1Y28A

Crystal structure of the r220a metbjfixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGAIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title A distal arginine in the oxygen-sensing heme-PAS domains is essential to ligand binding, signal transduction, and structure
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1y28A00
5HD3A 4GHIB 4R3AA 3E4QA 3SW1A 4BBUA 1S4RA 4NXGA 2QJ5A 2KDKA 1OTAA 4HIAA 1KOUA 2R78A 4HY8A 1XJ6A 4EXOA 1XFQA 2YKFA 3C2WA 4HJ6A 2PDRA 1DP9A 1OTIA 3LIAA 4NXBA 4I5SA 1D7EA 3UMEA 4HOIA 1S1YA 4LLOB 4DJ3A 1DP6A 3H82B 3UMDA 2PYRA 2A24A 2QJ7A 4EQ1A 4JGQA 2ZOHA 2J80A 4HI4A 4KUKA 2HV1A 4GW9A 2VV8A 3VE3A 1XJ2A 1OTEA 2KX6A 5HWVA 4I3JA 4B9OA 5J3WA 3LUQA 1T18A 2P7JA 2EA9A 2OWJA 4HH3A 4BBTA 2JHEA 3VOLA 3BWLA 3F1NA 3BY9A 4EETB 5TBMB 4WN5A 2V0WA 4NXEA 2BASA 4XT2B 4HJ4A 1N9LA 3CWFA 4H6JB 3KX0X 5F69A 1OTBA 4HQAA 1GSVA 1ODVA 1TS7A 3LIEA 4I39A 1N9NA 5DJUA 2QWSA 1LSWA 2ZBBA 2GJ3A 3IBRA 4R38A 3UB7A 1LSVA 3P7NA 3VE4A 5EFWA 4JGPA 3ULFA 4GS9B 4YWZA 1UGUA 2W27A 2OOLA 4WF0A 1TS6A 3T50A 2VEAA 3IS2B 3LYXA 1P0ZA 3UB9A 4JGRA 5F6AA 2A24B 1OJ5A 2L1MA 4EESA 1V9ZA 3A0RA 4I38A 4EEUA 5HDSA 1Y28A 1X0OA 1OT9A 3CLOA 3EWKA 4RQ9A 4WUJA 5HDCA 4LRXC 2CMNA 3A0VA 4GCZA 1BYWA 3G6OA 3LIBA 2L0WA 4F3LA 2ZOIA 5G4ZA 1T1AA 3H7WA 3D72A 3HJIA 3F1OA 1NWZA 4HP4A 4PKYA 1G28A 5AVFA 4KUOA 4LRZE 4HP9A 3LI9A 5A8BA 1LL8A 5F68A 2PD8A 2D02A 2W0NA 3MR0A 4I3AA 1S67L 1TS0A 2V1BA 3MQQA 3CAXA 1GSWA 4BBVA 1T19A 3NOUC 2M1CA 4I3IA 3LICA 4DJ2A 5IU1A 2WKQA 3UB6A 3MJQA 1V9YA 1WA9A 2PR5A 4NXFA 3F1PA 3E4OA 1DRMA 3A0SA 1P97A 3GDIA 3MQOA 3LI8A 1DP8A 4PKYG 1S66L 2D01A 2V0UA 2VLGA 5HZHA 3H9WA 4R70A 4LRYC 3NOTC 4XT2A 3FG8A 4HH2A 3FC7A 4WL9A 3RH8B 5DKKA 2VV7A 3ICYA 1GSXA 5IS1A 1OTDA 2V9AA 2I9VA 4M4XA 3UE6A 1UWPX 3MXQA 4L9GA 5HWTA 2L4RA 5AVEA 2OWHA 2PHYA 3C8CA 5HSQA 2QHKA 4F3LB 3EEHA 2B02A 3H7WB 1TS8A 3F1OB 3NHQA 4GHIA 4LPZA 3MFXA 2YKHA 1EW0A 1F9IA 4HJ3A 5F5YA 4GS9A 2VV6A 2Z6CA 3HJKA 2PR6A 1MZUA 3OLOA 2V1AA 3GECA 3IS2A 4E04A 3F1NB 4L9EA 5HDDA 2WKRA 4HHDA 2H28A 3ZQ5A 3K3CA 4L9FA 1F98A 1S1ZA 1S4SA 5I5LA 5J7EA 4R6LA 3PHYA 4HNBA 1UWNX 4MN6A 2JN7A 3NOPC 3H82A 5G4YA 5HD5A 4EERA 3RTYA 4EW7A 2PD7A 1D06A 1OT6A 3LIFA 4WLAA 4KQDA 4MN5A 1N9OA 2PYPA 3F1PB 2WKPA 2Z6DA 4JGOA 3E4PA 4EEPA 1XJ3A 3PYPA 2QKPA 3B33A 1VB6A 2INWA 5TBMA 3UB8A 1LSXA 1XJ4A 3LIDA 1XFNA 5KIZA 1OJGA 5DJTA 5J4EA 1T1CA 4K08A 2K7SA 5HWWA 3K3DA 4H6JA 1T1BA 1LT0A 3NJAA 1JNUA 3BY8A 5DKLA
chains in the Genus database with same CATH superfamily
4KQQA 2JE5A 3SW1A 4BBUA 3BYDA 3G2ZA 3B3XA 2IWCA 2WGVA 4NXGA 2WKIA 5EVIC 2HGVA 4LCLA 4LV3A 4HIAA 4OOMA 3SS4A 3AGFA 3Q7ZA 4S2MA 1DJBA 1ES4A 2A3UA 1ZHHB 4EBPA 4HJ6A 4N1XA 2Y8HA 5FI6A 1DP9A 4YOFA 4BQMA 5HPFA 4ZBEA 3D3OA 3UMEA 4HOIA 4C3QA 3JVUA 3W4QA 4HEFA 3LFVA 1LI0A 1FQGA 3DTIA 2PAVP 4H8RA 4X56A 5FQIA 2VV8A 4R4SA 3W8KA 1HD8A 2VX8A 1NXYA 2KX6A 3MF0A 3PBRA 3BQAA 1KGFA 1H5XA 4N9KA 5EVIA 1VEUA 1T18A 4Q8IA 2ZM0A 4PM7A 4KG5A 3CI6A 2OWJA 2G2WA 1MC0A 1G5UA 3IF6B 4QY5A 2H0TA 3BWLA 4KZAA 3GMWA 3UE0A 1HZOA 4WN5A 3BLMA 3PXPA 3LY3A 2Y2NA 5AJGA 5AQ7A 1YM1A 3UDXA 3CWFA 3MS6A 3S7PA 1W63Q 3GR2A 2FFYA 3KX0X 4P85A 3D9YA 3IX3A 4HQAA 1W79A 1Q2QA 1FSWA 3UO9A 5HFOA 2Y4AA 1FOFA 2NUTC 2ZMFA 2QWSA 3HLWA 2ZMAA 2ZBBA 3ZHHA 3TOIA 1WE4A 2C5WB 1LSVA 1YLZA 3MKFA 4E3NA 3VE4A 2PBYA 1CQAA 4JGPA 4N1HA 3ULFA 3BFEA 1JWZA 1PWDA 4OPZA 5CERA 1UGUA 3EQVA 4WF0A 4WMCD 1CI9A 5CXWA 3IXBA 1BULA 4F94A 2AVXA 1VHMA 1P0ZA 3UB9A 3IQAA 4MBKA 2X71A 5EOOA 1KVLA 3T1QB 5HDSA 2ZC7A 2M7UA 3OC2A 5FAQA 4PM8A 4S2LA 5EVIB 1VEUB 3HUOA 3C4OA 3IH9A 1U60A 4GCZA 1BYWA 2WYXA 4WZ5C 2HP5A 1PWGA 3BW6A 1K54A 4GD8A 4DXBA 1GHMA 4NK3A 4GDNA 4HP4A 2JKGA 4UEYA 4OKPA 1G28A 4EUVA 4P87A 1H8ZA 3CITA 4X1MA 4M3KA 3LI9A 2B95A 5HL6A 5A8BA 5F68A 4E3KA 2PD8A 3IXGA 3MR0A 1GCEA 2VGJA 3VSLA 4FTXA 1TS0A 3T1XA 3CAXA 2ZD8A 5FDSA 3MQ0A 4MLLA 2Y91A 2Y79A 4R0QA 4MEZA 1YPRA 4LV2A 4U3TA 3R7WA 4KQOA 3P98A 3MJQA 3AGEA 2IWBA 1EROA 4UAAA 5HAIA 4NXFA 5EM0A 1PZOA 2O99A 3IT9A 4LCMA 5GHZA 3V39A 3O86A 2ZJ9A 1XX2A 1C3BA 3GDIA 3MQOA 2UV0E 1SZVA 3H9WA 3VOYA 1YLJA 5GLAA 1OMEA 1EI5A 3PBSA 5D3OA 5A91A 3NDGA 1ESUA 3D4FA 5E2HA 5DKKA 2VV7A 3QP2A 4MBHA 3OCNA 1G6OA 1PWCA 5GLDA 5CGWA 3UE6A 1VETA 3Q81A 4FCFA 1OPXA 2OWHA 3C8CA 5HSQA 1XA1A 4S2IA 4BL2A 3ZDJA 2BLSA 4S2NC 3NULA 4LPZA 3ZG9B 4DMZA 1ONGA 2YKHA 4MBFA 3CMZA 4GS9A 2VV6A 2J9OA 2EX9A 4Y5FA 2HP9A 3HLFA 3PBTA 4C6YA 5FQKA 2W3HA 1S0WA 2WKRA 4X53A 2H28A 2E8IA 1KDWA 4OONA 4JF5A 1IYSA 1K56A 1F98A 1S1ZA 4LV1A 4ZJ1A 4OQGA 2WGIA 1SKFA 3LEZA 5BOHA 3JPUA 5GHYA 4U0XA 4KENB 1S6RA 1YQSA 5M18A 4ID4A 4MN7A 4GOGA 3H82A 2Y2HA 5G4YA 1LLBA 1FSYA 1AXBA 4S2NA 4DRTA 2PD7A 3RXWA 3LIFA 1LI9A 4XXRA 4Y0TA 3LCEA 3A3IA 2ZQDA 4PAUA 2EX8A 2ZC6B 1XXMA 4Y15A 4PMAA 4MDZA 4Y13A 3OPRA 3ITBA 2W1TA 5HW3A 1E4DA 1XJ3A 4ETXA 1ALQA 3B33A 2ZLYA 2OAQ1 4GD6A 4Y2FA 5TBMA 3UB8A 1LSXA 5M19A 3MBZA 1PW1A 3LIDA 4QU3A 5J4EA 3MMHA 1T1CA 1VETB 3CPTA 1IYOA 3MZFA 2K7SA 5HWWA 3K3DA 2ZQAA 4H6JA 2WGWA 4X69A 5MC7A 2HDQA 3KO6A 3NJAA 3VP0A 3KSHA 2PRFA 2A2LA 5DKLA 3KYQA 3N8LA 3ZCZA 4IJGA 