A;  1MY8 A;  3VV4 A;  3BFG A;  2J3T C;  4XT2 A;  3ZG7 B;  4BBT A;  5TFQ A;  3LIA A;  4ESP A;  2PU2 A;  4MDZ A;  4EET B;  1W63 M;  1GSW A;  4G3W A;  3SH8 A;  3LEZ A;  2V0W A;  4K0X A;  3DTM A;  3AGF A;  4HJ4 A;  3E98 A;  3OOV A;  3UME A;  3ICY A;  1OT6 A;  3U2A A;  1L3L A;  3C7V A;  1H8Y A;  2Y2O A;  5CGX A;  4CLC C;  1J3W A;  5KZH A;  3GQZ A;  1Z09 A;  3ZYT A;  5FAT A;  5K5B A;  3UE1 A;  4S2O A;  4I5S A;  4B4Z A;  2UV0 E;  3QP2 A;  3RJU A;  4R6L A;  5GL9 A;  2JE5 A;  3IF5 A;  2W3G A;  3CG5 A;  4WEL A;  3WS4 A;  5J4E A;  3MMH A;  1MPL A;  3L7H A;  1PIO A;  4OP8 A;  1N9N A;  3WS1 A;  4PPR A;  5AVE A;  1A0K A;  4EER A;  1RGY A;  5M19 A;  3O86 A;  4S2L A;  1STZ A;  3EGD C;  3RXX A;  3V3S A;  1DRM A;  3B33 A;  1DP6 A;  1XP4 A;  2JKR I;  4FCF A;  4BBU A;  2HP6 A;  1FCM A;  2KOI A;  4BLM A;  2IA2 A;  4UHU A;  2A24 B;  5EVL A;  1LSV A;  3ZNT A;  3IX4 A;  2P9V B;  4LV2 A;  2X01 A;  5A91 A;  2ZBB A;  3F1N B;  3DW0 A;  1IEL A;  1K57 A;  1KOU A;  1TD5 A;  4QB8 A;  1XA1 A;  1P0Z A;  5L8M A;  1S67 L;  3ZFZ A;  2DNS A;  1ZHH B;  5L2F A;  3HLD A;  2J9P A;  4OH0 A;  2W0N A;  2J3T D;  5F69 A;  4EBP A;  3A3F A;  3T1X A;  3DTE A;  4XUZ A;  4DXB A;  4Y3I A;  5U47 A;  3NOT C;  3UE3 A;  3PBO A;  3ZG9 B;  3EOI A;  3PAG A;  3T4S A;  3SOI A;  1VET A;  2H0Y A;  4HP9 A;  4FH4 A;  4WEK A;  4EQI A;  2LB9 A;  4OLD A;  1W8Y A;  2XFS A;  3TG9 A;  4U0X A;  2V9A A;  5EOO A;  4GLQ A;  3KSI A;  3HLG A;  3QP4 A;  1K56 A;  3UB8 A;  2PBY A;  2WKR A;  4D2O A;  5FI6 A;  2EFX A;  2I9V A;  5CED A;  2W1R A;  4ID4 A;  1BLP A;  3PHY A;  5DF8 A;  4A5R A;  1PWD A;  5CGW A;  4F3L A;  2QZ6 A;  1M40 A;  5EVI C;  2BG1 A;  2L4R A;  3IF6 A;  2PYR A;  2WYX A;  4GB7 A;  4WYY A;  3TOI A;  4UQI S;  1YLW A;  4R3B A;  3LIF A;  3A3I A;  2D02 A;  3VP2 A;  2FFF B;  3IBR A;  5AJG A;  4RVA A;  3NC8 A;  1PWG A;  3UNW A;  4P6Z S;  4CQH A;  3C4O A;  2ZQ9 A;  2XEP A;  2K31 A;  2PBD P;  1FR6 A;  2V8C A;  4RX2 A;  1MZU A;  5EEC A;  2XF3 A;  2XDM A;  5AVF A;  2VV8 