3E98A

Crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
VSLVERQVRLLRERNIEMRHRLSQLMDVARENDRLFDKTRRLVLDLLDATSLEDVVSTVEDSLRHEFQVPYVSLILFSDSSVSVGRSVSSAEAHQAIGGLLSGGKTVCGVLRPHELAFLFGESDRDEIGSAAVVSLSFQGLHGVLAIGSPDPQHYKSSLGTLFLGYVAEVLARVLPRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords GAF Domain of Unknown Function
publication title Crystal structure of a GAF Domain with Unknown Function (NP_253966.1) from PSEUDOMONAS AERUGINOSA at 2.43 A resolution
rcsb
source organism Pseudomonas aeruginosa
total genus 58
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04340 DUF484 Protein of unknown function, DUF484
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3e98A00
4IUKA 2O0YA 2XROA 1VHMA 2QYBA 2O9AA 5HSQA 3BJNA 2OOLA 2Y79A 3KSHA 2G7UA 3ZQ5A 3KSFA 3NHQA 4MMNA 4Q0HA 4GW9A 3W2ZA 2VZWA 2XSSA 3IBRA 4DN0A 3TRCA 3MQ0A 4GLQA 5DFYA 4Y2FA 4Y3IA 1MC0A 4Z1WA 1MKMA 2K31A 3HCYA 2Y8HA 5K5BA 3KSIA 3RFBA 3S7NA 2W3GA 3NOPC 4LRXC 3CI6A 4RQ9A 4ME4A 4LRZE 4YOFA 3NOTC 3KO6A 2LB5A 2VJWA 5TJJA 3G6OA 4R70A 3S7PA 2O9CA 3IBJA 2LB9A 4ZRRA 2W3HA 1TF1A 4CQHA 2W3FA 3KSGA 3CITA 3LFVA 4LRYC 3S7QA 5AJGA 4QPRA 4EU0A 4MDZA 4BWIA 3E98A 4DMZA 5HL6A 2ZMFA 2GX5A 3D3OA 4ETZA 2W3DA 3OBFA 4IUHA 4MCWA 1ZTUA 2W1TB 4Q0JA 3MF0A 5LBRA 4IJGA 5DFXA 2W1TA 2KLIA 1YSQA 4O01A 4PAUA 2XRNA 1YSPA 2W1RA 3VV4A 5HPFA 4EUVA 3C2WA 3MMHA 4O0PA 5L8MA 3E0YA 5I5LA 2KOIA 2K2NA 2O9BA 4YNRA 1TD5A 2IA2A 3K2NA 4G3WA 4R6LA 4G3VA 4G3KA 2O99A 1F5MA 3OOVA 2W3EA 4Q0IA 3S7OA 4E04A 2B18A 1YKDA 2HGVA 2VKSA 4MN7A 4Y5FA 3DBAA 5HPIA 3R4KA 4ETXA 2M7VA 3EEAA 4FOFA 3NOUC 1STZA 2M7UA 2VEAA 3O5YA 5C5KA 4O8GA
chains in the Genus database with same CATH superfamily
3BEBA 2ZMVA 2P9VB 2QYBA 1K55C 4WF0A 1DJBA 2HV1A 5E2EA 2OOLA 2G7UA 2XA7M 1XXMA 2XD1A 4U0TA 1OTIA 2FFFB 5CRFA 3T4QA 4P6BA 3G32A 1IFQA 3R7WA 1MKMA 1K56A 4OH0A 2KX6A 4FSFA 3GSGA 4MBKA 4DDYA 4LRXC 3ZNTA 3CI6A 1H8YA 3CPTA 3IXGA 1LT0A 3HJKA 5HWVA 3IWIA 2O9CA 4LGWA 2Y2HA 4ZRRA 1YQSA 4EBPA 4QY6A 3KSGA 3C38A 5EVID 3TOIA 2I72A 4LV0A 2ZMFA 2XDMA 3EEHA 1KE3A 1N9OA 5TBMA 1XP4A 2WKQA 3MQOA 1I2WA 1KVMA 5G4YA 1S4RA 1H8MA 2PDRA 3V50A 5EVIA 3NC8A 1XFQA 5IU1A 1HLUP 2QPNA 3TG9A 1ODVA 1GHIA 4EXOA 3F1OB 1XJ4A 1W7FA 3PBNA 1OJ5A 4G3VA 2ZJ9A 3HLWA 2J3TC 1FR1A 1QMFA 4YINA 2D02A 3ZG8B 4MN6A 4KENB 3T4LA 2A49A 1ALQA 4BBUA 3HLFA 2XLNA 1FCMA 2XROA 2R78A 3LIFA 2HP6A 3KSFA 5EVIC 2EWWA 4MMNA 5HW3A 3ZG9B 3V5MA 3LR4A 1W8YA 5GLAA 5HAIA 4HHDA 2QHKA 1CI8A 2WAEA 1CJFA 5MC7A 4N1XA 3C5AA 2HDUA 2RL3A 4ME4A 1OT9A 4YOFA 1AWIA 4R3BA 5M19A 1ZHHB 5FL3A 3NY4A 1NYMA 1E25A 1T1CA 4GHIB 1RGZA 3G35A 4N9LA 1VB6A 3BFEA 4HEFA 4OLGA 3S22A 4Y0UA 1ZC2A 4JF6A 5CTMA 2VV7A 5HFOA 3N7WA 4UHUA 2YKHA 3TSGA 3IWQA 4DJ3A 3DTIA 1K57A 2XH9A 4KQRA 4LFUA 4MCWA 4HBTA 3BFCA 1VETA 4WYYA 4DKIA 4XXRA 1LL8A 5G4ZA 3HL9A 3CHWP 2EX6A 3K2NA 5GLBA 3LIBA 2O99A 3DWZA 5F6AA 2V9AA 5AVFA 1WA9A 4U0XA 4CPKA 5FEFA 3WS5A 5HDSA 3PHYA 3PBSA 4E3IA 1SDEA 1K38A 5EOEA 4EQ1A 2XD5A 1FCOA 2O9AA 4QHCA 5HSQA 4XUZA 4II7A 1PW8A 4KQDA 5IT5A 4KZ5A 3T4JA 4HOIA 5FASA 3G34A 5DJTA 5DTKA 4PMAA 2WGWA 1IYQA 4FTXA 3V39A 4Q8IA 3FPWA 4U3TA 4QY5A 5KSHA 1DP6A 2GZAA 1ZG6A 3G6OA 4EW7A 4K91A 1MXOA 2B02A 3A3DA 1SDNA 5FAQA 3SH8A 3H82B 3S7QA 1BUEA 2WKPA 1KE4A 2Y2LA 1YLTA 4GS9B 4GKUA 2MJ6A 1K0KA 3PBRA 3OCNA 5AVEA 1E3UD 4H6JB 2X71A 4IBRA 4X1LA 1N9BA 4IBXA 4UEYA 1MWUA 5EV0A 4BBVA 2JKTM 3G2YA 4AFIA 3ISGA 3S4XA 2XRNA 1DP8A 2W1RA 3IHBA 2PD7A 3FG8A 4HNBA 3E4PA 4KZ7A 3F1OA 3ICYA 1E3UA 1EI5A 2WZXA 4ARZB 1GSVA 5CHJA 4HESA 1BTLA 4WZ5A 1KGFA 1PZPA 2J9PA 2V20A 1GSWA 1J3WA 1PWDA 4S2PA 4DE3A 1T18A 3LY4A 3M2JA 4H8RA 3NBLA 2ZC5B 1D7EA 4C3QA 3LI9A 3TRCA 3SZTA 3HUOA 2OWJA 2EXBA 3T4TA 1FIKA 3VOYA 1TDGA 2ZQDA 1P97A 1XGJA 1K54A 3T12B 1PIOA 4EWFA 3BQ8A 1N9NA 1AXBA 4GB7A 3WS4A 4BQMA 3O86A 4GD6A 4N9KA 1EROA 3LUQA 1Q2QA 3CLOA 2J9OA 2Y2MA 2EFXA 1L0DA 2JKRI 2OSUA 2W3HA 4GOGA 4BLMA 3MXQA 3QP6A 3GECA 1PZOA 4LCMA 4EV4A 1KVLA 1GA9A 3MSHA 4RX2A 2H28A 3HJIA 2ZL1B 3VOZA 5HWWA 3JVUA 2V0WA 2W3DA 4KZ6A 5A90A 4NXGA 1K54C 5DF9A 4S2JA 4IJGA 3HLEA 2GNXA 4KQOA 3UE6A 3C8CA 3M6HA 3MMHA 3BFFA 5EVLA 2Y2IA 4E3OA 5DVAA 5HWTA 3ITAA 2HDRA 4CLCC 3T1SA 4E3MA 3N8LA 5G18A 4ZJ1A 5FAPA 2H0YA 5DF8A 5HDDA 1OTEA 5DTTA 3TE8A 5C5KA 4CJNA 1JVJA 1JNUA 3HREA 3NDGA 4QJGA 4JGRA 3U2AA 3ZQ5A 3CAXA 4WZ4A 3IBRA 3M6BA 3N8SA 1L0GA 1OPXA 3UB6A 2Z2LB 3A3FA 3OPPA 4PM6A 5M1AA 5GHXA 4MN5A 4DF6A 2Y8HA 1T1AA 1XPBA 2VA0A 2X02A 1G6AA 3ITBA 2L1MA 1N4OA 3UN7A 1OMEA 3JYIA 5J4EA 3O88A 3N8RA 3IBJA 4NXFA 2QWSA 4FCFA 4ZAMA 5F1FA 3OPLA 1W5DA 4LV3A 1MWTA 4PM5A 2E8JA 2XK1A 4ESPA 1FSWA 3ZCZA 2FZ0A 4P85A 3LR0A 5L07A 4OPQA 4GZBA 4H6JA 4P6ZS 3WWXA 2WK0A 1BZAA 2Y2OA 4XT2B 4Q0JA 5LBRA 3BQAA 4I38A 2CC1A 1K25A 4JXGA 1BYWA 2PAVP 3IS2B 