3E98A

Crystal structure of a gaf domain containing protein that belongs to pfam duf484 family (pa5279) from pseudomonas aeruginosa at 2.43 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
b'VSLVERQVRLLRERNIEMRHRLSQLMDVARENDRLFDKTRRLVLDLLDATSLEDVVSTVEDSLRHEFQVPYVSLILFSDSSVSVGRSVSSAEAHQAIGGLLSGGKTVCGVLRPHELAFLFGESDRDEIGSAAVVSLSFQGLHGVLAIGSPDPQHYKSSLGTLFLGYVAEVLARVLPRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAF Domain of Unknown Function
molecule tags Unknown function
source organism Pseudomonas aeruginosa
publication title Crystal structure of a GAF Domain with Unknown Function (NP_253966.1) from PSEUDOMONAS AERUGINOSA at 2.43 A resolution
rcsb
total genus 58
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04340 DUF484 Protein of unknown function, DUF484
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3e98A00
3S7QA 4ETZA 4O01A 4G3VA 3C2WA 2O99A 4YNRA 2KOIA 3KSIA 3CITA 3OOVA 3D3OA 4Y3IA 2W1TA 2IA2A 3S7OA 1F5MA 4Q0HA 5DFYA 1MKMA 3MF0A 2QYBA 1VHMA 4MN7A 5HSQA 1TD5A 3G6OA 4Y2FA 2Y8HA 4LRXC 3KO6A 4MMNA 5LBRA 2W3FA 5TJJA 3KSFA 3NHQA 5L8MA 2M7UA 3HCYA 3S7PA 3VV4A 3OBFA 4QPRA 3NOTC 2XSSA 2VEAA 1MC0A 2XRNA 3K2NA 4YOFA 3ZQ5A 4ETXA 4GLQA 3BJNA 4LRZE 2KLIA 2LB9A 2OOLA 3IBRA 2W3HA 4ME4A 4LRYC 3R4KA 3NOUC 4O0PA 3NOPC 3E98A 2W3DA 2VZWA 2O9AA 2K2NA 4BWIA 4EUVA 4CQHA 2W3EA 3LFVA 2VKSA 5C5KA 2GX5A 3DBAA 2XROA 3CI6A 2W3GA 2VJWA 4FOFA 4Y5FA 5DFXA 1YKDA 1YSPA 1ZTUA 4E04A 3MQ0A 4IUHA 4R70A 5K5BA 3KSHA 4Z1WA 1STZA 3S7NA 4ZRRA 4Q0JA 1TF1A 3O5YA 4O8GA 4DMZA 4G3KA 3KSGA 4RQ9A 3RFBA 4G3WA 2K31A 3E0YA 4DN0A 2O0YA 4Q0IA 3IBJA 5HPFA 4R6LA 4GW9A 5I5LA 2HGVA 2O9CA 2W1TB 3W2ZA 4EU0A 2G7UA 3EEAA 2Y79A 5HL6A 4IUKA 2LB5A 4PAUA 4MDZA 1YSQA 2M7VA 4IJGA 2W1RA 3MMHA 2O9BA 2B18A 5AJGA 2ZMFA 4MCWA 5HPIA 3TRCA
chains in the Genus database with same CATH superfamily
2HP5A 1KVMA 3FV7A 4YNRA 5L10A 3U2AA 2VV8A 4KZBA 3UDIA 3LIFA 3BWLA 2XF3A 4ZAMA 2VLGA 5KIZA 2JE5A 4RX2A 5HX9A 1VQQA 1QMEA 4MN5A 3HLGA 1K54A 2IWDA 2Y2GA 4K91A 2DCFA 1L0EA 2Y59A 3HCYA 4OQ0A 2JKTM 1CEGA 5HW3A 3UN7A 5FEGA 2VX8A 2ZD8A 4DE3A 1JVJA 1K6RA 2ZC7A 5M1AA 5CXWA 4YWZA 4EBNA 3TJZC 1MWRA 1QMFA 1YMXA 2ZBBA 3DW0A 2ZQAA 3ULFA 2V0UA 2JKTI 4NK3A 2Y2JA 1BLHA 4LRYC 3R4KA 3D4FA 1PIOA 2W3DA 4DJ3A 2RCXA 2QJ5A 1Q2QA 1F98A 3VP4A 3CI6A 5G18A 4FOFA 3LR5A 4E6WA 5CEBA 2HDUA 2WKEA 5DTTA 3RH8B 5K5BA 4R70A 4WELA 1DJCA 2QHKA 1TF1A 3CJMA 2PHYA 3PHYA 3WS0A 4G3WA 4QU3A 3RTYA 3ZCZA 4E3NA 1ERQA 3VE4A 2W1TB 3BY8A 1OTAA 4DDYA 2J7VA 1XA1A 1L2SA 4BL2A 2XA7S 1MY8A 4QD4A 4K08A 4DXCA 4S2IA 1LLBA 1YT4A 1T1AA 2P9VB 1XKZA 3N8LA 1ACFA 3BY9A 3NJAA 2WKPA 5DFYA 1BLCA 2X01A 3T50A 4WL9A 3SS3A 3UMDA 3LCEA 3C7UA 4DF6A 1H8YA 2ZQ9A 4HBUA 4MLLA 4R3BA 1KE3A 3QHYA 5TJJA 4IHQA 4BQMA 5F5YA 5L8MA 1DJBA 4BENA 4Q8IA 4B93A 2XRNA 2ZC4B 2HPBA 3T1QB 4WYYA 3PBNA 4OONA 3V5MA 2XGNA 3I7JA 3T4JA 1IKIA 3WS2A 4EQIA 3N7WA 4S2LA 4ME4A 4M3KA 3HLBA 4X55A 1ONHA 2JHEA 2O9AA 1FSYA 3VP3A 4CQHA 5A91A 1G68A 1XA7A 5DTSA 1DP9A 3T4OA 2FH5A 4MNRA 4ZJ3A 3T12B 5FEFA 1N4OA 4Q0JA 4JGRA 4LENA 5E2GA 1EROA 1D06A 3BLSA 3UB7A 4LV3A 3JVUA 4DE0A 3SH8A 1AWIA 1LL9A 1W8YA 2O9CA 3LR3A 5A8BA 1OPXA 2G7UA 3EEAA 3MFXA 1NYMA 2X02A 3LY4A 4AFIA 5TBMA 1K0KA 2O9BA 3SH9A 4Y17A 1MXOA 5M18A 4UA7A 4DRTA 4E6XA 3DTMA 5GLBA 3LI8A 1XFNA 3BQAA 1CQAA 2PU4A 4BBUA 3BFFA 1EW0A 4UQIS 2WGWA 3KO6A 4EEPA 5LBRA 3GTCA 2KX6A 5HZHA 3B47A 3VE3A 1F2KA 3T1SA 3T4QA 1SKFA 2ZC6B 1K55C 4NG2A 3G2ZA 3A3FA 1OJ5A 1XP4A 4A5RA 3BJNA 5CGXA 2WAEA 4B4ZA 4EWFA 3IXDA 2A3UA 1PI5A 2W3HA 2AVXA 2KDKA 5EM1A 3TOIA 3HJIA 4BWIA 3T4TA 2H0YA 2VK3A 2WUQA 2VV6A 4X69A 2XROA 4H6JA 3O87A 2R9WA 3BFDA 1PWGA 1FQGA 1GSXA 3IH9A 4JPMA 4GD8A 1CK3A 1ZHHB 4X56A 3LEZA 3SS5A 3GR2A 4HQAA 4DN0A 4EU0A 4MEZA 5EVEA 4JF6A 3HLDA 3P98A 4HP9A 4X25A 5AJGA 2Y2QA 1TS8A 4G3VA 4L9EA 1W63Q 3C2WA 3KSIA 3UNWA 1K6SA 3CITA 4X1LA 3ZNYA 2V8CA 4OKPA 1E3UA 3CLOA 3DTKA 1Y4OA 1JWZA 4UEYA 3C8CA 3P01A 3F1OB 1TDGA 3TW8A 2J80A 3D72A 4EEUA 2OSUA 1ZC2A 3EQVA 1SHVA 5HDCA 1G6AA 4QB8A 2QZ6A 2Y2IA 3IF6B 2BLSA 3QP1A 4UQIM 2JKRI 3OPLA 1MWUA 2Z2MB 3OPHA 5FQMA 2WKRA 3VSLA 3T1RA 2VGLM 2EX9A 3IBRA 2ZQ7A 1PFLA 5TR7A 3FG8A 2PD8A 3NOUC 3LEQA 2WADA 4L9GA 4GB7A 4PKYA 3KYQA 1IYPA 3MSHA 3NULA 1I2WA 2NUPC 3ZG5A 4EV4A 1BTLA 2A49A 3HLFA 5DFXA 4E04A 3MQ0A 2HP9A 1Y28A 5EOEA 3UE0A 1FCMA 3UB9A 4LGWA 5A93A 1MBLA 2ZLYA 1KE0A 2GJ3A 2K31A 3E0YA 5FDSA 3IBJA 4OP5A 1YLTA 1L0DA 5EVIC 4PAUA 2NUTC 3PR6A 4GD6A 3C5AA 2ZM8A 1KDWA 2QMIA 2PT7A 1ES3A 3E2LA 3EOIA 4HP4A 2HV1A 4PKYG 1ZG4A 3P7NA 1SCWA 4IBRA 1ES5A 1YAXA 3NDGA 1A0KA 2ZMVA 2UWXA 4U3TA 4CPKA 4H8RA 5HWWA 1TEMA 3C7VA 5E2HA 3MS6A 3NHQA 1OMEA 5CHMA 3UPOA 1K57C 4RX3A 5L2FA 1P97A 3ZQ5A 5CX7A 1NXYA 4Y13A 4N9LA 3C4PA 1NY0A 1CF0A 4WZ5C 2PAVP 3NC8A 3ZGAB 3CUEC 