1Y28A

Crystal structure of the r220a metbjfixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGAIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein fixL
publication title A distal arginine in the oxygen-sensing heme-PAS domains is essential to ligand binding, signal transduction, and structure
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1y28A00
5HDSA 4GHIB 2PDRA 2D01A 1S4SA 3NOPC 2Z6CA 2JHEA 5HDDA 1MZUA 3UB6A 5TBMA 5F5YA 3IBRA 4GCZA 1LT0A 3F1OB 2CMNA 4B9OA 4RQ9A 1Y28A 3H9WA 1UWNX 2W0NA 4BBVA 2PYPA 1P0ZA 3H7WB 3LUQA 4BBUA 3E4QA 1TS8A 1LL8A 1X0OA 4PKYG 4BBTA 4KQDA 3UE6A 3KX0X 4EERA 2OOLA 1DP9A 2VV8A 5HZHA 1XJ4A 1TS6A 5AVEA 1N9OA 4LRYC 1OTEA 3T50A 5J4EA 1D7EA 3LIBA 4WL9A 3F1PB 3ICYA 2WKRA 5HD3A 4EQ1A 5A8BA 4GS9A 4HJ3A 3UB8A 4EW7A 1ODVA 3LYXA 4WLAA 4I3JA 4I5SA 5HSQA 2K7SA 2QJ7A 4NXBA 4HQAA 1XJ2A 4I3AA 4F3LB 4JGQA 1T19A 2L0WA 4EETB 3F1NA 4NXGA 4HP9A 3PHYA 1OT9A 2L4RA 4KUKA 1XFQA 3ULFA 1N9NA 3SW1A 5G4ZA 4HI4A 3GECA 2VV7A 1OTIA 4I38A 4E04A 2GJ3A 2QWSA 3ZQ5A 4XT2A 3F1OA 3A0SA 1F9IA 1OJGA 4L9FA 5G4YA 1VB6A 3E4OA 4R70A 3EWKA 1GSVA 1LSXA 3UB7A 4I39A 5HWTA 1XFNA 4GW9A 3MQQA 1S4RA 4HNBA 4R38A 4KUOA 1XJ3A 3LIFA 2D02A 1UWPX 5F6AA 4HJ6A 2PR5A 4PKYA 2KDKA 4YWZA 4I3IA 1DP6A 2VLGA 1V9ZA 3LI8A 3LI9A 3LICA 3NOTC 3P7NA 4L9EA 2VEAA 3CLOA 4HHDA 5TBMB 5DJTA 2A24A 2P7JA 2OWJA 2B02A 4LRXC 1TS0A 3FG8A 3K3CA 3RH8B 3IS2A 2V0UA 2R78A 3UB9A 2M1CA 1JNUA 1LSVA 1DRMA 4R3AA 4JGRA 3C8CA 3H82A 4NXEA 4LPZA 4WF0A 3NJAA 4H6JA 2L1MA 2I9VA 3BY9A 2WKPA 4LRZE 1T18A 5I5LA 4HP4A 4EESA 3G6OA 5HDCA 1WA9A 3D72A 1GSWA 2OWHA 3MR0A 3CWFA 1OTAA 3VE3A 1TS7A 4JGPA 4GHIA 3NHQA 4GS9B 3EEHA 3LIDA 5IU1A 2H28A 2ZBBA 2WKQA 1F98A 3K3DA 1NWZA 2QHKA 1KOUA 2YKHA 1V9YA 4WN5A 1S67L 4EEUA 2INWA 4DJ2A 3E4PA 3MQOA 3F1NB 4MN5A 3HJIA 3GDIA 1DP8A 1BYWA 3H7WA 2EA9A 2PR6A 3BY8A 4M4XA 3VOLA 2ZOIA 3NOUC 2BASA 1OJ5A 5HWVA 4EXOA 2PYRA 5KIZA 2W27A 1T1AA 2YKFA 1UGUA 3LIEA 4HH3A 1G28A 4R6LA 4LLOB 2QJ5A 1XJ6A 4XT2B 1S1ZA 3UMDA 3C2WA 4K08A 3A0RA 5J7EA 2V9AA 2V1BA 5DKKA 3F1PA 2PHYA 1EW0A 3MJQA 3MXQA 3UMEA 2VV6A 1LSWA 4MN6A 3A0VA 5DKLA 3RTYA 3OLOA 1OTBA 1T1BA 5F68A 4F3LA 4L9GA 5IS1A 5J3WA 4WUJA 3FC7A 4NXFA 1P97A 1D06A 5HWWA 2A24B 2V1AA 4HY8A 4EEPA 2PD8A 2PD7A 4HIAA 1GSXA 3PYPA 3IS2B 3BWLA 2V0WA 1S66L 4HOIA 3LIAA 2Z6DA 1S1YA 5HD5A 3H82B 2KX6A 4JGOA 4H6JB 3MFXA 2QKPA 3HJKA 1OTDA 4HH2A 1N9LA 5DJUA 5AVFA 4HJ4A 3VE4A 2J80A 1OT6A 4DJ3A 5EFWA 3B33A 1T1CA 2JN7A 5F69A 2HV1A 3CAXA 2ZOHA
chains in the Genus database with same CATH superfamily
5HDSA 5TGFA 2GX5A 2PDRA 3T1RA 2Z6CA 3O3VA 1BZAA 5BOHA 1O7EA 4PM8A 4Y0TA 3UB6A 4IBXA 3IF6A 1MWTA 5F5YA 1CK3A 3CMZA 1IELA 3QP6A 3SS4A 4GCZA 4IVKA 4Z9QA 4KG2A 1STZA 3G35A 4ETXA 3S7OA 1OPXA 3H9WA 4WELA 2Y91A 3LR4A 2W0NA 2VK3A 4BBVA 4OVDA 4II7A 4Y15A 3H7WB 4BBUA 3E4QA 3GSGA 1IEMA 4C6YA 4BBTA 2WGWA 2EWWA 1XGIA 3WRTA 2V2FF 2P08A 3BECA 1M6KA 3T1SA 2J7VA 2R9XA 2JCHA 1XJ4A 4H8RA 3KYQA 4KG6A 5HPIA 1PZPA 3PBSA 3MXSA 4JF5A 1N9OA 5L07A 1D7EA 1ES3A 2H10A 3UY6A 2X01A 5G18A 2ZM2A 2X71A 1ZHHB 1Z09A 1MWSA 3GMWA 4I3JA 4I5SA 4S2NC 5HSQA 2VGLS 1KGFA 4PM9A 3P98A 4JXWA 3C30A 4MDZA 1KVLA 3G30A 2GZAA 2MJ6A 1G6AA 1E3UD 1N9NA 1IYQA 1SDEA 4XXRA 3ZNYA 4LENA 3BW6A 4HI4A 2VV7A 2EX9A 1OTIA 4CLCD 2GJ3A 1SDNA 2B18A 3S4XA 5FEGA 5CEBA 4S2KA 1FSWA 5FDSA 1VEUB 3ZQ5A 3GRJA 3F1OA 4KENB 3WRZA 3A0SA 3KO6A 2JBFA 3EQUA 3S7PA 3HLGA 3E4OA 3UDIA 4GD8A 3EWKA 1PW1A 5IHVA 3CZDA 3UB7A 2WAFA 1XFNA 4GW9A 1S4RA 3PTEA 4KUOA 2HP9A 1XJ3A 2QZ6A 2D02A 5F6AA 4HJ6A 2PR5A 5DTTA 2HF6A 2KDKA 4YWZA 3A3FA 2XH9A 1LHYA 3LI8A 3LI9A 3ITBA 1FSYA 4LV2A 4U0TA 4BQMA 3NY4A 2OV5A 4EBNA 5FAOA 3CLOA 1TF1A 3Q7VB 3IF6C 5TBMB 2A24A 3FYZA 3OPLA 2OAQ1 3KSFA 2JC7A 2OWJA 4LRXC 3UPOA 1TS0A 5HARA 1F5MA 4RA7A 2M1CA 2J9PA 5DTSA 4WEKA 1DRMA 1NJ4A 1PFLA 2OSUA 4ZJ1A 4R23A 4JGRA 2PBYA 3C8CA 3H82A 5HAPA 1RGYA 2XGNA 2VA0A 1NLZA 2G2WA 1EROA 1FCMA 3CITA 4X55A 2IWCA 1Y54A 3IX8A 3VP0A 4B4XA 4LRZE 4UHUA 1ESUA 4OQIA 4UA9A 3MZFA 3V5MA 3T1XA 1CI8A 3D72A 1GSWA 3NECA 3TOIA 2OWHA 3HUOA 3FPWA 1BLPA 3CWFA 1LLBA 3IBJA 3ZCZA 2P74A 4JGPA 1G68A 1E3UA 3NHQA 4GS9B 1NRFA 1JVJA 1K54C 3EEHA 3OPHA 3ZG5A 4Q0JA 3RXXA 4ARZA 3CPTA 1NWZA 3HLBA 3HLWA 5FI7A 3BQ8A 4ZRRA 4CLCA 3JYIA 3DW0A 3M6BA 4DKIA 4JPMA 2INWA 1YLZA 5HW3A 5FATA 3MQOA 3Q81A 2ZQDA 4O8GA 1LL9A 1DP8A 4U0XA 2IWDA 3PXPA 3VP3A 3R4KA 5MC7A 5TR7A 2AVXA 3BY8A 4WYYA 1ESIA 3LO7A 3NOUC 2W1TA 1OJ5A 1NYMA 2DNSA 2Y2QA 2ZM8A 2PYRA 5KIZA 3EEAA 4LCLA 2YKFA 3HCYA 1L0GA 5KZHA 4LLOB 4D2OA 4R3BA 1KGEA 3UE3A 2XRNA 2W3GA 4G3KA 4GB7A 1YLYA 3C4OA 1I5QA 4R3JA 2V9AA 2V1BA 3TG9A 5DKKA 4JLFA 4CJNA 4HEFA 3IX4A 3E2LA 1ZG4A 4KQOA 3OC2A 3PBRA 4GKUA 4GOGA 3OCLA 4NK3A 5JYPA 1T1BA 2ZJ9A 1GCEA 1MKIA 5F68A 3BLMA 2VGLM 3BM6A 4FSFA 5M19A 4F3LA 3Q07A 4QD4A 3JVUA 4X25A 4PM6A 5IS1A 3FC7A 1D06A 1H3QA 4PAUA 4UAAA 2ZQ7A 5FQIA 3ZVTA 5M1AA 4HY8A 2OAP1 4HIAA 3VP1A 3FV7A 5CGXA 4OQ0A 3UDFA 1KDWA 4Q0IA 3CG5A 3IS2B 2ZC7A 3IXGA 4N9KA 4GNUA 4Z1WA 1PWGA 2V0WA 4S2PA 4DE2A 1JTGA 3LY3A 4LV3A 2Y8HA 5HD5A 2IWBA 1F2KA 1S6RA 1AXBA 4ZDXA 3PBOA 2HJEA 1HD8A 3MFXA 