3E98A

Crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
VSLVERQVRLLRERNIEMRHRLSQLMDVARENDRLFDKTRRLVLDLLDATSLEDVVSTVEDSLRHEFQVPYVSLILFSDSSVSVGRSVSSAEAHQAIGGLLSGGKTVCGVLRPHELAFLFGESDRDEIGSAAVVSLSFQGLHGVLAIGSPDPQHYKSSLGTLFLGYVAEVLARVLPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAF Domain of Unknown Function
publication title Crystal structure of a GAF Domain with Unknown Function (NP_253966.1) from PSEUDOMONAS AERUGINOSA at 2.43 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 58
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04340 DUF484 Protein of unknown function, DUF484
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3e98A00
1VHMA 3ZQ5A 4G3KA 3E0YA 3S7PA 2OOLA 4FOFA 5I5LA 3OOVA 2B18A 2M7VA 3K2NA 4EU0A 4LRYC 4GLQA 4O01A 2VZWA 4MCWA 2VJWA 3DBAA 2W3EA 2Y79A 3MQ0A 4Q0HA 3KSIA 2G7UA 2XRNA 4BWIA 2K2NA 3NOTC 2O0YA 2HGVA 4LRZE 5C5KA 2VEAA 2W1TA 2O9AA 3S7QA 3E98A 3IBRA 2W3GA 4Z1WA 1YKDA 3TRCA 3CI6A 2W1TB 2O99A 2GX5A 1F5MA 4IUHA 2O9CA 5AJGA 3S7OA 3OBFA 2O9BA 3KSHA 4LRXC 4YNRA 2LB5A 2LB9A 4ME4A 5HL6A 5HSQA 4DMZA 5K5BA 4E04A 5L8MA 2VKSA 3KSGA 3O5YA 3VV4A 4R70A 1YSPA 3C2WA 4R6LA 4YOFA 3NOUC 4Y2FA 2W3HA 3NOPC 2KOIA 3R4KA 4ETZA 2W3DA 5DFYA 1TF1A 4PAUA 4CQHA 2KLIA 3KO6A 5HPIA 4G3VA 4Y5FA 2K31A 4Q0JA 4Y3IA 4O0PA 3MF0A 1MC0A 4MN7A 4GW9A 4Q0IA 3KSFA 4MDZA 5LBRA 2Y8HA 3BJNA 4EUVA 4O8GA 4IUKA 1TD5A 1YSQA 3W2ZA 3D3OA 3G6OA 2IA2A 4IJGA 3RFBA 3MMHA 3LFVA 1MKMA 5TJJA 2QYBA 3NHQA 2XSSA 4G3WA 2M7UA 3S7NA 3EEAA 2W1RA 3IBJA 4MMNA 2W3FA 5HPFA 1ZTUA 4DN0A 4RQ9A 3CITA 4QPRA 2XROA 5DFXA 4ETXA 2ZMFA 3HCYA 4ZRRA 1STZA
chains in the Genus database with same CATH superfamily
4G3KA 2ZC6B 4K0XA 5G4YA 5DJUA 5CHMA 3Q7ZA 1E4DA 2OLVA 5EOOA 5FQQA 5GLAA 3FKWA 2JBFA 1XP4A 4WZ5A 3P09A 3B33A 2G7UA 3UY6A 2O0YA 3JPUA 4KQQA 3E98A 1BULA 2J3TC 3NJAA 4ZDXA 1LI0A 1YKDA 1BLSA 3FV7A 1PYYA 3JVVA 1OTAA 4YNRA 2L1MA 2CC1A 2WKPA 1L3LA 2GZAA 5BOHA 4NEED 4I38A 1XPBA 3MKFA 4NXBA 4JF6A 3E4OA 2VA0A 5EM0A 3ISGA 2FH5A 2XFTA 3IXGA 3T1QB 5CXWA 4Z9QA 1Y4OA 5EECA 1Z09A 5EV0A 1MWSA 3T4KA 4X69A 4EUVA 2V0WA 4WF0A 3HLEA 3CAXA 1S66L 3GVBA 3OC2A 4UQIM 1EW0A 1FSWA 3HJIA 2J9PA 3WRTA 2ZJ9A 1ONHA 1GSXA 1SKOA 3IXDA 2A2LA 4EQ1A 3G2ZA 4LLOB 3HCYA 3DWZA 1ES2A 3E0YA 2PDRA 3S7PA 3VP2A 1I5QA 4IBXA 1OTIA 2H10A 1NYYA 3UB7A 2ZD8A 1BYWA 2A24A 1FCMA 2K2NA 4M4XA 4F94A 1S4SA 2J3WA 4BQMA 4E3MA 2WGWA 4LENA 5JYPA 3CUEC 4WLAA 2JHEA 3RTYA 1K57C 1T18A 1ESUA 4GHIA 2HDQA 5DF8A 1OJ5A 1KVLA 3PYPA 1PI4A 4MN5A 1YSPA 1CF0A 3T1SA 4E3JA 3AGDA 4CJNA 5F83A 2ZC5B 4KENB 4PAUA 4DDYA 4P87A 5HPIA 3F1OA 3PTEA 4B4XA 5HAIA 4E3KA 1MC0A 4MN7A 3HUOA 2JE5A 1K57A 1OJGA 2AVXA 3BJNA 4OQ0A 2Z6CA 1Q2PA 2Y2LA 2QKPA 3IS2B 3D3OA 3PBRA 3KX0X 2RL3A 1SKFA 3CPTB 2HDUA 2EWVA 5EUAA 2HF6A 4X56A 1VQQA 4R38A 3S7NA 1G28A 4GDBA 4U3TA 3ZCZA 4X1MA 1W8YA 3CITA 4QPRA 4JPMA 4MN6A 4ZRRA 1K56D 1STZA 1BLCA 1K25A 3OPRA 4HBUA 3O87A 4HBTA 5J7EA 5FI7A 2B18A 1PWDA 2K7SA 3JYIA 4OP8A 3A3EA 1GA9A 1K55A 1LT0A 3DBAA 4Q0HA 3W4OA 3UDFA 1KDSA 4KQOA 3IBRA 2A49A 2BASA 1P9WA 1HD8A 4Z1WA 3M6BA 1GSWA 1K0KA 4JXGA 4QWOA 3QP6A 4RX3A 3RH8B 2XA7M 2INWA 3HLDA 2W0NA 5AJGA 4N1XA 2HDRA 1HTZA 5HL6A 3L9KA 4DMZA 4BD0A 4MBKA 4X25A 2ZM8A 4WBGA 5EVID 1SCWA 5MC7A 3KSGA 4BBUA 4PKYG 1MY8A 1CEGA 4N92A 2A3UA 3WRZA 1K54C 3FWLA 5HWVA 5FQMA 4Y3IA 2WKQA 1AXBA 2Y2PA 2VGKA 3C5AA 4BBTA 3UDIA 5LBRA 3MXRA 2XA7S 1VEUB 2G2UA 3UNWA 4EEPA 1MKMA 1TS8A 3BFCA 4NK3A 3MZEA 4QB8A 4P6ZS 1OT6A 2I72A 5FQ9A 3PAEA 4ZJ1A 4OQIA 5EFWA 5J4EA 2QWSA 4MMNA 2XD1A 5AQBA 1ZTUA 3LR3A 4DN0A 5TBMB 4ID4A 1DRMA 5CGXA 4HJ6A 4JGPA 1TS6A 2MJ6A 3SS5A 2V9AA 4D60A 4LRZE 4EBLA 2ZQ8A 1ES5A 4KZ3A 1WE4A 1YQSA 1F5MA 3CLOA 3T4QA 4IBRA 1XA1A 2O9CA 2OWJA 1NLZA 4RYEA 3F1NB 4I39A 1IKGA 3T4SA 5EPHA 4LV1A 3EGXC 4PMAA 1GHPA 2VKSA 4KZBA 4K0WA 5FL3A 3SZTA 5A92A 3O5YA 4N9LA 2PU2A 3NDEA 3W4QA 1DP8A 3T4TA 2ZC3B 1T1CA 1L2SA 5FQJA 3NULA 1ODVA 4RX2A 1MXOA 1JWZA 3ZDJA 2JC7A 4OPYA 1PFLA 3LO7A 1F98A 5HDSA 5KIZA 2OWHA 5G18A 5F1GA 3HLWA 3FC7A 4O7DA 5EVIB 2BLSA 2IWCA 3GRJA 3TOIA 1PI5A 2HP5A 2BTFP 1H8MA 1ONGA 1MWUA 4UA7A 2HP6A 1MPLA 3Q1FA 3MZDA 2EA9A 1NRFA 4WN5A 3IT9A 3PHYA 3LGOA 4S2KA 4FD8A 2V1AA 4ESPA 4KZ8A 1J9MA 3BQAA 3S1YA 3S7QA 3HUMA 1YAXA 1Z6FA 1XA7A 2Y91A 1Q2QA 1CQAA 5A93A 4HP9A 2J80A 3CI6A 2O99A 4EQIA 3V5MA 1W63M 4Y0OA 2WKEA 1I2SA 3T1RA 1WA9A 1FSYA 4DRTA 3M2KA 4OOMA 5HSQA 4QHCA 1LI9A 3QP8A 1A0KA 4E3NA 3C7UA 1LSVA 4XT2B 5M19A 1LHYA 4YOFA 3NOUC 4X6TA 2KLIA 2XD5A 2DMWA 5HAQA 1ERMA 5E43A 3IX3A 1H3QA 5EVLA 2H28A 3CHWP 2FZ0A 2EX9A 2V8CA 1BTLA 4QY6A 1TVFA 3B3XA 3EEHA 4R1GA 3LFVA 4LV2A 3GQZA 2XGNA 3FKVA 5TJJA 3R7WB 5FDHA 3LUQA 2CMNA 4I3IA 3EEAA 1IYPA 2WKIA 3N8RA 3LIEA 4R3BA 2DRWA 3F1PB 2JKTM 1TS0A 3IS2A 1ESIA 5CECA 2VV8A 