A;  1HVB A;  1NYM A;  1OJG A;  4UAA A;  2VV7 A;  1FR1 A;  3UO9 A;  4LCL A;  4CJN A;  2RL3 A;  2ZC5 B;  3QP1 A;  2ZM0 A;  1XPB A;  1YMX A;  2XK1 A;  3LFV A;  3LR4 A;  3BLS A;  4PHT A;  1KE0 A;  2V20 A;  1H3Q A;  3P09 A;  2HF6 A;  2QHK A;  2OAQ 1;  3IBJ A;  3BFE A;  3H7W B;  4WF0 A;  2Y4A A;  3QP5 A;  3C5A A;  4G3K A;  3NDG A;  4XT2 B;  4N1X A;  1E4D A;  1XJ2 A;  3MFD A;  3WS0 A;  5E2H A;  3SS4 A;  3DWZ A;  4YNR A;  3LO7 A;  3PBR A;  1CI8 A;  2O0Y A;  2KLI A;  3P7N A;  2OOL A;  3T4Q A;  4EQ1 A;  1Z6F A;  2QYB A;  4YOF A;  4ZJ3 A;  3A3E A;  1TDG A;  1O07 A;  4H8R A;  2HDS A;  5EVI D;  4PKY G;  3ZVW A;  4ZDX A;  2WKQ A;  1DP8 A;  3NHQ A;  3VSL A;  2EX2 A;  3B42 A;  1YAX A;  2HJE A;  1TS8 A;  1K38 A;  3BM6 A;  4HJ6 A;  5MC7 A;  2H10 A;  4OPZ A;  1NRF A;  1TDL A;  4R3A A;  5A92 A;  4RQ9 A;  2VGL M;  2V0U A;  1VM1 A;  3MXQ A;  4WMC D;  3C2W A;  2WGV A;  3FKW A;  4MEZ A;  1J9M A;  4M3K A;  3VE3 A;  4IBX A;  3PAE A;  4GS9 A;  3BEC A;  3UB6 A;  4LGW A;  5G4Y A;  4R70 A;  3F1O A;  4IBR A;  3IH9 A;  1JTG A;  3VFF A;  2ZD8 A;  2Y2G A;  1PZP A;  3KX0 X;  5HFO A;  3MQO A;  3PBS A;  4H6J A;  1KGE A;  2QJ7 A;  3UE6 A;  3W2Z A;  3Q7Z A;  1UWP X;  4DDY A;  5D3O A;  2W1T A;  1JWV A;  4MBH A;  4KZ4 A;  4R23 A;  4KQR A;  1JNU A;  2ZQ8 A;  1Y4O A;  1TVF A;  3QNB A;  2BTF P;  1ONH A;  1V9Y A;  3PYP A;  4HHD A;  5HL1 A;  4L0L A;  5FAS A;  5DFY A;  4GDN A;  2Q0O A;  1VB6 A;  1QMF A;  4L9G A;  2PHY A;  4KQO A;  5KIZ A;  1PZO A;  1VET B;  3MQQ A;  3C30 A;  4KQD A;  1D06 A;  1EW0 A;  2XLN A;  3UDI A;  5HL6 A;  4MLL A;  4X55 A;  4WBG A;  4IED A;  4RYE A;  4KZ3 A;  4GKU A;  3BWL A;  1PWC A;  2Y59 A;  5IT5 A;  3TW8 A;  3LID A;  2PR5 A;  5CER A;  2RCX A;  1LI9 A;  3LY4 A;  2A2L A;  4EES A;  2W3H A;  4B88 A;  4WL9 A;  1S4R A;  4L9F A;  4NXE A;  5DF7 A;  3U4L P;  1H5X A;  3SS3 A;  5LBR A;  4F3L B;  1IYQ A;  1L2S A;  4I3J A;  3DTI A;  3IF6 B;  3S7P A;  2OWJ A;  2Q9M A;  3ZQ5 A;  2IWD A;  2Z6D A;  1IKI A;  5HWV A;  3L9K A;  2FH5 A;  