1HLUP

Structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ACTIN
publication title The structure of an open state of beta-actin at 2.65 A resolution.
pubmed doi rcsb
molecule tags Complex (acetylation/actin-binding)
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1hluP00
1F2KA 3LGOA 1SZVA 2V8CA 5EVEA 4QWOA 1VEUA 5FEFA 1HLUP 1PNEA 3NECA 2BTFP 5EM1A 1FIKA 3UB5P 2ACGA 2HZ5A 1YPRA 1FILA 1VEUB 2B95A 2E8JA 3DAVA 1AWIA 4FUWA 4D60A 5FDSA 3U4LP 2V8FA 3MSHA 1CJFA 2ZL1A 1PRQA 5FEGA 3KYEA 3NULA 4X1LA 2VK3A 4FTXA 3L7HA 4ESPA 3T1RA 1SKOA 5EV0A 1VETA 1D1JA 3T1QB 4X25A 3MS6A 2JKGA 1A0KA 1ACFA 3D9YA 3T1SA 3L9KA 2JKFA 1CQAA 1J3WA 3CHWP 3T12B 1Z09A 3CPTA 3T1XA 2ZL1B 2PAVP 1G5UA 1Y4OA 2PRFA 3LEQA 1PFLA 5EM0A 1SKOB 2PBDP 1VETB 3CPTB 1K0KA 4X1MA 1CF0A
chains in the Genus database with same CATH superfamily
5AQ9A 4GW9A 5GLCA 3RJUA 2V8CA 2JHEA 1WE4A 1YM1A 4UA7A 3A3FA 3IWIA 4A5RA 1DP9A 3VE3A 3MFXA 3IF6B 4WZ4A 3UNWA 4AFIA 3T4JA 5E2EA 1ESIA 4BD0A 2B95A 2QKPA 1TF1A 4H6JB 1CI9A 4LV3A 3S4XA 3C7VA 3IXGA 3DWZA 5CHUA 3U4LP 1E4DA 4WBGA 4B88A 3CI6A 3N4IA 1O07A 2Y2PA 4HOIA 2XD5A 4CPKA 3H82B 3OC2A 4Q0IA 2O99A 4BQMA 2RCXA 1XGJA 1P9WA 1HD8A 4KUOA 1FSYA 2ZOIA 5HWVA 4II7A 1UGUA 5L10A 3BW6A 4KQQA 2XH9A 3UMDA 3C8CA 1MZUA 2PHYA 5CEBA 3KYZA 1XXMA 4ARZA 1TVFA 3V39A 5FQKA 4JXGA 3LI9A 3CHWP 4MBKA 3PHYA 3OCLA 1PI4A 3IX8A 4L9FA 3A0VA 2C6WB 1XKZA 5F83A 1IYSA 4IJGA 2W3DA 3PBOA 1Q2PA 4QB8A 3UY6A 2XA7M 3G31A 1JNUA 2R9XA 4NEED 2M7UA 4ETZA 4Y3IA 1GA9A 4S2NA 2X71A 5CXWA 2G7UA 4Y0TA 2Z2MB 1NYYA 2W3EA 4EERA 2WAEA 3OPLA 4EEUA 1VM1A 4HP4A 2KLIA 1XJ3A 1DJCA 2DMWA 1EI5A 4OP5A 3PTEA 1STZA 3CITA 1KVLA 2A24A 1IKIA 1FSWA 5U47A 4FTXA 4ZRRA 2A3UA 4E3JA 4LENA 1M6KA 2JBFA 1S6RA 4EBPA 2ZQ7A 1Z6FA 3KX0X 3RTYA 4S2IA 4CJNA 1N9NA 5FQJA 5F68A 2XA7S 4B9OA 4C3QA 5MC7A 3SZTA 4MLLA 5F69A 2V1ZA 1LI9A 2EX6A 4NXEA 5FDHA 3B33A 3G2YA 4G3VA 4I3AA 2PDRA 2VGJA 5FASA 3FPWA 1OTEA 3K3CA 2HGVA 1PFLA 5EM0A 1MXOA 3E4PA 3G4PA 3F1NB 3HJKA 2LB5A 5E2FA 1XFQA 2M7VA 3FG8A 3TW8A 5L07A 2VJWA 4S2NC 3TJZC 1ES5A 5EVIB 3ZNTA 2P9VA 1HLUP 3PAGA 4B4XA 1QMFA 3NY4A 3UB5P 3LR0A 4QY5A 2Y2JA 3VFHA 4CLCD 3O5YA 2L1MA 2Y2GA 2WKIA 4X6TA 2E8JA 4YNRA 1KE0A 1PWDA 2BLSA 2V2FF 1I2SA 1X0OA 4EEPA 1WYBA 4FUWA 3ZNYA 4M4XA 5EVLA 4JXSA 2V8FA 2WGVA 5FQQA 2P7JA 5HZHA 2NUTC 2ZMAA 1OJGA 1NRFA 3PR6A 3F1PA 3MQOA 1PZOA 4KZ6A 3VV4A 4CQHA 5D3OA 5HL1A 1FCNA 3MR0A 5GHZA 5A8BA 4RX2A 4KG2A 2VKSA 5TBMB 1CEFA 4DRTA 1ACFA 2OLUA 3M2KA 1OTBA 2P08A 4GHIA 4LV2A 3VP2A 2JKFA 1OTAA 3LY4A 3N7WA 2WYXA 2EFXA 4EXOA 1PIOA 2W3FA 5DTTA 3G35A 3V50A 2EWVA 1IYOA 2W1RA 1Z09A 4EWFA 1LI0A 4Y17A 1PWGA 1NRJA 3W8KA 2LB9A 3W4OA 3VMAA 3WS0A 1P9RA 4WMCA 3UN7A 5EOOA 2ZLYA 5DFXA 1N9LA 4GS9B 3MXRA 3C7UA 3LYXA 3O3VA 1F2KA 3LGOA 2INWA 1S0WA 3ISGA 5DTKA 3RXWA 4PM6A 4KZ3A 1BLSA 1HVBA 1XPBA 5L8MA 3A3JA 2YKFA 3GQZA 1PNEA 4QU3A 3O86A 3ZVWA 2H10A 1VQQA 5CHJA 2ACGA 3MZDA 3SH9A 4JGPA 3LR4A 2J9OA 2B18A 4NKPA 3Q07A 1VEUB 4JGQA 4IVKA 3TRCA 3N8SA 1U60A 4Y5FA 1NLYA 2X02A 1H8YA 4WEKA 4D60A 3PAEA 1XJ6A 2BG1A 1F5MA 3M2JA 4GN2A 1OTDA 5FAPA 1I5QA 1HZOA 4OPRA 3HLWA 3UE1A 1UWNX 4L0LA 4OQGA 3L7HA 1D06A 2WKQA 1P0ZA 3C4PA 1TS0A 1SKOA 3A0SA 4KZ7A 2Y59A 4OOMA 4ZJ1A 4Z9QA 4KZ9A 5CERA 3MS6A 1K56D 5CX7A 2WUQA 2K2NA 3A3DA 3E0YA 3D9YA 1L0EA 1SHVA 2OLVA 5FATA 2J8YA 3BQAA 2DCFA 4OQIA 3TE8A 1ERMA 4OVDA 4U0XA 3IF6A 2Q0OA 1T1AA 2XRNA 3EQVA 3C2WA 1W5DA 5EVID 2PD7A 2ZM8A 5F6AA 3VOYA 5FSRA 3LEQA 4H6JA 3HLBA 3RH8B 2ZJ9A 1ZC2A 1PWCA 3OPHA 2M1CA 3H82A 5C5KA 2J80A 5CEDA 3NIAA 1JVJA 