1HLUP

Structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an open state of beta-actin at 2.65 A resolution.
pubmed doi rcsb
molecule tags Complex (acetylation/actin-binding)
molecule keywords BETA-ACTIN
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1hluP00
1D1JA 3T1SA 2PRFA 5FDSA 3LEQA 2JKFA 5FEFA 4FUWA 3UB5P 4X1LA 1YPRA 1PNEA 3L7HA 1PFLA 2B95A 4ESPA 1G5UA 2JKGA 3DAVA 2ZL1B 1Z09A 1HLUP 2ACGA 4FTXA 4X1MA 5EVEA 1F2KA 1VETA 1Y4OA 3NULA 3NECA 4X25A 2V8CA 3T12B 2PBDP 3KYEA 2E8JA 1SZVA 3CPTA 3MS6A 2BTFP 3CPTB 4QWOA 5EM1A 1CF0A 1FIKA 1K0KA 3T1RA 1ACFA 1AWIA 1CJFA 3L9KA 2V8FA 1FILA 2HZ5A 3MSHA 1PRQA 3T1XA 1CQAA 2PAVP 1VETB 1VEUA 1SKOB 3LGOA 5EM0A 4D60A 1SKOA 1A0KA 2ZL1A 5EV0A 3T1QB 5FEGA 3CHWP 2VK3A 1VEUB 3U4LP 3D9YA 1J3WA
chains in the Genus database with same CATH superfamily
1Y54A 1G6AA 2WKIA 3E0YA 3NBLA 1O7EA 2J8YA 5AVEA 2CMNA 4EEPA 3NI9A 4OP8A 4YOFA 3LY4A 2PHYA 4EU0A 1OTDA 2WZZA 1J9MA 3U4LP 1D06A 3IHAA 3S7PA 5FDSA 4LV1A 4Z1WA 1SCWA 2HJEA 1OPXA 3DTKA 3T4SA 1YMSA 4KZ6A 1L2SA 3M2JA 1TEMA 1FCNA 3SOIA 4BBUA 3N8SA 1MWUA 4P6ZS 4S2IA 4UHUA 5FQ9A 4GHIB 3OPLA 4X56A 3MQOA 3LIDA 4NG2A 3VV4A 2Z6DA 4I3IA 1CK3A 2X71A 3WS0A 5KSCA 2FH5A 1RP5A 3C8CA 3OLOA 3WS5A 2G2UA 3E2KA 1ES2A 5FAQA 5J7EA 4BMWA 2XFTA 4HQAA 1D1JA 2WGVA 4G3KA 1PZOA 2P7JA 2HV1A 3S4XA 1PWDA 4KQDA 3ZHHA 2ZC7A 1JWPA 4WEKA 5FI6A 4OPRA 4E3OA 1ES5A 5FAPA 2QYBA 5F69A 3MMHA 3NDGA 1E3UA 2PR5A 1XKZA 2JC7A 3C7VA 3G31A 3OZHA 4S2NA 2VEAA 3PYPA 1HLUP 1OJ5A 3W2ZA 4JXWA 3TG9A 4E3KA 3IH9A 1BLSA 2Y2MA 4ZDXA 2XK1A 4IVIA 4QY5A 4NXFA 3A3IA 1WYCA 4YINA 1ZC2A 2MJ6A 4OQIA 3IS2B 4OLGA 1TD5A 5HDDA 3HLBA 5EOOA 1P9WA 4KQOA 4WLAA 4EBPA 1ESUA 4GHIA 2OLUA 4EV4A 3NIAA 3LEZA 1XXMA 4DN0A 2GNXA 3F1OA 1PWGA 2Y59A 4HJ6A 2M7UA 3P09A 4I3JA 3PBQA 1MWSA 3QNBA 3RJUA 1PIOA 1K54C 1G5UA 4X1MA 1HZOA 4YNRA 4KZ9A 3F1OB 5K5BA 3MR0A 3UMDA 1FIKA 3L9KA 4JBFA 2FFYA 4Y2FA 3UE0A 1FR1A 1H3QA 1E25A 2EA9A 3TW8A 5HPIA 3SH9A 4P6ZM 4IHQA 5G4YA 1CI9A 1LSXA 5DF9A 1NZUA 2Y2GA 3MXRA 3UDFA 4II7A 2WKPA 1IOUA 4R0QA 3C30A 2D01A 2VV6A 5KIZA 1KVLA 2JBFA 4PMAA 4ZJ2A 4CLCE 4YWZA 3OPPA 4EBLA 2V1AA 2LB9A 1P97A 5EV0A 4JXSA 3PHYA 4LV3A 4P0MA 5L10A 3VFHA 2ZQCA 3NDEA 1DJAA 4U0XA 1GSVA 2M1CA 1S66L 3CUEA 3DTMA 4XUXA 3HVFA 3T1RA 2QKPA 4WYYA 1NYYA 5F5YA 4DRTA 4WELA 3NHQA 5G18A 5DJUA 4KZAA 1RGZA 3SS3A 1ES3A 4QB8A 3LFVA 4N92A 3JVUA 2VGLS 4GKUA 4GLQA 4LCLA 5EPHA 2ZC4B 4QD4A 1NRJA 4GDNA 5I5LA 4N1XA 4IVKA 1JWZA 5F6AA 4M4XA 3ZFZA 2C5WB 2Q9MA 4MBKA 5CECA 2KOIA 5EVID 2X02A 3A0RA 3C5AA 3CMZA 2OSUA 3Q7VA 4QY6A 4ID4A 1JTGA 4D60A 4JF5A 3W4OA 3Q82A 1PWCA 1TS6A 3NCKA 3VE3A 3LEQA 3EQVA 3FKWA 1YLPA 2GJ3A 4JKTA 5CHUA 2JKGA 3A3DA 5CERA 4QU3A 2XA7M 2VA0A 1OTAA 2ZLYA 3BFFA 1N9NA 2O9AA 4C75A 1OTBA 3FV7A 1MZUA 5TR7A 3HLDA 3WS4A 1JNUA 4NXGA 4WL9A 4L9GA 2DNSA 3ZCZA 5DTTA 1GHPA 2OOLA 2PBDP 3HUMA 4HP9A 3CJMA 3ZG0A 3H82B 1T19A 4P87A 3QP1A 4PM7A 5EVEA 2FZ0A 1ERMA 1G68A 3RXWA 4HEFA 4Y3IA 3MJQA 4DE3A 4S2MA 2PYPA 1YLZA 5KSHA 3IXBA 5GLDA 4OQGA 4S2PA 5GHXA 4EERA 5E2FA 1YSQA 3A3FA 1GA0A 1K56D 5TJJA 1K56A 3S22A 1KOUA 3V67A 3MFXA 3HLCA 4UA9A 4MNRA 5A8BA 3WWXA 3ISGA 3SS5A 4Y7PA 4Y0OA 2PD7A 3M6HA 1MPLA 1PI4A 4LRZE 1W5DA 5GLAA 2Y2HA 1RGYA 3GSGA 4OVDA 1CF0A 3PBOA 3GDIA 1H8MA 1F5MA 1NXYA 3ICYA 4I39A 5EM0A 2O99A 3IBJA 3BQ8A 1LI9A 1WE4A 5E2GA 4E3LA 3SW1A 2P74A 4RX3A 4Q0HA 4DXBA 4LRXC 1N4OA 3F1NB 1P9RA 3C2WA 3ULFA 4CJNA 1Z6FA 1K55A 1XA7A 2J9PA 4B88A 3PBNA 1VM1A 1CI8A 3W4PA 3JPUA 2ZQ7A 1VEUA 2V0UA 4MLLA 3S7QA 1JVJA 1FQGA 1LSWA 5DVAA 3V3RA 3VE4A 