4IEDA 3GQZA 3ZVWA 4OQGA 1TD5A 3NJAA 3FWLA 1S67L 5HX9A 4S2NA 3ZG5A 2WGIA 2B18A 5E2GA 2Z2MB 3UPPA 5KIZA 1IYSA 2M7UA 2JN7A 2VEAA 2Q0OA 5FDSA 1VEUB 4PKYG 3BJNA 3MR0A 3CJMA 3VOLA 3Q81A 1OTBA 3MFDA 2XSSA 5DFYA 1VM1A 4E3KA 4E6XA 2ZQ7A 1MC0A 2HDQA 4KUKA 1Z6FA 4EEUA 3IF6B 1CF0A 4JPMA 3IT9A 3NCKA 1SKOB 4S2NC 5EOOA 3T4SA 2JKFA 5GL9A 4Y13A 2LB5A 5TJJA 2XGNA 3IWOA 4OKPA 3PBQA 3Q7ZA 3S7PA 1Q2PA 3QNCA 5FI6A 1H0MA 2E8IA 3T1XA 2K7SA 5HL6A 2AVXA 4IHQA 5FQJA 4QU3A 2GX5A 2FH5A 3A0VA 1P9WA 5U47A 4EUZA 2WUQA 1D1JA 1H8ZA 4M3KA 4A5RA 2QJ7A 5JYOA 4Y7PA 3MF0A 5DFXA 3MZDA 3EQUA 4JGOA 1E4DA 3IH8A 1G28A 1JTGA 5EPHA 3C2WA 1GSXA 3IX4A 4D2OA 4HY8A 4L0LA 5HZHA 4G3WA 4R6LA 1F5MA 2PU4A 2OWHA 4HJ4A 4I5SA 3S7OA 3AGFA 3PBOA 3D9YA 1BULA 1H5XA 1YPRA 3OLOA 3UDFA 2ZM2A 1JTDA 2BG1A 3IHAA 3BW6A 4PM8A 3VSLA 1MY8A 5DTSA 5A8BA 2NUTC 3FZCA 2XF3A 1F98A 1ES4A 1NYYA 2QZ6A 3W2ZA 1PI5A 4DN0A 1DRMA 1FQGA 3RJUA 2PRFA 3UB9A 1LI0A 4OONA 2ZM0A 3T1RA 5CXWA 2HJEA 4Z1WA 1NZUA 4I3AA 1BLSA 5FSRA 1ERMA 1SKFA 3HCYA 2H5SA 3F1PA 1FOFA 4NXBA 4IVIA 4DXCA 3D72A 3ZG7B 1Y28A 4GD8A 2W3FA 2R9XA 3G30A 3B42A 3CITA 4UA7A 3W8KA 3GDIA 5FQMA 3I7JA 1I2SA 4BWIA 2A24A 2ZQCA 3A3JA 4DMZA 4JXVA 4E6WA 2JC7A 2WYXA 1PWGA 2JE5A 2PD8A 5HL1A 3G2ZA 3OBFA 5EM0A 4WN5A 4XT2A 1YM1A 3ZNYA 4EEPA 4X55A 4F3LB 5AQBA 3VFHA 3IS2A 2ZMAA 1XA1A 1MKIA 4ZTKA 3ZDJA 4PM7A 3TW8A 2W3EA 3B47A 4CLCB 3Q7VB 5D3OA 1YMXA 5F82A 4ETXA 1PFLA 3IXHA 3IQAA 3O5YA 4GNUA 4K08A 2G2WA 1TS0A 1BLHA 1VEUA 3NHQA 1YLZA 2EFUA 2FFYA 2WGVA 5HAQA 5A93A 4UAAA 3BECA 2Y2QA 2C6WB 1WYBA 4BENA 1CQAA 1V9ZA 3KSIA 3IF6A 3UY6A 4R0QA 4P0MA 2IWBA 1K57C 3KX0X 1W63Q 2P9VA 3NOTC 1DP9A 1OTDA 2Y2JA 4GDBA 1FCNA 1Y4OA 3E4OA 3UMEA 5HD3A 5F69A 1W79A 1K6RA 2JKRM 1ERQA 4BD1A 4EESA 1XGIA 5HD5A 2Y4AA 4LV2A 4LENA 4PM9A 1A0KA 4OOYA 3AGDA 2VGLS 3LIEA 3QHYA 1XFNA 2Y59A 1LL9A 2Y2NA 3LIAA 1J9MA 1G68A 1BSGA 2J8YA 4NETA 3LR5A 1ZKJA 5EM1A 2XFSA 1T19A 2JHEA 4I3JA 1ZTUA 3HLDA 3JVVA 1XX2A 4I3IA 5GHZA 2XEPA 4EUVA 4L9GA 1XJ2A 2WZZA 2X01A 4DE2A 4Q0IA 2V1ZA 3CUEA 3G4PA 5AQ7A 5HPIA 1C3BA 3A3EA 3ZYTA 1S6RA 4ZJ3A 1CI9A 1S4SA 4RVAA 2V0UA 3GV9A 3UB5P 2KDKA 1NXYA 1GA0A 1XA7A 3B3XA 1KGEA 1SHVA 4WELA 3C4OA 4GLQA 2V1AA 3E4QA 1IYPA 1IOUA 3LGOA 4X69A 3DWKA 1LHYA 1DJCA 3NOPC 4LRZE 5GLCA 5J8XA 3IX3A 2XR0A 3KO6A 2XA7S 4R1GA 3C4PA 2EX8A 4Z9QA 2PR5A 2LB9A 4EETB 3MXSA 3VE3A 3BRMA 1LL5A 4QPRA 1W63M 3IX8A 2P08A 3LI8A 1EW0A 4R4SA 3A0SA 3IH9A 2DCFA 2QJ5A 3NDEA 5EVEA 4GN2A 1MWRA 5DKLA 4MLLA 4WZ5C 3MFXA 3PAEA 2W27A 3GVBA 1DY6A 3VMAA 5CHUA 4GHIA 1YSPA 5IS1A 2WKRA 5CTNA 4F3LA 4BL3A 3T4OA 2D01A 1OTAA 1MWSA 4G3KA 3A3IA 3T50A 3BFDA 3VP0A 3O3VA 2PBDP 4MBFA 2WKIA 4P87A 1RCJA 1I5QA 1S1ZA 2GJ3A 4B88A 1P9RA 4Y17A 3LR3A 1HD8A 3CG5A 1M40A 1T1BA 1NRFA 4HH2A 2DMWA 3IXBA 4OP8A 4JBFA 5HARA 4GCZA 5J3WA 4YWZA 5FQKA 4Y2FA 4B4XA 4OP5A 1G5UA 4N1HA 4WEJA 4KZ8A 4JLFA 5A92A 4ZBEA 3RXWA 2CMNA 3S7NA 4C6YA 2W3GA 3LIDA 5TFQA 3EGXC 3HVFA 3UB8A 4L9FA 5TBMB 3C30A 4EBNA 4HBUA 1BLCA 3CMZA 3NECA 1CEFA 3UE1A 2ZQ9A 5GHYA 4B93A 5FA7A 5EVIB 3LEZA 4RA7A 4ZDXA 2JKTI 3V3RA 4LRYC 1U60A 5A91A 4IVKA 3UE3A 4MDZA 5L2FA 4FUWA 4MNRA 3WRTA 1FR6A 1L3LA 1D06A 3UO9A 2OLVA 4BJPA 2ZQ8A 3NIAA 4PAUA 5BOHA 3K3DA 2JCHA 3H82A 1FILA 2Y55A 1V9YA 3W4QA 5CGWA 1UGUA 4OPZA 4GS9A 1IYOA 4QWOA 1YLYA 3HLBA 3K3CA 2YKFA 2H10A 2GDNA 3OCLA 2ZQAA 2WADA 3R4KA 1K4FA 5CX7A 2IWCA 4DXBA 4JXSA 3UB7A 4WUJA 2OAQ1 4Q0HA 2INWA 5GLDA 1QMEA 4Y3IA 4ARZA 4GDNA 3QP2A 3GTCA 3MKEA 4S2LA 3M2KA 1ESIA 3L9KA 1LSWA 4RQ9A 3Q1FA 4MBHA 3P98A 3UMDA 3P09A 3T4KA 1ES2A 3PAGA 2WAFA 1K55A 1VETB 4OPYA 3MS6A 3A0RA 1YLJA 1BT5A 2VX8A 5FQQA 3IF5A 2VGJA 2V2FF 2L0WA 3LICA 3H7WB 1XJ3A 3LO7A 4WBGA 4MEZA 3S1YA 4WEKA 2HZ5A 4EERA 4XUXA 3OPHA 1M6KA 1P0ZA 1YSQA 3BLMA 2QMIA 2ZOHA 5HPFA 3JPUA 1NJ4A 1TS8A 5CEDA 1JWPA 4X68A 2VGKA 3FC7A 3PXPA 3NULA 2P74A 3VE4A 1X0OA 2ZL1A 5TGFA 4DE1A 4MN7A 4QD4A 3DBAA 1O07A 2JBFA 1Z09A 2Q9NA 2WGWB 1XKZA 4X6TA 5FATA 3N4IA 1LSXA 1K4EA 3KYZA 3NOUC 2BLSA 2J3TD 5KSCA 3PBTA 2O0YA 1VHMA 3BWLA 3MQQA 5HAPA 2EX9A 2DRWA 2VZWA 3BM6A 4CLCE 3LCEA 3T1QB 1ES3A 1ONGA 1KE0A 4BMWA 4KZAA 1ONHA 4HQAA 1HVBA 1GCEA 5E2HA 4KG2A 3U4LP 4DDSA 4KUOA 4R70A 5HDCA 3C7UA 3FKWA 3KYQA 4WM9A 4X53A 3HLGA 2P7JA 1IELA 4BD0A 2ZC3B 4OQIA 4FH4A 4UQIM 4C75A 1EWZA 1TEMA 3D3OA 5F83A 5CECA 3DTMA 2UV0E 3UNWA 2ACGA 1LLBA 2W1TB 5L10A 4S2IA 2ZLYA 1BLPA 1NLYA 4I39A 5CGSA 5F68A 5L8MA 1XJ6A 2O9BA 1ACFA 4KZ3A 3FV7A 4LPZA 5FI7A 4E3LA 1G6OA 3V67A 4KZBA 2PYPA 2HP5A 2Y2GA 3MBZA 4KQQA 1S66L 2V8FA 4HP9A 4OQHA 3LEQA 2M7VA 2QKPA 4FOFA 2HPBA 2B95A 2V8CA 4NKPA 3TJZC 1PRQA 4O8GA 4WLAA 4IUKA 5FEGA 3VSKA 2XFTA 2UWXA 3PTEA 4S2MA 2Y79A 4EQIA 2PT7A 3G31A 1KDSA 4GW9A 5FAOA 3ZVTA 5DKKA 1OT6A 4F94A 5CERA 3ZFZA 4KZ9A 2K31A 3UDXA 4R38A 1GHPA 3RFBA 4NEED 5DF7A 