1HLUP

Structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an open state of beta-actin at 2.65 A resolution.
pubmed doi rcsb
molecule tags Complex (acetylation/actin-binding)
molecule keywords BETA-ACTIN
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1hluP00
1CF0A 2V8CA 1FILA 3U4LP 3T12B 2PBDP 2ZL1B 1AWIA 2JKGA 5FDSA 5EM1A 3NECA 1Z09A 1ACFA 2HZ5A 3T1QB 5FEGA 1F2KA 1CQAA 1VEUA 2B95A 3MSHA 4D60A 4X1MA 1A0KA 1Y4OA 5FEFA 1SZVA 2ACGA 1SKOA 5EV0A 1PRQA 3MS6A 2E8JA 1PNEA 2ZL1A 2BTFP 2PAVP 4FTXA 3CPTB 3UB5P 1VETA 3L7HA 3DAVA 1YPRA 1G5UA 4X25A 3KYEA 3D9YA 3L9KA 2PRFA 3T1SA 1SKOB 1D1JA 1PFLA 1J3WA 3T1RA 1K0KA 2V8FA 3NULA 4FUWA 4QWOA 4ESPA 2JKFA 1VEUB 1FIKA 2VK3A 3CHWP 3LEQA 5EVEA 1HLUP 1CJFA 3CPTA 3T1XA 1VETB 5EM0A 4X1LA 3LGOA
chains in the Genus database with same CATH superfamily
2JHEA 5DJUA 4O7DA 5AQ9A 3ZVTA 5GHZA 1F2KA 2PR5A 4CLCD 3BFFA 1F98A 3D4FA 5HD5A 1IEMA 4DKIA 2GJ3A 5KMWA 2JC7A 2XDMA 1VQQA 2ZQ7A 3K2NA 5FL3A 3UPNA 3GV9A 5HFOA 1PI4A 5FDHA 4HH2A 1PIOA 5TBMA 5DTKA 3PYPA 2VLGA 3BFDA 1MWSA 2Z2LB 3OZHA 3ULFA 3ICYA 3A3DA 4C6YA 4MDZA 3B3XA 4PKYA 2ZC5B 2HP5A 4OQIA 3G6OA 3R7WB 2ZL1B 3OPPA 4I3AA 4OOYA 3F1OB 4L9FA 4Z9QA 3T4TA 3QP2A 3WWXA 5FASA 1UWNX 4N92A 3OCNA 2OWJA 4KZ4A 3TRCA 5F6AA 1NZUA 1ESUA 1HZOA 3GMWA 5GLDA 4UQIS 5HPFA 4FD8A 2H28A 4UEYA 4E04A 4P6ZS 1AWIA 1FR1A 1CEFA 4DE1A 1YMXA 2OSUA 4Q0HA 5GHYA 2DNSA 2PD7A 5EOOA 3UB8A 4PM5A 4OLDA 4OH0A 1Y54A 5A91A 1GSXA 1YAXA 1W7FA 5A93A 2V1AA 5FDSA 1WYCA 5L2FA 1JWPA 3NI9A 3V67A 2J7VA 1ES3A 1Z6FA 3LCEA 3W4OA 4II7A 2KDKA 5FQIA 3EEAA 1K0KA 4FCFA 1ONGA 2AVXA 3HLBA 1MBLA 3NDGA 1TVFA 1YM1A 4EEUA 2H0YA 5DF9A 5E2GA 2WGVA 2ZLYA 4KG5A 3ZG9B 4HP4A 1S66L 3K3CA 2QMIA 2QZ6A 5KSCA 1JTGA 2HDQA 4YWZA 3PAEA 4B4XA 5EM0A 5IT5A 2ZQ9A 1K25A 3CAXA 3GDIA 5L07A 2PU2A 5M18A 3IF5A 3C38A 4P6BA 3UPOA 1XA7A 4LGWA 1ES4A 3NJAA 4QWOA 3NC8A 4PM6A 5F1FA 4BBVA 4EBLA 4QB8A 1M40A 4LLOB 5F69A 4MLLA 3FPVA 4PKYG 2WK0A 5CTMA 5E43A 1ZHHB 2HP9A 5CEBA 5GLAA 4X25A 3DWKA 5KIZA 3SS4A 2XLNA 3FC7A 1NJ4A 1FIKA 2HDRA 3ZGAB 3PBQA 4GS9B 3UE0A 4BENA 3KSIA 2KX6A 3H9WA 1K56A 4HJ4A 1T19A 4GLQA 4ZAMA 5HAIA 3IQAA 4YOFA 2Y2LA 3CITA 2VK3A 2VGLS 3SS5A 5IS1A 3LGOA 4FH2A 2V0UA 3Q82A 2YKHA 2PBYA 1PWCA 3LICA 4XUZA 1S0WA 4S2MA 1FCOA 4EXOA 4KZ7A 1G68A 1HVBA 4S2IA 1G6AA 5FSRA 4C75A 3IH8A 2V8FA 5HDDA 2P04A 1IKIA 4N9KA 2X71A 3OCLA 3U4LP 4X68A 3IH9A 3QP5A 3BFGA 3BYDA 3PBRA 4K0WA 4NEED 3R7WA 3GRJA 5HPIA 3UB5P 2JN7A 1PZPA 1KVLA 3T1SA 3C2WA 4Y7PA 1CJFA 5TR7A 3G30A 5AVFA 3KX0X 5C5KA 2ZOIA 3K3DA 3E4QA 1LSVA 5F83A 1YMSA 4KENB 3IF6B 3GR2A 5HDSA 4R3AA 4PHTA 5G4ZA 5J3WA 4WZ4A 3HLWA 4S2OA 1NZOA 4KUKA 1E3UA 1NWZA 4G3VA 4DE0A 3HL9A 1K54A 5J8XA 4JKTA 4HH3A 4Z1WA 3UE6A 4JF4A 4MN6A 5DJTA 3UB7A 3LUQA 1SCWA 3M2KA 4N1HA 4NXBA 1TF1A 4Y13A 3C7UA 5HL1A 2Y8HA 1VEUB 1H0MA 4GDBA 3LIDA 3FKWA 5EM1A 4B93A 2P9VB 2Y2OA 2Y79A 3OPHA 3PTEA 1ZC2A 4B9OA 1P0ZA 2HDSA 1OMEA 2EX9A 2ZC4B 4RA7A 4JXGA 3LR4A 2WADA 4PM9A 1H3QA 3E4OA 1HTZA 5TGFA 2K2NA 3T12B 1TS8A 4KZAA 2Z6DA 2Q9MA 3C7VA 3OOVA 2ZC3B 3EWKA 3RJUA 4X69A 1YT4A 5D3OA 3L9KA 4HHDA 1NRFA 2Y2GA 2MJ6A 3OPRA 3UE3A 3U2AA 5EPHA 3T1XA 2WGWA 3VE4A 3IWIA 2JE5A 2JKRI 2JKGA 4BQMA 3HLDA 4JLFA 1FOFA 2KLIA 2H0TA 1GHPA 4CQHA 4E3IA 1S4RA 3UPPA 1NRJA 3BM6A 5GLCA 4OOMA 1KOUA 2VKSA 2QJ5A 3UE1A 1ZG6A 1EW0A 4D2OA 2D01A 3ZVWA 3IHBA 4QD4A 3F1PB 1T18A 2INWA 3A0RA 1S6RA 1XFNA 5CHMA 5U47A 1BULA 1PRQA 2JKTM 4E6XA 4MBFA 4DJ3A 2PR6A 1H8YA 4N9LA 1IKGA 2VGKA 1BLCA 4XXRA 4OONA 3LY3A 4CJNA 2R78A 1BSGA 4GKUA 3RXWA 1OTAA 4MBKA 