5HPFA 1W63Q 2XQZA 2KLIA 1DY6A 5FL3A 2V8FA 4QHCA 1SKOA 3NJAA 4GOGA 1LHYA 5EUAA 3AGFA 2BASA 4GN2A 5DTKA 2IA2A 3EGXC 3O3VA 4MBHA 4FCFA 3DW0A 4GCZA 4KZ3A 5CTNA 1SHVA 2OLVA 2ZBBA 3N7WA 1CQAA 1YMXA 4EETB 5AQAA 5CHJA 2VGJA 4P85A 1RCJA 4MCWA 4LPZA 3HCYA 5HL6A 1TDGA 3LO7A 3MS6A 3GVBA 1LI0A 4BD1A 2HDSA 3V3SA 4R1GA 5F82A 3T1QB 3WRZA 4DJ3A 1D7EA 3G6OA 1Y28A 4UQIS 1K57A 2A24B 2PBYA 3W4QA 4EUZA 2ACGA 1WA9A 1UWNX 5J3WA 5D3OA 2VGKA 3VMAA 3A0SA 2W1TB 1K54A 4KG6A 1K4FA 4FOFA 3N6IA 3MZFA 1HTZA 3S7OA 2CC1A 2JKTM 3O86A 2XLNA 3GR2A 4X1LA 1F2KA 3BWLA 3IXDA 4BJPA 3M2KA 1XPBA 2JKTI 1SKFA 4MN5A 5L07A 4ETZA 4UQIM 3D4FA 1PW8A 2J80A 3PBTA 5DTSA 4O01A 2Y2OA 2J9OA 2IWCA 3MXSA 1W8YA 3HLGA 2P9VB 5CTMA 2HJ9C 2XF3A 3SZTA 4OPQA 2J3TC 2V8CA 3LI8A 1T1CA 3IXHA 4HOIA 2ZMAA 1NJ4A 2XSSA 3CZDA 2Q9NA 1F9IA 5FQMA 2A3UA 2V20A 2UWXA 2VV7A 1DJCA 4HESA 4KG5A 3ZDJA 3T4OA 2AVXA 5I94A 3KSFA 1H8ZA 3UB6A 3NOTC 3B42A 3Q1FA 3V50A 5HSQA 2V9AA 2INWA 2Y2JA 2PU2A 1ESIA 4HBUA 4BLMA 3D9YA 5J8XA 4C6YA 1IYSA 1XJ4A 3N4IA 3T1SA 2PRFA 4DXCA 4LFUA 4PKYG 4E6WA 1YAXA 4G3WA 4ZAMA 3VOYA 3H9WA 4NXBA 3RH8B 4LV0A 1NYMA 5U47A 4U3TA 3IHBA 4X25A 3A0VA 2RL3A 1VB6A 1L3LA 1DP6A 2EX9A 2EFUA 5IU1A 2HDQA 3HJIA 3G35A 5TGFA 2W3FA 4Q0IA 4LRYC 4ETXA 1ZTUA 2L0WA 2JHEA 4WM9A 5FQJA 3FYZA 2EWWA 2E8JA 3B47A 3CLOA 5BOHA 2W1RA 2W27A 1ONGA 3H7WA 3Q07A 2WAEA 5EVIA 1VQQA 3N8LA 1S1ZA 2K31A 4OH0A 3IF6C 2KDKA 4ARZA 1KE4A 3IF6B 1KDSA 1K6RA 1IKIA 1Y4OA 5A91A 1UGUA 2W1TA 3LCEA 1ONHA 1L0EA 2G7UA 1S6RA 5EFWA 4E3MA 2W3GA 3LY3A 4XUZA 1OT6A 2PD8A 3LUQA 4WZ5C 1XFQA 3UB5P 2OAP1 4E6XA 2VGLM 2XGNA 4JXGA 5M1AA 5CXWA 1VETA 2YKFA 3IT9A 3VFFA 5TFQA 3KYZA 3UMEA 5A93A 5JYOA 3S7NA 4CPKA 2DMWA 2WGWB 5F1FA 4EQ1A 1SDNA 2VLGA 1PNEA 3UB9A 2Y2QA 4X69A 3O87A 4EXOA 4S2NC 3W8KA 2NUPC 2O9CA 5JYPA 1V9ZA 5C5KA 3FWLA 1ERQA 5HD3A 3DTIA 4HJ3A 3UE1A 5IHVA 3UPOA 3BY8A 2B95A 2G2WA 3G32A 1NLZA 1G28A 4Y15A 2K2NA 2ZQ8A 4GNUA 3HJKA 2BLSA 2LB5A 5DFYA 1CEGA 4KENB 5HFOA 5FAOA 4GS9B 4WEJA 4WF0A 5DKKA 3BY9A 1IYQA 4R23A 4B9OA 4X68A 5F68A 4NK3A 3NULA 2IWDA 3BFEA 3B3XA 5CGWA 1STZA 2V1ZA 5EECA 4FH2A 1W79A 3A3JA 4K91A 3OCNA 3BLSA 3QP8A 1LSVA 2WUQA 1KGGA 2ZMFA 1S0WA 3HREA 4H6JA 4DDSA 5M18A 4F94A 4OOMA 4CLCC 2EX2A 4PPRA 1GSXA 5EM1A 1HVBA 1UWPX 3R4KA 2C6WB 4GS9A 4P6BA 3KSHA 5FA7A 4BENA 1PZPA 5L8MA 3FPWA 2WAFA 3IX3A 4LCMA 1DJBA 3G2YA 4FUWA 3PBRA 2ZJ9A 1KGEA 3PXPA 1H8YA 4ZJ3A 1NZOA 3B33A 3WS2A 4IEDA 2HGVA 4E3NA 4H8RA 2ZQAA 4UEYA 1P0ZA 3JVVA 3CAXA 4EUVA 5HX9A 2WGWA 2ZD8A 5HD5A 3CUEC 2WGIA 4AFIA 3KO6A 3BYDA 2XDMA 4K0WA 2GDNA 3OC2A 3PR6A 1M6KA 5EVIC 3LYXA 3R7WA 2R78A 3VOLA 3GTCA 5HWVA 4PM9A 1XGIA 3TRCA 3ZQ5A 1LL9A 4MDZA 4IBXA 1OJGA 2VV8A 3DTEA 3H7WB 3IX8A 4L0LA 4MBFA 3EGDC 3MZDA 1T1BA 5HWTA 4NKPA 5J4EA 3PAEA 1L0GA 4GD8A 3QNCA 4O0PA 1LL8A 5FQIA 2NUTC 4DJ2A 4LLOB 2GX5A 1K0KA 3GQZA 2WKRA 3UB8A 3MF0A 1YPRA 3I7JA 4L9EA 1N9OA 4DF6A 4EWFA 2QZ6A 3LR4A 2W3EA 2WKEA 3UN7A 3Q7VB 4DDYA 5MC7A 1CJFA 1FSWA 3ZG5A 4GZBA 3LICA 4K0XA 3UDIA 4RX2A 2JE5A 4OQ0A 5FQQA 4HH3A 4LENA 1MC0A 1Q2QA 2XD1A 3BEBA 1F98A 5FQKA 2ZM8A 3C7UA 4OPYA 4KZ4A 4Z9QA 2PT7A 4B93A 2XEPA 2H10A 2Z2LB 3LR5A 1W63M 1TDLA 3FPVA 5HARA 1G6OA 1TVFA 4X53A 4HHDA 1IYPA 4OLDA 4Q0JA 3EWKA 3EOIA 1I5QA 3OPHA 4S2KA 3OPRA 2XR0A 1YM1A 1DP8A 1YLJA 3LGOA 4R4RA 2Y2NA 3K2NA 1VEUB 1K55C 2OWJA 4DE2A 3IWOA 5DF7A 3T4TA 1Z09A 5AJGA 4N1HA 5KMWA 3NECA 1YLWA 1JWVA 3F1NA 3VP4A 2A49A 4F3LB 4LV2A 5KZHA 2B02A 2HP6A 4HIAA 2JKFA 3D72A 3HLFA 5HWWA 1KDWA 3L7HA 3UY6A 1YKDA 2ZQDA 4BQMA 5HZHA 2Z2MB 2R9WA 1YQSA 4OQHA 4WN5A 