4R4R A;  2EX9 A;  3Q7V B;  4E3J A;  2OWH A;  5DJT A;  2G2U A;  4LCM A;  4KZA A;  4O01 A;  4EUV A;  4ME4 A;  1XJ6 A;  4DMZ A;  1NRJ A;  4P85 A;  4GJ4 A;  1ONG A;  2PYP A;  4M4X A;  3CPT B;  3T4O A;  1UWN X;  4ETZ A;  1PYY A;  4E6W A;  1LHY A;  4HQA A;  1ODV A;  5FA7 A;  4D60 A;  1ACF A;  1YMS A;  3JVV A;  3SW1 A;  5HAI A;  5CEC A;  4KUK A;  4DF6 A;  1W79 A;  1K6S A;  4JF5 A;  2VX8 A;  3A0S A;  3KYZ A;  3O87 A;  1ES4 A;  1LSW A;  2JC7 A;  5AQA A;  3EWK A;  1KE3 A;  2OLV A;  4R38 A;  3HLC A;  2CC1 A;  4GHI B;  3PTE A;  5FQJ A;  1MKI A;  1S66 L;  3E4P A;  3VP4 A;  2WZX A;  3MJQ A;  3G31 A;  5EE8 A;  3V39 A;  3BW6 A;  1GA0 A;  2WGW A;  5E2F A;  1F9I A;  2ZOH A;  3DWK A;  3RTY A;  2QMI A;  5HW3 A;  2PDR A;  2C6W B;  4LV1 A;  5DKK A;  5TBM A;  3NUL A;  2GZA A;  2XGN A;  3SH7 A;  4LPZ A;  3T4J A;  4GZB A;  2Y2H A;  3F1P B;  2E8J A;  4E3N A;  4X68 A;  1X0O A;  2EXA A;  5I5L A;  2ZLY A;  1E3U D;  2FFY A;  2Y2I A;  4I3A A;  2ZQA A;  1F2K A;  3SS5 A;  1EWZ A;  3MFX A;  3S7N A;  4Q8I A;  2P74 A;  1WA9 A;  1CEF A;  3LIE A;  2XH9 A;  1ZC2 A;  3HJK A;  3UB5 P;  5M18 A;  3CIT A;  1BT5 A;  3T1R A;  1S1Z A;  1CEG A;  4CPK A;  2EXB A;  1HZO A;  3T4K A;  1YQS A;  4DE0 A;  1SKO A;  4GS9 B;  4NK3 A;  1IYO A;  1PRQ A;  4WLA A;  1XX2 A;  3G30 A;  4FSF A;  1YM1 A;  3WS5 A;  5G18 A;  4HOI A;  3K2N A;  3D9Y A;  1IFQ A;  2EX8 A;  3VE4 A;  2K7S A;  3CWF A;  5IU1 A;  2Y2N A;  2Y91 A;  5CTN A;  3CUE A;  3VP1 A;  3ULF A;  4DKI A;  1K4F A;  1N9L A;  4GD6 A;  3KSG A;  4B9O A;  3QHY A;  1PFL A;  5J3W A;  4K0W A;  1BYW A;  1TS6 A;  1OTI A;  3S4X A;  4LV0 A;  2HZ5 A;  3V50 A;  5AQ7 A;  3NI9 A;  2M1C A;  2WAD A;  4HI4 A;  4LFU A;  3JYI A;  3N8L A;  3AGE A;  3S7Q A;  3BFF A;  2B5R A;  2JKG A;  1LL8 A;  5GLD A;  4IVK A;  4X25 A;  3D72 A;  3GDI A;  2KDK A;  4JGP A;  4GOG A;  4LLO B;  2L0W A;  4I38 A;  5HDC A;  1ZG6 A;  2B18 A;  3MXS A;  4BEN A;  5KSC A;  3IF6 C;  3HUM A;  5J7E A;  4CLC D;  3LYX A;  3W8K A;  5EV0 A;  5GLC A;  1TS0 A;  