4FH2A 2G2UA 4R4RA 4Y15A 5M18A 4O7DA 3VP3A 4P6ZM 5F1GA 3W4OA 1HTZA 4WMCD 4OQ0A 4CQHA 5AJGA 3WS1A 5EECA 4OOMA 4EU0A 3E2LA 3E98A 3LYXA 4E3NA 1K6SA 3H7WA 1SZVA 4KG5A 1SKOA 1H3QA 4BL2A 5KMWA 2WKHA 4WMCA 3L7HA 1PW1A 1PI4A 4K0WA 4FD8A 3RXXA 2OLUA 4HJ6A 2VK3A 2BASA 3PYPA 3OC2A 4R23A 2ZC6B 3CZDA 3WS2A 1L0EA 1FSYA 3VP4A 2KOIA 3D4FA 2HP9A 3B33A 2XQZA 5FDHA 3FKVA 2EA9A 3RH8B 2VKSA 3IF6C 3QP4A 3WS0A 3EEAA 5CHMA 3OPRA 4JKTA 3PR6A 3MJQA 4B9OA 3CWFA 3MXRA 2A2LA 5I94A 2EX2A 5F5YA 5E2FA 4M4XA 1ES5A 2B5RA 1PNEA 1OJGA 4OVDA 1UWNX 4WL9A 1YLPA 4Y0TA 1WYCA 2PU2A 2H0TA 5FQ9A 1S0WA 3GMWA 1JWVA 1YT4A 2I9VA 4DJ2A 4RYEA 1NLZA 3HUMA 1GHMA 4S2OA 5KZHA 5IHVA 3QP8A 3SW1A 3EWKA 1KGGA 1KDWA 2BTFP 4HJ3A 1ESUA 3DTKA 2EWVA 4N92A 4R3JA 3BY8A 4NK3A 1TS6A 4NG2A 3F1NB 5EE8A 4HH3A 3SH7A 2OAP1 2L4RA 2HJ9C 3V3SA 1NY0A 3CUEC 3UPOA 1WE4A 2Z6DA 2RCXA 4ETZA 1RP5A 4ZJ2A 5DJUA 1NRJA 3EGDC 3BLSA 2W1TA 2KLIA 3LY3A 3P01A 2ZOIA 4O01A 2R9WA 3ZG0A 3BFGA 2Y2KA 5FQIA 4O0PA 2VLGA 4YNRA 2K2NA 4B4ZA 2IA2A 3GR2A 3SOIA 5EFWA 2Z6CA 3NI9A 4Y5FA 4BBTA 4CLCD 4HIAA 1NZOA 3OZHA 4PKYA 4JXWA 3UPNA 3H9WA 2HDSA 4UA6A 3N6IA 1MZUA 3BY9A 1TS7A 1F2KA 2WKEA 4Y0OA 4LCLA 4JF5A 3SS4A 4GJ4A 4NXEA 2IWDA 3R7WB 5CGXA 4CLCA 3Q7VA 2J3WA 4OPRA 2ZC4B 2EXAA 1YMSA 2VV6A 1DJAA 3CPTB 3DW0A 2ZM8A 3FYZA 3ZGAB 4L9EA 3P7NA 1SCWA 5E43A 1IKIA 3DAVA 2VJWA 4PPRA 2J7VA 4S2KA 1NWZA 5TR7A 3KYEA 1RGYA 3DTEA 3LFVA 4KZ4A 5EUAA 3VP2A 4UQIS 1N9LA 3HUNA 4OOLA 1S1YA 4K0XA 4QB8A 5L09A 3WRZA 1YAXA 5J7EA 1MPLA 4IUHA 4LLOB 1VQQA 1JWZA 3SH9A 3QP1A 4HP4A 4JF4A 3W4PA 3QP5A 5I5LA 3VP1A 4JGQA 3QNBA 4UA9A 3OOVA 1CK3A 3MZEA 3EOIA 4YFMA 3Q82A 1L2SA 4E04A 1PWCA 1YKDA 2HGVA 2M1CA 1O7EA 2V1BA 4ID4A 3F1PB 1STZA 2PBYA 4PHTA 1TDLA 4JGPA 4DE0A 4R3AA 5AQ9A 1L0FA 2J80A 3KSHA 3Q07A 2W0NA 3IXDA 1F9IA 1UWPX 3SS3A 3EQVA 3MQ0A 2ZBBA 1PYYA 3E2KA 1HZOA 5AQAA 2A24B 2NUPC 1LI9A 5K5BA 2A3UA 3O87A 2HF6A 1MBLA 2VGLM 3UE0A 2JKGA 4X1MA 2ZC7A 2PR6A 2OV5A 4DRTA 1LSVA 3VFFA 3ZHHA 1TF1A 4X56A 1IKGA 3HLCA 3F1NA 5FI2A 2VV8A 1YLWA 2C5WB 1KOUA 1W8QA 2Y91A 1TVFA 3SS5A 4RX3A 1CEGA 2P04A 4EBLA 2Q9MA 2ZD8A 2PYRA 1ZG4A 3AGEA 3C7VA 2Y2PA 4HI4A 3HBRA 3VV4A 2DNSA 5CEBA 3FPVA 3E0YA 3MKFA 4D60A 3BYDA 3UDIA 3MZFA 4X25A 4E3JA 2PHYA 4KG6A 4LV1A 3GRJA 4OLDA 3ULFA 1Y54A 3RTYA 1K56D 5JYPA 1IEMA
chains in the Genus database with same CATH topology
4IUKA 1JNUA 2ZMVA 2QYBA 4JGRA 4WF0A 2HV1A 2OOLA 2Y79A 3U2AA 2G7UA 2XA7M 3ZQ5A 2PT7A 3CAXA 4GW9A 1OTIA 3IBRA 4WELA 4GLQA 1OPXA 3T4QA 3UB6A 2V1AA 5DKKA 3E4QA 1OT6A 1IFQA 3R7WA 1MKMA 1IOUA 2K31A 2KX6A 4R38A 4MN5A 2Y8HA 4FSFA 1T1AA 3RFBA 4NEED 3NOPC 4LRXC 2VA0A 3CI6A 4LRZE 1LT0A 3HJKA 5HWVA 2L1MA 3KO6A 2XA7S 4P6ZM 5J4EA 2O9CA 3IBJA 2PR5A 2LB9A 4ZRRA 4NXFA 2QWSA 4EETB 4CQHA 3KSGA 3VE3A 3C38A 5AJGA 4QPRA 4OOMA 4EU0A 1W63M 2P08A 3E98A 3LYXA 3LI8A 2ZMFA 3EEHA 3H7WA 1EW0A 1N9OA 3A0SA 5TBMA 2QJ5A 2FZ0A 2WKQA 3MQOA 3LR0A 1H3QA 5DKLA 5G4YA 1S4RA 3MFXA 1H8MA 4H6JA 4P6ZS 2W27A 4XT2B 4Q0JA 5LBRA 2PDRA 3BQAA 4I38A 1XFQA 5IU1A 1BYWA 4GHIA 4HJ6A 2BASA 3IS2B 3PYPA 1ODVA 1YSPA 3OC2A 5IS1A 2WKRA 4F3LA 2KOIA 4EXOA 3T4OA 1TD5A 3F1OB 1XJ4A 3PBNA 2D01A 1OJ5A 4G3VA 1OTAA 3NJAA 4G3KA 3B33A 1S67L 2J3TC 2EA9A 3RH8B 3T50A 2B18A 2D02A 2VKSA 4MN6A 3T4LA 3EEAA 5KIZA 2M7UA 2JN7A 2GJ3A 1S1ZA 3PR6A 1P9RA 2VEAA 3LR3A 3MJQA 4B9OA 4BBUA 3CWFA 2A2LA 2XROA 1T1BA 5F5YA 4PKYG 2R78A 3LIFA 3BJNA 4HH2A 3MR0A 2DMWA 3VOLA 4M4XA 3KSFA 1OTBA 1OJGA 2EWWA 1UWNX 4MMNA 3LR4A 4WL9A 5J3WA 4GCZA 2XSSA 4YWZA 5DFYA 4HHDA 2QHKA 4Y2FA 1MC0A 2I9VA 4DJ2A 1NLZA 4WEJA 5MC7A 4KUKA 4EEUA 2CMNA 3S7NA 2W3GA 3LIDA 3EGXC 3UB8A 4L9FA 1OT9A 4ME4A 3C30A 4YOFA 5TBMB 3SW1A 3EWKA 3T4SA 2LB5A 4HJ3A 2EWVA 5TJJA 4B93A 3PBQA 3BY8A 3S7PA 1ZHHB 1TS6A 5FL3A 3F1NB 2JKTI 1T1CA 4GHIB 4HH3A 4LRYC 1VB6A 3UE3A 4MDZA 2OAP1 2L4RA 2HJ9C 2K7SA 5HL6A 4IHQA 2GX5A 3CUEC 2VV7A 2FH5A 3A0VA 1P9WA 2Z6DA 4ETZA 2YKHA 5DJUA 1D06A 4DJ3A 2QJ7A 4MCWA 1NRJA 3EGDC 3MF0A 5DFXA 2W1TA 2KLIA 3EQUA 4JGOA 4BJPA 3P01A 4O01A 1G28A 2ZOIA 4PAUA 1LL8A 3K3DA 5G4ZA 3H82A 3C2WA 1GSXA 4O0PA 2VLGA 4HY8A 4YNRA 1V9YA 2K2NA 4L0LA 2IA2A 3K2NA 5HZHA 1UGUA 4G3WA 4R6LA 3LIBA 4GS9A 2O99A 1F5MA 5F6AA 2OWHA 2V9AA 5AVFA 3K3CA 4HJ4A 4I5SA 3S7OA 5EFWA 2Z6CA 2YKFA 3PBOA 3OCLA 4Y5FA 4BBTA 1WA9A 3R4KA 3OLOA 4CLCD 4HIAA 4PKYA 5HDSA 3BW6A 3H9WA 3PHYA 3PBSA 5CX7A 5A8BA 2NUTC 1MZUA 3BY9A 4EQ1A 1TS7A 2O9AA 5HSQA 3UB7A 4WUJA 1F98A 4II7A 2OAQ1 4Q0HA 2INWA 3W2ZA 4GJ4A 4NXEA 4KQDA 4DN0A 1DRMA 5IT5A 3R7WB 3UB9A 3T4JA 4HOIA 4Y3IA 4ARZA 2HJEA 4CLCA 4Z1WA 4I3AA 2J3WA 5DJTA 3HCYA 3FPWA 3F1PA 2VV6A 5KSHA 1LSWA 4RQ9A 4L9EA 4NXBA 3P7NA 1DP6A 2GZAA 3UMDA 2VJWA 3T4KA 3G6OA 4EW7A 3D72A 1Y28A 2B02A 3A0RA 2W3FA 1NWZA 2VX8A 3B42A 3CITA 3H82B 3LFVA 3S7QA 3GDIA 2WKPA 4BWIA 2A24A 2L0WA 4DMZA 