2P9VB 1HTZA 1KE3A 4HJ4A 3UN7A 1PWCA 3W2ZA 3VFHA 2Y2PA 5EFWA 2HDUA 4X1LA 4OQHA 2EXBA 1JWZA 3PR6A 4KZ5A 5KSCA 4Y2FA 5LBRA 3V3SA 3GR2A 3MKFA 4GHIB 1H8ZA 1VM1A 5DTKA 5EVEA 4LV0A 3DWZA 1S4SA 1S0WA 1ONHA 4JXGA 2B95A 5GLBA 4ME4A 4MN7A 1IKIA 1FIKA 2W3EA 4OOMA 2LB5A 1LI0A 2CMNA 3O88A 1NY0A 4RQ9A 1JTDA 4OQGA 1Y28A 3ZG8B 4Y0UA 1MWUA 3L9KA 5L2FA 2W3DA 1Q2PA 1P0ZA 2O9CA 4Y17A 1LL8A 3OZHA 5A92A 3A3DA 1L0DA 2EX2A 3U4LP 3KX0X 5AQ9A 3RFBA 4EERA 2OOLA 2ZQ9A 2ZLYA 5AJGA 4WZ5A 1HLUP 3NCKA 5AVEA 4WBGA 4LRYC 1OTEA 4PHTA 3DAVA 4Y3IA 3T50A 5J4EA 1C3BA 3UNWA 3LIBA 2XQZA 4OP5A 3D3OA 3F1PB 2VGKA 1ES4A 5CHJA 4E3NA 3UB8A 3LYXA 4WLAA 2CC1A 2XF3A 2M7UA 3NI9A 4P0MA 3MQ0A 3QHYA 2K7SA 3G31A 1SKOB 4HESA 1YMSA 4I3AA 3EGDC 1YLWA 2E8IA 3DTKA 5DVAA 5DFXA 4EETB 5TJJA 3F1NA 2ZC3B 1I2WA 4X68A 5L09A 4ZBEA 4QB8A 4HP9A 3HL9A 3LFVA 2ZL1A 4KQQA 3UB5P 4OLGA 2P04A 1VETA 3ULFA 3A3EA 1PI5A 4E3IA 4JKTA 5EV0A 3SW1A 5G4ZA 1KE0A 4G3WA 1Q2QA 1VQQA 2ACGA 5AQ7A 2J3TD 2PBDP 1CEFA 2XK1A 2A49A 2BLSA 3DTIA 1EI5A 1NYYA 2Q9NA 4MCWA 3B3XA 1F9IA 4X69A 4CLCE 4E6XA 1CQAA 5G4YA 3VSLA 1BULA 3HLDA 4YOFA 3T4LA 1DJCA 1GHMA 4I39A 1LI9A 1YSQA 1CEGA 4LCMA 3D4FA 3LIFA 4KZ3A 3C4PA 4PKYA 2KOIA 3N7WA 4B4ZA 1DP6A 2FFYA 2FZ0A 1V9ZA 2ZQAA 4QHCA 2E8JA 1NXYA 3NOTC 3A3JA 3TE8A 3TJZC 3IF6B 5HL6A 2G2UA 2XD5A 3CUEA 4GLQA 5DJTA 4HHDA 2P7JA 3G32A 3N8SA 5FAQA 3MS6A 2B02A 4RYEA 3NDGA 1BLCA 3K3CA 1FCNA 3RH8B 2KLIA 5FAPA 1XKZA 3HVFA 3KSHA 4BL3A 1JNUA 1PWDA 3VP2A 5FI2A 1PRQA 2FH5A 3IHBA 2O9AA 3HBRA 5HAQA 2G7UA 4NXEA 2WGWB 4LPZA 2L1MA 2EX8A 4S2JA 2I9VA 2WKPA 2FFFB 5I5LA 3W8KA 3BFEA 3D9YA 3C7UA 3U2AA 3Q82A 2VJWA 3HLCA 3V3RA 2ZMVA 3DWKA 1WYCA 2K31A 3VE3A 1TS7A 5GLDA 3S22A 3ZG7B 5CTNA 3HUMA 2H28A 2ZBBA 4OPZA 2QHKA 3LGOA 4BWIA 1KOUA 2A3UA 1HVBA 4P85A 2ZM0A 1NRJA 1IYSA 1S67L 2PU2A 4BMWA 1WYBA 4EEUA 4DJ2A 2R9WA 3E4PA 4DN0A 5E2GA 2J8YA 2WAEA 5AQBA 3G2ZA 1GHIA 3MZEA 3OBFA 5FDHA 2M7VA 1YAXA 5EVID 3MMHA 4BD1A 4CPKA 2ZC5B 1UGUA 1IOUA 4WM9A 1XJ6A 5GHYA 1S1ZA 3UMDA 4NKPA 5A90A 4IJGA 1MPLA 1K57A 4K08A 3DBAA 3O5YA 3A3IA 3KYEA 1XPBA 3E98A 5J7EA 1VHMA 2Y59A 4EBPA 2PHYA 1K56D 1EW0A 3MJQA 1CI9A 1L3LA 3UMEA 4KZBA 2VKSA 1G6OA 4IBRA 3PBTA 3WS0A 3QP5A 3M2KA 4B93A 3MSHA 3C5AA 4FH4A 3QP8A 4DRTA 3OCNA 5J3WA 4LGWA 1P97A 4S2MA 2V8FA 3N6IA 5HWWA 1PYYA 3UPPA 4MBHA 2A24B 3CHWP 3Q7ZA 4EEPA 2HDSA 3FKVA 2JE5A 2W3FA 4NG2A 4PM5A 1SCWA 1W7FA 2Y2MA 5FQQA 4QY5A 3NC8A 4HOIA 2GNXA 3VSKA 3LIAA 2Z6DA 5CXWA 4N92A 3TW8A 3K2NA 3H82B 5FSRA 1K55A 4DE0A 5CHUA 3HJKA 3P01A 3IH8A 3BRMA 4JF6A 4MLLA 3ZVWA 3QP1A 4QY6A 2BTFP 3W4QA 3VE4A 2J80A 4DJ3A 1T1CA 4KG5A 2JN7A 1TD5A 5EOOA 4KZ9A 2ZOHA 3IT9A 2HP5A 4LFUA 4MEZA 3BQAA 4ZTKA 4ARZB 3CPTB 4DMZA 1ZKJA 4KZAA 5EVIA 3M2JA 2JHEA 1FILA 4RVAA 3IXBA 4CLCB 2HDQA 2J3TC 4RX3A 3B42A 3IBRA 3M6HA 2XEPA 4S2OA 2V1ZA 3KSGA 4B9OA 4IUHA 2PRFA 3ZNTA 4NEED 3S1YA 3IH9A 1K4FA 3HUNA 1MC0A 1YPRA 1XA7A 3LUQA 1K56A 1YMXA 2QYBA 2W1TB 4KQDA 4E3JA 4Y7PA 3CJMA 1OMEA 3UE6A 5CRFA 3T4KA 4S2IA 2VV8A 5HZHA 3Q1FA 5EVLA 4Q0HA 3W4OA 4HBTA 2EFUA 1ONGA 5AQAA 1ES5A 1K57C 1ZTUA 4P6BA 2W3HA 5DF8A 3V67A 5HD3A 4EQ1A 2C6WB 5HL1A 4C3QA 3SH7A 4B88A 5KMWA 3KSIA 4EUVA 2QJ7A 3AGDA 4NXBA 4HQAA 2P9VA 2Y2IA 3W4PA 4UEYA 1XJ2A 3BYDA 1WE4A 4F3LB 3N8RA 2Z2MB 2L0WA 4X6TA 3LY4A 4E3LA 4NXGA 3PHYA 1RP5A 3HLFA 3EGXC 3ITAA 5EE8A 2L4RA 1XFQA 2JKFA 4K0XA 1K38A 4FCFA 2WZZA 3GECA 1L2SA 2Q0OA 4U3TA 4E04A 3OPPA 5FL3A 1W63M 5CX7A 4Q8IA 3JPUA 2Z2LB 1KDSA 5F1GA 4XT2A 1K55C 1PI4A 5JYOA 3HLEA 4L9FA 1BT5A 4E6WA 1VB6A 4R70A 4CLCC 2C5WB 4DE1A 4N1XA 4X56A 3SH9A 4QJGA 1GSVA 1LSXA 5HWTA 4EBLA 1FR6A 1YLJA 4BJPA 4Y0OA 5E2EA 2UWXA 3VOYA 1BUEA 5FEFA 4QU3A 2WK0A 3WS5A 3LCEA 2WZXA 2O0YA 2XR0A 3B47A 4I3IA 3SS5A 1DJAA 5GHXA 2VLGA 2Y55A 3LICA 2Y2JA 1YT4A 1E4DA 3PBQA 2WGIA 2PU4A 5EVIC 2VEAA 4PM7A 1FR1A 2EWVA 3N8LA 2XD1A 4WMCD 3V50A 5EPHA 1FCOA 3KYZA 1DY6A 2ZQ8A 4P6ZM 2JKRI 2XA7M 4GN2A 2GDNA 4R4RA 3R7WA 1L0EA 4IUKA 2UV0E 2J3WA 1MY8A 3DTMA 2WKHA 4OH0A 5HX9A 4S2NA 1LSVA 4R3AA 4MBFA 1K4EA 3CI6A 2B5RA 5EM1A 1QMEA 4H6JA 2IA2A 1XGJA 3BFDA 5KSHA 2EX6A 2BG1A 3HREA 3NBLA 1D1JA 2O9BA 4KQRA 2Y2KA 3PAEA 5FQKA 3G6OA 5GLCA 2XSSA 2EFXA 5HDCA 1WA9A 1K25A 3O86A 1SHVA 1OTAA 4KZ4A 5I94A 4DXCA 2OLUA 3LIDA 5IU1A 4O0PA 3IQAA 4QPRA 4ETZA 1H5XA 3K3DA 4E3OA 2VZWA 2QMIA 2HZ5A 4O01A 1KGGA 2YKHA 3UPNA 4WN5A 4RX2A 1W8QA 3F1NB 3NIAA 4MN5A 3VV4A 3HJIA 2HGVA 2HDRA 3BFGA 3SS3A 5M18A 3T4JA 1VETB 2ZMFA 3IHAA 4DF6A 1IYOA 3GQZA 1BYWA 3H7WA 4LV1A 3VOLA 4M4XA 4XUXA 1AWIA 1YLPA 3FPVA 2JKGA 1G5UA 4EXOA 2W27A 4JXSA 2HJ9C 4HH3A 3LIEA 4FUWA 4GD6A 4DDSA 1G28A 1CF0A 2QJ5A 2ZC4B 2NUTC 4X53A 3C2WA 1ACFA 1JWPA 4UA7A 3RXWA 4C75A 3LEQA 4ZJ3A 4OONA 3A0RA 2PAVP 3ISGA 1SKFA 2EXAA 4WMCA 2JKTI 3S7QA 1TDGA 2HPBA 2VV6A 4CQHA 4R4SA 3S7NA 3A0VA 5DKLA 4FTXA 4OOLA 2RCXA 3RTYA 3OLOA 1OTBA 3T4OA 3VOZA 2RL3A 2JKRM 2NUPC 1DJBA 3T1QB 3BFCA 4L9GA 1NZUA 4ESPA 3T4TA 3BLSA 4QWOA 4WZ5C 4UQIM 2PD7A 3T4QA 5CGWA 1GSXA 4GDNA 1K54A 1GA9A 3PYPA 3AGEA 1I2SA 3BJNA 1S66L 3OOVA 4OP8A 3IXHA 1VEUA 2DMWA 4JGOA 5IT5A 5CHMA 5GHZA 1TVFA 4EV4A 2QKPA 3LR5A 1N9LA 5DJUA 3C7VA 5AVFA 