1Y28A

Crystal structure of the r220a metbjfixl heme domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGAIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein fixL
publication title A distal arginine in the oxygen-sensing heme-PAS domains is essential to ligand binding, signal transduction, and structure
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 29
structure length 119
sequence length 119
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1y28A00
2ZBBA 2D01A 1S1ZA 2V0WA 1XJ6A 5F5YA 4BBUA 3A0VA 4NXGA 2QJ5A 5J4EA 3IBRA 1F98A 4EETB 4LRYC 4HNBA 3H7WB 3NOTC 1DP9A 4LLOB 2P7JA 1TS0A 1XFNA 5I5LA 3F1OA 1XJ4A 5IU1A 2M1CA 4F3LA 5DKLA 5AVFA 4BBVA 2B02A 3FC7A 5EFWA 4KQDA 4JGQA 2Z6DA 3LIBA 3D72A 4NXFA 1S1YA 2V1AA 3C8CA 3MXQA 2V1BA 2WKPA 4LPZA 2VLGA 4EEPA 1LT0A 5AVEA 4KUKA 1P0ZA 4HP4A 1GSXA 3K3DA 3LI9A 1S4SA 5IS1A 4LRZE 3F1PA 3MFXA 1Y28A 1DP8A 3LIDA 4L9FA 4RQ9A 2OWJA 2YKHA 4HOIA 3LICA 3LIEA 4HH2A 2VEAA 1OJ5A 2GJ3A 1LL8A 2A24B 2L1MA 3IS2A 1UGUA 1T1AA 3UB6A 3BY8A 2L0WA 1KOUA 3VE4A 3UB8A 3SW1A 3C2WA 1LSXA 3LYXA 1T18A 4EEUA 1N9OA 1OJGA 4L9GA 5DKKA 4HP9A 5TBMA 3BWLA 3UB9A 4EQ1A 3EWKA 2CMNA 4M4XA 4NXEA 3F1OB 1S4RA 3RH8B 4HH3A 4E04A 2ZOHA 2VV6A 5HWWA 3UE6A 1F9IA 3UMDA 4HQAA 2ZOIA 4EERA 1EW0A 3F1NA 4PKYA 1D06A 1OTAA 1TS6A 4R3AA 3H82A 2V9AA 5G4YA 3BY9A 1DRMA 3LUQA 4JGRA 2KX6A 4JGOA 1S66L 5F68A 3E4QA 3H9WA 4LRXC 4H6JB 4HY8A 5HSQA 3T50A 3KX0X 4GS9B 2PR5A 3VE3A 3F1PB 2INWA 3CWFA 2D02A 3ICYA 5HD3A 2I9VA 1LSWA 3FG8A 5HDCA 1T1CA 4I3AA 2HV1A 3MQQA 1LSVA 2QKPA 5J3WA 3IS2B 4GCZA 3MJQA 2JHEA 4BBTA 1OTDA 1GSVA 3NJAA 4DJ3A 5HZHA 5HWVA 4MN6A 5TBMB 3VOLA 4GHIA 2W0NA 1V9YA 2JN7A 3CLOA 2BASA 3ZQ5A 3OLOA 3MQOA 1XJ2A 2PR6A 4L9EA 1N9NA 3ULFA 3UB7A 1TS7A 3UMEA 1P97A 3LIFA 1BYWA 1T1BA 3HJKA 4XT2A 4NXBA 4PKYG 4DJ2A 3A0RA 4F3LB 3H82B 4I5SA 3NOUC 5J7EA 1XFQA 1VB6A 2A24A 1ODVA 2PYPA 3P7NA 4HHDA 1N9LA 4WF0A 5DJUA 4B9OA 3G6OA 4KUOA 3PHYA 1OT9A 2R78A 4R70A 4JGPA 4K08A 3HJIA 3E4PA 4YWZA 2W27A 4WUJA 2VV8A 2PD7A 1OT6A 4I38A 1T19A 1OTEA 2J80A 2K7SA 2EA9A 3MR0A 2L4RA 3CAXA 3H7WA 5F69A 5HWTA 2V0UA 4R6LA 1S67L 4EW7A 1G28A 2PD8A 1MZUA 1DP6A 1D7EA 4GW9A 1WA9A 4GHIB 1TS8A 2KDKA 4R38A 3RTYA 2PHYA 4WN5A 2VV7A 4EXOA 2QJ7A 4HI4A 4I39A 3GDIA 2PDRA 2WKRA 4H6JA 1V9ZA 3LIAA 4GS9A 3A0SA 1X0OA 3PYPA 1XJ3A 4XT2B 5HD5A 4HJ4A 5HDDA 4HIAA 2H28A 2WKQA 3LI8A 3GECA 1OTIA 3B33A 3E4OA 4EESA 4WLAA 5KIZA 1GSWA 1NWZA 3NOPC 4I3JA 4MN5A 5F6AA 1UWPX 4HJ6A 2QWSA 3NHQA 5A8BA 1UWNX 4WL9A 3EEHA 3F1NB 5DJTA 2QHKA 3K3CA 4I3IA 1OTBA 4HJ3A 5G4ZA 1JNUA 2OWHA 5HDSA 2YKFA 2PYRA 2OOLA 2Z6CA
chains in the Genus database with same CATH superfamily
4MBHA 3N6IA 5L09A 2VK3A 2KOIA 3S7QA 3NBLA 5TJJA 4BBUA 1S6RA 4BD0A 4NXGA 5G18A 1U60A 3GV9A 2Q9NA 1O7EA 5L07A 2Y8HA 4MEZA 3BRMA 3G35A 5DF8A 1DP9A 4LENA 2P7JA 1XGIA 3HLCA 4KZBA 4KG5A 2XRNA 1XJ4A 1SDEA 4F3LA 4BBVA 3UDFA 2WUQA 2DCFA 3A3FA 1G6AA 1Q2QA 3T1XA 2WGIA 2P9VB 4Y0TA 2EX9A 3FWLA 4NXFA 1YLJA 1PFLA 2V1AA 1KGEA 3C8CA 4CLCD 3R7WA 4LPZA 1NXYA 3IT9A 5HPIA 2Y4AA 1YSQA 4PPRA 1LT0A 3VSKA 4N9KA 3T4LA 4ETZA 4WZ4A 3K3DA 3LI9A 3BFGA 2GX5A 2EX8A 3BQ8A 4CLCC 1GA9A 3MFXA 3CITA 4L0LA 4OVDA 4RA7A 5FI2A 2OWJA 5CGXA 3WS4A 3VP3A 1AXBA 1YPRA 3NI9A 4HH2A 3EGXC 2L1MA 4X56A 4BJPA 1J9MA 2PT7A 4BL2A 4ID4A 3UDXA 1NYMA 1CEFA 1T18A 1VETB 3SH9A 1OJGA 2EWWA 3C4PA 4HP9A 2GDNA 1CF0A 2A3UA 2XH9A 3LO7A 3M6BA 4LV3A 4NXEA 2HP6A 2W3EA 2ZOHA 4DE3A 5FQJA 3B47A 3KSHA 4E3KA 5FAQA 4S2NA 4JXSA 4Q0JA 4LV0A 2ZLYA 1YQSA 1LL9A 3W4PA 1MWUA 5FA7A 3SS3A 3BFFA 2Y2QA 3NCKA 4OPQA 3WS1A 4R3AA 2V9AA 5E2HA 5DFXA 5F1GA 4AFIA 4U0TA 2KX6A 4X68A 4JGOA 3MF0A 3ZNYA 2Y59A 2GZAA 2W1TA 4LRXC 4H6JB 4HY8A 5KMWA 4ARZA 3KX0X 4GS9B 5J8XA 3VE3A 3G31A 2WAFA 4PMAA 2AVXA 3ZNTA 4EBPA 1M40A 3WS2A 1FQGA 2H10A 1LSWA 5FI6A 5HDCA 1ZG6A 2JKTM 3G30A 4Q0IA 2HPBA 4E3OA 4P0MA 2HV1A 3QP5A 3MFDA 1LSVA 3FZCA 2DRWA 4GOGA 1E3UD 3LCEA 2IWDA 4UAAA 4IEDA 4KZ3A 1GSVA 1YM1A 3NJAA 3CMZA 4XUXA 1K57A 3MKFA 5HWVA 5TBMB 3VOLA 5CEBA 2ZC6B 3M2KA 1IELA 5EM0A 3OLOA 3B42A 4QJGA 2WGWA 1IYPA 4PM9A 4R4SA 1BLCA 4WYYA 5EOOA 1TS7A 2C5WB 4WELA 3LIFA 1BYWA 2J3TD 4F94A 1YLTA 4PM5A 2WZXA 4DE1A 2Q9MA 3O88A 3T4OA 4P85A 1S0WA 3JVUA 3H82B 1JTDA 2H0YA 2WKEA 1GHMA 5J7EA 4S2KA 5EVID 1EROA 1VB6A 3IX3A 4QHCA 1YSPA 4EBLA 2J3TC 4GKUA 2G7UA 2PYPA 3S7NA 3IWQA 3P7NA 2PBYA 4HHDA 1N9LA 3V50A 4KUOA 1DJAA 3LY4A 3NECA 3NIAA 3V3RA 1OT9A 2O0YA 4KZAA 1L0FA 5HL1A 4R1GA 3S4XA 4WEKA 4YINA 4UQIM 4K0XA 4R70A 1YAXA 3O86A 5EVIC 3IF6B 3HLDA 4KZ9A 3E4PA 4YWZA 4R4RA 4LCLA 3IX8A 2HDQA 3MS6A 2W27A 5FQQA 4X1LA 4WBGA 1Y54A 4JPMA 1PZOA 4KZ8A 4S2PA 2MJ6A 1OTEA 2K7SA 1KDWA 1IOUA 3LEQA 3NDGA 1MWSA 3VMAA 2XEPA 3U4LP 5HPFA 3HLBA 1NLYA 1W63M 4QPRA 4KZ5A 5TGFA 1G5UA 3VSLA 1DP6A 1PW8A 1K55C 3O5YA 5FAOA 5FDHA 3LR4A 4HBUA 1DY6A 1RGYA 4FOFA 2PHYA 1HTZA 2WAEA 3ITAA 1L0GA 1LHYA 2HP5A 1V9ZA 1W8YA 1H8ZA 2Y2NA 4GDBA 5DF7A 1XJ3A 4UA6A 5HD5A 1ES4A 3IH9A 3G2YA 4BENA 3ITBA 3DBAA 4PM6A 5E43A 2Y2IA 3E4OA 1PIOA 5KIZA 4GZBA 4KENB 1TF1A 3UDIA 1PYYA 4OQHA 3CPTA 3MXSA 2W3DA 4WL9A 3EEHA 1BZAA 4I3IA 3SH8A 1OTBA 2ZM2A 4ZBEA 