3HLBA 5TFQA 2OAQ1 2V8FA 2PAVP 3CPTA 5I5LA 4WZ5C 3TG9A 4YWZA 3UO9A 2P04A 1LL5A 3LY3A 3OPPA 3MZFA 4Y17A 4DJ2A 4JXSA 5KSCA 4R0QA 2WADA 4D2OA 3C8CA 3RXWA 1XJ3A 4JLFA 5DJTA 3TRCA 3Q82A 1IKIA 4OLGA 1NZUA 3ZVWA 2ZQDA 3BEBA 4DXCA 1DY6A 4LRXC 1IYQA 4MEZA 5EE8A 4M3KA 1IELA 2R9WA 4DKIA 4L9GA 3C4OA 3O88A 1H5XA 4DXBA 3KYQA 3QNBA 3WS4A 4PPRA 4S2PA 5KSHA 5DFYA 1TF1A 3KO6A 3QHYA 3Q07A 2P08A 2H0YA 2QHKA 2Y55A 2YKFA 3U4LP 3ZYTA 1W7FA 3RXXA 4NXFA 4GDNA 5HZHA 3D72A 1BSGA 3MQQA 5E2HA 5FAQA 1VM1A 4GNUA 1TD5A 1PZPA 1G68A 1P97A 1EROA 4YINA 3IX8A 5F1FA 1MKIA 5CTNA 1ERQA 2X71A 4QD4A 1XFQA 2B02A 1U60A 4E3IA 4GS9B 1JWVA 4HOIA 1NY0A 3O86A 4PM8A 3FPVA 3IX4A 5CGWA 1X0OA 1VEUA 4IVKA 5J3WA 3MQOA 2JKRI 1MWTA 3SS4A 4LGWA 1YLWA 3C38A 3LCEA 5L09A 4EETB 2M7VA 4JGRA 4ZTKA 4NETA 4BWIA 4NG2A 3KSIA 5HD3A 3WS2A 1ES4A 5TBMA 3IF5A 3BM6A 4DE1A 5F68A 4EERA 2W3GA 3GSGA 1VETB 4HH3A 1MBLA 3ITAA 4HH2A 2PU4A 2PYRA 4B4ZA 3L7HA 3BFDA 2HZ5A 3VOZA 1UWPX 2X02A 2P74A 5HWWA 1K4FA 4KG6A 3S4XA 1XFNA 4X53A 5G4ZA 3LIBA 3EGDC 4XXRA 3F1NA 5GLCA 3OPHA 2ZLYA 2J3TD 2PBDP 2WZXA 2XFSA 2IWDA 2Y2IA 2NUTC 4N1HA 4NXEA 1N9NA 2IA2A 3K3DA 3A0RA 2XF3A 5HX9A 5HDDA 4OOYA 3NHQA 4BMWA 4HQAA 2M7UA 4OQGA 4MBHA 3IBJA 1N9LA 2J7VA 4KZ6A 4E6WA 2YKHA 3V50A 3MFXA 2C5WB 3DTMA 3IHBA 5DVAA 5EVIA 4FOFA 3GR2A 2Y2JA 4YFMA 1DJAA 1K55C 3BFGA 4Y15A 3GECA 4R3JA 1H8ZA 5M1AA 4R3AA 4KZ5A 4HEFA 2ZBBA 4OKPA 3VFHA 2J8YA 3VSKA 1H8YA 1F2KA 2HGVA 4OP5A 3BYDA 1D1JA 2Y2GA 4WZ4A 4BL3A 5GHXA 3FYZA 1HLUP 4OPZA 5DF9A 4MLLA 3WS0A 2ZOHA 3BFFA 4X68A 3IQAA 4B88A 1GHIA 3HVFA 1SDEA 2ZQ9A 3VOYA 4DE3A 1I2WA 2WKHA 3C30A 4FH4A 4S2OA 1KE0A 4ZBEA 5IT5A 2WZZA 2GDNA 2Y2KA 2V1ZA 2C6WB 4ETZA 4X1LA 4EESA 5FASA 5HDCA 4PM7A 4U0XA 3VP1A 1KGFA 3VMAA 3IF6B 4Y13A 3MF0A 3HREA 1NJ4A 1XJ2A 1Y28A 3KSFA 4E6XA 2P7JA 4P6ZM 2WAEA 2V1BA 4XT2A 2VK3A 1S0WA 1S6RA 1KGEA 4KQRA 1OT9A 2JKFA 1JWPA 4KUOA 2PHYA 2VGLS 1G6OA 2Y2NA 1D06A 3SH8A 3V67A 2XSSA 4B9OA 3H82B 1KE3A 2ZM2A 2PD7A 4LPZA 4UAAA 2GJ3A 1CK3A 3B47A 3B42A 2HV1A 2OOLA 1YLPA 3R7WA 1TS7A 3GV9A 3LICA 4WM9A 4XUXA 4GLQA 3ITBA 3ZFZA 1UGUA 3IWQA 3A3DA 1GA0A 3BY9A 3F1PA 3NOTC 2XR0A 2O9AA 2ZC4B 3TW8A 3IH9A 3E2LA 4Y7PA 2WYXA 5FI6A 3C7VA 5M18A 1BLHA 1RGYA 2ZM0A 1CI9A 3PXPA 4OQHA 4KG2A 4HNBA 4FH2A 1YLJA 5EM1A 3LR5A 4IVIA 2L4RA 1LSXA 1XJ4A 2ZQAA 1E3UD 2R78A 3UE1A 3N8SA 3T4JA 4C6YA 2NUPC 3VSLA 4Y2FA 3UB6A 3ZNTA 1N4OA 2W3DA 5CRFA 1TEMA 1YLZA 4G3VA 4Y5FA 5FQKA 3BRMA 1OTBA 3O3VA 4O0PA 2ACGA 5FI2A 3UDXA 3VP4A 1RCJA 1V9ZA 4NKPA 3MR0A 4WEJA 3MSHA 4WUJA 4JKTA 4II7A 1XGIA 5HL1A 4CLCE 1OMEA 3MMHA 3OLOA 3ZG5A 2ZL1B 2WAFA 3EOIA 2J9OA 5E2FA 4G3WA 2G2WA 1K6SA 3PBNA 5E2GA 1K4EA 3BW6A 3G31A 1FCNA 4OVDA 1EWZA 5DFXA 4HY8A 3PR6A 1NLYA 4C3QA 4GD6A 1P0ZA 3DTKA 3ZGAB 2UWXA 2XK1A 1W5DA 4UHUA 3A3JA 5HAPA 3ZG7B 4S2LA 3NBLA 5DTKA 4GS9A 4MCWA 3PBOA 3AGEA 4F3LB 1S67L 4DDSA 3NI9A 2WGVA 4CLCD 5HWTA 1PW8A 2VV6A 3HUNA 1YLTA 4U0TA 3BY8A 1XKZA 1BUEA 2PYPA 3QP1A 3G32A 3HLCA 3OBFA 4KZAA 5IU1A 3VOLA 1IYSA 2B95A 3V39A 3UB9A 2V2FF 1BLPA 1VETA 4PKYA 4ZJ2A 3DAVA 4JF4A 1FQGA 1VB6A 5GLDA 2OV5A 5FATA 2D01A 2EX2A 2K31A 2H5SA 3G2YA 4JXWA 3G34A 2V20A 5GL9A 2XDMA 4L9EA 1RP5A 3BLMA 4IUKA 3T50A 5L10A 2ZOIA 3Q7VB 1M40A 3LEZA 3OZHA 3G6OA 1NWZA 4HESA 1KVMA 1PIOA 4DJ3A 4IHQA 1LL8A 3DTEA 2QYBA 3CG5A 3ZG8B 2QMIA 1RGZA 2B5RA 4PM6A 2I9VA 3N6IA 1T19A 4FCFA 4KUKA 3KYEA 2JCHA 1VHMA 4EEUA 4QU3A 1N9OA 5L2FA 3ZG9B 4EV4A 3G4PA 5DF7A 3UPPA 2WK0A 3SS3A 4LRYC 2P9VB 1IFQA 3U2AA 4DE2A 2PD8A 2VJWA 1HVBA 2W3EA 1ZKJA 4UEYA 4WMCD 5CX7A 4AFIA 4BENA 2VEAA 4H8RA 4JBFA 2XEPA 2VLGA 4FUWA 3BWLA 2EFXA 2Q9MA 2ZMVA 3CWFA 2ZMAA 3IHAA 4X55A 3LR0A 3OCNA 5HARA 1DP9A 4KG5A 1OPXA 1LL9A 2HP9A 1L0EA 5AVEA 3PBTA 4R70A 4OONA 2HDSA 4P85A 2FFYA 5DTTA 2PR5A 4S2NC 3IF6C 3LI9A 3E4PA 4CQHA 1F9IA 4WEKA 4BJPA 3FG8A 5CERA 4GCZA 4CLCB 2X01A 4GD8A 1NRJA 5CHUA 3FZCA 2VV7A 3H9WA 5HFOA 1YPRA 5FDSA 3TJZC 1MWRA 3GDIA 1KDWA 3W8KA 3S22A 4L0LA 4S2NA 5FSRA 1IEMA 3IF6A 1XXMA 2FFFB 4EWFA 3ICYA 3EWKA 1S4RA 3MXQA 5TR7A 2OAP1 1LSWA 3VE4A 2XROA 3OCLA 5CHJA 5L07A 2QJ7A 1ZC2A 3IXHA 3LEQA 1ACFA 2WKRA 5F6AA 3IWOA 5E2EA 3H7WB 3LI8A 4EU0A 5J8XA 4JXVA 2ZC7A 2VZWA 3H82A 2BG1A 2Y79A 3MFDA 2XRNA 4I5SA 3ZG0A 3G30A 5C5KA 5IS1A 2Y2QA 3V3RA 2OSUA 1MZUA 4GOGA 1TDLA 1O7EA 4H6JB 3EQUA 1GSVA 4FSFA 4UA9A 3MS6A 4IUHA 3E2KA 2Y4AA 4XUZA 3N8LA 1FR6A 4BD1A 5L8MA 3BLSA 4E3LA 3HJKA 5CEBA 3HL9A 5DTSA 3T4LA 3N7WA 2EX8A 3BQ8A 5IHVA 1YT4A 3C2WA 2W3HA 3NOPC 3K3CA 1KOUA 3PBSA 2E8IA 1PWGA 3WS5A 1YMSA 3CMZA 1JVJA 3M2JA 3BECA 4OH0A 4ZAMA 5HD5A 3MXSA 2Q9NA 4HHDA 1FOFA 4ARZB 4O8GA 1WYCA 5FQIA 3TE8A 4KQDA 3SW1A 4I3AA 4IJGA 3RFBA 4Y0TA 2JKRM 1K56A 3WS1A 1AWIA 2E8JA 3NECA 4LCMA 1FILA 1Y54A 5HW3A 5EOEA 5GLBA 2XQZA 2W1TB 3SH9A 5EVIC 4EUZA 1TDGA 3E4QA 4UQIS 1CI8A 