2JKT M;  3C4P A;  3ZCZ A;  2J9O A;  4GD8 A;  2B02 A;  4EWF A;  4XUX A;  5FAP A;  2WAF A;  3JPU A;  2Z2M B;  2Y2Q A;  4UQI M;  3BY9 A;  5EM1 A;  1LSX A;  2ZC6 B;  2ZM2 A;  2BAS A;  4PM8 A;  4KQQ A;  1BUL A;  3E4O A;  2ZM8 A;  4P6Z M;  2VZW A;  1NWZ A;  3FPW A;  4E3L A;  1W8Q A;  3IHA A;  4QU3 A;  2Y2K A;  5L07 A;  2P7J A;  5CTM A;  4HIA A;  4DJ3 A;  5TR7 A;  4ETX A;  4JKT A;  5AQ9 A;  1H8Z A;  2K2N A;  3E2L A;  3FWL A;  3MKE A;  1P9R A;  2HJ9 C;  3W4P A;  4KUO A;  2R9X A;  1N9B A;  4GCZ A;  4UA7 A;  1H0M A;  2XA7 S;  3RXW A;  4PM7 A;  5DFX A;  2OLU A;  1ERQ A;  1YPR A;  3NEC A;  5FQI A;  2AVX A;  2GDN A;  2R9W A;  2MJ6 A;  4ARZ A;  3G35 A;  3VOL A;  2DCF A;  5FQM A;  2HDR A;  3V5M A;  1OJ5 A;  5FI7 A;  3OPH A;  1HD8 A;  1YKD A;  3UB7 A;  3PBN A;  1D7E A;  3HLF A;  5L10 A;  5FAO A;  4OVD A;  3UDX A;  4MN6 A;  5FQQ A;  4ZTK A;  5FQ9 A;  1ZTU A;  5DVA A;  5EVI A;  2Y8H A;  3FYZ A;  2Z6C A;  3HLB A;  2ZL1 A;  2WUQ A;  3C38 A;  4RX3 A;  4EU0 A;  5AQB A;  1XFN A;  1FIL A;  2WZZ A;  3HBR A;  3GSG A;  4N9K A;  4OQH A;  1CK3 A;  2D01 A;  3S1Y A;  1Q2Q A;  3N4I A;  1UGU A;  1WE4 A;  3GVB A;  2ZMF A;  3K3D A;  1ZKJ A;  4KG2 A;  2WGW B;  4UEY A;  5GLB A;  4WMC A;  5C5K A;  2DMW A;  1CI9 A;  1BLC A;  2W27 A;  3VP3 A;  5E43 A;  2YKF A;  3DBA A;  4WZ4 A;  4NXG A;  5F5Y A;  1I2W A;  4KZ7 A;  4Z1W A;  1JWP A;  2G7U A;  5HAQ A;  3LIC A;  5HD5 A; 
#chains in the Genus database with same CATH homology
 2Y2O A;  3C7U A;  5CGX A;  1BLS A;  1SKF A;  3VSK A;  1PWC A;  2Y59 A;  5KZH A;  1XA7 A;  1C3B A;  3GQZ A;  3WWX A;  5CER A;  2RCX A;  3WS2 A;  1LI9 A;  3LY4 A;  1FCO A;  2DRW A;  1YLJ A;  4DE3 A;  5FAT A;  1E25 A;  4B88 A;  4WZ5 A;  3UE1 A;  4S2O A;  4OOL A;  5FDH A;  3G34 A;  4B4Z A;  4C3Q A;  3MBZ A;  3V3R A;  5DF7 A;  5DTK A;  3RJU A;  5GL9 A;  1H5X A;  2JE5 A;  3SS3 A;  4EBL A;  1SHV A;  3VP0 A;  1IYQ A;  3A3J A;  3IF5 A;  5FAQ A;  1BZA A;  1ESI A;  1L2S A;  3CMZ A;  1JWZ A;  4NET A;  3CG5 A;  4WEL A;  3WS4 A;  