4D2OA 5G4ZA 1PZPA 4WM9A 4DN0A 2P04A 2OWHA 5CTNA 1SKOB 2YKFA 4OOMA 5FQMA 1MXOA 4K91A 3BEBA 3OPLA 2J9OA 1S1ZA 3Q82A 4R23A 3ZFZA 2V0WA 3LR5A 3NC8A 4LGWA 4BLMA 1K56A 1Q2PA 2VKSA 5U47A 5J4EA 1F98A 2W3FA 1W5DA 2Y55A 3SOIA 1ES5A 1FR6A 4LRYC 3H7WB 3VV4A 3NOTC 4O01A 3IWIA 4P6BA 4LLOB 4PM8A 3F1OA 5E2FA 3IXHA 2VGLM 5IU1A 2RL3A 2ZQ9A 3OPPA 4ZJ2A 5DKLA 2ZM0A 4IJGA 3FC7A 5A91A 3Q1FA 2KLIA 3E2LA 3FPVA 2Y2PA 3UNWA 4OH0A 3ZGAB 3MZDA 3LIBA 2B5RA 2B18A 1NJ4A 3V39A 1CJFA 3CUEC 3MXQA 4UA9A 5CHJA 4X55A 5HW3A 5FATA 3ZG8B 4EWFA 4EEPA 5GLBA 3MQ0A 3R4KA 2Q0OA 1KGGA 4U3TA 3IX4A 1HLUP 4R3JA 1BT5A 3QP6A 4HP4A 1ERMA 2EFXA 5EVEA 5C5KA 4LRZE 3F1PA 2ZQDA 2HJEA 4HBTA 4N9LA 1Y28A 3T1QB 4CQHA 1DP8A 2OAQ1 1FOFA 4B4XA 4KQQA 3WS0A 4ZRRA 2YKHA 1STZA 2HZ5A 1OMEA 3LIEA 2EWVA 1M6KA 1CEGA 4YNRA 1K55A 4CPKA 2XD1A 2O9CA 2GJ3A 1LL8A 1SHVA 2FFYA 1TVFA 1T1AA 3BJNA 1ESIA 4B88A 4JXWA 3W4QA 4KZ7A 1XP4A 3UB8A 3SW1A 3RXWA 3GTCA 3CG5A 3LYXA 2BLSA 2JBFA 3CHWP 4GLQA 2EFUA 4MCWA 3T4JA 4OQ0A 4OPZA 4EQ1A 5GLCA 3EWKA 3W2ZA 4MMNA 4M4XA 1PWCA 1S4RA 1NZUA 2QPNA 3RH8B 4HH3A 2ZL1A 3KYZA 2Z2LB 5AQAA 3IH8A 3LR3A 3IHAA 2XROA 2WADA 4KG2A 3UE6A 1FSWA 5EV0A 3IBJA 4Y15A 5EVLA 1EW0A 3R7WB 1D06A 1OTAA 4DRTA 4UEYA 4BD1A 4O0PA 1GHPA 5G4YA 4JF4A 1DRMA 4R0QA 4KG6A 3W4OA 1CK3A 1BLHA 5FQIA 1NLZA 5HAPA 5HAQA 4WMCD 2X01A 3WRTA 3BFDA 5A90A 1D1JA 1W8QA 1EWZA 4P87A 1WYBA 4M3KA 2ZMVA 3OPHA 3CWFA 2VGJA 3ICYA 2X02A 3HUMA 5LBRA 2I9VA 4X1MA 4ZAMA 2XD5A 1PWDA 3FG8A 4FCFA 2Y79A 4XXRA 3NDEA 1T1CA 4Y0UA 4Y3IA 3I7JA 1K4EA 4PHTA 2W3GA 3TJZC 2J7VA 4GCZA 1PW1A 2EXBA 2JHEA 2P9VA 3KYQA 4DF6A 3PAGA 3HCYA 3CUEA 4DDSA 5HARA 4X69A 3ZVWA 5GHZA 3OZHA 3BFEA 2WZZA 4GHIA 1V9YA 3MSHA 1P9RA 2JN7A 3CLOA 3L9KA 1JTGA 3MQOA 1XJ2A 3GR2A 3ULFA 2LB5A 1BTLA 4NKPA 5KSHA 3FKWA 3N7WA 1NY0A 1ALQA 1SDNA 4HESA 4NXBA 3S22A 4ZJ1A 2VJWA 4I5SA 4S2MA 3VFFA 1HVBA 3NOUC 2OSUA 1ODVA 2V2FF 2E8IA 2V1ZA 2OV5A 4H8RA 4WF0A 3QNCA 3G6OA 3GSGA 3JYIA 2PU2A 5CRFA 2HP9A 5A93A 3T12B 4K08A 3HJIA 3IF6C 4LV1A 4ME4A 4UQIS 4Y17A 1OT6A 1T19A 2WKIA 3MZFA 3CZDA 2L4RA 5CXWA 5HWTA 4Y5FA 3D9YA 1MKIA 2Y2LA 3QP8A 4ESPA 1VM1A 1D7EA 2H0TA 1GCEA 1TS8A 5F83A 4GD6A 4JBFA 1L2SA 4Y7PA 4HI4A 5KZHA 3M6HA 3KYEA 2XGNA 1Z6FA 4DE0A 4IBRA 2PDRA 3IHBA 4H6JA 2LB9A 3G34A 1KE0A 5IHVA 2XK1A 4GS9A 3A0SA 3A3DA 3PYPA 3PBOA 2RCXA 3N4IA 4A5RA 1IKIA 3KO6A 5HDDA 4HIAA 2H28A 1PI5A 3O87A 4WZ5C 3HUOA 2WKQA 3LI8A 3B33A 2IWCA 4NETA 4WLAA 5EE8A 1GSWA 4CLCA 3NOPC 5DTKA 4I3JA 3LFVA 2QWSA 2M7VA 4BQMA 4Q8IA 3TSGA 3F1NB 4S2IA 3N8RA 1ONGA 3K3CA 4EQIA 4HJ3A 3C5AA 4NG2A 2ZMFA 2Y2GA 4JF5A 2V20A 4QY6A 3ZG9B 1BLSA 2ZBBA 3DTIA 1WE4A 3IF5A 3W8KA 5FSRA 3MBZA 1H8MA 1XJ6A 2GNXA 1XX2A 4MBKA 2O99A 3A0VA 3HVFA 2ZM8A 4PM7A 3UE1A 4HNBA 1MWRA 3ZVTA 1IFQA 3PTEA 4B4ZA 1YT4A 4FUWA 1MPLA 2DMWA 4LV2A 3Q7VA 5I5LA 5DF9A 4S2JA 2Y2HA 2M1CA 3P01A 5AVFA 4O7DA 5EFWA 3G2ZA 4FH4A 2JKGA 2VGLS 3IXGA 5FEGA 4JGQA 2Y2JA 4QU3A 2Z6DA 4EU0A 1W7FA 3D72A 1CQAA 5D3OA 5AJGA 5EUAA 1S1YA 1N9BA 4N92A 2WKPA 2VLGA 1H3QA 3OCLA 1P9WA 3BFCA 4Y0OA 1RP5A 5FEFA 3IF6A 2VA0A 2O9BA 1FILA 2B95A 1YMSA 1BLPA 4GNUA 5EPHA 5IS1A 3C7UA 4KZ6A 5L2FA 1IEMA 3MKEA 3SS4A 1JWVA 1XXMA 3LIDA 1K54C 1G6OA 1CI8A 5FQ9A 1LL5A 2UV0E 4KQOA 1PI4A 3LICA 3UPPA 3T1RA 3EOIA 2VEAA 1VQQA 3RFBA 5CERA 1OJ5A 3P09A 2A24B 3UE3A 2XSSA 2ACGA 3IS2A 1UGUA 5L10A 4R3BA 4E6XA 4QD4A 3BY8A 2L0WA 2Y2KA 1KOUA 3FKVA 5DTTA 3VE4A 3OOVA 3MXRA 4JXVA 1N9OA 4L9GA 1VEUA 1VHMA 2EX6A 5E2EA 2K31A 3EEAA 2CMNA 1ZC2A 1E3UA 3F1OB 5GLAA 3HLFA 3B3XA 2J8YA 4II7A 4E04A 1ERQA 4U0XA 4BMWA 1MWTA 3VOZA 2HDSA 1FCMA 4RX3A 4P6ZM 3SH7A 4N1XA 5HWWA 2QZ6A 4X53A 1XKZA 4EV4A 1PRQA 1IYOA 5EECA 4EERA 1YMXA 4PKYA 2HJ9C 3OCNA 2ZQ8A 1TS6A 3HLEA 5CHMA 5EM1A 3BY9A 4JGRA 1K38A 3WWXA 3BQAA 3PBRA 3VP4A 3E4QA 1LI9A 2VGKA 1G68A 3P98A 3H9WA 2J3WA 5HSQA 3UB5P 3T50A 4ZJ3A 5FL3A 1LLBA 5HFOA 3BM6A 5I94A 2OAP1 4E3NA 3F1PB 4OOLA 3ZG5A 2INWA 2Y2MA 1MC0A 2V8FA 5HD3A 5EVIA 4ZDXA 2G2WA 3ISGA 3ZYTA 3K2NA 4O8GA 2A2LA 2HGVA 2FH5A 3DWZA 3PBSA 1K6RA 1FSYA 2HDRA 4E6WA 4QB8A 2ZJ9A 4MDZA 3FYZA 4QWOA 3PXPA 1PWGA 1K6SA 1W79A 2OLVA 3BW6A 3U2AA 3TW8A 2W0NA 3QP1A 4C3QA 3V5MA 1AWIA 1HZOA 2DNSA 2ZD8A 3NULA 4OKPA 2PU4A 2BASA 3ZQ5A 4JLFA 4DXCA 3FV7A 4DKIA 4Y2FA 2PR6A 4GN2A 4N1HA 3UB7A 2BG1A 4B93A 3UMEA 1P97A 3HREA 1T1BA 2XFSA 2Z2MB 5CEDA 3HJKA 4XT2A 4S2NC 2JKRM 5M18A 2IA2A 4FD8A 3TG9A 4DJ2A 1TDLA 3A0RA 2J9PA 3ZHHA 4LCMA 4F3LB 4OLGA 4GB7A 1XFQA 1Z09A 2XF3A 1IYQA 2XA7M 1GHIA 2G2UA 2NUPC 5DJUA 1E25A 4FSFA 1H5XA 4B9OA 4IVKA 1NRJA 4C6YA 2H5SA 3CJMA 3AGDA 3VP1A 4OLDA 1W63Q 1SKFA 2VV8A 2EXAA 1TD5A 3KSGA 4MNRA 2FZ0A 3ZCZA 3A3JA 4EBNA 3JPUA 5TFQA 1EI5A 2EA9A 3PBQA 1H0MA 3UO9A 1GA0A 3CAXA 5F69A 2JKFA 5GHYA 3GMWA 1NYYA 3A3IA 1JWPA 5HAIA 1ES2A 3SZTA 1MZUA 4YOFA 1K57C 5F1FA 3GVBA 1WA9A 4GHIB 4R38A 4Z9QA 5CX7A 4DXBA 2OLUA 4WN5A 2VV7A 2QJ7A 4I39A 5CTMA 4OP8A 3QP2A 1K25A 2Y2OA 5HL6A 3SS5A 2WKRA 1SCWA 4DDYA 5DVAA 3G32A 1YLZA 1X0OA 3DTMA 5L8MA 1BUEA 3E0YA 3D4FA 4MN7A 3GECA 2I72A 2ZQ7A 1KVMA 4HJ6A 4GD8A 2JKRI 1LI0A 5GL9A 4LFUA 2ZQCA 1UWNX 1MKMA 3G4PA 4JF6A 5DJTA 2QHKA 3GQZA 2X71A 3O3VA 2V8CA 5CECA 