1L0DA 1DJCA 2ZL1A 3A0VA 3G35A 3WWXA 1K6RA 3QNCA 1W8QA 1ES3A 4B93A 1SHVA 2Z2MB 1G5UA 4HI4A 1M6KA 3CJMA 3SOIA 4KZ4A 3IWIA 2WGIA 2O9BA 3KSHA 5FEFA 2LB5A 3CUEA 1DP6A 4E04A 4F3LA 3M6HA 4CPKA 1IYOA 4R23A 1ZG6A 2GNXA 1GHMA 2HPBA 5DKLA 4R6LA 2KOIA 1JTDA 3MBZA 3R4KA 4MNRA 1ZHHB 1BZAA 1UWNX 2VX8A 3RJUA 3D9YA 4Q0JA 4ZJ3A 1SDNA 5CGSA 2VGLM 3LIAA 3GMWA 2Y8HA 1XX2A 3EQVA 3PAGA 4WL9A 3T4OA 3W2ZA 3SH7A 4I3JA 2UV0E 5KMWA 1D7EA 5EVEA 1S1ZA 5CTMA 1NZOA 4LV0A 1PNEA 4PHTA 2Q0OA 3HLFA 3UMDA 5HPFA 3HLGA 2ZQ7A 4P0MA 3DWKA 3VFFA 3Q7VA 4FTXA 3ZQ5A 2JN7A 1E3UA 3VP3A 5TGFA 3C4PA 5FAPA 2WUQA 4PM5A 4S2IA 3N4IA 2KDKA 4O01A 2Z2LB 2PRFA 3UE0A 4LFUA 5GHYA 2EXBA 1N9BA 3FPWA 2JKGA 5FA7A 1W79A 3ULFA 3LYXA 2QPNA 1KGGA 4NXGA 3AGFA 1L0FA 3IXBA 2P9VA 3P98A 3UMEA 2QZ6A 4GKUA 3P01A 3P7NA 3UN7A 1PWCA 3CZDA 3VV4A 2HJ9C 5AVFA 4CLCC 3W4PA 4KZ7A 4JGQA 4S2MA 4BBVA 1ALQA 3LIDA 4WYYA 4LV3A 1K54A 4A5RA 4GW9A 1SKOB 3KYZA 1YLYA 4GB7A 3HBRA 1OTDA 3NDGA 1YSQA 1WYBA 4OPQA 4HP4A 2V0UA 3MJQA 1GCEA 1W63Q 4CLCA 2IWBA 1YMXA 2DNSA 1FR1A 3A0SA 1J3WA 4DE0A 3TSGA 3LR4A 4GJ4A 3I7JA 2R9XA 2A24B 1NYMA 1JTGA 2Y59A 4ETXA 4WELA 1FIKA 3QP4A 2PT7A 4UA6A 4N9KA 2WGWB 2EFUA 5DKKA 1KE4A 3K2NA 3UE6A 3UPNA 1IOUA 2OLUA 3T12B 4QY5A 4HIAA 3MQ0A 3NY4A 2Y2MA 4GHIB 1PW1A 5AQ7A 3QP5A 1PRQA 2KX6A 1QMEA 2EXAA 4JF5A 2HJEA 5A8BA 3PBQA 1JNUA 5U47A 3H7WA 5A91A 3F1OB 1FCOA 2LB9A 4K91A 2PR6A 1QMFA 3IH8A 1E25A 2H0TA 3NIAA 4MBFA 5AQAA 1XJ6A 1YM1A 4BLMA 4RA7A 4PM9A 1C3BA 4H6JA 2Z6DA 4Y0UA 1S1YA 4OOLA 2QJ5A 3DTIA 1HZOA 2EWWA 1BT5A 4QJGA 4Q0IA 3UB8A 4MDZA 3LIFA 4GN2A 1P9RA 4BL2A 2EX6A 1T1AA 3VP0A 4WMCA 4Q8IA 4IEDA 4R4RA 5AQ9A 3DW0A 1K38A 3MKEA 3V3SA 3OPLA 1H0MA 2W3FA 5FEGA 3ZVTA 2XLNA 4ARZA 1G6AA 2ZMFA 2XH9A 4EW7A 3UE3A 3A3IA 4DF6A 1CEFA 3OOVA 3JVUA 2D02A 4L9FA 5F82A 4RVAA 1SZVA 5GHZA 2JKTI 1O07A 3VE3A 1T1BA 4GZBA 5D3OA 3NCKA 2W1TA 1L0GA 4EXOA 5CEDA 2W27A 1V9YA 2PBYA 3UB5P 1LLBA 3LY4A 2GX5A 4E3OA 3S7OA 1EI5A 4ME4A 5FAOA 5K5BA 4KZ9A 4HJ4A 4LCLA 5KZHA 3T1XA 5F5YA 3UPOA 3D4FA 4JGOA 3ZNYA 2DCFA 2M1CA 1CJFA 1ZG4A 5F69A 4R4SA 1NXYA 3A3FA 3BFEA 4HJ3A 4C75A 2L0WA 3ZHHA 4S2JA 2Y2OA 4OLDA 1XGJA 3Q81A 2Y2HA 3QP2A 1DJBA 4K08A 3GTCA 5JYOA 4OPRA 5A90A 3NC8A 4EBPA 2VGJA 4P6BA 2ZQCA 1PZOA 2W1RA 5I94A 4EBNA 1OTEA 4RQ9A 2RCXA
chains in the Genus database with same CATH topology
4G3KA 3E4QA 4UQIS 5G4YA 2EA9A 3B47A 3B42A 5DJUA 2HV1A 4WN5A 3PHYA 2OOLA 3A0VA 3R7WA 1TS7A 3LICA 4GLQA 4B93A 2V1AA 1UGUA 3B33A 2G7UA 3BY9A 3F1PA 3BQAA 3NOTC 2O0YA 3S7QA 4HI4A 1YAXA 2O9AA 3TW8A 3E98A 2J3TC 3NJAA 4HP9A 1YKDA 2J80A 3PXPA 3CI6A 2O99A 4HNBA 1W63M 3JVVA 1OTAA 4YNRA 2O9BA 3KSHA 2L1MA 3LR5A 1WA9A 2WKPA 2LB5A 3CUEA 1DP6A 2L4RA 4OOMA 5HSQA 1LSXA 1XJ4A 4E04A 4F3LA 2GZAA 2R78A 4NEED 3T4JA 2GNXA 4I38A 5DKLA 1LSVA 4XT2B 4NXBA 2NUPC 4R6LA 4YOFA 3NOUC 4Y2FA 3UB6A 3E4OA 2VA0A 2KOIA 3R4KA 2W3DA 1ZHHB 2KLIA 1UWNX 2DMWA 4G3VA 4Y5FA 2VX8A 2FH5A 4Q0JA 1H3QA 1OTBA 4O0PA 2H28A 2VGLM 3LIAA 1V9ZA 2FZ0A 4NKPA 2Y8HA 3T4KA 3EQVA 4EUVA 3MR0A 4WL9A 4WEJA 2V0WA 4WF0A 4WUJA 3T4OA 3W2ZA 3EEHA 4II7A 3CAXA 4I3JA 4CLCE 1S66L 3OC2A 3MMHA 3LFVA 3OLOA 1D7EA 3EOIA 4UQIM 1S1ZA 1EW0A 5TJJA 3HJIA 4PHTA 3R7WB 3LUQA 2CMNA 4G3WA 1GSXA 4I3IA 3EEAA 3UMDA 3PBNA 5HPFA 2A2LA 3BW6A 4EQ1A 3LIEA 3F1PB 5DFXA 4LLOB 3HCYA 2JKTM 1TS0A 4HY8A 3PR6A 1NLYA 3ZQ5A 2JN7A 3IS2A 3E0YA 2VV8A 2PDRA 1P0ZA 2OAQ1 3S7PA 5I5LA 1OTIA 4YWZA 2KDKA 4O01A 2P04A 4GS9A 3UB7A 4MCWA 3PBOA 4F3LB 4DJ2A 1BYWA 1S67L 2A24A 2K2NA 4M4XA 3FPWA 1S4SA 4CLCD 5HWTA 3ULFA 2VV6A 2J3WA 3C8CA 1XJ3A 5DJTA 3LYXA 3TRCA 3BY8A 2PYPA 4NXGA 3CUEC 4WLAA 2JHEA 3OBFA 4LRXC 3RTYA 5IU1A 3VOLA 3UMEA 1T18A 3P01A 4L9GA 4GHIA 3P7NA 1OJ5A 3UB9A 3PYPA 3KYQA 3VV4A 4MN5A 1YSPA 4PKYA 2HJ9C 5AVFA 4CLCC 5KSHA 4JGQA 5DFYA 1TF1A 4PAUA 1VB6A 3KO6A 5HPIA 3F1OA 4BBVA 2P08A 2D01A 3LIDA 2K31A 2QHKA 2YKFA 3ZYTA 1MC0A 4MN7A 4GW9A 3KYZA 4NXFA 5HZHA 1OJGA 3BJNA 3D72A 3MQQA 1OTDA 2Z6CA 4L9EA 4IUKA 3T50A 1TD5A 2ZOIA 1YSQA 1P97A 2QKPA 3IS2B 3D3OA 3G6OA 3PBRA 4HP4A 1NWZA 3KX0X 2V0UA 3MJQA 1W63Q 4CLCA 4DJ3A 4IHQA 2EWVA 1LL8A 2QYBA 2HF6A 1XFQA 2B02A 4R38A 3A0SA 3S7NA 1G28A 4GS9B 2I9VA 3LR4A 4GJ4A 4HOIA 1T19A 3CITA 3FPVA 2A24B 4QPRA 4KUKA 4ETXA 4WELA 1X0OA 4MN6A 4ZRRA 1STZA 1VHMA 5J3WA 3MQOA 4EEUA 1N9OA 2JKRI 2PT7A 3C38A 5DKKA 4EETB 5J7EA 2B18A 2M7VA 3K2NA 4JGRA 4LRYC 2K7SA 3UE6A 1IOUA 1IFQA 3U2AA 4HIAA 2PD8A 2VJWA 1LT0A 2W3EA 3DBAA 3MQ0A 4Q0HA 3KSIA 5HD3A 4BWIA 4UEYA 4GHIB 5CX7A 4AFIA 5TBMA 2VEAA 2KX6A 4KQOA 3IBRA 2BASA 1P9WA 5F68A 4EERA 2W3GA 4Z1WA 4HH3A 1GSWA 2HJEA 5A8BA 2VLGA 3BWLA 4HH2A 2PYRA 3PBQA 1JNUA 2XA7M 3RH8B 3H7WA 2INWA 2ZMVA 2W0NA 3CWFA 5AJGA 3F1OB 2LB9A 2PR6A 5HL6A 3LR0A 3OCNA 4DMZA 1DP9A 1OPXA 1UWPX 5MC7A 1XJ6A 5AVEA 3KSGA 3PBTA 4R70A 4BBUA 5HWWA 