1Y28A

Crystal structure of the r220a metbjfixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGAIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A distal arginine in the oxygen-sensing heme-PAS domains is essential to ligand binding, signal transduction, and structure
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords Sensor protein fixL
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1y28A00
2PD8A 2VLGA 4DJ2A 3MFXA 2V9AA 4F3LB 4EW7A 5IS1A 2P7JA 4HNBA 1TS6A 2WKQA 4WN5A 4WL9A 3VOLA 4EXOA 1LSXA 1S1ZA 5J7EA 2VEAA 1GSXA 1N9NA 1DP8A 1V9YA 3K3CA 5F68A 1VB6A 1T1CA 2GJ3A 2WKRA 3BWLA 5DKKA 1T19A 1OTIA 3G6OA 1F9IA 3LIEA 1S4RA 4R70A 2PR5A 3BY9A 5J3WA 1TS0A 5EFWA 4HJ3A 3F1OB 4H6JA 4JGQA 3H82B 4KUOA 2BASA 2PYPA 1GSWA 2W0NA 4H6JB 3EEHA 4HH2A 1D7EA 4M4XA 3T50A 4B9OA 1UWNX 4MN5A 3SW1A 1WA9A 3LIBA 5HDDA 2QWSA 5DKLA 4LLOB 2D01A 4HHDA 4YWZA 3F1NB 1LT0A 1TS8A 4XT2B 3D72A 1T1AA 4R3AA 4MN6A 4L9FA 5DJUA 3UB6A 5J4EA 2ZOIA 1XJ2A 2YKFA 2K7SA 2PR6A 4NXEA 4NXBA 4WF0A 4EETB 2QKPA 2YKHA 3HJIA 3A0RA 2Z6DA 1G28A 3H7WB 2V0WA 3H9WA 2A24B 1DRMA 3F1NA 3FC7A 1OJGA 3LIAA 4LPZA 2INWA 5HWTA 4GW9A 4GS9A 3E4PA 3LI9A 4GS9B 4EERA 4BBUA 1XFQA 4HP4A 2JN7A 2Z6CA 5TBMA 1OTAA 2KDKA 4GCZA 5F69A 4EEPA 2L1MA 2VV8A 1BYWA 1P0ZA 5HD5A 3NJAA 4I39A 4HIAA 5HWVA 2KX6A 1XJ4A 3F1PB 1NWZA 1S1YA 1T18A 1OTDA 3CAXA 4I38A 3HJKA 3VE3A 2M1CA 1S67L 2HV1A 1T1BA 4PKYG 2J80A 4HJ6A 4HOIA 1XJ6A 2H28A 1S4SA 2B02A 4JGOA 1LSVA 4WUJA 3MQOA 3H82A 4JGPA 3C2WA 2OOLA 4GHIA 4HP9A 4HQAA 4GHIB 4JGRA 3MQQA 3MR0A 1TS7A 4LRZE 3ICYA 3B33A 1F98A 4I5SA 5AVFA 4HJ4A 4LRYC 1D06A 2L4RA 2V1AA 3EWKA 3LI8A 4I3JA 1UWPX 5TBMB 1S66L 4KUKA 2WKPA 2D02A 1UGUA 2PD7A 4L9EA 4EQ1A 1DP9A 3GECA 4I3IA 4PKYA 3MJQA 2EA9A 3A0VA 5G4ZA 5AVEA 2PHYA 2V1BA 2PYRA 4DJ3A 2OWHA 4R38A 3ULFA 3K3DA 3IS2B 1OTBA 1DP6A 1Y28A 3IS2A 3VE4A 2ZOHA 3CWFA 4K08A 3LYXA 4XT2A 2VV6A 3NOUC 5DJTA 3ZQ5A 2R78A 3OLOA 3UB9A 2W27A 1OJ5A 1OTEA 3NOTC 5KIZA 3UMEA 3C8CA 4BBVA 2OWJA 4BBTA 3FG8A 2QHKA 3P7NA 4I3AA 2VV7A 3E4OA 4NXFA 1OT6A 3RTYA 4EEUA 1LL8A 3UB7A 4NXGA 1EW0A 2JHEA 3BY8A 2L0WA 3IBRA 4WLAA 3RH8B 5HZHA 2PDRA 1N9LA 3NOPC 2I9VA 3LIFA 1OT9A 1V9ZA 2QJ7A 1JNUA 1P97A 3H7WA 3UE6A 1XFNA 4HY8A 3UMDA 3PHYA 3GDIA 5I5LA 2A24A 3F1PA 3LIDA 1KOUA 3F1OA 5HWWA 1MZUA 5HSQA 1X0OA 4KQDA 4R6LA 5F6AA 5F5YA 2ZBBA 4EESA 3KX0X 4F3LA 3NHQA 4LRXC 1ODVA 3PYPA 5A8BA 4E04A 2QJ5A 2V0UA 4HI4A 2CMNA 5G4YA 5IU1A 1LSWA 1GSVA 3E4QA 3LICA 5HD3A 5HDCA 3UB8A 3CLOA 3LUQA 1N9OA 3MXQA 4RQ9A 4L9GA 5HDSA 4HH3A 1XJ3A 3A0SA
chains in the Genus database with same CATH superfamily
4ME4A 3BFGA 4PPRA 3WS4A 2WKQA 4JKTA 3VOLA 2OAQ1 3HUOA 3EGXC 1T19A 1OTIA 3G6OA 4R70A 3LIEA 1GA0A 5J3WA 1XXMA 4UQIS 3IX4A 2Q0OA 1D7EA 4B88A 1KVMA 2O9CA 1IKIA 3S7QA 4LLOB 2P9VA 2Y2NA 4MDZA 1XPBA 3TE8A 1VEUA 3VSKA 1NZOA 5J8XA 1N4OA 5FEFA 3QHYA 1IYOA 4Y7PA 3BFDA 5TJJA 4UHUA 4O01A 5EVID 1KGEA 2JKFA 3KSIA 2PU2A 4PM7A 3N8RA 1KDSA 3BYDA 4F94A 4JGRA 2O9AA 4LV1A 4EBLA 2RL3A 3CUEA 2XA7S 1UGUA 4WYYA 2V1ZA 3A0VA 2XD1A 3RXWA 1K57C 1G6OA 2ZMVA 2OWJA 3N6IA 1M6KA 3HVFA 4DDSA 4G3KA 2L0WA 4FH2A 4U0TA 5I94A 2PDRA 3NOPC 1YQSA 2X01A 3UE6A 5L09A 4BD0A 3P09A 3JVUA 1L0EA 5CRFA 1DJAA 2WZZA 1DJBA 1CI8A 5A93A 1MPLA 1YMSA 5EOOA 3VMAA 4F3LB 5IS1A 3IF5A 4OQIA 3KO6A 5CTMA 5F68A 3DW0A 4KG6A 1U60A 4M3KA 4H6JB 1KDWA 3QP5A 4OPYA 1PI5A 3ZFZA 4WZ5C 3OPRA 1PZOA 1G68A 5HW3A 4N9KA 5FAOA 2ZC5B 5DJUA 3A3JA 2PR6A 4OOMA 3VOYA 4EETB 3OCLA 2V20A 3T4TA 4S2KA 3HJIA 3LI8A 3KSHA 1FCOA 3LIAA 2Y4AA 3S4XA 4R3JA 1LI0A 2Z6CA 4GLQA 4Q0HA 3CMZA 1DY6A 4X25A 4II7A 2EX2A 1H8MA 1Z6FA 3GMWA 3IHBA 1S4SA 4N1HA 3ZNYA 4JLFA 1IOUA 3C7VA 2Y91A 5DVAA 1FSWA 2J9OA 2XA7M 1XA1A 5HL1A 5FQQA 5HL6A 1AXBA 4RX3A 2Q9NA 5AVEA 2OWHA 5GLDA 2XLNA 5KZHA 2ZQAA 4E6WA 4KZ3A 1HLUP 1J3WA 3DTEA 1GHMA 3NI9A 3F1PA 4MMNA 5HSQA 4DF6A 3BQAA 1SDNA 3UDFA 3UB8A 3TW8A 1PNEA 2PD8A 4DJ2A 3S1YA 3IXHA 5EM0A 4OLGA 4EU0A 3MKFA 2GJ3A 3G30A 2ZD8A 2VGKA 3BY9A 3HLFA 3ITBA 2EXBA 4LCMA 3VP1A 2J7VA 4FSFA 1W8QA 1T1AA 2WYXA 4P0MA 3H7WB 4P6ZS 4QD4A 5DTTA 5CEBA 3IWOA 2ZC4B 2ZM0A 3CZDA 2Y8HA 4PKYG 3UE0A 2JCHA 5FQMA 5F83A 4Q0IA 1JTGA 5M19A 4CLCC 4BQMA 2WKPA 1MWUA 3ZVWA 1KE3A 5G4ZA 1MXOA 5GLCA 4E3LA 4LGWA 2WGWB 4RA7A 3IF6A 1XA7A 2R78A 1NYYA 3NOTC 4CLCB 2XF3A 3CHWP 3E4OA 5BOHA 1JWVA 1JWZA 5EVLA 1P97A 1K25A 2HP5A 4DE2A 3NECA 4EESA 5E2GA 1GA9A 5CHUA 4E04A 2JKRI 1STZA 5JYPA 4QB8A 1K54C 2JKTM 3MXQA 5L2FA 4NG2A 2XROA 2HDQA 3CUEC 4EW7A 3S7OA 2FZ0A 2M7VA 4Y3IA 2HDSA 1K57A 2WGWA 4GD6A 3HCYA 3EEHA 3MFDA 3CPTA 3UPNA 4R0QA 2D01A 3GV9A 3M2JA 4XT2B 3TJZC 4RYEA 4OLDA 1BLHA 4Q0JA 2ZOIA 2YKFA 4IUHA 4BMWA 5CX7A 2VGJA 1PWGA 1BT5A 3CPTB 2L1MA 1N9BA 1P0ZA 3GVBA 3UPOA 3Q82A 5GL9A 1W63M 1W8YA 2W1TA 4ZTKA 4B4XA 3VE3A 3NDEA 3Q1FA 3ZHHA 1J9MA 4GHIA 3W2ZA 3LY3A 4LRZE 3B3XA 1F98A 1FR1A 4XUZA 4KUKA 2BG1A 4MBFA 3ZGAB 2A49A 4WZ5A 4XUXA 3K3DA 1OTBA 4FCFA 4O7DA 5KIZA 4FD8A 4CQHA 3O5YA 1NLZA 4WM9A 1LL8A 5HAQA 5FI6A 2GDNA 3UE1A 4PAUA 5GHZA 3P98A 3T1RA 2ZQ7A 3AGDA 5I5LA 2JKRM 3Q7VB 4Y5FA 4R3BA 3OPPA 4KQRA 3EEAA 1MC0A 4X53A 3A3FA 3NHQA 2BLSA 1E4DA 