3UPO A;  3IF6 B;  2VGK A;  1MPL A;  3OC2 A;  4WM9 A;  4Z9Q A;  3BFD A;  1PIO A;  4R1G A;  4OP8 A;  3IWI A;  5JYP A;  2Q9M A;  3WS1 A;  2IWD A;  4PPR A;  4R0Q A;  1IKI A;  4X6T A;  5F1G A;  4X69 A;  4EV4 A;  3UN7 A;  1G6A A;  4JPM A;  1RGY A;  4BJP A;  1K55 A;  5M19 A;  3O86 A;  4R4R A;  3W4Q A;  1DJB A;  1GHP A;  2EX9 A;  3Q7V B;  4PMA A;  4S2L A;  4E3J A;  1ALQ A;  4XXR A;  3RXX A;  1W5D A;  2G2U A;  4LCM A;  4KZA A;  4S2I A;  3V3S A;  3O88 A;  2ZC4 B;  3N8R A;  3Q7V A;  2I72 A;  4N92 A;  1PW1 A;  1XP4 A;  4FCF A;  3MKF A;  4P85 A;  5EPH A;  3W4O A;  1ONG A;  1KGF A;  2HP6 A;  1FCM A;  3IHB A;  3UE0 A;  4BLM A;  1NZO A;  5CHJ A;  4UHU A;  3M2K A;  5EVL A;  1K56 D;  1PYY A;  2OV5 A;  4X53 A;  4E6W A;  3ZNT A;  1VQQ A;  1GHM A;  1LHY A;  1L0G A;  2P9V B;  3IWO A;  4LV2 A;  5FA7 A;  5HAR A;  3UDF A;  2EX6 A;  2X01 A;  3Q07 A;  4F94 A;  5A91 A;  4QY6 A;  1YMS A;  3MZD A;  5HAI A;  5CEC A;  4JXG A;  2P9V A;  3ZG5 A;  4DF6 A;  4OQI A;  4YFM A;  4MNR A;  3DW0 A;  1IEL A;  1K57 A;  1W79 A;  1K6S A;  5FI2 A;  4QB8 A;  2ZJ9 A;  4S2N C;  3GRJ A;  1SDN A;  2ZQD A;  4JF5 A;  1XA1 A;  5GHY A;  1NXY A;  3N8S A;  3FZC A;  4S2K A;  1ERM A;  3ZFZ A;  4FD8 A;  2DNS A;  5L2F A;  3HLD A;  2J9P A;  4S2J A;  4OH0 A;  2HP5 A;  3I7J A;  2PU4 A;  1KVM A;  4U3T A;  5HX9 A;  3ZDJ A;  3O87 A;  2ZMA A;  1ES4 A;  2JC7 A;  3BYD A;  3N7W A;  4EBP A;  3G4P A;  3A3F A;  5AQA A;  2JBF A;  2Q9N A;  1KE3 A;  3OPR A;  2OLV A;  4XUZ A;  5CHU A;  3MZE A;  2E8I A;  4WZ5 C;  4DXB A;  1K54 A;  3HLC A;  2Y2L A;  5U47 A;  2CC1 A;  1JTD A;  1RP5 A;  3PTE A;  5E2G A;  3IWQ A;  3UE3 A;  5FQJ A;  1MKI A;  2Y2M A;  1K6R A;  4C75 A;  3VP4 A;  1BLH A;  3PBO A;  2WZX A;  3ZG9 B;  4FH2 A;  5M1A A;  3PAG A;  3G31 A;  3ITB A;  4ZJ1 A;  5EE8 A;  3QNC A;  3V39 A;  3SOI A;  4DE1 A;  1GA0 A;  3VFH A;  3EQU A;  2H0Y A;  2WGW A;  3OPP A;  2WKI A;  5E2F A;  3MZF A;  2XQZ A;  4FH4 A;  4WEK A;  3DWK A;  3OCL A;  4KG6 A;  3BFC A;  4EQI A;  4QJG A;  1L0E A;  