3E0YA 4MMNA 1YLTA 5HFOA 1RCJA 3B33A 1PIOA 4ZAMA 3T4SA 3G2YA 4K0WA 3MZDA 3CAXA 2XDMA 4A5RA 5FASA 1FQGA 3WS1A 3SZTA 2D01A 5E2FA 5A91A 3NOPC 4WZ4A 4PMAA 3IXDA 3IWQA 3WWXA 5HDDA 1MZUA 5CERA 3Q7VA 4PPRA 4R1GA 1IFQA 5TBMA 3BFFA 5L10A 1LT0A 3F1OB 4EQIA 1E25A 3RJUA 3DTEA 1UWNX 4KZ6A 2PYPA 1EWZA 1PW8A 2W1RA 1TS8A 1X0OA 4PKYG 4BL2A 1N9BA 1Y4OA 3ZDJA 3MBZA 1GHPA 5D3OA 1YM1A 1YQSA 2Y2NA 1DP9A 4WEJA 2XLNA 1BLSA 1TS6A 2JKTM 4FH2A 4EUZA 2Y2OA 4OPQA 1IYPA 2K2NA 1O07A 4ID4A 3CUEC 2I72A 4WL9A 3ICYA 4P6ZS 2WKRA 1YKDA 2XA7S 5A8BA 3MXRA 4GS9A 4HJ3A 3VFFA 2OLVA 1BSGA 4EW7A 1ODVA 5CEDA 3GTCA 2XFSA 3IWIA 4S2LA 4JGQA 1T19A 4BENA 5HPFA 4OPYA 1IKGA 1OT9A 4IHQA 1XX2A 4KUKA 2HP6A 2H0TA 3NDEA 1TEMA 4N1HA 4DDYA 1W63Q 4E3MA 2DRWA 1K0KA 1W8YA 2XROA 3QP4A 5TFQA 5F82A 4M3KA 4I38A 5A93A 5DF7A 2QWSA 5HAIA 3AGFA 1U60A 1K6SA 1YSPA 2Y2HA 5K5BA 1OJGA 3MFDA 1JWVA 5E2HA 3VP4A 2Y2GA 2Y2LA 3MF0A 1CJFA 1W79A 3LR3A 1ES2A 2ZC6B 3MQQA 1BLHA 4HNBA 1ZC2A 4R38A 4D60A 4YFMA 4GZBA 3QNBA 1UWPX 2A2LA 5FQ9A 2H0YA 3ZG9B 3E2KA 4K91A 3P7NA 3TSGA 4BLMA 5EOEA 2PT7A 5EVIB 4L9EA 4R0QA 3PBNA 3V39A 3SH8A 1RGZA 3LEZA 4BD0A 1MBLA 3JVVA 2Y79A 3FG8A 3C38A 4JXVA 3IX3A 3GV9A 3QNCA 4O7DA 3EOIA 3WS4A 3IS2A 3GVBA 2V0UA 3SOIA 2R78A 4E3KA 3UB9A 4EWFA 4P87A 1XA1A 1N4OA 1MKMA 4IVIA 3I7JA 3T12B 2O99A 4WF0A 3NJAA 5EM0A 3ZYTA 1ALQA 3BY9A 5EUAA 1PZOA 3UO9A 1T18A 1FOFA 4XUZA 3EQVA 3PAGA 4HP4A 5GL9A 1MWRA 3LR0A 1BTLA 3FWLA 2WGVA 4EESA 1K6RA 2V20A 4X1MA 3MR0A 4L0LA 1SZVA 2ZQCA 4UQIS 3G34A 4GHIA 1P9WA 5CTMA 2V8CA 1P9RA 2WKQA 1GA0A 2WYXA 1F98A 2WKEA 3ZG0A 1V9YA 4N9LA 4KZ8A 4OOYA 1M40A 1PNEA 1XP4A 2QPNA 3WS2A 3GDIA 2H5SA 2ZMAA 4KZ7A 2X02A 4YNRA 1HZOA 3ZFZA 4UA6A 3IF5A 4DE3A 2J9OA 5FA7A 2EA9A 2PR6A 4IEDA 2ZOIA 3G4PA 2WADA 5C5KA 2BASA 3OPRA 5HWVA 1T1AA 4FD8A 4OPRA 4R6LA 3UE0A 4XT2B 1KE4A 3NULA 3BEBA 3ZGAB 2WKIA 1ERMA 1NZOA 2Q9MA 5L8MA 1MXOA 1L0FA 5DF9A 1H8YA 1XXMA 3F1PA 3MXQA 4Y5FA 4G3VA 1TDLA 3UE1A 1LSWA 4MN6A 1H0MA 4DXBA 2VGJA 3ZHHA 5FQMA 3QP2A 4ZJ2A 4GDBA 5CECA 1W5DA 1SKOA 5CGSA 4Y13A 1LL5A 5F83A 1J3WA 5J8XA 4WUJA 4YINA 1QMFA 4NXFA 5U47A 5GLAA 5F1FA 1J9MA 5DFYA 4FOFA 2V1AA 4HBUA 4AFIA 3N4IA 1ERQA 1KVMA 2PD8A 1H8MA 3L7HA 2Y4AA 3FKWA 3IWOA 3R7WB 4EU0A 3BWLA 3VMAA 5FI6A 2WUQA 4MNRA 4NETA 2VX8A 2DCFA 1S1YA 1Z6FA 1ZG6A 4OLDA 4GJ4A 3TRCA 4JF4A 3FZCA 2KX6A 5EECA 2XFTA 4JBFA 3MKEA 4H6JB 4OKPA 1OTDA 4HH2A 2ZD8A 1A0KA 5E43A 3O87A 1OT6A 5FQJA 2LB9A 1NLYA 3P09A 5F69A 4F94A 2HV1A 2ZL1B 4MBKA 3UDXA
chains in the Genus database with same CATH topology
5HDSA 4GHIB 2GX5A 2PDRA 2D01A 1S4SA 3NOPC 3BQAA 4ARZB 2Z6CA 4DMZA 4ME4A 4MN7A 2JHEA 5HDDA 1MZUA 3UB6A 4CLCB 2W3EA 5TBMA 1IFQA 2J3TC 3B42A 5F5YA 3IBRA 4OOMA 2LB5A 4GCZA 1LT0A 3F1OB 2CMNA 1STZA 3KSGA 4B9OA 4ETXA 4RQ9A 4IUHA 3S7OA 1Y28A 4NEED 1OPXA 3H9WA 4WELA 1UWNX 3LR4A 2W0NA 2W3DA 4BBVA 2PYPA 1MC0A 1P0ZA 4II7A 3H7WB 3LUQA 4BBUA 2W1RA 3E4QA 1TS8A 2O9CA 1LL8A 1X0OA 2QYBA 2W1TB 4PKYG 4BBTA 4KQDA 2EWWA 3UE6A 3KX0X 2P08A 3T4KA 3RFBA 4EERA 2OOLA 1DP9A 4WEJA 2VV8A 5HZHA 1XJ4A 5AJGA 1TS6A 2JKTM 3KYQA 4Q0HA 5HPIA 5AVEA 3PBSA 1N9OA 4LRYC 1OTEA 4PHTA 3T50A 4Y3IA 2K2NA 5J4EA 1ZTUA 1D7EA 3CUEC 3LIBA 3D3OA 2W3HA 4WL9A 3F1PB 3ICYA 4P6ZS 2WKRA 3V67A 1YKDA 2XA7S 5HD3A 4EQ1A 5A8BA 4GS9A 4HJ3A 3UB8A 4EW7A 1ZHHB 1ODVA 3LYXA 4WLAA 4I3JA 2M7UA 4I5SA 3KSIA 3MQ0A 4EUVA 5HSQA 2K7SA 2QJ7A 4NXBA 2VGLS 4HQAA 4UEYA 1XJ2A 4I3AA 3EGDC 4F3LB 4JGQA 1T19A 2L0WA 5DFXA 4EETB 5TJJA 3F1NA 3C30A 4NXGA 4MDZA 5HPFA 4HP9A 3PHYA 3EGXC 1OT9A 2GZAA 3LFVA 2MJ6A 4IHQA 2L4RA 2P04A 4KUKA 1XFQA 3ULFA 1N9NA 1W63Q 3BW6A 5G4ZA 3SW1A 4HI4A 2XROA 3GECA 2VV7A 1OTIA 4G3WA 4I38A 4CLCD 4E04A 5FL3A 2J3TD 1W63M 2GJ3A 5CX7A 2B18A 2QWSA 3ZQ5A 4XT2A 3F1OA 4MCWA 1YSPA 3A0SA 3KO6A 5K5BA 1F9IA 4CLCE 1OJGA 3EQUA 4L9FA 5G4YA 1VB6A 3S7PA 3E4OA 4R70A 4CLCC 4YOFA 3EWKA 3T4LA 3MF0A 1GSVA 1LSXA 3UB7A 4I39A 5HWTA 3LR3A 1XFNA 4GW9A 3MQQA 1S4RA 1YSQA 4HNBA 4BJPA 4R38A 4KUOA 1XJ3A 3LIFA 2D02A 1UWPX 2A2LA 5F6AA 4HJ6A 2PR5A 4PKYA 2HF6A 2O0YA 2KOIA 2KDKA 3B47A 4YWZA 4I3IA 1DP6A 2FZ0A 2VLGA 1V9ZA 3LI8A 3LI9A 3LICA 3NOTC 3P7NA 2PT7A 3PBQA 3TE8A 3TJZC 4L9EA 2VEAA 3CLOA 3PBNA 5HL6A 1TF1A 2EWVA 3CUEA 4GLQA 4HHDA 5DJTA 5TBMB 2A24A 2P7JA 3KYZA 2OAQ1 3KSFA 2OWJA 3JVVA 2B02A 4LRXC 4P6ZM 3FG8A 1TS0A 2JKRI 2Y79A 3C38A 2XA7M 3K3CA 3R7WA 3EOIA 3RH8B 3IS2A 2KLIA 4IUKA 2J3WA 2V0UA 2R78A 1F5MA 2M1CA 3UB9A 3KSHA 1JNUA 4WEKA 1LSVA 1DRMA 4R3AA 2FH5A 4JGRA 3C8CA 2O9AA 3CI6A 2G7UA 1MKMA 3H82A 4NXEA 2VA0A 1NLZA 2O99A 4LPZA 3NJAA 4WF0A 3ZYTA 4H6JA 2IA2A 2L1MA 3CITA 5KSHA 2I9VA 3BY9A 2WKPA 4LRZE 1T18A 5I5LA 3EQVA 4HP4A 2O9BA 3U2AA 3LR0A 4EESA 3G6OA 2XSSA 5HDCA 1WA9A 3D72A 2VJWA 1GSWA 2OWHA 3FPWA 2ZMVA 3MR0A 4L0LA 3CWFA 2K31A 3IBJA 1OTAA 4UQIS 3VE3A 1TS7A 4JGPA 4GHIA 1P9WA 3NHQA 4GS9B 1P9RA 3EEHA 3LIDA 2H28A 5IU1A 2ZBBA 2WKQA 4O0PA 4Q0JA 4QPRA 4ARZA 1F98A 4ETZA 3K3DA 1NWZA 2VZWA 2QHKA 4BWIA 1KOUA 4O01A 3BQ8A 4ZRRA 4CLCA 2YKHA 1V9YA 1NRJA 4WN5A 1S67L 4BMWA 4EEUA 2INWA 4DJ2A 3E4PA 3MQOA 3F1NB 4DN0A 4MN5A 3VV4A 3HJIA 3GDIA 2HGVA 4O8GA 1DP8A 3T4JA 4YNRA 2ZMFA 