3G30A 3IS2B 1JWVA 3DTIA 5A90A 4LCLA 1Q2QA 2NUPC 3BECA 3EQUA 1YLJA 2HPBA 2WZZA 3E2KA 4GNUA 4MBHA 2W1TB 4BL3A 4LRXC 2L0WA 1KDSA 2W3GA 2ZQAA 1IELA 3LIBA 4JBFA 1PRQA 1NZOA 5HX9A 2KX6A 4ZAMA 3UB8A 3ZG8B 2PR5A 1XJ4A 4ETXA 2O9BA 4E3KA 4X25A 4Y15A 4IBRA 5FI7A 2O0YA 4NETA 1J3WA 3IXBA 2WGWB 4C75A 1ESUA 3PXPA 2UV0E 3MXQA 2XK1A 3G32A 2JC7A 3MJQA 4B4ZA 1NXYA 3JPUA 1VETB 2ZBBA 4YWZA 3MQQA 4WZ5A 1SKFA 3IHBA 1ONGA 4MBFA 2H28A 3T4QA 4E3LA 5EVEA 3UPNA 5FEFA 2E8IA 1PI5A 1LLBA 3NECA 3MXSA 1BTLA 5FI2A 3LUQA 4PM9A 4KQOA 2Q9NA 4C6YA 2ZMFA 3LIEA 3SW1A 5FA7A 3V3RA 4UA9A 3LICA 2P74A 3T50A 2BASA 3FZCA 3S1YA 3T4TA 5EOEA 5I5LA 4LV1A 3MSHA 2VV7A 5GLAA 4XT2B 4XUZA 1NLZA 3Q81A 4HH2A 2EFUA 4MMNA 5TR7A 2JN7A 2V9AA 3VP0A 3F1NA 2ZQDA 3E4OA 1CK3A 4QHCA 5CTNA 3UDIA 1XFNA 3FYZA 3HLEA 3Q7VB 2AVXA 1BULA 3GR2A 4PMAA 3ZDJA 5A91A 3EGDC 4DXBA 2VGKA 5DF7A 1G6OA 4GLQA 3L9KA 5GL9A 3JVVA 4Y13A 3Q82A 4CLCB 3SH7A 5DF8A 3NOUC 1YAXA 4BBUA 1OT6A 3HUMA 3T1XA 3BFFA 1YMXA 3C38A 3IXDA 5G18A 3LIAA 5HPFA 4WZ5C 5TFQA 1XP4A 5HAIA 1XA1A 3CPTB 3WS4A 3RFBA 3O88A 4GD6A 1G6AA 3PBNA 3MKEA 1CI8A 2OWJA 3Q1FA 1J9MA 4LPZA 2JKRM 1Y54A 4OQHA 4GDBA 5L09A 3IF5A 4B93A 3LR5A 4OOLA 2WKHA 1YLZA 2K7SA 4YFMA 2J7VA 4X53A 2KDKA 3HREA 2Y2LA 4P85A 4DDYA 3Q7ZA 3BLSA 3EGXC 4JF6A 3DTKA 4KG5A 3H7WB 4LRYC 4Q8IA 2W27A 5KIZA 1PW1A 4E3IA 4HJ3A 4S2KA 1MKIA 5F5YA 3MKFA 2VZWA 5HAQA 4N9KA 4BLMA 3FPVA 4UAAA 4GS9A 3NHQA 1D1JA 2IWCA 3QP4A 1IYQA 2DRWA 1VB6A 4BWIA 4ID4A 1E3UD 2VLGA 3VSKA 3CUEA 3P98A 4ZJ2A 1H5XA 2CC1A 2FFFB 5EFWA 4FH2A 4HY8A 3NDGA 3R7WA 4P87A 4RVAA 4GDNA 4IUKA 3T12B 2EXBA 1YKDA 1ERQA 1SDNA 1GCEA 2HF6A 5AVEA 2QYBA 3IH9A 4OH0A 4WL9A 5IU1A 2EX2A 2X01A 3CLOA 2Y8HA 3QP6A 2PU2A 2R78A 4OP8A 2HP9A 1KE3A 4MN5A 4WEJA 3M6BA 2HDRA 4ZDXA 1YLTA 4KZ8A 5BOHA 1GHPA 3LI8A 2I72A 2PT7A 1KVMA 2VV8A 2Y4AA 1L0GA 5CTMA 3ZG7B 3WRZA 3DTEA 2WGIA 5DFYA 4F3LB 2J3TD 3S7NA 2XFSA 3DAVA 5JYPA 3BRMA 1ZTUA 4Y0UA 3PBRA 4LRZE 2PYPA 3SS4A 4MCWA 3F1OB 4BL2A 5CHMA 1DP6A 3HCYA 5FEGA 2XLNA 3NULA 4QJGA 3TG9A 3MZFA 5CRFA 4GZBA 3DWKA 4BENA 3T4LA 4R6LA 3CZDA 3BEBA 4R4RA 4GD8A 3CUEC 3C5AA 1KGFA 4N9LA 2ZC6B 4DE3A 1KGEA 3G6OA 2EX8A 1ZG6A 1ONHA 3IS2A 3I7JA 4EW7A 3MFDA 2XDMA 4R70A 3FC7A 4EQIA 1K4EA 1IOUA 2QJ5A 2ZL1B 2EX9A 4HBUA 3NDEA 1G5UA 3H9WA 5A92A 2OV5A 4BJPA 1TS6A 3EOIA 3AGEA 4P0MA 5DF9A 4R3JA 3TSGA 5JYOA 2XFTA 5EUAA 5FQMA 3WS2A 1S1ZA 4E3MA 1DP8A 3B47A 3A0RA 2OSUA 1VHMA 1MC0A 4HH3A 2QZ6A 3ITBA 5EM1A 1WA9A 1OTIA 1TS8A 2D02A 5F1FA 3HVFA 5M19A 4HNBA 3MQ0A 3ZG0A 4MNRA 4UA6A 5FQ9A 3D72A 3RXXA 5G4ZA 1O7EA 5FDSA 5KMWA 4YOFA 3EEHA 5FAOA 4UEYA 1BLPA 3OCNA 4KG6A 4OPZA 4R1GA 2WADA 1IYPA 4E3NA 1KE4A 2FZ0A 2H5SA 3CWFA 1L3LA 3NC8A 3HBRA 1VETA 3QP5A 2A24B 4LCMA 1DJBA 4HP9A 2QJ7A 1PW8A 2XD1A 3W4PA 3T1SA 5E2GA 4DE2A 3BQ8A 2WKPA 1LSXA 1OPXA 4HESA 3DBAA 3NOTC 3ICYA 1FR6A 4OPYA 3BFGA 4MDZA 4PKYG 1GSXA 2RL3A 3A3EA 1GSWA 1MPLA 5CGXA 4I3JA 3GMWA 1K57A 3LY3A 2GDNA 4S2MA 3JYIA 4IVIA 1K54A 4DKIA 4BMWA 1H0MA 3UMEA 2V0WA 5HDCA 4PPRA 2BTFP 5HW3A 5AVFA 5DVAA 1JWZA 3Q7VA 1KGGA 1OJ5A 4OLDA 5F82A 1NWZA 1MY8A 2QHKA 1FCOA 1YPRA 2XQZA 3PYPA 3N6IA 2FH5A 3HLDA 2WK0A 2P9VB 4R3AA 3LO7A 2IA2A 2R9WA 3HUOA 1AWIA 4JKTA 2Y91A 1RGYA 2ZMVA 4CLCA 1PZPA 1NZUA 3UB6A 1K4FA 1H8ZA 5HD3A 2WKRA 5J7EA 5K5BA 4N92A 2ZOHA 4PHTA 1EROA 3GRJA 1BSGA 3CAXA 4O8GA 2DNSA 1F9IA 1T1CA 4H8RA 5HARA 4I3IA 4X68A 4G3WA 5CGSA 3F1PB 1K55A 1N9OA 1C3BA 4BD1A 3CJMA 2OWHA 5CECA 2HDUA 4I39A 4LFUA 2ZM0A 1QMEA 5I94A 2VA0A 3IXHA 4IUHA 3QNBA 3QP8A 1K57C 4ZJ3A 3KSHA 3VFFA 1K54C 1FR1A 4JF4A 