2QMI A;  5HW3 A;  1K4E A;  2WAE A;  1W8Y A;  4OLD A;  2C6W B;  3PBQ A;  2XFS A;  4OOM A;  3MXR A;  4LV1 A;  4BL3 A;  3VOZ A;  1K55 C;  1Y54 A;  2Y2J A;  3GTC A;  3ZGA B;  1KVL A;  2XGN A;  1PI5 A;  3SH7 A;  4C6Y A;  4UA6 A;  3Q82 A;  4U0X A;  3TG9 A;  2IWB A;  5EOO A;  4GZB A;  1MXO A;  2Y2H A;  1JVJ A;  3HLG A;  3OZH A;  4E3O A;  4E3N A;  2XR0 A;  1K56 A;  1LLB A;  1ES5 A;  2PBY A;  1RGZ A;  5TGF A;  4X68 A;  4D2O A;  2EFU A;  1OME A;  2EXA A;  5FI6 A;  2EFX A;  2ZLY A;  3HLE A;  1XGJ A;  1E3U D;  3ZNY A;  2FFY A;  4E3I A;  2WKE A;  1W7F A;  4N9L A;  5CED A;  2Y2I A;  2WGI A;  4JLF A;  4HBU A;  1K25 A;  4ID4 A;  1BLP A;  4JXW A;  3E2K A;  4JBF A;  5DF8 A;  2ZQA A;  3NCK A;  4A5R A;  1ZG4 A;  1WYB A;  1PWD A;  2A3U A;  3NIA A;  3SS5 A;  5CGW A;  3HLW A;  4Y0T A;  1EWZ A;  1LI0 A;  1PI4 A;  2QZ6 A;  1M40 A;  5EVI C;  2BG1 A;  4Q8I A;  2P74 A;  3IF6 A;  1MWU A;  4OPY A;  2J8Y A;  4ZJ2 A;  2WYX A;  1CEF A;  4K91 A;  4QHC A;  2HP9 A;  2XH9 A;  4MBF A;  1ZC2 A;  1NY0 A;  4GB7 A;  4WYY A;  1U60 A;  3TOI A;  5M18 A;  4P87 A;  4B4X A;  4OPR A;  3HUN A;  1BT5 A;  1G68 A;  1YLW A;  4R3B A;  3VOY A;  3ISG A;  3A3I A;  1CEG A;  4CPK A;  1LL5 A;  3VP2 A;  3NBL A;  2FFF B;  2EXB A;  1MWS A;  5FSR A;  1ES2 A;  1I5Q A;  1HZO A;  1YQS A;  4DE0 A;  1XKZ A;  2OSU A;  1FSW A;  3NC8 A;  4KZ9 A;  4RVA A;  5GHX A;  1K54 C;  1SCW A;  1PWG A;  3UNW A;  2XD1 A;  4DDS A;  3C4O A;  4NK3 A;  1IYO A;  1XX2 A;  3G30 A;  3M6H A;  4PM9 A;  3AGD A;  2IWC A;  4KZ8 A;  2ZQ9 A;  3PBT A;  2XEP A;  3CZD A;  1YM1 A;  4FSF A;  3WS5 A;  5G18 A;  1FR6 A;  1KGG A;  1L0F A;  4RX2 A;  1HTZ A;  2EX8 A;  4OQG A;  3HVF A;  5EEC A;  2WK0 A;  2XF3 A;  2Y2N A;  1LL9 A;  3IT9 A;  4P0M A;  4S2M A;  2XDM A;  1HVB A;  2Y91 A;  5CTN A;  1NYM A;  1NJ4 A;  3D4F A;  3VP1 A;  3UY6 A;  4E3K A;  3IH8 A;  2J7V A;  4UAA A;  4DKI A;  5F83 A;  1K4F A;  5GLA A;  1MBL A;  5JYO A;  1FR1 A;  4GD6 A;  5A90 A;  3IXH A;  2V2F F;  3QHY A;  1YT4 A;  2RL3 A;  2ZC5 B;  