1Z09A 2ZL1A 3JPUA 5IU1A 2PBYA 3MQ0A 3OOVA 1QMEA 1H5XA 2EWVA 2P7JA 4HNBA 1LHYA 1GSXA 3D4FA 4NK3A 3V5MA 5EFWA 1W79A 1MKIA 4OOYA 4QPRA 3SS5A 4MN5A 3LO7A 1K55A 3F1NB 5FATA 1TS8A 1W5DA 2GX5A 4D60A 5E43A 3HL9A 1ONGA 1XJ2A 4QY6A 3IHAA 1VETA 5E2EA 3BEBA 5GHXA 5HWTA 5FA7A 5U47A 2UWXA 2XK1A 4U3TA 1FCMA 3UNWA 2KDKA 2XFSA 5IHVA 3PXPA 4E3IA 4Q8IA 1PI4A 1EROA 3VP3A 3F1PB 5HX9A 3QP8A 3WS0A 1W7FA 3EOIA 1LSVA 2ZC7A 4PMAA 3H82A 4I5SA 2WAEA 3TG9A 1H8ZA 1WYCA 4ZBEA 4PKYA 4BL3A 2XFTA 1IKGA 1IYQA 4R38A 3ULFA 2WZXA 3FWLA 3NOUC 1OJ5A 5CECA 4OP8A 3OCNA 1BTLA 5A90A 3LY4A 1G5UA 1BULA 4IBRA 3V3RA 3AGEA 1V9ZA 3DWZA 1RCJA 2G7UA 1KOUA 1MZUA 5LBRA 4S2IA 3W8KA 2CMNA 2OV5A 4KZ6A 3LUQA 1N9OA 2QPNA 4ZJ1A 4CPKA 5EOEA 3A0SA 2HP9A 4FUWA 1L2SA 4RX2A 5FQ9A 3CG5A 4EXOA 2VEAA 4S2JA 1N9NA 3MXRA 2J3TC 3SZTA 1UWNX 4GNUA 5CGWA 2XEPA 4YWZA 1LT0A 5AQ7A 3T4JA 3T4QA 1F5MA 4OPQA 2K7SA 4NKPA 3VOZA 3BJNA 3IF6B 4S2PA 5GLBA 3G35A 3A3EA 4ZJ2A 1OTAA 5TGFA 4LCLA 3BFCA 3U2AA 1G6AA 3RJUA 1F2KA 1FR6A 2EXAA 1IYSA 4XXRA 3ICYA 3B33A 2JKGA 2VGLM 1S66L 3E2LA 5DTSA 3ZG5A 1FQGA 1Y28A 3IS2A 3T4SA 3IX3A 1HD8A 3LR3A 4BBTA 4NXFA 4FOFA 5M18A 3UB7A 5CTNA 2NUTC 3DAVA 1K6RA 2C5WB 3MXSA 1CQAA 4HBTA 1FIKA 4HY8A 2W1RA 4R6LA 1NZUA 2ZQDA 2DMWA 3PYPA 3G32A 2XDMA 3N7WA 4RVAA 1XX2A 5HDCA 5CHMA 2ZC3B 5F82A 4DXBA 2VLGA 1FCNA 4WL9A 2M7UA 3C4PA 3D9YA 1DP8A 4IVIA 4OQ0A 3NDGA 1VB6A 4JPMA 5DKKA 2EX8A 3NY4A 5EUAA 4G3WA 3VFHA 5FDSA 3ZG0A 4K0WA 3G4PA 3WS5A 2JC7A 3N4IA 3CJMA 3D72A 4R3AA 3L9KA 2GZAA 3GR2A 1MWSA 4IHQA 4KZ4A 2WKEA 3PBNA 2JN7A 3BRMA 3S7NA 1S1YA 1S67L 3S7PA 4HOIA 3BLSA 3MQOA 4HQAA 2I72A 1ESIA 1D1JA 4PHTA 3D3OA 5M1AA 2EA9A 3PBSA 4S2LA 3IXDA 1NY0A 3BW6A 3CWFA 3HLCA 2VV6A 2B5RA 1YLWA 3OLOA 5KMWA 3T4KA 4I3AA 2ZLYA 2ACGA 4KZ9A 4WLAA 5EECA 1SZVA 4MNRA 5FL3A 3LGOA 2PBDP 3MZEA 1ES4A 1L0FA 5HARA 4Y0OA 4KQDA 1NYMA 4QHCA 5G4YA 1FOFA 3Q07A 2V2FF 3V3SA 2VK3A 2LB9A 2V9AA 3CITA 3B42A 2WGIA 3O87A 2W3EA 1F9IA 1YLZA 4H6JA 3H82B 3CI6A 1GSWA 2FFYA 4JF5A 4B9OA 2E8IA 1PIOA 2QWSA 4ARZA 3SS3A 2R9XA 2EX6A 4WELA 2OLVA 5AQAA 1TD5A 3T1QB 1OJGA 1YAXA 3T4OA 1JTDA 1LL9A 2X02A 4X56A 4GCZA 3M6BA 4HIAA 2KX6A 3AGFA 3HJKA 2HV1A 2P04A 3NIAA 3PAEA 5EVIB 1TS7A 3QP1A 5CERA 4LFUA 3MZDA 2D02A 4X68A 2V1BA 1YLYA 3EGDC 3IS2B 1I2WA 1ZKJA 1H8YA 3QP4A 2ZJ9A 1LLBA 3IH9A 1KGGA 1OT6A 3FPVA 3RTYA 3BY8A 1CJFA 4E3JA 1BZAA 4JXGA 4R23A 3DBAA 3LIFA 2QJ7A 3K2NA 4DE0A 3MKEA 4P6ZM 3UY6A 1IYPA 3PHYA 4WBGA 3WS1A 4ZJ3A 1X0OA 3KX0X 4LRXC 5AJGA 3QNCA 3NCKA 3SH7A 3Q7VA 5J7EA 4X1LA 2OAP1 4IVKA 3FPWA 1TS0A 4KUOA 3ZDJA 4JBFA 3SW1A 3UO9A 3LIBA 5HDDA 3ITAA 3NC8A 1IEMA 2X71A 2JBFA 3FZCA 1Q2PA 2ZM8A 4FH4A 4KENB 1LL5A 4BWIA 1E3UD 1XJ4A 1RGZA 2ZM2A 1PW1A 1Q2QA 4MBHA 2O9BA 2ZQCA 3OC2A 2P08A 4HJ6A 1XJ6A 4O0PA 5A92A 3IXGA 4HBUA 4GDNA 1TDGA 4R4RA 2W3HA 3P01A 1K56D 2V1AA 3EWKA 5FDHA 3SOIA 4BJPA 4EQ1A 2BTFP 3GECA 3TSGA 3ZYTA 3MF0A 5EM1A 2H0TA 2ZMFA 2RCXA 1FILA 3C4OA 3UB9A 5D3OA 3PR6A 4BBVA 3DTKA 2VKSA 3LEQA 2P74A 3HLBA 3I7JA 3ZCZA 3IBJA 3EQVA 1QMFA 1JNUA 2GNXA 3H7WA 1PWCA 1SKOB 4Z9QA 2QMIA 5EVEA 4C75A 4BL2A 3O3VA 4C3QA 3MMHA 5HD3A 5DKLA 1Y54A 1XJ3A 3T4LA 1VQQA 3MFXA 2XRNA 1ERQA 2VJWA 3QNBA 3K3CA 4N9LA 4N1XA 1GHPA 4EWFA 2PYPA 4IEDA 3FYZA 3OPLA 5E2HA 3E98A 3T1SA 1ALQA 4CLCD 4Y0UA 3BQ8A 3OPHA 3MZFA 3A0RA 3FC7A 3DTMA 3Q7ZA 2ZQ8A 1CF0A 3ZG8B 4KZAA 3E4PA 1CK3A 1MBLA 4HEFA 4HP4A 4QY5A 1VEUB 3HREA 5HD5A 4ETXA 5A91A 5EE8A 4UEYA 5FAPA 2EX9A 4PM8A 5GHYA 1T1BA 4R1GA 1YMXA 1YM1A 4S2NC 3MQQA 1AWIA 2VGLS 2W3FA 4HJ4A 4LRYC 5DTKA 4DDYA 5F1FA 4A5RA 4I3IA 5GLAA 4AFIA 3N8SA 3V50A 3M6HA 3VE4A 4DN0A 3LCEA 2B95A 1IELA 3MS6A 4ID4A 4JF6A 3P7NA 3S22A 1S0WA 4OOLA 3IBRA 5C5KA 3VSLA 2DRWA 4WMCD 4WZ4A 1N9LA 3WRTA 4KG5A 1XFNA 1HVBA 3GDIA 2JE5A 3IF6C 1MWTA 4E3KA 4GJ4A 4GDBA 1TVFA 1ZG6A 1PZPA 4N92A 5CGSA 3KYQA 3QP2A 4KZ5A 2JKTI 1YT4A 4KG2A 4NETA 2PR5A 5DFXA 2E8JA 3BECA 3Q81A 5FAQA 1K54A 1ZTUA 3BFEA 5G18A 1WA9A 1K4EA 4EUZA 4DRTA 1EI5A 3MBZA 2Z6DA 1G28A 2Q9MA 3F1NA 2INWA 3HLWA 4PM6A 4GS9B 4B4ZA 4H8RA 4OQHA 3G31A 3NJAA 3DWKA 4E3NA 4I38A 4LENA 1CI9A 2M1CA 2Y2OA 2J80A 2O99A 5KSHA 1NJ4A 4S2MA 4GHIB 4JXVA 5DFYA 1PYYA 3DTIA 1VHMA 2H5SA 5FI2A 1BLPA 2WADA 4YINA 1YKDA 4JXSA 3QP6A 3LYXA 4S2NA 5DJTA 4HESA 4S2OA 1I2SA 5MC7A 2PRFA 2AVXA 3FG8A 4L0LA 3LR5A 3HUNA 4G3VA 4NXGA 5L10A 1DJCA 3PBRA 2J9PA 1OPXA 1H3QA 2A24A 3IX8A 3LIDA 1ONHA 2WKIA 2Y2QA 3C38A 4F3LA 3O88A 3A3IA 4MBKA 1K4FA 4WEKA 1SKOA 3E4QA 2Y2PA 2WGVA 5HDSA 3UDIA 1BUEA 3T12B 2B18A 3RXXA 1KVLA 2IA2A 1MWRA 5FI7A 1LSXA 4B93A 1ES2A 2XR0A 5EVIC 1JWPA 4E3OA 4LV2A 3T1XA 3U4LP 4JGQA 2WKHA 2BASA 4HHDA 2HP6A 1HTZA 3KSGA 2FFFB 4Z1WA 1NLYA 3A3DA 1YLTA 2G2WA 5F5YA 2VX8A 3LI9A 4MCWA 2XQZA 1XFQA 3HLGA 1RGYA 2HPBA 1OTDA 3CAXA 3GQZA 4OPZA 2HZ5A 2Y59A 3C7UA 4HP9A 3VP4A 1PW8A 1BLSA 1CEFA 3MR0A 3VV4A 1D06A 4I3JA 5L8MA 5CGXA 2J8YA 4E3MA 1H0MA 1GHIA 2PAVP 2ZOHA 3FKWA 4NEED 3GRJA 1ZC2A 5HFOA 4MEZA 2QHKA 4P87A 4DMZA 5DF9A 4PM5A 3RH8B 3NULA 2C6WB 5HAPA 3B47A 4GN2A 3M2KA 5FQKA 2EWWA 2W1TB 5HWWA 4X6TA 2W3DA 2QJ5A 3ISGA 2A2LA 4BLMA 4RQ9A 4OVDA 3BM6A 1VETB 2G2UA 4KZBA 4WN5A 2HGVA 3PTEA 