4R3AA 3E4QA 4OPQA 4KZBA 1H8YA 1S4RA 2QJ5A 2XA7S 3ZVTA 3UY6A 4CQHA 4MMNA 5I94A 4HESA 4ETZA 4RVAA 1TDLA 1XFQA 4X1LA 1H0MA 1L0DA 4JF6A 4QPRA 4OQ0A 4LV0A 4E3LA 4CLCE 4FD8A 4O7DA 2NUPC 4I5SA 1FR1A 4KZ5A 5TJJA 3PAEA 1MWRA 1S1YA 1DP6A 1W8QA 3H82B 5FQJA 4QHCA 3V3SA 3VP3A 2QJ7A 4JGQA 3OPHA 5CECA 3GV9A 3QP6A 4HI4A 3ZNYA 1H8MA 4WYYA 5L10A 4B88A 5HWVA 4I3JA 1JTGA 3ZG5A 4EBNA 3LUQA 1K6RA 3IH8A 5CGSA 2W1TB 4WEJA 3PR6A 4Z9QA 4ZJ2A 4WELA 2JHEA 2WUQA 3VOLA 3T1SA 3AGDA 4II7A 4ZAMA 5TBMB 3GVBA 2V0WA 3C7UA 1RGZA 2K31A 3CG5A 1MKMA 1G6AA 4GDBA 4S2OA 3IWOA 3L9KA 3CPTB 1WYBA 1YSPA 4H6JB 1L0FA 3UNWA 2G2UA 2J3TC 2WGWB 2DCFA 1JTDA 5FAPA 1OTBA 3EGXC 3LO7A 5FEFA 2HDSA 4NEED 3LY4A 2K2NA 1GSVA 5DTTA 2M7VA 4JXWA 2X01A 4E3IA 3MSHA 1F2KA 5DJUA 2BTFP 3SS3A 1ZG6A 3TW8A 1RGYA 1YMXA 1A0KA 3R4KA 5FQQA 4A5RA 2E8JA 1NYMA 5EECA 3QHYA 3IF5A 2W27A 2QYBA 2OOLA 2OV5A 5TFQA 1NZOA 4NETA 1ES2A 4EU0A 3IS2B 1BLCA 1J3WA 4K91A 1CEFA 1ERQA 3E98A 3VSKA 4Y0OA 4BL3A 2L1MA 3SS5A 2EFXA 4YFMA 1IEMA 4JPMA 4S2PA 4D60A 4GLQA 1X0OA 5DTKA 5AQBA 2JBFA 4EQIA 3EWKA 2HJ9C 5HDCA 2CMNA 3G6OA 5F83A 4B4ZA 3UB5P 3ZFZA 3O5YA 1SKOA 3LIBA 4JXVA 2XLNA 2L0WA 4ARZB 1JVJA 5G4ZA 3V67A 3H7WA 3D72A 4BD1A 3G34A 5KSCA 1FR6A 4PKYA 4CLCB 2H10A 1F5MA 3PBNA 5DF9A 3C30A 5EVEA 1FIKA 4HP9A 2QZ6A 5E43A 3T4JA 5KSHA 4S2KA 3N8SA 1IYQA 3DWKA 3B47A 2D02A 4BLMA 5KZHA 4OP8A 1L0GA 4R3BA 2MJ6A 4I3AA 4E3JA 4FH4A 5FDHA 2V1BA 4B93A 2B5RA 5M1AA 1GSWA 2Z2LB 1P9WA 1HVBA 4OOYA 2H5SA 2Z2MB 3ITAA 3UPPA 5JYOA 1PNEA 3W2ZA 4I3IA 3P09A 2EWWA 2Y2IA 2Q0OA 3IHBA 1ZTUA 4ZRRA 2DNSA 2PT7A 2XD1A 4KZ8A 5EOEA 4QB8A 3T4QA 1I2WA 3LI8A 4DXCA 5HZHA 2VLGA 3N4IA 1K54C 4R70A 3V3RA 1PZPA 4LRYC 3NOTC 1K57A 4XT2A 1L0EA 5HAPA 3VFFA 2HJEA 1ZG4A 5FATA 2P9VA 4JBFA 4UA7A 5J8XA 4O8GA 3FC7A 4WL9A 3G31A 3RH8B 4IVKA 2O9BA 5CTNA 3NECA 3RXXA 2I9VA 4K0XA 3TE8A 4L9GA 1IOUA 2XH9A 1KDSA 4P6ZM 1I2SA 2PHYA 3CHWP 4JF4A 1TD5A 3H7WB 3MFDA 3RFBA 1BUEA 2HZ5A 3IXDA 1EW0A 5F5YA 4G3VA 3A3JA 3SOIA 2Z6CA 3CUEC 5GHXA 3HJKA 4R1GA 3E2KA 3WRTA 3S7QA 3OCLA 4L9EA 1N4OA 4Y0UA 5G18A 5CEDA 1QMFA 3JYIA 3ZQ5A 5TGFA 3K3CA 2XK1A 4R23A 1S4SA 2Y55A 2J7VA 5EM1A 5I5LA 4O01A 5J7EA 4IVIA 4DE1A 3LGOA 5CTMA 3LR4A 4HNBA 3FKVA 2JKTI 2JN7A 1XKZA 4QD4A 3C38A 4UQIM 2GDNA 2GNXA 3DTEA 4EW7A 4DF6A 3ISGA 1N9OA 1CEGA 5CHJA 3CUEA 1J9MA 2LB9A 3MZDA 1ES3A 5E2GA 2QKPA 2OLVA 1W63M 2P9VB 1VB6A 5EE8A 3PAGA 2WZZA 1GHIA 1XJ4A 4X55A 1ONHA 3BQ8A 4IUKA 5KIZA 3OPLA 1OJGA 2V2FF 1MWTA 1XGJA 5L8MA 4EWFA 4OPRA 1ESIA 3ZG0A 3Q7VA 2OSUA 3N7WA 1PFLA 3HLDA 4EV4A 2P74A 1PYYA 4WMCA 2XA7M 3W4OA 3N6IA 3UN7A 4E3MA 3S1YA 2KDKA 2V8FA 4NG2A 1KOUA 3O87A 4P6ZS 3ZYTA 2XR0A 1XJ6A 2Y2MA 2WAEA 1HTZA 4EXOA 3WS5A 4WBGA 2EWVA 2VGLS 4OLDA 1CI8A 2WKEA 3VMAA 5DF8A 1MWSA 3C2WA 3KYEA 4OH0A 4GJ4A 3LR5A 3LIAA 1SDNA 1IYPA 2VGKA 3EGDC 4BWIA 3O88A 4LLOB 1KGEA 5FEGA 4DJ3A 3OOVA 2PYRA 4PPRA 2ZOHA 1K4FA 4KUKA 3CZDA 2HV1A 2QMIA 4G3KA 5DVAA 4GW9A 3VE3A 3HCYA 4KZ9A 1HLUP 2EX2A 4DDSA 2XQZA 4WM9A 4B9OA 5J3WA 5FQMA 3R7WB 5K5BA 2P7JA 4UQIS 4Y3IA 3T1RA 3DBAA 4BBTA 2GX5A 4OVDA 3F1NA 3BY9A 4E3OA 2KOIA 3SH8A 4GKUA 3KSIA 4HBTA 2BASA 3C4PA 3S4XA 4HJ4A 1N9LA 2XGNA 1TEMA 3GTCA 3Q7VB 5F69A 3JVVA 3HREA 5HPIA 3MZEA 4OP5A 4KG6A 5FQ9A 1TS7A 3LIEA 3HLGA 4UHUA 1M6KA 1TF1A 3DTMA 4PM6A 5CHMA 3BJNA 1TVFA 1LSWA 1NRFA 5GL9A 2GJ3A 3IBRA 4PM5A 4MCWA 3G35A 4R38A 1FCOA 1FILA 2ZC5B 3M6HA 3UB7A 4Y17A 3KYZA 4Y7PA 3BEBA 5EFWA 2RL3A 1LHYA 4R3JA 4U0TA 4GS9B 3VP4A 4YWZA 2WADA 4KZ6A 2EX6A 3WS0A 3HLCA 3T50A 3G32A 2VEAA 2ZM8A 3QNBA 3WS4A 1RCJA 1GHPA 4JGRA 4CPKA 1KVMA 1KE0A 5F6AA 4O0PA 1E3UD 1V9ZA 3A0RA 4I38A 3EEAA 4EEUA 3IWIA 2R9XA 4P0MA 3OZHA 3QP5A 3CLOA 3ZVWA 4LRXC 2HDUA 3HLEA 2IA2A 4F3LA 2ZOIA 2C6WB 3HJIA 3BLSA 1RP5A 4RX3A 1I5QA 5CX7A 3DTKA 5AVFA 2FH5A 5EUAA 1O7EA 3V5MA 4DN0A 3IWQA 4JKTA 3WS1A 5EVID 1D1JA 1NYYA 2JKRI 2ZM2A 3EQUA 1BTLA 1LL8A 5A90A 3Q1FA 2PU2A 5FI7A 2ZC4B 1CF0A 4OQIA 3OPPA 4EUZA 1YMSA 1STZA 3VFHA 1YLTA 4QJGA 4GN2A 5EVLA 4BBVA 1T19A 5CHUA 3S7OA 1ES5A 3BFDA 4KZ3A 3SH9A 3VOZA 2M1CA 1PI5A 3LICA 5IU1A 2WKQA 1V9YA 3FKWA 3IF6A 5CGXA 1WA9A 2PR5A 1N9BA 3F1PA 3L7HA 3E4OA 3TSGA 1DRMA 3A0SA 3QP1A 1P97A 2XF3A 4Q0JA 1KGGA 1SDEA 5CEBA 4E6WA 4OQHA 3ZNTA 1K55C 4N92A 1DP8A 4PKYG 2D01A 2V0UA 1MBLA 3OBFA 2OAP1 3HVFA 2J3WA 3UE1A 5E2EA 1IKIA 3NY4A 1BSGA 1YLWA 1YAXA 4LENA 4B4XA 3E0YA 1KE3A 4AFIA 1OTDA 2V9AA 3GRJA 5JYPA 2JCHA 3IXHA 2JKTM 3Q82A 5HWTA 1LL9A 4XUXA 2QHKA 2Y2PA 4E6XA 4F3LB 4IEDA 1NRJA 5DFYA 2Y2OA 1E3UA 4GHIA 3MFXA 3IX8A 1F9IA 3BFFA 4HJ3A 3TG9A 1W7FA 3C5AA 1K55A 4PM9A 4BMWA 5A93A 1W5DA 2WKHA 2V1AA 4C75A 3GECA 4P6BA 5HDDA 4Q0HA 3QP4A 3FV7A 5F1GA 5A92A 3UDIA 1ERMA 4R6LA 5DTSA 1G68A 1Z09A 1UWNX 2Y2JA 4QWOA 1JWPA 3NOPC 3VV4A 1K57C 3MXRA 1MXOA 5HD5A 4EERA 2V20A 2ZC3B 3RTYA 1H3QA 5FL3A 3ZG7B 1XP4A 3FPWA 3K2NA 1D06A 1OT6A 5DF7A 4WLAA 4DE2A 4UA6A 4MN5A 3F1PB 4X68A 3DWZA 2Z6DA 1GA0A 3RJUA 4JGOA 2JC7A 4IBXA 3VP2A 3PBQA 4X6TA 3MKEA 3IHAA 4EEPA 3B42A 3ZG8B 3QNCA 2LB5A 3LEQA 4OPYA 4DE0A 1PI4A 3EOIA 2IWDA 1XFNA 2PBDP 2XFSA 5DJTA 4ZDXA 2W3FA 4K08A 2WZXA 2EFUA 4MNRA 2UWXA 4LFUA 1T1BA 5IHVA 