1XFNA 2DRWA 2YKHA 2L4RA 2M7VA 4I38A 4JLFA 3SH7A 4QJGA 3T4LA 3CHWP 4JGPA 1PYYA 4GDBA 1E4DA 4HY8A 1MKIA 3OOVA 4UA6A 1LL5A 3UO9A 5E2EA 3VP2A 2VZWA 5CHMA 2A24A 3KYEA 3EEAA 1K38A 2EX8A 2PDRA 1ZG6A 3KX0X 5EVIB 1YT4A 4KZ5A 1J3WA 4CQHA 5IS1A 2K7SA 4R38A 4GJ4A 2XD5A 4HP4A 1BUEA 3O88A 5TBMA 4UA7A 3MKFA 3MZEA 4Y5FA 4WMCA 4BL3A 1BLCA 2HP5A 2OAQ1 3QP6A 2ZC6B 4JGRA 3T1XA 1DP9A 2WKQA 5FI7A 1SKOB 4DKIA 3QHYA 4RQ9A 3BW6A 3EEHA 1FSYA 5CEDA 2FFFB 4OONA 5DF8A 2B5RA 2XRNA 2VKSA 5CX7A 3T50A 2HDUA 4QPRA 2J7VA 2GZAA 3EQUA 1L0FA 4ARZB 1OMEA 2O9BA 1I2WA 1TS7A 4HJ4A 3DAVA 1QMFA 1EWZA 3UE6A 3RFBA 1Q2PA 1MY8A 3FKVA 4E3JA 2WZXA 3BJNA 1EW0A 3K3DA 2VJWA 5GLBA 2WK0A 4H6JB 3LIFA 1BZAA 3VSKA 3IWQA 2O0YA 1BSGA 4JF4A 3HUNA 1ES4A 2J3WA 3NOPC 3BFGA 4Y0UA 3DWZA 2HZ5A 3F1PB 3HLEA 1I2SA 1GA9A 3C4PA 2L1MA 3BFCA 3IBRA 3IWIA 4NEED 5EE8A 3UNWA 1U60A 2ZMVA 3G4PA 3PTEA 2H0YA 5TBMB 3ZNYA 3NOUC 2JKRI 4MN6A 3RTYA 5CGSA 3WS1A 4X55A 3ZVWA 4EW7A 2WKHA 3HBRA 2A2LA 4R3BA 5L09A 5GHYA 3ZVTA 1O07A 4DE0A 2Z6CA 4FD8A 3S1YA 2R9XA 4HH2A 4I5SA 4IUHA 4JGOA 3QP5A 3R7WB 3H82A 4KUKA 1MWTA 2PYRA 4XXRA 5M19A 5HDCA 3JYIA 3ZG8B 5HAPA 3VP3A 3SH8A 2QWSA 4GB7A 3DBAA 4ZRRA 3CI6A 4WZ4A 1XP4A 4WMCD 2H0TA 1GSWA 2BTFP 1FOFA 1BTLA 1K6SA 4EESA 1K25A 4R6LA 2ZQ9A 4OOYA 2KX6A 4YFMA 5CEBA 1DRMA 1LT0A 1HD8A 1X0OA 1C3BA 2WYXA 2PU4A 3VSLA 2HF6A 4BL2A 4M3KA 4K08A 2EXBA 1IELA 4KZ8A 1PRQA 1KE3A 2E8IA 4JPMA 4C3QA 1NWZA 2DCFA 3KSGA 4B4XA 2OWHA 1LLBA 4KZBA 2IWBA 3FC7A 2ZM0A 3G30A 3MFDA 2J3TD 3BLMA 5AQBA 1BYWA 3IXGA 4ZTKA 3LI9A 3IS2A 1L0DA 3ZNTA 1FILA 2QHKA 2PAVP 1XJ2A 3UPNA 3VOZA 1A0KA 2QPNA 4N9LA 4Q8IA 5EOEA 3IX4A 2QJ7A 2W3HA 4MMNA 1QMEA 5AQ9A 2X01A 1BT5A 3E4OA 4WBGA 3IQAA 3OBFA 3CWFA 5AVFA 1H0MA 2XH9A 3HUOA 3AGEA 3HL9A 4R3JA 3LIEA 3PAGA 3ZGAB 2ZL1A 1V9YA 3IH8A 3SS4A 2VK3A 2P9VA 2P08A 1EROA 5HAIA 4CLCB 3V5MA 2B18A 2W0NA 3BRMA 4HBTA 5GLCA 4Y13A 1H5XA 4WUJA 3QP2A 2JCHA 1IYOA 1PI5A 3G2ZA 4UAAA 2Y2IA 1BULA 1GCEA 1S4SA 4HI4A 3A3EA 3GRJA 4ZJ1A 5LBRA 4EEUA 1JTDA 3MQQA 3V39A 3AGDA 1IFQA 2Y2KA 3DWKA 4BD0A 2QMIA 1GHIA 3GV9A 5IT5A 1MXOA 1VETB 3F1PA 3M6BA 2XFSA 4OOLA 2H5SA 4RVAA 3MXQA 2EX6A 4PM8A 2VX8A 3Q7ZA 4L9FA 3N8RA 4ESPA 1NY0A 2P04A 2V1BA 4DMZA 4G3VA 1YSPA 2JN7A 1VHMA 3ITBA 5E2HA 3UDXA 2EXAA 3CPTA 3NC8A 3KYQA 1IEMA 1FCMA 3VP0A 2ZOHA 1NLYA 2ZC3B 3KSIA 3LR3A 1T1AA 3CITA 1M40A 4F3LA 4JXVA 2XA7S 4A5RA 4PM6A 3T4KA 3E4QA 1K57C 4IJGA 4NXEA 1S4RA 1ZG4A 1KE0A 3BQAA 3P98A 3FZCA 1OT9A 3UB7A 1N9BA 1ZKJA 4FTXA 5CRFA 4EQIA 4O7DA 5GL9A 3P01A 3T12B 1SZVA 5HW3A 1KGFA 1YLYA 2XROA 1PW1A 1XGJA 2Y55A 1BLHA 4CLCA 4PKYA 4O8GA 3ITAA 5FATA 4GW9A 1S67L 4X6TA 5F1GA 4BWIA 3BFDA 1FCOA 3TSGA 3K3CA 4KG2A 1BLPA 3E98A 1IKGA 3U2AA 2Q0OA 2BG1A 1SDEA 3TJZC 1NRFA 3C38A 3C4OA 5FSRA 2V0WA 2I72A 4S2JA 1OTEA 4Y17A 4ZBEA 5HAQA 1OTIA 2V2FF 5FASA 1MWRA 1XA1A 3BECA 5L2FA 3IF5A 1XJ6A 3FG8A 4IBRA 3GMWA 1CEFA 4R4SA 3Q81A 4XT2B 5CGXA 5FEGA 4JGQA 4RYEA 5FDHA 1XJ3A 5DKLA 3TOIA 4FH4A 3ZG7B 4FSFA 3BM6A 3T4JA 4B4ZA 2ZOIA 4BBTA 3LR0A 5HDSA 4WZ5A 1K4EA 4KUOA 4MN7A 5A92A 4S2OA 5HL1A 4IUKA 1MBLA 4GD6A 4OKPA 4D2OA 3TE8A 4KQRA 2OV5A 2Y4AA 1TS0A 2Y79A 4Y0TA 2ZL1B 4EBNA 3E4PA 3D3OA 3UPPA 1AXBA 4QWOA 3ZYTA 1XX2A 1EI5A 5AQ7A 3UE3A 2Y2LA 3MSHA 3ZG9B 2HP9A 4CLCD 1S1YA 4S2LA 3LIAA 1GHMA 5FEFA 3WRTA 1PFLA 2Y91A 4PHTA 2EFXA 3IF6A 4HNBA 4N9KA 2QJ5A 1W7FA 3O5YA 3NY4A 4KZ7A 4U0TA 4E04A 4XT2A 1T18A 5E43A 5G4ZA 3MBZA 4NETA 3P7NA 4R70A 4ME4A 2EWVA 1YLTA 2I9VA 3QP4A 1ZHHB 3MKEA 3T4QA 4KQQA 1MKMA 4OP5A 3G34A 1W8QA 2Y2PA 2ZC5B 1AWIA 1TS8A 3VP1A 4JF6A 2D02A 2UV0E 4RA7A 4E3IA 2ZM2A 4OPZA 5GHZA 3OCLA 4PM5A 3PBSA 4PAUA 5EVLA 1ODVA 5DJTA 2H28A 3CPTB 1ACFA 1FR6A 3MQ0A 1E3UD 3E2LA 2HDRA 3LIBA 5A90A 2JKRM 5FI2A 3HLWA 4I3AA 5DFXA 2WADA 3GECA 4LGWA 2W3DA 3RXXA 3CG5A 4R3AA 5F83A 2PR6A 2Y8HA 1KVMA 1WYBA 4MEZA 1N9LA 1ALQA 4DE1A 2HPBA 1TF1A 2RCXA 4BBVA