3A3DA 5HD5A 5HAQA 1L3LA 2Q9MA 2VZWA 4OPRA 2IWBA 3DBAA 2Z6DA 3KSHA 4OPYA 2V0WA 4OPZA 2OLUA 4ZRRA 1GHPA 4P85A 3E4PA 5EPHA 3EEHA 3VOZA 4DMZA 4I3AA 3IX3A 1S1YA 3ZG7B 4HEFA 2V1BA 4HBTA 4KZ8A 5FI2A 3R7WA 1ES4A 3MMHA 5DVAA 5HPIA 5F6AA 4WM9A 1FIKA 2ZC5B 3UB8A 3JYIA 4KQOA 2GDNA 3S7OA 4EETB 5CERA 3F1PB 5GLDA 2PBYA 4MMNA 2WYXA 1ONGA 4JXWA 2WZXA 1OJGA 5GL9A 2Q0OA 2M7UA 1MWTA 3TG9A 4R4RA 4JGPA 4GHIA 2HJEA 1JTDA 4CLCD 2X71A 1U60A 4NXGA 2OLVA 3CWFA 4OQGA 5HD3A 5U47A 4PM7A 3KYEA 4LCMA 2XQZA 4C6YA 1UGUA 3GSGA 4GN2A 3NOPC 4KG2A 2A2LA 3AGEA 3E98A 4JXSA 3LFVA 4CLCC 2A24A 1BUEA 1S66L 1BSGA 4ARZB 2VGLS 2VGKA 1T1CA 3CG5A 3PBOA 3CHWP 1RP5A 4R4SA 2CMNA 4O8GA 4WEJA 3HUNA 1NLZA 1PWDA 2Y2NA 2QPNA 4ID4A 5HAIA 4FD8A 4GW9A 4X53A 2ZOHA 4YINA 5HARA 3OCLA 4HJ6A 4NKPA 1PZOA 4UA9A 1LSVA 2H5SA 2M7VA 1DY6A 2B18A 4LCLA 2Y2PA 3GV9A 1LSXA 2H0TA 4KZAA 2DMWA 2WKIA 4S2NA 2EFXA 2IA2A 1S1ZA 3N8RA 4PM9A 2ZMAA 1OT6A 2QYBA 3FPWA 1NJ4A 3QP5A 4Y0TA 1NZOA 4KZ9A 3UPNA 4DE2A 1KGGA 3BYDA 3VMAA 3PBSA 3NDEA 2W0NA 2XA7M 5J8XA 3S7PA 5J3WA 4C75A 3IF5A 5FAOA 1UWPX 3UE1A 3BFCA 3MQOA 5FSRA 4HI4A 4BJPA 3JVVA 3P09A 4OLGA 4EQ1A 2Y2MA 2HJ9C 4K0XA 1YLZA 3V50A 3PBQA 1YLJA 5TGFA 3UMEA 2W3GA 5HL1A 3UPPA 1XFQA 2VGJA 2XEPA 1H3QA 1XJ4A 5FL3A 4KQDA 3V67A 3IHBA 5F68A 3F1NB 2JBFA 4N1XA 3KSGA 5DJTA 4RQ9A 3BECA 3O86A 1EWZA 3F1PA 5CRFA 2D02A 2V1ZA 5EV0A 4GOGA 2BG1A 3SH7A 1N9LA 5TFQA 1KE4A 1YQSA 4PM8A 2Y55A 4MDZA 4LV2A 5EVIA 2ZMFA 1GHMA 3AGDA 4KZ3A 4FSFA 3TRCA 4FH2A 3HUMA 3MXRA 4F3LA 5HDSA 2WK0A 3OOVA 5FQIA 3G30A 2JKFA 3MF0A 3C4OA 3W4OA 3MXSA 5DF7A 4D60A 4GJ4A 3A0SA 3ZVWA 4FUWA 4BL3A 4OQHA 2L0WA 4BLMA 2L4RA 5HWVA 4KZ6A 3UE6A 1OTEA 5D3OA 4LV0A 3OLOA 2HDQA 3IWOA 4R0QA 3SW1A 3GRJA 4ZBEA 1HZOA 5J4EA 4K0WA 2J8YA 1H8MA 3HLCA 4O7DA 3S22A 2JN7A 1RCJA 3LY3A 5GLCA 4WZ5A 3EQUA 2DRWA 4CLCA 3Q7VA 5E2FA 2PYRA 1L0FA 4OPQA 3UE3A 4GNUA 2V8FA 2VKSA 5F69A 1FOFA 4P6ZS 3FKVA 3WWXA 5EOOA 3BLMA 1T18A 4E3MA 2HDRA 1WYCA 1MPLA 3C38A 1SKOB 5CGWA 3CUEA 2FFYA 4S2KA 4IVKA 4JKTA 4HNBA 4F94A 4Q0IA 4R6LA 4QY5A 2HGVA 3W2ZA 2CC1A 3W8KA 3IX4A 3DWZA 1HD8A 4HH2A 2LB5A 4I38A 1FILA 3TSGA 5IU1A 3SOIA 5G4YA 1XJ6A 1MZUA 2YKHA 4BBVA 3G35A 3SZTA 3PBRA 3T1XA 3FWLA 2WZZA 4Q0HA 1D7EA 2Q9NA 1SKOA 5HSQA 3MR0A 2EFUA 2ZOIA 4I39A 5FATA 5DJUA 2Y8HA 2HDSA 4NETA 5A92A 3CZDA 3NIAA 1JWVA 3H7WA 1PNEA 1P0ZA 4GS9B 2ZM2A 5FA7A 1IELA 4B88A 2VEAA 4P87A 1ES2A 1W5DA 1G5UA 4KUKA 1S4RA 4ZJ1A 2G2WA 3Q81A 4Y15A 3PBTA 2GNXA 3BFEA 4KZ7A 3OPPA 1M6KA 1KGEA 2XH9A 3FC7A 3M6BA 3H7WB 4E3IA 1JNUA 1NYYA 2ZM0A 1CJFA 4WN5A 4IVIA 1YMSA 1LI9A 2D01A 1PYYA 1VEUA 4S2JA 1BYWA 5GHZA 4G3KA 1BLSA 1YM1A 3MKEA 1IOUA 1EI5A 2ZQCA 1TS7A 2QWSA 3LGOA 5HFOA 3K3DA 4PM5A 3PAEA 5GHXA 1V9ZA 2RL3A 3ZG9B 4XUZA 4OP8A 1IFQA 3S7QA 4PMAA 5L09A 4HOIA 3OPRA 1Z09A 3M6HA 3OCNA 1VHMA 3HBRA 1VETA 1ZKJA 3NY4A 5FASA 2Y4AA 1BZAA 4OOLA 5A90A 2DNSA 4H6JB 3UDFA 3VP2A 5CTNA 4HESA 4CLCE 1FSWA 5AVEA 2J9OA 4CLCB 4Y0UA 5CTMA 2W27A 3UB6A 3C30A 3QP6A 2E8JA 3ZFZA 4O0PA 4WLAA 1KVLA 1RGZA 1YPRA 1DJAA 1BULA 2W3EA 1GSWA 3ISGA 1H5XA 1RGYA 3SS4A 1K4EA 1LL8A 5CHUA 1K38A 1NRJA 4Z1WA 1HLUP 2PYPA 1DP6A 2G2UA 1IYSA 5AQ9A 4BBTA 3GECA 2JC7A 3D9YA 5E43A 3HUOA 1C3BA 3IHAA 3Q7ZA 5I5LA 4N1HA 3HLWA 3JPUA 4R3AA 3B42A 3IQAA 1O7EA 4EXOA 1I5QA 4DXBA 4B4XA 1K25A 4DKIA 4FH4A 4QJGA 3B3XA 1LHYA 5TBMB 5FQ9A 3NCKA 1TVFA 2R78A 4JGOA 1O07A 3Q1FA 3F1NA 4RA7A 5GHYA 1YLWA 5JYPA 4GZBA 3MJQA 4NXEA 4S2MA 1XGJA 3VFHA 4LRXC 1SDEA 3G31A 3MKFA 5EUAA 1GHIA 3S4XA 4HY8A 2OWHA 5EVID 5EE8A 1T1BA 4XT2B 3OZHA 5FI6A 3CPTB 2HF6A 2J3TC 2PD7A 2P7JA 4LV1A 4OOMA 2Y2KA 1XX2A 4ZDXA 2XD5A 3K3CA 1OTDA 4EERA 4QY6A 4FTXA 2XFTA 1ALQA 1J3WA 1P9WA 3A0VA 3CPTA 5CGSA 2XDMA 2K2NA 3G2YA 1ESUA 5EVLA 3LICA 1XGIA 4M4XA 2VJWA 3E2KA 2Y2HA 3QNBA 3LR0A 2EX2A 3M2JA 3DTIA 4EBLA 1KDSA 5HPFA 2EX8A 1NZUA 3TE8A 1ZG6A 2JKRM 1H0MA 2YKFA 1K57A 3GQZA 1FCNA 5J7EA 3FKWA 5IT5A 1G6OA 4YFMA 1D1JA 2R9XA 2V2FF 3R7WB 4ETZA 1XXMA 3GVBA 3VOLA 2KOIA 4EUZA 3D3OA 4PHTA 3MZEA 3VOYA 4XT2A 3VSKA 4LFUA 4ARZA 1W7FA 2QKPA 3B33A 1FCOA 3KSFA 1WE4A 4GHIB 3EWKA 4KQQA 3T4KA 1UWNX 2C5WB 3O88A 4JF4A 4MBHA 2V20A 1VB6A 1MC0A 3V3SA 1H8ZA 2GZAA 4ZTKA 3N4IA 5DKKA 3K2NA 1I2SA 2B95A 3WS1A 4JXGA 4ETXA 4JXVA 2VV7A 1E25A 4PM6A 4HJ3A 1N9NA 2UV0E 3RXWA 2XD1A 3KX0X 3W4QA 4KZ5A 4BD0A 3ZVTA 3FYZA 3IS2B 3PTEA 2GX5A 1JWPA 2EWWA 1E4DA 4QHCA 3U4LP 3IF6C 3OC2A 1LL5A 2BASA 1VETB 4LPZA 4IUHA 4II7A 3A0RA 3N8SA 1K55A 3S7NA 4XXRA 4E3OA 2JKGA 1Y54A 3QNCA 3O5YA 2ZC3B 1M40A 3S1YA 2MJ6A 2PR5A 3H82B 5DF8A 4X68A 4LLOB 3M2KA 4U0TA 3ZDJA 2O0YA 2WKHA 4BD1A 5FAPA 1FR6A 1S67L 4P6BA 4NXBA 2EWVA 2OV5A 3LUQA 4L0LA 4GKUA 4S2NC 4IJGA 3G32A 2JCHA 1YLYA 1ODVA 1JTGA 5FAQA 4Y3IA 2B02A 1Z6FA 1HVBA 4OLDA 1GA9A 5F83A 1NRFA 4S2PA 3ZG0A 2QJ7A 1XJ3A 4DDSA 1TS0A 3LIAA 1TD5A 3VP0A 4NXFA 