1IYSA 4IHQA 4FH2A 5HDSA 1YKDA 5KSCA 3N8LA 2PYRA 2OOLA 2JE5A 5CGSA 2Z6CA 4WEJA 1NZOA 2D01A 3C7VA 3ZG0A 2W1TB 5F5YA 4D60A 4ARZB 2QJ5A 3IBRA 1VETA 3LEZA 2R9XA 4EETB 5JYPA 2HF6A 4X25A 1FIKA 4GDNA 1K0KA 1TS0A 1XFNA 3OPRA 4Y13A 3CI6A 3DAVA 2B02A 4OQIA 3WRZA 5CHUA 2XFTA 2EX2A 2ZC4B 4KQDA 3VP2A 5M19A 3GRJA 2QYBA 5JYOA 2ZC3B 4E3JA 5AQBA 2V1BA 1ZTUA 1L0EA 1F5MA 3QHYA 1ONHA 4X6TA 5F82A 3S7PA 3QNBA 2W3HA 2WGWB 5AVEA 3AGEA 4KUKA 1P0ZA 5FQKA 1GSXA 1NRFA 1N4OA 1SZVA 3IXBA 4CLCB 3BYDA 1S4SA 5TR7A 1I5QA 1XA7A 5FAPA 3IQAA 5CGWA 3A3EA 2WK0A 4L9FA 3KSIA 3EGDC 4RQ9A 1K56D 2XR0A 1L0DA 1MBLA 1K4FA 4HOIA 3LGOA 3PAEA 4WMCA 5DTSA 3Q07A 3IXDA 4EUVA 3V3SA 4C75A 3L7HA 4ZTKA 1CI9A 4G3KA 5BOHA 3UB6A 3ZDJA 4CLCE 3C2WA 1LSXA 1HD8A 4EEUA 3WS5A 1E4DA 5DKKA 1F2KA 5TBMA 3Q7ZA 3BWLA 3UB9A 1ZG4A 2P74A 3PBTA 3E2KA 3Q7VB 2HDUA 3S1YA 4S2OA 4K0WA 4JXGA 3AGFA 2VV6A 3DWKA 1YLPA 2VX8A 4UA7A 1KE3A 1F9IA 3UMDA 5A92A 4HQAA 2BTFP 2ZOIA 1TDGA 3MZEA 1JWZA 4P6ZS 3F1NA 4G3WA 2XLNA 2M7UA 3H82A 3C38A 3LUQA 2XQZA 1S66L 5IT5A 5DFYA 3T4KA 3T4TA 4S2LA 5F68A 1QMFA 1TEMA 3BLMA 4JKTA 3UPOA 4HEFA 1A0KA 2PR5A 2ZMAA 3UE0A 4Q0HA 2D02A 4OP5A 3HL9A 3Q81A 2JKTI 4I3AA 3T1SA 2JC7A 1WYCA 1O07A 3LY3A 1PNEA 3MQQA 3D3OA 5EOEA 2QKPA 5J3WA 3IS2B 3CPTB 1ZKJA 2XDMA 3T4QA 3MJQA 3ZG7B 5HX9A 4BBTA 1OTDA 3HUNA 3DTEA 2A49A 4DJ3A 5HZHA 4CJNA 3TRCA 1VEUB 4MN6A 4MLLA 3C30A 1KE4A 3TOIA 3NY4A 3T4SA 4UHUA 5FI7A 4L9EA 1N9NA 1FR1A 3DW0A 3M2JA 4NEED 3BLSA 3FPWA 4IUHA 4NK3A 3N8SA 2W1RA 4DE2A 4PKYG 1L3LA 2PRFA 5M1AA 3VOYA 4WZ5A 4EUZA 4E3MA 2WGVA 5K5BA 3HBRA 4OPYA 2Y91A 2A24A 3DTKA 4E3LA 4Z1WA 1I2WA 4BL3A 3MMHA 3BECA 1Y4OA 4OQGA 1KGFA 4IBXA 3S7OA 4DMZA 1JVJA 2XA7S 3PHYA 2VZWA 4KZ4A 1I2SA 4OPRA 2R78A 5AQ9A 1RGZA 1SKOA 5EVIB 3HLWA 4JGPA 2O9AA 1MY8A 1XA1A 4WUJA 2PD7A 4XUZA 3IWOA 4I38A 2QMIA 4E3IA 3OC2A 5MC7A 1ES3A 3EQVA 1XPBA 2J80A 4OOYA 4OONA 2PBDP 3MR0A 1ESUA 1YLYA 3VP0A 3HLGA 3H7WA 2WYXA 2V0UA 4R6LA 1J3WA 1BSGA 3PR6A 1KDSA 1S67L 4EW7A 1DJCA 1G28A 4GJ4A 2R9WA 2PD8A 2ZC7A 4GW9A 3E98A 4RX2A 3JVVA 3KSFA 1XGJA 2KDKA 3RTYA 4EXOA 4QY5A 3GDIA 3TE8A 2FFFB 1FCOA 4IVIA 4BWIA 1ZHHB 4ETXA 3LIAA 1QMEA 3VFHA 2P08A 3EQUA 5FDSA 1BULA 3RJUA 2CC1A 1KVLA 4KQRA 4XT2B 1OPXA 5GLDA 4G3VA 4HJ4A 1DJBA 5E2GA 1FCNA 4FTXA 3UY6A 2ZL1B 5FASA 1ACFA 1OTIA 4EESA 4RVAA 2ZC5B 4RYEA 3PBNA 4PAUA 2C6WB 3QP4A 1NWZA 1H8YA 2UWXA 4MN5A 4MBFA 5F6AA 1UWPX 2IWBA 1C3BA 2ZQAA 3RXXA 1RCJA 1YLWA 3V67A 3NHQA 5A8BA 1K54A 3LR0A 2JCHA 3C4OA 4YFMA 5AQ7A 2E8JA 3OBFA 3UN7A 2NUTC 1IKGA 1JNUA 3UPNA 4IUKA 5GHXA 2PAVP 2WKHA 2K2NA
chains in the Genus database with same CATH topology
4WEJA 2ZBBA 2D01A 1S1ZA 2KOIA 2W1TB 2V0WA 3S7QA 1H8MA 5TJJA 3LR5A 1XJ6A 2GNXA 5F5YA 4ARZB 4BBUA 2O99A 2VKSA 3A0VA 4NXGA 2QJ5A 5J4EA 3IBRA 1F98A 2W3FA 4EETB 4LRYC 4HNBA 3H7WB 2Y8HA 3NOTC 2HF6A 3VV4A 1IFQA 4O01A 1DP9A 4LLOB 2P7JA 2DMWA 1TS0A 1XFNA 5I5LA 3F1OA 5DF9A 2XRNA 1XJ4A 2VGLM 5IU1A 2M1CA 3P01A 4F3LA 3CI6A 5DKLA 5AVFA 4IJGA 2B02A 4BBVA 3FC7A 5EFWA 2KLIA 3FPVA 2VGLS 4KQDA 4JGQA 2QYBA 2Z6DA 4EU0A 3LIBA 2B18A 3D72A 4NXFA 5AJGA 1S1YA 2V1AA 3C8CA 3CUEC 3MXQA 2V1BA 1ZTUA 3R7WA 4CLCD 2WKPA 1F5MA 4LPZA 2VLGA 1H3QA 3OCLA 5HPIA 1P9WA 1YSQA 4EEPA 3S7PA 1LT0A 2W3HA 3MQ0A 3R4KA 5AVEA 4KUKA 1P0ZA 3T4LA 2VA0A 4ETZA 2O9BA 4HP4A 1GSXA 3K3DA 3LI9A 2GX5A 4CLCB 3BQ8A 5C5KA 1S4SA 4CLCC 5IS1A 4LRZE 3F1PA 3MFXA 2HJEA 3CITA 4L0LA 1Y28A 4CQHA 1DP8A 2OAQ1 3LIDA 4L9FA 1G6OA 3KSIA 3EGDC 4RQ9A 2OWJA 4ZRRA 2YKHA 4HOIA 4KQOA 1STZA 3LICA 3LIEA 2EWVA 4HH2A 4YNRA 3EOIA 2VEAA 4EUVA 3EGXC 3RFBA 1OJ5A 2O9CA 2GJ3A 1LL8A 2A24B 3UE3A 4G3KA 2L1MA 2XSSA 3IS2A 1UGUA 4BJPA 3BJNA 1T1AA 2PT7A 3UB6A 3BY8A 2L0WA 1KOUA 3VE4A 3UB8A 4CLCE 3SW1A 3C2WA 1LSXA 3OOVA 3LYXA 1T18A 4EEUA 1N9OA 1OJGA 2EWWA 4L9GA 5DKKA 4GLQA 4MCWA 4HP9A 5TBMA 3T4JA 1VHMA 3BWLA 3UB9A 2K31A 3EEAA 4EQ1A 3EWKA 3PBTA 3W2ZA 2CMNA 4MMNA 4M4XA 4NXEA 3F1OB 1S4RA 3RH8B 2W3EA 4HH3A 2ZOHA 3KYZA 4II7A 4E04A 4BMWA 3LR3A 3B47A 3KSHA 2VV6A 2XROA 4P6ZM 5HWWA 2VX8A 3UE6A 3IBJA 1F9IA 4Q0JA 3UMDA 4HQAA 2ZOIA 4P6ZS 4EERA 1EW0A 3F1NA 4G3WA 4PKYA 2HJ9C 3R7WB 3OCNA 1D06A 1OTAA 1TS6A 4R3AA 2M7UA 3H82A 4UEYA 2V9AA 4O0PA 3C38A 5G4YA 3BY9A 5DFXA 1DRMA 3LUQA 4JGRA 4AFIA 2KX6A 3BQAA 4JGOA 1S66L 3MF0A 5DFYA 5IT5A 3T4KA 3PBRA 1NLZA 2GZAA 3T4TA 5F68A 3E4QA 2W1TA 3H9WA 4LRXC 4H6JB 2J3WA 4HY8A 5HSQA 4ARZA 3T50A 5FL3A 3KX0X 4GS9B 2PR5A 2OAP1 3VE3A 3F1PB 4OOLA 4Q0HA 2ZMVA 2INWA 3CWFA 1MC0A 2D02A 3ICYA 5HD3A 5LBRA 3ZYTA 2I9VA 3K2NA 1LSWA 3FG8A 4O8GA 5HDCA 2Y79A 2JKTI 2JKTM 4Q0IA 1T1CA 4Y3IA 2A2LA 4I3AA 2HV1A 2HGVA 2FH5A 3MQQA 4PHTA 1LSVA 2W3GA 3D3OA 2QKPA 5J3WA 3IS2B 3PBSA 3TJZC 4GCZA 3T4QA 3MJQA 2JHEA 3KYQA 4BBTA 1OTDA 1GSVA 3HCYA 3CUEA 3NJAA 4MDZA 4DJ3A 3PXPA 5HZHA 3TRCA 5HWVA 4MN6A 5TBMB 3BW6A 3U2AA 3TW8A 3VOLA 3C30A 2W0NA 4GHIA 1V9YA 1P9RA 2JN7A 3CLOA 2BASA 3ZQ5A 3T4SA 3OLOA 3B42A 3MQOA 4Y2FA 1XJ2A 2PR6A 4L9EA 1N9NA 3ULFA 2LB5A 3UB7A 4B93A 1TS7A 4NKPA 1P97A 4WELA 3UMEA 3LIFA 1BYWA 4NEED 5KSHA 1T1BA 3FPWA 4IUHA 2J3TD 3HJKA 4XT2A 2JKRM 2W1RA 4NXBA 2IA2A 4PKYG 3T4OA 4DJ2A 3A0RA 3JVUA 4F3LB 2VJWA 