chains in the Genus database with same CATH topology
1D1JA 3T1SA 2PRFA 5FDSA 3LEQA 2JKFA 5FEFA 4FUWA 3UB5P 4X1LA 1YPRA 1PNEA 3L7HA 1PFLA 2B95A 4ESPA 1G5UA 2JKGA 3DAVA 2ZL1B 1Z09A 1HLUP 2ACGA 4FTXA 4X1MA 5EVEA 1F2KA 1VETA 1Y4OA 3NULA 3NECA 4X25A 2V8CA 3T12B 2PBDP 3KYEA 2E8JA 1SZVA 3CPTA 3MS6A 2BTFP 3CPTB 4QWOA 5EM1A 1CF0A 1FIKA 1K0KA 3T1RA 1ACFA 1AWIA 1CJFA 3L9KA 2V8FA 1FILA 2HZ5A 3MSHA 1PRQA 3T1XA 1CQAA 2PAVP 1VETB 1VEUA 1SKOB 3LGOA 5EM0A 4D60A 1SKOA 1A0KA 2ZL1A 5EV0A 3T1QB 5FEGA 3CHWP 2VK3A 1VEUB 3U4LP 3D9YA 1J3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1J A;  3T1S A;  2PRF A;  5FDS A;  3LEQ A;  2JKF A;  5FEF A;  4FUW A;  3UB5 P;  4X1L A;  1YPR A;  1PNE A;  3L7H A;  1PFL A;  2B95 A;  4ESP A;  1G5U A;  2JKG A;  3DAV A;  2ZL1 B;  1Z09 A;  1HLU P;  2ACG A;  4FTX A;  4X1M A;  5EVE A;  1F2K A;  1VET A;  1Y4O A;  3NUL A;  3NEC A;  4X25 A;  2V8C A;  3T12 B;  2PBD P;  3KYE A;  2E8J A;  1SZV A;  3CPT A;  3MS6 A;  2BTF P;  3CPT B;  4QWO A;  5EM1 A;  1CF0 A;  1FIK A;  1K0K A;  3T1R A;  1ACF A;  1AWI A;  1CJF A;  3L9K A;  2V8F A;  1FIL A;  2HZ5 A;  3MSH A;  1PRQ A;  3T1X A;  1CQA A;  2PAV P;  1VET B;  1VEU A;  1SKO B;  3LGO A;  5EM0 A;  4D60 A;  1SKO A;  1A0K A;  2ZL1 A;  5EV0 A;  3T1Q B;  5FEG A;  3CHW P;  2VK3 A;  1VEU B;  3U4L P;  3D9Y A;  1J3W A; 
#chains in the Genus database with same CATH topology
 1Y54 A;  1G6A A;  2WKI A;  3E0Y A;  3NBL A;  1O7E A;  2J8Y A;  5AVE A;  2CMN A;  4EEP A;  3NI9 A;  4OP8 A;  4YOF A;  3LY4 A;  2PHY A;  4EU0 A;  1OTD A;  2WZZ A;  1J9M A;  3U4L P;  1D06 A;  3IHA A;  3S7P A;  5FDS A;  4LV1 A;  4Z1W A;  1SCW A;  2HJE A;  1OPX A;  3DTK A;  3T4S A;  1YMS A;  4KZ6 A;  1L2S A;  3M2J A;  1TEM A;  1FCN A;  3SOI A;  4BBU A;  3N8S A;  1MWU A;  4P6Z S;  4S2I A;  4UHU A;  5FQ9 A;  4GHI B;  3OPL A;  4X56 A;  3MQO A;  3LID A;  4NG2 A;  3VV4 A;  2Z6D A;  4I3I A;  1CK3 A;  2X71 A;  3WS0 A;  5KSC A;  2FH5 A;  1RP5 A;  3C8C A;  3OLO A;  3WS5 A;  2G2U A;  3E2K A;  1ES2 A;  5FAQ A;  5J7E A;  4BMW A;  2XFT A;  4HQA A;  1D1J A;  2WGV A;  4G3K A;  1PZO A;  2P7J A;  2HV1 A;  3S4X A;  1PWD A;  4KQD A;  3ZHH A;  2ZC7 A;  1JWP A;  4WEK A;  5FI6 A;  4OPR A;  4E3O A;  1ES5 A;  5FAP A;  2QYB A;  5F69 A;  3MMH A;  3NDG A;  1E3U A;  2PR5 A;  1XKZ A;  2JC7 A;  3C7V A;  3G31 A;  3OZH A;  4S2N A;  2VEA A;  3PYP A;  1HLU P;  1OJ5 A;  3W2Z A;  4JXW A;  3TG9 A;  4E3K A;  3IH9 A;  1BLS A;  2Y2M A;  4ZDX A;  2XK1 A;  4IVI A;  4QY5 A;  4NXF A;  3A3I A;  1WYC A;  4YIN A;  1ZC2 A;  2MJ6 A;  4OQI A;  3IS2 B;  4OLG A;  1TD5 A;  5HDD A;  3HLB A;  5EOO A;  1P9W A;  4KQO A;  4WLA A;  4EBP A;  1ESU A;  4GHI A;  2OLU A;  4EV4 A;  3NIA A;  3LEZ A;  1XXM A;  4DN0 A;  2GNX A;  3F1O A;  1PWG A;  2Y59 A;  4HJ6 A;  2M7U A;  3P09 A;  4I3J A;  3PBQ A;  1MWS A;  3QNB A;  3RJU A;  1PIO A;  1K54 C;  1G5U A;  4X1M A;  1HZO A;  4YNR A;  4KZ9 A;  3F1O B;  5K5B A;  3MR0 A;  3UMD A;  1FIK A;  3L9K A;  4JBF A;  2FFY A;  4Y2F A;  3UE0 A;  1FR1 A;  1H3Q A;  1E25 A;  2EA9 A;  3TW8 A;  5HPI A;  3SH9 A;  4P6Z M;  4IHQ A;  5G4Y A;  1CI9 A;  1LSX A;  5DF9 A;  1NZU A;  2Y2G A;  3MXR A;  3UDF A;  4II7 A;  2WKP A;  1IOU A;  4R0Q A;  