3PXPA 3R4KA 5MC7A 3OBFA 1BYWA 3H7WA 2EA9A 2PR6A 3BY8A 4M4XA 3VOLA 2M7VA 2ZOIA 5C5KA 3NOUC 1YAXA 2W1TA 3MMHA 2BASA 1OJ5A 3FPVA 5HWVA 4EXOA 2PYRA 5KIZA 2W27A 3EEAA 1T1AA 2HJ9C 2YKFA 1UGUA 3HCYA 3LIEA 4HH3A 1IOUA 1G28A 4R6LA 4LLOB 2QJ5A 1XJ6A 4XT2B 2NUTC 1S1ZA 3UMDA 4NKPA 3UE3A 2XRNA 3C2WA 2W3GA 4G3KA 4IJGA 5L8MA 4K08A 3DBAA 3O5YA 3A0RA 3E98A 5J7EA 1VHMA 2V9AA 5DF9A 2V1BA 5DKKA 3F1PA 2PHYA 2JKTI 1EW0A 3MJQA 3MXQA 3S7QA 4Y5FA 4G3VA 3UMEA 2VV6A 1LSWA 4KQOA 4MN6A 2VKSA 1G6OA 4CQHA 3OC2A 3PBRA 3PBTA 3S7NA 3A0VA 3OCLA 5DKLA 4OOLA 3RTYA 3OLOA 4B93A 1OTBA 1T1BA 3T4OA 5F68A 2VGLM 4FSFA 2JKRM 4F3LA 2NUPC 3JVUA 4L9GA 3OCNA 5J3WA 5IS1A 4WUJA 3FC7A 4NXFA 1P97A 1D06A 1H3QA 4PAUA 5HWWA 5DFYA 2A24B 4FOFA 2V1AA 4HY8A 4AFIA 3T4TA 4EEPA 2OAP1 2PD8A 1H8MA 4UQIM 2PD7A 3T4QA 4HIAA 1GSXA 2W3FA 3PYPA 3R7WB 4Q0IA 4EU0A 3IS2B 4Z1WA 3BWLA 2V0WA 3BJNA 1S66L 3OOVA 2VX8A 4HOIA 2GNXA 3LIAA 2Z6DA 1S1YA 3TW8A 3K2NA 2Y8HA 5HD5A 3H82B 2DMWA 4GJ4A 3TRCA 2KX6A 4JGOA 3PBOA 4H6JB 5IT5A 2HJEA 3MFXA 2QKPA 3HJKA 3P01A 3LR5A 1OTDA 4HH2A 1N9LA 5DJUA 5AVFA 3E0YA 4MMNA 4HJ4A 3W2ZA 3VE4A 2J80A 1OT6A 4DJ3A 5EFWA 3B33A 2LB9A 1T1CA 2JN7A 1NLYA 1TD5A 5F69A 3T4SA 2HV1A 3PR6A 3CAXA 4Y2FA 5LBRA 2ZOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  4GHI B;  2PDR A;  2D01 A;  1S4S A;  3NOP C;  2Z6C A;  2JHE A;  5HDD A;  1MZU A;  3UB6 A;  5TBM A;  5F5Y A;  3IBR A;  4GCZ A;  1LT0 A;  3F1O B;  2CMN A;  4B9O A;  4RQ9 A;  1Y28 A;  3H9W A;  1UWN X;  2W0N A;  4BBV A;  2PYP A;  1P0Z A;  3H7W B;  3LUQ A;  4BBU A;  3E4Q A;  1TS8 A;  1LL8 A;  1X0O A;  4PKY G;  4BBT A;  4KQD A;  3UE6 A;  3KX0 X;  4EER A;  2OOL A;  1DP9 A;  2VV8 A;  5HZH A;  1XJ4 A;  1TS6 A;  5AVE A;  1N9O A;  4LRY C;  1OTE A;  3T50 A;  5J4E A;  1D7E A;  3LIB A;  4WL9 A;  3F1P B;  3ICY A;  2WKR A;  5HD3 A;  4EQ1 A;  5A8B A;  4GS9 A;  4HJ3 A;  3UB8 A;  4EW7 A;  1ODV A;  3LYX A;  4WLA A;  4I3J A;  4I5S A;  5HSQ A;  2K7S A;  2QJ7 A;  4NXB A;  4HQA A;  1XJ2 A;  4I3A A;  4F3L B;  4JGQ A;  1T19 A;  2L0W A;  4EET B;  3F1N A;  4NXG A;  4HP9 A;  3PHY A;  1OT9 A;  2L4R A;  4KUK A;  1XFQ A;  3ULF A;  1N9N A;  3SW1 A;  5G4Z A;  4HI4 A;  3GEC A;  2VV7 A;  1OTI A;  4I38 A;  4E04 A;  2GJ3 A;  2QWS A;  3ZQ5 A;  4XT2 A;  3F1O A;  3A0S A;  1F9I A;  1OJG A;  4L9F A;  5G4Y A;  1VB6 A;  3E4O A;  4R70 A;  3EWK A;  1GSV A;  1LSX A;  3UB7 A;  4I39 A;  5HWT A;  1XFN A;  4GW9 A;  3MQQ A;  1S4R A;  4HNB A;  4R38 A;  4KUO A;  1XJ3 A;  3LIF A;  2D02 A;  1UWP X;  5F6A A;  4HJ6 A;  2PR5 A;  4PKY A;  2KDK A;  4YWZ A;  4I3I A;  1DP6 A;  2VLG A;  1V9Z A;  3LI8 A;  3LI9 A;  3LIC A;  3NOT C;  3P7N A;  4L9E A;  2VEA A;  3CLO A;  4HHD A;  5TBM B;  5DJT A;  2A24 A;  2P7J A;  2OWJ A;  2B02 A;  4LRX C;  1TS0 A;  3FG8 A;  3K3C A;  3RH8 B;  3IS2 A;  2V0U A;  2R78 A;  3UB9 A;  2M1C A;  1JNU A;  1LSV A;  1DRM A;  4R3A A;  4JGR A;  3C8C A;  3H82 A;  4NXE A;  4LPZ A;  4WF0 A;  3NJA A;  4H6J A;  2L1M A;  2I9V A;  3BY9 A;  2WKP A;  4LRZ E;  1T18 A;  5I5L A;  4HP4 A;  4EES A;  3G6O A;  5HDC A;  1WA9 A;  3D72 A;  1GSW A;  2OWH A;  3MR0 A;  3CWF A;  1OTA A;  3VE3 A;  1TS7 A;  4JGP A;  4GHI A;  3NHQ A;  4GS9 B;  3EEH A;  3LID A;  5IU1 A;  2H28 A;  2ZBB A;  2WKQ A;  1F98 A;  3K3D A;  1NWZ A;  2QHK A;  1KOU A;  2YKH A;  1V9Y A;  4WN5 A;  1S67 L;  4EEU A;  2INW A;  4DJ2 A;  3E4P A;  3MQO A;  3F1N B;  4MN5 A;  3HJI A;  3GDI A;  1DP8 A;  1BYW A;  3H7W A;  2EA9 A;  2PR6 A;  3BY8 A;  4M4X A;  3VOL A;  2ZOI A;  3NOU C;  2BAS A;  1OJ5 A;  5HWV A;  4EXO A;  2PYR A;  5KIZ A;  2W27 A;  1T1A A;  2YKF A;  1UGU A;  3LIE A;  4HH3 A;  1G28 A;  4R6L A;  4LLO B;  2QJ5 A;  1XJ6 A;  4XT2 B;  1S1Z A;  3UMD A;  3C2W A;  4K08 A;  3A0R A;  5J7E A;  2V9A A;  2V1B A;  5DKK A;  3F1P A;  2PHY A;  1EW0 A;  3MJQ A;  3MXQ A;  3UME A;  2VV6 A;  1LSW A;  4MN6 A;  3A0V A;  5DKL A;  3RTY A;  3OLO A;  1OTB A;  1T1B A;  5F68 A;  4F3L A;  4L9G A;  5IS1 A;  5J3W A;  4WUJ A;  3FC7 A;  4NXF A;  1P97 A;  1D06 A;  5HWW A;  2A24 B;  2V1A A;  4HY8 A;  4EEP A;  2PD8 A;  2PD7 A;  4HIA A;  1GSX A;  3PYP A;  3IS2 B;  3BWL A;  2V0W A;  1S66 L;  4HOI A;  3LIA A;  2Z6D A;  1S1Y A;  5HD5 A;  3H82 B;  2KX6 A;  4JGO A;  4H6J B;  3MFX A;  2QKP A;  3HJK A;  1OTD A;  4HH2 A;  1N9L A;  5DJU A;  5AVF A;  4HJ4 A;  3VE4 A;  2J80 A;  1OT6 A;  4DJ3 A;  5EFW A;  3B33 A;  1T1C A;  2JN7 A;  5F69 A;  2HV1 A;  3CAX A;  2ZOH A; 
#chains in the Genus database with same CATH topology