1DY6A 3N8RA 4GJ4A 1S1YA 3ZGAB 1IKGA 2QMIA 3IF6C 3H7WA 2PBDP 2XROA 1BLHA 3D4FA 2EWWA 4U0TA 4X56A 3IBJA 3S7OA 3C30A 1ODVA 1RP5A 1JTGA 3QP1A 4QY6A 3GECA 3NOPC 1XGIA 3D3OA 4BBTA 1KOUA 4Q0HA 3LIFA 2Z2LB 2HDSA 4CLCC 4PM8A 4L9EA 2CMNA 2H0YA 1V9ZA 1ALQA 2A49A 3W4QA 4R0QA 4U3TA 1SCWA 4LGWA 2Y2MA 5KZHA 3ULFA 3QP2A 1S66L 2JKTI 5GHXA 1V9YA 4NK3A 1W63Q 4MEZA 3UDFA 1S4RA 2XGNA 1ES2A 5GLDA 2HJ9C 2V0UA 1FCMA 1T18A 3ZYTA 5GLBA 4NXGA 5FQIA 4R23A 1L0DA 1K55C 4ZTKA 1ZG4A 2ZC7A 1BYWA 1YLYA 4Y7PA 4EBLA 5HSQA 1F98A 3UE6A 2GX5A 1OT9A 3OZHA 5FI6A 4EQ1A 1W79A 4G3KA 5IS1A 2IWBA 1K56A 2JKRI 1T1BA 1YLPA 1JTDA 4WELA 5DKKA 3SS5A 1NY0A 3GVBA 4NXBA 4NG2A 5F1GA 4P6ZS 4GOGA 4F3LA 4HHDA 1FOFA 3E2LA 3T4SA 5M1AA 2HV1A 3B42A 1FQGA 5EVIA 3F1OA 5HFOA 1CEGA 3CMZA 4IEDA 4S2OA 2JKTM 4UQIM 1T19A 1MWTA 2OOLA 3AGFA 1K6SA 4QD4A 3NCKA 4E04A 3HLGA 4R38A 2ZQ9A 3R4KA 1NJ4A 1FILA 2WZXA 4K08A 2XR0A 1N4OA 3ZCZA 3HL9A 1G28A 4JPMA 4Y0OA 2ZL1A 3KYEA 1YSQA 4XXRA 3UDXA 5TBMA 4KENB 3MF0A 5EECA 3IBRA 2O9CA 3GTCA 4O0PA 2VEAA 4LLOB 2O9AA 4DF6A 2L4RA 2Y2NA 4EESA 1MKMA 4IBXA 4UQIS 2IWDA 4X69A 2VGLM 4WMCD 1D7EA 1E25A 2ZD8A 3E4QA 3BFEA 3BFDA 3W2ZA 4I38A 1W7FA 4N1HA 1LSVA 3K2NA 5EVIC 4EUVA 5A93A 2G2WA 1K25A 3BYDA 2PBYA 1Y4OA 4MN6A 3IWQA 3S7QA 3VP1A 3QNCA 2ZQCA 4S2PA 4PKYA 3HUNA 3ZG9B 4X1MA 5AQAA 2G2UA 3M6HA 1SZVA 1K6RA 1XJ2A 5G4YA 4QWOA 1JWPA 4KZ5A 1VEUA 2FFYA 4KQRA 2HP6A 2QPNA 3HLCA 1FIKA 1MBLA 3T4KA 3WS1A 5HAPA 4FH4A 4KZBA 2HZ5A 3WS5A 1LHYA 1AXBA 2V1BA 4WN5A 4OLGA 3LIDA 3PBQA 1LT0A 4F94A 1LSWA 2JE5A 4K91A 4JXVA 1RGZA 3A3IA 4I5SA 3G2ZA 3VOLA 2Y2OA 3ZVTA 2A2LA 4KUKA 1MWUA 4Q0JA 3IX3A 1CJFA 3B3XA 4OPQA 2W0NA 1WYCA 4X1LA 2V20A 1YMSA 3TOIA 5E2HA 5HL6A 3HLFA 5LBRA 4CLCE 2VGLS 4HI4A 1RCJA 5EV0A 4RYEA 1PYYA 5HWTA 3T1QB 1GA0A 2PR6A 2JKGA 5HDSA 1Y28A 5E43A 1ZHHB 1SDEA 3DTMA 3G34A 4FD8A 5M18A 4IHQA 1ES3A 3ITAA 3ZFZA 5TGFA 5DTSA 3VP3A 4P6BA 3MZEA 3OPRA 5FAQA 2J3WA 4KQDA 4WUJA 2V1AA 4E6WA 3NJAA 3PBSA 4EETB 4EU0A 4OQ0A 2Y2QA 4PAUA 3S7PA 4WLAA 3UPPA 3VE4A 4WF0A 3SOIA 2XF3A 3LR3A 3U2AA 1GHMA 1YSPA 2HJEA 4R3BA 3GSGA 2W3HA 3E98A 5FL3A 3UB9A 1BLCA 4ARZB 2W1TA 3BJNA 3ZG5A 1N9BA 3QHYA 2P04A 3UO9A 4ZBEA 3OLOA 2GNXA 2Q9MA 2ZC4B 3BLMA 2ZQ8A 3NBLA 2D01A 4YINA 3IH8A 3V5MA 5IHVA 1S67L 1H8MA 2C5WB 4DE0A 4K0XA 5EE8A 3K3DA 1YT4A 1BZAA 3WRTA 3T4OA 3DW0A 4M3KA 5HD5A 1P97A 3T1RA 3FKWA 2PD8A 1GHIA 1ES4A 3BY8A 1OMEA 5AQBA 1A0KA 4RX3A 4WM9A 5HWWA 4EUZA 3LFVA 4OONA 2WGWA 4Y2FA 4BBVA 1M40A 4RQ9A 4DJ2A 4DMZA 1LL8A 3WWXA 2B02A 2ZC3B 1E3UA 4DN0A 2HDQA 2ZC5B 4HQAA 5DJTA 1XX2A 1S4SA 3KSFA 2WKEA 3KO6A 1GSVA 3FV7A 3R7WB 1W8YA 2PRFA 3O87A 4HBTA 3JVUA 5J4EA 4HJ4A 1TDLA 1LL9A 1K0KA 1CF0A 3CG5A 3MMHA 3UE0A 3OBFA 1IEMA 3S22A 4JGRA 3AGDA 5L2FA 5CGWA 4S2JA 3PBTA 5DJUA 4K0WA 4MN7A 3IHAA 4JF5A 1K38A 2GZAA 2WAFA 3KYQA 3SH8A 1KDWA 1HTZA 5IT5A 2EXAA 2XEPA 2J9PA 2PU4A 4FCFA 3VSLA 4EBNA 4HIAA 1BT5A 4XT2A 2VV6A 4S2LA 4QPRA 3C4OA 3SS3A 5AJGA 4PM7A 3ZHHA 3MBZA 4GB7A 4LV0A 3GV9A 4GKUA 2Z6DA 2Y2IA 1IFQA 2VX8A 4R4SA 2VK3A 5HDDA 2KOIA 5KSHA 2B5RA 4EV4A 5HPIA 4E6XA 2YKHA 4PM5A 2PYRA 1UWPX 4JXWA 5TJJA 4O7DA 3FKVA 3UPOA 4UHUA 3KSIA 2GJ3A 1YQSA 2OAQ1 3P7NA 3FWLA 1TS7A 4OOYA 1TEMA 3LEZA 3LCEA 4NXFA 3ZQ5A 4E3OA 3NI9A 3EEAA 4FSFA 5EPHA 3BM6A 3IWOA 5J3WA 3CPTA 2H0TA 2XSSA 4X55A 1TD5A 2I9VA 3P09A 1L2SA 2MJ6A 1BUEA 4HJ6A 2HP5A 3EWKA 3UE3A 3BY9A 3VOZA 3HJIA 4JLFA 3KSGA 1LL5A 4GCZA 1DJAA 4GHIB 4Z1WA 3V3SA 4XUXA 4ME4A 5KSCA 4D2OA 3GDIA 3IX4A 1MWSA 2J3TC 4DXCA 2Z6CA 3N8LA 4P6ZM 1EW0A 2Y79A 1YLWA 4KZ4A 1G68A 4OKPA 5GHYA 4DE1A 4N1XA 3V67A 2Y55A 2QWSA 1XA7A 4ESPA 3OPPA 2UWXA 1NYMA 4O01A 4KZAA 4FOFA 3VP4A 1W63M 4RA7A 1ZKJA 1MWRA 1DRMA 5AQ7A 3IT9A 4DJ3A 4HEFA 3IQAA 5DKLA 2Y2KA 1CQAA 1L0FA 2K31A 2OAP1 3BFCA 4DDSA 2EA9A 1TDGA 4WYYA 2ZM2A 3UB7A 4L9GA 3P01A 2PAVP 1I2WA 2JCHA 4JGOA 1W8QA 3BWLA 1EWZA 1SKOB 1H3QA 5J8XA 2Y2HA 3OOVA