4UA7A 1P9WA 1TEMA 4C6YA 3W4OA 1PWDA 4QWOA 4UQIM 5AQ9A 3MSHA 1WYBA 4OP5A 1SCWA 2A3UA 3JYIA 4P85A 4IJGA 3KSFA 5J4EA 4WF0A 3UPPA 4CJNA 1ZHHB 1WE4A 3H9WA 1XP4A 4GW9A 5CHJA 2NUPC 3JVVA 1NRJA 2IWDA 3W4PA 2ZMAA 5HWVA 5AQBA 2K2NA 1XGJA 3E2KA 4Y17A 3R4KA 2OOLA 5FQIA 3V39A 5AVFA 4DE3A 2IWCA 4KQQA 5TBMB 4ZAMA 2P9VB 4OQGA 4YFMA 2Y2LA 3MJQA 4DJ3A 1P9RA 3G2ZA 1FSYA 2Y55A 4K08A 4Y15A 1C3BA 2W27A 3LR4A 3GTCA 2VV7A 2Y79A 1EW0A 3TRCA 4ZDXA 2ZQ9A 1EWZA 3R7WA 1SDEA 2KLIA 4YOFA 3SH9A 2V0UA 4K91A 5KSCA 1JVJA 4HH3A 1HZOA 4GOGA 4DE1A 4Y2FA 1IFQA 3RFBA 2WK0A 2Y2JA 4MN7A 1S1ZA 1SKFA 5FSRA 2WKRA 1T1CA 2Y2GA 1S4RA 4HJ3A 3BFFA 2W0NA 4GKUA 1E25A 1ZG4A 5F1GA 4DKIA 4L9FA 3UB5P 3ZG9B 4NXBA 4NXEA 3IWQA 1ERMA 4UAAA 2V0WA 1YSQA 2LB5A 4K0XA 4LPZA 1NXYA 4ESPA 4EERA 1ACFA 3UN7A 4BBUA 5TR7A 3PAGA 5FASA 1BYWA 4I39A 3ZNTA 4P6BA 1T18A 2HDRA 2H28A 2W3GA 4JGOA 4X55A 4X69A 2WUQA 3C2WA 4JXWA 5EVIA 2UV0E 1TF1A 4ETZA 2HJ9C 1UWPX 4L9EA 1DP9A 4ZRRA 3C30A 4EBPA 1PRQA 3ZQ5A 3WS2A 1OTEA 3C8CA 1ESUA 3PBOA 4CLCA 2QYBA 3IQAA 3TOIA 3HLDA 4LV3A 2CC1A 3LR0A 4ARZB 1W63Q 4R4SA 2Y2IA 2IWBA 2WAFA 2ZBBA 4EUVA 5A8BA 4HI4A 2XD5A 3KYZA 4UA6A 1LSWA 1YPRA 1GSVA 3VFFA 3HUMA 1O07A 1TS6A 1VM1A 1L0GA 2XSSA 1BLCA 1V9YA 3R7WB 2O0YA 1RP5A 3ZG7B 3BLMA 1YLPA 3HLEA 2EFUA 3F1OB 2OLUA 2HF6A 4QJGA 3ZVTA 3UB6A 4MN6A 5IT5A 3OZHA 4OPRA 2QKPA 2YKHA 3UDXA 4JF4A 3PBQA 1I5QA 2Z2LB 4WEJA 3GSGA 4FTXA 3IXBA 4DXCA 2J3TD 2FH5A 2PT7A 2ZC6B 3O86A 1L3LA 2Y2MA 3N8LA 4WMCA 5JYOA 5L07A 4WUJA 4X1MA 4JGPA 1GCEA 1L0DA 2V8FA 2L4RA 2J3WA 1ES3A 3IH8A 2PD7A 2HJEA 5DF7A 3LFVA 4CLCE 2KOIA 4XT2A 3V67A 2VA0A 4GZBA 4UA9A 4OH0A 1SHVA 3W4QA 4EEUA 2EFXA 2JHEA 5DF8A 5CEDA 2H10A 1TDLA 5HZHA 3IWIA 2I9VA 4MLLA 4E6XA 3HBRA 1YLJA 3PBTA 3UMDA 1KE0A 1ES5A 5FQJA 3WWXA 2Y2HA 2PU4A 4YNRA 5F6AA 3NBLA 1E3UA 3SS4A 3L7HA 1M40A 4PM9A 3KYEA 3E0YA 2DCFA 4KZ8A 2XGNA 4GD8A 4L9GA 1XKZA 3LICA 1A0KA 4BENA 3WRZA 4EBNA 5HAIA 4EQIA 3BWLA 4IUKA 3G34A 1KGFA 1XGIA 4M4XA 4HH2A 3T50A 3SH8A 5CXWA 1LI9A 1OMEA 4KZ7A 2Y2KA 2HDUA 3UE3A 1PFLA 1DRMA 1K38A 2A24B 3OBFA 3EQUA 4GS9A 5TBMA 5F69A 4EEPA 2MJ6A 2VV8A 1K55C 3VP0A 3FV7A 1NWZA 2K31A 2V8CA 2XH9A 4U0XA 2B02A 4QU3A 3C5AA 1MY8A 4EV4A 2OSUA 4OONA 5E2FA 1Y4OA 1K0KA 1K56A 1MKMA 2VZWA 1BSGA 2PHYA 2H0YA 2PYRA 1K6SA 1DP6A 4Y13A 1CEGA 3UMEA 1NRFA 1S6RA 2ZL1B 4Y0TA 1YSPA 2R9WA 4BD1A 5HPIA 3G2YA 1O7EA 3IT9A 1KE4A 5HPFA 1OT9A 2DNSA 4D2OA 4IBXA 3F1OA 4O8GA 4OKPA 4LV0A 5EV0A 5FEGA 5K5BA 1ODVA 3LEZA 3VP2A 2Z2MB 3FKVA 4GB7A 5EPHA 3CLOA 4KQOA 2QZ6A 5TFQA
chains in the Genus database with same CATH topology
2EWVA 4ME4A 2P7JA 4HNBA 2WKQA 4WN5A 3VOLA 2HGVA 5J7EA 1P9WA 1GSXA 2OAQ1 2OAP1 3EGXC 4UQIM 1T19A 1OTIA 3G6OA 4R70A 3LIEA 3FPWA 5J3WA 1TS0A 4UQIS 5EFWA 4KUOA 3SW1A 1D7EA 4QPRA 4MN5A 3LIBA 2O9CA 5HDDA 3S7QA 4LLOB 3F1NB 1TS8A 2GX5A 4MDZA 4IJGA 3KSFA 3TE8A 5J4EA 1XJ2A 4WF0A 1ZHHB 3H9WA 5HWTA 4GW9A 5TJJA 2NUPC 4BWIA 3JVVA 2KDKA 1NRJA 4O01A 3PXPA 3KSIA 5HWVA 1XJ4A 3F1PB 2O9BA 3OC2A 2K2NA 2P08A 4HJ6A 1XJ6A 4O0PA 3EOIA 1LSVA 3R4KA 3H82A 4JGRA 2OOLA 2O9AA 2W3HA 3P01A 4I5SA 5AVFA 2V1AA 3EWKA 5TBMB 4BJPA 3CUEA 2XA7S 1UGUA 4EQ1A 3GECA 4PKYA 3MJQA 3A0VA 3ZYTA 3MF0A 4DJ3A 1P9RA 4R38A 3ULFA 2ZMFA 4K08A 3NOUC 3UB9A 1G6OA 1OJ5A 2W27A 2ZMVA 3PR6A 3LR4A 3OCNA 2OWJA 4BBVA 2VV7A 2Y79A 2VKSA 4G3KA 1EW0A 2L0WA 3TRCA 3IBJA 3EQVA 2PDRA 3NOPC 3R7WA 1V9ZA 1JNUA 2GNXA 3H7WA 3UE6A 2KLIA 2G7UA 1KOUA 3JVUA 1MZUA 5LBRA 4YOFA 3MMHA 2V0UA 2CMNA 5HD3A 3LUQA 1N9OA 5DKLA 4HH3A 1XJ3A 3A0SA 3T4LA 4Y2FA 1IFQA 3MFXA 3RFBA 4F3LB 2XRNA 5IS1A 4MN7A 2VJWA 4EXOA 1S1ZA 2VEAA 1N9NA 3KO6A 3K3CA 5F68A 2WKRA 1T1CA 1S4RA 4HJ3A 2J3TC 4H6JB 2PYPA 2W0NA 1UWNX 3E98A 4YWZA 4CLCD 1LT0A 3T4JA 3T4QA 1F5MA 4L9FA 5DJUA 3BQ8A 2K7SA 2PR6A 4NKPA 4NXEA 4NXBA 4OOMA 3OCLA 4EETB 3T4TA 3HJIA 3A0RA 3LI8A 3KSHA 2V0WA 1YSQA 3FC7A 2LB5A 3BJNA 3LIAA 4LPZA 3E4PA 4EERA 4BBUA 4HP4A 2Z6CA 1OTAA 1BYWA 5HD5A 4I39A 4GLQA 4Q0HA 4ETXA 3U2AA 1T18A 4UEYA 4II7A 1H8MA 1T1BA 2H28A 1S4SA 2W3GA 4JGOA 3C2WA 1IOUA 3MQQA 3ICYA 2VGLS 1TF1A 3B33A 2W3FA 4HJ4A 2HJ9C 2XA7M 2VGLM 4LRYC 4ETZA 1UWPX 1S66L 4L9EA 1DP9A 5HL6A 4I3IA 4AFIA 5AVEA 4ZRRA 3C30A 2OWHA 1Y28A 3IS2A 3T4SA 3VE4A 4DN0A 3ZQ5A 1OTEA 3LR3A 3C8CA 3PBOA 4CLCA 4BBTA 3P7NA 2QYBA 4NXFA 4FOFA 4OOLA 3UB7A 2NUTC 3IBRA 5C5KA 1N9LA 3LR0A 4ARZB 1W63Q 1XFNA 2W1RA 4HY8A 3GDIA 3F1PA 4MMNA 5HSQA 4R6LA 2ZBBA 2DMWA 4EUVA 5A8BA 3PYPA 4HI4A 3BQAA 3KYZA 1LSWA 1GSVA 3UB8A 5HDCA 4GJ4A 3TW8A 2PD8A 2VLGA 4DJ2A 1TS6A 3KYQA 4WL9A 2M7UA 2XSSA 2JKTI 4EU0A 1DP8A 1V9YA 3R7WB 2O0YA 1VB6A 2GJ3A 5DKKA 2PR5A 3BY9A 4G3WA 5DFXA 3F1OB 1ZTUA 1WA9A 2HF6A 4FSFA 3D72A 1T1AA 4R3AA 4MN6A 3UB6A 5IT5A 2GZAA 2QKPA 2YKHA 4IHQA 3H7WB 2Z6DA 1G28A 4P6ZS 3F1NA 3PBQA 3PBNA 2INWA 4GS9B 4WEJA 2JN7A 3S7NA 3NJAA 1S1YA 4I38A 2J3TD 2Y8HA 2FH5A 2M1CA 2PT7A 1S67L 4PKYG 3S7PA 2J80A 4HOIA 2O99A 4WUJA 3MQOA 5KSHA 4JGPA 4Q0IA 4HQAA 4GHIB 4CLCC 5DFYA 2L4RA 2J3WA 2WKPA 1VHMA 2PD7A 4PHTA 2HJEA 3LFVA 3D3OA 4CLCE 2EA9A 3PBSA 5G4ZA 1YKDA 3BW6A 3CWFA 2KOIA 3LYXA 4XT2A 2VV6A 3V67A 5DJTA 2VA0A 2R78A 3OLOA 5MC7A 3NOTC 4CLCB 3FG8A 4L0LA 3T4KA 3LR5A 4I3AA 3E4OA 4EEUA 4G3VA 4NXGA 2JHEA 4WLAA 5HZHA 5FL3A 3PBRA 2I9VA 1OPXA 1P97A 3PBTA 3UMDA 1H3QA 2A24A 3LIDA 4YNRA 5F6AA 4KQDA 3C38A 4EESA 4F3LA 4E04A 5G4YA 2JKRI 1STZA 3E0YA 4WEKA 3E4QA 2JKTM 3MXQA 5HDSA 4L9GA 3LICA 2LB9A 2XROA 2B18A 2V9AA 3CUEC 3CITA 4EW7A 3S7OA 3B42A 2IA2A 2FZ0A 1LSXA 2M7VA 4B93A 4Y3IA 3BWLA 2W3EA 1F9IA 4IUKA 4H6JA 4JGQA 3H82B 3CI6A 2BASA 4M4XA 1GSWA 3HCYA 3EEHA 4HH2A 3T50A 4B9OA 2QWSA 4ARZA 2D01A 4HHDA 4XT2B 3KSGA 3TJZC 4Q0JA 4Z1WA 2ZOIA 2YKFA 4WELA 1NLYA 4IUHA 4BMWA 1TD5A 5F5YA 3UE3A 2A24B 1DRMA 3OBFA 2VX8A 1OJGA 5CX7A 1YAXA 3T4OA 3EQUA 4GS9A 3LI9A 4MCWA 1XFQA 5TBMA 4GCZA 5F69A 2MJ6A 4EEPA 2L1MA 2VV8A 1P0ZA 4HIAA 2KX6A 1NWZA 2K31A 1W63M 2W1TA 1OTDA 3CAXA 3VE3A 3HJKA 2HV1A 2P04A 2B02A 4HP9A 4GHIA 3W2ZA 3MR0A 1TS7A 4LRZE 3VV4A 1F98A 1D06A 4I3JA 5L8MA 4KUKA 2D02A 1MKMA 2VZWA 2PHYA 2V1BA 2PYRA 3K3DA 3EGDC 3IS2B 1OTBA 1DP6A 2ZOHA 4NEED 5KIZA 3UMEA 4CQHA 2QHKA 3O5YA 4DMZA 1NLZA 1OT6A 3FPVA 3RTYA 1LL8A 1YSPA 5DF9A 3BY8A 5HPIA 3RH8B 3DBAA 4PAUA 5HPFA 3LIFA 1OT9A 2QJ7A 3K2NA 4P6ZM 3B47A 3PHYA 2JKRM 5I5LA 2EWWA 2W1TB 4Y5FA 5HWWA 3F1OA 1X0OA 4O8GA 3EEAA 1MC0A 5K5BA 3KX0X 3NHQA 4LRXC 1ODVA 2W3DA 5AJGA 2QJ5A 5IU1A 3MQ0A 2A2LA 3CLOA 4KQOA 4RQ9A 3OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  2VLG A;  4DJ2 A;  3MFX A;  2V9A A;  4F3L B;  4EW7 A;  5IS1 A;  2P7J A;  4HNB A;  1TS6 A;  2WKQ A;  4WN5 A;  4WL9 A;  3VOL A;  4EXO A;  1LSX A;  1S1Z A;  5J7E A;  2VEA A;  1GSX A;  1N9N A;  1DP8 A;  1V9Y A;  3K3C A;  5F68 A;  1VB6 A;  1T1C A;  2GJ3 A;  2WKR A;  3BWL A;  5DKK A;  1T19 A;  1OTI A;  3G6O A;  1F9I A;  3LIE A;  1S4R A;  4R70 A;  2PR5 A;  3BY9 A;  5J3W A;  1TS0 A;  5EFW A;  4HJ3 A;  3F1O B;  4H6J A;  4JGQ A;  3H82 B;  4KUO A;  2BAS A;  2PYP A;  1GSW A;  2W0N A;  4H6J B;  3EEH A;  4HH2 A;  1D7E A;  4M4X A;  3T50 A;  4B9O A;  1UWN X;  4MN5 A;  3SW1 A;  1WA9 A;  3LIB A;  5HDD A;  2QWS A;  5DKL A;  4LLO B;  2D01 A;  4HHD A;  4YWZ A;  3F1N B;  1LT0 A;  1TS8 A;  4XT2 B;  3D72 A;  1T1A A;  4R3A A;  4MN6 A;  4L9F A;  5DJU A;  3UB6 A;  5J4E A;  2ZOI A;  1XJ2 A;  2YKF A;  2K7S A;  2PR6 A;  4NXE A;  4NXB A;  4WF0 A;  4EET B;  2QKP A;  2YKH A;  3HJI A;  3A0R A;  2Z6D A;  1G28 A;  3H7W B;  2V0W A;  3H9W A;  2A24 B;  1DRM A;  3F1N A;  3FC7 A;  1OJG A;  3LIA A;  4LPZ A;  2INW A;  5HWT A;  4GW9 A;  4GS9 A;  3E4P A;  3LI9 A;  4GS9 B;  4EER A;  4BBU A;  1XFQ A;  4HP4 A;  2JN7 A;  2Z6C A;  5TBM A;  1OTA A;  2KDK A;  4GCZ A;  5F69 A;  4EEP A;  2L1M A;  2VV8 A;  1BYW A;  1P0Z A;  5HD5 A;  3NJA A;  4I39 A;  4HIA A;  5HWV A;  2KX6 A;  1XJ4 A;  3F1P B;  1NWZ A;  1S1Y A;  1T18 A;  1OTD A;  3CAX A;  4I38 A;  3HJK A;  3VE3 A;  2M1C A;  1S67 L;  2HV1 A;  1T1B A;  4PKY G;  2J80 A;  4HJ6 A;  4HOI A;  1XJ6 A;  2H28 A;  1S4S A;  2B02 A;  4JGO A;  1LSV A;  4WUJ A;  3MQO A;  3H82 A;  4JGP A;  3C2W A;  2OOL A;  4GHI A;  4HP9 A;  4HQA A;  4GHI B;  4JGR A;  3MQQ A;  3MR0 A;  1TS7 A;  4LRZ E;  3ICY A;  3B33 A;  1F98 A;  4I5S A;  5AVF A;  4HJ4 A;  4LRY C;  1D06 A;  2L4R A;  2V1A A;  3EWK A;  3LI8 A;  4I3J A;  1UWP X;  5TBM B;  1S66 L;  4KUK A;  2WKP A;  2D02 A;  1UGU A;  2PD7 A;  4L9E A;  4EQ1 A;  1DP9 A;  3GEC A;  4I3I A;  4PKY A;  3MJQ A;  2EA9 A;  3A0V A;  5G4Z A;  5AVE A;  2PHY A;  2V1B A;  2PYR A;  4DJ3 A;  2OWH A;  4R38 A;  3ULF A;  3K3D A;  3IS2 B;  1OTB A;  1DP6 A;  1Y28 A;  3IS2 A;  3VE4 A;  2ZOH A;  3CWF A;  4K08 A;  3LYX A;  4XT2 A;  2VV6 A;  3NOU C;  5DJT A;  3ZQ5 A;  2R78 A;  3OLO A;  3UB9 A;  2W27 A;  1OJ5 A;  1OTE A;  3NOT C;  5KIZ A;  3UME A;  3C8C A;  4BBV A;  2OWJ A;  4BBT A;  3FG8 A;  2QHK A;  3P7N A;  4I3A A;  2VV7 A;  3E4O A;  4NXF A;  1OT6 A;  3RTY A;  4EEU A;  1LL8 A;  3UB7 A;  4NXG A;  1EW0 A;  2JHE A;  3BY8 A;  2L0W A;  3IBR A;  4WLA A;  3RH8 B;  5HZH A;  2PDR A;  1N9L A;  3NOP C;  2I9V A;  3LIF A;  1OT9 A;  1V9Z A;  2QJ7 A;  1JNU A;  1P97 A;  3H7W A;  3UE6 A;  1XFN A;  4HY8 A;  3UMD A;  3PHY A;  3GDI A;  5I5L A;  2A24 A;  3F1P A;  3LID A;  1KOU A;  3F1O A;  5HWW A;  1MZU A;  5HSQ A;  1X0O A;  4KQD A;  4R6L A;  5F6A A;  5F5Y A;  2ZBB A;  4EES A;  3KX0 X;  4F3L A;  3NHQ A;  4LRX C;  1ODV A;  3PYP A;  5A8B A;  4E04 A;  2QJ5 A;  2V0U A;  4HI4 A;  2CMN A;  5G4Y A;  5IU1 A;  1LSW A;  1GSV A;  3E4Q A;  3LIC A;  5HD3 A;  5HDC A;  3UB8 A;  3CLO A;  3LUQ A;  1N9O A;  3MXQ A;  4RQ9 A;  4L9G A;  5HDS A;  4HH3 A;  1XJ3 A;  3A0S A; 
#chains in the Genus database with same CATH topology