5DF7A 1MXOA 4JF5A 3E2KA 3QHYA 3IHAA 4R38A 2FH5A 3N8LA 3KSHA 4F3LA 2R9WA 4BLMA 2VEAA 3TOIA 2DRWA 1L3LA 1U60A 4MCWA 2Y2PA 5J7EA 1KE3A 5I94A 3PHYA 3SOIA 4LV1A 4ETZA 1O07A 1N9LA 5HX9A 3UO9A 1AXBA 1FCMA 1FSWA 2HPBA 2CMNA 1K6RA 2IWCA 4WMCA 3FYZA 3HJIA 1CI8A 2IA2A 4RQ9A 3WS1A 3KYZA 3WS5A 3KSFA 4KQDA 1S67L 2HJEA 3S7OA 2VZWA 3G2ZA 4IUKA 2WKRA 4E3JA 4X1MA 2EFXA 2XFTA 3G4PA 2ZQAA 4N1XA 4HQAA 4FSFA 3KYQA 4KQOA 4YNRA 3N8SA 4Y15A 1YLPA 4GZBA 4M3KA 2W27A 4ZDXA 5FEGA 3HLEA 1XX2A 3S22A 4EUVA 3NIAA 3QP4A 2VJWA 3H7WA 5E2EA 4ZJ3A 3CWFA 3O88A 3NHQA 2HP6A 5FI6A 4ZJ2A 1GA0A 2R9XA 5KZHA 3LIBA 4Y0OA 2GX5A 3MSHA 4B4ZA 4I3JA 4FOFA 3P98A 4KUOA 1S1ZA 4A5RA 4DDYA 1DJCA 4P6ZM 2OAP1 3NULA 3R4KA 4BL3A 5FAQA 1LHYA 3FV7A 5GL9A 1IOUA 1HD8A 1K4EA 2WKQA 3E98A 3PBTA 1W8YA 5CECA 3CMZA 1BT5A 2W3FA 1WA9A 5DKKA 3SZTA 2HGVA 4RVAA 4BJPA 3B33A 2J9OA 4R3JA 1TD5A 3UDXA 3MR0A 5FA7A 1L0EA 5HW3A 2HDUA 3NOTC 4Y5FA 3MZDA 2XGNA 2V1BA 1I5QA 3ZHHA 3S7QA 4GHIA 4DN0A 1SKFA 2JKFA 2VGJA 4P85A 1MY8A 4HIAA 4I38A 1Q2QA 1SHVA 1Y28A 5FQ9A 1T1AA 1SKOA 3CI6A 3BRMA 2ZMAA 3F1PA 3VMAA 1D06A 3N8RA 1GSVA 2WYXA 2Y2NA 1LL9A 5KSHA 2WAFA 1X0OA 3FG8A 1NYMA 3W8KA 1CI9A 3BJNA 3FWLA 5CEDA 4BBTA 4NETA 2VV7A 4WL9A 2M7UA 5GLBA 3V3RA 5EVIA 4JGPA 4FTXA 3BW6A 3G35A 4WMCD 1BZAA 4YINA 1YLYA 3TJZC 3IWQA 2W1RA 1W63M 4GJ4A 1DJAA 1IFQA 1STZA 2QJ7A 3I7JA 1G28A 4JXWA 5EVLA 1XJ6A 1V9YA 3MZEA 3LY4A 3WRZA 2OOLA 5L09A 4KG2A 3SW1A 5DKLA 3KO6A 3ZFZA 3T4OA 2PT7A 4UA6A 4NXEA 1YSQA 3IXBA 4NKPA 3BY9A 3C5AA 5TFQA 1NYYA 1RP5A 5HD3A 3TE8A 2XK1A 3IF6A 3CHWP 5F68A 1DP9A 3N4IA 4OPZA 2PBDP 2HV1A 3P09A 5AJGA 2X02A 4EESA 1E25A 4F94A 2QKPA 1K56D 2B02A 1JVJA 3M6BA 3MS6A 5LBRA 5CTNA 4NXGA 1JNUA 1G5UA 3G32A 2LB5A 3JVUA 4XT2A 2L0WA 1V9ZA 5M19A 4LRZE 3VP4A 3AGFA 1NY0A 2O9CA 3N7WA 5FI2A 1GHIA 1TS0A 1K55C 5AQ7A 3F1NA 4I5SA 1KGEA 2ZBBA 2QHKA 4KZ6A 4IVKA 2RCXA 4H6JB 4LRXC 1TEMA 3ZDJA 4QJGA 2BASA 3IX4A 1LT0A 1FSYA 3C4PA 1OT9A 2Z6CA 5BOHA 3IS2A 4GOGA 4LPZA 2B18A 1PI5A 3HJKA 2C5WB 3A0VA 3A0SA 3P01A 5CGSA 4EUZA 4YFMA 4OVDA 2V9AA 3GSGA 4HJ3A 2W1TB 4ID4A 2CC1A 3LEZA 3DTKA 4EETB 2DCFA 1MWRA 4CLCA 4RX2A 3VOZA 2EXBA 1TDLA 2Y4AA 3B47A 1IYSA 1KDSA 1RGYA 1EI5A 1CQAA 2VV8A 2WGWB 2Y2HA 4QY5A 3GECA 3O5YA 1PWDA 4M4XA 4OQHA 3ZG7B 5DTSA 5A90A 1KDWA 2XD5A 3H82A 5HWTA 3FPWA 3EQVA 4GHIB 1F5MA 4OP5A 3BLSA 5CX7A 4U3TA 3PR6A 1UGUA 4CLCC 3O87A 4KZ9A 4XUXA 2J3WA 2EFUA 5DFYA 2A2LA 4Y2FA 2Y2JA 1IELA 4GB7A 1A0KA 3MXQA 4Q8IA 2Q0OA 4WUJA 3W4QA 3CZDA 2PU4A 3DW0A 2WKHA 1K57C 3VOLA 4R1GA 1XJ3A 4O0PA 3UMDA 5CHUA 4JBFA 2NUTC 5MC7A 2WKPA 3IX8A 3MQOA 3NDEA 2GDNA 2K7SA 2Q9NA 4UAAA 3QNCA 3OBFA 4OKPA 2XSSA 3ITAA 2W3EA 4IJGA 3A3IA 5CGXA 3GTCA 3HVFA 1YSPA 2ZJ9A 4UA7A 3IBJA 1FR6A 3AGEA 1S1YA 1MPLA 1ONHA 4KZ8A 3O86A 1K57A 4OP8A 2XD1A 2J80A 2WAEA 4WZ5A 3Q7VA 2FFFB 3N6IA 1ODVA 3LR0A 3VP1A 1SDEA 4I39A 1VETB 4X6TA 4LCMA 4E3LA 4S2KA 4BD1A 4KQRA 4R0QA 1I2SA 4RYEA 5FEFA 2J3TD 1K55A 1ERMA 2VV6A 3NCKA 5EVIC 5HL6A 5IU1A 5EE8A 4BBUA 4UA9A 2P9VA 2B5RA 2XFSA 2Y59A 4HOIA 3UMEA 2NUPC 4Y3IA 1GCEA 4XT2B 3DTMA 2OLUA 3VV4A 1BTLA 4WZ5C 3A3EA 3WS0A 4U0TA 3HUOA 4HNBA 1KE4A 3LR5A 1LLBA 3B42A 4EEPA 3T50A 1IYOA 4X55A 3Q7ZA 3BFCA 1BLSA 4X1LA 5EOEA 1DJBA 1W5DA 3G2YA 2FFYA 3ZQ5A 4BD0A 3CUEA 2ACGA 3MKEA 3SS3A 5DFXA 5DTTA 3V39A 4WYYA 1XP4A 1N4OA 2WKIA 1JTDA 2ZMFA 2Y91A 2DMWA 3SH7A 3SH8A 3T4QA 5HWVA 3DTEA 1D7EA 4L9EA 4R70A 3OLOA 1TS7A 3G31A 1L0GA 2FZ0A 4KQQA 4GNUA 3L7HA 3PAGA 4JGRA 5EECA 1LL5A 2HJ9C 4OPQA 5JYPA 1I2WA 5TJJA 2ZQ8A 3ZG0A 4E3MA 4OOLA 1VHMA 4UQIM 5FI7A 4QY6A 