1HLUP

Structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of an open state of beta-actin at 2.65 A resolution.
pubmed doi rcsb
molecule tags Complex (acetylation/actin-binding)
molecule keywords BETA-ACTIN
total genus 44
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1997-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1hluP00
2ACGA 4X25A 1Y4OA 2PRFA 2V8FA 3NECA 3NULA 1ACFA 3CPTA 3MSHA 2E8JA 2BTFP 4FUWA 3LEQA 2JKFA 2HZ5A 2PBDP 3T1SA 1PFLA 1SKOA 3UB5P 4FTXA 5EVEA 5EM0A 1HLUP 3CPTB 1Z09A 3L7HA 3LGOA 1F2KA 2V8CA 4ESPA 2B95A 1PNEA 1VETA 2VK3A 2ZL1B 5EM1A 1FIKA 3T1RA 3T1XA 1D1JA 1J3WA 1SZVA 1K0KA 1VEUB 1VEUA 4QWOA 4D60A 1A0KA 1G5UA 3D9YA 3MS6A 1CQAA 1AWIA 1FILA 5FDSA 3L9KA 2PAVP 1YPRA 5EV0A 5FEFA 4X1MA 1PRQA 4X1LA 3KYEA 1VETB 2ZL1A 1CF0A 3T1QB 3DAVA 2JKGA 3CHWP 3U4LP 3T12B 5FEGA 1CJFA 1SKOB
chains in the Genus database with same CATH superfamily
3VOLA 4OLDA 2FFYA 4R23A 5F69A 3CJMA 4I3JA 4C75A 5L07A 3TRCA 3HVFA 3TSGA 2WUQA 2EX2A 4F3LB 3QNCA 2ZQ7A 3A3JA 1JWZA 4A5RA 4Q0JA 3BM6A 4EQ1A 4X25A 2V2FF 3KSGA 2W3GA 2ZJ9A 1G28A 1ESUA 1BLHA 1I2SA 3D4FA 2Z2LB 4QY6A 5A93A 1LHYA 1LSVA 3AGEA 4XUXA 5AQAA 5HAIA 4E6WA 3PBQA 5F82A 2XQZA 5FATA 4WN5A 1Y28A 2ZM2A 4OQIA 2CC1A 4GZBA 4ID4A 2HF6A 2EFXA 3WS0A 2WGWA 5FASA 1DJBA 3EEHA 5M19A 3R4KA 4YNRA 3QP2A 3DWZA 4N1XA 1SKFA 4BBVA 3SH8A 1D7EA 2RCXA 3VE3A 1ONHA 4WL9A 2V0WA 2G7UA 5FDHA 3T4KA 3C4PA 3QP4A 2J9OA 1XFNA 1XGIA 2XD5A 2M7VA 3VP0A 4E6XA 1W79A 1TF1A 3KSFA 4GW9A 2X02A 5DJTA 4HP9A 3MZFA 3GVBA 1GHMA 3K3DA 1P9RA 2PYPA 4DE2A 2IWDA 4S2PA 5K5BA 3PBTA 4IEDA 4OVDA 4DKIA 4N9KA 2BLSA 3GDIA 4KQRA 4ZAMA 1E4DA 4R0QA 2ZM0A 3IXDA 2FFFB 4D2OA 3NOTC 3DTEA 4FH4A 4EBNA 4FTXA 5A90A 3VSKA 4KUKA 3IXGA 