 5HDS A;  5TGF A;  2GX5 A;  2PDR A;  3T1R A;  2Z6C A;  3O3V A;  1BZA A;  5BOH A;  1O7E A;  4PM8 A;  4Y0T A;  3UB6 A;  4IBX A;  3IF6 A;  1MWT A;  5F5Y A;  1CK3 A;  3CMZ A;  1IEL A;  3QP6 A;  3SS4 A;  4GCZ A;  4IVK A;  4Z9Q A;  4KG2 A;  1STZ A;  3G35 A;  4ETX A;  3S7O A;  1OPX A;  3H9W A;  4WEL A;  2Y91 A;  3LR4 A;  2W0N A;  2VK3 A;  4BBV A;  4OVD A;  4II7 A;  4Y15 A;  3H7W B;  4BBU A;  3E4Q A;  3GSG A;  1IEM A;  4C6Y A;  4BBT A;  2WGW A;  2EWW A;  1XGI A;  3WRT A;  2V2F F;  2P08 A;  3BEC A;  1M6K A;  3T1S A;  2J7V A;  2R9X A;  2JCH A;  1XJ4 A;  4H8R A;  3KYQ A;  4KG6 A;  5HPI A;  1PZP A;  3PBS A;  3MXS A;  4JF5 A;  1N9O A;  5L07 A;  1D7E A;  1ES3 A;  2H10 A;  3UY6 A;  2X01 A;  5G18 A;  2ZM2 A;  2X71 A;  1ZHH B;  1Z09 A;  1MWS A;  3GMW A;  4I3J A;  4I5S A;  4S2N C;  5HSQ A;  2VGL S;  1KGF A;  4PM9 A;  3P98 A;  4JXW A;  3C30 A;  4MDZ A;  1KVL A;  3G30 A;  2GZA A;  2MJ6 A;  1G6A A;  1E3U D;  1N9N A;  1IYQ A;  1SDE A;  4XXR A;  3ZNY A;  4LEN A;  3BW6 A;  4HI4 A;  2VV7 A;  2EX9 A;  1OTI A;  4CLC D;  2GJ3 A;  1SDN A;  2B18 A;  3S4X A;  5FEG A;  5CEB A;  4S2K A;  1FSW A;  5FDS A;  1VEU B;  3ZQ5 A;  3GRJ A;  3F1O A;  4KEN B;  3WRZ A;  3A0S A;  3KO6 A;  2JBF A;  3EQU A;  3S7P A;  3HLG A;  3E4O A;  3UDI A;  4GD8 A;  3EWK A;  1PW1 A;  5IHV A;  3CZD A;  3UB7 A;  2WAF A;  1XFN A;  4GW9 A;  1S4R A;  3PTE A;  4KUO A;  2HP9 A;  1XJ3 A;  2QZ6 A;  2D02 A;  5F6A A;  4HJ6 A;  2PR5 A;  5DTT A;  2HF6 A;  2KDK A;  4YWZ A;  3A3F A;  2XH9 A;  1LHY A;  3LI8 A;  3LI9 A;  3ITB A;  1FSY A;  4LV2 A;  4U0T A;  4BQM A;  3NY4 A;  2OV5 A;  4EBN A;  5FAO A;  3CLO A;  1TF1 A;  3Q7V B;  3IF6 C;  5TBM B;  2A24 A;  3FYZ A;  3OPL A;  2OAQ 1;  3KSF A;  2JC7 A;  2OWJ A;  4LRX C;  3UPO A;  1TS0 A;  5HAR A;  1F5M A;  4RA7 A;  2M1C A;  2J9P A;  5DTS A;  4WEK A;  1DRM A;  1NJ4 A;  1PFL A;  2OSU A;  4ZJ1 A;  4R23 A;  4JGR A;  2PBY A;  3C8C A;  3H82 A;  5HAP A;  1RGY A;  2XGN A;  2VA0 A;  1NLZ A;  2G2W A;  1ERO A;  1FCM A;  3CIT A;  4X55 A;  2IWC A;  1Y54 A;  3IX8 A;  3VP0 A;  4B4X A;  4LRZ E;  4UHU A;  1ESU A;  4OQI A;  4UA9 A;  3MZF A;  3V5M A;  3T1X A;  1CI8 A;  3D72 A;  1GSW A;  3NEC A;  3TOI A;  2OWH A;  3HUO A;  3FPW A;  1BLP A;  3CWF A;  1LLB A;  3IBJ A;  3ZCZ A;  2P74 A;  4JGP A;  1G68 A;  1E3U A;  3NHQ A;  4GS9 B;  1NRF A;  1JVJ A;  1K54 C;  3EEH A;  3OPH A;  3ZG5 A;  4Q0J A;  3RXX A;  4ARZ A;  3CPT A;  1NWZ A;  3HLB A;  3HLW A;  5FI7 A;  3BQ8 A;  4ZRR A;  4CLC A;  3JYI A;  3DW0 A;  3M6B A;  4DKI A;  4JPM A;  2INW A;  1YLZ A;  5HW3 A;  5FAT A;  3MQO A;  3Q81 A;  2ZQD A;  4O8G A;  1LL9 A;  1DP8 A;  4U0X A;  2IWD A;  3PXP A;  3VP3 A;  3R4K A;  5MC7 A;  5TR7 A;  2AVX A;  3BY8 A;  4WYY A;  1ESI A;  3LO7 A;  3NOU C;  2W1T A;  1OJ5 A;  1NYM A;  2DNS A;  2Y2Q A;  2ZM8 A;  2PYR A;  5KIZ A;  3EEA A;  4LCL A;  2YKF A;  3HCY A;  1L0G A;  5KZH A;  4LLO B;  4D2O A;  4R3B A;  1KGE A;  3UE3 A;  2XRN A;  2W3G A;  4G3K A;  4GB7 A;  1YLY A;  3C4O A;  1I5Q A;  4R3J A;  2V9A A;  2V1B A;  3TG9 A;  5DKK A;  4JLF A;  4CJN A;  4HEF A;  3IX4 A;  3E2L A;  1ZG4 A;  4KQO A;  3OC2 A;  3PBR A;  4GKU A;  4GOG A;  3OCL A;  4NK3 A;  5JYP A;  1T1B A;  2ZJ9 A;  1GCE A;  1MKI A;  5F68 A;  3BLM A;  2VGL M;  3BM6 A;  4FSF A;  5M19 A;  4F3L A;  3Q07 A;  4QD4 A;  3JVU A;  4X25 A;  4PM6 A;  5IS1 A;  3FC7 A;  1D06 A;  1H3Q A;  4PAU A;  4UAA A;  2ZQ7 A;  5FQI A;  3ZVT A;  5M1A A;  4HY8 A;  2OAP 1;  4HIA A;  3VP1 A;  3FV7 A;  5CGX A;  4OQ0 A;  3UDF A;  1KDW A;  4Q0I A;  3CG5 A;  3IS2 B;  2ZC7 A;  3IXG A;  4N9K A;  4GNU A;  4Z1W A;  1PWG A;  2V0W A;  4S2P A;  4DE2 A;  1JTG A;  3LY3 A;  4LV3 A;  2Y8H A;  5HD5 A;  2IWB A;  1F2K A;  1S6R A;  1AXB A;  4ZDX A;  3PBO A;  2HJE A;  1HD8 A;  3MFX A;  2P9V B;  1HTZ A;  1KE3 A;  4HJ4 A;  3UN7 A;  1PWC A;  3W2Z A;  3VFH A;  2Y2P A;  5EFW A;  2HDU A;  4X1L A;  4OQH A;  2EXB A;  1JWZ A;  3PR6 A;  4KZ5 A;  5KSC A;  4Y2F A;  5LBR A;  3V3S A;  3GR2 A;  3MKF A;  4GHI B;  1H8Z A;  1VM1 A;  5DTK A;  5EVE A;  4LV0 A;  3DWZ A;  1S4S A;  1S0W A;  1ONH A;  4JXG A;  2B95 A;  5GLB A;  4ME4 A;  4MN7 A;  1IKI A;  1FIK A;  2W3E A;  4OOM A;  2LB5 A;  1LI0 A;  2CMN A;  3O88 A;  1NY0 A;  4RQ9 A;  1JTD A;  4OQG A;  1Y28 A;  3ZG8 B;  4Y0U A;  1MWU A;  3L9K A;  5L2F A;  2W3D A;  1Q2P A;  1P0Z A;  2O9C A;  4Y17 A;  1LL8 A;  3OZH A;  5A92 A;  3A3D A;  1L0D A;  2EX2 A;  3U4L P;  3KX0 X;  5AQ9 A;  3RFB A;  4EER A;  2OOL A;  2ZQ9 A;  2ZLY A;  5AJG A;  4WZ5 A;  1HLU P;  3NCK A;  5AVE A;  4WBG A;  4LRY C;  1OTE A;  4PHT A;  3DAV A;  4Y3I A;  3T50 A;  5J4E A;  1C3B A;  3UNW A;  3LIB A;  2XQZ A;  4OP5 A;  3D3O A;  3F1P B;  2VGK A;  1ES4 A;  5CHJ A;  4E3N A;  3UB8 A;  3LYX A;  4WLA A;  2CC1 A;  2XF3 A;  2M7U A;  3NI9 A;  4P0M A;  3MQ0 A;  3QHY A;  2K7S A;  3G31 A;  1SKO B;  4HES A;  1YMS A;  4I3A A;  3EGD C;  1YLW A;  2E8I A;  3DTK A;  5DVA A;  5DFX A;  4EET B;  5TJJ A;  3F1N A;  2ZC3 B;  1I2W A;  4X68 A;  5L09 A;  4ZBE A;  4QB8 A;  4HP9 A;  3HL9 A;  3LFV A;  2ZL1 A;  4KQQ A;  3UB5 P;  4OLG A;  2P04 A;  1VET A;  3ULF A;  3A3E A;  1PI5 A;  4E3I A;  4JKT A;  5EV0 A;  3SW1 A;  5G4Z A;  1KE0 A;  4G3W A;  1Q2Q A;  1VQQ A;  2ACG A;  5AQ7 A;  2J3T D;  2PBD P;  1CEF A;  2XK1 A;  2A49 A;  2BLS A;  3DTI A;  1EI5 A;  1NYY A;  2Q9N A;  4MCW A;  3B3X A;  1F9I A;  4X69 A;  4CLC E;  4E6X A;  1CQA A;  5G4Y A;  3VSL A;  1BUL A;  3HLD A;  4YOF A;  3T4L A;  1DJC A;  1GHM A;  4I39 A;  1LI9 A;  1YSQ A;  1CEG A;  4LCM A;  3D4F A;  3LIF A;  4KZ3 A;  3C4P A;  4PKY A;  2KOI A;  3N7W A;  4B4Z A;  1DP6 A;  2FFY A;  2FZ0 A;  1V9Z A;  2ZQA A;  