3BFGA 1DRMA 3E4QA 3LO7A 5BOHA 4R3JA 3G34A 3DAVA 4JBFA 3UB5P 3ZNTA 3LIBA 4QPRA 2PU2A 5DF9A 3NOTC 5E2EA 2ZQDA 2XSSA 4HIAA 5HWTA 4I5SA 1Q2PA 1WA9A 2Y2LA 4YOFA 3NBLA 1PW8A 3LIDA 5KZHA 2PDRA 2PBDP 2Z6CA 3PYPA 3WS4A 3H9WA 1P9RA 2IWCA 3NECA 4Z9QA 1GA0A 4I3IA 4MBFA 1FR1A 3IWQA 4E3LA 3IX8A 1LT0A 4GS9A 4WEKA 1G28A 1CEFA 3ZG8B 3IH8A 4XUXA 2EXBA 5HDDA 3IWIA 2PR6A 1YSPA 4B9OA 4GDBA 5AQBA 4OQIA 3A3EA 2FZ0A 2ZJ9A 4GDNA 4MN6A 5DKLA 3BQ8A 4WMCD 4EBPA 1VEUB 2J3TD 3EGXC 1XJ2A 5CHJA 5M19A 3RFBA 5F1FA 1X0OA 4WBGA 1CI8A 5KMWA 2L1MA 4WZ4A 2EXAA 2Y79A 5FQJA 3GDIA 4IUKA 1J9MA 4R1GA 3DWKA 5CEDA 2Y91A 3ICYA 3BRMA 1IYQA 5MC7A 2FFFB 1PW1A 4MBKA 3HVFA 2ZL1B 2O99A 5IS1A 4UA6A 3V39A 1F5MA 3FZCA 1MKMA 3LYXA 4MN7A 2H10A 2C6WB 3ITBA 4KG6A 3G6OA 4D2OA 1KGFA 4Y2FA 1SDNA 5G4ZA 4QWOA 4IBXA 5GLAA 3WRZA 1K56D 5DTKA 3OBFA 4OVDA 4JGQA 3Q7VB 1AXBA 2I9VA 2XFSA 3W4PA 3E4OA 1W8QA 4GLQA 3N6IA 2XK1A 4KG5A 4U0XA 2LB9A 2INWA 4UAAA 4UHUA 4PPRA 2E8IA 2H28A 3IF6A 2EX6A 3V3RA 5FDHA 5C5KA 3UY6A 3QP8A 2V1AA 3F1OA 4Y5FA 1IYOA 3VFFA 3H82A 1ZTUA 5AQ7A 1CI9A 2V9AA 1K56A 1V9YA 1TDLA 2Z2LB 1OTIA 3LI9A 2B5RA 4E3JA 4F3LB 1GCEA 4C3QA 3NI9A 3Q82A 4Y0OA 1DP8A 3IS2A 5HL6A 5EVIB 2WKQA 5L07A 3QP2A 5F82A 1HTZA 3DTEA 4WUJA 4MCWA 3RJUA 4R38A 4HH3A 4S2OA 5FQQA 2WGIA 1S6RA 3QP4A 1N9BA 2HZ5A 1ESIA 3UDXA 4HJ4A 3ITAA 1TS6A 4E3KA 1F9IA 3CAXA 1N9OA 3FPVA 1W79A 2M1CA 2P04A 3RXXA 4DJ2A 3HREA 1IKGA 4WF0A 1LSWA 4RYEA 4WMCA 4JLFA 1S4SA 1YLPA 2WGWB 4X6TA 2K7SA 1MKIA 1PI4A 5FI7A 2WAFA 4OH0A 3A3JA 1OT9A 2OOLA 1K54C 3EGDC 4P6ZM 5KSCA 1OTBA 1S0WA 4BMWA 4EUVA 4DE1A 2P08A 4JF5A 3AGFA 1STZA 3PXPA 5JYOA 3Q07A 4NEED 2WGVA 3CMZA 2BTFP 3L9KA 3MQQA 3HLEA 5AQAA 2OAQ1 4KZ4A 3LR4A 3MFDA 4ZJ2A 1W63M 1PZPA 2PRFA 5IHVA 2ACGA 2ZL1A 3HL9A 2I72A 3BW6A 4L9FA 2ZQ8A 2W1RA 3PAGA 4R23A 3IXGA 5KSHA 4O01A 3KYZA 3MXQA 4IEDA 2EA9A 2W1TA 1NWZA 4CJNA 2Y2OA 4KUOA 3LIEA 3WRTA 4N92A 1MWSA 4I3JA 2VA0A 1PRQA 3O3VA 2W3FA 3IT9A 3IXBA 4KENB 3T4SA 3VV4A 2J9PA 2HP6A 3T4LA 2P74A 1XPBA 1IEMA 4GCZA 4LRZE 2KLIA 3ZYTA 5EFWA 2OWJA 3BM6A 4X1MA 2P9VA 3MBZA 3G4PA 4RVAA 5EECA 3HJKA 5EM0A 1LI0A 1VM1A 4ESPA 4KQRA 4P0MA 3L7HA 4EW7A 1KOUA 1SZVA 3IXHA 5CECA 5I94A 1WYBA 3WS5A 1YKDA 5HAPA 1NLYA 3GMWA 1PWCA 1BLPA 3UO9A 3VP1A 2XR0A 5FQKA 3MZFA 1L0GA 4OOYA 3A3IA 1ERMA 1BT5A 2A24B 4N9KA 1E3UD 1K4FA 2J3WA 2XLNA 3MZDA 5AVFA 4HHDA 1YSQA 4EESA 3BEBA 2OAP1 3ZHHA 1GSVA 5F1GA 4FCFA 4Y7PA 1T19A
chains in the Genus database with same CATH topology
1XJ6A 1MZUA 1ODVA 2YKHA 1YAXA 4BBVA 4YNRA 3PBRA 2ZMVA 3U2AA 4Y3IA 2VV8A 2B02A 3LIFA 3BWLA 4Q0HA 2QJ7A 2VLGA 1D7EA 1XJ3A 5HWWA 1TS0A 3LIAA 5HSQA 3MR0A 5KIZA 1TD5A 4I39A 2ZOIA 4NXFA 4MN5A 5DJUA 2Y8HA 1DRMA 3E4QA 3NHQA 3HCYA 3H7WA 4GS9B 1P0ZA 2JKTM 3LIBA 4QPRA 5DF9A 3NOTC 2VX8A 2XSSA 4HIAA 5HWTA 2VEAA 4I5SA 1P97A 1WA9A 4YOFA 3ZQ5A 5CX7A 4KUKA 4YWZA 3LIDA 1S4RA 2PDRA 3TJZC 2Z6CA 2ZBBA 3CUEC 3ULFA 3PBTA 2GNXA 3PYPA 2V0UA 2JKTI 5HD5A 3H9WA 1P9RA 4LRYC 4I3IA 3R4KA 2W3DA 3FC7A 1LT0A 2VZWA 4GS9A 4WEKA 3H7WB 4DJ3A 1G28A 2QJ5A 1JNUA 1F98A 3DBAA 3CI6A 2Z6DA 5HDDA 2PR6A 4FOFA 3LR5A 1YSPA 4B9OA 4WN5A 3RH8B 5K5BA 4R70A 4WELA 3KSHA 2D01A 2V0WA 2FZ0A 4MN6A 5DKLA 3BQ8A 2QHKA 4ZRRA 3EGXC 2J3TD 3E4PA 1TF1A 3EEHA 1BYWA 4DMZA 1XJ2A 4G3KA 2PHYA 3PHYA 4I3AA 3RFBA 1X0OA 4G3WA 3RTYA 1S1YA 1IOUA 3VE4A 1TS7A 2QWSA 2W1TB 3BY8A 1OTAA 2L1MA 2V1BA 2Y79A 3GDIA 3K3DA 4IUKA 2XA7S 3R7WA 4K08A 3MMHA 1V9ZA 3ICYA 5HPIA 5F6AA 5MC7A 1IFQA 3S7QA 2O99A 3UB8A 1T1AA 4KQOA 5IS1A 4HOIA 3BY9A 3NJAA 3S7OA 1F5MA 2WKPA 4EETB 5DFYA 1MKMA 3F1PB 3T50A 3OCNA 4WL9A 3UMDA 1VHMA 3LYXA 4MN7A 3G6OA 4Y2FA 4MMNA 5G4ZA 5TJJA 4IHQA 1OJGA 5F5YA 5L8MA 2M7UA 4OOLA 4JGPA 3OBFA 4GHIA 4JGQA 4H6JB 4B93A 2HJEA 2XRNA 4CLCE 5AVEA 2I9VA 4CLCD 4CLCB 3E4OA 4NXGA 3CWFA 3PBNA 4GLQA 5HD3A 2W27A 2LB9A 2INWA 3T4JA 3UB6A 3C30A 4ME4A 1UGUA 2H28A 4O0PA 3NOPC 2A2LA 3E98A 4WLAA 2JHEA 2O9AA 4CQHA 2W3EA 3LFVA 5C5KA 1GSWA 2A24A 4CLCC 1DP9A 3T4OA 1S66L 2FH5A 2V1AA 3F1OA 4Y5FA 1LL8A 4ARZB 3H82A 2VGLS 1ZTUA 1NRJA 4Z1WA 2PYPA 1DP6A 1T1CA 3PBOA 4Q0JA 4JGRA 2V9AA 4BBTA 1D06A 3GECA 2CMNA 1V9YA 4O8GA 3UB7A 1OTIA 3JVUA 4WEJA 3LI9A 4F3LB 1NLZA 4GW9A 5I5LA 2O9CA 3LR3A 4R3AA 5A8BA 3B42A 1OPXA 2G7UA 2ZOHA 3EEAA 1DP8A 3IS2A 5HL6A 3MFXA 4EXOA 3OCLA 4HJ6A 2WKQA 4NKPA 4AFIA 5TBMA 1LSVA 2M7VA 2O9BA 2B18A 4WUJA 4MCWA 4R38A 4HH3A 1LSXA 5TBMB 2R78A 4JGOA 2DMWA 3F1NA 2IA2A 3LI8A 1XFNA 1S1ZA 3BQAA 4HJ4A 1OT6A 2QYBA 3FPWA 3MJQA 1TS6A 1F9IA 3CAXA 4BBUA 4NXEA 1N9OA 3FPVA 1EW0A 4UQIS 4LRXC 2M1CA 3KO6A 4EEPA 5LBRA 2KX6A 2P04A 3PBSA 5HZHA 3B47A 5G4YA 3VE3A 2W0NA 2XA7M 4HY8A 3S7PA 4DJ2A 5J3WA 2OWHA 4WF0A 1LSWA 1UWPX 1T1BA 3T4QA 4XT2B 1S4SA 2HF6A 3MQOA 2J3TC 2PD7A 2P7JA 4HI4A 4OOMA 2K7SA 4BJPA 1OJ5A 3BJNA 3JVVA 3K3CA 1OTDA 4EERA 1OT9A 4EQ1A 2OOLA 