3H82B 4I5SA 3NOUC 5K5BA 5J7EA 1XFQA 1VB6A 1YSPA 2A24A 1ODVA 2J3TC 2G7UA 2PYPA 2XA7M 4Z1WA 3S7NA 3MMHA 3P7NA 4HHDA 1N9LA 2NUPC 4WF0A 5DJUA 4FSFA 4B9OA 3G6OA 3S7OA 4DMZA 4KUOA 1NRJA 2XA7S 3PHYA 1OT9A 2VZWA 2O0YA 2R78A 4WEKA 4UQIM 4R70A 1YAXA 4JGPA 4K08A 2O9AA 3HJIA 3E4PA 4YWZA 1W63Q 2W27A 4WUJA 4ME4A 4UQIS 2VV8A 2PD7A 1TD5A 3KSGA 2FZ0A 1OT6A 4I38A 1T19A 2MJ6A 3OC2A 1OTEA 3EQVA 5MC7A 2J80A 2K7SA 2EA9A 3PBQA 1IOUA 3MR0A 2L4RA 3CAXA 3H7WA 5F69A 5HWTA 2V0UA 4Y5FA 4R6LA 3PR6A 5HPFA 1S67L 4EW7A 1G28A 1NLYA 4GJ4A 1W63M 4QPRA 2PD8A 1MZUA 4YOFA 1DP6A 1D7EA 3E98A 3O5YA 4GW9A 3LR4A 1WA9A 4GHIB 3JVVA 1TS8A 3KSFA 2KDKA 4R38A 3RTYA 5CX7A 4FOFA 2PHYA 4WN5A 2VV7A 4EXOA 2QJ7A 4HI4A 4I39A 3GDIA 3TE8A 5HL6A 1ZHHB 4BWIA 2PDRA 2WKRA 4H6JA 4ETXA 1V9ZA 2LB9A 3LIAA 2P08A 3EQUA 4GS9A 3A0SA 1X0OA 3PYPA 1XJ3A 3PBOA 5L8MA 4XT2B 5HD5A 1OPXA 4G3VA 3KO6A 4HJ4A 3E0YA 5HDDA 4HIAA 3DBAA 2H28A 4MN7A 2WKQA 3LI8A 3GECA 1OTIA 3B33A 3E4OA 4EESA 4WLAA 3PBNA 5KIZA 1GSWA 4PAUA 1NWZA 4CLCA 3NOPC 4I3JA 4MN5A 1TF1A 5F6AA 3LFVA 1UWPX 4HJ6A 2JKRI 2QWSA 3V67A 2M7VA 3NHQA 5A8BA 1UWNX 3LR0A 1MKMA 2W3DA 3EEHA 4WL9A 3F1NB 5DJTA 2QHKA 3K3CA 3OBFA 4I3IA 2NUTC 1OTBA 4HJ3A 5G4ZA 1JNUA 4IHQA 4DN0A 2P04A 4IUKA 2OWHA 2ZMFA 5HDSA 1YKDA 2YKFA 4OOMA 2PYRA 2OOLA 2Z6CA 2K2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBB A;  2D01 A;  1S1Z A;  2V0W A;  1XJ6 A;  5F5Y A;  4BBU A;  3A0V A;  4NXG A;  2QJ5 A;  5J4E A;  3IBR A;  1F98 A;  4EET B;  4LRY C;  4HNB A;  3H7W B;  3NOT C;  1DP9 A;  4LLO B;  2P7J A;  1TS0 A;  1XFN A;  5I5L A;  3F1O A;  1XJ4 A;  5IU1 A;  2M1C A;  4F3L A;  5DKL A;  5AVF A;  4BBV A;  2B02 A;  3FC7 A;  5EFW A;  4KQD A;  4JGQ A;  2Z6D A;  3LIB A;  3D72 A;  4NXF A;  1S1Y A;  2V1A A;  3C8C A;  3MXQ A;  2V1B A;  2WKP A;  4LPZ A;  2VLG A;  4EEP A;  1LT0 A;  5AVE A;  4KUK A;  1P0Z A;  4HP4 A;  1GSX A;  3K3D A;  3LI9 A;  1S4S A;  5IS1 A;  4LRZ E;  3F1P A;  3MFX A;  1Y28 A;  1DP8 A;  3LID A;  4L9F A;  4RQ9 A;  2OWJ A;  2YKH A;  4HOI A;  3LIC A;  3LIE A;  4HH2 A;  2VEA A;  1OJ5 A;  2GJ3 A;  1LL8 A;  2A24 B;  2L1M A;  3IS2 A;  1UGU A;  1T1A A;  3UB6 A;  3BY8 A;  2L0W A;  1KOU A;  3VE4 A;  3UB8 A;  3SW1 A;  3C2W A;  1LSX A;  3LYX A;  1T18 A;  4EEU A;  1N9O A;  1OJG A;  4L9G A;  5DKK A;  4HP9 A;  5TBM A;  3BWL A;  3UB9 A;  4EQ1 A;  3EWK A;  2CMN A;  4M4X A;  4NXE A;  3F1O B;  1S4R A;  3RH8 B;  4HH3 A;  4E04 A;  2ZOH A;  2VV6 A;  5HWW A;  3UE6 A;  1F9I A;  3UMD A;  4HQA A;  2ZOI A;  4EER A;  1EW0 A;  3F1N A;  4PKY A;  1D06 A;  1OTA A;  1TS6 A;  4R3A A;  3H82 A;  2V9A A;  5G4Y A;  3BY9 A;  1DRM A;  3LUQ A;  4JGR A;  2KX6 A;  4JGO A;  1S66 L;  5F68 A;  3E4Q A;  3H9W A;  4LRX C;  4H6J B;  4HY8 A;  5HSQ A;  3T50 A;  3KX0 X;  4GS9 B;  2PR5 A;  3VE3 A;  3F1P B;  2INW A;  3CWF A;  2D02 A;  3ICY A;  5HD3 A;  2I9V A;  1LSW A;  3FG8 A;  5HDC A;  1T1C A;  4I3A A;  2HV1 A;  3MQQ A;  1LSV A;  2QKP A;  5J3W A;  3IS2 B;  4GCZ A;  3MJQ A;  2JHE A;  4BBT A;  1OTD A;  1GSV A;  3NJA A;  4DJ3 A;  5HZH A;  5HWV A;  4MN6 A;  5TBM B;  3VOL A;  4GHI A;  2W0N A;  1V9Y A;  2JN7 A;  3CLO A;  2BAS A;  3ZQ5 A;  3OLO A;  3MQO A;  1XJ2 A;  2PR6 A;  4L9E A;  1N9N A;  3ULF A;  3UB7 A;  1TS7 A;  3UME A;  1P97 A;  3LIF A;  1BYW A;  1T1B A;  3HJK A;  4XT2 A;  4NXB A;  4PKY G;  4DJ2 A;  3A0R A;  4F3L B;  3H82 B;  4I5S A;  3NOU C;  5J7E A;  1XFQ A;  1VB6 A;  2A24 A;  1ODV A;  2PYP A;  3P7N A;  4HHD A;  1N9L A;  4WF0 A;  5DJU A;  4B9O A;  3G6O A;  4KUO A;  3PHY A;  1OT9 A;  2R78 A;  4R70 A;  4JGP A;  4K08 A;  3HJI A;  3E4P A;  4YWZ A;  2W27 A;  4WUJ A;  2VV8 A;  2PD7 A;  1OT6 A;  4I38 A;  1T19 A;  1OTE A;  2J80 A;  2K7S A;  2EA9 A;  3MR0 A;  2L4R A;  3CAX A;  3H7W A;  5F69 A;  5HWT A;  2V0U A;  4R6L A;  1S67 L;  4EW7 A;  1G28 A;  2PD8 A;  1MZU A;  1DP6 A;  1D7E A;  4GW9 A;  1WA9 A;  4GHI B;  1TS8 A;  2KDK A;  4R38 A;  3RTY A;  2PHY A;  4WN5 A;  2VV7 A;  4EXO A;  2QJ7 A;  4HI4 A;  4I39 A;  3GDI A;  2PDR A;  2WKR A;  4H6J A;  1V9Z A;  3LIA A;  4GS9 A;  3A0S A;  1X0O A;  3PYP A;  1XJ3 A;  4XT2 B;  5HD5 A;  4HJ4 A;  5HDD A;  4HIA A;  2H28 A;  2WKQ A;  3LI8 A;  3GEC A;  1OTI A;  3B33 A;  3E4O A;  4EES A;  4WLA A;  5KIZ A;  1GSW A;  1NWZ A;  3NOP C;  4I3J A;  4MN5 A;  5F6A A;  1UWP X;  4HJ6 A;  2QWS A;  3NHQ A;  5A8B A;  1UWN X;  4WL9 A;  3EEH A;  3F1N B;  5DJT A;  2QHK A;  3K3C A;  4I3I A;  1OTB A;  4HJ3 A;  5G4Z A;  1JNU A;  2OWH A;  5HDS A;  2YKF A;  2PYR A;  2OOL A;  2Z6C A; 
#chains in the Genus database with same CATH topology
 4MBH A;  3N6I A;  5L09 A;  2VK3 A;  2KOI A;  3S7Q A;  3NBL A;  5TJJ A;  4BBU A;  1S6R A;  4BD0 A;  4NXG A;  5G18 A;  1U60 A;  3GV9 A;  2Q9N A;  1O7E A;  5L07 A;  2Y8H A;  4MEZ A;  3BRM A;  3G35 A;  5DF8 A;  1DP9 A;  4LEN A;  2P7J A;  1XGI A;  3HLC A;  4KZB A;  4KG5 A;  2XRN A;  1XJ4 A;  1SDE A;  4F3L A;  4BBV A;  3UDF A;  2WUQ A;  2DCF A;  3A3F A;  1G6A A;  1Q2Q A;  3T1X A;  2WGI A;  2P9V B;  4Y0T A;  2EX9 A;  3FWL A;  4NXF A;  1YLJ A;  1PFL A;  2V1A A;  1KGE A;  3C8C A;  4CLC D;  3R7W A;  4LPZ A;  1NXY A;  3IT9 A;  5HPI A;  2Y4A A;  1YSQ A;  4PPR A;  1LT0 A;  3VSK A;  4N9K A;  3T4L A;  4ETZ A;  4WZ4 A;  3K3D A;  3LI9 A;  3BFG A;  2GX5 A;  2EX8 A;  3BQ8 A;  4CLC C;  1GA9 A;  3MFX A;  3CIT A;  4L0L A;  4OVD A;  4RA7 A;  5FI2 A;  2OWJ A;  5CGX A;  3WS4 A;  3VP3 A;  1AXB A;  1YPR A;  3NI9 A;  4HH2 A;  3EGX C;  2L1M A;  4X56 A;  4BJP A;  1J9M A;  2PT7 A;  4BL2 A;  4ID4 A;  3UDX A;  1NYM A;  1CEF A;  1T18 A;  1VET B;  3SH9 A;  1OJG A;  2EWW A;  3C4P A;  4HP9 A;  2GDN A;  1CF0 A;  2A3U A;  2XH9 A;  3LO7 A;  3M6B A;  4LV3 A;  4NXE A;  2HP6 A;  2W3E A;  2ZOH A;  4DE3 A;  5FQJ A;  3B47 A;  3KSH A;  4E3K A;  5FAQ A;  4S2N A;  4JXS A;  4Q0J A;  4LV0 A;  2ZLY A;  1YQS A;  1LL9 A;  3W4P A;  1MWU A;  5FA7 A;  3SS3 A;  3BFF A;  2Y2Q A;  3NCK A;  4OPQ A;  3WS1 A;  4R3A A;  2V9A A;  5E2H A;  5DFX A;  5F1G A;  4AFI A;  4U0T A;  2KX6 A;  4X68 A;  4JGO A;  3MF0 A;  3ZNY A;  2Y59 A;  2GZA A;  2W1T A;  4LRX C;  4H6J B;  4HY8 A;  5KMW A;  4ARZ A;  3KX0 X;  4GS9 B;  5J8X A;  3VE3 A;  3G31 A;  2WAF A;  4PMA A;  2AVX A;  3ZNT A;  4EBP A;  1M40 A;  3WS2 A;  1FQG A;  2H10 A;  1LSW A;  5FI6 A;  5HDC A;  1ZG6 A;  2JKT M;  3G30 A;  4Q0I A;  2HPB A;  4E3O A;  4P0M A;  2HV1 A;  3QP5 A;  3MFD A;  1LSV A;  3FZC A;  2DRW A;  4GOG A;  1E3U D;  3LCE A;  2IWD A;  4UAA A;  4IED A;  4KZ3 A;  1GSV A;  1YM1 A;  3NJA A;  3CMZ A;  4XUX A;  1K57 A;  3MKF A;  5HWV A;  5TBM B;  3VOL A;  5CEB A;  2ZC6 B;  3M2K A;  1IEL A;  5EM0 A;  3OLO A;  3B42 A;  4QJG A;  2WGW A;  1IYP A;  4PM9 A;  4R4S A;  1BLC A;  4WYY A;  5EOO A;  1TS7 A;  2C5W B;  4WEL A;  3LIF A;  1BYW A;  2J3T D;  4F94 A;  1YLT A;  4PM5 A;  2WZX A;  4DE1 A;  2Q9M A;  3O88 A;  3T4O A;  4P85 A;  1S0W A;  3JVU A;  3H82 B;  1JTD A;  2H0Y A;  2WKE A;  1GHM A;  5J7E A;  4S2K A;  5EVI D;  1ERO A;  1VB6 A;  3IX3 A;  4QHC A;  1YSP A;  4EBL A;  2J3T C;  4GKU A;  2G7U A;  2PYP A;  3S7N A;  3IWQ A;  3P7N A;  2PBY A;  4HHD A;  1N9L A;  3V50 A;  4KUO A;  1DJA A;  3LY4 A;  3NEC A;  3NIA A;  3V3R A;  1OT9 A;  2O0Y A;  4KZA A;  1L0F A;  5HL1 A;  4R1G A;  3S4X A;  4WEK A;  4YIN A;  4UQI M;  4K0X A;  4R70 A;  1YAX A;  3O86 A;  5EVI C;  3IF6 B;  3HLD A;  4KZ9 A;  3E4P A;  4YWZ A;  4R4R A;  4LCL A;  3IX8 A;  2HDQ A;  3MS6 A;  2W27 A;  5FQQ A;  4X1L A;  4WBG A;  1Y54 A;  4JPM A;  1PZO A;  4KZ8 A;  4S2P A;  2MJ6 A;  1OTE A;  2K7S A;  1KDW A;  1IOU A;  3LEQ A;  3NDG A;  1MWS A;  3VMA A;  2XEP A;  3U4L P;  5HPF A;  3HLB A;  1NLY A;  1W63 M;  4QPR A;  4KZ5 A;  5TGF A;  1G5U A;  3VSL A;  1DP6 A;  1PW8 A;  1K55 C;  3O5Y A;  5FAO A;  5FDH A;  3LR4 A;  4HBU A;  1DY6 A;  1RGY A;  4FOF A;  2PHY A;  1HTZ A;  2WAE A;  3ITA A;  1L0G A;  1LHY A;  2HP5 A;  1V9Z A;  1W8Y A;  1H8Z A;  2Y2N A;  4GDB A;  5DF7 A;  1XJ3 A;  4UA6 A;  5HD5 A;  1ES4 A;  3IH9 A;  3G2Y A;  4BEN A;  3ITB A;  3DBA A;  4PM6 A;  5E43 A;  2Y2I A;  3E4O A;  1PIO A;  5KIZ A;  4GZB A;  4KEN B;  1TF1 A;  3UDI A;  1PYY A;  4OQH A;  3CPT A;  3MXS A;  2W3D A;  4WL9 A;  3EEH A;  1BZA A;  4I3I A;  3SH8 A;  1OTB A;  2ZM2 A;  4ZBE A;  4D2O A;  5G4Z A;  1PZP A;  4WM9 A;  4DN0 A;  2P04 A;  2OWH A;  5CTN A;  1SKO B;  2YKF A;  4OOM A;  5FQM A;  1MXO A;  4K91 A;  3BEB A;  3OPL A;  2J9O A;  1S1Z A;  3Q82 A;  4R23 A;  3ZFZ A;  2V0W A;  3LR5 A;  3NC8 A;  4LGW A;  4BLM A;  1K56 A;  1Q2P A;  2VKS A;  5U47 A;  5J4E A;  1F98 A;  2W3F A;  1W5D A;  2Y55 A;  3SOI A;  1ES5 A;  1FR6 A;  4LRY C;  3H7W B;  3VV4 A;  3NOT C;  4O01 A;  3IWI A;  4P6B A;  4LLO B;  4PM8 A;  3F1O A;  5E2F A;  3IXH A;  2VGL M;  5IU1 A;  2RL3 A;  2ZQ9 A;  3OPP A;  4ZJ2 A;  5DKL A;  2ZM0 A;  4IJG A;  3FC7 A;  5A91 A;  3Q1F A;  2KLI A;  3E2L A;  3FPV A;  2Y2P A;  3UNW A;  4OH0 A;  3ZGA B;  3MZD A;  3LIB A;  2B5R A;  2B18 A;  1NJ4 A;  3V39 A;  1CJF A;  3CUE C;  3MXQ A;  4UA9 A;  5CHJ A;  4X55 A;  5HW3 A;  5FAT A;  3ZG8 B;  4EWF A;  4EEP A;  5GLB A;  3MQ0 A;  3R4K A;  2Q0O A;  1KGG A;  4U3T A;  3IX4 A;  1HLU P;  4R3J A;  1BT5 A;  3QP6 A;  4HP4 A;  1ERM A;  2EFX A;  5EVE A;  5C5K A;  4LRZ E;  3F1P A;  2ZQD A;  2HJE A;  4HBT A;  4N9L A;  1Y28 A;  3T1Q B;  4CQH A;  1DP8 A;  2OAQ 1;  1FOF A;  4B4X A;  4KQQ A;  3WS0 A;  4ZRR A;  2YKH A;  1STZ A;  2HZ5 A;  1OME A;  3LIE A;  2EWV A;  1M6K A;  1CEG A;  4YNR A;  1K55 A;  4CPK A;  2XD1 A;  2O9C A;  2GJ3 A;  1LL8 A;  1SHV A;  2FFY A;  1TVF A;  1T1A A;  3BJN A;  1ESI A;  4B88 A;  4JXW A;  3W4Q A;  4KZ7 A;  1XP4 A;  3UB8 A;  3SW1 A;  3RXW A;  3GTC A;  3CG5 A;  3LYX A;  2BLS A;  2JBF A;  3CHW P;  4GLQ A;  2EFU A;  4MCW A;  3T4J A;  4OQ0 A;  4OPZ A;  4EQ1 A;  5GLC A;  3EWK A;  3W2Z A;  4MMN A;  4M4X A;  1PWC A;  1S4R A;  1NZU A;  2QPN A;  3RH8 B;  4HH3 A;  2ZL1 A;  3KYZ A;  2Z2L B;  5AQA A;  3IH8 A;  3LR3 A;  3IHA A;  2XRO A;  2WAD A;  4KG2 A;  3UE6 A;  1FSW A;  5EV0 A;  3IBJ A;  4Y15 A;  5EVL A;  1EW0 A;  3R7W B;  1D06 A;  1OTA A;  4DRT A;  4UEY A;  4BD1 A;  4O0P A;  1GHP A;  5G4Y A;  4JF4 A;  1DRM A;  4R0Q A;  4KG6 A;  3W4O A;  1CK3 A;  1BLH A;  5FQI A;  1NLZ A;  5HAP A;  5HAQ A;  4WMC D;  2X01 A;  3WRT A;  3BFD A;  5A90 A;  1D1J A;  1W8Q A;  1EWZ A;  4P87 A;  1WYB A;  4M3K A;  2ZMV A;  3OPH A;  3CWF A;  2VGJ A;  3ICY A;  2X02 A;  3HUM A;  5LBR A;  2I9V A;  4X1M A;  4ZAM A;  2XD5 A;  1PWD A;  3FG8 A;  4FCF A;  2Y79 A;  4XXR A;  3NDE A;  1T1C A;  4Y0U A;  4Y3I A;  3I7J A;  1K4E A;  4PHT A;  2W3G A;  3TJZ C;  2J7V A;  4GCZ A;  1PW1 A;  2EXB A;  2JHE A;  2P9V A;  3KYQ A;  4DF6 A;  3PAG A;  3HCY A;  3CUE A;  4DDS A;  5HAR A;  4X69 A;  3ZVW A;  5GHZ A;  3OZH A;  3BFE A;  2WZZ A;  4GHI A;  1V9Y A;  3MSH A;  1P9R A;  2JN7 A;  3CLO A;  3L9K A;  1JTG A;  3MQO A;  1XJ2 A;  3GR2 A;  3ULF A;  2LB5 A;  1BTL A;  4NKP A;  5KSH A;  3FKW A;  3N7W A;  1NY0 A;  1ALQ A;  1SDN A;  4HES A;  4NXB A;  3S22 A;  4ZJ1 A;  2VJW A;  4I5S A;  4S2M A;  3VFF A;  1HVB A;  3NOU C;  2OSU A;  1ODV A;  2V2F F;  2E8I A;  2V1Z A;  2OV5 A;  4H8R A;  4WF0 A;  3QNC A;  3G6O A;  3GSG A;  3JYI A;  2PU2 A;  5CRF A;  2HP9 A;  5A93 A;  3T12 B;  4K08 A;  3HJI A;  3IF6 C;  4LV1 A;  4ME4 A;  4UQI S;  4Y17 A;  1OT6 A;  1T19 A;  2WKI A;  3MZF A;  3CZD A;  2L4R A;  5CXW A;  5HWT A;  4Y5F A;  3D9Y A;  1MKI A;  2Y2L A;  3QP8 A;  4ESP A;  1VM1 A;  1D7E A;  2H0T A;  1GCE A;  1TS8 A;  5F83 A;  4GD6 A;  4JBF A;  1L2S A;  4Y7P A;  4HI4 A;  5KZH A;  3M6H A;  3KYE A;  2XGN A;  1Z6F A;  4DE0 A;  4IBR A;  2PDR A;  3IHB A;  4H6J A;  2LB9 A;  3G34 A;  1KE0 A;  5IHV A;  2XK1 A;  4GS9 A;  3A0S A;  3A3D A;  3PYP A;  3PBO A;  2RCX A;  3N4I A;  4A5R A;  1IKI A;  3KO6 A;  5HDD A;  4HIA A;  2H28 A;  1PI5 A;  3O87 A;  4WZ5 C;  3HUO A;  2WKQ A;  3LI8 A;  3B33 A;  2IWC A;  4NET A;  4WLA A;  5EE8 A;  1GSW A;  4CLC A;  3NOP C;  5DTK A;  4I3J A;  3LFV A;  2QWS A;  2M7V A;  4BQM A;  4Q8I A;  3TSG A;  3F1N B;  4S2I A;  3N8R A;  1ONG A;  3K3C A;  4EQI A;  4HJ3 A;  3C5A A;  4NG2 A;  2ZMF A;  2Y2G A;  4JF5 A;  2V20 A;  4QY6 A;  3ZG9 B;  1BLS A;  2ZBB A;  3DTI A;  1WE4 A;  3IF5 A;  3W8K A;  5FSR A;  3MBZ A;  1H8M A;  1XJ6 A;  2GNX A;  1XX2 A;  4MBK A;  2O99 A;  3A0V A;  3HVF A;  2ZM8 A;  4PM7 A;  3UE1 A;  4HNB A;  1MWR A;  3ZVT A;  1IFQ A;  3PTE A;  4B4Z A;  1YT4 A;  4FUW A;  1MPL A;  2DMW A;  4LV2 A;  3Q7V A;  5I5L A;  5DF9 A;  4S2J A;  2Y2H A;  2M1C A;  3P01 A;  5AVF A;  4O7D A;  5EFW A;  3G2Z A;  4FH4 A;  2JKG A;  2VGL S;  3IXG A;  5FEG A;  4JGQ A;  2Y2J A;  4QU3 A;  2Z6D A;  4EU0 A;  1W7F A;  3D72 A;  1CQA A;  5D3O A;  5AJG A;  5EUA A;  1S1Y A;  1N9B A;  4N92 A;  2WKP A;  2VLG A;  1H3Q A;  3OCL A;  1P9W A;  3BFC A;  4Y0O A;  1RP5 A;  5FEF A;  3IF6 A;  2VA0 A;  2O9B A;  1FIL A;  2B95 A;  1YMS A;  1BLP A;  4GNU A;  5EPH A;  5IS1 A;  3C7U A;  4KZ6 A;  5L2F A;  1IEM A;  3MKE A;  3SS4 A;  1JWV A;  1XXM A;  3LID A;  1K54 C;  1G6O A;  1CI8 A;  5FQ9 A;  1LL5 A;  2UV0 E;  4KQO A;  1PI4 A;  3LIC A;  3UPP A;  3T1R A;  3EOI A;  2VEA A;  1VQQ A;  3RFB A;  5CER A;  1OJ5 A;  3P09 A;  2A24 B;  3UE3 A;  2XSS A;  2ACG A;  3IS2 A;  1UGU A;  5L10 A;  4R3B A;  4E6X A;  4QD4 A;  3BY8 A;  2L0W A;  2Y2K A;  1KOU A;  3FKV A;  5DTT A;  3VE4 A;  3OOV A;  3MXR A;  4JXV A;  1N9O A;  4L9G A;  1VEU A;  1VHM A;  2EX6 A;  5E2E A;  2K31 A;  3EEA A;  2CMN A;  1ZC2 A;  1E3U A;  3F1O B;  5GLA A;  3HLF A;  3B3X A;  2J8Y A;  4II7 A;  4E04 A;  1ERQ A;  4U0X A;  4BMW A;  1MWT A;  3VOZ A;  2HDS A;  1FCM A;  4RX3 A;  4P6Z M;  3SH7 A;  4N1X A;  5HWW A;  2QZ6 A;  4X53 A;  1XKZ A;  4EV4 A;  1PRQ A;  1IYO A;  5EEC A;  4EER A;  1YMX A;  4PKY A;  2HJ9 C;  3OCN A;  2ZQ8 A;  1TS6 A;  3HLE A;  5CHM A;  5EM1 A;  3BY9 A;  4JGR A;  1K38 A;  3WWX A;  3BQA A;  3PBR A;  3VP4 A;  3E4Q A;  1LI9 A;  2VGK A;  1G68 A;  3P98 A;  3H9W A;  2J3W A;  5HSQ A;  3UB5 P;  3T50 A;  4ZJ3 A;  5FL3 A;  1LLB A;  5HFO A;  3BM6 A;  5I94 A;  2OAP 1;  4E3N A;  3F1P B;  4OOL A;  3ZG5 A;  2INW A;  2Y2M A;  1MC0 A;  2V8F A;  5HD3 A;  5EVI A;  4ZDX A;  2G2W A;  3ISG A;  3ZYT A;  3K2N A;  4O8G A;  2A2L A;  2HGV A;  2FH5 A;  3DWZ A;  3PBS A;  1K6R A;  1FSY A;  2HDR A;  4E6W A;  4QB8 A;  2ZJ9 A;  4MDZ A;  3FYZ A;  4QWO A;  3PXP A;  1PWG A;  1K6S A;  1W79 A;  2OLV A;  3BW6 A;  3U2A A;  3TW8 A;  2W0N A;  3QP1 A;  4C3Q A;  3V5M A;  1AWI A;  1HZO A;  2DNS A;  2ZD8 A;  3NUL A;  4OKP A;  2PU4 A;  2BAS A;  3ZQ5 A;  4JLF A;  4DXC A;  3FV7 A;  4DKI A;  4Y2F A;  2PR6 A;  4GN2 A;  4N1H A;  3UB7 A;  2BG1 A;  4B93 A;  3UME A;  1P97 A;  3HRE A;  1T1B A;  2XFS A;  2Z2M B;  5CED A;  3HJK A;  4XT2 A;  4S2N C;  2JKR M;  5M18 A;  2IA2 A;  4FD8 A;  3TG9 A;  4DJ2 A;  1TDL A;  3A0R A;  2J9P A;  3ZHH A;  4LCM A;  4F3L B;  4OLG A;  4GB7 A;  1XFQ A;  1Z09 A;  2XF3 A;  1IYQ A;  2XA7 M;  1GHI A;  2G2U A;  2NUP C;  5DJU A;  1E25 A;  4FSF A;  1H5X A;  4B9O A;  4IVK A;  1NRJ A;  4C6Y A;  2H5S A;  3CJM A;  3AGD A;  3VP1 A;  4OLD A;  1W63 Q;  1SKF A;  2VV8 A;  2EXA A;  1TD5 A;  3KSG A;  4MNR A;  2FZ0 A;  3ZCZ A;  3A3J A;  4EBN A;  3JPU A;  5TFQ A;  1EI5 A;  2EA9 A;  3PBQ A;  1H0M A;  3UO9 A;  1GA0 A;  3CAX A;  5F69 A;  2JKF A;  5GHY A;  3GMW A;  1NYY A;  3A3I A;  1JWP A;  5HAI A;  