4QHC A;  2E8J A;  1NXY A;  3NOT C;  3A3J A;  3TE8 A;  3TJZ C;  3IF6 B;  5HL6 A;  2G2U A;  2XD5 A;  3CUE A;  4GLQ A;  5DJT A;  4HHD A;  2P7J A;  3G32 A;  3N8S A;  5FAQ A;  3MS6 A;  2B02 A;  4RYE A;  3NDG A;  1BLC A;  3K3C A;  1FCN A;  3RH8 B;  2KLI A;  5FAP A;  1XKZ A;  3HVF A;  3KSH A;  4BL3 A;  1JNU A;  1PWD A;  3VP2 A;  5FI2 A;  1PRQ A;  2FH5 A;  3IHB A;  2O9A A;  3HBR A;  5HAQ A;  2G7U A;  4NXE A;  2WGW B;  4LPZ A;  2L1M A;  2EX8 A;  4S2J A;  2I9V A;  2WKP A;  2FFF B;  5I5L A;  3W8K A;  3BFE A;  3D9Y A;  3C7U A;  3U2A A;  3Q82 A;  2VJW A;  3HLC A;  3V3R A;  2ZMV A;  3DWK A;  1WYC A;  2K31 A;  3VE3 A;  1TS7 A;  5GLD A;  3S22 A;  3ZG7 B;  5CTN A;  3HUM A;  2H28 A;  2ZBB A;  4OPZ A;  2QHK A;  3LGO A;  4BWI A;  1KOU A;  2A3U A;  1HVB A;  4P85 A;  2ZM0 A;  1NRJ A;  1IYS A;  1S67 L;  2PU2 A;  4BMW A;  1WYB A;  4EEU A;  4DJ2 A;  2R9W A;  3E4P A;  4DN0 A;  5E2G A;  2J8Y A;  2WAE A;  5AQB A;  3G2Z A;  1GHI A;  3MZE A;  3OBF A;  5FDH A;  2M7V A;  1YAX A;  5EVI D;  3MMH A;  4BD1 A;  4CPK A;  2ZC5 B;  1UGU A;  1IOU A;  4WM9 A;  1XJ6 A;  5GHY A;  1S1Z A;  3UMD A;  4NKP A;  5A90 A;  4IJG A;  1MPL A;  1K57 A;  4K08 A;  3DBA A;  3O5Y A;  3A3I A;  3KYE A;  1XPB A;  3E98 A;  5J7E A;  1VHM A;  2Y59 A;  4EBP A;  2PHY A;  1K56 D;  1EW0 A;  3MJQ A;  1CI9 A;  1L3L A;  3UME A;  4KZB A;  2VKS A;  1G6O A;  4IBR A;  3PBT A;  3WS0 A;  3QP5 A;  3M2K A;  4B93 A;  3MSH A;  3C5A A;  4FH4 A;  3QP8 A;  4DRT A;  3OCN A;  5J3W A;  4LGW A;  1P97 A;  4S2M A;  2V8F A;  3N6I A;  5HWW A;  1PYY A;  3UPP A;  4MBH A;  2A24 B;  3CHW P;  3Q7Z A;  4EEP A;  2HDS A;  3FKV A;  2JE5 A;  2W3F A;  4NG2 A;  4PM5 A;  1SCW A;  1W7F A;  2Y2M A;  5FQQ A;  4QY5 A;  3NC8 A;  4HOI A;  2GNX A;  3VSK A;  3LIA A;  2Z6D A;  5CXW A;  4N92 A;  3TW8 A;  3K2N A;  3H82 B;  5FSR A;  1K55 A;  4DE0 A;  5CHU A;  3HJK A;  3P01 A;  3IH8 A;  3BRM A;  4JF6 A;  4MLL A;  3ZVW A;  3QP1 A;  4QY6 A;  2BTF P;  3W4Q A;  3VE4 A;  2J80 A;  4DJ3 A;  1T1C A;  4KG5 A;  2JN7 A;  1TD5 A;  5EOO A;  4KZ9 A;  2ZOH A;  3IT9 A;  2HP5 A;  4LFU A;  4MEZ A;  3BQA A;  4ZTK A;  4ARZ B;  3CPT B;  4DMZ A;  1ZKJ A;  4KZA A;  5EVI A;  3M2J A;  2JHE A;  1FIL A;  4RVA A;  3IXB A;  4CLC B;  2HDQ A;  2J3T C;  4RX3 A;  3B42 A;  3IBR A;  3M6H A;  2XEP A;  4S2O A;  2V1Z A;  3KSG A;  4B9O A;  4IUH A;  2PRF A;  3ZNT A;  4NEE D;  3S1Y A;  3IH9 A;  1K4F A;  3HUN A;  1MC0 A;  1YPR A;  1XA7 A;  3LUQ A;  1K56 A;  1YMX A;  2QYB A;  2W1T B;  4KQD A;  4E3J A;  4Y7P A;  3CJM A;  1OME A;  3UE6 A;  5CRF A;  3T4K A;  4S2I A;  2VV8 A;  5HZH A;  3Q1F A;  5EVL A;  4Q0H A;  3W4O A;  4HBT A;  2EFU A;  1ONG A;  5AQA A;  1ES5 A;  1K57 C;  1ZTU A;  4P6B A;  2W3H A;  5DF8 A;  3V67 A;  5HD3 A;  4EQ1 A;  2C6W B;  5HL1 A;  4C3Q A;  3SH7 A;  4B88 A;  5KMW A;  3KSI A;  4EUV A;  2QJ7 A;  3AGD A;  4NXB A;  4HQA A;  2P9V A;  2Y2I A;  3W4P A;  4UEY A;  1XJ2 A;  3BYD A;  1WE4 A;  4F3L B;  3N8R A;  2Z2M B;  2L0W A;  4X6T A;  3LY4 A;  4E3L A;  4NXG A;  3PHY A;  1RP5 A;  3HLF A;  3EGX C;  3ITA A;  5EE8 A;  2L4R A;  1XFQ A;  2JKF A;  4K0X A;  1K38 A;  4FCF A;  2WZZ A;  3GEC A;  1L2S A;  2Q0O A;  4U3T A;  4E04 A;  3OPP A;  5FL3 A;  1W63 M;  5CX7 A;  4Q8I A;  3JPU A;  2Z2L B;  1KDS A;  5F1G A;  4XT2 A;  1K55 C;  1PI4 A;  5JYO A;  3HLE A;  4L9F A;  1BT5 A;  4E6W A;  1VB6 A;  4R70 A;  4CLC C;  2C5W B;  4DE1 A;  4N1X A;  4X56 A;  3SH9 A;  4QJG A;  1GSV A;  1LSX A;  5HWT A;  4EBL A;  1FR6 A;  1YLJ A;  4BJP A;  4Y0O A;  5E2E A;  2UWX A;  3VOY A;  1BUE A;  5FEF A;  4QU3 A;  2WK0 A;  3WS5 A;  3LCE A;  2WZX A;  2O0Y A;  2XR0 A;  3B47 A;  4I3I A;  3SS5 A;  1DJA A;  5GHX A;  2VLG A;  2Y55 A;  3LIC A;  2Y2J A;  1YT4 A;  1E4D A;  3PBQ A;  2WGI A;  2PU4 A;  5EVI C;  2VEA A;  4PM7 A;  1FR1 A;  2EWV A;  3N8L A;  2XD1 A;  4WMC D;  3V50 A;  5EPH A;  1FCO A;  3KYZ A;  1DY6 A;  2ZQ8 A;  4P6Z M;  2JKR I;  2XA7 M;  4GN2 A;  2GDN A;  4R4R A;  3R7W A;  1L0E A;  4IUK A;  2UV0 E;  2J3W A;  1MY8 A;  3DTM A;  2WKH A;  4OH0 A;  5HX9 A;  4S2N A;  1LSV A;  4R3A A;  4MBF A;  1K4E A;  3CI6 A;  2B5R A;  5EM1 A;  1QME A;  4H6J A;  2IA2 A;  1XGJ A;  3BFD A;  5KSH A;  2EX6 A;  2BG1 A;  3HRE A;  3NBL A;  1D1J A;  2O9B A;  4KQR A;  2Y2K A;  3PAE A;  5FQK A;  3G6O A;  5GLC A;  2XSS A;  2EFX A;  5HDC A;  1WA9 A;  1K25 A;  3O86 A;  1SHV A;  1OTA A;  4KZ4 A;  5I94 A;  4DXC A;  2OLU A;  3LID A;  5IU1 A;  4O0P A;  3IQA A;  4QPR A;  4ETZ A;  1H5X A;  3K3D A;  4E3O A;  2VZW A;  2QMI A;  2HZ5 A;  4O01 A;  1KGG A;  2YKH A;  3UPN A;  4WN5 A;  4RX2 A;  1W8Q A;  3F1N B;  3NIA A;  4MN5 A;  3VV4 A;  3HJI A;  2HGV A;  2HDR A;  3BFG A;  3SS3 A;  5M18 A;  3T4J A;  1VET B;  2ZMF A;  3IHA A;  4DF6 A;  1IYO A;  3GQZ A;  1BYW A;  3H7W A;  4LV1 A;  3VOL A;  4M4X A;  4XUX A;  1AWI A;  1YLP A;  3FPV A;  2JKG A;  1G5U A;  4EXO A;  2W27 A;  4JXS A;  2HJ9 C;  4HH3 A;  3LIE A;  4FUW A;  4GD6 A;  4DDS A;  1G28 A;  1CF0 A;  2QJ5 A;  2ZC4 B;  2NUT C;  4X53 A;  3C2W A;  1ACF A;  1JWP A;  4UA7 A;  3RXW A;  4C75 A;  3LEQ A;  4ZJ3 A;  4OON A;  3A0R A;  2PAV P;  3ISG A;  1SKF A;  2EXA A;  4WMC A;  2JKT I;  3S7Q A;  1TDG A;  2HPB A;  2VV6 A;  4CQH A;  4R4S A;  3S7N A;  3A0V A;  5DKL A;  4FTX A;  4OOL A;  2RCX A;  3RTY A;  3OLO A;  1OTB A;  3T4O A;  3VOZ A;  2RL3 A;  2JKR M;  2NUP C;  1DJB A;  3T1Q B;  3BFC A;  4L9G A;  1NZU A;  4ESP A;  3T4T A;  3BLS A;  4QWO A;  4WZ5 C;  4UQI M;  2PD7 A;  3T4Q A;  5CGW A;  1GSX A;  4GDN A;  1K54 A;  1GA9 A;  3PYP A;  3AGE A;  1I2S A;  3BJN A;  1S66 L;  3OOV A;  4OP8 A;  3IXH A;  1VEU A;  2DMW A;  4JGO A;  5IT5 A;  5CHM A;  5GHZ A;  1TVF A;  4EV4 A;  2QKP A;  3LR5 A;  1N9L A;  5DJU A;  3C7V A;  5AVF A;  3E0Y A;  4MMN A;  1YLT A;  5HFO A;  1RCJ A;  3B33 A;  1PIO A;  4ZAM A;  3T4S A;  3G2Y A;  4K0W A;  3MZD A;  3CAX A;  2XDM A;  4A5R A;  5FAS A;  1FQG A;  3WS1 A;  3SZT A;  2D01 A;  5E2F A;  5A91 A;  3NOP C;  4WZ4 A;  4PMA A;  3IXD A;  3IWQ A;  3WWX A;  5HDD A;  1MZU A;  5CER A;  3Q7V A;  4PPR A;  4R1G A;  1IFQ A;  5TBM A;  3BFF A;  5L10 A;  1LT0 A;  3F1O B;  4EQI A;  1E25 A;  3RJU A;  3DTE A;  1UWN X;  4KZ6 A;  2PYP A;  1EWZ A;  1PW8 A;  2W1R A;  1TS8 A;  1X0O A;  4PKY G;  4BL2 A;  1N9B A;  1Y4O A;  3ZDJ A;  3MBZ A;  1GHP A;  5D3O A;  1YM1 A;  1YQS A;  2Y2N A;  1DP9 A;  4WEJ A;  2XLN A;  1BLS A;  1TS6 A;  2JKT M;  4FH2 A;  4EUZ A;  2Y2O A;  4OPQ A;  1IYP A;  2K2N A;  1O07 A;  4ID4 A;  3CUE C;  2I72 A;  4WL9 A;  3ICY A;  4P6Z S;  2WKR A;  1YKD A;  2XA7 S;  5A8B A;  3MXR A;  4GS9 A;  4HJ3 A;  3VFF A;  2OLV A;  1BSG A;  4EW7 A;  1ODV A;  5CED A;  3GTC A;  2XFS A;  3IWI A;  4S2L A;  4JGQ A;  1T19 A;  4BEN A;  5HPF A;  4OPY A;  1IKG A;  1OT9 A;  4IHQ A;  1XX2 A;  4KUK A;  2HP6 A;  2H0T A;  3NDE A;  1TEM A;  4N1H A;  4DDY A;  1W63 Q;  4E3M A;  2DRW A;  1K0K A;  1W8Y A;  2XRO A;  3QP4 A;  5TFQ A;  5F82 A;  4M3K A;  4I38 A;  5A93 A;  5DF7 A;  2QWS A;  5HAI A;  3AGF A;  1U60 A;  1K6S A;  1YSP A;  2Y2H A;  5K5B A;  1OJG A;  3MFD A;  1JWV A;  5E2H A;  3VP4 A;  2Y2G A;  2Y2L A;  3MF0 A;  1CJF A;  1W79 A;  3LR3 A;  1ES2 A;  2ZC6 B;  3MQQ A;  1BLH A;  4HNB A;  1ZC2 A;  4R38 A;  4D60 A;  4YFM A;  4GZB A;  3QNB A;  1UWP X;  2A2L A;  5FQ9 A;  2H0Y A;  3ZG9 B;  3E2K A;  4K91 A;  3P7N A;  3TSG A;  4BLM A;  5EOE A;  2PT7 A;  5EVI B;  4L9E A;  4R0Q A;  3PBN A;  3V39 A;  3SH8 A;  1RGZ A;  3LEZ A;  4BD0 A;  1MBL A;  3JVV A;  2Y79 A;  3FG8 A;  3C38 A;  4JXV A;  3IX3 A;  3GV9 A;  3QNC A;  4O7D A;  3EOI A;  3WS4 A;  3IS2 A;  3GVB A;  2V0U A;  3SOI A;  2R78 A;  4E3K A;  3UB9 A;  4EWF A;  4P87 A;  1XA1 A;  1N4O A;  1MKM A;  4IVI A;  3I7J A;  3T12 B;  2O99 A;  4WF0 A;  3NJA A;  5EM0 A;  3ZYT A;  1ALQ A;  3BY9 A;  5EUA A;  1PZO A;  3UO9 A;  1T18 A;  1FOF A;  4XUZ A;  3EQV A;  3PAG A;  4HP4 A;  5GL9 A;  1MWR A;  3LR0 A;  1BTL A;  3FWL A;  2WGV A;  4EES A;  1K6R A;  2V20 A;  4X1M A;  3MR0 A;  4L0L A;  1SZV A;  2ZQC A;  4UQI S;  3G34 A;  4GHI A;  1P9W A;  5CTM A;  2V8C A;  1P9R A;  2WKQ A;  1GA0 A;  2WYX A;  1F98 A;  2WKE A;  3ZG0 A;  1V9Y A;  4N9L A;  4KZ8 A;  4OOY A;  1M40 A;  1PNE A;  1XP4 A;  2QPN A;  3WS2 A;  3GDI A;  2H5S A;  2ZMA A;  4KZ7 A;  2X02 A;  4YNR A;  1HZO A;  3ZFZ A;  4UA6 A;  3IF5 A;  4DE3 A;  2J9O A;  5FA7 A;  2EA9 A;  2PR6 A;  4IED A;  2ZOI A;  3G4P A;  2WAD A;  5C5K A;  2BAS A;  3OPR A;  5HWV A;  1T1A A;  4FD8 A;  4OPR A;  4R6L A;  3UE0 A;  4XT2 B;  1KE4 A;  3NUL A;  3BEB A;  3ZGA B;  2WKI A;  1ERM A;  1NZO A;  2Q9M A;  5L8M A;  1MXO A;  1L0F A;  5DF9 A;  1H8Y A;  1XXM A;  3F1P A;  3MXQ A;  4Y5F A;  4G3V A;  1TDL A;  3UE1 A;  1LSW A;  4MN6 A;  1H0M A;  4DXB A;  2VGJ A;  3ZHH A;  5FQM A;  3QP2 A;  4ZJ2 A;  4GDB A;  5CEC A;  1W5D A;  1SKO A;  5CGS A;  4Y13 A;  1LL5 A;  5F83 A;  1J3W A;  5J8X A;  4WUJ A;  4YIN A;  1QMF A;  4NXF A;  5U47 A;  5GLA A;  5F1F A;  1J9M A;  5DFY A;  4FOF A;  2V1A A;  4HBU A;  4AFI A;  3N4I A;  1ERQ A;  1KVM A;  2PD8 A;  1H8M A;  3L7H A;  2Y4A A;  3FKW A;  3IWO A;  3R7W B;  4EU0 A;  3BWL A;  3VMA A;  5FI6 A;  2WUQ A;  4MNR A;  4NET A;  2VX8 A;  2DCF A;  1S1Y A;  1Z6F A;  1ZG6 A;  4OLD A;  4GJ4 A;  3TRC A;  4JF4 A;  3FZC A;  2KX6 A;  5EEC A;  2XFT A;  4JBF A;  3MKE A;  4H6J B;  4OKP A;  1OTD A;  4HH2 A;  2ZD8 A;  1A0K A;  5E43 A;  3O87 A;  1OT6 A;  5FQJ A;  2LB9 A;  1NLY A;  3P09 A;  5F69 A;  4F94 A;  2HV1 A;  2ZL1 B;  4MBK A;  3UDX A; 
#chains in the Genus database with same CATH homology