3P01A 3IBJA 4G3WA 1CK3A 1YSQA 4HBUA 5HD3A 4GHIB 3CJMA 4FH2A 2Q9MA 3MXSA 1XA7A 1SKOB 5FASA 3HUMA 1OTAA 2W1RA 2R78A 4FUWA 4HY8A 1E25A 2VGLM 5IT5A 1YKDA 4BD0A 2YKFA 2Y2QA 1TDGA 2PDRA 1NJ4A 4L0LA 3LR3A 1OTIA 2ZMVA 1XPBA 4NXBA 1D7EA 1Y54A 4PHTA 1SHVA 2VJWA 1Y4OA 3T12B 1Z6FA 4X25A 2O9AA 3UMDA 2A24A 4EQ1A 3T4LA 2J80A 4R4RA 2XD5A 2V1ZA 1QMEA 3I7JA 1K56D 1OTEA 1XJ2A 4RYEA 3NCKA 2JKFA 4BJPA 1KE4A 2GZAA 2O9CA 4K0WA 1W8YA 1SCWA 1IELA 2EA9A 3FWLA 2O0YA 4QY6A 4HH3A 4ZTKA 3T4TA 2W3EA 3U2AA 2G7UA 2VZWA 1WYCA 2R9WA 1NY0A 2QPNA 4EETB 4KG2A 1DY6A 4NXEA 5CRFA 1FCNA 2BG1A 4ME4A 4XT2B 5F1FA 2VA0A 3G30A 3NC8A 4WZ5A 3BFGA 1LL5A 1NZUA 2ZL1A 2W3GA 1BLPA 3G2YA 1ODVA 4JXGA 4OLGA 1DJCA 1L3LA 2B18A 4I39A 1N9NA 5E2FA 4KZ7A 3BFCA 1YT4A 2H0YA 3DW0A 3BRMA 4WZ4A 5FI2A 3M2KA 4XUZA 2Q9NA 3U4LP 3QP8A 3A3DA 4KZ4A 4YNRA 3P7NA 1K0KA 2CC1A 3NDEA 2P08A 3KSGA 1AWIA 5LBRA 4DKIA 3V50A 3TRCA 3NIAA 3LR0A 1K25A 1TS6A 1IFQA 1L2SA 1NLYA 3LYXA 3UPOA 2JKRM 2Y2GA 1BT5A 2W3DA 1BLHA 5HX9A 2A24B 1OJ5A 1EWZA 4EESA 1XGIA 2VKSA 3TJZC 1DJAA 1Y28A 5GLBA 1OT9A 4DDYA 3NBLA 2HDRA 2A49A 3PBOA 4Q0IA 4JLFA 4RQ9A 4WUJA 5HL1A 5AQAA 3A0VA 2J8YA 3T4OA 3WWXA 2ZQ8A 1BZAA 4IHQA 1T1AA 2ZQCA 1MKIA 3F1OA 1NWZA 4GZBA 4KQRA 4KUOA 1CJFA 3FYZA 4ESPA 2X02A 4LRZE 3HLBA 4WEKA 3N8RA 1BLSA 2J9PA 3FPVA 2FFFB 2HPBA 2W0NA 2ZL1B 2WAFA 1ZKJA 4IUHA 1FCMA 4CLCD 1S67L 2EXAA 3GQZA 3MQQA 1YLYA 4CJNA 3IX4A 3NOUC 2ACGA 1Q2PA 2ZQ9A 4DJ2A 3UB6A 3BM6A 2WK0A 2XSSA 3FZCA 1GA9A 2XEPA 1K6SA 1S66L 3W4PA 3Q07A 4DE3A 1YLPA 5EV0A 1MWUA 2V8CA 3FG8A 4HH2A 5HARA 3KSFA 5FSRA 3T4SA 3ICYA 1GSXA 5IS1A 3UPNA 1VM1A 4M4XA 1PW8A 3M6BA 3UE3A 1UWPX 5F82A 1ACFA 3MXQA 4EBLA 2L4RA 5AVEA 2J3TD 4YINA 5TR7A 1PRQA 4FOFA 2XDMA 3EEHA 2B02A 2EXBA 2RCXA 1TS8A 2DMWA 3T4KA 3F1OB 2XFTA 5L09A 3S22A 3NHQA 2OLUA 2I72A 3GSGA 2VK3A 2Y59A 3C7VA 3WRZA 2FZ0A 4ZJ3A 4CLCC 5KMWA 5HAQA 2PR6A 1MZUA 5FA7A 1NLZA 3S7NA 1O07A 3OLOA 3IS2A 4E04A 3F1NB 1K38A 1MY8A 2Y2LA 5FAOA 3IF6C 3M2JA 3PTEA 5AQ9A 4HHDA 1IKGA 4JXSA 4L9FA 3NI9A 4IBRA 3HL9A 1M40A 2ZQ7A 4GB7A 1PIOA 4RX2A 5L07A 2XROA 3PHYA 1K4EA 4MN6A 1MPLA 5GLCA 3VP1A 2KLIA 3A3EA 3A3FA 3SZTA 5L2FA 4RA7A 5C5KA 2DRWA 4ARZA 2HP6A 3HUNA 4KQDA 2PYPA 3ZGAB 3SH7A 2WKPA 4CLCA 3HBRA 4D2OA 4Z1WA 3O3VA 3E4PA 4GNUA 3UDFA 4LGWA 2XRNA 3E2LA 3PYPA 5U47A 1ZC2A 1VQQA 2HF6A 5EPHA 3BECA 2INWA 4OOLA 4S2JA 4FSFA 4BENA 4UA9A 1JWVA 4NKPA 5DFXA 3DAVA 2P04A 1P9RA 3G4PA 1LT0A 2PU4A 2Y2KA 4N9LA 1JNUA 3BY8A 3WS2A
chains in the Genus database with same CATH topology
5HD3A 4GHIB 4IJGA 4R3AA 3E4QA 3SW1A 4BBUA 2XA7M 1S4RA 4NXGA 2QJ5A 2KDKA 2XA7S 2HGVA 1OTAA 2W1RA 1KOUA 2R78A 4HIAA 4CQHA 4P6ZS 4MMNA 4HY8A 4OOMA 3ZYTA 2VGLM 4ETZA 1XJ6A 5IT5A 1YKDA 4EXOA 1XFQA 2EWVA 2VGLS 1ZHHB 4QPRA 2YKFA 3C2WA 4HJ6A 2PDRA 4CLCE 2Y8HA 4GJ4A 4L0LA 3LR3A 1DP9A 4YOFA 5HPFA 1OTIA 3LR5A 3LIAA 2ZMVA 4NXBA 4I5SA 2NUPC 1D7EA 3D3OA 5TJJA 3UMEA 4PHTA 3EGDC 4BWIA 4HOIA 3JVUA 2VJWA 1S1YA 4LLOB 4DJ3A 1DP6A 3LFVA 3H82B 2O9AA 3OOVA 2PYRA 2A24A 2QJ7A 3UMDA 4EQ1A 4JGQA 3T4LA 2ZOHA 2J80A 4HI4A 4KUKA 2HV1A 4G3KA 4GW9A 2VV8A 3VE3A 2VX8A 3HCYA 1XJ2A 1OTEA 2KX6A 1H8MA 3MF0A 3BQAA 3PBRA 4BJPA 5HWVA 2GZAA 4I3JA 2O9CA 4B9OA 5J3WA 3LUQA 1T18A 3R7WB 5K5BA 2P7JA 2EA9A 2O0YA 4UQIS 3CI6A 2OWJA 4HH3A 4Y3IA 2W1TB 1MC0A 4WEJA 3T4TA 2W3EA 3PR6A 3DBAA 4BBTA 2GX5A 3U2AA 2G7UA 2VZWA 4WELA 2JHEA 3VOLA 3BWLA 3F1NA 3BY9A 4II7A 4EETB 2KOIA 5TBMB 4WN5A 3PXPA 2V0WA 3KSIA 4NXEA 2K31A 1MKMA 2BASA 5AJGA 4ME4A 4XT2B 2VA0A 1N9LA 4HJ4A 1YSPA 3CWFA 4H6JB 2J3TC 3S7PA 1W63Q 3KX0X 5F69A 3JVVA 1OTBA 2W3GA 3EGXC 4NEED 5HPIA 2K2NA 4HQAA 1GSVA 1ODVA 1TS7A 2B18A 2M7VA 3LIEA 4I39A 1N9NA 1TF1A 2NUTC 5DJUA 2ZMFA 3BJNA 2QWSA 3TW8A 1LSWA 2ZBBA 2GJ3A 3IBRA 4MCWA 4R38A 3UB7A 4YNRA 1LSVA 3R4KA 3KYZA 3P7NA 3VE4A 5EFWA 2P08A 4JGPA 3ULFA 3KSGA 4GS9B 5LBRA 4YWZA 1UGUA 2W27A 2QYBA 2OOLA 3TRCA 3EQVA 3LR0A 4WF0A 1TS6A 3T50A 1IFQA 1NLYA 2VEAA 4EU0A 3IS2B 3LYXA 1VHMA 1P0ZA 3UB9A 2JKRM 2W3DA 4JGRA 5F6AA 3E98A 4O0PA 2A24B 1OJ5A 2L1MA 4EESA 1V9ZA 3A0RA 4I38A 3EEAA 4EEUA 2VKSA 3TJZC 5HDSA 1Y28A 2M7UA 4GLQA 3OC2A 1X0OA 1OT9A 3CLOA 3PBOA 3EWKA 4Q0IA 4RQ9A 4WUJA 2HJ9C 5HDCA 4LRXC 2CMNA 3A0VA 4GCZA 1BYWA 3G6OA 3T4OA 3O5YA 3LIBA 2IA2A 2L0WA 4ARZB 3BW6A 4F3LA 4IHQA 2ZOIA 5G4ZA 1T1AA 3V67A 3H7WA 3D72A 3HJIA 3F1OA 1NWZA 4HP4A 4PKYA 4UEYA 5CX7A 4CLCB 1G28A 3PBNA 1F5MA 5DF9A 4KUOA 5AVFA 2FH5A 4EUVA 4DN0A 3C30A 4LRZE 4WEKA 4HP9A 3CITA 2JKRI 3LI9A 3T4JA 3EQUA 3FPVA 5KSHA 5HL6A 5A8BA 1LL8A 5F68A 2PD8A 3B47A 2D02A 2W0NA 3MR0A 2MJ6A 4IUHA 4I3AA 4CLCD 1S67L 1STZA 1TS0A 2V1BA 3MQQA 4B93A 3CAXA 1GSWA 3MQ0A 4BBVA 1P9WA 1T19A 3NOUC 3S7OA 2Y79A 3W2ZA 2M1CA 4I3IA 3R7WA 4KQOA 3LICA 4DJ2A 5IU1A 2WKQA 3UB6A 2EWWA 3MJQA 1V9YA 1WA9A 2PR5A 4NXFA 1ZTUA 4ZRRA 2PT7A 2XSSA 2O99A 3F1PA 3E4OA 1DRMA 3A0SA 1P97A 4Q0JA 3GDIA 3MQOA 3T4QA 3LI8A 1DP8A 1S66L 2D01A 2V0UA 2VLGA 4PKYG 3OBFA 3H9WA 4R70A 5HZHA 4LRYC 3NOTC 2OAP1 4XT2A 2J3WA 2HJEA 3FG8A 3PBSA 4HH2A 4O8GA 3KSFA 3FC7A 1YAXA 4WL9A 3RH8B 3E0YA 3T4SA 5DKKA 4AFIA 2VV7A 3ICYA 1GSXA 5IS1A 2O9BA 3OCNA 1G6OA 1OTDA 2V9AA 