3C30 A;  2D01 A;  2VV6 A;  5KIZ A;  1KVL A;  2JBF A;  4PMA A;  4ZJ2 A;  4CLC E;  4YWZ A;  3OPP A;  4EBL A;  2V1A A;  2LB9 A;  1P97 A;  5EV0 A;  4JXS A;  3PHY A;  4LV3 A;  4P0M A;  5L10 A;  3VFH A;  2ZQC A;  3NDE A;  1DJA A;  4U0X A;  1GSV A;  2M1C A;  1S66 L;  3CUE A;  3DTM A;  4XUX A;  3HVF A;  3T1R A;  2QKP A;  4WYY A;  1NYY A;  5F5Y A;  4DRT A;  4WEL A;  3NHQ A;  5G18 A;  5DJU A;  4KZA A;  1RGZ A;  3SS3 A;  1ES3 A;  4QB8 A;  3LFV A;  4N92 A;  3JVU A;  2VGL S;  4GKU A;  4GLQ A;  4LCL A;  5EPH A;  2ZC4 B;  4QD4 A;  1NRJ A;  4GDN A;  5I5L A;  4N1X A;  4IVK A;  1JWZ A;  5F6A A;  4M4X A;  3ZFZ A;  2C5W B;  2Q9M A;  4MBK A;  5CEC A;  2KOI A;  5EVI D;  2X02 A;  3A0R A;  3C5A A;  3CMZ A;  2OSU A;  3Q7V A;  4QY6 A;  4ID4 A;  1JTG A;  4D60 A;  4JF5 A;  3W4O A;  3Q82 A;  1PWC A;  1TS6 A;  3NCK A;  3VE3 A;  3LEQ A;  3EQV A;  3FKW A;  1YLP A;  2GJ3 A;  4JKT A;  5CHU A;  2JKG A;  3A3D A;  5CER A;  4QU3 A;  2XA7 M;  2VA0 A;  1OTA A;  2ZLY A;  3BFF A;  1N9N A;  2O9A A;  4C75 A;  1OTB A;  3FV7 A;  1MZU A;  5TR7 A;  3HLD A;  3WS4 A;  1JNU A;  4NXG A;  4WL9 A;  4L9G A;  2DNS A;  3ZCZ A;  5DTT A;  1GHP A;  2OOL A;  2PBD P;  3HUM A;  4HP9 A;  3CJM A;  3ZG0 A;  3H82 B;  1T19 A;  4P87 A;  3QP1 A;  4PM7 A;  5EVE A;  2FZ0 A;  1ERM A;  1G68 A;  3RXW A;  4HEF A;  4Y3I A;  3MJQ A;  4DE3 A;  4S2M A;  2PYP A;  1YLZ A;  5KSH A;  3IXB A;  5GLD A;  4OQG A;  4S2P A;  5GHX A;  4EER A;  5E2F A;  1YSQ A;  3A3F A;  1GA0 A;  1K56 D;  5TJJ A;  1K56 A;  3S22 A;  1KOU A;  3V67 A;  3MFX A;  3HLC A;  4UA9 A;  4MNR A;  5A8B A;  3WWX A;  3ISG A;  3SS5 A;  4Y7P A;  4Y0O A;  2PD7 A;  3M6H A;  1MPL A;  1PI4 A;  4LRZ E;  1W5D A;  5GLA A;  2Y2H A;  1RGY A;  3GSG A;  4OVD A;  1CF0 A;  3PBO A;  3GDI A;  1H8M A;  1F5M A;  1NXY A;  3ICY A;  4I39 A;  5EM0 A;  2O99 A;  3IBJ A;  3BQ8 A;  1LI9 A;  1WE4 A;  5E2G A;  4E3L A;  3SW1 A;  2P74 A;  4RX3 A;  4Q0H A;  4DXB A;  4LRX C;  1N4O A;  3F1N B;  1P9R A;  3C2W A;  3ULF A;  4CJN A;  1Z6F A;  1K55 A;  1XA7 A;  2J9P A;  4B88 A;  3PBN A;  1VM1 A;  1CI8 A;  3W4P A;  3JPU A;  2ZQ7 A;  1VEU A;  2V0U A;  4MLL A;  3S7Q A;  1JVJ A;  1FQG A;  1LSW A;  5DVA A;  3V3R A;  3VE4 A;  5HPF A;  1W63 Q;  2XQZ A;  2KLI A;  1DY6 A;  5FL3 A;  2V8F A;  4QHC A;  1SKO A;  3NJA A;  4GOG A;  1LHY A;  5EUA A;  3AGF A;  2BAS A;  4GN2 A;  5DTK A;  2IA2 A;  3EGX C;  3O3V A;  4MBH A;  4FCF A;  3DW0 A;  4GCZ A;  4KZ3 A;  5CTN A;  1SHV A;  2OLV A;  2ZBB A;  3N7W A;  1CQA A;  1YMX A;  4EET B;  5AQA A;  5CHJ A;  2VGJ A;  4P85 A;  1RCJ A;  4MCW A;  4LPZ A;  3HCY A;  5HL6 A;  1TDG A;  3LO7 A;  3MS6 A;  3GVB A;  1LI0 A;  4BD1 A;  2HDS A;  3V3S A;  4R1G A;  5F82 A;  3T1Q B;  3WRZ A;  4DJ3 A;  1D7E A;  3G6O A;  1Y28 A;  4UQI S;  1K57 A;  2A24 B;  2PBY A;  3W4Q A;  4EUZ A;  2ACG A;  1WA9 A;  1UWN X;  5J3W A;  5D3O A;  2VGK A;  3VMA A;  3A0S A;  2W1T B;  1K54 A;  4KG6 A;  1K4F A;  4FOF A;  3N6I A;  3MZF A;  1HTZ A;  3S7O A;  2CC1 A;  2JKT M;  3O86 A;  2XLN A;  3GR2 A;  4X1L A;  1F2K A;  3BWL A;  3IXD A;  4BJP A;  3M2K A;  1XPB A;  2JKT I;  1SKF A;  4MN5 A;  5L07 A;  4ETZ A;  4UQI M;  3D4F A;  1PW8 A;  2J80 A;  3PBT A;  5DTS A;  4O01 A;  2Y2O A;  2J9O A;  2IWC A;  3MXS A;  1W8Y A;  3HLG A;  2P9V B;  5CTM A;  2HJ9 C;  2XF3 A;  3SZT A;  4OPQ A;  2J3T C;  2V8C A;  3LI8 A;  1T1C A;  3IXH A;  4HOI A;  2ZMA A;  1NJ4 A;  2XSS A;  3CZD A;  2Q9N A;  1F9I A;  5FQM A;  2A3U A;  2V20 A;  2UWX A;  2VV7 A;  1DJC A;  4HES A;  4KG5 A;  3ZDJ A;  