chains in the Genus database with same CATH topology
1F2KA 3LGOA 1SZVA 2V8CA 5EVEA 4QWOA 1VEUA 5FEFA 1HLUP 1PNEA 3NECA 2BTFP 5EM1A 1FIKA 3UB5P 2ACGA 2HZ5A 1YPRA 1FILA 1VEUB 2B95A 2E8JA 3DAVA 1AWIA 4FUWA 4D60A 5FDSA 3U4LP 2V8FA 3MSHA 1CJFA 2ZL1A 1PRQA 5FEGA 3KYEA 3NULA 4X1LA 2VK3A 4FTXA 3L7HA 4ESPA 3T1RA 1SKOA 5EV0A 1VETA 1D1JA 3T1QB 4X25A 3MS6A 2JKGA 1A0KA 1ACFA 3D9YA 3T1SA 3L9KA 2JKFA 1CQAA 1J3WA 3CHWP 3T12B 1Z09A 3CPTA 3T1XA 2ZL1B 2PAVP 1G5UA 1Y4OA 2PRFA 3LEQA 1PFLA 5EM0A 1SKOB 2PBDP 1VETB 3CPTB 1K0KA 4X1MA 1CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2K A;  3LGO A;  1SZV A;  2V8C A;  5EVE A;  4QWO A;  1VEU A;  5FEF A;  1HLU P;  1PNE A;  3NEC A;  2BTF P;  5EM1 A;  1FIK A;  3UB5 P;  2ACG A;  2HZ5 A;  1YPR A;  1FIL A;  1VEU B;  2B95 A;  2E8J A;  3DAV A;  1AWI A;  4FUW A;  4D60 A;  5FDS A;  3U4L P;  2V8F A;  3MSH A;  1CJF A;  2ZL1 A;  1PRQ A;  5FEG A;  3KYE A;  3NUL A;  4X1L A;  2VK3 A;  4FTX A;  3L7H A;  4ESP A;  3T1R A;  1SKO A;  5EV0 A;  1VET A;  1D1J A;  3T1Q B;  4X25 A;  3MS6 A;  2JKG A;  1A0K A;  1ACF A;  3D9Y A;  3T1S A;  3L9K A;  2JKF A;  1CQA A;  1J3W A;  3CHW P;  3T12 B;  1Z09 A;  3CPT A;  3T1X A;  2ZL1 B;  2PAV P;  1G5U A;  1Y4O A;  2PRF A;  3LEQ A;  1PFL A;  5EM0 A;  1SKO B;  2PBD P;  1VET B;  3CPT B;  1K0K A;  4X1M A;  1CF0 A; 
#chains in the Genus database with same CATH topology
 5AQ9 A;  4GW9 A;  5GLC A;  3RJU A;  2V8C A;  2JHE A;  1WE4 A;  1YM1 A;  4UA7 A;  3A3F A;  3IWI A;  4A5R A;  1DP9 A;  3VE3 A;  3MFX A;  3IF6 B;  4WZ4 A;  3UNW A;  4AFI A;  3T4J A;  5E2E A;  1ESI A;  4BD0 A;  2B95 A;  2QKP A;  1TF1 A;  4H6J B;  1CI9 A;  4LV3 A;  3S4X A;  3C7V A;  3IXG A;  3DWZ A;  5CHU A;  3U4L P;  1E4D A;  4WBG A;  4B88 A;  3CI6 A;  3N4I A;  1O07 A;  2Y2P A;  4HOI A;  2XD5 A;  4CPK A;  3H82 B;  3OC2 A;  4Q0I A;  2O99 A;  4BQM A;  2RCX A;  1XGJ A;  1P9W A;  1HD8 A;  4KUO A;  1FSY A;  2ZOI A;  5HWV A;  4II7 A;  1UGU A;  5L10 A;  3BW6 A;  4KQQ A;  2XH9 A;  3UMD A;  3C8C A;  1MZU A;  2PHY A;  5CEB A;  3KYZ A;  1XXM A;  4ARZ A;  1TVF A;  3V39 A;  5FQK A;  4JXG A;  3LI9 A;  3CHW P;  4MBK A;  3PHY A;  3OCL A;  1PI4 A;  3IX8 A;  4L9F A;  3A0V A;  2C6W B;  1XKZ A;  5F83 A;  1IYS A;  4IJG A;  2W3D A;  3PBO A;  1Q2P A;  4QB8 A;  3UY6 A;  2XA7 M;  3G31 A;  1JNU A;  2R9X A;  4NEE D;  2M7U A;  4ETZ A;  4Y3I A;  1GA9 A;  4S2N A;  2X71 A;  5CXW A;  2G7U A;  4Y0T A;  2Z2M B;  1NYY A;  2W3E A;  4EER A;  2WAE A;  3OPL A;  4EEU A;  1VM1 A;  4HP4 A;  2KLI A;  1XJ3 A;  1DJC A;  2DMW A;  1EI5 A;  4OP5 A;  3PTE A;  1STZ A;  3CIT A;  1KVL A;  2A24 A;  1IKI A;  1FSW A;  5U47 A;  4FTX A;  4ZRR A;  2A3U A;  4E3J A;  4LEN A;  1M6K A;  2JBF A;  1S6R A;  4EBP A;  2ZQ7 A;  1Z6F A;  3KX0 X;  3RTY A;  4S2I A;  4CJN A;  1N9N A;  5FQJ A;  5F68 A;  2XA7 S;  4B9O A;  4C3Q A;  5MC7 A;  3SZT A;  4MLL A;  5F69 A;  2V1Z A;  1LI9 A;  2EX6 A;  4NXE A;  5FDH A;  3B33 A;  3G2Y A;  4G3V A;  4I3A A;  2PDR A;  2VGJ A;  5FAS A;  3FPW A;  1OTE A;  3K3C A;  2HGV A;  1PFL A;  5EM0 A;  1MXO A;  3E4P A;  3G4P A;  3F1N B;  3HJK A;  2LB5 A;  5E2F A;  1XFQ A;  2M7V A;  3FG8 A;  3TW8 A;  5L07 A;  2VJW A;  4S2N C;  3TJZ C;  1ES5 