 4ME4 A;  3BFG A;  4PPR A;  3WS4 A;  2WKQ A;  4JKT A;  3VOL A;  2OAQ 1;  3HUO A;  3EGX C;  1T19 A;  1OTI A;  3G6O A;  4R70 A;  3LIE A;  1GA0 A;  5J3W A;  1XXM A;  4UQI S;  3IX4 A;  2Q0O A;  1D7E A;  4B88 A;  1KVM A;  2O9C A;  1IKI A;  3S7Q A;  4LLO B;  2P9V A;  2Y2N A;  4MDZ A;  1XPB A;  3TE8 A;  1VEU A;  3VSK A;  1NZO A;  5J8X A;  1N4O A;  5FEF A;  3QHY A;  1IYO A;  4Y7P A;  3BFD A;  5TJJ A;  4UHU A;  4O01 A;  5EVI D;  1KGE A;  2JKF A;  3KSI A;  2PU2 A;  4PM7 A;  3N8R A;  1KDS A;  3BYD A;  4F94 A;  4JGR A;  2O9A A;  4LV1 A;  4EBL A;  2RL3 A;  3CUE A;  2XA7 S;  1UGU A;  4WYY A;  2V1Z A;  3A0V A;  2XD1 A;  3RXW A;  1K57 C;  1G6O A;  2ZMV A;  2OWJ A;  3N6I A;  1M6K A;  3HVF A;  4DDS A;  4G3K A;  2L0W A;  4FH2 A;  4U0T A;  5I94 A;  2PDR A;  3NOP C;  1YQS A;  2X01 A;  3UE6 A;  5L09 A;  4BD0 A;  3P09 A;  3JVU A;  1L0E A;  5CRF A;  1DJA A;  2WZZ A;  1DJB A;  1CI8 A;  5A93 A;  1MPL A;  1YMS A;  5EOO A;  3VMA A;  4F3L B;  5IS1 A;  3IF5 A;  4OQI A;  3KO6 A;  5CTM A;  5F68 A;  3DW0 A;  4KG6 A;  1U60 A;  4M3K A;  4H6J B;  1KDW A;  3QP5 A;  4OPY A;  1PI5 A;  3ZFZ A;  4WZ5 C;  3OPR A;  1PZO A;  1G68 A;  5HW3 A;  4N9K A;  5FAO A;  2ZC5 B;  5DJU A;  3A3J A;  2PR6 A;  4OOM A;  3VOY A;  4EET B;  3OCL A;  2V20 A;  3T4T A;  4S2K A;  3HJI A;  3LI8 A;  3KSH A;  1FCO A;  3LIA A;  2Y4A A;  3S4X A;  4R3J A;  1LI0 A;  2Z6C A;  4GLQ A;  4Q0H A;  3CMZ A;  1DY6 A;  4X25 A;  4II7 A;  2EX2 A;  1H8M A;  1Z6F A;  3GMW A;  3IHB A;  1S4S A;  4N1H A;  3ZNY A;  4JLF A;  1IOU A;  3C7V A;  2Y91 A;  5DVA A;  1FSW A;  2J9O A;  2XA7 M;  1XA1 A;  5HL1 A;  5FQQ A;  5HL6 A;  1AXB A;  4RX3 A;  2Q9N A;  5AVE A;  2OWH A;  5GLD A;  2XLN A;  5KZH A;  2ZQA A;  4E6W A;  4KZ3 A;  1HLU P;  1J3W A;  3DTE A;  1GHM A;  3NI9 A;  3F1P A;  4MMN A;  5HSQ A;  4DF6 A;  3BQA A;  1SDN A;  3UDF A;  3UB8 A;  3TW8 A;  1PNE A;  2PD8 A;  4DJ2 A;  3S1Y A;  3IXH A;  5EM0 A;  4OLG A;  4EU0 A;  3MKF A;  2GJ3 A;  3G30 A;  2ZD8 A;  2VGK A;  3BY9 A;  3HLF A;  3ITB A;  2EXB A;  4LCM A;  3VP1 A;  2J7V A;  4FSF A;  1W8Q A;  1T1A A;  2WYX A;  4P0M A;  3H7W B;  4P6Z S;  4QD4 A;  5DTT A;  5CEB A;  3IWO A;  2ZC4 B;  2ZM0 A;  3CZD A;  2Y8H A;  4PKY G;  3UE0 A;  2JCH A;  5FQM A;  5F83 A;  4Q0I A;  1JTG A;  5M19 A;  4CLC C;  4BQM A;  2WKP A;  1MWU A;  3ZVW A;  1KE3 A;  5G4Z A;  1MXO A;  5GLC A;  4E3L A;  4LGW A;  2WGW B;  4RA7 A;  3IF6 A;  1XA7 A;  2R78 A;  1NYY A;  3NOT C;  4CLC B;  2XF3 A;  3CHW P;  3E4O A;  5BOH A;  1JWV A;  1JWZ A;  5EVL A;  1P97 A;  1K25 A;  2HP5 A;  4DE2 A;  3NEC A;  4EES A;  5E2G A;  1GA9 A;  5CHU A;  4E04 A;  2JKR I;  1STZ A;  5JYP A;  4QB8 A;  1K54 C;  2JKT M;  3MXQ A;  5L2F A;  4NG2 A;  2XRO A;  2HDQ A;  3CUE C;  4EW7 A;  3S7O A;  2FZ0 A;  2M7V A;  4Y3I A;  2HDS A;  1K57 A;  2WGW A;  4GD6 A;  3HCY A;  3EEH A;  3MFD A;  3CPT A;  3UPN A;  4R0Q A;  2D01 A;  3GV9 A;  3M2J A;  4XT2 B;  3TJZ C;  4RYE A;  4OLD A;  1BLH A;  4Q0J A;  2ZOI A;  2YKF A;  4IUH A;  4BMW A;  5CX7 A;  2VGJ A;  1PWG A;  1BT5 A;  3CPT B;  2L1M A;  1N9B A;  1P0Z A;  3GVB A;  3UPO A;  3Q82 A;  5GL9 A;  1W63 M;  1W8Y A;  2W1T A;  4ZTK A;  4B4X A;  3VE3 A;  3NDE A;  3Q1F A;  3ZHH A;  1J9M A;  4GHI A;  3W2Z A;  3LY3 A;  4LRZ E;  3B3X A;  1F98 A;  1FR1 A;  4XUZ A;  4KUK A;  2BG1 A;  4MBF A;  3ZGA B;  2A49 A;  4WZ5 A;  4XUX A;  3K3D A;  1OTB A;  4FCF A;  4O7D A;  5KIZ A;  4FD8 A;  4CQH A;  3O5Y A;  1NLZ A;  4WM9 A;  1LL8 A;  5HAQ A;  5FI6 A;  2GDN A;  3UE1 A;  4PAU A;  5GHZ A;  3P98 A;  3T1R A;  2ZQ7 A;  3AGD A;  5I5L A;  2JKR M;  3Q7V B;  4Y5F A;  4R3B A;  3OPP A;  4KQR A;  3EEA A;  1MC0 A;  4X53 A;  3A3F A;  3NHQ A;  2BLS A;  1E4D A;  1Z09 A;  2ZL1 A;  3JPU A;  5IU1 A;  2PBY A;  3MQ0 A;  3OOV A;  1QME A;  1H5X A;  2EWV A;  2P7J A;  4HNB A;  1LHY A;  1GSX A;  3D4F A;  4NK3 A;  3V5M A;  5EFW A;  1W79 A;  1MKI A;  4OOY A;  4QPR A;  3SS5 A;  4MN5 A;  3LO7 A;  1K55 A;  3F1N B;  5FAT A;  1TS8 A;  1W5D A;  2GX5 A;  4D60 A;  5E43 A;  3HL9 A;  1ONG A;  1XJ2 A;  4QY6 A;  3IHA A;  1VET A;  5E2E A;  3BEB A;  5GHX A;  5HWT A;  5FA7 A;  5U47 A;  2UWX A;  2XK1 A;  4U3T A;  1FCM A;  3UNW A;  2KDK A;  2XFS A;  5IHV A;  3PXP A;  4E3I A;  4Q8I A;  1PI4 A;  1ERO A;  3VP3 A;  3F1P B;  5HX9 A;  3QP8 A;  3WS0 A;  1W7F A;  3EOI A;  1LSV A;  2ZC7 A;  4PMA A;  3H82 A;  4I5S A;  2WAE A;  3TG9 A;  1H8Z A;  1WYC A;  4ZBE A;  4PKY A;  4BL3 A;  2XFT A;  1IKG A;  1IYQ A;  4R38 A;  3ULF A;  2WZX A;  3FWL A;  3NOU C;  1OJ5 A;  5CEC A;  4OP8 A;  3OCN A;  1BTL A;  5A90 A;  3LY4 A;  1G5U A;  1BUL A;  4IBR A;  3V3R A;  3AGE A;  1V9Z A;  3DWZ A;  1RCJ A;  2G7U A;  1KOU A;  1MZU A;  5LBR A;  4S2I A;  3W8K A;  2CMN A;  2OV5 A;  4KZ6 A;  3LUQ A;  1N9O A;  2QPN A;  4ZJ1 A;  4CPK A;  5EOE A;  3A0S A;  2HP9 A;  4FUW A;  1L2S A;  4RX2 A;  5FQ9 A;  3CG5 A;  4EXO A;  2VEA A;  4S2J A;  1N9N A;  3MXR A;  2J3T C;  3SZT A;  1UWN X;  4GNU A;  5CGW A;  2XEP A;  4YWZ A;  1LT0 A;  5AQ7 A;  3T4J A;  3T4Q A;  1F5M A;  4OPQ A;  2K7S A;  4NKP A;  3VOZ A;  3BJN A;  3IF6 B;  4S2P A;  5GLB A;  3G35 A;  3A3E A;  4ZJ2 A;  1OTA A;  5TGF A;  4LCL A;  3BFC A;  3U2A A;  1G6A A;  3RJU A;  1F2K A;  1FR6 A;  2EXA A;  1IYS A;  4XXR A;  3ICY A;  3B33 A;  2JKG A;  2VGL M;  1S66 L;  3E2L A;  5DTS A;  3ZG5 A;  1FQG A;  1Y28 A;  3IS2 A;  3T4S A;  3IX3 A;  1HD8 A;  3LR3 A;  4BBT A;  4NXF A;  4FOF A;  5M18 A;  3UB7 A;  5CTN A;  2NUT C;  3DAV A;  1K6R A;  2C5W B;  3MXS A;  1CQA A;  4HBT A;  1FIK A;  4HY8 A;  2W1R A;  4R6L A;  1NZU A;  2ZQD A;  2DMW A;  3PYP A;  3G32 A;  2XDM A;  3N7W A;  4RVA A;  1XX2 A;  5HDC A;  5CHM A;  2ZC3 B;  5F82 A;  4DXB A;  2VLG A;  1FCN A;  4WL9 A;  2M7U A;  3C4P A;  3D9Y A;  1DP8 A;  4IVI A;  4OQ0 A;  3NDG A;  1VB6 A;  4JPM A;  5DKK A;  2EX8 A;  3NY4 A;  5EUA A;  4G3W A;  3VFH A;  5FDS A;  3ZG0 A;  4K0W A;  3G4P A;  3WS5 A;  2JC7 A;  3N4I A;  3CJM A;  3D72 A;  4R3A A;  3L9K A;  2GZA A;  3GR2 A;  1MWS A;  4IHQ A;  4KZ4 A;  2WKE A;  3PBN A;  2JN7 A;  3BRM A;  3S7N A;  1S1Y A;  1S67 L;  3S7P A;  4HOI A;  3BLS A;  3MQO A;  4HQA A;  2I72 A;  1ESI A;  1D1J A;  4PHT A;  3D3O A;  5M1A A;  2EA9 A;  3PBS A;  4S2L A;  3IXD A;  1NY0 A;  3BW6 A;  3CWF A;  3HLC A;  2VV6 A;  2B5R A;  1YLW A;  3OLO A;  5KMW A;  3T4K A;  4I3A A;  2ZLY A;  2ACG A;  4KZ9 A;  4WLA A;  5EEC A;  1SZV A;  4MNR A;  5FL3 A;  3LGO A;  2PBD P;  3MZE A;  1ES4 A;  1L0F A;  5HAR A;  4Y0O A;  4KQD A;  1NYM A;  4QHC A;  5G4Y A;  1FOF A;  3Q07 A;  2V2F F;  3V3S A;  2VK3 A;  2LB9 A;  2V9A A;  3CIT A;  3B42 A;  2WGI A;  3O87 A;  2W3E A;  1F9I A;  1YLZ A;  4H6J A;  3H82 B;  3CI6 A;  1GSW A;  2FFY A;  4JF5 A;  4B9O A;  2E8I A;  1PIO A;  2QWS A;  4ARZ A;  3SS3 A;  2R9X A;  2EX6 A;  4WEL A;  2OLV A;  5AQA A;  1TD5 A;  3T1Q B;  1OJG A;  1YAX A;  3T4O A;  1JTD A;  1LL9 A;  2X02 A;  4X56 A;  4GCZ A;  3M6B A;  4HIA A;  2KX6 A;  3AGF A;  3HJK A;  2HV1 A;  2P04 A;  3NIA A;  3PAE A;  5EVI B;  1TS7 A;  3QP1 A;  5CER A;  4LFU A;  3MZD A;  2D02 A;  4X68 A;  2V1B A;  1YLY A;  3EGD C;  3IS2 B;  1I2W A;  1ZKJ A;  1H8Y A;  3QP4 A;  2ZJ9 A;  1LLB A;  3IH9 A;  1KGG A;  1OT6 A;  3FPV A;  3RTY A;  3BY8 A;  1CJF A;  4E3J A;  1BZA A;  4JXG A;  4R23 A;  3DBA A;  3LIF A;  2QJ7 A;  3K2N A;  4DE0 A;  3MKE A;  4P6Z M;  3UY6 A;  1IYP A;  3PHY A;  4WBG A;  3WS1 A;  4ZJ3 A;  1X0O A;  3KX0 X;  4LRX C;  5AJG A;  3QNC A;  3NCK A;  3SH7 A;  3Q7V A;  5J7E A;  4X1L A;  2OAP 1;  4IVK A;  3FPW A;  1TS0 A;  4KUO A;  3ZDJ A;  4JBF A;  3SW1 A;  3UO9 A;  3LIB A;  5HDD A;  3ITA A;  3NC8 A;  1IEM A;  2X71 A;  2JBF A;  3FZC A;  1Q2P A;  2ZM8 A;  4FH4 A;  4KEN B;  1LL5 A;  4BWI A;  1E3U D;  1XJ4 A;  1RGZ A;  2ZM2 A;  1PW1 A;  1Q2Q A;  4MBH A;  2O9B A;  2ZQC A;  3OC2 A;  2P08 A;  4HJ6 A;  1XJ6 A;  4O0P A;  5A92 A;  3IXG A;  4HBU A;  4GDN A;  1TDG A;  4R4R A;  2W3H A;  3P01 A;  1K56 D;  2V1A A;  3EWK A;  5FDH A;  3SOI A;  4BJP A;  4EQ1 A;  2BTF P;  3GEC A;  3TSG A;  3ZYT A;  3MF0 A;  5EM1 A;  2H0T A;  2ZMF A;  2RCX A;  1FIL A;  3C4O A;  3UB9 A;  5D3O A;  3PR6 A;  4BBV A;  3DTK A;  2VKS A;  3LEQ A;  2P74 A;  3HLB A;  3I7J A;  3ZCZ A;  3IBJ A;  3EQV A;  1QMF A;  1JNU A;  2GNX A;  3H7W A;  1PWC A;  1SKO B;  4Z9Q A;  2QMI A;  5EVE A;  4C75 A;  4BL2 A;  3O3V A;  4C3Q A;  3MMH A;  5HD3 A;  5DKL A;  1Y54 A;  1XJ3 A;  3T4L A;  1VQQ A;  3MFX A;  2XRN A;  1ERQ A;  2VJW A;  3QNB A;  3K3C A;  4N9L A;  4N1X A;  1GHP A;  4EWF A;  2PYP A;  4IED A;  3FYZ A;  3OPL A;  5E2H A;  3E98 A;  3T1S A;  1ALQ A;  4CLC D;  4Y0U A;  3BQ8 A;  3OPH A;  3MZF A;  3A0R A;  3FC7 A;  3DTM A;  3Q7Z A;  2ZQ8 A;  1CF0 A;  3ZG8 B;  4KZA A;  3E4P A;  1CK3 A;  1MBL A;  4HEF A;  4HP4 A;  4QY5 A;  1VEU B;  3HRE A;  5HD5 A;  4ETX A;  5A91 A;  5EE8 A;  4UEY A;  5FAP A;  2EX9 A;  4PM8 A;  5GHY A;  1T1B A;  4R1G A;  1YMX A;  1YM1 A;  4S2N C;  3MQQ A;  1AWI A;  2VGL S;  2W3F A;  4HJ4 A;  4LRY C;  5DTK A;  4DDY A;  5F1F A;  4A5R A;  4I3I A;  5GLA A;  4AFI A;  3N8S A;  3V50 A;  3M6H A;  3VE4 A;  4DN0 A;  3LCE A;  2B95 A;  1IEL A;  3MS6 A;  4ID4 A;  4JF6 A;  3P7N A;  3S22 A;  1S0W A;  4OOL A;  3IBR A;  5C5K A;  3VSL A;  2DRW A;  4WMC D;  4WZ4 A;  1N9L A;  3WRT A;  4KG5 A;  1XFN A;  1HVB A;  3GDI A;  2JE5 A;  3IF6 C;  1MWT A;  4E3K A;  4GJ4 A;  4GDB A;  1TVF A;  1ZG6 A;  1PZP A;  4N92 A;  5CGS A;  3KYQ A;  3QP2 A;  4KZ5 A;  2JKT I;  1YT4 A;  4KG2 A;  4NET A;  2PR5 A;  5DFX A;  2E8J A;  3BEC A;  3Q81 A;  5FAQ A;  1K54 A;  1ZTU A;  3BFE A;  5G18 A;  1WA9 A;  1K4E A;  4EUZ A;  4DRT A;  1EI5 A;  3MBZ A;  2Z6D A;  1G28 A;  2Q9M A;  3F1N A;  2INW A;  3HLW A;  4PM6 A;  4GS9 B;  4B4Z A;  4H8R A;  4OQH A;  3G31 A;  3NJA A;  3DWK A;  4E3N A;  4I38 A;  4LEN A;  1CI9 A;  2M1C A;  2Y2O A;  2J80 A;  2O99 A;  5KSH A;  1NJ4 A;  4S2M A;  4GHI B;  4JXV A;  5DFY A;  1PYY A;  3DTI A;  1VHM A;  2H5S A;  5FI2 A;  1BLP A;  2WAD A;  4YIN A;  1YKD A;  4JXS A;  3QP6 A;  3LYX A;  4S2N A;  5DJT A;  4HES A;  4S2O A;  1I2S A;  5MC7 A;  2PRF A;  2AVX A;  3FG8 A;  4L0L A;  3LR5 A;  3HUN A;  4G3V A;  4NXG A;  5L10 A;  1DJC A;  3PBR A;  2J9P A;  1OPX A;  1H3Q A;  2A24 A;  3IX8 A;  3LID A;  1ONH A;  2WKI A;  2Y2Q A;  3C38 A;  4F3L A;  3O88 A;  3A3I A;  4MBK A;  1K4F A;  4WEK A;  1SKO A;  3E4Q A;  2Y2P A;  2WGV A;  5HDS A;  3UDI A;  1BUE A;  3T12 B;  2B18 A;  3RXX A;  1KVL A;  2IA2 A;  1MWR A;  5FI7 A;  1LSX A;  4B93 A;  1ES2 A;  2XR0 A;  5EVI C;  1JWP A;  4E3O A;  4LV2 A;  3T1X A;  3U4L P;  4JGQ A;  2WKH A;  2BAS A;  4HHD A;  2HP6 A;  1HTZ A;  3KSG A;  2FFF B;  4Z1W A;  1NLY A;  3A3D A;  1YLT A;  2G2W A;  5F5Y A;  2VX8 A;  3LI9 A;  4MCW A;  2XQZ A;  1XFQ A;  