4PKYG 2PR5A 4H6JA 3LI9A 3E4PA 4CQHA 1F9IA 2Z6DA 4WEKA 4BJPA 3FG8A 1XFNA 5G4ZA 3LIBA 4GCZA 3EGDC 4CLCB 1S1YA 4OOLA 5HWVA 3F1NA 4Y3IA 2QJ5A 2WKQA 2EWWA 1NRJA 2J3TD 4Q0IA 3UB8A 4BBTA 4MDZA 3LIFA 2VV7A 3H9WA 5LBRA 1P9RA 3TJZC 2XA7S 2NUTC 1T1AA 3GDIA 4NXEA 1N9NA 2IA2A 3K3DA 4EEPA 1MKMA 4L0LA 1TS8A 3A0RA 3ICYA 3EWKA 5HDDA 3NHQA 4P6ZS 1OT6A 4BMWA 4HQAA 2M7UA 1S4RA 3MXQA 3IBJA 5EFWA 5J4EA 2QWSA 4MMNA 1N9LA 2W3FA 2OAP1 1ZTUA 1LSWA 3LR3A 4DN0A 3VE4A 4ARZA 2XROA 3OCLA 5TBMB 2ZMFA 2YKHA 2QJ7A 3MFXA 2WKRA 5F6AA 4EW7A 1DRMA 3UE3A 4FOFA 4HJ6A 3OOVA 4JGPA 1TS6A 2MJ6A 3JVUA 3H7WB 2D02A 3LI8A 4EU0A 3GECA 4L9FA 2VZWA 3H82A 4R3AA 2Y79A 2JKTI 2XRNA 2ZBBA 4I5SA 1T1BA 3VE3A 2V9AA 4LRZE 2HGVA 5C5KA 2W1TA 4EXOA 5IS1A 2W27A 1V9YA 1MZUA 3EQUA 4FSFA 1GSVA 2GX5A 4H6JB 1F5MA 3CLOA 5DF9A 3T4QA 4IUHA 2O9CA 2OWJA 3S7OA 2ZOHA 1NLZA 4ME4A 3F1NB 5K5BA 4I39A 4HJ4A 3T4SA 3EGXC 5L8MA 3HJKA 2VKSA 3C30A 5F5YA 5FL3A 3T4LA 3O5YA 3BQ8A 5IT5A 3C2WA 2W3HA 3NOPC 4JGOA 3K3CA 4ETZA 1KOUA 1DP8A 3PBSA 4EESA 3T4TA 1T1CA 2M1CA 5HDCA 3MF0A 5F69A 1ODVA 4HJ3A 1XJ2A 1Y28A 5HD5A 3KSFA 2L0WA 2P7JA 4HHDA 4P6ZM 1F98A 2V1BA 4XT2A 4ARZB 5HDSA 5KIZA 4O8GA 2OWHA 3TE8A 4KQDA 3SW1A 1OT9A 3FC7A 4I3AA 4IJGA 3RFBA 4KUOA 4K08A 2PHYA 2VGLS 1G6OA 2JKRM 1D06A 3V67A 2XSSA 4B9OA 2W1RA 3H82B 1H8MA 1OTEA 4RQ9A 2PD7A 4LPZA 2W1TB 2GJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHM A;  3ZQ5 A;  4G3K A;  3E0Y A;  3S7P A;  2OOL A;  4FOF A;  5I5L A;  3OOV A;  2B18 A;  2M7V A;  3K2N A;  4EU0 A;  4LRY C;  4GLQ A;  4O01 A;  2VZW A;  4MCW A;  2VJW A;  3DBA A;  2W3E A;  2Y79 A;  3MQ0 A;  4Q0H A;  3KSI A;  2G7U A;  2XRN A;  4BWI A;  2K2N A;  3NOT C;  2O0Y A;  2HGV A;  4LRZ E;  5C5K A;  2VEA A;  2W1T A;  2O9A A;  3S7Q A;  3E98 A;  3IBR A;  2W3G A;  4Z1W A;  1YKD A;  3TRC A;  3CI6 A;  2W1T B;  2O99 A;  2GX5 A;  1F5M A;  4IUH A;  2O9C A;  5AJG A;  3S7O A;  3OBF A;  2O9B A;  3KSH A;  4LRX C;  4YNR A;  2LB5 A;  2LB9 A;  4ME4 A;  5HL6 A;  5HSQ A;  4DMZ A;  5K5B A;  4E04 A;  5L8M A;  2VKS A;  3KSG A;  3O5Y A;  3VV4 A;  4R70 A;  1YSP A;  3C2W A;  4R6L A;  4YOF A;  3NOU C;  4Y2F A;  2W3H A;  3NOP C;  2KOI A;  3R4K A;  4ETZ A;  2W3D A;  5DFY A;  1TF1 A;  4PAU A;  4CQH A;  2KLI A;  3KO6 A;  5HPI A;  4G3V A;  4Y5F A;  2K31 A;  4Q0J A;  4Y3I A;  4O0P A;  3MF0 A;  1MC0 A;  4MN7 A;  4GW9 A;  4Q0I A;  3KSF A;  4MDZ A;  5LBR A;  2Y8H A;  3BJN A;  4EUV A;  4O8G A;  4IUK A;  1TD5 A;  1YSQ A;  3W2Z A;  3D3O A;  3G6O A;  2IA2 A;  4IJG A;  3RFB A;  3MMH A;  3LFV A;  1MKM A;  5TJJ A;  2QYB A;  3NHQ A;  2XSS A;  4G3W A;  2M7U A;  3S7N A;  3EEA A;  2W1R A;  3IBJ A;  4MMN A;  2W3F A;  5HPF A;  1ZTU A;  4DN0 A;  4RQ9 A;  3CIT A;  4QPR A;  2XRO A;  5DFX A;  4ETX A;  2ZMF A;  3HCY A;  4ZRR A;  1STZ A; 
#chains in the Genus database with same CATH topology
 4G3K A;  2ZC6 B;  4K0X A;  5G4Y A;  5DJU A;  5CHM A;  3Q7Z A;  1E4D A;  2OLV A;  5EOO A;  5FQQ A;  5GLA A;  3FKW A;  2JBF A;  1XP4 A;  4WZ5 A;  3P09 A;  3B33 A;  2G7U A;  3UY6 A;  2O0Y A;  3JPU A;  4KQQ A;  3E98 A;  1BUL A;  2J3T C;  3NJA A;  4ZDX A;  1LI0 A;  1YKD A;  1BLS A;  3FV7 A;  1PYY A;  3JVV A;  1OTA A;  4YNR A;  2L1M A;  2CC1 A;  2WKP A;  1L3L A;  2GZA A;  5BOH A;  4NEE D;  4I38 A;  1XPB A;  3MKF A;  4NXB A;  4JF6 A;  3E4O A;  2VA0 A;  5EM0 A;  3ISG A;  2FH5 A;  2XFT A;  3IXG A;  3T1Q B;  5CXW A;  4Z9Q A;  1Y4O A;  5EEC A;  1Z09 A;  5EV0 A;  1MWS A;  3T4K A;  4X69 A;  4EUV A;  2V0W A;  4WF0 A;  3HLE A;  3CAX A;  1S66 L;  3GVB A;  3OC2 A;  4UQI M;  1EW0 A;  1FSW A;  3HJI A;  2J9P A;  3WRT A;  2ZJ9 A;  1ONH A;  1GSX A;  1SKO A;  3IXD A;  2A2L A;  4EQ1 A;  3G2Z A;  4LLO B;  3HCY A;  3DWZ A;  1ES2 A;  3E0Y A;  2PDR A;  3S7P A;  3VP2 A;  1I5Q A;  4IBX A;  1OTI A;  2H10 A;  1NYY A;  3UB7 A;  2ZD8 A;  1BYW A;  2A24 A;  1FCM A;  2K2N A;  4M4X A;  4F94 A;  1S4S A;  2J3W A;  4BQM A;  4E3M A;  2WGW A;  4LEN A;  5JYP A;  3CUE C;  4WLA A;  2JHE A;  3RTY A;  1K57 C;  1T18 A;  1ESU A;  4GHI A;  2HDQ A;  5DF8 A;  1OJ5 A;  1KVL A;  3PYP A;  1PI4 A;  4MN5 A;  1YSP A;  1CF0 A;  3T1S A;  4E3J A;  3AGD A;  4CJN A;  5F83 A;  2ZC5 B;  4KEN B;  4PAU A;  4DDY A;  4P87 A;  5HPI A;  3F1O A;  3PTE A;  4B4X A;  5HAI A;  4E3K A;  1MC0 A;  4MN7 A;  3HUO A;  2JE5 A;  1K57 A;  1OJG A;  2AVX A;  3BJN A;  4OQ0 A;  2Z6C A;  1Q2P A;  2Y2L A;  2QKP A;  3IS2 B;  3D3O A;  3PBR A;  3KX0 X;  2RL3 A;  1SKF A;  3CPT B;  2HDU A;  2EWV A;  5EUA A;  2HF6 A;  4X56 A;  1VQQ A;  4R38 A;  3S7N A;  1G28 A;  4GDB A;  4U3T A;  3ZCZ A;  4X1M A;  1W8Y A;  3CIT A;  4QPR A;  4JPM A;  4MN6 A;  4ZRR A;  1K56 D;  1STZ A;  1BLC A;  1K25 A;  3OPR A;  4HBU A;  3O87 A;  4HBT A;  5J7E A;  5FI7 A;  2B18 A;  1PWD