 5HDS A;  4GHI B;  2GX5 A;  2PDR A;  2D01 A;  1S4S A;  3NOP C;  3BQA A;  4ARZ B;  2Z6C A;  4DMZ A;  4ME4 A;  4MN7 A;  2JHE A;  5HDD A;  1MZU A;  3UB6 A;  4CLC B;  2W3E A;  5TBM A;  1IFQ A;  2J3T C;  3B42 A;  5F5Y A;  3IBR A;  4OOM A;  2LB5 A;  4GCZ A;  1LT0 A;  3F1O B;  2CMN A;  1STZ A;  3KSG A;  4B9O A;  4ETX A;  4RQ9 A;  4IUH A;  3S7O A;  1Y28 A;  4NEE D;  1OPX A;  3H9W A;  4WEL A;  1UWN X;  3LR4 A;  2W0N A;  2W3D A;  4BBV A;  2PYP A;  1MC0 A;  1P0Z A;  4II7 A;  3H7W B;  3LUQ A;  4BBU A;  2W1R A;  3E4Q A;  1TS8 A;  2O9C A;  1LL8 A;  1X0O A;  2QYB A;  2W1T B;  4PKY G;  4BBT A;  4KQD A;  2EWW A;  3UE6 A;  3KX0 X;  2P08 A;  3T4K A;  3RFB A;  4EER A;  2OOL A;  1DP9 A;  4WEJ A;  2VV8 A;  5HZH A;  1XJ4 A;  5AJG A;  1TS6 A;  2JKT M;  3KYQ A;  4Q0H A;  5HPI A;  5AVE A;  3PBS A;  1N9O A;  4LRY C;  1OTE A;  4PHT A;  3T50 A;  4Y3I A;  2K2N A;  5J4E A;  1ZTU A;  1D7E A;  3CUE C;  3LIB A;  3D3O A;  2W3H A;  4WL9 A;  3F1P B;  3ICY A;  4P6Z S;  2WKR A;  3V67 A;  1YKD A;  2XA7 S;  5HD3 A;  4EQ1 A;  5A8B A;  4GS9 A;  4HJ3 A;  3UB8 A;  4EW7 A;  1ZHH B;  1ODV A;  3LYX A;  4WLA A;  4I3J A;  2M7U A;  4I5S A;  3KSI A;  3MQ0 A;  4EUV A;  5HSQ A;  2K7S A;  2QJ7 A;  4NXB A;  2VGL S;  4HQA A;  4UEY A;  1XJ2 A;  4I3A A;  3EGD C;  4F3L B;  4JGQ A;  1T19 A;  2L0W A;  5DFX A;  4EET B;  5TJJ A;  3F1N A;  3C30 A;  4NXG A;  4MDZ A;  5HPF A;  4HP9 A;  3PHY A;  3EGX C;  1OT9 A;  2GZA A;  3LFV A;  2MJ6 A;  4IHQ A;  2L4R A;  2P04 A;  4KUK A;  1XFQ A;  3ULF A;  1N9N A;  1W63 Q;  3BW6 A;  5G4Z A;  3SW1 A;  4HI4 A;  2XRO A;  3GEC A;  2VV7 A;  1OTI A;  4G3W A;  4I38 A;  4CLC D;  4E04 A;  5FL3 A;  2J3T D;  1W63 M;  2GJ3 A;  5CX7 A;  2B18 A;  2QWS A;  3ZQ5 A;  4XT2 A;  3F1O A;  4MCW A;  1YSP A;  3A0S A;  3KO6 A;  5K5B A;  1F9I A;  4CLC E;  1OJG A;  3EQU A;  4L9F A;  5G4Y A;  1VB6 A;  3S7P A;  3E4O A;  4R70 A;  4CLC C;  4YOF A;  3EWK A;  3T4L A;  3MF0 A;  1GSV A;  1LSX A;  3UB7 A;  4I39 A;  5HWT A;  3LR3 A;  1XFN A;  4GW9 A;  3MQQ A;  1S4R A;  1YSQ A;  4HNB A;  4BJP A;  4R38 A;  4KUO A;  1XJ3 A;  3LIF A;  2D02 A;  1UWP X;  2A2L A;  5F6A A;  4HJ6 A;  2PR5 A;  4PKY A;  2HF6 A;  2O0Y A;  2KOI A;  2KDK A;  3B47 A;  4YWZ A;  4I3I A;  1DP6 A;  2FZ0 A;  2VLG A;  1V9Z A;  3LI8 A;  3LI9 A;  3LIC A;  3NOT C;  3P7N A;  2PT7 A;  3PBQ A;  3TE8 A;  3TJZ C;  4L9E A;  2VEA A;  3CLO A;  3PBN A;  5HL6 A;  1TF1 A;  2EWV A;  3CUE A;  4GLQ A;  4HHD A;  5DJT A;  5TBM B;  2A24 A;  2P7J A;  3KYZ A;  2OAQ 1;  3KSF A;  2OWJ A;  3JVV A;  2B02 A;  4LRX C;  4P6Z M;  3FG8 A;  1TS0 A;  2JKR I;  2Y79 A;  3C38 A;  2XA7 M;  3K3C A;  3R7W A;  3EOI A;  3RH8 B;  3IS2 A;  2KLI A;  4IUK A;  2J3W A;  2V0U A;  2R78 A;  1F5M A;  2M1C A;  3UB9 A;  3KSH A;  1JNU A;  4WEK A;  1LSV A;  1DRM A;  4R3A A;  2FH5 A;  4JGR A;  3C8C A;  2O9A A;  3CI6 A;  2G7U A;  1MKM A;  3H82 A;  4NXE A;  2VA0 A;  1NLZ A;  2O99 A;  4LPZ A;  3NJA A;  4WF0 A;  3ZYT A;  4H6J A;  2IA2 A;  2L1M A;  3CIT A;  5KSH A;  2I9V A;  3BY9 A;  2WKP A;  4LRZ E;  1T18 A;  5I5L A;  3EQV A;  4HP4 A;  2O9B A;  3U2A A;  3LR0 A;  4EES A;  3G6O A;  2XSS A;  5HDC A;  1WA9 A;  3D72 A;  2VJW A;  1GSW A;  2OWH A;  3FPW A;  2ZMV A;  3MR0 A;  4L0L A;  3CWF A;  2K31 A;  3IBJ A;  1OTA A;  4UQI S;  3VE3 A;  1TS7 A;  4JGP A;  4GHI A;  1P9W A;  3NHQ A;  4GS9 B;  1P9R A;  3EEH A;  3LID A;  2H28 A;  5IU1 A;  2ZBB A;  2WKQ A;  4O0P A;  4Q0J A;  4QPR A;  4ARZ A;  1F98 A;  4ETZ A;  3K3D A;  1NWZ A;  2VZW A;  2QHK A;  4BWI A;  1KOU A;  4O01 A;  3BQ8 A;  4ZRR A;  4CLC A;  2YKH A;  1V9Y A;  1NRJ A;  4WN5 A;  1S67 L;  4BMW A;  4EEU A;  2INW A;  4DJ2 A;  3E4P A;  3MQO A;  3F1N B;  4DN0 A;  4MN5 A;  3VV4 A;  3HJI A;  3GDI A;  2HGV A;  4O8G A;  1DP8 A;  3T4J A;  4YNR A;  2ZMF A;  3PXP A;  3R4K A;  5MC7 A;  3OBF A;  1BYW A;  3H7W A;  2EA9 A;  2PR6 A;  3BY8 A;  4M4X A;  3VOL A;  2M7V A;  2ZOI A;  5C5K A;  3NOU C;  1YAX A;  2W1T A;  3MMH A;  2BAS A;  1OJ5 A;  3FPV A;  5HWV A;  4EXO A;  2PYR A;  5KIZ A;  2W27 A;  3EEA A;  1T1A A;  2HJ9 C;  2YKF A;  1UGU A;  3HCY A;  3LIE A;  4HH3 A;  1IOU A;  1G28 A;  4R6L A;  4LLO B;  2QJ5 A;  1XJ6 A;  4XT2 B;  2NUT C;  1S1Z A;  3UMD A;  4NKP A;  3UE3 A;  2XRN A;  3C2W A;  2W3G A;  4G3K A;  4IJG A;  5L8M A;  4K08 A;  3DBA A;  3O5Y A;  3A0R A;  3E98 A;  5J7E A;  1VHM A;  2V9A A;  5DF9 A;  2V1B A;  5DKK A;  3F1P A;  2PHY A;  2JKT I;  1EW0 A;  3MJQ A;  3MXQ A;  3S7Q A;  4Y5F A;  4G3V A;  3UME A;  2VV6 A;  1LSW A;  4KQO A;  4MN6 A;  2VKS A;  1G6O A;  4CQH A;  3OC2 A;  3PBR A;  3PBT A;  3S7N A;  3A0V A;  3OCL A;  5DKL A;  4OOL A;  3RTY A;  3OLO A;  4B93 A;  1OTB A;  1T1B A;  3T4O A;  5F68 A;  2VGL M;  4FSF A;  2JKR M;  4F3L A;  2NUP C;  3JVU A;  4L9G A;  3OCN A;  5J3W A;  5IS1 A;  4WUJ A;  3FC7 A;  4NXF A;  1P97 A;  1D06 A;  1H3Q A;  4PAU A;  5HWW A;  5DFY A;  2A24 B;  4FOF A;  2V1A A;  4HY8 A;  4AFI A;  3T4T A;  4EEP A;  2OAP 1;  2PD8 A;  1H8M A;  4UQI M;  2PD7 A;  3T4Q A;  4HIA A;  1GSX A;  2W3F A;  3PYP A;  3R7W B;  4Q0I A;  4EU0 A;  3IS2 B;  4Z1W A;  3BWL A;  2V0W A;  3BJN A;  1S66 L;  3OOV A;  2VX8 A;  4HOI A;  2GNX A;  3LIA A;  2Z6D A;  1S1Y A;  3TW8 A;  3K2N A;  2Y8H A;  5HD5 A;  3H82 B;  2DMW A;  4GJ4 A;  3TRC A;  2KX6 A;  4JGO A;  3PBO A;  4H6J B;  5IT5 A;  2HJE A;  3MFX A;  2QKP A;  3HJK A;  3P01 A;  3LR5 A;  1OTD A;  4HH2 A;  1N9L A;  5DJU A;  5AVF A;  3E0Y A;  4MMN A;  4HJ4 A;  3W2Z A;  3VE4 A;  2J80 A;  1OT6 A;  4DJ3 A;  5EFW A;  3B33 A;  2LB9 A;  1T1C A;  2JN7 A;  1NLY A;  1TD5 A;  5F69 A;  3T4S A;  2HV1 A;  3PR6 A;  3CAX A;  4Y2F A;  5LBR A;  2ZOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...