4LCL A;  3P98 A;  3UO9 A;  3G2Y A;  4CJN A;  5KMW A;  4OON A;  4K0W A;  1E3U A;  2Y55 A;  1IYS A;  2ZM0 A;  4S2P A;  1XPB A;  1YMX A;  2XK1 A;  3BLS A;  1KE0 A;  2V20 A;  3S4X A;  4LV0 A;  4EUZ A;  3V50 A;  5AQ7 A;  4Y0U A;  2X71 A;  3NI9 A;  4RA7 A;  2WAD A;  3P09 A;  4U0T A;  4Y0O A;  1DJC A;  2JCH A;  2C5W B;  1WYC A;  3JYI A;  3AGE A;  3BFE A;  3N8L A;  3BFF A;  2B5R A;  2ZQC A;  3B3X A;  4KZ6 A;  4BD0 A;  2Y4A A;  3SH9 A;  3C5A A;  4DE2 A;  1QME A;  3FV7 A;  5GLD A;  4IVK A;  5BOH A;  4LV3 A;  3NDG A;  1IKG A;  4GOG A;  4KZB A;  1E4D A;  4N1X A;  1ZG6 A;  4GN2 A;  4P6B A;  3MXS A;  4BEN A;  5KSC A;  3UPN A;  3IF6 C;  3HUM A;  4PM6 A;  4YIN A;  1FCN A;  3IXD A;  3W8K A;  5GLC A;  1Q2P A;  3MFD A;  3ZG0 A;  1L0D A;  2H0T A;  3WS0 A;  5E2H A;  3N6I A;  3SS4 A;  3DWZ A;  1BSG A;  3C4P A;  5DF9 A;  3Q1F A;  3LO7 A;  3PBR A;  1CI8 A;  3ZCZ A;  2J9O A;  4GD8 A;  4E3M A;  4EWF A;  4XUX A;  5FAP A;  2WAF A;  2Z2M B;  2Y2Q A;  4OQ0 A;  1GHI A;  3ITA A;  2BLS A;  1XXM A;  2HDU A;  1Z6F A;  4JXS A;  2ZC6 B;  2ZM2 A;  1BTL A;  3CJM A;  4PM8 A;  4ZJ3 A;  5F1F A;  4S2N A;  3NY4 A;  3A3E A;  1TDG A;  4KQQ A;  1YLP A;  1O07 A;  1BUL A;  4HES A;  2ZM8 A;  4H8R A;  2HDS A;  5EVI D;  4KG5 A;  4R3J A;  4Y7P A;  5KSH A;  1MWR A;  5CGS A;  3ZVW A;  3GMW A;  4ZDX A;  4E3L A;  4OLG A;  1RCJ A;  1DJA A;  1XGI A;  3VSL A;  3G32 A;  3WRZ A;  1W8Q A;  2EX2 A;  4BD1 A;  3IHA A;  4QU3 A;  1K57 C;  2H5S A;  2Y2K A;  4E6X A;  5GHZ A;  1DY6 A;  4HEF A;  3LCE A;  4UA9 A;  3VMA A;  1K38 A;  3BM6 A;  5CTM A;  3Q81 A;  2XD5 A;  2H10 A;  5EUA A;  5CRF A;  3HUO A;  5TR7 A;  4OOY A;  4OPZ A;  4JKT A;  5AQ9 A;  2QPN A;  1H8Z A;  3E2L A;  3FWL A;  4PM5 A;  3G2Z A;  3MKE A;  1NRF A;  1N4O A;  1TDL A;  5A92 A;  3BLM A;  3W4P A;  4MBK A;  2R9X A;  1I2S A;  5HAP A;  1S0W A;  1S6R A;  1VM1 A;  1N9B A;  2V1Z A;  2XFT A;  4UA7 A;  1KDS A;  2HPB A;  2UWX A;  3RXW A;  4PM7 A;  3OCN A;  4LEN A;  4WMC D;  4ZAM A;  2VGJ A;  2OLU A;  2WGV A;  5CEB