2VA0A 3S4XA 2G2WA 2H10A 3UB9A 1SKOB 3NY4A 3S7NA 4HBUA 5HARA 3VSLA 1BLHA 4WN5A 3C4OA 3C30A 2Z2MB 4KG6A 4LV3A 2BTFP 1H5XA 1M6KA 3V5MA 4OQGA 1LSXA 3UNWA 3OPLA 3UY6A 5EVIB 1ES2A 4Y0TA 3DTIA 1P9RA 2LB9A 4GD8A 1XKZA 4PAUA 1N9NA 2OLVA 4BWIA 1Y4OA 1PZOA 1QMEA 5A92A 3CJMA 2ZL1A 4EV4A 2H5SA 2KOIA 3HLFA 5E2FA 5F5YA 4MBHA 4ARZB 1PFLA 3E0YA 4NXFA 4L9GA 5EVID 2I72A 2PHYA 1GA9A 5HZHA 3QP8A 1VB6A 3EOIA 5FQQA 3E2LA 3W2ZA 3MF0A 4EU0A 4JGQA 2UWXA 4WEJA 4DJ2A 3MMHA 4BMWA 5HSQA 3H7WB 2K31A 2XA7M 4WM9A 1PYYA 2W3GA 2WUQA 1J9MA 3NOUC 3BEBA 1OTEA 4C3QA 2J3TC 3VP0A 3WS4A 4PM7A 3LFVA 2D02A 3E4PA 4O01A 4R3BA 2EXAA 3UB6A 4CLCE 3CPTA 1TDGA 5IHVA 1MKIA 5K5BA 1L0FA 4EQ1A 4NK3A 4KZ5A 3MFDA 4UHUA 1IYQA 1L2SA 5I5LA 3RFBA 4EBNA 4I3IA 3MXRA 1UWPX 2O9AA 1W79A 1OPXA 5HDCA 4G3WA 1J3WA 4KZ3A 3T4SA 1F9IA 2OWHA 1P97A 2A24B 4H6JA 3V3SA 1FQGA 1IYPA 5L8MA 3PBSA 2Y2MA 3EGXC 2WZZA 2I9VA 3T1QB 3BFEA 4JXSA 4EW7A 3IS2B 1BLPA 4S2JA 2YKFA 4WLAA 2XROA 2ZC7A 1E4DA 1OTDA 3M6HA 4X53A 4WELA 3D3OA 3LR3A 3KYEA 1XXMA 2PRFA 3MBZA 2V1ZA 3CLOA 3TG9A 2EX2A 2EWVA 2W1TA 5FATA 3BLMA 1JWZA 1ACFA 3W4PA 5DVAA 3LIFA 2VX8A 3BWLA 2JKRM 2OAQ1 1NLZA 2J8YA 2XRNA 5HWWA 3NOPC 2EX8A 2XH9A 4R4SA 2E8JA 2PYRA 3QP1A 1G6OA 3IF6C 2Y55A 1H8MA 4GD6A 2QPNA 2E8IA 3HCYA 2P74A 3VP3A 4D60A 3H82B 4DMZA 2WZXA 2HF6A 2V0WA 3HBRA 4ETXA 4EBPA 1YKDA 5TBMB 3ISGA 3RTYA 1KGGA 3GQZA 3S1YA 1ZG4A 1CF0A 3AGDA 3V50A 4OPYA 4PM8A 2PD8A 1Z09A 4MEZA 1LL8A 3BQ8A 4S2LA 2XA7S 1T1CA 4LRYC 4ZJ1A 1S4SA 4L0LA 4JF6A 4FUWA 4PPRA 2JCHA 4GCZA 2B95A 1FCNA 1YLWA 1N9OA 1RGZA 3IXHA 4IEDA 4DF6A 4QHCA 3D72A 4DXBA 3VE3A 3SH9A 1K54C 2G7UA 1P9WA 4AFIA 3F1OA 1YPRA 3D9YA 1L0DA 4G3KA 3T1RA 1JWVA 5A8BA 2ZM8A 4IHQA 2V8CA 3JVVA 5M1AA 1GHMA 2X01A 3WS2A 1SDNA 4ZTKA 4WF0A 3ZYTA 1VETA 4HBTA 3DWZA 1MWTA 1N9BA 1XJ2A 2XF3A 2RL3A 3Q7VB 1BUEA 4LFUA 5CGWA 2W3DA 2O0YA 4OLGA 3T4KA 3GVBA 1WE4A 1MWUA 3UN7A 3HLCA 5JYOA 4S2NA 2PAVP 3HUNA 2P08A 5CHJA 2V2FF 3MKFA 3EEHA 3FKVA 4E3OA 3F1NB 4NG2A 2ZM0A 2EWWA 3HUMA 3IT9A 4IBRA 1EROA 3G34A 1OT6A 2HZ5A 1GSWA 3MJQA 1OTIA 1PW8A 1DY6A 1XGIA 5AQBA 2G2UA 5EFWA 2OV5A 2VGLM 1T1BA 3JYIA 2O99A 2ZC6B 5G4YA 3M2JA 4GDNA 1CK3A 3IBRA 1DP8A 1YLJA 3IXDA 3Q07A 4EERA 2A49A 5J4EA 1NLYA 4CLCB 3LIAA 1W8QA 2ZQCA 3QNBA 2ZQDA 4HJ6A 3ZG5A 1DP6A 4DE2A 3VOYA 2ZMVA 4EQIA 5CRFA 1MC0A 1ALQA 1KE0A 4WEKA 5FQJA 1WYBA 3IX3A 4EWFA 5EV0A 3CUEC 5G18A 4Q0IA 1BYWA 3PBOA 2BG1A 4E3KA 2XR0A 2V20A 3T4LA 5FQKA 1XJ4A 2GZAA 4E6WA 3JPUA 2ZD8A 3LEQA 4ME4A 3ITBA 3LO7A 3VFFA 5AVEA 4JPMA 1K38A 2M1CA 3RH8B 4ZBEA 1C3BA 1ESIA 1XA1A 4LENA 2Y2KA 1E3UD 1D1JA 3BY8A 2GNXA 4HY8A 1OJ5A 4K08A 1HLUP 5AQAA 3MQ0A 3BECA 4ESPA 3LI9A 1RCJA 1MZUA 3ZNTA 2A3UA 4GW9A 1XFQA 3FZCA 3P7NA 4K0XA 1SZVA 5EUAA 1K4FA 4LV2A 3OC2A 4Y17A 4DE3A 4O8GA 4BL2A 4QPRA 3LI8A 4H8RA 1H8ZA 3BQAA 4OQ0A 3VP2A 1K6SA 1PWGA 2WKEA 3A3JA 3QP6A 1CEGA 4F3LB 4S2PA 1TS6A 2W0NA 3VFHA 4ARZA 2UV0E 4Q0JA 4HP9A 4LV0A 3DBAA 4P0MA 3CG5A 1PNEA 3UDFA 2QWSA 5FAOA 2ZOHA 2JKTI 2XQZA 4S2NC 4FH4A 3LIEA 3MXSA 1YQSA 2BLSA 4E3NA 4P87A 4Y0UA 1QMFA 1O7EA 4R4RA 5L10A 2PYPA 2L1MA 2PDRA 2W3HA 2JBFA 4PMAA 3UDIA 3ZG8B 1XGJA 1DRMA 2QYBA 4HEFA 2Y2IA 5FAPA 3EQUA 4MNRA 2EX6A 3PBNA 3DAVA 4LCLA 4DDSA 1ZTUA 3IWOA 3EGDC 3HREA 4MN5A 2ZM2A 3PXPA 4GN2A 4IBXA 4WBGA 5E2HA 3HLGA 4OPRA 3NECA 2EA9A 2IWDA 3RXXA 5HAPA 4JGOA 4HESA 4U0XA 5HAQA 2L4RA 1YLZA 3Q81A 4CPKA 3MQQA 3CPTB 4QU3A 1MKMA 3LYXA 5F1GA 3ZNYA 2J9PA 2IWBA 1LSWA 3O3VA 3ZCZA 2Y2QA 4MMNA 1PW1A 1FILA 3TSGA 4K91A 1Q2PA 3IXGA 3WRTA 1VEUA 4RX3A 4JXVA 3NBLA 3MZFA 4MN7A 1XPBA 2A24A 3A3FA 3S7PA 5EVEA 4ZRRA 4R6LA 2WGIA 4IUHA 1LI0A 4KZBA 2C6WB 2M7VA 5CERA 1KGFA 4DXCA 3KSGA 1VM1A 5GHXA 4X56A 1ES5A 3Q1FA 1ZKJA 3T4JA 1W63Q 3MFXA 1OJGA 1EWZA 2O9BA 2P7JA 2XEPA 1OTBA 5F82A 1LI9A 3C8CA 1ERQA 5DF8A 4HI4A 3TW8A 3VSKA 1KVMA 4GS9A 4R23A 5FQMA 1YLTA 4DRTA 1NXYA 4B88A 5CXWA 4IVIA