4MN5A 4R6LA 4N1HA 5GHYA 2Y2OA 3VV4A 5FEGA 1SKOB 4IJGA 5CGXA 1S67L 4LRYC 5CTNA 3R7WB 1ESIA 4S2NA 1HTZA 1XKZA 4CLCE 3WS1A 4U0TA 1OT9A 1J3WA 3DW0A 1S0WA 3M6HA 5EE8A 2OSUA 3SZTA 4S2LA 3T1QB 3VP4A 3ZG5A 3HLGA 4IUHA 1GCEA 4KZ8A 4X6TA 3VFHA 3UPOA 4KZ5A 4GS9A 1H0MA 3UPPA 5EVEA 5L10A 1NZOA 3CG5A 1E3UA 3C2WA 3LCEA 4RX2A 4JGRA 5EUAA 3G2ZA 3DWKA 4KZBA 2W3FA 2K31A 1S4SA 4ETXA 1IYPA 4O7DA 3HUMA 3H7WA 1GSWA 3G35A 1ZTUA 2INWA 3OPHA 3E4OA 4OQ0A 4U3TA 2R9XA 4LPZA 4MBHA 3MKFA 1PI4A 1CI9A 3A3EA 4MLLA 5G18A 4P0MA 1VEUB 3FPVA 3TE8A 3G34A 3MKEA 2J9PA 5CGSA 1NY0A 3M2JA 4PM6A 3BLSA 3T1SA 1DP8A 2VEAA 3F1OB 3L7HA 4KZ7A 3OPLA 1K55A 3RFBA 1CEGA 3PBNA 5EFWA 4B88A 1JNUA 3DAVA 1W63M 3HUOA 1BSGA 3EQVA 5EPHA 1X0OA 1SKOA 2V1AA 1FSWA 3LR5A 5FI7A 2VA0A 4NXGA 2V8CA 4GLQA 3OCNA 3HL9A 4JGOA 3UE6A 4WBGA 4BL3A 5HPIA 4OOYA 2KLIA 4EQIA 4ZJ1A 3MXQA 2EXAA 3NI9A 3PTEA 3PXPA 3W4QA 1YAXA 3RXWA 1ACFA 2Y8HA 4EEUA 1DY6A 3OBFA 1YLTA 2B95A 2IWBA 4JBFA 1TS7A 2B5RA 4S2KA 1IOUA 3WS4A 3Q81A 5DKLA 2VGLS 4BJPA 2XD1A 1TD5A 5AQ7A 5MC7A 3AGFA 1O07A 2KDKA 2JN7A 3Q1FA 3VP1A 5U47A 1SZVA 1VB6A 4WF0A 1I5QA 3IS2B 2ZQDA 5HAQA 4EERA 2O99A 2Z2MB 4WZ4A 4NXFA 3NCKA 4ZJ2A 5J3WA 4DRTA 2V1ZA 1K57C 3QP8A 2WGWB 3F1PA 1L2SA 3O86A 4DDSA 3QHYA 2EX9A 2V8FA 2PBYA 3W8KA 1KGEA 4BLMA 4E3MA 5HX9A 4HHDA 4JF4A 3OPPA 3B47A 5EM1A 4E3IA 3TW8A 2WGVA 4O0PA 3KYQA 2XROA 2W0NA 1BLSA 2VJWA 2PR6A 2Y79A 2XF3A 2A49A 3RTYA 1PZPA 3W4PA 2J8YA 2RL3A 3ZYTA 2EWVA 4PMAA 2I9VA 1KVMA 2WAEA 1PI5A 1H8YA 5KMWA 4G3KA 3DTKA 4NXBA 4DXBA 1Y54A 1ZKJA 4P6BA 4MBKA 3F1NA 1T18A 1U60A 3OLOA 3QNBA 2JHEA 4XT2A 1F98A 2Q9NA 2PU2A 3WWXA 1XP4A 1RGYA 2G2UA 3H82B 4QB8A 4K08A 3G4PA 3UDFA 5IU1A 2OV5A 3E2LA 2JC7A 4L9EA 1IKIA 4ME4A 3JVVA 1OMEA 2JKGA 2O9AA 