A;  1ERQ A;  1NZU A;  2HDQ A;  3FKW A;  4MEZ A;  1J9M A;  4M3K A;  4IBX A;  5FQI A;  3IXG A;  3PAE A;  2GDN A;  2R9W A;  3IXB A;  4DRT A;  2X02 A;  1SDE A;  3GV9 A;  2Y2P A;  3BEB A;  1TEM A;  4R4S A;  3BEC A;  3G35 A;  5IHV A;  5J8X A;  2DCF A;  3S22 A;  5FQM A;  2G2W A;  2HDR A;  3V5M A;  2Z2L B;  5FI7 A;  3M2J A;  1PW8 A;  4JXV A;  3OPH A;  1HD8 A;  3OPL A;  4IBR A;  2ZC7 A;  4OPQ A;  3PBN A;  3IH9 A;  1JTG A;  4ZBE A;  3O3V A;  3HLF A;  1O7E A;  3VFF A;  2ZD8 A;  1ERO A;  3A3D A;  3GR2 A;  2Y2G A;  3ZHH A;  4OP5 A;  1PZP A;  5FAO A;  4OVD A;  5HFO A;  3UDX A;  3LY3 A;  3PBS A;  1ESU A;  5EOE A;  3WRT A;  1KGE A;  5EVI B;  1AXB A;  2A49 A;  4BQM A;  4QY5 A;  5FQQ A;  4EBN A;  4IVI A;  4QD4 A;  4ZTK A;  1EI5 A;  3Q7Z A;  5FQ9 A;  4DDY A;  5D3O A;  1ES3 A;  1JWV A;  5DVA A;  4OKP A;  2ZQ7 A;  5FQK A;  4MBH A;  5EVI A;  1KDW A;  4KZ4 A;  4R23 A;  4KQR A;  3FYZ A;  3HRE A;  5DTT A;  4JF6 A;  2ZQ8 A;  1YLT A;  3IQA A;  3ZG8 B;  4DXC A;  3HLB A;  5A93 A;  5CHM A;  1GCE A;  1TVF A;  1FSY A;  3HL9 A;  3BRM A;  2WUQ A;  1YLY A;  4X56 A;  4RX3 A;  3QNB A;  1ONH A;  1FOF A;  4BL2 A;  3M6B A;  5AQB A;  4WEJ A;  4GNU A;  2WZZ A;  4KEN B;  3HBR A;  5F82 A;  5HL1 A;  3GSG A;  4L0L A;  4N9K A;  4OQH A;  5I94 A;  4O7D A;  5FAS A;  1YLZ A;  3NDE A;  4JF4 A;  5CXW A;  2ZC3 B;  4GDN A;  1IEM A;  1CK3 A;  1MY8 A;  3S1Y A;  1Q2Q A;  3BFG A;  1QMF A;  3EQV A;  3N4I A;  4HBT A;  3ZG7 B;  1M6K A;  4N1H A;  3GVB A;  1WE4 A;  4KQO A;  1NYY A;  1PZO A;  3UPP A;  5TFQ A;  1BUE A;  5DTS A;  1ZKJ A;  2PU2 A;  4GDB A;  2WGW B;  4KG2 A;  5GLB A;  4WMC A;  3TSG A;  5E2E A;  1CI9 A;  1GA9 A;  1BLC A;  3VP3 A;  5E43 A;  1MWT A;  2XLN A;  3LEZ A;  3SH8 A;  4WZ4 A;  3UDI A;  4KZ5 A;  1I2W A;  4KZ7 A;  1FQG A;  1IYP A;  4K0X A;  4MLL A;  3DTM A;  1JWP A;  4X55 A;  3AGF A;  5HAQ A;  3FKV A;  1KE4 A;  3ZVT A;  4WBG A;  4IED A;  4RYE A;  2WKH A;  3C7V A;  4KZ3 A;  4GKU A;  1H8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...