chains in the Genus database with same CATH topology
1CF0A 2V8CA 1FILA 3U4LP 3T12B 2PBDP 2ZL1B 1AWIA 2JKGA 5FDSA 5EM1A 3NECA 1Z09A 1ACFA 2HZ5A 3T1QB 5FEGA 1F2KA 1CQAA 1VEUA 2B95A 3MSHA 4D60A 4X1MA 1A0KA 1Y4OA 5FEFA 1SZVA 2ACGA 1SKOA 5EV0A 1PRQA 3MS6A 2E8JA 1PNEA 2ZL1A 2BTFP 2PAVP 4FTXA 3CPTB 3UB5P 1VETA 3L7HA 3DAVA 1YPRA 1G5UA 4X25A 3KYEA 3D9YA 3L9KA 2PRFA 3T1SA 1SKOB 1D1JA 1PFLA 1J3WA 3T1RA 1K0KA 2V8FA 3NULA 4FUWA 4QWOA 4ESPA 2JKFA 1VEUB 1FIKA 2VK3A 3CHWP 3LEQA 5EVEA 1HLUP 1CJFA 3CPTA 3T1XA 1VETB 5EM0A 4X1LA 3LGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CF0 A;  2V8C A;  1FIL A;  3U4L P;  3T12 B;  2PBD P;  2ZL1 B;  1AWI A;  2JKG A;  5FDS A;  5EM1 A;  3NEC A;  1Z09 A;  1ACF A;  2HZ5 A;  3T1Q B;  5FEG A;  1F2K A;  1CQA A;  1VEU A;  2B95 A;  3MSH A;  4D60 A;  4X1M A;  1A0K A;  1Y4O A;  5FEF A;  1SZV A;  2ACG A;  1SKO A;  5EV0 A;  1PRQ A;  3MS6 A;  2E8J A;  1PNE A;  2ZL1 A;  2BTF P;  2PAV P;  4FTX A;  3CPT B;  3UB5 P;  1VET A;  3L7H A;  3DAV A;  1YPR A;  1G5U A;  4X25 A;  3KYE A;  3D9Y A;  3L9K A;  2PRF A;  3T1S A;  1SKO B;  1D1J A;  1PFL A;  1J3W A;  3T1R A;  1K0K A;  2V8F A;  3NUL A;  4FUW A;  4QWO A;  4ESP A;  2JKF A;  1VEU B;  1FIK A;  2VK3 A;  3CHW P;  3LEQ A;  5EVE A;  1HLU P;  1CJF A;  3CPT A;  3T1X A;  1VET B;  5EM0 A;  4X1L A;  3LGO A; 
#chains in the Genus database with same CATH topology
 2JHE A;  5DJU A;  4O7D A;  5AQ9 A;  3ZVT A;  5GHZ A;  1F2K A;  2PR5 A;  4CLC D;  3BFF A;  1F98 A;  3D4F A;  5HD5 A;  1IEM A;  4DKI A;  2GJ3 A;  5KMW A;  2JC7 A;  2XDM A;  1VQQ A;  2ZQ7 A;  3K2N A;  5FL3 A;  3UPN A;  3GV9 A;  5HFO A;  1PI4 A;  5FDH A;  4HH2 A;  1PIO A;  5TBM A;  5DTK A;  3PYP A;  2VLG A;  3BFD A;  1MWS A;  2Z2L B;  3OZH A;  3ULF A;  3ICY A;  3A3D A;  4C6Y A;  4MDZ A;  3B3X A;  4PKY A;  2ZC5 B;  2HP5 A;  4OQI A;  3G6O A;  3R7W B;  2ZL1 B;  3OPP A;  4I3A A;  4OOY A;  3F1O B;  4L9F A;  4Z9Q A;  3T4T A;  3QP2 A;  3WWX A;  5FAS A;  1UWN X;  4N92 A;  3OCN A;  2OWJ A;  4KZ4 A;  3TRC A;  5F6A A;  1NZU A;  1ESU A;  1HZO A;  3GMW A;  5GLD A;  4UQI S;  5HPF A;  4FD8 A;  2H28 A;  4UEY A;  4E04 A;  4P6Z S;  1AWI A;  1FR1 A;  1CEF A;  4DE1 A;  1YMX A;  2OSU A;  4Q0H A;  5GHY A;  2DNS A;  2PD7 A;  5EOO A;  3UB8 A;  4PM5 A;  4OLD A;  4OH0 A;  1Y54 A;  5A91 A;  1GSX A;  1YAX A;  1W7F A;  5A93 A;  2V1A A;  5FDS A;  1WYC A;  5L2F A;  1JWP A;  3NI9 A;  3V67 A;  2J7V A;  1ES3 A;  1Z6F A;  3LCE A;  3W4O A;  4II7 A;  2KDK A;  5FQI A;  3EEA A;  1K0K A;  4FCF A;  1ONG A;  2AVX A;  3HLB A;  1MBL A;  3NDG A;  1TVF A;  1YM1 A;  4EEU A;  2H0Y A;  5DF9 A;  5E2G A;  2WGV A;  2ZLY A;  4KG5 A;  3ZG9 B;  4HP4 A;  1S66 L;  3K3C A;  2QMI A;  2QZ6 A;  5KSC A;  1JTG A;  2HDQ A;  4YWZ A;  3PAE A;  4B4X A;  5EM0 A;  5IT5 A;  2ZQ9 A;  1K25 A;  3CAX A;  3GDI A;  5L07 A;  2PU2 A;  5M18 A;  3IF5 A;  3C38 A;  4P6B A;  3UPO A;  1XA7 A;  4LGW A;  1ES4 A;  3NJA A;  4QWO A;  3NC8 A;  4PM6 A;  5F1F A;  4BBV A;  4EBL A;  4QB8 A;  1M40 A;  4LLO B;  5F69 A;  4MLL A;  3FPV A;  4PKY G;  2WK0 A;  5CTM A;  5E43 A;  1ZHH B;  2HP9 A;  5CEB A;  5GLA A;  4X25 A;  3DWK A;  5KIZ A;  3SS4 A;  2XLN A;  3FC7 A;  1NJ4 A;  1FIK A;  2HDR A;  