3T4O A;  2AVX A;  5I94 A;  3KSF A;  1H8Z A;  3UB6 A;  3NOT C;  3B42 A;  3Q1F A;  3V50 A;  5HSQ A;  2V9A A;  2INW A;  2Y2J A;  2PU2 A;  1ESI A;  4HBU A;  4BLM A;  3D9Y A;  5J8X A;  4C6Y A;  1IYS A;  1XJ4 A;  3N4I A;  3T1S A;  2PRF A;  4DXC A;  4LFU A;  4PKY G;  4E6W A;  1YAX A;  4G3W A;  4ZAM A;  3VOY A;  3H9W A;  4NXB A;  3RH8 B;  4LV0 A;  1NYM A;  5U47 A;  4U3T A;  3IHB A;  4X25 A;  3A0V A;  2RL3 A;  1VB6 A;  1L3L A;  1DP6 A;  2EX9 A;  2EFU A;  5IU1 A;  2HDQ A;  3HJI A;  3G35 A;  5TGF A;  2W3F A;  4Q0I A;  4LRY C;  4ETX A;  1ZTU A;  2L0W A;  2JHE A;  4WM9 A;  5FQJ A;  3FYZ A;  2EWW A;  2E8J A;  3B47 A;  3CLO A;  5BOH A;  2W1R A;  2W27 A;  1ONG A;  3H7W A;  3Q07 A;  2WAE A;  5EVI A;  1VQQ A;  3N8L A;  1S1Z A;  2K31 A;  4OH0 A;  3IF6 C;  2KDK A;  4ARZ A;  1KE4 A;  3IF6 B;  1KDS A;  1K6R A;  1IKI A;  1Y4O A;  5A91 A;  1UGU A;  2W1T A;  3LCE A;  1ONH A;  1L0E A;  2G7U A;  1S6R A;  5EFW A;  4E3M A;  2W3G A;  3LY3 A;  4XUZ A;  1OT6 A;  2PD8 A;  3LUQ A;  4WZ5 C;  1XFQ A;  3UB5 P;  2OAP 1;  4E6X A;  2VGL M;  2XGN A;  4JXG A;  5M1A A;  5CXW A;  1VET A;  2YKF A;  3IT9 A;  3VFF A;  5TFQ A;  3KYZ A;  3UME A;  5A93 A;  5JYO A;  3S7N A;  4CPK A;  2DMW A;  2WGW B;  5F1F A;  4EQ1 A;  1SDN A;  2VLG A;  1PNE A;  3UB9 A;  2Y2Q A;  4X69 A;  3O87 A;  4EXO A;  4S2N C;  3W8K A;  2NUP C;  2O9C A;  5JYP A;  1V9Z A;  5C5K A;  3FWL A;  1ERQ A;  5HD3 A;  3DTI A;  4HJ3 A;  3UE1 A;  5IHV A;  3UPO A;  3BY8 A;  2B95 A;  2G2W A;  3G32 A;  1NLZ A;  1G28 A;  4Y15 A;  2K2N A;  2ZQ8 A;  4GNU A;  3HJK A;  2BLS A;  2LB5 A;  5DFY A;  1CEG A;  4KEN B;  5HFO A;  5FAO A;  4GS9 B;  4WEJ A;  4WF0 A;  5DKK A;  3BY9 A;  1IYQ A;  4R23 A;  4B9O A;  4X68 A;  5F68 A;  4NK3 A;  3NUL A;  2IWD A;  3BFE A;  3B3X A;  5CGW A;  1STZ A;  2V1Z A;  5EEC A;  4FH2 A;  1W79 A;  3A3J A;  4K91 A;  3OCN A;  3BLS A;  3QP8 A;  1LSV A;  2WUQ A;  1KGG A;  2ZMF A;  1S0W A;  3HRE A;  4H6J A;  4DDS A;  5M18 A;  4F94 A;  4OOM A;  4CLC C;  2EX2 A;  4PPR A;  1GSX A;  5EM1 A;  1HVB A;  1UWP X;  3R4K A;  2C6W B;  4GS9 A;  4P6B A;  3KSH A;  5FA7 A;  4BEN A;  1PZP A;  5L8M A;  3FPW A;  2WAF A;  3IX3 A;  4LCM A;  1DJB A;  3G2Y A;  4FUW A;  3PBR A;  2ZJ9 A;  1KGE A;  3PXP A;  1H8Y A;  4ZJ3 A;  1NZO A;  3B33 A;  3WS2 A;  4IED A;  2HGV A;  4E3N A;  4H8R A;  2ZQA A;  4UEY A;  1P0Z A;  3JVV A;  3CAX A;  4EUV A;  5HX9 A;  2WGW A;  2ZD8 A;  5HD5 A;  3CUE C;  2WGI A;  4AFI A;  3KO6 A;  3BYD A;  2XDM A;  4K0W A;  2GDN A;  3OC2 A;  3PR6 A;  1M6K A;  5EVI C;  3LYX A;  3R7W A;  2R78 A;  3VOL A;  3GTC A;  5HWV A;  4PM9 A;  1XGI A;  3TRC A;  3ZQ5 A;  1LL9 A;  4MDZ A;  4IBX A;  1OJG A;  2VV8 A;  3DTE A;  3H7W B;  3IX8 A;  4L0L A;  4MBF A;  3EGD C;  3MZD A;  1T1B A;  5HWT A;  4NKP A;  5J4E A;  3PAE A;  1L0G A;  4GD8 A;  3QNC A;  4O0P A;  1LL8 A;  5FQI A;  2NUT C;  4DJ2 A;  4LLO B;  2GX5 A;  1K0K A;  3GQZ A;  2WKR A;  3UB8 A;  3MF0 A;  1YPR A;  3I7J A;  4L9E A;  1N9O A;  4DF6 A;  4EWF A;  2QZ6 A;  3LR4 A;  2W3E A;  2WKE A;  3UN7 A;  3Q7V B;  4DDY A;  5MC7 A;  1CJF A;  1FSW A;  3ZG5 A;  4GZB A;  3LIC A;  4K0X A;  3UDI A;  4RX2 A;  2JE5 A;  4OQ0 A;  5FQQ A;  4HH3 A;  4LEN A;  1MC0 A;  1Q2Q A;  2XD1 A;  3BEB A;  1F98 A;  5FQK A;  2ZM8 A;  3C7U A;  4OPY A;  4KZ4 A;  4Z9Q A;  2PT7 A;  4B93 A;  2XEP A;  2H10 A;  2Z2L B;  3LR5 A;  1W63 M;  1TDL A;  3FPV A;  5HAR A;  1G6O A;  1TVF A;  4X53 A;  4HHD A;  1IYP A;  4OLD A;  4Q0J A;  3EWK A;  3EOI A;  1I5Q A;  3OPH A;  4S2K A;  3OPR A;  