A;  2K7S A;  3JYI A;  4OP8 A;  3A3E A;  1GA9 A;  1K55 A;  1LT0 A;  3DBA A;  4Q0H A;  3W4O A;  3UDF A;  1KDS A;  4KQO A;  3IBR A;  2A49 A;  2BAS A;  1P9W A;  1HD8 A;  4Z1W A;  3M6B A;  1GSW A;  1K0K A;  4JXG A;  4QWO A;  3QP6 A;  4RX3 A;  3RH8 B;  2XA7 M;  2INW A;  3HLD A;  2W0N A;  5AJG A;  4N1X A;  2HDR A;  1HTZ A;  5HL6 A;  3L9K A;  4DMZ A;  4BD0 A;  4MBK A;  4X25 A;  2ZM8 A;  4WBG A;  5EVI D;  1SCW A;  5MC7 A;  3KSG A;  4BBU A;  4PKY G;  1MY8 A;  1CEG A;  4N92 A;  2A3U A;  3WRZ A;  1K54 C;  3FWL A;  5HWV A;  5FQM A;  4Y3I A;  2WKQ A;  1AXB A;  2Y2P A;  2VGK A;  3C5A A;  4BBT A;  3UDI A;  5LBR A;  3MXR A;  2XA7 S;  1VEU B;  2G2U A;  3UNW A;  4EEP A;  1MKM A;  1TS8 A;  3BFC A;  4NK3 A;  3MZE A;  4QB8 A;  4P6Z S;  1OT6 A;  2I72 A;  5FQ9 A;  3PAE A;  4ZJ1 A;  4OQI A;  5EFW A;  5J4E A;  2QWS A;  4MMN A;  2XD1 A;  5AQB A;  1ZTU A;  3LR3 A;  4DN0 A;  5TBM B;  4ID4 A;  1DRM A;  5CGX A;  4HJ6 A;  4JGP A;  1TS6 A;  2MJ6 A;  3SS5 A;  2V9A A;  4D60 A;  4LRZ E;  4EBL A;  2ZQ8 A;  1ES5 A;  4KZ3 A;  1WE4 A;  1YQS A;  1F5M A;  3CLO A;  3T4Q A;  4IBR A;  1XA1 A;  2O9C A;  2OWJ A;  1NLZ A;  4RYE A;  3F1N B;  4I39 A;  1IKG A;  3T4S A;  5EPH A;  4LV1 A;  3EGX C;  4PMA A;  1GHP A;  2VKS A;  4KZB A;  4K0W A;  5FL3 A;  3SZT A;  5A92 A;  3O5Y A;  4N9L A;  2PU2 A;  3NDE A;  3W4Q A;  1DP8 A;  3T4T A;  2ZC3 B;  1T1C A;  1L2S A;  5FQJ A;  3NUL A;  1ODV A;  4RX2 A;  1MXO A;  1JWZ A;  3ZDJ A;  2JC7 A;  4OPY A;  1PFL A;  3LO7 A;  1F98 A;  5HDS A;  5KIZ A;  2OWH A;  5G18 A;  5F1G A;  3HLW A;  3FC7 A;  4O7D A;  5EVI B;  2BLS A;  2IWC A;  3GRJ A;  3TOI A;  1PI5 A;  2HP5 A;  2BTF P;  1H8M A;  1ONG A;  1MWU A;  4UA7 A;  2HP6 A;  1MPL A;  3Q1F A;  3MZD A;  2EA9 A;  1NRF A;  4WN5 A;  3IT9 A;  3PHY A;  3LGO A;  4S2K A;  4FD8 A;  2V1A A;  4ESP A;  4KZ8 A;  1J9M A;  3BQA A;  3S1Y A;  3S7Q A;  3HUM A;  1YAX A;  1Z6F A;  1XA7 A;  2Y91 A;  1Q2Q A;  1CQA A;  5A93 A;  4HP9 A;  2J80 A;  3CI6 A;  2O99 A;  4EQI A;  3V5M A;  1W63 M;  4Y0O A;  2WKE A;  1I2S A;  3T1R A;  1WA9 A;  1FSY A;  4DRT A;  3M2K A;  4OOM A;  5HSQ A;  4QHC A;  1LI9 A;  3QP8 A;  1A0K A;  4E3N A;  3C7U A;  1LSV A;  4XT2 B;  5M19 A;  1LHY A;  4YOF A;  3NOU C;  4X6T A;  2KLI A;  2XD5 A;  2DMW A;  5HAQ A;  1ERM A;  5E43 A;  3IX3 A;  1H3Q A;  5EVL A;  2H28 A;  3CHW P;  2FZ0 A;  2EX9 A;  2V8C A;  1BTL A;  4QY6 A;  1TVF A;  3B3X A;  3EEH A;  4R1G A;  3LFV A;  4LV2 A;  3GQZ A;  2XGN A;  3FKV A;  5TJJ A;  3R7W B;  5FDH A;  3LUQ A;  2CMN A;  4I3I A;  3EEA A;  1IYP A;  2WKI A;  3N8R A;  3LIE A;  4R3B A;  2DRW A;  3F1P B;  2JKT M;  1TS0 A;  3IS2 A;  1ESI A;  5CEC A;  2VV8 A;  3HLB A;  5TFQ A;  2OAQ 1;  2V8F A;  2PAV P;  3CPT A;  5I5L A;  4WZ5 C;  3TG9 A;  4YWZ A;  3UO9 A;  2P04 A;  1LL5 A;  3LY3 A;  3OPP A;  3MZF A;  4Y17 A;  4DJ2 A;  4JXS A;  5KSC A;  4R0Q A;  2WAD A;  4D2O A;  3C8C A;  3RXW A;  1XJ3 A;  4JLF A;  5DJT A;  3TRC A;  3Q82 A;  1IKI A;  4OLG A;  1NZU A;  3ZVW A;  2ZQD A;  3BEB A;  4DXC A;  1DY6 A;  4LRX C;  1IYQ A;  4MEZ A;  5EE8 A;  4M3K A;  1IEL A;  2R9W A;  4DKI A;  4L9G A;  3C4O A;  3O88 A;  1H5X A;  4DXB A;  3KYQ A;  3QNB A;  3WS4 A;  4PPR A;  4S2P A;  5KSH A;  5DFY A;  1TF1 A;  3KO6 A;  3QHY A;  3Q07 A;  2P08 A;  2H0Y A;  2QHK A;  2Y55 A;  2YKF A;  3U4L P;  3ZYT A;  1W7F A;  3RXX A;  4NXF A;  4GDN A;  5HZH A;  3D72 A;  1BSG A;  3MQQ A;  5E2H A;  5FAQ A;  1VM1 A;  4GNU A;  1TD5 A;  1PZP A;  1G68 A;  1P97 A;  1ERO A;  4YIN A;  3IX8 A;  5F1F A;  1MKI A;  5CTN A;  1ERQ A;  2X71 A;  4QD4 A;  1XFQ A;  2B02 A;  1U60 A;  4E3I A;  4GS9 B;  1JWV A;  4HOI A;  1NY0 A;  3O86 A;  4PM8 A;  3FPV A;  3IX4 A;  5CGW A;  1X0O A;  1VEU A;  4IVK A;  5J3W A;  3MQO A;  2JKR I;  1MWT A;  3SS4 A;  4LGW A;  1YLW A;  3C38 A;  3LCE A;  5L09 A;  4EET B;  2M7V A;  4JGR A;  4ZTK A;  4NET A;  4BWI A;  4NG2 A;  3KSI A;  5HD3 A;  3WS2 A;  1ES4 A;  5TBM A;  3IF5 A;  3BM6 A;  4DE1 A;  5F68 A;  4EER A;  2W3G A;  3GSG A;  1VET B;  4HH3 A;  1MBL A;  3ITA A;  4HH2 A;  2PU4 A;  2PYR A;  4B4Z A;  3L7H A;  3BFD A;  2HZ5 A;  3VOZ A;  1UWP X;  2X02 A;  2P74 A;  5HWW A;  1K4F A;  4KG6 A;  3S4X A;  1XFN A;  4X53 A;  5G4Z A;  3LIB A;  3EGD C;  4XXR A;  3F1N A;  5GLC A;  3OPH A;  2ZLY A;  2J3T D;  2PBD P;  2WZX A;  2XFS A;  2IWD A;  2Y2I A;  2NUT C;  4N1H A;  4NXE A;  1N9N A;  2IA2 A;  3K3D A;  3A0R A;  2XF3 A;  5HX9 A;  5HDD A;  4OOY A;  3NHQ A;  4BMW A;  4HQA A;  2M7U A;  4OQG A;  4MBH A;  3IBJ A;  1N9L A;  2J7V A;  4KZ6 A;  4E6W A;  2YKH A;  3V50 A;  3MFX A;  2C5W B;  3DTM A;  3IHB A;  5DVA A;  5EVI A;  4FOF A;  3GR2 A;  2Y2J A;  4YFM A;  1DJA A;  1K55 C;  3BFG A;  4Y15 A;  3GEC A;  4R3J A;  1H8Z A;  5M1A A;  