2W3HA 1P9WA 3A0VA 3EGDC 2KDKA 4P6ZM 2HJ9C 3HJIA 3PBQA 2K2NA 1OTBA 3T4TA 4BMWA 4BWIA 4EUVA 3UMEA 2VV6A 2P08A 3LICA 2XROA 4H6JA 4M4XA 2W3GA 2VJWA 1XFQA 3LR0A 1H3QA 1XJ4A 5FL3A 1STZA 4KQDA 3PXPA 3V67A 5F68A 1GSXA 3F1NB 4NEED 3MQQA 3KSGA 5DJTA 1ZHHB 4RQ9A 2OAQ1 3F1PA 2D02A 4HQAA 4DN0A 3LR4A 5HPFA 4EU0A 1W63M 1N9LA 3TE8A 2JKRM 2YKFA 4HP9A 4MDZA 3BW6A 4L9FA 2W1RA 5J7EA 5AJGA 2ZMFA 1G6OA 5IT5A 5KSHA 4FSFA 3TRCA 3R7WB 1TS8A 4ETZA 4O01A 3KYZA 4G3VA 4L9EA 3VOLA 1W63Q 3C2WA 2KOIA 4F3LA 3MXQA 3KSIA 5HDSA 3CITA 3OOVA 3D3OA 2EA9A 2W1TA 1NWZA 4PHTA 3MF0A 4KUOA 3LIEA 3CLOA 4XT2A 4GJ4A 4I3JA 3A0SA 4UEYA 3C8CA 3P01A 2VA0A 4ARZA 2L0WA 3F1OB 2QKPA 3B33A 3TW8A 2W3FA 2J80A 3D72A 3KSFA 2L4RA 4GHIB 5HWVA 3EWKA 3UE6A 4EEUA 1OTEA 3EQVA 1UWNX 3T4KA 3T4SA 3VV4A 5HDCA 3OLOA 3SW1A 1VB6A 1MC0A 2GZAA 4UQIM 2JKRI 5DKKA 3T4LA 3K2NA 4ETXA 2WKRA 5J4EA 4GCZA 1H8MA 4LRZE 2VGLM 2VV7A 2KLIA 2JN7A 3ZYTA 4HJ3A 1N9NA 5EFWA 3IBRA 3EQUA 2OWJA 4CLCA 3KX0X 3FG8A 2PD8A 3NOUC 3HJKA 4L9GA 2PYRA 4PKYA 3UE3A 3IS2B 3KYQA 2VKSA 2GX5A 2EWWA 5F69A 4EW7A 1KOUA 2NUPC 3OC2A 1YKDA 5DFXA 4P6ZS 2BASA 1NLYA 4LPZA 4E04A 3MQ0A 4IUHA 4II7A 3A0RA 1Y28A 3S7NA 3UB9A 3O5YA 1T18A 2MJ6A 3C38A 2PR5A 3H82B 3CUEA 2GJ3A 4LLOB 2K31A 3E0YA 4HNBA 2O0YA 4Q0IA 3IBJA 4R6LA 2A24B 2HGVA 3W2ZA 2J3WA 4HH2A 1S67L 2LB5A 4PAUA 4NXBA 2EWVA 3LUQA 2NUTC 3PR6A 4L0LA 4HHDA 5AVFA 1YSQA 4I38A 4IJGA 4EESA 2PT7A 3EOIA 4HP4A 2OAP1 2HV1A 1GSVA 5IU1A 4PKYG 3P7NA 1T19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7Q A;  4ETZ A;  4O01 A;  4G3V A;  3C2W A;  2O99 A;  4YNR A;  2KOI A;  3KSI A;  3CIT A;  3OOV A;  3D3O A;  4Y3I A;  2W1T A;  2IA2 A;  3S7O A;  1F5M A;  4Q0H A;  5DFY A;  1MKM A;  3MF0 A;  2QYB A;  1VHM A;  4MN7 A;  5HSQ A;  1TD5 A;  3G6O A;  4Y2F A;  2Y8H A;  4LRX C;  3KO6 A;  4MMN A;  5LBR A;  2W3F A;  5TJJ A;  3KSF A;  3NHQ A;  5L8M A;  2M7U A;  3HCY A;  3S7P A;  3VV4 A;  3OBF A;  4QPR A;  3NOT C;  2XSS A;  2VEA A;  1MC0 A;  2XRN A;  3K2N A;  4YOF A;  3ZQ5 A;  4ETX A;  4GLQ A;  3BJN A;  4LRZ E;  2KLI A;  2LB9 A;  2OOL A;  3IBR A;  2W3H A;  4ME4 A;  4LRY C;  3R4K A;  3NOU C;  4O0P A;  3NOP C;  3E98 A;  2W3D A;  2VZW A;  2O9A A;  2K2N A;  4BWI A;  4EUV A;  4CQH A;  2W3E A;  3LFV A;  2VKS A;  5C5K A;  2GX5 A;  3DBA A;  2XRO A;  3CI6 A;  2W3G A;  2VJW A;  4FOF A;  4Y5F A;  5DFX A;  1YKD A;  1YSP A;  1ZTU A;  4E04 A;  3MQ0 A;  4IUH A;  4R70 A;  5K5B A;  3KSH A;  4Z1W A;  1STZ A;  3S7N A;  4ZRR A;  4Q0J A;  1TF1 A;  3O5Y A;  4O8G A;  4DMZ A;  4G3K A;  3KSG A;  4RQ9 A;  3RFB A;  4G3W A;  2K31 A;  3E0Y A;  4DN0 A;  2O0Y A;  4Q0I A;  3IBJ A;  5HPF A;  4R6L A;  4GW9 A;  5I5L A;  2HGV A;  2O9C A;  2W1T B;  3W2Z A;  4EU0 A;  2G7U A;  3EEA A;  2Y79 A;  5HL6 A;  4IUK A;  2LB5 A;  4PAU A;  4MDZ A;  1YSQ A;  2M7V A;  4IJG A;  2W1R A;  3MMH A;  2O9B A;  2B18 A;  5AJG A;  2ZMF A;  4MCW A;  5HPI A;  3TRC A; 
#chains in the Genus database with same CATH topology
 2HP5 A;  1KVM A;  3FV7 A;  4YNR A;  5L10 A;  3U2A A;  2VV8 A;  4KZB A;  3UDI A;  3LIF A;  3BWL A;  2XF3 A;  4ZAM A;  2VLG A;  5KIZ A;  2JE5 A;  4RX2 A;  5HX9 A;  1VQQ A;  1QME A;  4MN5 A;  3HLG A;  1K54 A;  2IWD A;  2Y2G A;  4K91 A;  2DCF A;  1L0E A;  2Y59 A;  3HCY A;  4OQ0 A;  2JKT M;  1CEG A;  5HW3 A;  3UN7 A;  5FEG A;  2VX8 A;  2ZD8 A;  4DE3 A;  1JVJ A;  1K6R A;  2ZC7 A;  5M1A A;  5CXW A;  4YWZ A;  4EBN A;  3TJZ C;  1MWR A;  1QMF A;  1YMX A;  2ZBB A;  3DW0 A;  2ZQA A;  3ULF A;  2V0U A;  2JKT I;  4NK3 A;  2Y2J A;  1BLH A;  4LRY C;  3R4K A;  3D4F A;  1PIO A;  2W3D A;  4DJ3 A;  2RCX A;  2QJ5 A;  1Q2Q A;  1F98 A;  3VP4 A;  3CI6 A;  5G18 A;  4FOF A;  3LR5 A;  4E6W A;  5CEB A;  2HDU A;  2WKE A;  5DTT A;  3RH8 B;  5K5B A;  4R70 A;  4WEL A;  1DJC A;  2QHK A;  1TF1 A;  3CJM A;  2PHY A;  3PHY A;  3WS0 A;  4G3W A;  4QU3 A;  3RTY A;  3ZCZ A;  4E3N A;  1ERQ A;  3VE4 A;  2W1T B;  3BY8 A;  1OTA A;  4DDY A;  2J7V A;  1XA1 A;  1L2S A;  4BL2 A;  2XA7 S;  1MY8 A;  4QD4 A;  4K08 A;  4DXC A;  4S2I A;  1LLB A;  1YT4 A;  1T1A A;  2P9V B;  1XKZ A;  3N8L A;  1ACF A;  3BY9 A;  3NJA A;  2WKP A;  5DFY A;  1BLC A;  2X01 A;  3T50 A;  4WL9 A;  3SS3 A;  3UMD A;  3LCE A;  3C7U A;  4DF6 A;  1H8Y A;  2ZQ9 A;  4HBU A;  4MLL A;  4R3B A;  1KE3 A;  3QHY A;  5TJJ A;  4IHQ A;  4BQM A;  5F5Y A;  5L8M A;  1DJB A;  4BEN A;  4Q8I A;  4B93 A;  2XRN A;  2ZC4 B;  2HPB A;  3T1Q B;  4WYY A;  3PBN A;  4OON A;  3V5M A;  2XGN A;  3I7J A;  3T4J A;  1IKI A;  3WS2 A;  4EQI A;  3N7W A;  4S2L A;  4ME4 A;  4M3K A;  3HLB A;  4X55 A;  1ONH A;  2JHE A;  2O9A A;  1FSY A;  3VP3 A;  4CQH A;  5A91 A;  1G68 A;  1XA7 A;  5DTS A;  1DP9 A;  3T4O A;  2FH5 A;  4MNR A;  4ZJ3 A;  3T12 B;  5FEF A;  1N4O A;  4Q0J A;  4JGR A;  4LEN A;  5E2G