2I9VA 4M4XA 3UE6A 3UE3A 3TE8A 1UWPX 2JKTM 3MXQA 4L9GA 1IOUA 5HWTA 4P6ZM 2L4RA 5AVEA 2J3TD 1OPXA 2OWHA 2PHYA 3C8CA 5HSQA 2QHKA 4FOFA 4F3LB 1TD5A 3EEHA 2B02A 3H7WB 1TS8A 2DMWA 3T4KA 3F1OB 3RFBA 1NRJA 5DFYA 3NHQA 4GHIA 4LPZA 3MFXA 4DMZA 2YKHA 1EW0A 1F9IA 4HJ3A 5F5YA 2FZ0A 4GS9A 4G3VA 2VV6A 4BMWA 2Z6CA 3CUEC 4CLCC 3HJKA 4Y5FA 2PR6A 1MZUA 1NLZA 3PBTA 3S7NA 3S7QA 3OLOA 2V1AA 3GECA 3IS2A 4E04A 3F1NB 3OCLA 4L9EA 2W3HA 5HDDA 2WKRA 4Q0HA 4HHDA 2H28A 3ZQ5A 3K3CA 4L9FA 1F98A 1S1ZA 1S4SA 5I5LA 4O01A 5J7EA 2XROA 4R6LA 3PHYA 3LR4A 4HNBA 1UWNX 2JKTI 4MN6A 2JN7A 4MN7A 2KLIA 3NOPC 3C38A 3H82A 3VV4A 4UQIM 5G4YA 2GNXA 5HD5A 4EERA 3RTYA 1H3QA 5FL3A 3K2NA 2PD7A 3FPWA 1D06A 5C5KA 4EW7A 4ARZA 1OT6A 3LIFA 4WLAA 4KQDA 4MN5A 1N9OA 2PYPA 3F1PB 3CUEA 2WKPA 4CLCA 4PAUA 2Z6DA 4Z1WA 4JGOA 3E4PA 2LB9A 3PBQA 4MDZA 2XRNA 2W1TA 4EEPA 1XJ3A 4ETXA 3B42A 3PYPA 2QKPA 3B33A 1W63M 2LB5A 2HF6A 1VB6A 2OAQ1 2INWA 4Y2FA 4OOLA 5TBMA 3UB8A 1LSXA 1XJ4A 4FSFA 3EOIA 3BQ8A 3LIDA 1XFNA 4IUKA 5KIZA 1OJGA 5DJTA 5J4EA 2W3FA 4NKPA 5DFXA 3MMHA 1T1CA 2P04A 1P9RA 4K08A 5L8MA 2K7SA 5HWWA 3K3DA 4H6JA 5MC7A 1T1BA 3P01A 1LT0A 3IBJA 3KO6A 3NJAA 4G3WA 3KSHA 1JNUA 3BY8A 1YSQA 2A2LA 5DKLA 3KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HD3 A;  4GHI B;  4R3A A;  3E4Q A;  3SW1 A;  4BBU A;  1S4R A;  4NXG A;  2QJ5 A;  2KDK A;  1OTA A;  4HIA A;  1KOU A;  2R78 A;  4HY8 A;  1XJ6 A;  4EXO A;  1XFQ A;  2YKF A;  3C2W A;  4HJ6 A;  2PDR A;  1DP9 A;  1OTI A;  3LIA A;  4NXB A;  4I5S A;  1D7E A;  3UME A;  4HOI A;  1S1Y A;  4LLO B;  4DJ3 A;  1DP6 A;  3H82 B;  3UMD A;  2PYR A;  2A24 A;  2QJ7 A;  4EQ1 A;  4JGQ A;  2ZOH A;  2J80 A;  4HI4 A;  4KUK A;  2HV1 A;  4GW9 A;  2VV8 A;  3VE3 A;  1XJ2 A;  1OTE A;  2KX6 A;  5HWV A;  4I3J A;  4B9O A;  5J3W A;  3LUQ A;  1T18 A;  2P7J A;  2EA9 A;  2OWJ A;  4HH3 A;  4BBT A;  2JHE A;  3VOL A;  3BWL A;  3F1N A;  3BY9 A;  4EET B;  5TBM B;  4WN5 A;  2V0W A;  4NXE A;  2BAS A;  4XT2 B;  4HJ4 A;  1N9L A;  3CWF A;  4H6J B;  3KX0 X;  5F69 A;  1OTB A;  4HQA A;  1GSV A;  1ODV A;  1TS7 A;  3LIE A;  4I39 A;  1N9N A;  5DJU A;  2QWS A;  1LSW A;  2ZBB A;  2GJ3 A;  3IBR A;  4R38 A;  3UB7 A;  1LSV A;  3P7N A;  3VE4 A;  5EFW A;  4JGP A;  3ULF A;  4GS9 B;  4YWZ A;  1UGU A;  2W27 A;  2OOL A;  4WF0 A;  1TS6 A;  3T50 A;  2VEA A;  3IS2 B;  3LYX A;  1P0Z A;  3UB9 A;  4JGR A;  5F6A A;  2A24 B;  1OJ5 A;  2L1M A;  4EES A;  1V9Z A;  3A0R A;  4I38 A;  4EEU A;  5HDS A;  1Y28 A;  1X0O A;  1OT9 A;  3CLO A;  3EWK A;  4RQ9 A;  4WUJ A;  5HDC A;  4LRX C;  2CMN A;  3A0V A;  4GCZ A;  1BYW A;  3G6O A;  3LIB A;  2L0W A;  4F3L A;  2ZOI A;  5G4Z A;  1T1A A;  3H7W A;  3D72 A;  3HJI A;  3F1O A;  1NWZ A;  4HP4 A;  4PKY A;  1G28 A;  5AVF A;  4KUO A;  4LRZ E;  4HP9 A;  3LI9 A;  5A8B A;  1LL8 A;  5F68 A;  2PD8 A;  2D02 A;  2W0N A;  3MR0 A;  4I3A A;  1S67 L;  1TS0 A;  2V1B A;  3MQQ A;  3CAX A;  1GSW A;  4BBV A;  1T19 A;  3NOU C;  2M1C A;  4I3I A;  3LIC A;  4DJ2 A;  5IU1 A;  2WKQ A;  3UB6 A;  3MJQ A;  1V9Y A;  1WA9 A;  2PR5 A;  4NXF A;  3F1P A;  3E4O A;  1DRM A;  3A0S A;  1P97 A;  3GDI A;  3MQO A;  3LI8 A;  1DP8 A;  4PKY G;  1S66 L;  2D01 A;  2V0U A;  2VLG A;  5HZH A;  3H9W A;  4R70 A;  4LRY C;  3NOT C;  4XT2 A;  3FG8 A;  4HH2 A;  3FC7 A;  4WL9 A;  3RH8 B;  5DKK A;  2VV7 A;  3ICY A;  1GSX A;  5IS1 A;  1OTD A;  2V9A A;  2I9V A;  4M4X A;  3UE6 A;  1UWP X;  3MXQ A;  4L9G A;  5HWT A;  2L4R A;  5AVE A;  2OWH A;  2PHY A;  3C8C A;  5HSQ A;  2QHK A;  4F3L B;  3EEH A;  2B02 A;  3H7W B;  1TS8 A;  3F1O B;  3NHQ A;  4GHI A;  4LPZ A;  3MFX A;  2YKH A;  1EW0 A;  1F9I A;  4HJ3 A;  5F5Y A;  4GS9 A;  2VV6 A;  2Z6C A;  3HJK A;  2PR6 A;  1MZU A;  3OLO A;  2V1A A;  3GEC A;  3IS2 A;  4E04 A;  3F1N B;  4L9E A;  5HDD A;  2WKR A;  4HHD A;  2H28 A;  3ZQ5 A;  3K3C A;  4L9F A;  1F98 A;  1S1Z A;  1S4S A;  5I5L A;  5J7E A;  4R6L A;  3PHY A;  4HNB A;  1UWN X;  4MN6 A;  2JN7 A;  3NOP C;  3H82 A;  5G4Y A;  5HD5 A;  4EER A;  3RTY A;  4EW7 A;  2PD7 A;  1D06 A;  1OT6 A;  3LIF A;  4WLA A;  4KQD A;  4MN5 A;  1N9O A;  2PYP A;  3F1P B;  2WKP A;  2Z6D A;  4JGO A;  3E4P A;  4EEP A;  1XJ3 A;  3PYP A;  2QKP A;  3B33 A;  1VB6 A;  2INW A;  5TBM A;  3UB8 A;  1LSX A;  1XJ4 A;  3LID A;  1XFN A;  5KIZ A;  1OJG A;  5DJT A;  5J4E A;  1T1C A;  4K08 A;  2K7S A;  5HWW A;  3K3D A;  4H6J A;  1T1B A;  1LT0 A;  3NJA A;  1JNU A;  3BY8 A;  5DKL A; 
#chains in the Genus database with same CATH topology