3ZGA B;  3PBQ A;  4GS9 B;  3UE0 A;  4BEN A;  3KSI A;  2KX6 A;  3H9W A;  1K56 A;  4HJ4 A;  1T19 A;  4GLQ A;  4ZAM A;  5HAI A;  3IQA A;  4YOF A;  2Y2L A;  3CIT A;  2VK3 A;  2VGL S;  3SS5 A;  5IS1 A;  3LGO A;  4FH2 A;  2V0U A;  3Q82 A;  2YKH A;  2PBY A;  1PWC A;  3LIC A;  4XUZ A;  1S0W A;  4S2M A;  1FCO A;  4EXO A;  4KZ7 A;  1G68 A;  1HVB A;  4S2I A;  1G6A A;  5FSR A;  4C75 A;  3IH8 A;  2V8F A;  5HDD A;  2P04 A;  1IKI A;  4N9K A;  2X71 A;  3OCL A;  3U4L P;  4X68 A;  3IH9 A;  3QP5 A;  3BFG A;  3BYD A;  3PBR A;  4K0W A;  4NEE D;  3R7W A;  3GRJ A;  5HPI A;  3UB5 P;  2JN7 A;  1PZP A;  1KVL A;  3T1S A;  3C2W A;  4Y7P A;  1CJF A;  5TR7 A;  3G30 A;  5AVF A;  3KX0 X;  5C5K A;  2ZOI A;  3K3D A;  3E4Q A;  1LSV A;  5F83 A;  1YMS A;  4KEN B;  3IF6 B;  3GR2 A;  5HDS A;  4R3A A;  4PHT A;  5G4Z A;  5J3W A;  4WZ4 A;  3HLW A;  4S2O A;  1NZO A;  4KUK A;  1E3U A;  1NWZ A;  4G3V A;  4DE0 A;  3HL9 A;  1K54 A;  5J8X A;  4JKT A;  4HH3 A;  4Z1W A;  3UE6 A;  4JF4 A;  4MN6 A;  5DJT A;  3UB7 A;  3LUQ A;  1SCW A;  3M2K A;  4N1H A;  4NXB A;  1TF1 A;  4Y13 A;  3C7U A;  5HL1 A;  2Y8H A;  1VEU B;  1H0M A;  4GDB A;  3LID A;  3FKW A;  5EM1 A;  4B93 A;  2P9V B;  2Y2O A;  2Y79 A;  3OPH A;  3PTE A;  1ZC2 A;  4B9O A;  1P0Z A;  2HDS A;  1OME A;  2EX9 A;  2ZC4 B;  4RA7 A;  4JXG A;  3LR4 A;  2WAD A;  4PM9 A;  1H3Q A;  3E4O A;  1HTZ A;  5TGF A;  2K2N A;  3T12 B;  1TS8 A;  4KZA A;  2Z6D A;  2Q9M A;  3C7V A;  3OOV A;  2ZC3 B;  3EWK A;  3RJU A;  4X69 A;  1YT4 A;  5D3O A;  3L9K A;  4HHD A;  1NRF A;  2Y2G A;  2MJ6 A;  3OPR A;  3UE3 A;  3U2A A;  5EPH A;  3T1X A;  2WGW A;  3VE4 A;  3IWI A;  2JE5 A;  2JKR I;  2JKG A;  4BQM A;  3HLD A;  4JLF A;  1FOF A;  2KLI A;  2H0T A;  1GHP A;  4CQH A;  4E3I A;  1S4R A;  3UPP A;  1NRJ A;  3BM6 A;  5GLC A;  4OOM A;  1KOU A;  2VKS A;  2QJ5 A;  3UE1 A;  1ZG6 A;  1EW0 A;  4D2O A;  2D01 A;  3ZVW A;  3IHB A;  4QD4 A;  3F1P B;  1T18 A;  2INW A;  3A0R A;  1S6R A;  1XFN A;  5CHM A;  5U47 A;  1BUL A;  1PRQ A;  2JKT M;  4E6X A;  4MBF A;  4DJ3 A;  2PR6 A;  1H8Y A;  4N9L A;  1IKG A;  2VGK A;  1BLC A;  4XXR A;  4OON A;  3LY3 A;  4CJN A;  2R78 A;  1BSG A;  4GKU A;  3RXW A;  1OTA A;  4MBK A;  5DF7 A;  1MXO A;  4JF5 A;  3E2K A;  3QHY A;  3IHA A;  4R38 A;  2FH5 A;  3N8L A;  3KSH A;  4F3L A;  2R9W A;  4BLM A;  2VEA A;  3TOI A;  2DRW A;  1L3L A;  1U60 A;  4MCW A;  2Y2P A;  5J7E A;  1KE3 A;  5I94 A;  3PHY A;  3SOI A;  4LV1 A;  4ETZ A;  1O07 A;  1N9L A;  5HX9 A;  3UO9 A;  1AXB A;  1FCM A;  1FSW A;  2HPB A;  2CMN A;  1K6R A;  2IWC A;  4WMC A;  3FYZ A;  3HJI A;  1CI8 A;  2IA2 A;  4RQ9 A;  3WS1 A;  3KYZ A;  3WS5 A;  3KSF A;  4KQD A;  1S67 L;  2HJE A;  3S7O A;  2VZW A;  3G2Z A;  4IUK A;  2WKR A;  4E3J A;  4X1M A;  2EFX A;  2XFT A;  3G4P A;  2ZQA A;  4N1X A;  4HQA A;  4FSF A;  3KYQ A;  4KQO A;  4YNR A;  3N8S A;  4Y15 A;  1YLP A;  4GZB A;  4M3K A;  2W27 A;  4ZDX A;  5FEG A;  3HLE A;  1XX2 A;  3S22 A;  4EUV A;  3NIA A;  3QP4 A;  2VJW A;  3H7W A;  5E2E A;  4ZJ3 A;  3CWF A;  3O88 A;  3NHQ A;  2HP6 A;  5FI6 A;  4ZJ2 A;  1GA0 A;  2R9X A;  5KZH A;  3LIB A;  4Y0O A;  2GX5 A;  3MSH A;  4B4Z A;  4I3J A;  4FOF A;  3P98 A;  4KUO A;  1S1Z A;  4A5R A;  4DDY A;  1DJC A;  4P6Z M;  2OAP 1;  3NUL A;  3R4K A;  4BL3 A;  5FAQ A;  1LHY A;  3FV7 A;  5GL9 A;  1IOU A;  1HD8 A;  1K4E A;  2WKQ A;  3E98 A;  3PBT A;  1W8Y A;  5CEC A;  3CMZ A;  1BT5 A;  2W3F A;  1WA9 A;  5DKK A;  3SZT A;  2HGV A;  4RVA A;  4BJP A;  3B33 A;  2J9O A;  4R3J A;  1TD5 A;  