A;  1ERO A;  1D06 A;  3BLS A;  3UB7 A;  4LV3 A;  3JVU A;  4DE0 A;  3SH8 A;  1AWI A;  1LL9 A;  1W8Y A;  2O9C A;  3LR3 A;  5A8B A;  1OPX A;  2G7U A;  3EEA A;  3MFX A;  1NYM A;  2X02 A;  3LY4 A;  4AFI A;  5TBM A;  1K0K A;  2O9B A;  3SH9 A;  4Y17 A;  1MXO A;  5M18 A;  4UA7 A;  4DRT A;  4E6X A;  3DTM A;  5GLB A;  3LI8 A;  1XFN A;  3BQA A;  1CQA A;  2PU4 A;  4BBU A;  3BFF A;  1EW0 A;  4UQI S;  2WGW A;  3KO6 A;  4EEP A;  5LBR A;  3GTC A;  2KX6 A;  5HZH A;  3B47 A;  3VE3 A;  1F2K A;  3T1S A;  3T4Q A;  1SKF A;  2ZC6 B;  1K55 C;  4NG2 A;  3G2Z A;  3A3F A;  1OJ5 A;  1XP4 A;  4A5R A;  3BJN A;  5CGX A;  2WAE A;  4B4Z A;  4EWF A;  3IXD A;  2A3U A;  1PI5 A;  2W3H A;  2AVX A;  2KDK A;  5EM1 A;  3TOI A;  3HJI A;  4BWI A;  3T4T A;  2H0Y A;  2VK3 A;  2WUQ A;  2VV6 A;  4X69 A;  2XRO A;  4H6J A;  3O87 A;  2R9W A;  3BFD A;  1PWG A;  1FQG A;  1GSX A;  3IH9 A;  4JPM A;  4GD8 A;  1CK3 A;  1ZHH B;  4X56 A;  3LEZ A;  3SS5 A;  3GR2 A;  4HQA A;  4DN0 A;  4EU0 A;  4MEZ A;  5EVE A;  4JF6 A;  3HLD A;  3P98 A;  4HP9 A;  4X25 A;  5AJG A;  2Y2Q A;  1TS8 A;  4G3V A;  4L9E A;  1W63 Q;  3C2W A;  3KSI A;  3UNW A;  1K6S A;  3CIT A;  4X1L A;  3ZNY A;  2V8C A;  4OKP A;  1E3U A;  3CLO A;  3DTK A;  1Y4O A;  1JWZ A;  4UEY A;  3C8C A;  3P01 A;  3F1O B;  1TDG A;  3TW8 A;  2J80 A;  3D72 A;  4EEU A;  2OSU A;  1ZC2 A;  3EQV A;  1SHV A;  5HDC A;  1G6A A;  4QB8 A;  2QZ6 A;  2Y2I A;  3IF6 B;  2BLS A;  3QP1 A;  4UQI M;  2JKR I;  3OPL A;  1MWU A;  2Z2M B;  3OPH A;  5FQM A;  2WKR A;  3VSL A;  3T1R A;  2VGL M;  2EX9 A;  3IBR A;  2ZQ7 A;  1PFL A;  5TR7 A;  3FG8 A;  2PD8 A;  3NOU C;  3LEQ A;  2WAD A;  4L9G A;  4GB7 A;  4PKY A;  3KYQ A;  1IYP A;  3MSH A;  3NUL A;  1I2W A;  2NUP C;  3ZG5 A;  4EV4 A;  1BTL A;  2A49 A;  3HLF A;  5DFX A;  4E04 A;  3MQ0 A;  2HP9 A;  1Y28 A;  5EOE A;  3UE0 A;  1FCM A;  3UB9 A;  4LGW A;  5A93 A;  1MBL A;  2ZLY A;  1KE0 A;  2GJ3 A;  2K31 A;  3E0Y A;  5FDS A;  3IBJ A;  4OP5 A;  1YLT A;  1L0D A;  5EVI C;  4PAU A;  2NUT C;  3PR6 A;  4GD6 A;  3C5A A;  2ZM8 A;  1KDW A;  2QMI A;  2PT7 A;  1ES3 A;  3E2L A;  3EOI A;  4HP4 A;  2HV1 A;  4PKY G;  1ZG4 A;  3P7N A;  1SCW A;  4IBR A;  1ES5 A;  1YAX A;  3NDG A;  1A0K A;  2ZMV A;  2UWX A;  4U3T A;  4CPK A;  4H8R A;  5HWW A;  1TEM A;  3C7V A;  5E2H A;  3MS6 A;  3NHQ A;  1OME A;  5CHM A;  3UPO A;  1K57 C;  4RX3 A;  5L2F A;  1P97 A;  3ZQ5 A;  5CX7 A;  1NXY A;  4Y13 A;  4N9L A;  3C4P A;  1NY0 A;  1CF0 A;  4WZ5 C;  2PAV P;  3NC8 A;  3ZGA B;  3CUE C;  3A3D A;  5HD5 A;  5HAQ A;  1L3L A;  2Q9M A;  2VZW A;  4OPR A;  2IWB A;  3DBA A;  2Z6D A;  3KSH A;  4OPY A;  2V0W A;  4OPZ A;  2OLU A;  4ZRR A;  1GHP A;  4P85 A;  3E4P A;  5EPH A;  3EEH A;  3VOZ A;  4DMZ A;  4I3A A;  3IX3 A;  1S1Y A;  3ZG7 B;  4HEF A;  2V1B A;  4HBT A;  4KZ8 A;  5FI2 A;  3R7W A;  1ES4 A;  3MMH A;  5DVA A;  5HPI A;  5F6A A;  4WM9 A;  1FIK A;  2ZC5 B;  3UB8 A;  3JYI A;  4KQO A;  2GDN A;  3S7O A;  4EET B;  5CER A;  3F1P B;  5GLD A;  2PBY A;  4MMN A;  2WYX A;  1ONG A;  4JXW A;  2WZX A;  1OJG A;  5GL9 A;  2Q0O A;  2M7U A;  1MWT A;  3TG9 A;  4R4R A;  4JGP A;  4GHI A;  2HJE A;  1JTD A;  4CLC D;  2X71 A;  1U60 A;  4NXG A;  2OLV A;  3CWF A;  4OQG A;  5HD3 A;  5U47 A;  4PM7 A;  3KYE A;  4LCM A;  2XQZ A;  4C6Y A;  1UGU A;  3GSG A;  4GN2 A;  3NOP C;  4KG2 A;  2A2L A;  3AGE A;  3E98 A;  4JXS A;  3LFV A;  4CLC C;  2A24 A;  1BUE A;  1S66 L;  1BSG A;  4ARZ B;  2VGL S;  2VGK A;  1T1C A;  3CG5 A;  3PBO A;  3CHW P;  1RP5 A;  4R4S A;  2CMN A;  4O8G A;  4WEJ A;  3HUN A;  1NLZ A;  1PWD A;  2Y2N A;  2QPN A;  4ID4 A;  5HAI A;  4FD8 A;  4GW9 A;  4X53 A;  2ZOH A;  4YIN A;  5HAR A;  3OCL A;  4HJ6 A;  4NKP A;  1PZO A;  4UA9 A;  1LSV A;  2H5S A;  2M7V A;  1DY6 A;  2B18 A;  4LCL A;  2Y2P A;  3GV9 A;  1LSX A;  2H0T A;  4KZA A;  2DMW A;  2WKI A;  4S2N A;  2EFX A;  2IA2 A;  1S1Z A;  3N8R A;  4PM9 A;  2ZMA A;  1OT6 A;  2QYB A;  3FPW A;  1NJ4 A;  3QP5 A;  4Y0T A;  1NZO A;  4KZ9 A;  3UPN A;  4DE2 A;  1KGG A;  3BYD A;  3VMA A;  3PBS A;  3NDE A;  2W0N A;  2XA7 M;  5J8X A;  3S7P A;  5J3W A;  4C75 A;  3IF5 A;  5FAO A;  1UWP X;  3UE1 A;  3BFC A;  3MQO A;  5FSR A;  4HI4 A;  4BJP A;  3JVV A;  3P09 A;  4OLG A;  4EQ1 A;  2Y2M A;  2HJ9 C;  4K0X A;  1YLZ A;  3V50 A;  3PBQ A;  1YLJ A;  5TGF A;  3UME A;  2W3G A;  5HL1 A;  3UPP A;  1XFQ A;  2VGJ A;  2XEP A;  1H3Q A;  1XJ4 A;  5FL3 A;  4KQD A;  3V67 A;  3IHB A;  5F68 A;  3F1N B;  2JBF A;  4N1X A;  3KSG A;  5DJT A;  4RQ9 A;  3BEC A;  3O86 A;  1EWZ A;  3F1P A;  5CRF A;  2D02 A;  2V1Z A;  5EV0 A;  4GOG A;  2BG1 A;  3SH7 A;  1N9L A;  5TFQ A;  1KE4 A;  1YQS A;  4PM8 A;  2Y55 A;  4MDZ A;  4LV2 A;  5EVI A;  2ZMF A;  1GHM A;  3AGD A;  4KZ3 A;  4FSF A;  3TRC A;  4FH2 