 4KQQ A;  2JE5 A;  3SW1 A;  4BBU A;  3BYD A;  3G2Z A;  3B3X A;  2IWC A;  2WGV A;  4NXG A;  2WKI A;  5EVI C;  2HGV A;  4LCL A;  4LV3 A;  4HIA A;  4OOM A;  3SS4 A;  3AGF A;  3Q7Z A;  4S2M A;  1DJB A;  1ES4 A;  2A3U A;  1ZHH B;  4EBP A;  4HJ6 A;  4N1X A;  2Y8H A;  5FI6 A;  1DP9 A;  4YOF A;  4BQM A;  5HPF A;  4ZBE A;  3D3O A;  3UME A;  4HOI A;  4C3Q A;  3JVU A;  3W4Q A;  4HEF A;  3LFV A;  1LI0 A;  1FQG A;  3DTI A;  2PAV P;  4H8R A;  4X56 A;  5FQI A;  2VV8 A;  4R4S A;  3W8K A;  1HD8 A;  2VX8 A;  1NXY A;  2KX6 A;  3MF0 A;  3PBR A;  3BQA A;  1KGF A;  1H5X A;  4N9K A;  5EVI A;  1VEU A;  1T18 A;  4Q8I A;  2ZM0 A;  4PM7 A;  4KG5 A;  3CI6 A;  2OWJ A;  2G2W A;  1MC0 A;  1G5U A;  3IF6 B;  4QY5 A;  2H0T A;  3BWL A;  4KZA A;  3GMW A;  3UE0 A;  1HZO A;  4WN5 A;  3BLM A;  3PXP A;  3LY3 A;  2Y2N A;  5AJG A;  5AQ7 A;  1YM1 A;  3UDX A;  3CWF A;  3MS6 A;  3S7P A;  1W63 Q;  3GR2 A;  2FFY A;  3KX0 X;  4P85 A;  3D9Y A;  3IX3 A;  4HQA A;  1W79 A;  1Q2Q A;  1FSW A;  3UO9 A;  5HFO A;  2Y4A A;  1FOF A;  2NUT C;  2ZMF A;  2QWS A;  3HLW A;  2ZMA A;  2ZBB A;  3ZHH A;  3TOI A;  1WE4 A;  2C5W B;  1LSV A;  1YLZ A;  3MKF A;  4E3N A;  3VE4 A;  2PBY A;  1CQA A;  4JGP A;  4N1H A;  3ULF A;  3BFE A;  1JWZ A;  1PWD A;  4OPZ A;  5CER A;  1UGU A;  3EQV A;  4WF0 A;  4WMC D;  1CI9 A;  5CXW A;  3IXB A;  1BUL A;  4F94 A;  2AVX A;  1VHM A;  1P0Z A;  3UB9 A;  3IQA A;  4MBK A;  2X71 A;  5EOO A;  1KVL A;  3T1Q B;  5HDS A;  2ZC7 A;  2M7U A;  3OC2 A;  5FAQ A;  4PM8 A;  4S2L A;  5EVI B;  1VEU B;  3HUO A;  3C4O A;  3IH9 A;  1U60 A;  4GCZ A;  1BYW A;  2WYX A;  4WZ5 C;  2HP5 A;  1PWG A;  3BW6 A;  1K54 A;  4GD8 A;  4DXB A;  1GHM A;  4NK3 A;  4GDN A;  4HP4 A;  2JKG A;  4UEY A;  4OKP A;  1G28 A;  4EUV A;  4P87 A;  1H8Z A;  3CIT A;  4X1M A;  4M3K A;  3LI9 A;  2B95 A;  5HL6 A;  5A8B A;  5F68 A;  4E3K A;  2PD8 A;  3IXG A;  3MR0 A;  1GCE A;  2VGJ A;  3VSL A;  4FTX A;  1TS0 A;  3T1X A;  3CAX A;  2ZD8 A;  5FDS A;  3MQ0 A;  4MLL A;  2Y91 A;  2Y79 A;  4R0Q A;  4MEZ A;  1YPR A;  4LV2 A;  4U3T A;  3R7W A;  4KQO A;  3P98 A;  3MJQ A;  3AGE A;  2IWB A;  1ERO A;  4UAA A;  5HAI A;  4NXF A;  5EM0 A;  1PZO A;  2O99 A;  3IT9 A;  4LCM A;  5GHZ A;  3V39 A;  3O86 A;  2ZJ9 A;  1XX2 A;  1C3B A;  3GDI A;  3MQO A;  2UV0 E;  1SZV A;  3H9W A;  3VOY A;  1YLJ A;  5GLA A;  1OME A;  1EI5 A;  3PBS A;  5D3O A;  5A91 A;  3NDG A;  1ESU A;  3D4F A;  5E2H A;  5DKK A;  2VV7 A;  3QP2 A;  4MBH A;  3OCN A;  1G6O A;  1PWC A;  5GLD A;  5CGW A;  3UE6 A;  1VET A;  3Q81 A;  4FCF A;  1OPX A;  2OWH A;  3C8C A;  5HSQ A;  1XA1 A;  4S2I A;  4BL2 A;  3ZDJ A;  2BLS A;  4S2N C;  3NUL A;  4LPZ A;  3ZG9 B;  4DMZ A;  1ONG A;  2YKH A;  4MBF A;  3CMZ A;  4GS9 A;  2VV6 A;  2J9O A;  2EX9 A;  4Y5F A;  2HP9 A;  3HLF A;  3PBT A;  4C6Y A;  5FQK A;  2W3H A;  1S0W A;  2WKR A;  4X53 A;  2H28 A;  2E8I A;  1KDW A;  4OON A;  4JF5 A;  1IYS A;  1K56 A;  1F98 A;  1S1Z A;  4LV1 A;  4ZJ1 A;  4OQG A;  2WGI A;  1SKF A;  3LEZ A;  5BOH A;  3JPU A;  5GHY A;  4U0X A;  4KEN B;  1S6R A;  1YQS A;  5M18 A;  4ID4 A;  4MN7 A;  4GOG A;  3H82 A;  2Y2H A;  5G4Y A;  1LLB A;  1FSY A;  1AXB A;  4S2N A;  4DRT A;  2PD7 A;  3RXW A;  3LIF A;  1LI9 A;  4XXR A;  4Y0T A;  3LCE A;  3A3I A;  2ZQD A;  4PAU A;  2EX8 A;  2ZC6 B;  1XXM A;  4Y15 A;  4PMA A;  4MDZ A;  4Y13 A;  3OPR A;  3ITB A;  2W1T A;  5HW3 A;  1E4D A;  1XJ3 A;  4ETX A;  1ALQ A;  3B33 A;  2ZLY A;  2OAQ 1;  4GD6 A;  4Y2F A;  5TBM A;  3UB8 A;  1LSX A;  5M19 A;  3MBZ A;  1PW1 A;  3LID A;  4QU3 A;  5J4E A;  3MMH A;  1T1C A;  1VET B;  3CPT A;  1IYO A;  3MZF A;  2K7S A;  5HWW A;  3K3D A;  2ZQA A;  4H6J A;  2WGW A;  4X69 A;  5MC7 A;  2HDQ A;  3KO6 A;  3NJA A;  3VP0 A;  3KSH A;  2PRF A;  2A2L A;  5DKL A;  3KYQ A;  3N8L A;  3ZCZ A;  4IJG A;  4R3A A;  3E4Q A;  4OPQ A;  4KZB A;  1H8Y A;  1S4R A;  2QJ5 A;  2XA7 S;  3ZVT A;  3UY6 A;  4CQH A;  4MMN A;  5I94 A;  4HES A;  4ETZ A;  4RVA A;  1TDL A;  1XFQ A;  4X1L A;  1H0M A;  1L0D A;  4JF6 A;  4QPR A;  4OQ0 A;  4LV0 A;  4E3L A;  4CLC E;  4FD8 A;  4O7D A;  2NUP C;  4I5S A;  1FR1 A;  4KZ5 A;  5TJJ A;  3PAE A;  1MWR A;  1S1Y A;  1DP6 A;  1W8Q A;  3H82 B;  5FQJ A;  4QHC A;  3V3S A;  3VP3 A;  2QJ7 A;  4JGQ A;  3OPH A;  5CEC A;  3GV9 A;  3QP6 A;  4HI4 A;  3ZNY A;  1H8M A;  4WYY A;  5L10 A;  4B88 A;  5HWV A;  4I3J A;  1JTG A;  3ZG5 A;  4EBN A;  3LUQ A;  1K6R A;  3IH8 A;  5CGS A;  2W1T B;  4WEJ A;  3PR6 A;  4Z9Q A;  4ZJ2 A;  4WEL A;  2JHE A;  2WUQ A;  3VOL A;  3T1S A;  3AGD A;  4II7 A;  4ZAM A;  5TBM B;  3GVB A;  2V0W A;  3C7U A;  1RGZ A;  2K31 A;  3CG5 A;  1MKM A;  1G6A A;  4GDB A;  4S2O A;  3IWO A;  3L9K A;  3CPT B;  1WYB A;  1YSP A;  4H6J B;  1L0F A;  3UNW A;  2G2U A;  2J3T C;  2WGW B;  2DCF A;  1JTD A;  5FAP A;  1OTB A;  3EGX C;  3LO7 A;  5FEF A;  2HDS A;  4NEE D;  3LY4 A;  2K2N A;  1GSV A;  5DTT A;  2M7V A;  4JXW A;  2X01 A;  4E3I A;  3MSH A;  1F2K A;  5DJU A;  2BTF P;  3SS3 A;  1ZG6 A;  3TW8 A;  1RGY A;  1YMX A;  1A0K A;  3R4K A;  5FQQ A;  4A5R A;  2E8J A;  1NYM A;  5EEC A;  3QHY A;  3IF5 A;  2W27 A;  2QYB A;  2OOL A;  2OV5 A;  5TFQ A;  1NZO A;  4NET A;  1ES2 A;  4EU0 A;  3IS2 B;  1BLC A;  1J3W A;  4K91 A;  1CEF A;  1ERQ A;  3E98 A;  3VSK A;  4Y0O A;  4BL3 A;  2L1M A;  3SS5 A;  2EFX A;  4YFM A;  1IEM A;  4JPM A;  4S2P A;  4D60 A;  4GLQ A;  1X0O A;  5DTK A;  5AQB A;  2JBF A;  4EQI A;  3EWK A;  2HJ9 C;  5HDC A;  2CMN A;  3G6O A;  5F83 A;  4B4Z A;  3UB5 P;  3ZFZ A;  3O5Y A;  1SKO A;  3LIB A;  4JXV A;  2XLN A;  2L0W A;  4ARZ B;  1JVJ A;  5G4Z A;  3V67 A;  3H7W A;  3D72 A;  4BD1 A;  3G34 A;  5KSC A;  1FR6 A;  4PKY A;  