3LICA 3H7WB 1XJ3A 4GS9B 4UQIS 1N9LA 2MJ6A 3PBRA 4OOLA 3OCNA 2PD8A 1S1YA 5AVEA 1YAXA 4WEKA 4H6JB 5J7EA 3OBFA 4IUHA 4LLOB 4EERA 4UEYA 1P0ZA 4WN5A 4XT2A 1YSQA 4BBVA 2JKTM 4AFIA 4EEPA 2XRNA 1DP8A 4HP4A 4F3LB 2ZOHA 2W1RA 5HPFA 3IS2A 2PD7A 3FG8A 1TS8A 5I5LA 4HNBA 3E4PA 4JGQA 3F1OA 3FC7A 3ICYA 3PXPA 3TW8A 3VE4A 3OOVA 2W3EA 3EOIA 3B47A 1X0OA 4E04A 4ARZB 4CLCB 1YKDA 2HGVA 4MN7A 1GSVA 3DBAA 2M1CA 4ETXA 2V1BA 1LSXA 3KYZA 3F1PB 1STZA 3NOUC 2J3TD 3O5YA 1GSWA 3PBTA 4PHTA 4K08A 2O0YA 1VHMA 3BWLA 3MQQA 4JGPA 1TS0A 4R3AA 1T18A 2J80A 3KSHA 2W0NA 3NHQA 1D7EA 1F9IA 1UWPX 2VZWA 3LI9A 3EQVA 3TRCA 3MQ0A 4CLCE 2OWJA 2ZBBA 3T4TA 1P97A 2A24B 2NUPC 4BMWA 1V9ZA 5K5BA 3KSIA 2HF6A 3BQ8A 2VGLM 4HQAA 1N9NA 3KX0X 1W63Q 3NOTC 4KUOA 1DP9A 1OTDA 3LUQA 2PR6A 3CLOA 3E4OA 4R70A 3UMEA 1LSVA 5HDCA 5HD3A 5F69A 2W3HA 2JKRI 1TF1A 2JKRM 3MXQA 3F1NA 3GECA 2VV8A 4EESA 3KYQA 5HD5A 1KOUA 2P7JA 2VGLS 4UQIM 3LIEA 2P04A 1XFNA 3LIAA 2H28A 3HJIA 3D3OA 5HWWA 3JVUA 2V0WA 2W3DA 3LR5A 4NXGA 5DF9A 1T19A 2JHEA 2PYRA 4I3JA 1ZTUA 2W1TB 4IJGA 3JVVA 4HI4A 2GNXA 4I3IA 1NLYA 4I39A 4KQOA 3VV4A 5F68A 3UE6A 4EUVA 3C8CA 4L9GA 3MMHA 1XJ2A 3FPVA 5L8MA 3E0YA 1XJ6A 2O9BA 4LPZA 5HWTA 1G6OA 3V67A 4CLCC 2PYPA 2PHYA 4Q0IA 3CUEA 1S66L 5HDDA 1OTEA 5HPIA 3ZYTA 4HP9A 3ULFA 3TE8A 2M7VA 1S4SA 2QKPA 4FOFA 3RTYA 2V0UA 4NKPA 3TJZC 5C5KA 4O8GA 4WLAA 2KDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUK A;  2O0Y A;  2XRO A;  1VHM A;  2QYB A;  2O9A A;  5HSQ A;  3BJN A;  2OOL A;  2Y79 A;  3KSH A;  2G7U A;  3ZQ5 A;  3KSF A;  3NHQ A;  4MMN A;  4Q0H A;  4GW9 A;  3W2Z A;  2VZW A;  2XSS A;  3IBR A;  4DN0 A;  3TRC A;  3MQ0 A;  4GLQ A;  5DFY A;  4Y2F A;  4Y3I A;  1MC0 A;  4Z1W A;  1MKM A;  2K31 A;  3HCY A;  2Y8H A;  5K5B A;  3KSI A;  3RFB A;  3S7N A;  2W3G A;  3NOP C;  4LRX C;  3CI6 A;  4RQ9 A;  4ME4 A;  4LRZ E;  4YOF A;  3NOT C;  3KO6 A;  2LB5 A;  2VJW A;  5TJJ A;  3G6O A;  4R70 A;  3S7P A;  2O9C A;  3IBJ A;  2LB9 A;  4ZRR A;  2W3H A;  1TF1 A;  4CQH A;  2W3F A;  3KSG A;  3CIT A;  3LFV A;  4LRY C;  3S7Q A;  5AJG A;  4QPR A;  4EU0 A;  4MDZ A;  4BWI A;  3E98 A;  4DMZ A;  5HL6 A;  2ZMF A;  2GX5 A;  3D3O A;  4ETZ A;  2W3D A;  3OBF A;  4IUH A;  4MCW A;  1ZTU A;  2W1T B;  4Q0J A;  3MF0 A;  5LBR A;  4IJG A;  5DFX A;  2W1T A;  2KLI A;  1YSQ A;  4O01 A;  4PAU A;  2XRN A;  1YSP A;  2W1R A;  3VV4 A;  5HPF A;  4EUV A;  3C2W A;  3MMH A;  4O0P A;  5L8M A;  3E0Y A;  5I5L A;  2KOI A;  2K2N A;  2O9B A;  4YNR A;  1TD5 A;  2IA2 A;  3K2N A;  4G3W A;  4R6L A;  4G3V A;  4G3K A;  2O99 A;  1F5M A;  3OOV A;  2W3E A;  4Q0I A;  3S7O A;  4E04 A;  2B18 A;  1YKD A;  2HGV A;  2VKS A;  4MN7 A;  4Y5F A;  3DBA A;  5HPI A;  3R4K A;  4ETX A;  2M7V A;  3EEA A;  4FOF A;  3NOU C;  1STZ A;  2M7U A;  2VEA A;  3O5Y A;  5C5K A;  4O8G A; 
#chains in the Genus database with same CATH topology
 3BEB A;  2ZMV A;  2P9V B;  2QYB A;  1K55 C;  4WF0 A;  1DJB A;  2HV1 A;  5E2E A;  2OOL A;  2G7U A;  2XA7 M;  1XXM A;  2XD1 A;  4U0T A;  1OTI A;  2FFF B;  5CRF A;  3T4Q A;  4P6B A;  3G32 A;  1IFQ A;  3R7W A;  1MKM A;  1K56 A;  4OH0 A;  2KX6 A;  4FSF A;  3GSG A;  4MBK A;  4DDY A;  4LRX C;  3ZNT A;  3CI6 A;  1H8Y A;  3CPT A;  3IXG A;  1LT0 A;  3HJK A;  5HWV A;  3IWI A;  2O9C A;  4LGW A;  2Y2H A;  4ZRR A;  1YQS A;  4EBP A;  4QY6 A;  3KSG A;  3C38 A;  5EVI D;  3TOI A;  2I72 A;  4LV0 A;  2ZMF A;  2XDM A;  3EEH A;  1KE3 A;  1N9O A;  5TBM A;  1XP4 A;  2WKQ A;  3MQO A;  1I2W A;  1KVM A;  5G4Y A;  1S4R A;  1H8M A;  2PDR A;  3V50 A;  5EVI A;  3NC8 A;  1XFQ A;  5IU1 A;  1HLU P;  2QPN A;  3TG9 A;  1ODV A;  1GHI A;  4EXO A;  3F1O B;  1XJ4 A;  1W7F A;  3PBN A;  1OJ5 A;  4G3V A;  2ZJ9 A;  3HLW A;  2J3T C;  1FR1 A;  1QMF A;  4YIN A;  2D02 A;  3ZG8 B;  4MN6 A;  4KEN B;  3T4L A;  2A49 A;  1ALQ A;  4BBU A;  3HLF A;  2XLN A;  1FCM A;  2XRO A;  2R78 A;  3LIF A;  2HP6 A;  3KSF A;  5EVI C;  2EWW A;  4MMN A;  5HW3 A;  3ZG9 B;  3V5M A;  3LR4 A;  1W8Y A;  5GLA A;  5HAI A;  4HHD A;  2QHK A;  1CI8 A;  2WAE A;  1CJF A;  5MC7 A;  4N1X A;  3C5A A;  2HDU A;  2RL3 A;  4ME4 A;  1OT9 A;  4YOF A;  1AWI A;  4R3B A;  5M19 A;  1ZHH B;  5FL3 A;  3NY4 A;  1NYM A;  1E25 A;  1T1C A;  4GHI B;  1RGZ A;  3G35 A;  4N9L A;  1VB6 A;  3BFE A;  4HEF A;  4OLG A;  3S22 A;  4Y0U A;  1ZC2 A;  4JF6 A;  5CTM A;  2VV7 A;  5HFO A;  3N7W A;  4UHU A;  2YKH A;  3TSG A;  3IWQ A;  4DJ3 A;  3DTI A;  1K57 A;  2XH9 A;  4KQR A;  4LFU A;  4MCW A;  4HBT A;  3BFC A;  1VET A;  4WYY A;  4DKI A;  4XXR A;  1LL8 A;  5G4Z A;  3HL9 A;  3CHW P;  2EX6 A;  3K2N A;  5GLB A;  3LIB A;  2O99 A;  3DWZ A;  5F6A A;  2V9A A;  5AVF A;  1WA9 A;  4U0X A;  4CPK A;  5FEF A;  3WS5 A;  5HDS A;  3PHY A;  3PBS A;  4E3I A;  1SDE A;  1K38 A;  