A;  3HUM A;  3MXR A;  4F3L A;  5HDS A;  2WK0 A;  3OOV A;  5FQI A;  3G30 A;  2JKF A;  3MF0 A;  3C4O A;  3W4O A;  3MXS A;  5DF7 A;  4D60 A;  4GJ4 A;  3A0S A;  3ZVW A;  4FUW A;  4BL3 A;  4OQH A;  2L0W A;  4BLM A;  2L4R A;  5HWV A;  4KZ6 A;  3UE6 A;  1OTE A;  5D3O A;  4LV0 A;  3OLO A;  2HDQ A;  3IWO A;  4R0Q A;  3SW1 A;  3GRJ A;  4ZBE A;  1HZO A;  5J4E A;  4K0W A;  2J8Y A;  1H8M A;  3HLC A;  4O7D A;  3S22 A;  2JN7 A;  1RCJ A;  3LY3 A;  5GLC A;  4WZ5 A;  3EQU A;  2DRW A;  4CLC A;  3Q7V A;  5E2F A;  2PYR A;  1L0F A;  4OPQ A;  3UE3 A;  4GNU A;  2V8F A;  2VKS A;  5F69 A;  1FOF A;  4P6Z S;  3FKV A;  3WWX A;  5EOO A;  3BLM A;  1T18 A;  4E3M A;  2HDR A;  1WYC A;  1MPL A;  3C38 A;  1SKO B;  5CGW A;  3CUE A;  2FFY A;  4S2K A;  4IVK A;  4JKT A;  4HNB A;  4F94 A;  4Q0I A;  4R6L A;  4QY5 A;  2HGV A;  3W2Z A;  2CC1 A;  3W8K A;  3IX4 A;  3DWZ A;  1HD8 A;  4HH2 A;  2LB5 A;  4I38 A;  1FIL A;  3TSG A;  5IU1 A;  3SOI A;  5G4Y A;  1XJ6 A;  1MZU A;  2YKH A;  4BBV A;  3G35 A;  3SZT A;  3PBR A;  3T1X A;  3FWL A;  2WZZ A;  4Q0H A;  1D7E A;  2Q9N A;  1SKO A;  5HSQ A;  3MR0 A;  2EFU A;  2ZOI A;  4I39 A;  5FAT A;  5DJU A;  2Y8H A;  2HDS A;  4NET A;  5A92 A;  3CZD A;  3NIA A;  1JWV A;  3H7W A;  1PNE A;  1P0Z A;  4GS9 B;  2ZM2 A;  5FA7 A;  1IEL A;  4B88 A;  2VEA A;  4P87 A;  1ES2 A;  1W5D A;  1G5U A;  4KUK A;  1S4R A;  4ZJ1 A;  2G2W A;  3Q81 A;  4Y15 A;  3PBT A;  2GNX A;  3BFE A;  4KZ7 A;  3OPP A;  1M6K A;  1KGE A;  2XH9 A;  3FC7 A;  3M6B A;  3H7W B;  4E3I A;  1JNU A;  1NYY A;  2ZM0 A;  1CJF A;  4WN5 A;  4IVI A;  1YMS A;  1LI9 A;  2D01 A;  1PYY A;  1VEU A;  4S2J A;  1BYW A;  5GHZ A;  4G3K A;  1BLS A;  1YM1 A;  3MKE A;  1IOU A;  1EI5 A;  2ZQC A;  1TS7 A;  2QWS A;  3LGO A;  5HFO A;  3K3D A;  4PM5 A;  3PAE A;  5GHX A;  1V9Z A;  2RL3 A;  3ZG9 B;  4XUZ A;  4OP8 A;  1IFQ A;  3S7Q A;  4PMA A;  5L09 A;  4HOI A;  3OPR A;  1Z09 A;  3M6H A;  3OCN A;  1VHM A;  3HBR A;  1VET A;  1ZKJ A;  3NY4 A;  5FAS A;  2Y4A A;  1BZA A;  4OOL A;  5A90 A;  2DNS A;  4H6J B;  3UDF A;  3VP2 A;  5CTN A;  4HES A;  4CLC E;  1FSW A;  5AVE A;  2J9O A;  4CLC B;  4Y0U A;  5CTM A;  2W27 A;  3UB6 A;  3C30 A;  3QP6 A;  2E8J A;  3ZFZ A;  4O0P A;  4WLA A;  1KVL A;  1RGZ A;  1YPR A;  1DJA A;  1BUL A;  2W3E A;  1GSW A;  3ISG A;  1H5X A;  1RGY A;  3SS4 A;  1K4E A;  1LL8 A;  5CHU A;  1K38 A;  1NRJ A;  4Z1W A;  1HLU P;  2PYP A;  1DP6 A;  2G2U A;  1IYS A;  5AQ9 A;  4BBT A;  3GEC A;  2JC7 A;  3D9Y A;  5E43 A;  3HUO A;  1C3B A;  3IHA A;  3Q7Z A;  5I5L A;  4N1H A;  3HLW A;  3JPU A;  4R3A A;  3B42 A;  3IQA A;  1O7E A;  4EXO A;  1I5Q A;  4DXB A;  4B4X A;  1K25 A;  4DKI A;  4FH4 A;  4QJG A;  3B3X A;  1LHY A;  5TBM B;  5FQ9 A;  3NCK A;  1TVF A;  2R78 A;  4JGO A;  1O07 A;  3Q1F A;  3F1N A;  4RA7 A;  5GHY A;  1YLW A;  5JYP A;  4GZB A;  3MJQ A;  4NXE A;  4S2M A;  1XGJ A;  3VFH A;  4LRX C;  1SDE A;  3G31 A;  3MKF A;  5EUA A;  1GHI A;  3S4X A;  4HY8 A;  2OWH A;  5EVI D;  5EE8 A;  1T1B A;  4XT2 B;  3OZH A;  5FI6 A;  3CPT B;  2HF6 A;  2J3T C;  2PD7 A;  2P7J A;  4LV1 A;  4OOM A;  2Y2K A;  1XX2 A;  4ZDX A;  2XD5 A;  3K3C A;  1OTD A;  4EER A;  4QY6 A;  4FTX A;  2XFT A;  1ALQ A;  1J3W A;  1P9W A;  3A0V A;  3CPT A;  5CGS A;  2XDM A;  2K2N A;  3G2Y A;  1ESU A;  5EVL A;  3LIC A;  1XGI A;  4M4X A;  2VJW A;  3E2K A;  2Y2H A;  3QNB A;  3LR0 A;  2EX2 A;  3M2J A;  3DTI A;  4EBL A;  1KDS A;  5HPF A;  2EX8 A;  1NZU A;  3TE8 A;  1ZG6 A;  2JKR M;  1H0M A;  2YKF A;  1K57 A;  3GQZ A;  1FCN A;  5J7E A;  3FKW A;  5IT5 A;  1G6O A;  4YFM A;  1D1J A;  2R9X A;  2V2F F;  3R7W B;  4ETZ A;  1XXM A;  3GVB A;  3VOL A;  2KOI A;  4EUZ A;  3D3O A;  4PHT A;  3MZE A;  3VOY A;  4XT2 A;  3VSK A;  4LFU A;  4ARZ A;  1W7F A;  2QKP A;  3B33 A;  1FCO A;  3KSF A;  1WE4 A;  4GHI B;  3EWK A;  4KQQ A;  3T4K A;  1UWN X;  2C5W B;  3O88 A;  4JF4 A;  4MBH A;  2V20 A;  1VB6 A;  1MC0 A;  3V3S A;  1H8Z A;  2GZA A;  4ZTK A;  3N4I A;  5DKK A;  3K2N A;  1I2S A;  2B95 A;  3WS1 A;  4JXG A;  4ETX A;  4JXV A;  2VV7 A;  1E25 A;  4PM6 A;  4HJ3 A;  1N9N A;  2UV0 E;  3RXW A;  2XD1 A;  3KX0 X;  3W4Q A;  4KZ5 A;  4BD0 A;  3ZVT A;  3FYZ A;  3IS2 B;  3PTE A;  2GX5 A;  1JWP A;  2EWW A;  1E4D A;  4QHC A;  3U4L P;  3IF6 C;  3OC2 A;  1LL5 A;  2BAS A;  1VET B;  4LPZ A;  4IUH A;  4II7 A;  3A0R A;  3N8S A;  1K55 A;  3S7N A;  4XXR A;  4E3O A;  2JKG A;  1Y54 A;  3QNC A;  3O5Y A;  2ZC3 B;  1M40 A;  3S1Y A;  2MJ6 A;  2PR5 A;  3H82 B;  5DF8 A;  4X68 A;  4LLO B;  3M2K A;  4U0T A;  3ZDJ A;  2O0Y A;  2WKH A;  4BD1 A;  5FAP A;  1FR6 A;  1S67 L;  4P6B A;  4NXB A;  2EWV A;  2OV5 A;  3LUQ A;  4L0L A;  4GKU A;  4S2N C;  4IJG A;  3G32 A;  2JCH A;  1YLY A;  1ODV A;  1JTG A;  5FAQ A;  4Y3I A;  2B02 A;  