4CLC B;  2H10 A;  1F5M A;  3PBN A;  5DF9 A;  3C30 A;  5EVE A;  1FIK A;  4HP9 A;  2QZ6 A;  5E43 A;  3T4J A;  5KSH A;  4S2K A;  3N8S A;  1IYQ A;  3DWK A;  3B47 A;  2D02 A;  4BLM A;  5KZH A;  4OP8 A;  1L0G A;  4R3B A;  2MJ6 A;  4I3A A;  4E3J A;  4FH4 A;  5FDH A;  2V1B A;  4B93 A;  2B5R A;  5M1A A;  1GSW A;  2Z2L B;  1P9W A;  1HVB A;  4OOY A;  2H5S A;  2Z2M B;  3ITA A;  3UPP A;  5JYO A;  1PNE A;  3W2Z A;  4I3I A;  3P09 A;  2EWW A;  2Y2I A;  2Q0O A;  3IHB A;  1ZTU A;  4ZRR A;  2DNS A;  2PT7 A;  2XD1 A;  4KZ8 A;  5EOE A;  4QB8 A;  3T4Q A;  1I2W A;  3LI8 A;  4DXC A;  5HZH A;  2VLG A;  3N4I A;  1K54 C;  4R70 A;  3V3R A;  1PZP A;  4LRY C;  3NOT C;  1K57 A;  4XT2 A;  1L0E A;  5HAP A;  3VFF A;  2HJE A;  1ZG4 A;  5FAT A;  2P9V A;  4JBF A;  4UA7 A;  5J8X A;  4O8G A;  3FC7 A;  4WL9 A;  3G31 A;  3RH8 B;  4IVK A;  2O9B A;  5CTN A;  3NEC A;  3RXX A;  2I9V A;  4K0X A;  3TE8 A;  4L9G A;  1IOU A;  2XH9 A;  1KDS A;  4P6Z M;  1I2S A;  2PHY A;  3CHW P;  4JF4 A;  1TD5 A;  3H7W B;  3MFD A;  3RFB A;  1BUE A;  2HZ5 A;  3IXD A;  1EW0 A;  5F5Y A;  4G3V A;  3A3J A;  3SOI A;  2Z6C A;  3CUE C;  5GHX A;  3HJK A;  4R1G A;  3E2K A;  3WRT A;  3S7Q A;  3OCL A;  4L9E A;  1N4O A;  4Y0U A;  5G18 A;  5CED A;  1QMF A;  3JYI A;  3ZQ5 A;  5TGF A;  3K3C A;  2XK1 A;  4R23 A;  1S4S A;  2Y55 A;  2J7V A;  5EM1 A;  5I5L A;  4O01 A;  5J7E A;  4IVI A;  4DE1 A;  3LGO A;  5CTM A;  3LR4 A;  4HNB A;  3FKV A;  2JKT I;  2JN7 A;  1XKZ A;  4QD4 A;  3C38 A;  4UQI M;  2GDN A;  2GNX A;  3DTE A;  4EW7 A;  4DF6 A;  3ISG A;  1N9O A;  1CEG A;  5CHJ A;  3CUE A;  1J9M A;  2LB9 A;  3MZD A;  1ES3 A;  5E2G A;  2QKP A;  2OLV A;  1W63 M;  2P9V B;  1VB6 A;  5EE8 A;  3PAG A;  2WZZ A;  1GHI A;  1XJ4 A;  4X55 A;  1ONH A;  3BQ8 A;  4IUK A;  5KIZ A;  3OPL A;  1OJG A;  2V2F F;  1MWT A;  1XGJ A;  5L8M A;  4EWF A;  4OPR A;  1ESI A;  3ZG0 A;  3Q7V A;  2OSU A;  3N7W A;  1PFL A;  3HLD A;  4EV4 A;  2P74 A;  1PYY A;  4WMC A;  2XA7 M;  3W4O A;  3N6I A;  3UN7 A;  4E3M A;  3S1Y A;  2KDK A;  2V8F A;  4NG2 A;  1KOU A;  3O87 A;  4P6Z S;  3ZYT A;  2XR0 A;  1XJ6 A;  2Y2M A;  2WAE A;  1HTZ A;  4EXO A;  3WS5 A;  4WBG A;  2EWV A;  2VGL S;  4OLD A;  1CI8 A;  2WKE A;  3VMA A;  5DF8 A;  1MWS A;  3C2W A;  3KYE A;  4OH0 A;  4GJ4 A;  3LR5 A;  3LIA A;  1SDN A;  1IYP A;  2VGK A;  3EGD C;  4BWI A;  3O88 A;  4LLO B;  1KGE A;  5FEG A;  4DJ3 A;  3OOV A;  2PYR A;  4PPR A;  2ZOH A;  1K4F A;  4KUK A;  3CZD A;  2HV1 A;  2QMI A;  4G3K A;  5DVA A;  4GW9 A;  3VE3 A;  3HCY A;  4KZ9 A;  1HLU P;  2EX2 A;  4DDS A;  2XQZ A;  4WM9 A;  4B9O A;  5J3W A;  5FQM A;  3R7W B;  5K5B A;  2P7J A;  4UQI S;  4Y3I A;  3T1R A;  3DBA A;  4BBT A;  2GX5 A;  4OVD A;  3F1N A;  3BY9 A;  4E3O A;  2KOI A;  3SH8 A;  4GKU A;  3KSI A;  4HBT A;  2BAS A;  3C4P A;  3S4X A;  4HJ4 A;  1N9L A;  2XGN A;  1TEM A;  3GTC A;  3Q7V B;  5F69 A;  3JVV A;  3HRE A;  5HPI A;  3MZE A;  4OP5 A;  4KG6 A;  5FQ9 A;  1TS7 A;  3LIE A;  3HLG A;  4UHU A;  1M6K A;  1TF1 A;  3DTM A;  4PM6 A;  5CHM A;  3BJN A;  1TVF A;  1LSW A;  1NRF A;  5GL9 A;  2GJ3 A;  3IBR A;  4PM5 A;  4MCW A;  3G35 A;  4R38 A;  1FCO A;  1FIL A;  2ZC5 B;  3M6H A;  3UB7 A;  4Y17 A;  3KYZ A;  4Y7P A;  3BEB A;  5EFW A;  2RL3 A;  1LHY A;  4R3J A;  4U0T A;  4GS9 B;  3VP4 A;  4YWZ A;  2WAD A;  4KZ6 A;  2EX6 A;  3WS0 A;  3HLC A;  3T50 A;  3G32 A;  2VEA A;  2ZM8 A;  3QNB A;  3WS4 A;  1RCJ A;  1GHP A;  4JGR A;  4CPK A;  1KVM A;  1KE0 A;  5F6A A;  4O0P A;  1E3U D;  1V9Z A;  3A0R A;  4I38 A;  3EEA A;  4EEU A;  3IWI A;  2R9X A;  4P0M A;  3OZH A;  3QP5 A;  3CLO A;  3ZVW A;  4LRX C;  2HDU A;  3HLE A;  2IA2 A;  4F3L A;  2ZOI A;  2C6W B;  3HJI A;  3BLS A;  1RP5 A;  4RX3 A;  1I5Q A;  5CX7 A;  3DTK A;  5AVF A;  2FH5 A;  5EUA A;  1O7E A;  3V5M A;  4DN0 A;  3IWQ A;  4JKT A;  3WS1 A;  5EVI D;  1D1J A;  1NYY A;  2JKR I;  2ZM2 A;  3EQU A;  1BTL A;  1LL8 A;  5A90 A;  3Q1F A;  2PU2 A;  5FI7 A;  2ZC4 B;  1CF0 A;  4OQI A;  3OPP A;  4EUZ A;  1YMS A;  1STZ A;  3VFH A;  1YLT A;  4QJG A;  4GN2 A;  5EVL A;  4BBV A;  1T19 A;  5CHU A;  3S7O A;  1ES5 A;  3BFD A;  4KZ3 A;  3SH9 A;  3VOZ A;  2M1C A;  1PI5 A;  3LIC A;  5IU1 A;  2WKQ A;  1V9Y A;  3FKW A;  3IF6 A;  5CGX A;  1WA9 A;  2PR5 A;  1N9B A;  3F1P A;  3L7H A;  3E4O A;  3TSG A;  1DRM A;  3A0S A;  3QP1 A;  1P97 A;  2XF3 A;  4Q0J A;  1KGG A;  1SDE A;  5CEB A;  4E6W A;  4OQH A;  3ZNT A;  1K55 C;  4N92 A;  1DP8 A;  4PKY G;  2D01 A;  2V0U A;  1MBL A;  3OBF A;  2OAP 1;  3HVF A;  2J3W A;  3UE1 A;  5E2E A;  1IKI A;  3NY4 A;  1BSG A;  1YLW A;  1YAX A;  4LEN A;  4B4X A;  3E0Y A;  1KE3 A;  4AFI A;  1OTD A;  2V9A A;  3GRJ A;  5JYP A;  2JCH A;  3IXH A;  2JKT M;  3Q82 A;  5HWT A;  1LL9 A;  4XUX A;  2QHK A;  2Y2P A;  4E6X A;  4F3L B;  4IED A;  1NRJ A;  5DFY A;  2Y2O A;  1E3U A;  4GHI A;  3MFX A;  3IX8 A;  1F9I A;  3BFF A;  4HJ3 A;  3TG9 A;  1W7F A;  3C5A A;  1K55 A;  4PM9 A;  4BMW A;  5A93 A;  1W5D A;  2WKH A;  2V1A A;  4C75 A;  3GEC A;  4P6B A;  5HDD A;  4Q0H A;  3QP4 A;  3FV7 A;  5F1G A;  5A92 