4R3A A;  4KZ5 A;  4HEF A;  2ZBB A;  4OKP A;  3VFH A;  2J8Y A;  3VSK A;  1H8Y A;  1F2K A;  2HGV A;  4OP5 A;  3BYD A;  1D1J A;  2Y2G A;  4WZ4 A;  4BL3 A;  5GHX A;  3FYZ A;  1HLU P;  4OPZ A;  5DF9 A;  4MLL A;  3WS0 A;  2ZOH A;  3BFF A;  4X68 A;  3IQA A;  4B88 A;  1GHI A;  3HVF A;  1SDE A;  2ZQ9 A;  3VOY A;  4DE3 A;  1I2W A;  2WKH A;  3C30 A;  4FH4 A;  4S2O A;  1KE0 A;  4ZBE A;  5IT5 A;  2WZZ A;  2GDN A;  2Y2K A;  2V1Z A;  2C6W B;  4ETZ A;  4X1L A;  4EES A;  5FAS A;  5HDC A;  4PM7 A;  4U0X A;  3VP1 A;  1KGF A;  3VMA A;  3IF6 B;  4Y13 A;  3MF0 A;  3HRE A;  1NJ4 A;  1XJ2 A;  1Y28 A;  3KSF A;  4E6X A;  2P7J A;  4P6Z M;  2WAE A;  2V1B A;  4XT2 A;  2VK3 A;  1S0W A;  1S6R A;  1KGE A;  4KQR A;  1OT9 A;  2JKF A;  1JWP A;  4KUO A;  2PHY A;  2VGL S;  1G6O A;  2Y2N A;  1D06 A;  3SH8 A;  3V67 A;  2XSS A;  4B9O A;  3H82 B;  1KE3 A;  2ZM2 A;  2PD7 A;  4LPZ A;  4UAA A;  2GJ3 A;  1CK3 A;  3B47 A;  3B42 A;  2HV1 A;  2OOL A;  1YLP A;  3R7W A;  1TS7 A;  3GV9 A;  3LIC A;  4WM9 A;  4XUX A;  4GLQ A;  3ITB A;  3ZFZ A;  1UGU A;  3IWQ A;  3A3D A;  1GA0 A;  3BY9 A;  3F1P A;  3NOT C;  2XR0 A;  2O9A A;  2ZC4 B;  3TW8 A;  3IH9 A;  3E2L A;  4Y7P A;  2WYX A;  5FI6 A;  3C7V A;  5M18 A;  1BLH A;  1RGY A;  2ZM0 A;  1CI9 A;  3PXP A;  4OQH A;  4KG2 A;  4HNB A;  4FH2 A;  1YLJ A;  5EM1 A;  3LR5 A;  4IVI A;  2L4R A;  1LSX A;  1XJ4 A;  2ZQA A;  1E3U D;  2R78 A;  3UE1 A;  3N8S A;  3T4J A;  4C6Y A;  2NUP C;  3VSL A;  4Y2F A;  3UB6 A;  3ZNT A;  1N4O A;  2W3D A;  5CRF A;  1TEM A;  1YLZ A;  4G3V A;  4Y5F A;  5FQK A;  3BRM A;  1OTB A;  3O3V A;  4O0P A;  2ACG A;  5FI2 A;  3UDX A;  3VP4 A;  1RCJ A;  1V9Z A;  4NKP A;  3MR0 A;  4WEJ A;  3MSH A;  4WUJ A;  4JKT A;  4II7 A;  1XGI A;  5HL1 A;  4CLC E;  1OME A;  3MMH A;  3OLO A;  3ZG5 A;  2ZL1 B;  2WAF A;  3EOI A;  2J9O A;  5E2F A;  4G3W A;  2G2W A;  1K6S A;  3PBN A;  5E2G A;  1K4E A;  3BW6 A;  3G31 A;  1FCN A;  4OVD A;  1EWZ A;  5DFX A;  4HY8 A;  3PR6 A;  1NLY A;  4C3Q A;  4GD6 A;  1P0Z A;  3DTK A;  3ZGA B;  2UWX A;  2XK1 A;  1W5D A;  4UHU A;  3A3J A;  5HAP A;  3ZG7 B;  4S2L A;  3NBL A;  5DTK A;  4GS9 A;  4MCW A;  3PBO A;  3AGE A;  4F3L B;  1S67 L;  4DDS A;  3NI9 A;  2WGV A;  4CLC D;  5HWT A;  1PW8 A;  2VV6 A;  3HUN A;  1YLT A;  4U0T A;  3BY8 A;  1XKZ A;  1BUE A;  2PYP A;  3QP1 A;  3G32 A;  3HLC A;  3OBF A;  4KZA A;  5IU1 A;  3VOL A;  1IYS A;  2B95 A;  3V39 A;  3UB9 A;  2V2F F;  1BLP A;  1VET A;  4PKY A;  4ZJ2 A;  3DAV A;  4JF4 A;  1FQG A;  1VB6 A;  5GLD A;  2OV5 A;  5FAT A;  2D01 A;  2EX2 A;  2K31 A;  2H5S A;  3G2Y A;  4JXW A;  3G34 A;  2V20 A;  5GL9 A;  2XDM A;  4L9E A;  1RP5 A;  3BLM A;  4IUK A;  3T50 A;  5L10 A;  2ZOI A;  3Q7V B;  1M40 A;  3LEZ A;  3OZH A;  3G6O A;  1NWZ A;  4HES A;  1KVM A;  1PIO A;  4DJ3 A;  4IHQ A;  1LL8 A;  3DTE A;  2QYB A;  3CG5 A;  3ZG8 B;  2QMI A;  1RGZ A;  2B5R A;  4PM6 A;  2I9V A;  3N6I A;  1T19 A;  4FCF A;  4KUK A;  3KYE A;  2JCH A;  1VHM A;  4EEU A;  4QU3 A;  1N9O A;  5L2F A;  3ZG9 B;  4EV4 A;  3G4P A;  5DF7 A;  3UPP A;  2WK0 A;  3SS3 A;  4LRY C;  2P9V B;  1IFQ A;  3U2A A;  4DE2 A;  2PD8 A;  2VJW A;  1HVB A;  2W3E A;  1ZKJ A;  4UEY A;  4WMC D;  5CX7 A;  4AFI A;  4BEN A;  2VEA A;  4H8R A;  4JBF A;  2XEP A;  2VLG A;  4FUW A;  3BWL A;  2EFX A;  2Q9M A;  2ZMV A;  3CWF A;  2ZMA A;  3IHA A;  4X55 A;  3LR0 A;  3OCN A;  5HAR A;  1DP9 A;  4KG5 A;  1OPX A;  1LL9 A;  2HP9 A;  1L0E A;  5AVE A;  3PBT A;  4R70 A;  4OON A;  2HDS A;  4P85 A;  2FFY A;  5DTT A;  2PR5 A;  4S2N C;  3IF6 C;  3LI9 A;  3E4P A;  4CQH A;  1F9I A;  4WEK A;  4BJP A;  3FG8 A;  5CER A;  4GCZ A;  4CLC B;  2X01 A;  4GD8 A;  1NRJ A;  5CHU A;  3FZC A;  2VV7 A;  3H9W A;  5HFO A;  1YPR A;  5FDS A;  3TJZ C;  1MWR A;  3GDI A;  1KDW A;  3W8K A;  3S22 A;  4L0L A;  4S2N A;  5FSR A;  1IEM A;  3IF6 A;  1XXM A;  2FFF B;  4EWF A;  3ICY A;  3EWK A;  1S4R A;  3MXQ A;  5TR7 A;  2OAP 1;  1LSW A;  3VE4 A;  2XRO A;  3OCL A;  5CHJ A;  5L07 A;  2QJ7 A;  1ZC2 A;  3IXH A;  3LEQ A;  1ACF A;  2WKR A;  5F6A A;  3IWO A;  5E2E A;  3H7W B;  3LI8 A;  4EU0 A;  5J8X A;  4JXV A;  2ZC7 A;  2VZW A;  3H82 A;  2BG1 A;  2Y79 A;  3MFD A;  2XRN A;  4I5S A;  3ZG0 A;  3G30 A;  5C5K A;  5IS1 A;  2Y2Q A;  3V3R A;  2OSU A;  1MZU A;  4GOG A;  1TDL A;  1O7E A;  4H6J B;  3EQU A;  1GSV A;  4FSF A;  4UA9 A;  3MS6 A;  4IUH A;  3E2K A;  2Y4A A;  4XUZ A;  3N8L A;  1FR6 A;  4BD1 A;  5L8M A;  3BLS A;  4E3L A;  3HJK A;  5CEB A;  3HL9 A;  5DTS A;  3T4L A;  3N7W A;  2EX8 A;  3BQ8 A;  5IHV A;  1YT4 A;  3C2W A;  2W3H A;  3NOP C;  3K3C A;  1KOU A;  3PBS A;  2E8I A;  1PWG A;  3WS5 A;  1YMS A;  3CMZ A;  1JVJ A;  3M2J A;  3BEC A;  4OH0 A;  4ZAM A;  5HD5 A;  3MXS A;  2Q9N A;  4HHD A;  