2XR0 A;  1YM1 A;  1DP8 A;  1YLJ A;  3LGO A;  4R4R A;  2Y2N A;  3K2N A;  1VEU B;  1K55 C;  2OWJ A;  4DE2 A;  3IWO A;  5DF7 A;  3T4T A;  1Z09 A;  5AJG A;  4N1H A;  5KMW A;  3NEC A;  1YLW A;  1JWV A;  3F1N A;  3VP4 A;  2A49 A;  4F3L B;  4LV2 A;  5KZH A;  2B02 A;  2HP6 A;  4HIA A;  2JKF A;  3D72 A;  3HLF A;  5HWW A;  1KDW A;  3L7H A;  3UY6 A;  1YKD A;  2ZQD A;  4BQM A;  5HZH A;  2Z2M B;  2R9W A;  1YQS A;  4OQH A;  4WN5 A;  1XFN A;  2DRW A;  2YKH A;  2L4R A;  2M7V A;  4I38 A;  4JLF A;  3SH7 A;  4QJG A;  3T4L A;  3CHW P;  4JGP A;  1PYY A;  4GDB A;  1E4D A;  4HY8 A;  1MKI A;  3OOV A;  4UA6 A;  1LL5 A;  3UO9 A;  5E2E A;  3VP2 A;  2VZW A;  5CHM A;  2A24 A;  3KYE A;  3EEA A;  1K38 A;  2EX8 A;  2PDR A;  1ZG6 A;  3KX0 X;  5EVI B;  1YT4 A;  4KZ5 A;  1J3W A;  4CQH A;  5IS1 A;  2K7S A;  4R38 A;  4GJ4 A;  2XD5 A;  4HP4 A;  1BUE A;  3O88 A;  5TBM A;  4UA7 A;  3MKF A;  3MZE A;  4Y5F A;  4WMC A;  4BL3 A;  1BLC A;  2HP5 A;  2OAQ 1;  3QP6 A;  2ZC6 B;  4JGR A;  3T1X A;  1DP9 A;  2WKQ A;  5FI7 A;  1SKO B;  4DKI A;  3QHY A;  4RQ9 A;  3BW6 A;  3EEH A;  1FSY A;  5CED A;  2FFF B;  4OON A;  5DF8 A;  2B5R A;  2XRN A;  2VKS A;  5CX7 A;  3T50 A;  2HDU A;  4QPR A;  2J7V A;  2GZA A;  3EQU A;  1L0F A;  4ARZ B;  1OME A;  2O9B A;  1I2W A;  1TS7 A;  4HJ4 A;  3DAV A;  1QMF A;  1EWZ A;  3UE6 A;  3RFB A;  1Q2P A;  1MY8 A;  3FKV A;  4E3J A;  2WZX A;  3BJN A;  1EW0 A;  3K3D A;  2VJW A;  5GLB A;  2WK0 A;  4H6J B;  3LIF A;  1BZA A;  3VSK A;  3IWQ A;  2O0Y A;  1BSG A;  4JF4 A;  3HUN A;  1ES4 A;  2J3W A;  3NOP C;  3BFG A;  4Y0U A;  3DWZ A;  2HZ5 A;  3F1P B;  3HLE A;  1I2S A;  1GA9 A;  3C4P A;  2L1M A;  3BFC A;  3IBR A;  3IWI A;  4NEE D;  5EE8 A;  3UNW A;  1U60 A;  2ZMV A;  3G4P A;  3PTE A;  2H0Y A;  5TBM B;  3ZNY A;  3NOU C;  2JKR I;  4MN6 A;  3RTY A;  5CGS A;  3WS1 A;  4X55 A;  3ZVW A;  4EW7 A;  2WKH A;  3HBR A;  2A2L A;  4R3B A;  5L09 A;  5GHY A;  3ZVT A;  1O07 A;  4DE0 A;  2Z6C A;  4FD8 A;  3S1Y A;  2R9X A;  4HH2 A;  4I5S A;  4IUH A;  4JGO A;  3QP5 A;  3R7W B;  3H82 A;  4KUK A;  1MWT A;  2PYR A;  4XXR A;  5M19 A;  5HDC A;  3JYI A;  3ZG8 B;  5HAP A;  3VP3 A;  3SH8 A;  2QWS A;  4GB7 A;  3DBA A;  4ZRR A;  3CI6 A;  4WZ4 A;  1XP4 A;  4WMC D;  2H0T A;  1GSW A;  2BTF P;  1FOF A;  1BTL A;  1K6S A;  4EES A;  1K25 A;  4R6L A;  2ZQ9 A;  4OOY A;  2KX6 A;  4YFM A;  5CEB A;  1DRM A;  1LT0 A;  1HD8 A;  1X0O A;  1C3B A;  2WYX A;  2PU4 A;  3VSL A;  2HF6 A;  4BL2 A;  4M3K A;  4K08 A;  2EXB A;  1IEL A;  4KZ8 A;  1PRQ A;  1KE3 A;  2E8I A;  4JPM A;  4C3Q A;  1NWZ A;  2DCF A;  3KSG A;  4B4X A;  2OWH A;  1LLB A;  4KZB A;  2IWB A;  3FC7 A;  2ZM0 A;  3G30 A;  3MFD A;  2J3T D;  3BLM A;  5AQB A;  1BYW A;  3IXG A;  4ZTK A;  3LI9 A;  3IS2 A;  1L0D A;  3ZNT A;  1FIL A;  2QHK A;  2PAV P;  1XJ2 A;  3UPN A;  3VOZ A;  1A0K A;  2QPN A;  4N9L A;  4Q8I A;  5EOE A;  3IX4 A;  2QJ7 A;  2W3H A;  4MMN A;  1QME A;  5AQ9 A;  2X01 A;  1BT5 A;  3E4O A;  4WBG A;  3IQA A;  3OBF A;  3CWF A;  5AVF A;  1H0M A;  2XH9 A;  3HUO A;  3AGE A;  3HL9 A;  4R3J A;  3LIE A;  3PAG A;  3ZGA B;  2ZL1 A;  1V9Y A;  3IH8 A;  3SS4 A;  2VK3 A;  2P9V A;  2P08 A;  1ERO A;  5HAI A;  4CLC B;  3V5M A;  2B18 A;  2W0N A;  3BRM A;  4HBT A;  5GLC A;  4Y13 A;  1H5X A;  4WUJ A;  3QP2 A;  2JCH A;  1IYO A;  1PI5 A;  3G2Z A;  4UAA A;  2Y2I A;  1BUL A;  1GCE A;  1S4S A;  4HI4 A;  3A3E A;  3GRJ A;  4ZJ1 A;  5LBR A;  4EEU A;  1JTD A;  3MQQ A;  3V39 A;  3AGD A;  1IFQ A;  2Y2K A;  3DWK A;  4BD0 A;  2QMI