5EOE A;  4EQ1 A;  2XD5 A;  1FCO A;  2O9A A;  4QHC A;  5HSQ A;  4XUZ A;  4II7 A;  1PW8 A;  4KQD A;  5IT5 A;  4KZ5 A;  3T4J A;  4HOI A;  5FAS A;  3G34 A;  5DJT A;  5DTK A;  4PMA A;  2WGW A;  1IYQ A;  4FTX A;  3V39 A;  4Q8I A;  3FPW A;  4U3T A;  4QY5 A;  5KSH A;  1DP6 A;  2GZA A;  1ZG6 A;  3G6O A;  4EW7 A;  4K91 A;  1MXO A;  2B02 A;  3A3D A;  1SDN A;  5FAQ A;  3SH8 A;  3H82 B;  3S7Q A;  1BUE A;  2WKP A;  1KE4 A;  2Y2L A;  1YLT A;  4GS9 B;  4GKU A;  2MJ6 A;  1K0K A;  3PBR A;  3OCN A;  5AVE A;  1E3U D;  4H6J B;  2X71 A;  4IBR A;  4X1L A;  1N9B A;  4IBX A;  4UEY A;  1MWU A;  5EV0 A;  4BBV A;  2JKT M;  3G2Y A;  4AFI A;  3ISG A;  3S4X A;  2XRN A;  1DP8 A;  2W1R A;  3IHB A;  2PD7 A;  3FG8 A;  4HNB A;  3E4P A;  4KZ7 A;  3F1O A;  3ICY A;  1E3U A;  1EI5 A;  2WZX A;  4ARZ B;  1GSV A;  5CHJ A;  4HES A;  1BTL A;  4WZ5 A;  1KGF A;  1PZP A;  2J9P A;  2V20 A;  1GSW A;  1J3W A;  1PWD A;  4S2P A;  4DE3 A;  1T18 A;  3LY4 A;  3M2J A;  4H8R A;  3NBL A;  2ZC5 B;  1D7E A;  4C3Q A;  3LI9 A;  3TRC A;  3SZT A;  3HUO A;  2OWJ A;  2EXB A;  3T4T A;  1FIK A;  3VOY A;  1TDG A;  2ZQD A;  1P97 A;  1XGJ A;  1K54 A;  3T12 B;  1PIO A;  4EWF A;  3BQ8 A;  1N9N A;  1AXB A;  4GB7 A;  3WS4 A;  4BQM A;  3O86 A;  4GD6 A;  4N9K A;  1ERO A;  3LUQ A;  1Q2Q A;  3CLO A;  2J9O A;  2Y2M A;  2EFX A;  1L0D A;  2JKR I;  2OSU A;  2W3H A;  4GOG A;  4BLM A;  3MXQ A;  3QP6 A;  3GEC A;  1PZO A;  4LCM A;  4EV4 A;  1KVL A;  1GA9 A;  3MSH A;  4RX2 A;  2H28 A;  3HJI A;  2ZL1 B;  3VOZ A;  5HWW A;  3JVU A;  2V0W A;  2W3D A;  4KZ6 A;  5A90 A;  4NXG A;  1K54 C;  5DF9 A;  4S2J A;  4IJG A;  3HLE A;  2GNX A;  4KQO A;  3UE6 A;  3C8C A;  3M6H A;  3MMH A;  3BFF A;  5EVL A;  2Y2I A;  4E3O A;  5DVA A;  5HWT A;  3ITA A;  2HDR A;  4CLC C;  3T1S A;  4E3M A;  3N8L A;  5G18 A;  4ZJ1 A;  5FAP A;  2H0Y A;  5DF8 A;  5HDD A;  1OTE A;  5DTT A;  3TE8 A;  5C5K A;  4CJN A;  1JVJ A;  1JNU A;  3HRE A;  3NDG A;  4QJG A;  4JGR A;  3U2A A;  3ZQ5 A;  3CAX A;  4WZ4 A;  3IBR A;  3M6B A;  3N8S A;  1L0G A;  1OPX A;  3UB6 A;  2Z2L B;  3A3F A;  3OPP A;  4PM6 A;  5M1A A;  5GHX A;  4MN5 A;  4DF6 A;  2Y8H A;  1T1A A;  1XPB A;  2VA0 A;  2X02 A;  1G6A A;  3ITB A;  2L1M A;  1N4O A;  3UN7 A;  1OME A;  3JYI A;  5J4E A;  3O88 A;  3N8R A;  3IBJ A;  4NXF A;  2QWS A;  4FCF A;  4ZAM A;  5F1F A;  3OPL A;  1W5D A;  4LV3 A;  1MWT A;  4PM5 A;  2E8J A;  2XK1 A;  4ESP A;  1FSW A;  3ZCZ A;  2FZ0 A;  4P85 A;  3LR0 A;  5L07 A;  4OPQ A;  4GZB A;  4H6J A;  4P6Z S;  3WWX A;  2WK0 A;  1BZA A;  2Y2O A;  4XT2 B;  4Q0J A;  5LBR A;  3BQA A;  4I38 A;  2CC1 A;  1K25 A;  4JXG A;  1BYW A;  2PAV P;  3IS2 B;  4IED A;  3GQZ A;  3ZVW A;  4OQG A;  1TD5 A;  3NJA A;  3FWL A;  1S67 L;  5HX9 A;  4S2N A;  3ZG5 A;  2WGI A;  2B18 A;  5E2G A;  2Z2M B;  3UPP A;  5KIZ A;  1IYS A;  2M7U A;  2JN7 A;  2VEA A;  2Q0O A;  5FDS A;  1VEU B;  4PKY G;  3BJN A;  3MR0 A;  3CJM A;  3VOL A;  3Q81 A;  1OTB A;  3MFD A;  2XSS A;  5DFY A;  1VM1 A;  4E3K A;  4E6X A;  2ZQ7 A;  1MC0 A;  2HDQ A;  4KUK A;  1Z6F A;  4EEU A;  3IF6 B;  1CF0 A;  4JPM A;  3IT9 A;  3NCK A;  1SKO B;  4S2N C;  5EOO A;  3T4S A;  2JKF A;  5GL9 A;  4Y13 A;  2LB5 A;  5TJJ A;  2XGN A;  3IWO A;  4OKP A;  3PBQ A;  3Q7Z A;  3S7P A;  1Q2P A;  3QNC A;  5FI6 A;  1H0M A;  2E8I A;  3T1X A;  2K7S A;  5HL6 A;  2AVX A;  4IHQ A;  5FQJ A;  4QU3 A;  2GX5 A;  2FH5 A;  3A0V A;  1P9W A;  5U47 A;  4EUZ A;  2WUQ A;  1D1J A;  1H8Z A;  4M3K A;  4A5R A;  2QJ7 A;  5JYO A;  4Y7P A;  3MF0 A;  5DFX A;  3MZD A;  3EQU A;  4JGO A;  1E4D A;  3IH8 A;  1G28 A;  1JTG A;  5EPH A;  3C2W A;  1GSX A;  3IX4 A;  4D2O A;  4HY8 A;  4L0L A;  5HZH A;  4G3W A;  4R6L A;  1F5M A;  2PU4 A;  2OWH A;  4HJ4 A;  4I5S A;  3S7O A;  3AGF A;  3PBO A;  3D9Y A;  1BUL A;  1H5X A;  1YPR A;  3OLO A;  3UDF A;  2ZM2 A;  1JTD A;  2BG1 A;  3IHA A;  3BW6 A;  4PM8 A;  3VSL A;  1MY8 A;  5DTS A;  5A8B A;  2NUT C;  3FZC A;  2XF3 A;  1F98 A;  1ES4 A;  1NYY A;  2QZ6 A;  3W2Z A;  1PI5 A;  4DN0 A;  1DRM A;  1FQG A;  3RJU A;  2PRF A;  3UB9 A;  1LI0 A;  4OON A;  2ZM0 A;  3T1R A;  5CXW A;  2HJE A;  4Z1W A;  1NZU A;  4I3A A;  1BLS A;  5FSR A;  1ERM A;  1SKF A;  3HCY A;  2H5S A;  3F1P A;  1FOF A;  4NXB A;  4IVI A;  4DXC A;  3D72 A;  3ZG7 B;  1Y28 A;  4GD8 A;  2W3F A;  2R9X A;  3G30 A;  3B42 A;  3CIT A;  4UA7 A;  3W8K A;  3GDI A;  5FQM A;  3I7J A;  1I2S A;  4BWI A;  2A24 A;  2ZQC A;  3A3J A;  4DMZ A;  4JXV A;  4E6W A;  2JC7 A;  2WYX A;  1PWG A;  2JE5 A;  2PD8 A;  5HL1 A;  3G2Z A;  3OBF A;  5EM0 A;  4WN5 A;  4XT2 A;  1YM1 A;  3ZNY A;  4EEP A;  4X55 A;  4F3L B;  5AQB A;  3VFH A;  3IS2 A;  2ZMA A;  1XA1 A;  1MKI A;  4ZTK A;  3ZDJ A;  4PM7 A;  3TW8 A;  2W3E A;  3B47 A;  4CLC B;  3Q7V