1FOF A;  4ARZ B;  4O8G A;  1WYC A;  5FQI A;  3TE8 A;  4KQD A;  3SW1 A;  4I3A A;  4IJG A;  3RFB A;  4Y0T A;  2JKR M;  1K56 A;  3WS1 A;  1AWI A;  2E8J A;  3NEC A;  4LCM A;  1FIL A;  1Y54 A;  5HW3 A;  5EOE A;  5GLB A;  2XQZ A;  2W1T B;  3SH9 A;  5EVI C;  4EUZ A;  1TDG A;  3E4Q A;  4UQI S;  1CI8 A;  1L0D A;  1DJC A;  2ZL1 A;  3A0V A;  3G35 A;  3WWX A;  1K6R A;  3QNC A;  1W8Q A;  1ES3 A;  4B93 A;  1SHV A;  2Z2M B;  1G5U A;  4HI4 A;  1M6K A;  3CJM A;  3SOI A;  4KZ4 A;  3IWI A;  2WGI A;  2O9B A;  3KSH A;  5FEF A;  2LB5 A;  3CUE A;  1DP6 A;  4E04 A;  4F3L A;  3M6H A;  4CPK A;  1IYO A;  4R23 A;  1ZG6 A;  2GNX A;  1GHM A;  2HPB A;  5DKL A;  4R6L A;  2KOI A;  1JTD A;  3MBZ A;  3R4K A;  4MNR A;  1ZHH B;  1BZA A;  1UWN X;  2VX8 A;  3RJU A;  3D9Y A;  4Q0J A;  4ZJ3 A;  1SDN A;  5CGS A;  2VGL M;  3LIA A;  3GMW A;  2Y8H A;  1XX2 A;  3EQV A;  3PAG A;  4WL9 A;  3T4O A;  3W2Z A;  3SH7 A;  4I3J A;  2UV0 E;  5KMW A;  1D7E A;  5EVE A;  1S1Z A;  5CTM A;  1NZO A;  4LV0 A;  1PNE A;  4PHT A;  2Q0O A;  3HLF A;  3UMD A;  5HPF A;  3HLG A;  2ZQ7 A;  4P0M A;  3DWK A;  3VFF A;  3Q7V A;  4FTX A;  3ZQ5 A;  2JN7 A;  1E3U A;  3VP3 A;  5TGF A;  3C4P A;  5FAP A;  2WUQ A;  4PM5 A;  4S2I A;  3N4I A;  2KDK A;  4O01 A;  2Z2L B;  2PRF A;  3UE0 A;  4LFU A;  5GHY A;  2EXB A;  1N9B A;  3FPW A;  2JKG A;  5FA7 A;  1W79 A;  3ULF A;  3LYX A;  2QPN A;  1KGG A;  4NXG A;  3AGF A;  1L0F A;  3IXB A;  2P9V A;  3P98 A;  3UME A;  2QZ6 A;  4GKU A;  3P01 A;  3P7N A;  3UN7 A;  1PWC A;  3CZD A;  3VV4 A;  2HJ9 C;  5AVF A;  4CLC C;  3W4P A;  4KZ7 A;  4JGQ A;  4S2M A;  4BBV A;  1ALQ A;  3LID A;  4WYY A;  4LV3 A;  1K54 A;  4A5R A;  4GW9 A;  1SKO B;  3KYZ A;  1YLY A;  4GB7 A;  3HBR A;  1OTD A;  3NDG A;  1YSQ A;  1WYB A;  4OPQ A;  4HP4 A;  2V0U A;  3MJQ A;  1GCE A;  1W63 Q;  4CLC A;  2IWB A;  1YMX A;  2DNS A;  1FR1 A;  3A0S A;  1J3W A;  4DE0 A;  3TSG A;  3LR4 A;  4GJ4 A;  3I7J A;  2R9X A;  2A24 B;  1NYM A;  1JTG A;  2Y59 A;  4ETX A;  4WEL A;  1FIK A;  3QP4 A;  2PT7 A;  4UA6 A;  4N9K A;  2WGW B;  2EFU A;  5DKK A;  1KE4 A;  3K2N A;  3UE6 A;  3UPN A;  1IOU A;  2OLU A;  3T12 B;  4QY5 A;  4HIA A;  3MQ0 A;  3NY4 A;  2Y2M A;  4GHI B;  1PW1 A;  5AQ7 A;  3QP5 A;  1PRQ A;  2KX6 A;  1QME A;  2EXA A;  4JF5 A;  2HJE A;  5A8B A;  3PBQ A;  1JNU A;  5U47 A;  3H7W A;  5A91 A;  3F1O B;  1FCO A;  2LB9 A;  4K91 A;  2PR6 A;  1QMF A;  3IH8 A;  1E25 A;  2H0T A;  3NIA A;  4MBF A;  5AQA A;  1XJ6 A;  1YM1 A;  4BLM A;  4RA7 A;  4PM9 A;  1C3B A;  4H6J A;  2Z6D A;  4Y0U A;  1S1Y A;  4OOL A;  2QJ5 A;  3DTI A;  1HZO A;  2EWW A;  1BT5 A;  4QJG A;  4Q0I A;  3UB8 A;  4MDZ A;  3LIF A;  4GN2 A;  1P9R A;  4BL2 A;  2EX6 A;  1T1A A;  3VP0 A;  4WMC A;  4Q8I A;  4IED A;  4R4R A;  5AQ9 A;  3DW0 A;  1K38 A;  3MKE A;  3V3S A;  3OPL A;  1H0M A;  2W3F A;  5FEG A;  3ZVT A;  2XLN A;  4ARZ A;  1G6A A;  2ZMF A;  2XH9 A;  4EW7 A;  3UE3 A;  3A3I A;  4DF6 A;  1CEF A;  3OOV A;  3JVU A;  2D02 A;  4L9F A;  5F82 A;  4RVA A;  1SZV A;  5GHZ A;  2JKT I;  1O07 A;  3VE3 A;  1T1B A;  4GZB A;  5D3O A;  3NCK A;  2W1T A;  1L0G A;  4EXO A;  5CED A;  2W27 A;  1V9Y A;  2PBY A;  3UB5 P;  1LLB A;  3LY4 A;  2GX5 A;  4E3O A;  3S7O A;  1EI5 A;  4ME4 A;  5FAO A;  5K5B A;  4KZ9 A;  4HJ4 A;  4LCL A;  5KZH A;  3T1X A;  5F5Y A;  3UPO A;  3D4F A;  4JGO A;  3ZNY A;  2DCF A;  2M1C A;  1CJF A;  1ZG4 A;  5F69 A;  4R4S A;  1NXY A;  3A3F A;  3BFE A;  4HJ3 A;  4C75 A;  2L0W A;  3ZHH A;  4S2J A;  2Y2O A;  4OLD A;  1XGJ A;  3Q81 A;  2Y2H A;  3QP2 A;  1DJB A;  4K08 A;  3GTC A;  5JYO A;  4OPR A;  5A90 A;  3NC8 A;  4EBP A;  2VGJ A;  4P6B A;  2ZQC A;  1PZO A;  2W1R A;  5I94 A;  4EBN A;  1OTE A;  4RQ9 A;  2RCX A; 
#chains in the Genus database with same CATH homology
 4G3K A;  3E4Q A;  4UQI S;  5G4Y A;  2EA9 A;  3B47 A;  3B42 A;  5DJU A;  2HV1 A;  4WN5 A;  3PHY A;  2OOL A;  3A0V A;  3R7W A;  1TS7 A;  3LIC A;  4GLQ A;  4B93 A;  2V1A A;  1UGU A;  3B33 A;  2G7U A;  3BY9 A;  3F1P A;  3BQA A;  3NOT C;  2O0Y A;  3S7Q A;  4HI4 A;  1YAX A;  2O9A A;  3TW8 A;  3E98 A;  2J3T C;  3NJA A;  4HP9 A;  1YKD A;  2J80 A;  3PXP A;  3CI6 A;  2O99 A;  4HNB A;  1W63 M;  3JVV A;  1OTA A;  4YNR A;  2O9B A;  3KSH A;  2L1M A;  3LR5 A;  1WA9 A;  2WKP A;  2LB5 A;  3CUE A;  1DP6 A;  2L4R A;  4OOM A;  5HSQ A;  1LSX A;  1XJ4 A;  4E04 A;  4F3L A;  2GZA A;  2R78 A;  4NEE D;  3T4J A;  2GNX A;  4I38 A;  5DKL A;  1LSV A;  4XT2 B;  4NXB A;  2NUP C;  4R6L A;  4YOF A;  3NOU C;  4Y2F A;  3UB6 A;  3E4O A;  2VA0 A;  2KOI A;  3R4K A;  2W3D A;  1ZHH B;  2KLI A;  1UWN X;  2DMW A;  4G3V A;  4Y5F A;  2VX8 A;  2FH5 A;  4Q0J A;  1H3Q A;  1OTB A;  4O0P A;  2H28 A;  2VGL M;  3LIA A;  1V9Z A;  2FZ0 A;  4NKP