A;  1GHI A;  3GV9 A;  5IT5 A;  1MXO A;  1VET B;  3F1P A;  3M6B A;  2XFS A;  4OOL A;  2H5S A;  4RVA A;  3MXQ A;  2EX6 A;  4PM8 A;  2VX8 A;  3Q7Z A;  4L9F A;  3N8R A;  4ESP A;  1NY0 A;  2P04 A;  2V1B A;  4DMZ A;  4G3V A;  1YSP A;  2JN7 A;  1VHM A;  3ITB A;  5E2H A;  3UDX A;  2EXA A;  3CPT A;  3NC8 A;  3KYQ A;  1IEM A;  1FCM A;  3VP0 A;  2ZOH A;  1NLY A;  2ZC3 B;  3KSI A;  3LR3 A;  1T1A A;  3CIT A;  1M40 A;  4F3L A;  4JXV A;  2XA7 S;  4A5R A;  4PM6 A;  3T4K A;  3E4Q A;  1K57 C;  4IJG A;  4NXE A;  1S4R A;  1ZG4 A;  1KE0 A;  3BQA A;  3P98 A;  3FZC A;  1OT9 A;  3UB7 A;  1N9B A;  1ZKJ A;  4FTX A;  5CRF A;  4EQI A;  4O7D A;  5GL9 A;  3P01 A;  3T12 B;  1SZV A;  5HW3 A;  1KGF A;  1YLY A;  2XRO A;  1PW1 A;  1XGJ A;  2Y55 A;  1BLH A;  4CLC A;  4PKY A;  4O8G A;  3ITA A;  5FAT A;  4GW9 A;  1S67 L;  4X6T A;  5F1G A;  4BWI A;  3BFD A;  1FCO A;  3TSG A;  3K3C A;  4KG2 A;  1BLP A;  3E98 A;  1IKG A;  3U2A A;  2Q0O A;  2BG1 A;  1SDE A;  3TJZ C;  1NRF A;  3C38 A;  3C4O A;  5FSR A;  2V0W A;  2I72 A;  4S2J A;  1OTE A;  4Y17 A;  4ZBE A;  5HAQ A;  1OTI A;  2V2F F;  5FAS A;  1MWR A;  1XA1 A;  3BEC A;  5L2F A;  3IF5 A;  1XJ6 A;  3FG8 A;  4IBR A;  3GMW A;  1CEF A;  4R4S A;  3Q81 A;  4XT2 B;  5CGX A;  5FEG A;  4JGQ A;  4RYE A;  5FDH A;  1XJ3 A;  5DKL A;  3TOI A;  4FH4 A;  3ZG7 B;  4FSF A;  3BM6 A;  3T4J A;  4B4Z A;  2ZOI A;  4BBT A;  3LR0 A;  5HDS A;  4WZ5 A;  1K4E A;  4KUO A;  4MN7 A;  5A92 A;  4S2O A;  5HL1 A;  4IUK A;  1MBL A;  4GD6 A;  4OKP A;  4D2O A;  3TE8 A;  4KQR A;  2OV5 A;  2Y4A A;  1TS0 A;  2Y79 A;  4Y0T A;  2ZL1 B;  4EBN A;  3E4P A;  3D3O A;  3UPP A;  1AXB A;  4QWO A;  3ZYT A;  1XX2 A;  1EI5 A;  5AQ7 A;  3UE3 A;  2Y2L A;  3MSH A;  3ZG9 B;  2HP9 A;  4CLC D;  1S1Y A;  4S2L A;  3LIA A;  1GHM A;  5FEF A;  3WRT A;  1PFL A;  2Y91 A;  4PHT A;  2EFX A;  3IF6 A;  4HNB A;  4N9K A;  2QJ5 A;  1W7F A;  3O5Y A;  3NY4 A;  4KZ7 A;  4U0T A;  4E04 A;  4XT2 A;  1T18 A;  5E43 A;  5G4Z A;  3MBZ A;  4NET A;  3P7N A;  4R70 A;  4ME4 A;  2EWV A;  1YLT A;  2I9V A;  3QP4 A;  1ZHH B;  3MKE A;  3T4Q A;  4KQQ A;  1MKM A;  4OP5 A;  3G34 A;  1W8Q A;  2Y2P A;  2ZC5 B;  1AWI A;  1TS8 A;  3VP1 A;  4JF6 A;  2D02 A;  2UV0 E;  4RA7 A;  4E3I A;  2ZM2 A;  4OPZ A;  5GHZ A;  3OCL A;  4PM5 A;  3PBS A;  4PAU A;  5EVL A;  1ODV A;  5DJT A;  2H28 A;  3CPT B;  1ACF A;  1FR6 A;  3MQ0 A;  1E3U D;  3E2L A;  2HDR A;  3LIB A;  5A90 A;  2JKR M;  5FI2 A;  3HLW A;  4I3A A;  5DFX A;  2WAD A;  3GEC A;  4LGW A;  2W3D A;  3RXX A;  3CG5 A;  4R3A A;  5F83 A;  2PR6 A;  2Y8H A;  1KVM A;  1WYB A;  4MEZ A;  1N9L A;  1ALQ A;  4DE1 A;  2HPB A;  1TF1 A;  2RCX A;  4BBV A; 
#chains in the Genus database with same CATH homology
 1D1J A;  3T1S A;  2PRF A;  5FDS A;  3LEQ A;  2JKF A;  5FEF A;  4FUW A;  3UB5 P;  4X1L A;  1YPR A;  1PNE A;  3L7H A;  1PFL A;  2B95 A;  4ESP A;  1G5U A;  2JKG A;  3DAV A;  2ZL1 B;  1Z09 A;  1HLU P;  2ACG A;  4FTX A;  4X1M A;  5EVE A;  1F2K A;  1VET A;  1Y4O A;  3NUL A;  3NEC A;  4X25 A;  2V8C A;  3T12 B;  2PBD P;  3KYE A;  2E8J A;  1SZV A;  3CPT A;  3MS6 A;  2BTF P;  3CPT B;  4QWO A;  5EM1 A;  1CF0 A;  1FIK A;  1K0K A;  3T1R A;  1ACF A;  1AWI A;  1CJF A;  3L9K A;  2V8F A;  1FIL A;  2HZ5 A;  3MSH A;  1PRQ A;  3T1X A;  1CQA A;  2PAV P;  1VET B;  1VEU A;  1SKO B;  3LGO A;  5EM0 A;  4D60 A;  1SKO A;  1A0K A;  2ZL1 A;  5EV0 A;  3T1Q B;  5FEG A;  3CHW P;  2VK3 A;  1VEU B;  3U4L P;  3D9Y A;  1J3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...