3UDX A;  3MR0 A;  5FA7 A;  1L0E A;  5HW3 A;  2HDU A;  3NOT C;  4Y5F A;  3MZD A;  2XGN A;  2V1B A;  1I5Q A;  3ZHH A;  3S7Q A;  4GHI A;  4DN0 A;  1SKF A;  2JKF A;  2VGJ A;  4P85 A;  1MY8 A;  4HIA A;  4I38 A;  1Q2Q A;  1SHV A;  1Y28 A;  5FQ9 A;  1T1A A;  1SKO A;  3CI6 A;  3BRM A;  2ZMA A;  3F1P A;  3VMA A;  1D06 A;  3N8R A;  1GSV A;  2WYX A;  2Y2N A;  1LL9 A;  5KSH A;  2WAF A;  1X0O A;  3FG8 A;  1NYM A;  3W8K A;  1CI9 A;  3BJN A;  3FWL A;  5CED A;  4BBT A;  4NET A;  2VV7 A;  4WL9 A;  2M7U A;  5GLB A;  3V3R A;  5EVI A;  4JGP A;  4FTX A;  3BW6 A;  3G35 A;  4WMC D;  1BZA A;  4YIN A;  1YLY A;  3TJZ C;  3IWQ A;  2W1R A;  1W63 M;  4GJ4 A;  1DJA A;  1IFQ A;  1STZ A;  2QJ7 A;  3I7J A;  1G28 A;  4JXW A;  5EVL A;  1XJ6 A;  1V9Y A;  3MZE A;  3LY4 A;  3WRZ A;  2OOL A;  5L09 A;  4KG2 A;  3SW1 A;  5DKL A;  3KO6 A;  3ZFZ A;  3T4O A;  2PT7 A;  4UA6 A;  4NXE A;  1YSQ A;  3IXB A;  4NKP A;  3BY9 A;  3C5A A;  5TFQ A;  1NYY A;  1RP5 A;  5HD3 A;  3TE8 A;  2XK1 A;  3IF6 A;  3CHW P;  5F68 A;  1DP9 A;  3N4I A;  4OPZ A;  2PBD P;  2HV1 A;  3P09 A;  5AJG A;  2X02 A;  4EES A;  1E25 A;  4F94 A;  2QKP A;  1K56 D;  2B02 A;  1JVJ A;  3M6B A;  3MS6 A;  5LBR A;  5CTN A;  4NXG A;  1JNU A;  1G5U A;  3G32 A;  2LB5 A;  3JVU A;  4XT2 A;  2L0W A;  1V9Z A;  5M19 A;  4LRZ E;  3VP4 A;  3AGF A;  1NY0 A;  2O9C A;  3N7W A;  5FI2 A;  1GHI A;  1TS0 A;  1K55 C;  5AQ7 A;  3F1N A;  4I5S A;  1KGE A;  2ZBB A;  2QHK A;  4KZ6 A;  4IVK A;  2RCX A;  4H6J B;  4LRX C;  1TEM A;  3ZDJ A;  4QJG A;  2BAS A;  3IX4 A;  1LT0 A;  1FSY A;  3C4P A;  1OT9 A;  2Z6C A;  5BOH A;  3IS2 A;  4GOG A;  4LPZ A;  2B18 A;  1PI5 A;  3HJK A;  2C5W B;  3A0V A;  3A0S A;  3P01 A;  5CGS A;  4EUZ A;  4YFM A;  4OVD A;  2V9A A;  3GSG A;  4HJ3 A;  2W1T B;  4ID4 A;  2CC1 A;  3LEZ A;  3DTK A;  4EET B;  2DCF A;  1MWR A;  4CLC A;  4RX2 A;  3VOZ A;  2EXB A;  1TDL A;  2Y4A A;  3B47 A;  1IYS A;  1KDS A;  1RGY A;  1EI5 A;  1CQA A;  2VV8 A;  2WGW B;  2Y2H A;  4QY5 A;  3GEC A;  3O5Y A;  1PWD A;  4M4X A;  4OQH A;  3ZG7 B;  5DTS A;  5A90 A;  1KDW A;  2XD5 A;  3H82 A;  5HWT A;  3FPW A;  3EQV A;  4GHI B;  1F5M A;  4OP5 A;  3BLS A;  5CX7 A;  4U3T A;  3PR6 A;  1UGU A;  4CLC C;  3O87 A;  4KZ9 A;  4XUX A;  2J3W A;  2EFU A;  5DFY A;  2A2L A;  4Y2F A;  2Y2J A;  1IEL A;  4GB7 A;  1A0K A;  3MXQ A;  4Q8I A;  2Q0O A;  4WUJ A;  3W4Q A;  3CZD A;  2PU4 A;  3DW0 A;  2WKH A;  1K57 C;  3VOL A;  4R1G A;  1XJ3 A;  4O0P A;  3UMD A;  5CHU A;  4JBF A;  2NUT C;  5MC7 A;  2WKP A;  3IX8 A;  3MQO A;  3NDE A;  2GDN A;  2K7S A;  2Q9N A;  4UAA A;  3QNC A;  3OBF A;  4OKP A;  2XSS A;  3ITA A;  2W3E A;  4IJG A;  3A3I A;  5CGX A;  3GTC A;  3HVF A;  1YSP A;  2ZJ9 A;  4UA7 A;  3IBJ A;  1FR6 A;  3AGE A;  1S1Y A;  1MPL A;  1ONH A;  4KZ8 A;  3O86 A;  1K57 A;  4OP8 A;  2XD1 A;  2J80 A;  2WAE A;  4WZ5 A;  3Q7V A;  2FFF B;  3N6I A;  1ODV A;  3LR0 A;  3VP1 A;  1SDE A;  4I39 A;  1VET B;  4X6T A;  4LCM A;  4E3L A;  4S2K A;  4BD1 A;  4KQR A;  4R0Q A;  1I2S A;  4RYE A;  5FEF A;  2J3T D;  1K55 A;  1ERM A;  2VV6 A;  3NCK A;  5EVI C;  5HL6 A;  5IU1 A;  5EE8 A;  4BBU A;  4UA9 A;  2P9V A;  2B5R A;  2XFS A;  2Y59 A;  4HOI A;  3UME A;  2NUP C;  4Y3I A;  1GCE A;  4XT2 B;  3DTM A;  2OLU A;  3VV4 A;  1BTL A;  4WZ5 C;  3A3E A;  3WS0 A;  4U0T A;  3HUO A;  4HNB A;  1KE4 A;  3LR5 A;  1LLB A;  3B42 A;  4EEP A;  3T50 A;  1IYO A;  4X55 A;  3Q7Z A;  3BFC A;  1BLS A;  4X1L A;  5EOE A;  1DJB A;  1W5D A;  3G2Y A;  2FFY A;  3ZQ5 A;  4BD0 A;  3CUE A;  