3HLG A;  1RGY A;  2HPB A;  1OTD A;  3CAX A;  3GQZ A;  4OPZ A;  2HZ5 A;  2Y59 A;  3C7U A;  4HP9 A;  3VP4 A;  1PW8 A;  1BLS A;  1CEF A;  3MR0 A;  3VV4 A;  1D06 A;  4I3J A;  5L8M A;  5CGX A;  2J8Y A;  4E3M A;  1H0M A;  1GHI A;  2PAV P;  2ZOH A;  3FKW A;  4NEE D;  3GRJ A;  1ZC2 A;  5HFO A;  4MEZ A;  2QHK A;  4P87 A;  4DMZ A;  5DF9 A;  4PM5 A;  3RH8 B;  3NUL A;  2C6W B;  5HAP A;  3B47 A;  4GN2 A;  3M2K A;  5FQK A;  2EWW A;  2W1T B;  5HWW A;  4X6T A;  2W3D A;  2QJ5 A;  3ISG A;  2A2L A;  4BLM A;  4RQ9 A;  4OVD A;  3BM6 A;  1VET B;  2G2U A;  4KZB A;  4WN5 A;  2HGV A;  3PTE A;  4UA7 A;  1P9W A;  1TEM A;  4C6Y A;  3W4O A;  1PWD A;  4QWO A;  4UQI M;  5AQ9 A;  3MSH A;  1WYB A;  4OP5 A;  1SCW A;  2A3U A;  3JYI A;  4P85 A;  4IJG A;  3KSF A;  5J4E A;  4WF0 A;  3UPP A;  4CJN A;  1ZHH B;  1WE4 A;  3H9W A;  1XP4 A;  4GW9 A;  5CHJ A;  2NUP C;  3JVV A;  1NRJ A;  2IWD A;  3W4P A;  2ZMA A;  5HWV A;  5AQB A;  2K2N A;  1XGJ A;  3E2K A;  4Y17 A;  3R4K A;  2OOL A;  5FQI A;  3V39 A;  5AVF A;  4DE3 A;  2IWC A;  4KQQ A;  5TBM B;  4ZAM A;  2P9V B;  4OQG A;  4YFM A;  2Y2L A;  3MJQ A;  4DJ3 A;  1P9R A;  3G2Z A;  1FSY A;  2Y55 A;  4K08 A;  4Y15 A;  1C3B A;  2W27 A;  3LR4 A;  3GTC A;  2VV7 A;  2Y79 A;  1EW0 A;  3TRC A;  4ZDX A;  2ZQ9 A;  1EWZ A;  3R7W A;  1SDE A;  2KLI A;  4YOF A;  3SH9 A;  2V0U A;  4K91 A;  5KSC A;  1JVJ A;  4HH3 A;  1HZO A;  4GOG A;  4DE1 A;  4Y2F A;  1IFQ A;  3RFB A;  2WK0 A;  2Y2J A;  4MN7 A;  1S1Z A;  1SKF A;  5FSR A;  2WKR A;  1T1C A;  2Y2G A;  1S4R A;  4HJ3 A;  3BFF A;  2W0N A;  4GKU A;  1E25 A;  1ZG4 A;  5F1G A;  4DKI A;  4L9F A;  3UB5 P;  3ZG9 B;  4NXB A;  4NXE A;  3IWQ A;  1ERM A;  4UAA A;  2V0W A;  1YSQ A;  2LB5 A;  4K0X A;  4LPZ A;  1NXY A;  4ESP A;  4EER A;  1ACF A;  3UN7 A;  4BBU A;  5TR7 A;  3PAG A;  5FAS A;  1BYW A;  4I39 A;  3ZNT A;  4P6B A;  1T18 A;  2HDR A;  2H28 A;  2W3G A;  4JGO A;  4X55 A;  4X69 A;  2WUQ A;  3C2W A;  4JXW A;  5EVI A;  2UV0 E;  1TF1 A;  4ETZ A;  2HJ9 C;  1UWP X;  4L9E A;  1DP9 A;  4ZRR A;  3C30 A;  4EBP A;  1PRQ A;  3ZQ5 A;  3WS2 A;  1OTE A;  3C8C A;  1ESU A;  3PBO A;  4CLC A;  2QYB A;  3IQA A;  3TOI A;  3HLD A;  4LV3 A;  2CC1 A;  3LR0 A;  4ARZ B;  1W63 Q;  4R4S A;  2Y2I A;  2IWB A;  2WAF A;  2ZBB A;  4EUV A;  5A8B A;  4HI4 A;  2XD5 A;  3KYZ A;  4UA6 A;  1LSW A;  1YPR A;  1GSV A;  3VFF A;  3HUM A;  1O07 A;  1TS6 A;  1VM1 A;  1L0G A;  2XSS A;  1BLC A;  1V9Y A;  3R7W B;  2O0Y A;  1RP5 A;  3ZG7 B;  3BLM A;  1YLP A;  3HLE A;  2EFU A;  3F1O B;  2OLU A;  2HF6 A;  4QJG A;  3ZVT A;  3UB6 A;  4MN6 A;  5IT5 A;  3OZH A;  4OPR A;  2QKP A;  2YKH A;  3UDX A;  4JF4 A;  3PBQ A;  1I5Q A;  2Z2L B;  4WEJ A;  3GSG A;  4FTX A;  3IXB A;  4DXC A;  2J3T D;  2FH5 A;  2PT7 A;  2ZC6 B;  3O86 A;  1L3L A;  2Y2M A;  3N8L A;  4WMC A;  5JYO A;  5L07 A;  4WUJ A;  4X1M A;  4JGP A;  1GCE A;  1L0D A;  2V8F A;  2L4R A;  2J3W A;  1ES3 A;  3IH8 A;  2PD7 A;  2HJE A;  5DF7 A;  3LFV A;  4CLC E;  2KOI A;  4XT2 A;  3V67 A;  2VA0 A;  4GZB A;  4UA9 A;  4OH0 A;  1SHV A;  3W4Q A;  4EEU A;  2EFX A;  2JHE A;  5DF8 A;  5CED A;  2H10 A;  1TDL A;  5HZH A;  3IWI A;  2I9V A;  4MLL A;  4E6X A;  3HBR A;  1YLJ A;  3PBT A;  3UMD A;  1KE0 A;  1ES5 A;  5FQJ A;  3WWX A;  2Y2H A;  2PU4 A;  4YNR A;  5F6A A;  3NBL A;  1E3U A;  3SS4 A;  3L7H A;  1M40 A;  4PM9 A;  3KYE A;  3E0Y A;  2DCF A;  4KZ8 A;  2XGN A;  4GD8 A;  4L9G A;  1XKZ A;  3LIC A;  1A0K A;  4BEN A;  3WRZ A;  4EBN A;  5HAI A;  4EQI A;  3BWL A;  4IUK A;  3G34 A;  1KGF A;  1XGI A;  4M4X A;  4HH2 A;  3T50 A;  3SH8 A;  5CXW A;  1LI9 A;  1OME A;  4KZ7 A;  2Y2K A;  2HDU A;  3UE3 A;  1PFL A;  1DRM A;  1K38 A;  2A24 B;  3OBF A;  3EQU A;  4GS9 A;  5TBM A;  5F69 A;  4EEP A;  2MJ6 A;  2VV8 A;  1K55 C;  3VP0 A;  3FV7 A;  1NWZ A;  2K31 A;  2V8C A;  2XH9 A;  4U0X A;  2B02 A;  4QU3 A;  3C5A A;  1MY8 A;  4EV4 A;  2OSU A;  4OON A;  5E2F A;  1Y4O A;  1K0K A;  1K56 A;  1MKM A;  2VZW A;  1BSG A;  2PHY A;  2H0Y A;  2PYR A;  1K6S A;  1DP6 A;  4Y13 A;  1CEG A;  3UME A;  1NRF A;  1S6R A;  2ZL1 B;  4Y0T A;  1YSP A;  2R9W A;  4BD1 A;  5HPI A;  3G2Y A;  1O7E A;  3IT9 A;  1KE4 A;  5HPF A;  1OT9 A;  2DNS A;  4D2O A;  4IBX A;  3F1O A;  4O8G A;  4OKP A;  4LV0 A;  5EV0 A;  5FEG A;  5K5B A;  1ODV A;  3LEZ A;  3VP2 A;  2Z2M B;  3FKV A;  4GB7 A;  5EPH A;  3CLO A;  4KQO A;  2QZ6 A;  5TFQ A; 
#chains in the Genus database with same CATH homology