A;  5EVI B;  3ZNT A;  2P9V A;  1HLU P;  3PAG A;  4B4X A;  1QMF A;  3NY4 A;  3UB5 P;  3LR0 A;  4QY5 A;  2Y2J A;  3VFH A;  4CLC D;  3O5Y A;  2L1M A;  2Y2G A;  2WKI A;  4X6T A;  2E8J A;  4YNR A;  1KE0 A;  1PWD A;  2BLS A;  2V2F F;  1I2S A;  1X0O A;  4EEP A;  1WYB A;  4FUW A;  3ZNY A;  4M4X A;  5EVL A;  4JXS A;  2V8F A;  2WGV A;  5FQQ A;  2P7J A;  5HZH A;  2NUT C;  2ZMA A;  1OJG A;  1NRF A;  3PR6 A;  3F1P A;  3MQO A;  1PZO A;  4KZ6 A;  3VV4 A;  4CQH A;  5D3O A;  5HL1 A;  1FCN A;  3MR0 A;  5GHZ A;  5A8B A;  4RX2 A;  4KG2 A;  2VKS A;  5TBM B;  1CEF A;  4DRT A;  1ACF A;  2OLU A;  3M2K A;  1OTB A;  2P08 A;  4GHI A;  4LV2 A;  3VP2 A;  2JKF A;  1OTA A;  3LY4 A;  3N7W A;  2WYX A;  2EFX A;  4EXO A;  1PIO A;  2W3F A;  5DTT A;  3G35 A;  3V50 A;  2EWV A;  1IYO A;  2W1R A;  1Z09 A;  4EWF A;  1LI0 A;  4Y17 A;  1PWG A;  1NRJ A;  3W8K A;  2LB9 A;  3W4O A;  3VMA A;  3WS0 A;  1P9R A;  4WMC A;  3UN7 A;  5EOO A;  2ZLY A;  5DFX A;  1N9L A;  4GS9 B;  3MXR A;  3C7U A;  3LYX A;  3O3V A;  1F2K A;  3LGO A;  2INW A;  1S0W A;  3ISG A;  5DTK A;  3RXW A;  4PM6 A;  4KZ3 A;  1BLS A;  1HVB A;  1XPB A;  5L8M A;  3A3J A;  2YKF A;  3GQZ A;  1PNE A;  4QU3 A;  3O86 A;  3ZVW A;  2H10 A;  1VQQ A;  5CHJ A;  2ACG A;  3MZD A;  3SH9 A;  4JGP A;  3LR4 A;  2J9O A;  2B18 A;  4NKP A;  3Q07 A;  1VEU B;  4JGQ A;  4IVK A;  3TRC A;  3N8S A;  1U60 A;  4Y5F A;  1NLY A;  2X02 A;  1H8Y A;  4WEK A;  4D60 A;  3PAE A;  1XJ6 A;  2BG1 A;  1F5M A;  3M2J A;  4GN2 A;  1OTD A;  5FAP A;  1I5Q A;  1HZO A;  4OPR A;  3HLW A;  3UE1 A;  1UWN X;  4L0L A;  4OQG A;  3L7H A;  1D06 A;  2WKQ A;  1P0Z A;  3C4P A;  1TS0 A;  1SKO A;  3A0S A;  4KZ7 A;  2Y59 A;  4OOM A;  4ZJ1 A;  4Z9Q A;  4KZ9 A;  5CER A;  3MS6 A;  1K56 D;  5CX7 A;  2WUQ A;  2K2N A;  3A3D A;  3E0Y A;  3D9Y A;  1L0E A;  1SHV A;  2OLV A;  5FAT A;  2J8Y A;  3BQA A;  2DCF A;  4OQI A;  3TE8 A;  1ERM A;  4OVD A;  4U0X A;  3IF6 A;  2Q0O A;  1T1A A;  2XRN A;  3EQV A;  3C2W A;  1W5D A;  5EVI D;  2PD7 A;  2ZM8 A;  5F6A A;  3VOY A;  5FSR A;  3LEQ A;  4H6J A;  3HLB A;  3RH8 B;  2ZJ9 A;  1ZC2 A;  1PWC A;  3OPH A;  2M1C A;  3H82 A;  5C5K A;  2J80 A;  5CED A;  3NIA A;  1JVJ A;  3G30 A;  3IS2 B;  1JWV A;  3DTI A;  5A90 A;  4LCL A;  1Q2Q A;  2NUP C;  3BEC A;  3EQU A;  1YLJ A;  2HPB A;  2WZZ A;  3E2K A;  4GNU A;  4MBH A;  2W1T B;  4BL3 A;  4LRX C;  2L0W A;  1KDS A;  2W3G A;  2ZQA A;  1IEL A;  3LIB A;  4JBF A;  1PRQ A;  1NZO A;  5HX9 A;  2KX6 A;  4ZAM A;  3UB8 A;  3ZG8 B;  2PR5 A;  1XJ4 A;  4ETX A;  2O9B A;  4E3K A;  4X25 A;  4Y15 A;  4IBR A;  5FI7 A;  2O0Y A;  4NET A;  1J3W A;  3IXB A;  2WGW B;  4C75 A;  1ESU A;  3PXP A;  2UV0 E;  3MXQ A;  2XK1 A;  3G32 A;  2JC7 A;  3MJQ A;  4B4Z A;  1NXY A;  3JPU A;  1VET B;  2ZBB A;  4YWZ A;  3MQQ A;  4WZ5 A;  1SKF A;  3IHB A;  1ONG A;  4MBF A;  2H28 A;  3T4Q A;  4E3L A;  5EVE A;  3UPN A;  5FEF A;  2E8I A;  1PI5 A;  1LLB A;  3NEC A;  3MXS A;  1BTL A;  5FI2 A;  3LUQ A;  4PM9 A;  4KQO A;  2Q9N A;  4C6Y A;  2ZMF A;  3LIE A;  3SW1 A;  5FA7 A;  3V3R A;  4UA9 A;  3LIC A;  2P74 A;  3T50 A;  2BAS A;  3FZC A;  3S1Y A;  3T4T A;  5EOE A;  5I5L A;  4LV1 A;  3MSH A;  2VV7 A;  5GLA A;  4XT2 B;  4XUZ A;  1NLZ A;  3Q81 A;  4HH2 A;  2EFU A;  4MMN A;  5TR7 A;  2JN7 A;  2V9A A;  3VP0 A;  3F1N A;  2ZQD A;  3E4O A;  1CK3 A;  4QHC A;  5CTN A;  3UDI A;  1XFN A;  3FYZ A;  3HLE A;  3Q7V B;  2AVX A;  1BUL A;  3GR2 A;  4PMA A;  3ZDJ A;  5A91 A;  3EGD C;  4DXB A;  2VGK A;  5DF7 A;  1G6O A;  4GLQ A;  3L9K