2ACG A;  3MKE A;  3SS3 A;  5DFX A;  5DTT A;  3V39 A;  4WYY A;  1XP4 A;  1N4O A;  2WKI A;  1JTD A;  2ZMF A;  2Y91 A;  2DMW A;  3SH7 A;  3SH8 A;  3T4Q A;  5HWV A;  3DTE A;  1D7E A;  4L9E A;  4R70 A;  3OLO A;  1TS7 A;  3G31 A;  1L0G A;  2FZ0 A;  4KQQ A;  4GNU A;  3L7H A;  3PAG A;  4JGR A;  5EEC A;  1LL5 A;  2HJ9 C;  4OPQ A;  5JYP A;  1I2W A;  5TJJ A;  2ZQ8 A;  3ZG0 A;  4E3M A;  4OOL A;  1VHM A;  4UQI M;  5FI7 A;  4QY6 A;  2VA0 A;  3S4X A;  2G2W A;  2H10 A;  3UB9 A;  1SKO B;  3NY4 A;  3S7N A;  4HBU A;  5HAR A;  3VSL A;  1BLH A;  4WN5 A;  3C4O A;  3C30 A;  2Z2M B;  4KG6 A;  4LV3 A;  2BTF P;  1H5X A;  1M6K A;  3V5M A;  4OQG A;  1LSX A;  3UNW A;  3OPL A;  3UY6 A;  5EVI B;  1ES2 A;  4Y0T A;  3DTI A;  1P9R A;  2LB9 A;  4GD8 A;  1XKZ A;  4PAU A;  1N9N A;  2OLV A;  4BWI A;  1Y4O A;  1PZO A;  1QME A;  5A92 A;  3CJM A;  2ZL1 A;  4EV4 A;  2H5S A;  2KOI A;  3HLF A;  5E2F A;  5F5Y A;  4MBH A;  4ARZ B;  1PFL A;  3E0Y A;  4NXF A;  4L9G A;  5EVI D;  2I72 A;  2PHY A;  1GA9 A;  5HZH A;  3QP8 A;  1VB6 A;  3EOI A;  5FQQ A;  3E2L A;  3W2Z A;  3MF0 A;  4EU0 A;  4JGQ A;  2UWX A;  4WEJ A;  4DJ2 A;  3MMH A;  4BMW A;  5HSQ A;  3H7W B;  2K31 A;  2XA7 M;  4WM9 A;  1PYY A;  2W3G A;  2WUQ A;  1J9M A;  3NOU C;  3BEB A;  1OTE A;  4C3Q A;  2J3T C;  3VP0 A;  3WS4 A;  4PM7 A;  3LFV A;  2D02 A;  3E4P A;  4O01 A;  4R3B A;  2EXA A;  3UB6 A;  4CLC E;  3CPT A;  1TDG A;  5IHV A;  1MKI A;  5K5B A;  1L0F A;  4EQ1 A;  4NK3 A;  4KZ5 A;  3MFD A;  4UHU A;  1IYQ A;  1L2S A;  5I5L A;  3RFB A;  4EBN A;  4I3I A;  3MXR A;  1UWP X;  2O9A A;  1W79 A;  1OPX A;  5HDC A;  4G3W A;  1J3W A;  4KZ3 A;  3T4S A;  1F9I A;  2OWH A;  1P97 A;  2A24 B;  4H6J A;  3V3S A;  1FQG A;  1IYP A;  5L8M A;  3PBS A;  2Y2M A;  3EGX C;  2WZZ A;  2I9V A;  3T1Q B;  3BFE A;  4JXS A;  4EW7 A;  3IS2 B;  1BLP A;  4S2J A;  2YKF A;  4WLA A;  2XRO A;  2ZC7 A;  1E4D A;  1OTD A;  3M6H A;  4X53 A;  4WEL A;  3D3O A;  3LR3 A;  3KYE A;  1XXM A;  2PRF A;  3MBZ A;  2V1Z A;  3CLO A;  3TG9 A;  2EX2 A;  2EWV A;  2W1T A;  5FAT A;  3BLM A;  1JWZ A;  1ACF A;  3W4P A;  5DVA A;  3LIF A;  2VX8 A;  3BWL A;  2JKR M;  2OAQ 1;  1NLZ A;  2J8Y A;  2XRN A;  5HWW A;  3NOP C;  2EX8 A;  2XH9 A;  4R4S A;  2E8J A;  2PYR A;  3QP1 A;  1G6O A;  3IF6 C;  2Y55 A;  1H8M A;  4GD6 A;  2QPN A;  2E8I A;  3HCY A;  2P74 A;  3VP3 A;  4D60 A;  3H82 B;  4DMZ A;  2WZX A;  2HF6 A;  2V0W A;  3HBR A;  4ETX A;  4EBP A;  1YKD A;  5TBM B;  3ISG A;  3RTY A;  1KGG A;  3GQZ A;  3S1Y A;  1ZG4 A;  1CF0 A;  3AGD A;  3V50 A;  4OPY A;  4PM8 A;  2PD8 A;  1Z09 A;  4MEZ A;  1LL8 A;  3BQ8 A;  4S2L A;  2XA7 S;  1T1C A;  4LRY C;  4ZJ1 A;  1S4S A;  4L0L A;  4JF6 A;  4FUW A;  4PPR A;  2JCH A;  4GCZ A;  2B95 A;  1FCN A;  1YLW A;  1N9O A;  1RGZ A;  3IXH A;  4IED A;  4DF6 A;  4QHC A;  3D72 A;  4DXB A;  3VE3 A;  3SH9 A;  1K54 C;  2G7U A;  1P9W A;  4AFI A;  3F1O A;  1YPR A;  3D9Y A;  1L0D A;  4G3K A;  3T1R A;  1JWV A;  5A8B A;  2ZM8 A;  4IHQ A;  2V8C A;  3JVV A;  5M1A A;  1GHM A;  2X01 A;  3WS2 A;  1SDN A;  4ZTK A;  4WF0 A;  3ZYT A;  1VET A;  4HBT A;  3DWZ A;  1MWT A;  1N9B A;  1XJ2 A;  2XF3 A;  2RL3 A;  3Q7V B;  1BUE A;  4LFU A;  5CGW A;  2W3D A;  2O0Y A;  4OLG A;  3T4K A;  3GVB A;  1WE4 A;  1MWU A;  3UN7 A;  3HLC A;  5JYO A;  4S2N A;  2PAV P;  3HUN A;  2P08 A;  5CHJ A;  2V2F F;  3MKF A;  3EEH A;  3FKV A;  4E3O A;  3F1N B;  4NG2 A;  2ZM0 A;  2EWW A;  3HUM A;  3IT9 A;  4IBR A;  1ERO A;  3G34 A;  1OT6 A;  2HZ5 A;  1GSW A;  3MJQ A;  1OTI