1Z6F A;  1HVB A;  4OLD A;  1GA9 A;  5F83 A;  1NRF A;  4S2P A;  3ZG0 A;  2QJ7 A;  1XJ3 A;  4DDS A;  1TS0 A;  3LIA A;  1TD5 A;  3VP0 A;  4NXF A;  3BFG A;  1DRM A;  3E4Q A;  3LO7 A;  5BOH A;  4R3J A;  3G34 A;  3DAV A;  4JBF A;  3UB5 P;  3ZNT A;  3LIB A;  4QPR A;  2PU2 A;  5DF9 A;  3NOT C;  5E2E A;  2ZQD A;  2XSS A;  4HIA A;  5HWT A;  4I5S A;  1Q2P A;  1WA9 A;  2Y2L A;  4YOF A;  3NBL A;  1PW8 A;  3LID A;  5KZH A;  2PDR A;  2PBD P;  2Z6C A;  3PYP A;  3WS4 A;  3H9W A;  1P9R A;  2IWC A;  3NEC A;  4Z9Q A;  1GA0 A;  4I3I A;  4MBF A;  1FR1 A;  3IWQ A;  4E3L A;  3IX8 A;  1LT0 A;  4GS9 A;  4WEK A;  1G28 A;  1CEF A;  3ZG8 B;  3IH8 A;  4XUX A;  2EXB A;  5HDD A;  3IWI A;  2PR6 A;  1YSP A;  4B9O A;  4GDB A;  5AQB A;  4OQI A;  3A3E A;  2FZ0 A;  2ZJ9 A;  4GDN A;  4MN6 A;  5DKL A;  3BQ8 A;  4WMC D;  4EBP A;  1VEU B;  2J3T D;  3EGX C;  1XJ2 A;  5CHJ A;  5M19 A;  3RFB A;  5F1F A;  1X0O A;  4WBG A;  1CI8 A;  5KMW A;  2L1M A;  4WZ4 A;  2EXA A;  2Y79 A;  5FQJ A;  3GDI A;  4IUK A;  1J9M A;  4R1G A;  3DWK A;  5CED A;  2Y91 A;  3ICY A;  3BRM A;  1IYQ A;  5MC7 A;  2FFF B;  1PW1 A;  4MBK A;  3HVF A;  2ZL1 B;  2O99 A;  5IS1 A;  4UA6 A;  3V39 A;  1F5M A;  3FZC A;  1MKM A;  3LYX A;  4MN7 A;  2H10 A;  2C6W B;  3ITB A;  4KG6 A;  3G6O A;  4D2O A;  1KGF A;  4Y2F A;  1SDN A;  5G4Z A;  4QWO A;  4IBX A;  5GLA A;  3WRZ A;  1K56 D;  5DTK A;  3OBF A;  4OVD A;  4JGQ A;  3Q7V B;  1AXB A;  2I9V A;  2XFS A;  3W4P A;  3E4O A;  1W8Q A;  4GLQ A;  3N6I A;  2XK1 A;  4KG5 A;  4U0X A;  2LB9 A;  2INW A;  4UAA A;  4UHU A;  4PPR A;  2E8I A;  2H28 A;  3IF6 A;  2EX6 A;  3V3R A;  5FDH A;  5C5K A;  3UY6 A;  3QP8 A;  2V1A A;  3F1O A;  4Y5F A;  1IYO A;  3VFF A;  3H82 A;  1ZTU A;  5AQ7 A;  1CI9 A;  2V9A A;  1K56 A;  1V9Y A;  1TDL A;  2Z2L B;  1OTI A;  3LI9 A;  2B5R A;  4E3J A;  4F3L B;  1GCE A;  4C3Q A;  3NI9 A;  3Q82 A;  4Y0O A;  1DP8 A;  3IS2 A;  5HL6 A;  5EVI B;  2WKQ A;  5L07 A;  3QP2 A;  5F82 A;  1HTZ A;  3DTE A;  4WUJ A;  4MCW A;  3RJU A;  4R38 A;  4HH3 A;  4S2O A;  5FQQ A;  2WGI A;  1S6R A;  3QP4 A;  1N9B A;  2HZ5 A;  1ESI A;  3UDX A;  4HJ4 A;  3ITA A;  1TS6 A;  4E3K A;  1F9I A;  3CAX A;  1N9O A;  3FPV A;  1W79 A;  2M1C A;  2P04 A;  3RXX A;  4DJ2 A;  3HRE A;  1IKG A;  4WF0 A;  1LSW A;  4RYE A;  4WMC A;  4JLF A;  1S4S A;  1YLP A;  2WGW B;  4X6T A;  2K7S A;  1MKI A;  1PI4 A;  5FI7 A;  2WAF A;  4OH0 A;  3A3J A;  1OT9 A;  2OOL A;  1K54 C;  3EGD C;  4P6Z M;  5KSC A;  1OTB A;  1S0W A;  4BMW A;  4EUV A;  4DE1 A;  2P08 A;  4JF5 A;  3AGF A;  1STZ A;  3PXP A;  5JYO A;  3Q07 A;  4NEE D;  2WGV A;  3CMZ A;  2BTF P;  3L9K A;  3MQQ A;  3HLE A;  5AQA A;  2OAQ 1;  4KZ4 A;  3LR4 A;  3MFD A;  4ZJ2 A;  1W63 M;  1PZP A;  2PRF A;  5IHV A;  2ACG A;  2ZL1 A;  3HL9 A;  2I72 A;  3BW6 A;  4L9F A;  2ZQ8 A;  2W1R A;  3PAG A;  4R23 A;  3IXG A;  5KSH A;  4O01 A;  3KYZ A;  3MXQ A;  4IED A;  2EA9 A;  2W1T A;  1NWZ A;  4CJN A;  2Y2O A;  4KUO A;  3LIE A;  3WRT A;  4N92 A;  1MWS A;  4I3J A;  2VA0 A;  1PRQ A;  3O3V A;  2W3F A;  3IT9 A;  3IXB A;  4KEN B;  3T4S A;  3VV4 A;  2J9P A;  2HP6 A;  3T4L A;  2P74 A;  1XPB A;  1IEM A;  4GCZ A;  4LRZ E;  2KLI A;  3ZYT A;  5EFW A;  2OWJ A;  3BM6 A;  4X1M A;  2P9V A;  3MBZ A;  3G4P A;  4RVA A;  5EEC A;  3HJK A;  5EM0 A;  1LI0 A;  1VM1 A;  4ESP A;  4KQR A;  4P0M A;  3L7H A;  4EW7 A;  1KOU A;  1SZV A;  3IXH A;  5CEC A;  5I94 A;  1WYB A;  3WS5 A;  1YKD A;  5HAP A;  1NLY A;  3GMW A;  1PWC A;  1BLP A;  3UO9 A;  3VP1 A;  2XR0 A;  5FQK A;  3MZF A;  1L0G A;  4OOY A;  3A3I A;  1ERM A;  1BT5 A;  2A24 B;  4N9K A;  1E3U D;  1K4F A;  2J3W A;  2XLN A;  3MZD A;  5AVF A;  4HHD A;  1YSQ A;  4EES A;  3BEB A;  2OAP 1;  3ZHH A;  1GSV A;  5F1G A;  4FCF A;  4Y7P A;  1T19 A; 
#chains in the Genus database with same CATH homology
 1XJ6 A;  1MZU A;  1ODV A;  2YKH A;  1YAX A;  4BBV A;  4YNR A;  3PBR A;  2ZMV A;  3U2A A;  4Y3I A;  2VV8 A;  2B02 A;  3LIF A;  3BWL A;  4Q0H A;  2QJ7 A;  2VLG A;  1D7E A;  1XJ3 A;  5HWW A;  1TS0 A;  3LIA A;  5HSQ A;  3MR0 A;  5KIZ A;  1TD5 A;  4I39 A;  2ZOI A;  4NXF A;  4MN5 A;  5DJU A;  2Y8H A;  1DRM A;  3E4Q A;  3NHQ A;  3HCY A;  3H7W A;  4GS9 B;  1P0Z A;  2JKT M;  3LIB A;  4QPR A;  5DF9 A;  3NOT C;  2VX8 A;  2XSS A;  4HIA A;  5HWT A;  2VEA A;  4I5S A;  1P97 A;  1WA9 A;  4YOF A;  3ZQ5 A;  5CX7 A;  4KUK A;  4YWZ A;  3LID A;  1S4R A;  2PDR A;  3TJZ C;  2Z6C A;  2ZBB A;  3CUE C;  3ULF A;  3PBT A;  2GNX A;  3PYP A;  2V0U A;  2JKT I;  5HD5 A;  3H9W A;  1P9R A;  4LRY C;  4I3I A;  3R4K A;  2W3D A;  3FC7 A;  1LT0 A;  2VZW A;  4GS9 A;  4WEK A;  3H7W B;  4DJ3 A;  1G28 A;  2QJ5 A;  1JNU A;  1F98 A;  3DBA A;  3CI6 A;  2Z6D A;  5HDD A;  2PR6 A;  4FOF A;  3LR5 A;  1YSP A;  4B9O A;  4WN5 