A;  5GL9 A;  3JVV A;  4Y13 A;  3Q82 A;  4CLC B;  3SH7 A;  5DF8 A;  3NOU C;  1YAX A;  4BBU A;  1OT6 A;  3HUM A;  3T1X A;  3BFF A;  1YMX A;  3C38 A;  3IXD A;  5G18 A;  3LIA A;  5HPF A;  4WZ5 C;  5TFQ A;  1XP4 A;  5HAI A;  1XA1 A;  3CPT B;  3WS4 A;  3RFB A;  3O88 A;  4GD6 A;  1G6A A;  3PBN A;  3MKE A;  1CI8 A;  2OWJ A;  3Q1F A;  1J9M A;  4LPZ A;  2JKR M;  1Y54 A;  4OQH A;  4GDB A;  5L09 A;  3IF5 A;  4B93 A;  3LR5 A;  4OOL A;  2WKH A;  1YLZ A;  2K7S A;  4YFM A;  2J7V A;  4X53 A;  2KDK A;  3HRE A;  2Y2L A;  4P85 A;  4DDY A;  3Q7Z A;  3BLS A;  3EGX C;  4JF6 A;  3DTK A;  4KG5 A;  3H7W B;  4LRY C;  4Q8I A;  2W27 A;  5KIZ A;  1PW1 A;  4E3I A;  4HJ3 A;  4S2K A;  1MKI A;  5F5Y A;  3MKF A;  2VZW A;  5HAQ A;  4N9K A;  4BLM A;  3FPV A;  4UAA A;  4GS9 A;  3NHQ A;  1D1J A;  2IWC A;  3QP4 A;  1IYQ A;  2DRW A;  1VB6 A;  4BWI A;  4ID4 A;  1E3U D;  2VLG A;  3VSK A;  3CUE A;  3P98 A;  4ZJ2 A;  1H5X A;  2CC1 A;  2FFF B;  5EFW A;  4FH2 A;  4HY8 A;  3NDG A;  3R7W A;  4P87 A;  4RVA A;  4GDN A;  4IUK A;  3T12 B;  2EXB A;  1YKD A;  1ERQ A;  1SDN A;  1GCE A;  2HF6 A;  5AVE A;  2QYB A;  3IH9 A;  4OH0 A;  4WL9 A;  5IU1 A;  2EX2 A;  2X01 A;  3CLO A;  2Y8H A;  3QP6 A;  2PU2 A;  2R78 A;  4OP8 A;  2HP9 A;  1KE3 A;  4MN5 A;  4WEJ A;  3M6B A;  2HDR A;  4ZDX A;  1YLT A;  4KZ8 A;  5BOH A;  1GHP A;  3LI8 A;  2I72 A;  2PT7 A;  1KVM A;  2VV8 A;  2Y4A A;  1L0G A;  5CTM A;  3ZG7 B;  3WRZ A;  3DTE A;  2WGI A;  5DFY A;  4F3L B;  2J3T D;  3S7N A;  2XFS A;  3DAV A;  5JYP A;  3BRM A;  1ZTU A;  4Y0U A;  3PBR A;  4LRZ E;  2PYP A;  3SS4 A;  4MCW A;  3F1O B;  4BL2 A;  5CHM A;  1DP6 A;  3HCY A;  5FEG A;  2XLN A;  3NUL A;  4QJG A;  3TG9 A;  3MZF A;  5CRF A;  4GZB A;  3DWK A;  4BEN A;  3T4L A;  4R6L A;  3CZD A;  3BEB A;  4R4R A;  4GD8 A;  3CUE C;  3C5A A;  1KGF A;  4N9L A;  2ZC6 B;  4DE3 A;  1KGE A;  3G6O A;  2EX8 A;  1ZG6 A;  1ONH A;  3IS2 A;  3I7J A;  4EW7 A;  3MFD A;  2XDM A;  4R70 A;  3FC7 A;  4EQI A;  1K4E A;  1IOU A;  2QJ5 A;  2ZL1 B;  2EX9 A;  4HBU A;  3NDE A;  1G5U A;  3H9W A;  5A92 A;  2OV5 A;  4BJP A;  1TS6 A;  3EOI A;  3AGE A;  4P0M A;  5DF9 A;  4R3J A;  3TSG A;  5JYO A;  2XFT A;  5EUA A;  5FQM A;  3WS2 A;  1S1Z A;  4E3M A;  1DP8 A;  3B47 A;  3A0R A;  2OSU A;  1VHM A;  1MC0 A;  4HH3 A;  2QZ6 A;  3ITB A;  5EM1 A;  1WA9 A;  1OTI A;  1TS8 A;  2D02 A;  5F1F A;  3HVF A;  5M19 A;  4HNB A;  3MQ0 A;  3ZG0 A;  4MNR A;  4UA6 A;  5FQ9 A;  3D72 A;  3RXX A;  5G4Z A;  1O7E A;  5FDS A;  5KMW A;  4YOF A;  3EEH A;  5FAO A;  4UEY A;  1BLP A;  3OCN A;  4KG6 A;  4OPZ A;  4R1G A;  2WAD A;  1IYP A;  4E3N A;  1KE4 A;  2FZ0 A;  2H5S A;  3CWF A;  1L3L A;  3NC8 A;  3HBR A;  1VET A;  3QP5 A;  2A24 B;  4LCM A;  1DJB A;  4HP9 A;  2QJ7 A;  1PW8 A;  2XD1 A;  3W4P A;  3T1S A;  5E2G A;  4DE2 A;  3BQ8 A;  2WKP A;  1LSX A;  1OPX A;  4HES A;  3DBA A;  3NOT C;  3ICY A;  1FR6 A;  4OPY A;  3BFG A;  4MDZ A;  4PKY G;  1GSX A;  2RL3 A;  3A3E A;  1GSW A;  1MPL A;  5CGX A;  4I3J A;  3GMW A;  1K57 A;  3LY3 A;  2GDN A;  4S2M A;  3JYI A;  4IVI A;  1K54 A;  4DKI A;  4BMW A;  1H0M A;  3UME A;  2V0W A;  5HDC A;  4PPR A;  2BTF P;  5HW3 A;  5AVF A;  5DVA A;  1JWZ A;  3Q7V A;  1KGG A;  1OJ5 A;  4OLD A;  5F82 A;  1NWZ A;  1MY8 A;  2QHK A;  1FCO A;  1YPR A;  2XQZ A;  3PYP A;  3N6I A;  2FH5 A;  3HLD A;  2WK0 A;  2P9V B;  4R3A A;  3LO7 A;  2IA2 A;  2R9W A;  3HUO A;  1AWI A;  4JKT A;  2Y91 A;  1RGY A;  2ZMV A;  4CLC A;  1PZP A;  1NZU A;  3UB6 A;  1K4F A;  1H8Z A;  5HD3 A;  2WKR