A;  3UDI A;  1ERM A;  4R6L A;  5DTS A;  1G68 A;  1Z09 A;  1UWN X;  2Y2J A;  4QWO A;  1JWP A;  3NOP C;  3VV4 A;  1K57 C;  3MXR A;  1MXO A;  5HD5 A;  4EER A;  2V20 A;  2ZC3 B;  3RTY A;  1H3Q A;  5FL3 A;  3ZG7 B;  1XP4 A;  3FPW A;  3K2N A;  1D06 A;  1OT6 A;  5DF7 A;  4WLA A;  4DE2 A;  4UA6 A;  4MN5 A;  3F1P B;  4X68 A;  3DWZ A;  2Z6D A;  1GA0 A;  3RJU A;  4JGO A;  2JC7 A;  4IBX A;  3VP2 A;  3PBQ A;  4X6T A;  3MKE A;  3IHA A;  4EEP A;  3B42 A;  3ZG8 B;  3QNC A;  2LB5 A;  3LEQ A;  4OPY A;  4DE0 A;  1PI4 A;  3EOI A;  2IWD A;  1XFN A;  2PBD P;  2XFS A;  5DJT A;  4ZDX A;  2W3F A;  4K08 A;  2WZX A;  2EFU A;  4MNR A;  2UWX A;  4LFU A;  1T1B A;  5IHV A;  3P01 A;  3IBJ A;  4G3W A;  1CK3 A;  1YSQ A;  4HBU A;  5HD3 A;  4GHI B;  3CJM A;  4FH2 A;  2Q9M A;  3MXS A;  1XA7 A;  1SKO B;  5FAS A;  3HUM A;  1OTA A;  2W1R A;  2R78 A;  4FUW A;  4HY8 A;  1E25 A;  2VGL M;  5IT5 A;  1YKD A;  4BD0 A;  2YKF A;  2Y2Q A;  1TDG A;  2PDR A;  1NJ4 A;  4L0L A;  3LR3 A;  1OTI A;  2ZMV A;  1XPB A;  4NXB A;  1D7E A;  1Y54 A;  4PHT A;  1SHV A;  2VJW A;  1Y4O A;  3T12 B;  1Z6F A;  4X25 A;  2O9A A;  3UMD A;  2A24 A;  4EQ1 A;  3T4L A;  2J80 A;  4R4R A;  2XD5 A;  2V1Z A;  1QME A;  3I7J A;  1K56 D;  1OTE A;  1XJ2 A;  4RYE A;  3NCK A;  2JKF A;  4BJP A;  1KE4 A;  2GZA A;  2O9C A;  4K0W A;  1W8Y A;  1SCW A;  1IEL A;  2EA9 A;  3FWL A;  2O0Y A;  4QY6 A;  4HH3 A;  4ZTK A;  3T4T A;  2W3E A;  3U2A A;  2G7U A;  2VZW A;  1WYC A;  2R9W A;  1NY0 A;  2QPN A;  4EET B;  4KG2 A;  1DY6 A;  4NXE A;  5CRF A;  1FCN A;  2BG1 A;  4ME4 A;  4XT2 B;  5F1F A;  2VA0 A;  3G30 A;  3NC8 A;  4WZ5 A;  3BFG A;  1LL5 A;  1NZU A;  2ZL1 A;  2W3G A;  1BLP A;  3G2Y A;  1ODV A;  4JXG A;  4OLG A;  1DJC A;  1L3L A;  2B18 A;  4I39 A;  1N9N A;  5E2F A;  4KZ7 A;  3BFC A;  1YT4 A;  2H0Y A;  3DW0 A;  3BRM A;  4WZ4 A;  5FI2 A;  3M2K A;  4XUZ A;  2Q9N A;  3U4L P;  3QP8 A;  3A3D A;  4KZ4 A;  4YNR A;  3P7N A;  1K0K A;  2CC1 A;  3NDE A;  2P08 A;  3KSG A;  1AWI A;  5LBR A;  4DKI A;  3V50 A;  3TRC A;  3NIA A;  3LR0 A;  1K25 A;  1TS6 A;  1IFQ A;  1L2S A;  1NLY A;  3LYX A;  3UPO A;  2JKR M;  2Y2G A;  1BT5 A;  2W3D A;  1BLH A;  5HX9 A;  2A24 B;  1OJ5 A;  1EWZ A;  4EES A;  1XGI A;  2VKS A;  3TJZ C;  1DJA A;  1Y28 A;  5GLB A;  1OT9 A;  4DDY A;  3NBL A;  2HDR A;  2A49 A;  3PBO A;  4Q0I A;  4JLF A;  4RQ9 A;  4WUJ A;  5HL1 A;  5AQA A;  3A0V A;  2J8Y A;  3T4O A;  3WWX A;  2ZQ8 A;  1BZA A;  4IHQ A;  1T1A A;  2ZQC A;  1MKI A;  3F1O A;  1NWZ A;  4GZB A;  4KQR A;  4KUO A;  1CJF A;  3FYZ A;  4ESP A;  2X02 A;  4LRZ E;  3HLB A;  4WEK A;  3N8R A;  1BLS A;  2J9P A;  3FPV A;  2FFF B;  2HPB A;  2W0N A;  2ZL1 B;  2WAF A;  1ZKJ A;  4IUH A;  1FCM A;  4CLC D;  1S67 L;  2EXA A;  3GQZ A;  3MQQ A;  1YLY A;  4CJN A;  3IX4 A;  3NOU C;  2ACG A;  1Q2P A;  2ZQ9 A;  4DJ2 A;  3UB6 A;  3BM6 A;  2WK0 A;  2XSS A;  3FZC A;  1GA9 A;  2XEP A;  1K6S A;  1S66 L;  3W4P A;  3Q07 A;  4DE3 A;  1YLP A;  5EV0 A;  1MWU A;  2V8C A;  3FG8 A;  4HH2 A;  5HAR A;  3KSF A;  5FSR A;  3T4S A;  3ICY A;  1GSX A;  5IS1 A;  3UPN A;  1VM1 A;  4M4X A;  1PW8 A;  3M6B A;  3UE3 A;  1UWP X;  5F82 A;  1ACF A;  3MXQ A;  4EBL A;  2L4R A;  5AVE A;  2J3T D;  4YIN A;  5TR7 A;  1PRQ A;  4FOF A;  2XDM A;  3EEH A;  2B02 A;  2EXB A;  2RCX A;  1TS8 A;  2DMW A;  3T4K A;  3F1O B;  2XFT A;  5L09 A;  3S22 A;  3NHQ A;  2OLU A;  2I72 A;  3GSG A;  2VK3 A;  2Y59 A;  3C7V A;  3WRZ A;  2FZ0 A;  4ZJ3 A;  4CLC C;  5KMW A;  5HAQ A;  2PR6 A;  1MZU A;  5FA7 A;  1NLZ A;  3S7N A;  1O07 A;  3OLO A;  3IS2 A;  4E04 A;  3F1N B;  1K38 A;  1MY8 A;  2Y2L A;  5FAO A;  3IF6 C;  3M2J A;  3PTE A;  5AQ9 A;  4HHD A;  1IKG A;  4JXS A;  4L9F A;  3NI9 A;  4IBR A;  3HL9 A;  1M40 A;  2ZQ7 A;  4GB7 A;  1PIO A;  4RX2 A;  5L07 A;  2XRO A;  3PHY A;  1K4E A;  4MN6 A;  1MPL A;  5GLC A;  3VP1 A;  2KLI A;  3A3E A;  3A3F A;  3SZT A;  5L2F A;  4RA7 A;  5C5K A;  2DRW A;  4ARZ A;  2HP6 A;  3HUN A;  4KQD A;  2PYP A;  3ZGA B;  3SH7 A;  2WKP A;  4CLC A;  3HBR A;  4D2O A;  4Z1W A;  3O3V A;  3E4P A;  4GNU A;  3UDF A;  4LGW A;  2XRN A;  3E2L A;  3PYP A;  5U47 A;  1ZC2 A;  1VQQ A;  2HF6 A;  5EPH A;  3BEC A;  2INW A;  4OOL A;  4S2J A;  4FSF A;  4BEN A;  4UA9 A;  1JWV A;  4NKP A;  5DFX A;  3DAV A;  2P04 A;  1P9R A;  3G4P A;  1LT0 A;  2PU4 A;  2Y2K A;  4N9L A;  1JNU A;  3BY8 A;  3WS2 A; 
#chains in the Genus database with same CATH homology