A;  3RH8 B;  5K5B A;  4R70 A;  4WEL A;  3KSH A;  2D01 A;  2V0W A;  2FZ0 A;  4MN6 A;  5DKL A;  3BQ8 A;  2QHK A;  4ZRR A;  3EGX C;  2J3T D;  3E4P A;  1TF1 A;  3EEH A;  1BYW A;  4DMZ A;  1XJ2 A;  4G3K A;  2PHY A;  3PHY A;  4I3A A;  3RFB A;  1X0O A;  4G3W A;  3RTY A;  1S1Y A;  1IOU A;  3VE4 A;  1TS7 A;  2QWS A;  2W1T B;  3BY8 A;  1OTA A;  2L1M A;  2V1B A;  2Y79 A;  3GDI A;  3K3D A;  4IUK A;  2XA7 S;  3R7W A;  4K08 A;  3MMH A;  1V9Z A;  3ICY A;  5HPI A;  5F6A A;  5MC7 A;  1IFQ A;  3S7Q A;  2O99 A;  3UB8 A;  1T1A A;  4KQO A;  5IS1 A;  4HOI A;  3BY9 A;  3NJA A;  3S7O A;  1F5M A;  2WKP A;  4EET B;  5DFY A;  1MKM A;  3F1P B;  3T50 A;  3OCN A;  4WL9 A;  3UMD A;  1VHM A;  3LYX A;  4MN7 A;  3G6O A;  4Y2F A;  4MMN A;  5G4Z A;  5TJJ A;  4IHQ A;  1OJG A;  5F5Y A;  5L8M A;  2M7U A;  4OOL A;  4JGP A;  3OBF A;  4GHI A;  4JGQ A;  4H6J B;  4B93 A;  2HJE A;  2XRN A;  4CLC E;  5AVE A;  2I9V A;  4CLC D;  4CLC B;  3E4O A;  4NXG A;  3CWF A;  3PBN A;  4GLQ A;  5HD3 A;  2W27 A;  2LB9 A;  2INW A;  3T4J A;  3UB6 A;  3C30 A;  4ME4 A;  1UGU A;  2H28 A;  4O0P A;  3NOP C;  2A2L A;  3E98 A;  4WLA A;  2JHE A;  2O9A A;  4CQH A;  2W3E A;  3LFV A;  5C5K A;  1GSW A;  2A24 A;  4CLC C;  1DP9 A;  3T4O A;  1S66 L;  2FH5 A;  2V1A A;  3F1O A;  4Y5F A;  1LL8 A;  4ARZ B;  3H82 A;  2VGL S;  1ZTU A;  1NRJ A;  4Z1W A;  2PYP A;  1DP6 A;  1T1C A;  3PBO A;  4Q0J A;  4JGR A;  2V9A A;  4BBT A;  1D06 A;  3GEC A;  2CMN A;  1V9Y A;  4O8G A;  3UB7 A;  1OTI A;  3JVU A;  4WEJ A;  3LI9 A;  4F3L B;  1NLZ A;  4GW9 A;  5I5L A;  2O9C A;  3LR3 A;  4R3A A;  5A8B A;  3B42 A;  1OPX A;  2G7U A;  2ZOH A;  3EEA A;  1DP8 A;  3IS2 A;  5HL6 A;  3MFX A;  4EXO A;  3OCL A;  4HJ6 A;  2WKQ A;  4NKP A;  4AFI A;  5TBM A;  1LSV A;  2M7V A;  2O9B A;  2B18 A;  4WUJ A;  4MCW A;  4R38 A;  4HH3 A;  1LSX A;  5TBM B;  2R78 A;  4JGO A;  2DMW A;  3F1N A;  2IA2 A;  3LI8 A;  1XFN A;  1S1Z A;  3BQA A;  4HJ4 A;  1OT6 A;  2QYB A;  3FPW A;  3MJQ A;  1TS6 A;  1F9I A;  3CAX A;  4BBU A;  4NXE A;  1N9O A;  3FPV A;  1EW0 A;  4UQI S;  4LRX C;  2M1C A;  3KO6 A;  4EEP A;  5LBR A;  2KX6 A;  2P04 A;  3PBS A;  5HZH A;  3B47 A;  5G4Y A;  3VE3 A;  2W0N A;  2XA7 M;  4HY8 A;  3S7P A;  4DJ2 A;  5J3W A;  2OWH A;  4WF0 A;  1LSW A;  1UWP X;  1T1B A;  3T4Q A;  4XT2 B;  1S4S A;  2HF6 A;  3MQO A;  2J3T C;  2PD7 A;  2P7J A;  4HI4 A;  4OOM A;  2K7S A;  4BJP A;  1OJ5 A;  3BJN A;  3JVV A;  3K3C A;  1OTD A;  4EER A;  1OT9 A;  4EQ1 A;  2OOL A;  2W3H A;  1P9W A;  3A0V A;  3EGD C;  2KDK A;  4P6Z M;  2HJ9 C;  3HJI A;  3PBQ A;  2K2N A;  1OTB A;  3T4T A;  4BMW A;  4BWI A;  4EUV A;  3UME A;  2VV6 A;  2P08 A;  3LIC A;  2XRO A;  4H6J A;  4M4X A;  2W3G A;  2VJW A;  1XFQ A;  3LR0 A;  1H3Q A;  1XJ4 A;  5FL3 A;  1STZ A;  4KQD A;  3PXP A;  3V67 A;  5F68 A;  1GSX A;  3F1N B;  4NEE D;  3MQQ A;  3KSG A;  5DJT A;  1ZHH B;  4RQ9 A;  2OAQ 1;  3F1P A;  2D02 A;  4HQA A;  4DN0 A;  3LR4 A;  5HPF A;  4EU0 A;  1W63 M;  1N9L A;  3TE8 A;  2JKR M;  2YKF A;  4HP9 A;  4MDZ A;  3BW6 A;  4L9F A;  2W1R A;  5J7E A;  5AJG A;  2ZMF A;  1G6O A;  5IT5 A;  5KSH A;  4FSF A;  3TRC A;  3R7W B;  1TS8 A;  4ETZ A;  4O01 A;  3KYZ A;  4G3V A;  4L9E A;  3VOL A;  1W63 Q;  3C2W A;  2KOI A;  4F3L A;  3MXQ A;  3KSI A;  5HDS A;  3CIT A;  3OOV A;  3D3O A;  2EA9 A;  2W1T A;  1NWZ A;  4PHT A;  3MF0 A;  4KUO A;  3LIE A;  3CLO A;  4XT2 A;  4GJ4 A;  4I3J A;  3A0S A;  4UEY A;  3C8C A;  3P01 A;  2VA0 A;  4ARZ A;  2L0W A;  3F1O B;  2QKP A;  3B33 A;  3TW8 A;  2W3F A;  2J80 A;  3D72 A;  3KSF A;  2L4R A;  4GHI B;  5HWV A;  3EWK A;  3UE6 A;  4EEU A;  1OTE A;  3EQV A;  1UWN X;  3T4K A;  3T4S A;  3VV4 A;  5HDC A;  3OLO A;  3SW1 A;  1VB6 A;  1MC0 A;  2GZA A;  4UQI M;  2JKR I;  5DKK A;  3T4L A;  3K2N A;  4ETX A;  2WKR A;  5J4E A;  4GCZ A;  1H8M A;  4LRZ E;  2VGL M;  2VV7 A;  2KLI A;  2JN7 A;  3ZYT A;  4HJ3 A;  1N9N A;  5EFW A;  3IBR A;  3EQU A;  2OWJ A;  4CLC A;  3KX0 X;  3FG8 A;  2PD8 A;  3NOU C;  3HJK A;  4L9G A;  2PYR A;  4PKY A;  3UE3 A;  3IS2 B;  3KYQ A;  2VKS A;  2GX5 A;  2EWW A;  5F69 A;  4EW7 A;  1KOU A;  2NUP C;  3OC2 A;  1YKD A;  5DFX A;  4P6Z S;  2BAS A;  1NLY A;  4LPZ A;  4E04 A;  3MQ0 A;  4IUH A;  4II7 A;  3A0R A;  1Y28 A;  3S7N A;  3UB9 A;  3O5Y A;  1T18 A;  2MJ6 A;  3C38 A;  2PR5 A;  3H82 B;  3CUE A;  2GJ3 A;  4LLO B;  2K31 A;  3E0Y A;  4HNB A;  2O0Y A;  4Q0I A;  3IBJ A;  4R6L A;  2A24 B;  2HGV A;  3W2Z A;  2J3W A;  4HH2 A;  1S67 L;  2LB5 A;  4PAU A;  4NXB A;  2EWV A;  3LUQ A;  2NUT C;  3PR6 A;  4L0L A;  4HHD A;  5AVF A;  1YSQ A;  4I38 A;  4IJG A;  4EES A;  2PT7 A;  3EOI A;  4HP4 A;  2OAP 1;  2HV1 A;  1GSV A;  5IU1 A;  4PKY G;  3P7N A;  1T19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...