A;  5J7E A;  5K5B A;  4N92 A;  2ZOH A;  4PHT A;  1ERO A;  3GRJ A;  1BSG A;  3CAX A;  4O8G A;  2DNS A;  1F9I A;  1T1C A;  4H8R A;  5HAR A;  4I3I A;  4X68 A;  4G3W A;  5CGS A;  3F1P B;  1K55 A;  1N9O A;  1C3B A;  4BD1 A;  3CJM A;  2OWH A;  5CEC A;  2HDU A;  4I39 A;  4LFU A;  2ZM0 A;  1QME A;  5I94 A;  2VA0 A;  3IXH A;  4IUH A;  3QNB A;  3QP8 A;  1K57 C;  4ZJ3 A;  3KSH A;  3VFF A;  1K54 C;  1FR1 A;  4JF4 A;  1DY6 A;  3N8R A;  4GJ4 A;  1S1Y A;  3ZGA B;  1IKG A;  2QMI A;  3IF6 C;  3H7W A;  2PBD P;  2XRO A;  1BLH A;  3D4F A;  2EWW A;  4U0T A;  4X56 A;  3IBJ A;  3S7O A;  3C30 A;  1ODV A;  1RP5 A;  1JTG A;  3QP1 A;  4QY6 A;  3GEC A;  3NOP C;  1XGI A;  3D3O A;  4BBT A;  1KOU A;  4Q0H A;  3LIF A;  2Z2L B;  2HDS A;  4CLC C;  4PM8 A;  4L9E A;  2CMN A;  2H0Y A;  1V9Z A;  1ALQ A;  2A49 A;  3W4Q A;  4R0Q A;  4U3T A;  1SCW A;  4LGW A;  2Y2M A;  5KZH A;  3ULF A;  3QP2 A;  1S66 L;  2JKT I;  5GHX A;  1V9Y A;  4NK3 A;  1W63 Q;  4MEZ A;  3UDF A;  1S4R A;  2XGN A;  1ES2 A;  5GLD A;  2HJ9 C;  2V0U A;  1FCM A;  1T18 A;  3ZYT A;  5GLB A;  4NXG A;  5FQI A;  4R23 A;  1L0D A;  1K55 C;  4ZTK A;  1ZG4 A;  2ZC7 A;  1BYW A;  1YLY A;  4Y7P A;  4EBL A;  5HSQ A;  1F98 A;  3UE6 A;  2GX5 A;  1OT9 A;  3OZH A;  5FI6 A;  4EQ1 A;  1W79 A;  4G3K A;  5IS1 A;  2IWB A;  1K56 A;  2JKR I;  1T1B A;  1YLP A;  1JTD A;  4WEL A;  5DKK A;  3SS5 A;  1NY0 A;  3GVB A;  4NXB A;  4NG2 A;  5F1G A;  4P6Z S;  4GOG A;  4F3L A;  4HHD A;  1FOF A;  3E2L A;  3T4S A;  5M1A A;  2HV1 A;  3B42 A;  1FQG A;  5EVI A;  3F1O A;  5HFO A;  1CEG A;  3CMZ A;  4IED A;  4S2O A;  2JKT M;  4UQI M;  1T19 A;  1MWT A;  2OOL A;  3AGF A;  1K6S A;  4QD4 A;  3NCK A;  4E04 A;  3HLG A;  4R38 A;  2ZQ9 A;  3R4K A;  1NJ4 A;  1FIL A;  2WZX A;  4K08 A;  2XR0 A;  1N4O A;  3ZCZ A;  3HL9 A;  1G28 A;  4JPM A;  4Y0O A;  2ZL1 A;  3KYE A;  1YSQ A;  4XXR A;  3UDX A;  5TBM A;  4KEN B;  3MF0 A;  5EEC A;  3IBR A;  2O9C A;  3GTC A;  4O0P A;  2VEA A;  4LLO B;  2O9A A;  4DF6 A;  2L4R A;  2Y2N A;  4EES A;  1MKM A;  4IBX A;  4UQI S;  2IWD A;  4X69 A;  2VGL M;  4WMC D;  1D7E A;  1E25 A;  2ZD8 A;  3E4Q A;  3BFE A;  3BFD A;  3W2Z A;  4I38 A;  1W7F A;  4N1H A;  1LSV A;  3K2N A;  5EVI C;  4EUV A;  5A93 A;  2G2W A;  1K25 A;  3BYD A;  2PBY A;  1Y4O A;  4MN6 A;  3IWQ A;  3S7Q A;  3VP1 A;  3QNC A;  2ZQC A;  4S2P A;  4PKY A;  3HUN A;  3ZG9 B;  4X1M A;  5AQA A;  2G2U A;  3M6H A;  1SZV A;  1K6R A;  1XJ2 A;  5G4Y A;  4QWO A;  1JWP A;  4KZ5 A;  1VEU A;  2FFY A;  4KQR A;  2HP6 A;  2QPN A;  3HLC A;  1FIK A;  1MBL A;  3T4K A;  3WS1 A;  5HAP A;  4FH4 A;  4KZB A;  2HZ5 A;  3WS5 A;  1LHY A;  1AXB A;  2V1B A;  4WN5 A;  4OLG A;  3LID A;  3PBQ A;  1LT0 A;  4F94 A;  1LSW A;  2JE5 A;  4K91 A;  4JXV A;  1RGZ A;  3A3I A;  4I5S A;  3G2Z A;  3VOL A;  2Y2O A;  3ZVT A;  2A2L A;  4KUK A;  1MWU A;  4Q0J A;  3IX3 A;  1CJF A;  3B3X A;  4OPQ A;  2W0N A;  1WYC A;  4X1L A;  2V20 A;  1YMS A;  3TOI A;  5E2H A;  5HL6 A;  3HLF A;  5LBR A;  4CLC E;  2VGL S;  4HI4 A;  1RCJ A;  5EV0 A;  4RYE A;  1PYY A;  5HWT A;  3T1Q B;  1GA0 A;  2PR6 A;  2JKG A;  5HDS A;  1Y28 A;  5E43 A;  1ZHH B;  1SDE A;  3DTM A;  3G34 A;  4FD8 A;  5M18 A;  4IHQ A;  1ES3 A;  3ITA A;  3ZFZ A;  5TGF A;  5DTS A;  3VP3 A;  4P6B A;  3MZE A;  3OPR A;  5FAQ A;  2J3W A;  4KQD A;  4WUJ A;  2V1A A;  4E6W A;  3NJA A;  3PBS A;  4EET B;  4EU0 A;  4OQ0 A;  2Y2Q A;  4PAU A;  3S7P A;  4WLA A;  3UPP A;  3VE4 A;  4WF0 A;  3SOI A;  2XF3 A;  3LR3 A;  3U2A A;  1GHM A;  1YSP A;  2HJE