A;  1PW8 A;  1DY6 A;  1XGI A;  5AQB A;  2G2U A;  5EFW A;  2OV5 A;  2VGL M;  1T1B A;  3JYI A;  2O99 A;  2ZC6 B;  5G4Y A;  3M2J A;  4GDN A;  1CK3 A;  3IBR A;  1DP8 A;  1YLJ A;  3IXD A;  3Q07 A;  4EER A;  2A49 A;  5J4E A;  1NLY A;  4CLC B;  3LIA A;  1W8Q A;  2ZQC A;  3QNB A;  2ZQD A;  4HJ6 A;  3ZG5 A;  1DP6 A;  4DE2 A;  3VOY A;  2ZMV A;  4EQI A;  5CRF A;  1MC0 A;  1ALQ A;  1KE0 A;  4WEK A;  5FQJ A;  1WYB A;  3IX3 A;  4EWF A;  5EV0 A;  3CUE C;  5G18 A;  4Q0I A;  1BYW A;  3PBO A;  2BG1 A;  4E3K A;  2XR0 A;  2V20 A;  3T4L A;  5FQK A;  1XJ4 A;  2GZA A;  4E6W A;  3JPU A;  2ZD8 A;  3LEQ A;  4ME4 A;  3ITB A;  3LO7 A;  3VFF A;  5AVE A;  4JPM A;  1K38 A;  2M1C A;  3RH8 B;  4ZBE A;  1C3B A;  1ESI A;  1XA1 A;  4LEN A;  2Y2K A;  1E3U D;  1D1J A;  3BY8 A;  2GNX A;  4HY8 A;  1OJ5 A;  4K08 A;  1HLU P;  5AQA A;  3MQ0 A;  3BEC A;  4ESP A;  3LI9 A;  1RCJ A;  1MZU A;  3ZNT A;  2A3U A;  4GW9 A;  1XFQ A;  3FZC A;  3P7N A;  4K0X A;  1SZV A;  5EUA A;  1K4F A;  4LV2 A;  3OC2 A;  4Y17 A;  4DE3 A;  4O8G A;  4BL2 A;  4QPR A;  3LI8 A;  4H8R A;  1H8Z A;  3BQA A;  4OQ0 A;  3VP2 A;  1K6S A;  1PWG A;  2WKE A;  3A3J A;  3QP6 A;  1CEG A;  4F3L B;  4S2P A;  1TS6 A;  2W0N A;  3VFH A;  4ARZ A;  2UV0 E;  4Q0J A;  4HP9 A;  4LV0 A;  3DBA A;  4P0M A;  3CG5 A;  1PNE A;  3UDF A;  2QWS A;  5FAO A;  2ZOH A;  2JKT I;  2XQZ A;  4S2N C;  4FH4 A;  3LIE A;  3MXS A;  1YQS A;  2BLS A;  4E3N A;  4P87 A;  4Y0U A;  1QMF A;  1O7E A;  4R4R A;  5L10 A;  2PYP A;  2L1M A;  2PDR A;  2W3H A;  2JBF A;  4PMA A;  3UDI A;  3ZG8 B;  1XGJ A;  1DRM A;  2QYB A;  4HEF A;  2Y2I A;  5FAP A;  3EQU A;  4MNR A;  2EX6 A;  3PBN A;  3DAV A;  4LCL A;  4DDS A;  1ZTU A;  3IWO A;  3EGD C;  3HRE A;  4MN5 A;  2ZM2 A;  3PXP A;  4GN2 A;  4IBX A;  4WBG A;  5E2H A;  3HLG A;  4OPR A;  3NEC A;  2EA9 A;  2IWD A;  3RXX A;  5HAP A;  4JGO A;  4HES A;  4U0X A;  5HAQ A;  2L4R A;  1YLZ A;  3Q81 A;  4CPK A;  3MQQ A;  3CPT B;  4QU3 A;  1MKM A;  3LYX A;  5F1G A;  3ZNY A;  2J9P A;  2IWB A;  1LSW A;  3O3V A;  3ZCZ A;  2Y2Q A;  4MMN A;  1PW1 A;  1FIL A;  3TSG A;  4K91 A;  1Q2P A;  3IXG A;  3WRT A;  1VEU A;  4RX3 A;  4JXV A;  3NBL A;  3MZF A;  4MN7 A;  1XPB A;  2A24 A;  3A3F A;  3S7P A;  5EVE A;  4ZRR A;  4R6L A;  2WGI A;  4IUH A;  1LI0 A;  4KZB A;  2C6W B;  2M7V A;  5CER A;  1KGF A;  4DXC A;  3KSG A;  1VM1 A;  5GHX A;  4X56 A;  1ES5 A;  3Q1F A;  1ZKJ A;  3T4J A;  1W63 Q;  3MFX A;  1OJG A;  1EWZ A;  2O9B A;  2P7J A;  2XEP A;  1OTB A;  5F82 A;  1LI9 A;  3C8C A;  1ERQ A;  5DF8 A;  4HI4 A;  3TW8 A;  3VSK A;  1KVM A;  4GS9 A;  4R23 A;  5FQM A;  1YLT A;  4DRT A;  1NXY A;  4B88 A;  5CXW A;  4IVI A; 
#chains in the Genus database with same CATH homology
 1CF0 A;  2V8C A;  1FIL A;  3U4L P;  3T12 B;  2PBD P;  2ZL1 B;  1AWI A;  2JKG A;  5FDS A;  5EM1 A;  3NEC A;  1Z09 A;  1ACF A;  2HZ5 A;  3T1Q B;  5FEG A;  1F2K A;  1CQA A;  1VEU A;  2B95 A;  3MSH A;  4D60 A;  4X1M A;  1A0K A;  1Y4O A;  5FEF A;  1SZV A;  2ACG A;  1SKO A;  5EV0 A;  1PRQ A;  3MS6 A;  2E8J A;  1PNE A;  2ZL1 A;  2BTF P;  2PAV P;  4FTX A;  3CPT B;  3UB5 P;  1VET A;  3L7H A;  3DAV A;  1YPR A;  1G5U A;  4X25 A;  3KYE A;  3D9Y A;  3L9K A;  2PRF A;  3T1S A;  1SKO B;  1D1J A;  1PFL A;  1J3W A;  3T1R A;  1K0K A;  2V8F A;  3NUL A;  4FUW A;  4QWO A;  4ESP A;  2JKF A;  1VEU B;  1FIK A;  2VK3 A;  3CHW P;  3LEQ A;  5EVE A;  1HLU P;  1CJF A;  3CPT A;  3T1X A;  1VET B;  5EM0 A;  4X1L A;  3LGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...