1ES2 A;  3SZT A;  1MZU A;  4YOF A;  1K57 C;  5F1F A;  3GVB A;  1WA9 A;  4GHI B;  4R38 A;  4Z9Q A;  5CX7 A;  4DXB A;  2OLU A;  4WN5 A;  2VV7 A;  2QJ7 A;  4I39 A;  5CTM A;  4OP8 A;  3QP2 A;  1K25 A;  2Y2O A;  5HL6 A;  3SS5 A;  2WKR A;  1SCW A;  4DDY A;  5DVA A;  3G32 A;  1YLZ A;  1X0O A;  3DTM A;  5L8M A;  1BUE A;  3E0Y A;  3D4F A;  4MN7 A;  3GEC A;  2I72 A;  2ZQ7 A;  1KVM A;  4HJ6 A;  4GD8 A;  2JKR I;  1LI0 A;  5GL9 A;  4LFU A;  2ZQC A;  1UWN X;  1MKM A;  3G4P A;  4JF6 A;  5DJT A;  2QHK A;  3GQZ A;  2X71 A;  3O3V A;  2V8C A;  5CEC A;  1IYS A;  4IHQ A;  4FH2 A;  5HDS A;  1YKD A;  5KSC A;  3N8L A;  2PYR A;  2OOL A;  2JE5 A;  5CGS A;  2Z6C A;  4WEJ A;  1NZO A;  2D01 A;  3C7V A;  3ZG0 A;  2W1T B;  5F5Y A;  4D60 A;  4ARZ B;  2QJ5 A;  3IBR A;  1VET A;  3LEZ A;  2R9X A;  4EET B;  5JYP A;  2HF6 A;  4X25 A;  1FIK A;  4GDN A;  1K0K A;  1TS0 A;  1XFN A;  3OPR A;  4Y13 A;  3CI6 A;  3DAV A;  2B02 A;  4OQI A;  3WRZ A;  5CHU A;  2XFT A;  2EX2 A;  2ZC4 B;  4KQD A;  3VP2 A;  5M19 A;  3GRJ A;  2QYB A;  5JYO A;  2ZC3 B;  4E3J A;  5AQB A;  2V1B A;  1ZTU A;  1L0E A;  1F5M A;  3QHY A;  1ONH A;  4X6T A;  5F82 A;  3S7P A;  3QNB A;  2W3H A;  2WGW B;  5AVE A;  3AGE A;  4KUK A;  1P0Z A;  5FQK A;  1GSX A;  1NRF A;  1N4O A;  1SZV A;  3IXB A;  4CLC B;  3BYD A;  1S4S A;  5TR7 A;  1I5Q A;  1XA7 A;  5FAP A;  3IQA A;  5CGW A;  3A3E A;  2WK0 A;  4L9F A;  3KSI A;  3EGD C;  4RQ9 A;  1K56 D;  2XR0 A;  1L0D A;  1MBL A;  1K4F A;  4HOI A;  3LGO A;  3PAE A;  4WMC A;  5DTS A;  3Q07 A;  3IXD A;  4EUV A;  3V3S A;  4C75 A;  3L7H A;  4ZTK A;  1CI9 A;  4G3K A;  5BOH A;  3UB6 A;  3ZDJ A;  4CLC E;  3C2W A;  1LSX A;  1HD8 A;  4EEU A;  3WS5 A;  1E4D A;  5DKK A;  1F2K A;  5TBM A;  3Q7Z A;  3BWL A;  3UB9 A;  1ZG4 A;  2P74 A;  3PBT A;  3E2K A;  3Q7V B;  2HDU A;  3S1Y A;  4S2O A;  4K0W A;  4JXG A;  3AGF A;  2VV6 A;  3DWK A;  1YLP A;  2VX8 A;  4UA7 A;  1KE3 A;  1F9I A;  3UMD A;  5A92 A;  4HQA A;  2BTF P;  2ZOI A;  1TDG A;  3MZE A;  1JWZ A;  4P6Z S;  3F1N A;  4G3W A;  2XLN A;  2M7U A;  3H82 A;  3C38 A;  3LUQ A;  2XQZ A;  1S66 L;  5IT5 A;  5DFY A;  3T4K A;  3T4T A;  4S2L A;  5F68 A;  1QMF A;  1TEM A;  3BLM A;  4JKT A;  3UPO A;  4HEF A;  1A0K A;  2PR5 A;  2ZMA A;  3UE0 A;  4Q0H A;  2D02 A;  4OP5 A;  3HL9 A;  3Q81 A;  2JKT I;  4I3A A;  3T1S A;  2JC7 A;  1WYC A;  1O07 A;  3LY3 A;  1PNE A;  3MQQ A;  3D3O A;  5EOE A;  2QKP A;  5J3W A;  3IS2 B;  3CPT B;  1ZKJ A;  2XDM A;  3T4Q A;  3MJQ A;  3ZG7 B;  5HX9 A;  4BBT A;  1OTD A;  3HUN A;  3DTE A;  2A49 A;  4DJ3 A;  5HZH A;  4CJN A;  3TRC A;  1VEU B;  4MN6 A;  4MLL A;  3C30 A;  1KE4 A;  3TOI A;  3NY4 A;  3T4S A;  4UHU A;  5FI7 A;  4L9E A;  1N9N A;  1FR1 A;  3DW0 A;  3M2J A;  4NEE D;  3BLS A;  3FPW A;  4IUH A;  4NK3 A;  3N8S A;  2W1R A;  4DE2 A;  4PKY G;  1L3L A;  2PRF A;  5M1A A;  3VOY A;  4WZ5 A;  4EUZ A;  4E3M A;  2WGV A;  5K5B A;  3HBR A;  4OPY A;  2Y91 A;  2A24 A;  3DTK A;  4E3L A;  4Z1W A;  1I2W A;  4BL3 A;  3MMH A;  3BEC A;  1Y4O A;  4OQG A;  1KGF A;  4IBX A;  3S7O A;  4DMZ A;  1JVJ A;  2XA7 S;  3PHY A;  2VZW A;  4KZ4 A;  1I2S A;  4OPR A;  2R78 A;  5AQ9 A;  1RGZ A;  1SKO A;  5EVI B;  3HLW A;  4JGP A;  2O9A A;  1MY8 A;  1XA1 A;  4WUJ A;  2PD7 A;  4XUZ A;  3IWO A;  4I38 A;  2QMI A;  4E3I A;  3OC2 A;  5MC7 A;  1ES3 A;  3EQV A;  1XPB A;  2J80 A;  4OOY A;  4OON A;  2PBD P;  3MR0 A;  1ESU A;  1YLY A;  3VP0 A;  3HLG A;  3H7W A;  2WYX A;  2V0U A;  4R6L A;  1J3W A;  1BSG A;  3PR6 A;  1KDS A;  1S67 L;  4EW7 A;  1DJC A;  1G28 A;  4GJ4 A;  2R9W A;  2PD8 A;  2ZC7 A;  4GW9 A;  3E98 A;  4RX2 A;  3JVV A;  3KSF A;  1XGJ A;  2KDK A;  3RTY A;  4EXO A;  4QY5 A;  3GDI A;  3TE8 A;  2FFF B;  1FCO A;  4IVI A;  4BWI A;  1ZHH B;  4ETX A;  3LIA A;  1QME A;  3VFH A;  2P08 A;  3EQU A;  5FDS A;  1BUL A;  3RJU A;  2CC1 A;  1KVL A;  4KQR A;  4XT2 B;  1OPX A;  5GLD A;  4G3V A;  4HJ4 A;  1DJB A;  5E2G A;  1FCN A;  4FTX A;  3UY6 A;  2ZL1 B;  5FAS A;  1ACF A;  1OTI A;  4EES A;  4RVA A;  2ZC5 B;  4RYE A;  3PBN A;  4PAU A;  2C6W B;  3QP4 A;  1NWZ A;  1H8Y A;  2UWX A;  4MN5 A;  4MBF A;  5F6A A;  1UWP X;  2IWB A;  1C3B A;  2ZQA A;  3RXX A;  1RCJ A;  1YLW A;  3V67 A;  3NHQ A;  5A8B A;  1K54 A;  3LR0 A;  2JCH A;  3C4O A;  4YFM A;  5AQ7 A;  2E8J A;  3OBF A;  3UN7 A;  2NUT C;  1IKG A;  1JNU A;  3UPN A;  4IUK A;  5GHX A;  2PAV P;  2WKH A;  2K2N A; 
#chains in the Genus database with same CATH homology