 2EWV A;  4ME4 A;  2P7J A;  4HNB A;  2WKQ A;  4WN5 A;  3VOL A;  2HGV A;  5J7E A;  1P9W A;  1GSX A;  2OAQ 1;  2OAP 1;  3EGX C;  4UQI M;  1T19 A;  1OTI A;  3G6O A;  4R70 A;  3LIE A;  3FPW A;  5J3W A;  1TS0 A;  4UQI S;  5EFW A;  4KUO A;  3SW1 A;  1D7E A;  4QPR A;  4MN5 A;  3LIB A;  2O9C A;  5HDD A;  3S7Q A;  4LLO B;  3F1N B;  1TS8 A;  2GX5 A;  4MDZ A;  4IJG A;  3KSF A;  3TE8 A;  5J4E A;  1XJ2 A;  4WF0 A;  1ZHH B;  3H9W A;  5HWT A;  4GW9 A;  5TJJ A;  2NUP C;  4BWI A;  3JVV A;  2KDK A;  1NRJ A;  4O01 A;  3PXP A;  3KSI A;  5HWV A;  1XJ4 A;  3F1P B;  2O9B A;  3OC2 A;  2K2N A;  2P08 A;  4HJ6 A;  1XJ6 A;  4O0P A;  3EOI A;  1LSV A;  3R4K A;  3H82 A;  4JGR A;  2OOL A;  2O9A A;  2W3H A;  3P01 A;  4I5S A;  5AVF A;  2V1A A;  3EWK A;  5TBM B;  4BJP A;  3CUE A;  2XA7 S;  1UGU A;  4EQ1 A;  3GEC A;  4PKY A;  3MJQ A;  3A0V A;  3ZYT A;  3MF0 A;  4DJ3 A;  1P9R A;  4R38 A;  3ULF A;  2ZMF A;  4K08 A;  3NOU C;  3UB9 A;  1G6O A;  1OJ5 A;  2W27 A;  2ZMV A;  3PR6 A;  3LR4 A;  3OCN A;  2OWJ A;  4BBV A;  2VV7 A;  2Y79 A;  2VKS A;  4G3K A;  1EW0 A;  2L0W A;  3TRC A;  3IBJ A;  3EQV A;  2PDR A;  3NOP C;  3R7W A;  1V9Z A;  1JNU A;  2GNX A;  3H7W A;  3UE6 A;  2KLI A;  2G7U A;  1KOU A;  3JVU A;  1MZU A;  5LBR A;  4YOF A;  3MMH A;  2V0U A;  2CMN A;  5HD3 A;  3LUQ A;  1N9O A;  5DKL A;  4HH3 A;  1XJ3 A;  3A0S A;  3T4L A;  4Y2F A;  1IFQ A;  3MFX A;  3RFB A;  4F3L B;  2XRN A;  5IS1 A;  4MN7 A;  2VJW A;  4EXO A;  1S1Z A;  2VEA A;  1N9N A;  3KO6 A;  3K3C A;  5F68 A;  2WKR A;  1T1C A;  1S4R A;  4HJ3 A;  2J3T C;  4H6J B;  2PYP A;  2W0N A;  1UWN X;  3E98 A;  4YWZ A;  4CLC D;  1LT0 A;  3T4J A;  3T4Q A;  1F5M A;  4L9F A;  5DJU A;  3BQ8 A;  2K7S A;  2PR6 A;  4NKP A;  4NXE A;  4NXB A;  4OOM A;  3OCL A;  4EET B;  3T4T A;  3HJI A;  3A0R A;  3LI8 A;  3KSH A;  2V0W A;  1YSQ A;  3FC7 A;  2LB5 A;  3BJN A;  3LIA A;  4LPZ A;  3E4P A;  4EER A;  4BBU A;  4HP4 A;  2Z6C A;  1OTA A;  1BYW A;  5HD5 A;  4I39 A;  4GLQ A;  4Q0H A;  4ETX A;  3U2A A;  1T18 A;  4UEY A;  4II7 A;  1H8M A;  1T1B A;  2H28 A;  1S4S A;  2W3G A;  4JGO A;  3C2W A;  1IOU A;  3MQQ A;  3ICY A;  2VGL S;  1TF1 A;  3B33 A;  2W3F A;  4HJ4 A;  2HJ9 C;  2XA7 M;  2VGL M;  4LRY C;  4ETZ A;  1UWP X;  1S66 L;  4L9E A;  1DP9 A;  5HL6 A;  4I3I A;  4AFI A;  5AVE A;  4ZRR A;  3C30 A;  2OWH A;  1Y28 A;  3IS2 A;  3T4S A;  3VE4 A;  4DN0 A;  3ZQ5 A;  1OTE A;  3LR3 A;  3C8C A;  3PBO A;  4CLC A;  4BBT A;  3P7N A;  2QYB A;  4NXF A;  4FOF A;  4OOL A;  3UB7 A;  2NUT C;  3IBR A;  5C5K A;  1N9L A;  3LR0 A;  4ARZ B;  1W63 Q;  1XFN A;  2W1R A;  4HY8 A;  3GDI A;  3F1P A;  4MMN A;  5HSQ A;  4R6L A;  2ZBB A;  2DMW A;  4EUV A;  5A8B A;  3PYP A;  4HI4 A;  3BQA A;  3KYZ A;  1LSW A;  1GSV A;  3UB8 A;  5HDC A;  4GJ4 A;  3TW8 A;  2PD8 A;  2VLG A;  4DJ2 A;  1TS6 A;  3KYQ A;  4WL9 A;  2M7U A;  2XSS A;  2JKT I;  4EU0 A;  1DP8 A;  1V9Y A;  3R7W B;  2O0Y A;  1VB6 A;  2GJ3 A;  5DKK A;  2PR5 A;  3BY9 A;  4G3W A;  5DFX A;  3F1O B;  1ZTU A;  1WA9 A;  2HF6 A;  4FSF A;  3D72 A;  1T1A A;  4R3A A;  4MN6 A;  3UB6 A;  5IT5 A;  2GZA A;  2QKP A;  2YKH A;  4IHQ A;  3H7W B;  2Z6D A;  1G28 A;  4P6Z S;  3F1N A;  3PBQ A;  3PBN A;  2INW A;  4GS9 B;  4WEJ A;  2JN7 A;  3S7N A;  3NJA A;  1S1Y A;  4I38 A;  2J3T D;  2Y8H A;  2FH5 A;  2M1C A;  2PT7 A;  1S67 L;  4PKY G;  3S7P A;  2J80 A;  4HOI A;  2O99 A;  4WUJ A;  3MQO A;  5KSH A;  4JGP A;  4Q0I A;  4HQA A;  4GHI B;  4CLC C;  5DFY A;  2L4R A;  2J3W A;  2WKP A;  1VHM A;  2PD7 A;  4PHT A;  2HJE A;  3LFV A;  3D3O A;  4CLC E;  2EA9 A;  3PBS A;  5G4Z A;  1YKD A;  3BW6 A;  3CWF A;  2KOI A;  3LYX A;  4XT2 A;  2VV6 A;  3V67 A;  5DJT A;  2VA0 A;  2R78 A;  3OLO A;  5MC7 A;  3NOT C;  4CLC B;  3FG8 A;  4L0L A;  3T4K A;  3LR5 A;  4I3A A;  3E4O A;  4EEU A;  4G3V A;  4NXG A;  2JHE A;  4WLA A;  5HZH A;  5FL3 A;  3PBR A;  2I9V A;  1OPX A;  1P97 A;  3PBT A;  3UMD A;  1H3Q A;  2A24 A;  3LID A;  4YNR A;  5F6A A;  4KQD A;  3C38 A;  4EES A;  4F3L A;  4E04 A;  5G4Y A;  2JKR I;  1STZ A;  3E0Y A;  4WEK A;  3E4Q A;  2JKT M;  3MXQ A;  5HDS A;  4L9G A;  3LIC A;  2LB9 A;  2XRO A;  2B18 A;  2V9A A;  3CUE C;  3CIT A;  4EW7 A;  3S7O A;  3B42 A;  2IA2 A;  2FZ0 A;  1LSX A;  2M7V A;  4B93 A;  4Y3I A;  3BWL A;  2W3E A;  1F9I A;  4IUK A;  4H6J A;  4JGQ A;  3H82 B;  3CI6 A;  2BAS A;  4M4X A;  1GSW A;  3HCY A;  3EEH A;  4HH2 A;  3T50 A;  4B9O A;  2QWS A;  4ARZ A;  2D01 A;  4HHD A;  4XT2 B;  3KSG A;  3TJZ C;  4Q0J A;  4Z1W A;  2ZOI A;  2YKF A;  4WEL A;  1NLY A;  4IUH A;  4BMW A;  1TD5 A;  5F5Y A;  3UE3 A;  2A24 B;  1DRM A;  3OBF A;  2VX8 A;  1OJG A;  5CX7 A;  1YAX A;  3T4O A;  3EQU A;  4GS9 A;  3LI9 A;  4MCW A;  1XFQ A;  5TBM A;  4GCZ A;  5F69 A;  2MJ6 A;  4EEP A;  2L1M A;  2VV8 A;  1P0Z A;  4HIA A;  2KX6 A;  1NWZ A;  2K31 A;  1W63 M;  2W1T A;  1OTD A;  3CAX A;  3VE3 A;  3HJK A;  2HV1 A;  2P04 A;  2B02 A;  4HP9 A;  4GHI A;  3W2Z A;  3MR0 A;  1TS7 A;  4LRZ E;  3VV4 A;  1F98 A;  1D06 A;  4I3J A;  5L8M A;  4KUK A;  2D02 A;  1MKM A;  2VZW A;  2PHY A;  2V1B A;  2PYR A;  3K3D A;  3EGD C;  3IS2 B;  1OTB A;  1DP6 A;  2ZOH A;  4NEE D;  5KIZ A;  3UME A;  4CQH A;  2QHK A;  3O5Y A;  4DMZ A;  1NLZ A;  1OT6 A;  3FPV A;  3RTY A;  1LL8 A;  1YSP A;  5DF9 A;  3BY8 A;  5HPI A;  3RH8 B;  3DBA A;  4PAU A;  5HPF A;  3LIF A;  1OT9 A;  2QJ7 A;  3K2N A;  4P6Z M;  3B47 A;  3PHY A;  2JKR M;  5I5L A;  2EWW A;  2W1T B;  4Y5F A;  5HWW A;  3F1O A;  1X0O A;  4O8G A;  3EEA A;  1MC0 A;  5K5B A;  3KX0 X;  3NHQ A;  4LRX C;  1ODV A;  2W3D A;  5AJG A;  2QJ5 A;  5IU1 A;  3MQ0 A;  2A2L A;  3CLO A;  4KQO A;  4RQ9 A;  3OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...