A;  4R3B A;  3GSG A;  2W3H A;  3E98 A;  5FL3 A;  3UB9 A;  1BLC A;  4ARZ B;  2W1T A;  3BJN A;  3ZG5 A;  1N9B A;  3QHY A;  2P04 A;  3UO9 A;  4ZBE A;  3OLO A;  2GNX A;  2Q9M A;  2ZC4 B;  3BLM A;  2ZQ8 A;  3NBL A;  2D01 A;  4YIN A;  3IH8 A;  3V5M A;  5IHV A;  1S67 L;  1H8M A;  2C5W B;  4DE0 A;  4K0X A;  5EE8 A;  3K3D A;  1YT4 A;  1BZA A;  3WRT A;  3T4O A;  3DW0 A;  4M3K A;  5HD5 A;  1P97 A;  3T1R A;  3FKW A;  2PD8 A;  1GHI A;  1ES4 A;  3BY8 A;  1OME A;  5AQB A;  1A0K A;  4RX3 A;  4WM9 A;  5HWW A;  4EUZ A;  3LFV A;  4OON A;  2WGW A;  4Y2F A;  4BBV A;  1M40 A;  4RQ9 A;  4DJ2 A;  4DMZ A;  1LL8 A;  3WWX A;  2B02 A;  2ZC3 B;  1E3U A;  4DN0 A;  2HDQ A;  2ZC5 B;  4HQA A;  5DJT A;  1XX2 A;  1S4S A;  3KSF A;  2WKE A;  3KO6 A;  1GSV A;  3FV7 A;  3R7W B;  1W8Y A;  2PRF A;  3O87 A;  4HBT A;  3JVU A;  5J4E A;  4HJ4 A;  1TDL A;  1LL9 A;  1K0K A;  1CF0 A;  3CG5 A;  3MMH A;  3UE0 A;  3OBF A;  1IEM A;  3S22 A;  4JGR A;  3AGD A;  5L2F A;  5CGW A;  4S2J A;  3PBT A;  5DJU A;  4K0W A;  4MN7 A;  3IHA A;  4JF5 A;  1K38 A;  2GZA A;  2WAF A;  3KYQ A;  3SH8 A;  1KDW A;  1HTZ A;  5IT5 A;  2EXA A;  2XEP A;  2J9P A;  2PU4 A;  4FCF A;  3VSL A;  4EBN A;  4HIA A;  1BT5 A;  4XT2 A;  2VV6 A;  4S2L A;  4QPR A;  3C4O A;  3SS3 A;  5AJG A;  4PM7 A;  3ZHH A;  3MBZ A;  4GB7 A;  4LV0 A;  3GV9 A;  4GKU A;  2Z6D A;  2Y2I A;  1IFQ A;  2VX8 A;  4R4S A;  2VK3 A;  5HDD A;  2KOI A;  5KSH A;  2B5R A;  4EV4 A;  5HPI A;  4E6X A;  2YKH A;  4PM5 A;  2PYR A;  1UWP X;  4JXW A;  5TJJ A;  4O7D A;  3FKV A;  3UPO A;  4UHU A;  3KSI A;  2GJ3 A;  1YQS A;  2OAQ 1;  3P7N A;  3FWL A;  1TS7 A;  4OOY A;  1TEM A;  3LEZ A;  3LCE A;  4NXF A;  3ZQ5 A;  4E3O A;  3NI9 A;  3EEA A;  4FSF A;  5EPH A;  3BM6 A;  3IWO A;  5J3W A;  3CPT A;  2H0T A;  2XSS A;  4X55 A;  1TD5 A;  2I9V A;  3P09 A;  1L2S A;  2MJ6 A;  1BUE A;  4HJ6 A;  2HP5 A;  3EWK A;  3UE3 A;  3BY9 A;  3VOZ A;  3HJI A;  4JLF A;  3KSG A;  1LL5 A;  4GCZ A;  1DJA A;  4GHI B;  4Z1W A;  3V3S A;  4XUX A;  4ME4 A;  5KSC A;  4D2O A;  3GDI A;  3IX4 A;  1MWS A;  2J3T C;  4DXC A;  2Z6C A;  3N8L A;  4P6Z M;  1EW0 A;  2Y79 A;  1YLW A;  4KZ4 A;  1G68 A;  4OKP A;  5GHY A;  4DE1 A;  4N1X A;  3V67 A;  2Y55 A;  2QWS A;  1XA7 A;  4ESP A;  3OPP A;  2UWX A;  1NYM A;  4O01 A;  4KZA A;  4FOF A;  3VP4 A;  1W63 M;  4RA7 A;  1ZKJ A;  1MWR A;  1DRM A;  5AQ7 A;  3IT9 A;  4DJ3 A;  4HEF A;  3IQA A;  5DKL A;  2Y2K A;  1CQA A;  1L0F A;  2K31 A;  2OAP 1;  3BFC A;  4DDS A;  2EA9 A;  1TDG A;  4WYY A;  2ZM2 A;  3UB7 A;  4L9G A;  3P01 A;  2PAV P;  1I2W A;  2JCH A;  4JGO A;  1W8Q A;  3BWL A;  1EWZ A;  1SKO B;  1H3Q A;  5J8X A;  2Y2H A;  3OOV A; 
#chains in the Genus database with same CATH homology
 1F2K A;  3LGO A;  1SZV A;  2V8C A;  5EVE A;  4QWO A;  1VEU A;  5FEF A;  1HLU P;  1PNE A;  3NEC A;  2BTF P;  5EM1 A;  1FIK A;  3UB5 P;  2ACG A;  2HZ5 A;  1YPR A;  1FIL A;  1VEU B;  2B95 A;  2E8J A;  3DAV A;  1AWI A;  4FUW A;  4D60 A;  5FDS A;  3U4L P;  2V8F A;  3MSH A;  1CJF A;  2ZL1 A;  1PRQ A;  5FEG A;  3KYE A;  3NUL A;  4X1L A;  2VK3 A;  4FTX A;  3L7H A;  4ESP A;  3T1R A;  1SKO A;  5EV0 A;  1VET A;  1D1J A;  3T1Q B;  4X25 A;  3MS6 A;  2JKG A;  1A0K A;  1ACF A;  3D9Y A;  3T1S A;  3L9K A;  2JKF A;  1CQA A;  1J3W A;  3CHW P;  3T12 B;  1Z09 A;  3CPT A;  3T1X A;  2ZL1 B;  2PAV P;  1G5U A;  1Y4O A;  2PRF A;  3LEQ A;  1PFL A;  5EM0 A;  1SKO B;  2PBD P;  1VET B;  3CPT B;  1K0K A;  4X1M A;  1CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...