B;  5D3O A;  1YMX A;  5F82 A;  4ETX A;  1PFL A;  3IXH A;  3IQA A;  3O5Y A;  4GNU A;  4K08 A;  2G2W A;  1TS0 A;  1BLH A;  1VEU A;  3NHQ A;  1YLZ A;  2EFU A;  2FFY A;  2WGV A;  5HAQ A;  5A93 A;  4UAA A;  3BEC A;  2Y2Q A;  2C6W B;  1WYB A;  4BEN A;  1CQA A;  1V9Z A;  3KSI A;  3IF6 A;  3UY6 A;  4R0Q A;  4P0M A;  2IWB A;  1K57 C;  3KX0 X;  1W63 Q;  2P9V A;  3NOT C;  1DP9 A;  1OTD A;  2Y2J A;  4GDB A;  1FCN A;  1Y4O A;  3E4O A;  3UME A;  5HD3 A;  5F69 A;  1W79 A;  1K6R A;  2JKR M;  1ERQ A;  4BD1 A;  4EES A;  1XGI A;  5HD5 A;  2Y4A A;  4LV2 A;  4LEN A;  4PM9 A;  1A0K A;  4OOY A;  3AGD A;  2VGL S;  3LIE A;  3QHY A;  1XFN A;  2Y59 A;  1LL9 A;  2Y2N A;  3LIA A;  1J9M A;  1G68 A;  1BSG A;  2J8Y A;  4NET A;  3LR5 A;  1ZKJ A;  5EM1 A;  2XFS A;  1T19 A;  2JHE A;  4I3J A;  1ZTU A;  3HLD A;  3JVV A;  1XX2 A;  4I3I A;  5GHZ A;  2XEP A;  4EUV A;  4L9G A;  1XJ2 A;  2WZZ A;  2X01 A;  4DE2 A;  4Q0I A;  2V1Z A;  3CUE A;  3G4P A;  5AQ7 A;  5HPI A;  1C3B A;  3A3E A;  3ZYT A;  1S6R A;  4ZJ3 A;  1CI9 A;  1S4S A;  4RVA A;  2V0U A;  3GV9 A;  3UB5 P;  2KDK A;  1NXY A;  1GA0 A;  1XA7 A;  3B3X A;  1KGE A;  1SHV A;  4WEL A;  3C4O A;  4GLQ A;  2V1A A;  3E4Q A;  1IYP A;  1IOU A;  3LGO A;  4X69 A;  3DWK A;  1LHY A;  1DJC A;  3NOP C;  4LRZ E;  5GLC A;  5J8X A;  3IX3 A;  2XR0 A;  3KO6 A;  2XA7 S;  4R1G A;  3C4P A;  2EX8 A;  4Z9Q A;  2PR5 A;  2LB9 A;  4EET B;  3MXS A;  3VE3 A;  3BRM A;  1LL5 A;  4QPR A;  1W63 M;  3IX8 A;  2P08 A;  3LI8 A;  1EW0 A;  4R4S A;  3A0S A;  3IH9 A;  2DCF A;  2QJ5 A;  3NDE A;  5EVE A;  4GN2 A;  1MWR A;  5DKL A;  4MLL A;  4WZ5 C;  3MFX A;  3PAE A;  2W27 A;  3GVB A;  1DY6 A;  3VMA A;  5CHU A;  4GHI A;  1YSP A;  5IS1 A;  2WKR A;  5CTN A;  4F3L A;  4BL3 A;  3T4O A;  2D01 A;  1OTA A;  1MWS A;  4G3K A;  3A3I A;  3T50 A;  3BFD A;  3VP0 A;  3O3V A;  2PBD P;  4MBF A;  2WKI A;  4P87 A;  1RCJ A;  1I5Q A;  1S1Z A;  2GJ3 A;  4B88 A;  1P9R A;  4Y17 A;  3LR3 A;  1HD8 A;  3CG5 A;  1M40 A;  1T1B A;  1NRF A;  4HH2 A;  2DMW A;  3IXB A;  4OP8 A;  4JBF A;  5HAR A;  4GCZ A;  5J3W A;  4YWZ A;  5FQK A;  4Y2F A;  4B4X A;  4OP5 A;  1G5U A;  4N1H A;  4WEJ A;  4KZ8 A;  4JLF A;  5A92 A;  4ZBE A;  3RXW A;  2CMN A;  3S7N A;  4C6Y A;  2W3G A;  3LID A;  5TFQ A;  3EGX C;  3HVF A;  3UB8 A;  4L9F A;  5TBM B;  3C30 A;  4EBN A;  4HBU A;  1BLC A;  3CMZ A;  3NEC A;  1CEF A;  3UE1 A;  2ZQ9 A;  5GHY A;  4B93 A;  5FA7 A;  5EVI B;  3LEZ A;  4RA7 A;  4ZDX A;  2JKT I;  3V3R A;  4LRY C;  1U60 A;  5A91 A;  4IVK A;  3UE3 A;  4MDZ A;  5L2F A;  4FUW A;  4MNR A;  3WRT A;  1FR6 A;  1L3L A;  1D06 A;  3UO9 A;  2OLV A;  4BJP A;  2ZQ8 A;  3NIA A;  4PAU A;  5BOH A;  3K3D A;  2JCH A;  3H82 A;  1FIL A;  2Y55 A;  1V9Y A;  3W4Q A;  5CGW A;  1UGU A;  4OPZ A;  4GS9 A;  1IYO A;  4QWO A;  1YLY A;  3HLB A;  3K3C A;  2YKF A;  2H10 A;  2GDN A;  3OCL A;  2ZQA A;  2WAD A;  3R4K A;  1K4F A;  5CX7 A;  2IWC A;  4DXB A;  4JXS A;  3UB7 A;  4WUJ A;  2OAQ 1;  4Q0H A;  2INW A;  5GLD A;  1QME A;  4Y3I A;  4ARZ A;  4GDN A;  3QP2 A;  3GTC A;  3MKE A;  4S2L A;  3M2K A;  1ESI A;  3L9K A;  1LSW A;  4RQ9 A;  3Q1F A;  4MBH A;  3P98 A;  3UMD A;  3P09 A;  3T4K A;  1ES2 A;  3PAG A;  2WAF A;  1K55 A;  1VET B;  4OPY A;  3MS6 A;  3A0R A;  1YLJ A;  1BT5 A;  2VX8 A;  5FQQ A;  3IF5 A;  2VGJ A;  2V2F F;  2L0W A;  3LIC A;  3H7W B;  1XJ3 A;  3LO7 A;  4WBG A;  4MEZ A;  3S1Y A;  4WEK A;  2HZ5 A;  4EER A;  4XUX A;  3OPH A;  1M6K A;  1P0Z A;  1YSQ A;  3BLM A;  2QMI A;  2ZOH A;  5HPF A;  3JPU A;  1NJ4 A;  1TS8 A;  5CED A;  1JWP A;  4X68 A;  2VGK A;  3FC7 A;  3PXP A;  3NUL A;  2P74 A;  3VE4 A;  1X0O A;  2ZL1 A;  5TGF A;  4DE1 A;  4MN7 A;  4QD4 A;  3DBA A;  1O07 A;  2JBF A;  1Z09 A;  2Q9N A;  2WGW B;  1XKZ A;  4X6T A;  5FAT A;  3N4I A;  1LSX A;  1K4E A;  3KYZ A;  3NOU C;  2BLS A;  2J3T D;  5KSC A;  3PBT A;  2O0Y A;  1VHM A;  3BWL A;  3MQQ A;  5HAP A;  2EX9 A;  2DRW A;  2VZW A;  3BM6 A;  4CLC E;  3LCE A;  3T1Q B;  1ES3 A;  1ONG A;  1KE0 A;  4BMW A;  4KZA A;  1ONH A;  4HQA A;  1HVB A;  1GCE A;  5E2H A;  4KG2 A;  3U4L P;  4DDS A;  4KUO A;  4R70 A;  5HDC A;  3C7U A;  3FKW A;  3KYQ A;  4WM9 A;  4X53 A;  3HLG A;  2P7J A;  1IEL A;  4BD0 A;  2ZC3 B;  4OQI A;  4FH4 A;  4UQI M;  4C75 A;  1EWZ A;  1TEM A;  3D3O A;  5F83 A;  5CEC A;  3DTM A;  2UV0 E;  3UNW A;  2ACG A;  1LLB A;  2W1T B;  5L10 A;  4S2I A;  2ZLY A;  1BLP A;  1NLY A;  4I39 A;  5CGS A;  5F68 A;  5L8M A;  1XJ6 A;  2O9B A;  1ACF A;  4KZ3 A;  3FV7 A;  4LPZ A;  5FI7 A;  4E3L A;  1G6O A;  3V67 A;  4KZB A;  2PYP A;  2HP5 A;  2Y2G A;  3MBZ A;  4KQQ A;  1S66 L;  2V8F A;  4HP9 A;  4OQH A;  3LEQ A;  2M7V A;  2QKP A;  4FOF A;  2HPB A;  2B95 A;  2V8C A;  4NKP A;  3TJZ C;  1PRQ A;  4O8G A;  4WLA A;  4IUK A;  5FEG A;  3VSK A;  2XFT A;  2UWX A;  3PTE A;  4S2M A;  2Y79 A;  4EQI A;  2PT7 A;  3G31 A;  1KDS A;  4GW9 A;  5FAO A;  3ZVT A;  5DKK A;  1OT6 A;  4F94 A;  5CER A;  3ZFZ A;  4KZ9 A;  2K31 A;  3UDX A;  4R38 A;  1GHP A;  3RFB A;  4NEE D;  5DF7 A;  4FH2 A;  2G2U A;  4R4R A;  4Y15 A;  5M18 A;  4O7D A;  3VP3 A;  4P6Z M;  5F1G A;  3W4O A;  1HTZ A;  4WMC D;  4OQ0 A;  4CQH A;  5AJG A;  3WS1 A;  5EEC A;  4OOM A;  4EU0 A;  3E2L A;  3E98 A;  3LYX A;  4E3N A;  1K6S A;  3H7W A;  1SZV A;  4KG5 A;  1SKO A;  1H3Q A;  4BL2 A;  5KMW A;  2WKH A;  4WMC A;  3L7H A;  1PW1 A;  1PI4 A;  4K0W A;  4FD8 A;  3RXX A;  2OLU A;  4HJ6 A;  2VK3 A;  2BAS A;  3PYP A;  3OC2 A;  4R23 A;  2ZC6 B;  3CZD A;  3WS2 A;  1L0E A;  1FSY A;  3VP4 A;  2KOI A;  3D4F A;  2HP9 A;  3B33 A;  2XQZ A;  5FDH A;  3FKV A;  2EA9 A;  3RH8 B;  2VKS A;  3IF6 C;  3QP4 A;  3WS0 A;  3EEA A;  5CHM A;  3OPR A;  4JKT A;  3PR6 A;  3MJQ A;  4B9O A;  3CWF A;  3MXR A;  2A2L A;  5I94 A;  2EX2 A;  5F5Y A;  5E2F A;  4M4X A;  1ES5 A;  2B5R A;  1PNE A;  1OJG A;  4OVD A;  1UWN X;  4WL9 A;  1YLP A;  4Y0T A;  1WYC A;  2PU2 A;  2H0T A;  5FQ9 A;  1S0W A;  3GMW A;  1JWV A;  1YT4 A;  2I9V A;  4DJ2 A;  4RYE A;  1NLZ A;  3HUM A;  1GHM A;  4S2O A;  5KZH A;  5IHV A;  3QP8 A;  3SW1 A;  3EWK A;  1KGG A;  1KDW A;  2BTF P;  4HJ3 A;  1ESU A;  3DTK A;  2EWV A;  4N92 A;  4R3J A;  3BY8 A;  4NK3 A;  1TS6 A;  4NG2 A;  3F1N B;  5EE8 A;  4HH3 A;  3SH7 A;  2OAP 1;  2L4R A;  2HJ9 C;  3V3S A;  1NY0 A;  3CUE C;  3UPO A;  1WE4 A;  2Z6D A;  2RCX A;  4ETZ A;  1RP5 A;  4ZJ2 A;  5DJU A;  1NRJ A;  3EGD C;  3BLS A;  2W1T A;  2KLI A;  3LY3 A;  3P01 A;  2ZOI A;  4O01 A;  2R9W A;  3ZG0 A;  3BFG A;  2Y2K A;  5FQI A;  4O0P A;  2VLG A;  4YNR A;  2K2N A;  4B4Z A;  2IA2 A;  3GR2 A;  3SOI A;  5EFW A;  2Z6C A;  3NI9 A;  4Y5F A;  4BBT A;  4CLC D;  4HIA A;  1NZO A;  3OZH A;  4PKY A;  4JXW A;  3UPN A;  3H9W A;  2HDS A;  4UA6 A;  3N6I A;  1MZU A;  3BY9 A;  1TS7 A;  1F2K A;  2WKE A;  4Y0O A;  4LCL A;  4JF5 A;  3SS4 A;  4GJ4 A;  4NXE A;  2IWD A;  3R7W B;  5CGX A;  4CLC A;  3Q7V A;  2J3W A;  4OPR A;  2ZC4 B;  2EXA A;  1YMS A;  2VV6 A;  1DJA A;  3CPT B;  3DW0 A;  2ZM8 A;  3FYZ A;  3ZGA B;  4L9E A;  3P7N A;  1SCW A;  5E43 A;  1IKI A;  3DAV A;  2VJW A;  4PPR A;  2J7V A;  4S2K A;  1NWZ A;  5TR7 A;  3KYE A;  1RGY A;  3DTE A;  3LFV A;  4KZ4 A;  5EUA A;  3VP2 A;  4UQI S;  1N9L A;  3HUN A;  4OOL A;  1S1Y A;  4K0X A;  4QB8 A;  5L09 A;  3WRZ A;  1YAX A;  5J7E A;  1MPL A;  4IUH A;  4LLO B;  1VQQ A;  1JWZ A;  3SH9 A;  3QP1 A;  4HP4 A;  4JF4 A;  3W4P A;  3QP5 A;  5I5L A;  3VP1 A;  4JGQ A;  3QNB A;  4UA9 A;  3OOV A;  1CK3 A;  3MZE A;  3EOI A;  4YFM A;  3Q82 A;  1L2S A;  4E04 A;  1PWC A;  1YKD A;  2HGV A;  2M1C A;  1O7E A;  2V1B A;  4ID4 A;  3F1P B;  1STZ A;  2PBY A;  4PHT A;  1TDL A;  4JGP A;  4DE0 A;  4R3A A;  5AQ9 A;  1L0F A;  2J80 A;  3KSH A;  3Q07 A;  2W0N A;  3IXD A;  1F9I A;  1UWP X;  3SS3 A;  3EQV A;  3MQ0 A;  2ZBB A;  1PYY A;  3E2K A;  1HZO A;  5AQA A;  2A24 B;  2NUP C;  1LI9 A;  5K5B A;  2A3U A;  3O87 A;  2HF6 A;  1MBL A;  2VGL M;  3UE0 A;  2JKG A;  4X1M A;  2ZC7 A;  2PR6 A;  2OV5 A;  4DRT A;  1LSV A;  3VFF A;  3ZHH A;  1TF1 A;  4X56 A;  1IKG A;  3HLC A;  3F1N A;  5FI2 A;  2VV8 A;  1YLW A;  2C5W B;  1KOU A;  1W8Q A;  2Y91 A;  1TVF A;  3SS5 A;  4RX3 A;  1CEG A;  2P04 A;  4EBL A;  2Q9M A;  2ZD8 A;  2PYR A;  1ZG4 A;  3AGE A;  3C7V A;  2Y2P A;  4HI4 A;  3HBR A;  3VV4 A;  2DNS A;  5CEB A;  3FPV A;  3E0Y A;  3MKF A;  4D60 A;  3BYD A;  3UDI A;  3MZF A;  4X25 A;  4E3J A;  2PHY A;  4KG6 A;  4LV1 A;  3GRJ A;  4OLD A;  3ULF A;  1Y54 A;  3RTY A;  1K56 D;  5JYP A;  1IEM A; 
#chains in the Genus database with same CATH homology
 4IUK A;  1JNU A;  2ZMV A;  2QYB A;  4JGR A;  4WF0 A;  2HV1 A;  2OOL A;  2Y79 A;  3U2A A;  2G7U A;  2XA7 M;  3ZQ5 A;  2PT7 A;  3CAX A;  4GW9 A;  1OTI A;  3IBR A;  4WEL A;  4GLQ A;  1OPX A;  3T4Q A;  3UB6 A;  2V1A A;  5DKK A;  3E4Q A;  1OT6 A;  1IFQ A;  3R7W A;  1MKM A;  1IOU A;  2K31 A;  2KX6 A;  4R38 A;  4MN5 A;  2Y8H A;  4FSF A;  1T1A A;  3RFB A;  4NEE D;  3NOP C;  4LRX C;  2VA0 A;  3CI6 A;  4LRZ E;  1LT0 A;  3HJK A;  5HWV A;  2L1M A;  3KO6 A;  2XA7 S;  4P6Z M;  5J4E A;  2O9C A;  3IBJ A;  2PR5 A;  2LB9 A;  4ZRR A;  4NXF A;  2QWS A;  4EET B;  4CQH A;  3KSG A;  3VE3 A;  3C38 A;  5AJG A;  4QPR A;  4OOM A;  4EU0 A;  1W63 M;  2P08 A;  3E98 A;  3LYX A;  3LI8 A;  2ZMF A;  3EEH A;  3H7W A;  1EW0 A;  1N9O A;  3A0S A;  5TBM A;  2QJ5 A;  2FZ0 A;  2WKQ A;  3MQO A;  3LR0 A;  1H3Q A;  5DKL A;  5G4Y A;  1S4R A;  3MFX A;  1H8M A;  4H6J A;  4P6Z S;  2W27 A;  4XT2 B;  4Q0J A;  5LBR A;  2PDR A;  3BQA A;  4I38 