 4WEJ A;  2ZBB A;  2D01 A;  1S1Z A;  2KOI A;  2W1T B;  2V0W A;  3S7Q A;  1H8M A;  5TJJ A;  3LR5 A;  1XJ6 A;  2GNX A;  5F5Y A;  4ARZ B;  4BBU A;  2O99 A;  2VKS A;  3A0V A;  4NXG A;  2QJ5 A;  5J4E A;  3IBR A;  1F98 A;  2W3F A;  4EET B;  4LRY C;  4HNB A;  3H7W B;  2Y8H A;  3NOT C;  2HF6 A;  3VV4 A;  1IFQ A;  4O01 A;  1DP9 A;  4LLO B;  2P7J A;  2DMW A;  1TS0 A;  1XFN A;  5I5L A;  3F1O A;  5DF9 A;  2XRN A;  1XJ4 A;  2VGL M;  5IU1 A;  2M1C A;  3P01 A;  4F3L A;  3CI6 A;  5DKL A;  5AVF A;  4IJG A;  2B02 A;  4BBV A;  3FC7 A;  5EFW A;  2KLI A;  3FPV A;  2VGL S;  4KQD A;  4JGQ A;  2QYB A;  2Z6D A;  4EU0 A;  3LIB A;  2B18 A;  3D72 A;  4NXF A;  5AJG A;  1S1Y A;  2V1A A;  3C8C A;  3CUE C;  3MXQ A;  2V1B A;  1ZTU A;  3R7W A;  4CLC D;  2WKP A;  1F5M A;  4LPZ A;  2VLG A;  1H3Q A;  3OCL A;  5HPI A;  1P9W A;  1YSQ A;  4EEP A;  3S7P A;  1LT0 A;  2W3H A;  3MQ0 A;  3R4K A;  5AVE A;  4KUK A;  1P0Z A;  3T4L A;  2VA0 A;  4ETZ A;  2O9B A;  4HP4 A;  1GSX A;  3K3D A;  3LI9 A;  2GX5 A;  4CLC B;  3BQ8 A;  5C5K A;  1S4S A;  4CLC C;  5IS1 A;  4LRZ E;  3F1P A;  3MFX A;  2HJE A;  3CIT A;  4L0L A;  1Y28 A;  4CQH A;  1DP8 A;  2OAQ 1;  3LID A;  4L9F A;  1G6O A;  3KSI A;  3EGD C;  4RQ9 A;  2OWJ A;  4ZRR A;  2YKH A;  4HOI A;  4KQO A;  1STZ A;  3LIC A;  3LIE A;  2EWV A;  4HH2 A;  4YNR A;  3EOI A;  2VEA A;  4EUV A;  3EGX C;  3RFB A;  1OJ5 A;  2O9C A;  2GJ3 A;  1LL8 A;  2A24 B;  3UE3 A;  4G3K A;  2L1M A;  2XSS A;  3IS2 A;  1UGU A;  4BJP A;  3BJN A;  1T1A A;  2PT7 A;  3UB6 A;  3BY8 A;  2L0W A;  1KOU A;  3VE4 A;  3UB8 A;  4CLC E;  3SW1 A;  3C2W A;  1LSX A;  3OOV A;  3LYX A;  1T18 A;  4EEU A;  1N9O A;  1OJG A;  2EWW A;  4L9G A;  5DKK A;  4GLQ A;  4MCW A;  4HP9 A;  5TBM A;  3T4J A;  1VHM A;  3BWL A;  3UB9 A;  2K31 A;  3EEA A;  4EQ1 A;  3EWK A;  3PBT A;  3W2Z A;  2CMN A;  4MMN A;  4M4X A;  4NXE A;  3F1O B;  1S4R A;  3RH8 B;  2W3E A;  4HH3 A;  2ZOH A;  3KYZ A;  4II7 A;  4E04 A;  4BMW A;  3LR3 A;  3B47 A;  3KSH A;  2VV6 A;  2XRO A;  4P6Z M;  5HWW A;  2VX8 A;  3UE6 A;  3IBJ A;  1F9I A;  4Q0J A;  3UMD A;  4HQA A;  2ZOI A;  4P6Z S;  4EER A;  1EW0 A;  3F1N A;  4G3W A;  4PKY A;  2HJ9 C;  3R7W B;  3OCN A;  1D06 A;  1OTA A;  1TS6 A;  4R3A A;  2M7U A;  3H82 A;  4UEY A;  2V9A A;  4O0P A;  3C38 A;  5G4Y A;  3BY9 A;  5DFX A;  1DRM A;  3LUQ A;  4JGR A;  4AFI A;  2KX6 A;  3BQA A;  4JGO A;  1S66 L;  3MF0 A;  5DFY A;  5IT5 A;  3T4K A;  3PBR A;  1NLZ A;  2GZA A;  3T4T A;  5F68 A;  3E4Q A;  2W1T A;  3H9W A;  4LRX C;  4H6J B;  2J3W A;  4HY8 A;  5HSQ A;  4ARZ A;  3T50 A;  5FL3 A;  3KX0 X;  4GS9 B;  2PR5 A;  2OAP 1;  3VE3 A;  3F1P B;  4OOL A;  4Q0H A;  2ZMV A;  2INW A;  3CWF A;  1MC0 A;  2D02 A;  3ICY A;  5HD3 A;  5LBR A;  3ZYT A;  2I9V A;  3K2N A;  1LSW A;  3FG8 A;  4O8G A;  5HDC A;  2Y79 A;  2JKT I;  2JKT M;  4Q0I A;  1T1C A;  4Y3I A;  2A2L A;  4I3A A;  2HV1 A;  2HGV A;  2FH5 A;  3MQQ A;  4PHT A;  1LSV A;  2W3G A;  3D3O A;  2QKP A;  5J3W A;  3IS2 B;  3PBS A;  3TJZ C;  4GCZ A;  3T4Q A;  3MJQ A;  2JHE A;  3KYQ A;  4BBT A;  1OTD A;  1GSV A;  3HCY A;  3CUE A;  3NJA A;  4MDZ A;  4DJ3 A;  3PXP A;  5HZH A;  3TRC A;  5HWV A;  4MN6 A;  5TBM B;  3BW6 A;  3U2A A;  3TW8 A;  3VOL A;  3C30 A;  2W0N A;  4GHI A;  1V9Y A;  1P9R A;  2JN7 A;  3CLO A;  2BAS A;  3ZQ5 A;  3T4S A;  3OLO A;  3B42 A;  3MQO A;  4Y2F A;  1XJ2 A;  2PR6 A;  4L9E A;  1N9N A;  3ULF A;  2LB5 A;  3UB7 A;  4B93 A;  1TS7 A;  4NKP A;  1P97 A;  4WEL A;  3UME A;  3LIF A;  1BYW A;  4NEE D;  5KSH A;  1T1B A;  3FPW A;  4IUH A;  2J3T D;  3HJK A;  4XT2 A;  2JKR M;  2W1R A;  4NXB A;  2IA2 A;  4PKY G;  3T4O A;  4DJ2 A;  3A0R A;  3JVU A;  4F3L B;  2VJW A;  3H82 B;  4I5S A;  3NOU C;  5K5B A;  5J7E A;  1XFQ A;  1VB6 A;  1YSP A;  2A24 A;  1ODV A;  2J3T C;  2G7U A;  2PYP A;  2XA7 M;  4Z1W A;  3S7N A;  3MMH A;  3P7N A;  4HHD A;  1N9L A;  2NUP C;  4WF0 A;  5DJU A;  4FSF A;  4B9O A;  3G6O A;  3S7O A;  4DMZ A;  4KUO A;  1NRJ A;  2XA7 S;  3PHY A;  1OT9 A;  2VZW A;  2O0Y A;  2R78 A;  4WEK A;  4UQI M;  4R70 A;  1YAX A;  4JGP A;  4K08 A;  2O9A A;  3HJI A;  3E4P A;  4YWZ A;  1W63 Q;  2W27 A;  4WUJ A;  4ME4 A;  4UQI S;  2VV8 A;  2PD7 A;  1TD5 A;  3KSG A;  2FZ0 A;  1OT6 A;  4I38 A;  1T19 A;  2MJ6 A;  3OC2 A;  1OTE A;  3EQV A;  5MC7 A;  2J80 A;  2K7S A;  2EA9 A;  3PBQ A;  1IOU A;  3MR0 A;  2L4R A;  3CAX A;  3H7W A;  5F69 A;  5HWT A;  2V0U A;  4Y5F A;  4R6L A;  3PR6 A;  5HPF A;  1S67 L;  4EW7 A;  1G28 A;  1NLY A;  4GJ4 A;  1W63 M;  4QPR A;  2PD8 A;  1MZU A;  4YOF A;  1DP6 A;  1D7E A;  3E98 A;  3O5Y A;  4GW9 A;  3LR4 A;  1WA9 A;  4GHI B;  3JVV A;  1TS8 A;  3KSF A;  2KDK A;  4R38 A;  3RTY A;  5CX7 A;  4FOF A;  2PHY A;  4WN5 A;  2VV7 A;  4EXO A;  2QJ7 A;  4HI4 A;  4I39 A;  3GDI A;  3TE8 A;  5HL6 A;  1ZHH B;  4BWI A;  2PDR A;  2WKR A;  4H6J A;  4ETX A;  1V9Z A;  2LB9 A;  3LIA A;  2P08 A;  3EQU A;  4GS9 A;  3A0S A;  1X0O A;  3PYP A;  1XJ3 A;  3PBO A;  5L8M A;  4XT2 B;  5HD5 A;  1OPX A;  4G3V A;  3KO6 A;  4HJ4 A;  3E0Y A;  5HDD A;  4HIA A;  3DBA A;  2H28 A;  4MN7 A;  2WKQ A;  3LI8 A;  3GEC A;  1OTI A;  3B33 A;  3E4O A;  4EES A;  4WLA A;  3PBN A;  5KIZ A;  1GSW A;  4PAU A;  1NWZ A;  4CLC A;  3NOP C;  4I3J A;  4MN5 A;  1TF1 A;  5F6A A;  3LFV A;  1UWP X;  4HJ6 A;  2JKR I;  2QWS A;  3V67 A;  2M7V A;  3NHQ A;  5A8B A;  1UWN X;  3LR0 A;  1MKM A;  2W3D A;  3EEH A;  4WL9 A;  3F1N B;  5DJT A;  2QHK A;  3K3C A;  3OBF A;  4I3I A;  2NUT C;  1OTB A;  4HJ3 A;  5G4Z A;  1JNU A;  4IHQ A;  4DN0 A;  2P04 A;  4IUK A;  2OWH A;  2ZMF A;  5HDS A;  1YKD A;  2YKF A;  4OOM A;  2PYR A;  2OOL A;  2Z6C A;  2K2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...