A;  2Y8H A;  3T4K A;  3EQV A;  4EUV A;  3MR0 A;  4WL9 A;  4WEJ A;  2V0W A;  4WF0 A;  4WUJ A;  3T4O A;  3W2Z A;  3EEH A;  4II7 A;  3CAX A;  4I3J A;  4CLC E;  1S66 L;  3OC2 A;  3MMH A;  3LFV A;  3OLO A;  1D7E A;  3EOI A;  4UQI M;  1S1Z A;  1EW0 A;  5TJJ A;  3HJI A;  4PHT A;  3R7W B;  3LUQ A;  2CMN A;  4G3W A;  1GSX A;  4I3I A;  3EEA A;  3UMD A;  3PBN A;  5HPF A;  2A2L A;  3BW6 A;  4EQ1 A;  3LIE A;  3F1P B;  5DFX A;  4LLO B;  3HCY A;  2JKT M;  1TS0 A;  4HY8 A;  3PR6 A;  1NLY A;  3ZQ5 A;  2JN7 A;  3IS2 A;  3E0Y A;  2VV8 A;  2PDR A;  1P0Z A;  2OAQ 1;  3S7P A;  5I5L A;  1OTI A;  4YWZ A;  2KDK A;  4O01 A;  2P04 A;  4GS9 A;  3UB7 A;  4MCW A;  3PBO A;  4F3L B;  4DJ2 A;  1BYW A;  1S67 L;  2A24 A;  2K2N A;  4M4X A;  3FPW A;  1S4S A;  4CLC D;  5HWT A;  3ULF A;  2VV6 A;  2J3W A;  3C8C A;  1XJ3 A;  5DJT A;  3LYX A;  3TRC A;  3BY8 A;  2PYP A;  4NXG A;  3CUE C;  4WLA A;  2JHE A;  3OBF A;  4LRX C;  3RTY A;  5IU1 A;  3VOL A;  3UME A;  1T18 A;  3P01 A;  4L9G A;  4GHI A;  3P7N A;  1OJ5 A;  3UB9 A;  3PYP A;  3KYQ A;  3VV4 A;  4MN5 A;  1YSP A;  4PKY A;  2HJ9 C;  5AVF A;  4CLC C;  5KSH A;  4JGQ A;  5DFY A;  1TF1 A;  4PAU A;  1VB6 A;  3KO6 A;  5HPI A;  3F1O A;  4BBV A;  2P08 A;  2D01 A;  3LID A;  2K31 A;  2QHK A;  2YKF A;  3ZYT A;  1MC0 A;  4MN7 A;  4GW9 A;  3KYZ A;  4NXF A;  5HZH A;  1OJG A;  3BJN A;  3D72 A;  3MQQ A;  1OTD A;  2Z6C A;  4L9E A;  4IUK A;  3T50 A;  1TD5 A;  2ZOI A;  1YSQ A;  1P97 A;  2QKP A;  3IS2 B;  3D3O A;  3G6O A;  3PBR A;  4HP4 A;  1NWZ A;  3KX0 X;  2V0U A;  3MJQ A;  1W63 Q;  4CLC A;  4DJ3 A;  4IHQ A;  2EWV A;  1LL8 A;  2QYB A;  2HF6 A;  1XFQ A;  2B02 A;  4R38 A;  3A0S A;  3S7N A;  1G28 A;  4GS9 B;  2I9V A;  3LR4 A;  4GJ4 A;  4HOI A;  1T19 A;  3CIT A;  3FPV A;  2A24 B;  4QPR A;  4KUK A;  4ETX A;  4WEL A;  1X0O A;  4MN6 A;  4ZRR A;  1STZ A;  1VHM A;  5J3W A;  3MQO A;  4EEU A;  1N9O A;  2JKR I;  2PT7 A;  3C38 A;  5DKK A;  4EET B;  5J7E A;  2B18 A;  2M7V A;  3K2N A;  4JGR A;  4LRY C;  2K7S A;  3UE6 A;  1IOU A;  1IFQ A;  3U2A A;  4HIA A;  2PD8 A;  2VJW A;  1LT0 A;  2W3E A;  3DBA A;  3MQ0 A;  4Q0H A;  3KSI A;  5HD3 A;  4BWI A;  4UEY A;  4GHI B;  5CX7 A;  4AFI A;  5TBM A;  2VEA A;  2KX6 A;  4KQO A;  3IBR A;  2BAS A;  1P9W A;  5F68 A;  4EER A;  2W3G A;  4Z1W A;  4HH3 A;  1GSW A;  2HJE A;  5A8B A;  2VLG A;  3BWL A;  4HH2 A;  2PYR A;  3PBQ A;  1JNU A;  2XA7 M;  3RH8 B;  3H7W A;  2INW A;  2ZMV A;  2W0N A;  3CWF A;  5AJG A;  3F1O B;  2LB9 A;  2PR6 A;  5HL6 A;  3LR0 A;  3OCN A;  4DMZ A;  1DP9 A;  1OPX A;  1UWP X;  5MC7 A;  1XJ6 A;  5AVE A;  3KSG A;  3PBT A;  4R70 A;  4BBU A;  5HWW A;  4PKY G;  2PR5 A;  4H6J A;  3LI9 A;  3E4P A;  4CQH A;  1F9I A;  2Z6D A;  4WEK A;  4BJP A;  3FG8 A;  1XFN A;  5G4Z A;  3LIB A;  4GCZ A;  3EGD C;  4CLC B;  1S1Y A;  4OOL A;  5HWV A;  3F1N A;  4Y3I A;  2QJ5 A;  2WKQ A;  2EWW A;  1NRJ A;  2J3T D;  4Q0I A;  3UB8 A;  4BBT A;  4MDZ A;  3LIF A;  2VV7 A;  3H9W A;  5LBR A;  1P9R A;  3TJZ C;  2XA7 S;  2NUT C;  1T1A A;  3GDI A;  4NXE A;  1N9N A;  2IA2 A;  3K3D A;  4EEP A;  1MKM A;  4L0L A;  1TS8 A;  3A0R A;  3ICY A;  3EWK A;  5HDD A;  3NHQ A;  4P6Z S;  1OT6 A;  4BMW A;  4HQA A;  2M7U A;  1S4R A;  3MXQ A;  3IBJ A;  5EFW A;  5J4E A;  2QWS A;  4MMN A;  1N9L A;  2W3F A;  2OAP 1;  1ZTU A;  1LSW A;  3LR3 A;  4DN0 A;  3VE4 A;  4ARZ A;  2XRO A;  3OCL A;  5TBM B;  2ZMF A;  2YKH A;  2QJ7 A;  3MFX A;  2WKR A;  5F6A A;  4EW7 A;  1DRM A;  3UE3 A;  4FOF A;  4HJ6 A;  3OOV A;  4JGP A;  1TS6 A;  2MJ6 A;  3JVU A;  3H7W B;  2D02 A;  3LI8 A;  4EU0 A;  3GEC A;  4L9F A;  2VZW A;  3H82 A;  4R3A A;  2Y79 A;  2JKT I;  2XRN A;  2ZBB A;  4I5S A;  1T1B A;  3VE3 A;  2V9A A;  4LRZ E;  2HGV A;  5C5K A;  2W1T A;  4EXO A;  5IS1 A;  2W27 A;  1V9Y A;  1MZU A;  3EQU A;  4FSF A;  1GSV A;  2GX5 A;  4H6J B;  1F5M A;  3CLO A;  5DF9 A;  3T4Q A;  4IUH A;  2O9C A;  2OWJ A;  3S7O A;  2ZOH A;  1NLZ A;  4ME4 A;  3F1N B;  5K5B A;  4I39 A;  4HJ4 A;  3T4S A;  3EGX C;  5L8M A;  3HJK A;  2VKS A;  3C30 A;  5F5Y A;  5FL3 A;  3T4L A;  3O5Y A;  3BQ8 A;  5IT5 A;  3C2W A;  2W3H A;  3NOP C;  4JGO A;  3K3C A;  4ETZ A;  1KOU A;  1DP8 A;  3PBS A;  4EES A;  3T4T A;  1T1C A;  2M1C A;  5HDC A;  3MF0 A;  5F69 A;  1ODV A;  4HJ3 A;  1XJ2 A;  1Y28 A;  5HD5 A;  3KSF A;  2L0W A;  2P7J A;  4HHD A;  4P6Z M;  1F98 A;  2V1B A;  4XT2 A;  4ARZ B;  5HDS A;  5KIZ A;  4O8G A;  2OWH A;  3TE8 A;  4KQD A;  3SW1 A;  1OT9 A;  3FC7 A;  4I3A A;  4IJG A;  3RFB A;  4KUO A;  4K08 A;  2PHY A;  2VGL S;  1G6O A;  2JKR M;  1D06 A;  3V67 A;  2XSS A;  4B9O A;  2W1R A;  3H82 B;  1H8M A;  1OTE A;  4RQ9 A;  2PD7 A;  4LPZ A;  2W1T B;  2GJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...