 5HD3 A;  4GHI B;  4IJG A;  4R3A A;  3E4Q A;  3SW1 A;  4BBU A;  2XA7 M;  1S4R A;  4NXG A;  2QJ5 A;  2KDK A;  2XA7 S;  2HGV A;  1OTA A;  2W1R A;  1KOU A;  2R78 A;  4HIA A;  4CQH A;  4P6Z S;  4MMN A;  4HY8 A;  4OOM A;  3ZYT A;  2VGL M;  4ETZ A;  1XJ6 A;  5IT5 A;  1YKD A;  4EXO A;  1XFQ A;  2EWV A;  2VGL S;  1ZHH B;  4QPR A;  2YKF A;  3C2W A;  4HJ6 A;  2PDR A;  4CLC E;  2Y8H A;  4GJ4 A;  4L0L A;  3LR3 A;  1DP9 A;  4YOF A;  5HPF A;  1OTI A;  3LR5 A;  3LIA A;  2ZMV A;  4NXB A;  4I5S A;  2NUP C;  1D7E A;  3D3O A;  5TJJ A;  3UME A;  4PHT A;  3EGD C;  4BWI A;  4HOI A;  3JVU A;  2VJW A;  1S1Y A;  4LLO B;  4DJ3 A;  1DP6 A;  3LFV A;  3H82 B;  2O9A A;  3OOV A;  2PYR A;  2A24 A;  2QJ7 A;  3UMD A;  4EQ1 A;  4JGQ A;  3T4L A;  2ZOH A;  2J80 A;  4HI4 A;  4KUK A;  2HV1 A;  4G3K A;  4GW9 A;  2VV8 A;  3VE3 A;  2VX8 A;  3HCY A;  1XJ2 A;  1OTE A;  2KX6 A;  1H8M A;  3MF0 A;  3BQA A;  3PBR A;  4BJP A;  5HWV A;  2GZA A;  4I3J A;  2O9C A;  4B9O A;  5J3W A;  3LUQ A;  1T18 A;  3R7W B;  5K5B A;  2P7J A;  2EA9 A;  2O0Y A;  4UQI S;  3CI6 A;  2OWJ A;  4HH3 A;  4Y3I A;  2W1T B;  1MC0 A;  4WEJ A;  3T4T A;  2W3E A;  3PR6 A;  3DBA A;  4BBT A;  2GX5 A;  3U2A A;  2G7U A;  2VZW A;  4WEL A;  2JHE A;  3VOL A;  3BWL A;  3F1N A;  3BY9 A;  4II7 A;  4EET B;  2KOI A;  5TBM B;  4WN5 A;  3PXP A;  2V0W A;  3KSI A;  4NXE A;  2K31 A;  1MKM A;  2BAS A;  5AJG A;  4ME4 A;  4XT2 B;  2VA0 A;  1N9L A;  4HJ4 A;  1YSP A;  3CWF A;  4H6J B;  2J3T C;  3S7P A;  1W63 Q;  3KX0 X;  5F69 A;  3JVV A;  1OTB A;  2W3G A;  3EGX C;  4NEE D;  5HPI A;  2K2N A;  4HQA A;  1GSV A;  1ODV A;  1TS7 A;  2B18 A;  2M7V A;  3LIE A;  4I39 A;  1N9N A;  1TF1 A;  2NUT C;  5DJU A;  2ZMF A;  3BJN A;  2QWS A;  3TW8 A;  1LSW A;  2ZBB A;  2GJ3 A;  3IBR A;  4MCW A;  4R38 A;  3UB7 A;  4YNR A;  1LSV A;  3R4K A;  3KYZ A;  3P7N A;  3VE4 A;  5EFW A;  2P08 A;  4JGP A;  3ULF A;  3KSG A;  4GS9 B;  5LBR A;  4YWZ A;  1UGU A;  2W27 A;  2QYB A;  2OOL A;  3TRC A;  3EQV A;  3LR0 A;  4WF0 A;  1TS6 A;  3T50 A;  1IFQ A;  1NLY A;  2VEA A;  4EU0 A;  3IS2 B;  3LYX A;  1VHM A;  1P0Z A;  3UB9 A;  2JKR M;  2W3D A;  4JGR A;  5F6A A;  3E98 A;  4O0P A;  2A24 B;  1OJ5 A;  2L1M A;  4EES A;  1V9Z A;  3A0R A;  4I38 A;  3EEA A;  4EEU A;  2VKS A;  3TJZ C;  5HDS A;  1Y28 A;  2M7U A;  4GLQ A;  3OC2 A;  1X0O A;  1OT9 A;  3CLO A;  3PBO A;  3EWK A;  4Q0I A;  4RQ9 A;  4WUJ A;  2HJ9 C;  5HDC A;  4LRX C;  2CMN A;  3A0V A;  4GCZ A;  1BYW A;  3G6O A;  3T4O A;  3O5Y A;  3LIB A;  2IA2 A;  2L0W A;  4ARZ B;  3BW6 A;  4F3L A;  4IHQ A;  2ZOI A;  5G4Z A;  1T1A A;  3V67 A;  3H7W A;  3D72 A;  3HJI A;  3F1O A;  1NWZ A;  4HP4 A;  4PKY A;  4UEY A;  5CX7 A;  4CLC B;  1G28 A;  3PBN A;  1F5M A;  5DF9 A;  4KUO A;  5AVF A;  2FH5 A;  4EUV A;  4DN0 A;  3C30 A;  4LRZ E;  4WEK A;  4HP9 A;  3CIT A;  2JKR I;  3LI9 A;  3T4J A;  3EQU A;  3FPV A;  5KSH A;  5HL6 A;  5A8B A;  1LL8 A;  5F68 A;  2PD8 A;  3B47 A;  2D02 A;  2W0N A;  3MR0 A;  2MJ6 A;  4IUH A;  4I3A A;  4CLC D;  1S67 L;  1STZ A;  1TS0 A;  2V1B A;  3MQQ A;  4B93 A;  3CAX A;  1GSW A;  3MQ0 A;  4BBV A;  1P9W A;  1T19 A;  3NOU C;  3S7O A;  2Y79 A;  3W2Z A;  2M1C A;  4I3I A;  3R7W A;  4KQO A;  3LIC A;  4DJ2 A;  5IU1 A;  2WKQ A;  3UB6 A;  2EWW A;  3MJQ A;  1V9Y A;  1WA9 A;  2PR5 A;  4NXF A;  1ZTU A;  4ZRR A;  2PT7 A;  2XSS A;  2O99 A;  3F1P A;  3E4O A;  1DRM A;  3A0S A;  1P97 A;  4Q0J A;  3GDI A;  3MQO A;  3T4Q A;  3LI8 A;  1DP8 A;  1S66 L;  2D01 A;  2V0U A;  2VLG A;  4PKY G;  3OBF A;  3H9W A;  4R70 A;  5HZH A;  4LRY C;  3NOT C;  2OAP 1;  4XT2 A;  2J3W A;  2HJE A;  3FG8 A;  3PBS A;  4HH2 A;  4O8G A;  3KSF A;  3FC7 A;  1YAX A;  4WL9 A;  3RH8 B;  3E0Y A;  3T4S A;  5DKK A;  4AFI A;  2VV7 A;  3ICY A;  1GSX A;  5IS1 A;  2O9B A;  3OCN A;  1G6O A;  1OTD A;  2V9A A;  2I9V A;  4M4X A;  3UE6 A;  3UE3 A;  3TE8 A;  1UWP X;  2JKT M;  3MXQ A;  4L9G A;  1IOU A;  5HWT A;  4P6Z M;  2L4R A;  5AVE A;  2J3T D;  1OPX A;  2OWH A;  2PHY A;  3C8C A;  5HSQ A;  2QHK A;  4FOF A;  4F3L B;  1TD5 A;  3EEH A;  2B02 A;  3H7W B;  1TS8 A;  2DMW A;  3T4K A;  3F1O B;  3RFB A;  1NRJ A;  5DFY A;  3NHQ A;  4GHI A;  4LPZ A;  3MFX A;  4DMZ A;  2YKH A;  1EW0 A;  1F9I A;  4HJ3 A;  5F5Y A;  2FZ0 A;  4GS9 A;  4G3V A;  2VV6 A;  4BMW A;  2Z6C A;  3CUE C;  4CLC C;  3HJK A;  4Y5F A;  2PR6 A;  1MZU A;  1NLZ A;  3PBT A;  3S7N A;  3S7Q A;  3OLO A;  2V1A A;  3GEC A;  3IS2 A;  4E04 A;  3F1N B;  3OCL A;  4L9E A;  2W3H A;  5HDD A;  2WKR A;  4Q0H A;  4HHD A;  2H28 A;  3ZQ5 A;  3K3C A;  4L9F A;  1F98 A;  1S1Z A;  1S4S A;  5I5L A;  4O01 A;  5J7E A;  2XRO A;  4R6L A;  3PHY A;  3LR4 A;  4HNB A;  1UWN X;  2JKT I;  4MN6 A;  2JN7 A;  4MN7 A;  2KLI A;  3NOP C;  3C38 A;  3H82 A;  3VV4 A;  4UQI M;  5G4Y A;  2GNX A;  5HD5 A;  4EER A;  3RTY A;  1H3Q A;  5FL3 A;  3K2N A;  2PD7 A;  3FPW A;  1D06 A;  5C5K A;  4EW7 A;  4ARZ A;  1OT6 A;  3LIF A;  4WLA A;  4KQD A;  4MN5 A;  1N9O A;  2PYP A;  3F1P B;  3CUE A;  2WKP A;  4CLC A;  4PAU A;  2Z6D A;  4Z1W A;  4JGO A;  3E4P A;  2LB9 A;  3PBQ A;  4MDZ A;  2XRN A;  2W1T A;  4EEP A;  1XJ3 A;  4ETX A;  3B42 A;  3PYP A;  2QKP A;  3B33 A;  1W63 M;  2LB5 A;  2HF6 A;  1VB6 A;  2OAQ 1;  2INW A;  4Y2F A;  4OOL A;  5TBM A;  3UB8 A;  1LSX A;  1XJ4 A;  4FSF A;  3EOI A;  3BQ8 A;  3LID A;  1XFN A;  4IUK A;  5KIZ A;  1OJG A;  5DJT A;  5J4E A;  2W3F A;  4NKP A;  5DFX A;  3MMH A;  1T1C A;  2P04 A;  1P9R A;  4K08 A;  5L8M A;  2K7S A;  5HWW A;  3K3D A;  4H6J A;  5MC7 A;  1T1B A;  3P01 A;  1LT0 A;  3IBJ A;  3KO6 A;  3NJA A;  4G3W A;  3KSH A;  1JNU A;  3BY8 A;  1YSQ A;  2A2L A;  5DKL A;  3KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...