A;  1XFQ A;  5IU1 A;  1BYW A;  4GHI A;  4HJ6 A;  2BAS A;  3IS2 B;  3PYP A;  1ODV A;  1YSP A;  3OC2 A;  5IS1 A;  2WKR A;  4F3L A;  2KOI A;  4EXO A;  3T4O A;  1TD5 A;  3F1O B;  1XJ4 A;  3PBN A;  2D01 A;  1OJ5 A;  4G3V A;  1OTA A;  3NJA A;  4G3K A;  3B33 A;  1S67 L;  2J3T C;  2EA9 A;  3RH8 B;  3T50 A;  2B18 A;  2D02 A;  2VKS A;  4MN6 A;  3T4L A;  3EEA A;  5KIZ A;  2M7U A;  2JN7 A;  2GJ3 A;  1S1Z A;  3PR6 A;  1P9R A;  2VEA A;  3LR3 A;  3MJQ A;  4B9O A;  4BBU A;  3CWF A;  2A2L A;  2XRO A;  1T1B A;  5F5Y A;  4PKY G;  2R78 A;  3LIF A;  3BJN A;  4HH2 A;  3MR0 A;  2DMW A;  3VOL A;  4M4X A;  3KSF A;  1OTB A;  1OJG A;  2EWW A;  1UWN X;  4MMN A;  3LR4 A;  4WL9 A;  5J3W A;  4GCZ A;  2XSS A;  4YWZ A;  5DFY A;  4HHD A;  2QHK A;  4Y2F A;  1MC0 A;  2I9V A;  4DJ2 A;  1NLZ A;  4WEJ A;  5MC7 A;  4KUK A;  4EEU A;  2CMN A;  3S7N A;  2W3G A;  3LID A;  3EGX C;  3UB8 A;  4L9F A;  1OT9 A;  4ME4 A;  3C30 A;  4YOF A;  5TBM B;  3SW1 A;  3EWK A;  3T4S A;  2LB5 A;  4HJ3 A;  2EWV A;  5TJJ A;  4B93 A;  3PBQ A;  3BY8 A;  3S7P A;  1ZHH B;  1TS6 A;  5FL3 A;  3F1N B;  2JKT I;  1T1C A;  4GHI B;  4HH3 A;  4LRY C;  1VB6 A;  3UE3 A;  4MDZ A;  2OAP 1;  2L4R A;  2HJ9 C;  2K7S A;  5HL6 A;  4IHQ A;  2GX5 A;  3CUE C;  2VV7 A;  2FH5 A;  3A0V A;  1P9W A;  2Z6D A;  4ETZ A;  2YKH A;  5DJU A;  1D06 A;  4DJ3 A;  2QJ7 A;  4MCW A;  1NRJ A;  3EGD C;  3MF0 A;  5DFX A;  2W1T A;  2KLI A;  3EQU A;  4JGO A;  4BJP A;  3P01 A;  4O01 A;  1G28 A;  2ZOI A;  4PAU A;  1LL8 A;  3K3D A;  5G4Z A;  3H82 A;  3C2W A;  1GSX A;  4O0P A;  2VLG A;  4HY8 A;  4YNR A;  1V9Y A;  2K2N A;  4L0L A;  2IA2 A;  3K2N A;  5HZH A;  1UGU A;  4G3W A;  4R6L A;  3LIB A;  4GS9 A;  2O99 A;  1F5M A;  5F6A A;  2OWH A;  2V9A A;  5AVF A;  3K3C A;  4HJ4 A;  4I5S A;  3S7O A;  5EFW A;  2Z6C A;  2YKF A;  3PBO A;  3OCL A;  4Y5F A;  4BBT A;  1WA9 A;  3R4K A;  3OLO A;  4CLC D;  4HIA A;  4PKY A;  5HDS A;  3BW6 A;  3H9W A;  3PHY A;  3PBS A;  5CX7 A;  5A8B A;  2NUT C;  1MZU A;  3BY9 A;  4EQ1 A;  1TS7 A;  2O9A A;  5HSQ A;  3UB7 A;  4WUJ A;  1F98 A;  4II7 A;  2OAQ 1;  4Q0H A;  2INW A;  3W2Z A;  4GJ4 A;  4NXE A;  4KQD A;  4DN0 A;  1DRM A;  5IT5 A;  3R7W B;  3UB9 A;  3T4J A;  4HOI A;  4Y3I A;  4ARZ A;  2HJE A;  4CLC A;  4Z1W A;  4I3A A;  2J3W A;  5DJT A;  3HCY A;  3FPW A;  3F1P A;  2VV6 A;  5KSH A;  1LSW A;  4RQ9 A;  4L9E A;  4NXB A;  3P7N A;  1DP6 A;  2GZA A;  3UMD A;  2VJW A;  3T4K A;  3G6O A;  4EW7 A;  3D72 A;  1Y28 A;  2B02 A;  3A0R A;  2W3F A;  1NWZ A;  2VX8 A;  3B42 A;  3CIT A;  3H82 B;  3LFV A;  3S7Q A;  3GDI A;  2WKP A;  4BWI A;  2A24 A;  2L0W A;  4DMZ A;  3LIC A;  3H7W B;  1XJ3 A;  4GS9 B;  4UQI S;  1N9L A;  2MJ6 A;  3PBR A;  4OOL A;  3OCN A;  2PD8 A;  1S1Y A;  5AVE A;  1YAX A;  4WEK A;  4H6J B;  5J7E A;  3OBF A;  4IUH A;  4LLO B;  4EER A;  4UEY A;  1P0Z A;  4WN5 A;  4XT2 A;  1YSQ A;  4BBV A;  2JKT M;  4AFI A;  4EEP A;  2XRN A;  1DP8 A;  4HP4 A;  4F3L B;  2ZOH A;  2W1R A;  5HPF A;  3IS2 A;  2PD7 A;  3FG8 A;  1TS8 A;  5I5L A;  4HNB A;  3E4P A;  4JGQ A;  3F1O A;  3FC7 A;  3ICY A;  3PXP A;  3TW8 A;  3VE4 A;  3OOV A;  2W3E A;  3EOI A;  3B47 A;  1X0O A;  4E04 A;  4ARZ B;  4CLC B;  1YKD A;  2HGV A;  4MN7 A;  1GSV A;  3DBA A;  2M1C A;  4ETX A;  2V1B A;  1LSX A;  3KYZ A;  3F1P B;  1STZ A;  3NOU C;  2J3T D;  3O5Y A;  1GSW A;  3PBT A;  4PHT A;  4K08 A;  2O0Y A;  1VHM A;  3BWL A;  3MQQ A;  4JGP A;  1TS0 A;  4R3A A;  1T18 A;  2J80 A;  3KSH A;  2W0N A;  3NHQ A;  1D7E A;  1F9I A;  1UWP X;  2VZW A;  3LI9 A;  3EQV A;  3TRC A;  3MQ0 A;  4CLC E;  2OWJ A;  2ZBB A;  3T4T A;  1P97 A;  2A24 B;  2NUP C;  4BMW A;  1V9Z A;  5K5B A;  3KSI A;  2HF6 A;  3BQ8 A;  2VGL M;  4HQA A;  1N9N A;  3KX0 X;  1W63 Q;  3NOT C;  4KUO A;  1DP9 A;  1OTD A;  3LUQ A;  2PR6 A;  3CLO A;  3E4O A;  4R70 A;  3UME A;  1LSV A;  5HDC A;  5HD3 A;  5F69 A;  2W3H A;  2JKR I;  1TF1 A;  2JKR M;  3MXQ A;  3F1N A;  3GEC A;  2VV8 A;  4EES A;  3KYQ A;  5HD5 A;  1KOU A;  2P7J A;  2VGL S;  4UQI M;  3LIE A;  2P04 A;  1XFN A;  3LIA A;  2H28 A;  3HJI A;  3D3O A;  5HWW A;  3JVU A;  2V0W A;  2W3D A;  3LR5 A;  4NXG A;  5DF9 A;  1T19 A;  2JHE A;  2PYR A;  4I3J A;  1ZTU A;  2W1T B;  4IJG A;  3JVV A;  4HI4 A;  2GNX A;  4I3I A;  1NLY A;  4I39 A;  4KQO A;  3VV4 A;  5F68 A;  3UE6 A;  4EUV A;  3C8C A;  4L9G A;  3MMH A;  1XJ2 A;  3FPV A;  5L8M A;  3E0Y A;  1XJ6 A;  2O9B A;  4LPZ A;  5HWT A;  1G6O A;  3V67 A;  4CLC C;  2PYP A;  2PHY A;  4Q0I A;  3CUE A;  1S66 L;  5HDD A;  1OTE A;  5HPI A;  3ZYT A;  4HP9 A;  3ULF A;  3TE8 A;  2M7V A;  1S4S A;  2QKP A;  4FOF A;  3RTY A;  2V0U A;  4NKP A;  3TJZ C;  5C5K A;  4O8G A;  4WLA A;  2KDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...