4Y7PA 3S7OA 1MXOA 3WS2A 4DXCA 1BZAA 4I39A 4OP5A 3BYDA 1D1JA 2VLGA 4JPMA 2Y2JA 2BG1A 1BYWA 4EUVA 3HREA 4UA6A 2ZLYA 3N6IA 3KYEA 4P6ZS 2QYBA 3HCYA 2EX8A 1BLCA 5F6AA 3T4JA 2P9VA 2JKRI 3OCLA 1EW0A 1TDLA 1YT4A 5JYPA 4MBFA 2A24A 2EXBA 3MR0A 4DJ2A 4GCZA 3D72A 3V39A 4LFUA 5DKKA 4JKTA 2P74A 4E3JA 4EU0A 1ALQA 4EXOA 1NWZA 2E8IA 3E4QA 4HH2A 4KENB 4GDBA 1K38A 3ZDJA 3ZVWA 2XRNA 1OT6A 3A0SA 3T4TA 1YLZA 5DF9A 3MS6A 4NG2A 1LL5A 1OTIA 2ZQ9A 2M1CA 4PHTA 5E2EA 4DE1A 2HP9A 1G6AA 1QMFA 2C5WB 2QHKA 5E2HA 1N4OA 4OQHA 1K0KA 1G5UA 1NLZA 1JVJA 3G32A 3BFDA 1GA9A 4Q0HA 5HL1A 4Z9QA 4H6JA 3U4LP 1FCOA 2R9WA 3PHYA 2ZMAA 2WKEA 1F9IA 5CERA 1UWNX 1IEMA 3KX0X 4WYYA 4UQIS 5CGWA 3UN7A 3Q07A 4KZ9A 5FAQA 1K54C 1WYBA 2DCFA 3NOUC 1H3QA 2NUTC 4BQMA 4EV4A 3FPWA 3E4PA 4HJ6A 4ZBEA 4BMWA 2HDQA 3GTCA 1Z09A 5EVLA 3UB7A 2J3TD 3LIDA 1YLYA 3HJKA 2OWJA 2XGNA 3SS5A 3T4SA 4EEPA 2BASA 5CECA 2ZOIA 3IWIA 2Y2IA 2GNXA 2W1TA 1YKDA 5FQMA 4G3VA 2WZXA 4EW7A 3LUQA 5E2FA 1L0EA 1CK3A 2EFUA 3EQUA 2ZL1B 2VKSA 4LCMA 1K25A 3VP2A 5BOHA 2M7UA 4OLGA 3B3XA 3SH9A 3N4IA 1SHVA 2HP6A 5DTTA 1KDSA 2P04A 3A0VA 4QPRA 1LI0A 4RX3A 2Y2LA 2GZAA 4DDYA 4E3NA 3R7WA 3AGDA 5I5LA 1T1BA 4GOGA 4QWOA 2D02A 2IWCA 3M2KA 4JGQA 5EV0A 4KZ6A 2HJ9C 3O3VA 3IF6C 2XFTA 3CMZA 2VV7A 5GL9A 5DFXA 1K6RA 3IF6B 4Q0IA 4GNUA 3EGDC 5J8XA 1CEFA 1D06A 2Q0OA 3LYXA 4I38A 4F94A 4GN2A 2QMIA 3UMDA 3A0RA 5J7EA 1STZA 4GD8A 2PDRA 1PWDA 3OOVA 3PAGA 3BEBA 3MFXA 3VSLA 1RCJA 5FQ9A 3U2AA 1DP9A 2WK0A 4S2NC 4BD1A 4IVKA 4UHUA 3DTMA 4JF5A 4KQDA 2W1RA 3IHAA 3BFEA 4X1LA 2L0WA 1S6RA 5TGFA 3ZVTA 2KOIA 1CJFA 1Y4OA 3K2NA 4LRZE 1OTBA 5HDCA 1EROA 4LV0A 1E25A 2QJ7A 3LEZA 3N8SA 4XXRA 5TR7A 1XA7A 1LI9A 3ZNYA 1ES3A 5HW3A 3NBLA 2ZD8A 3GV9A 5EOEA 1P9WA 2PR5A 1IFQA 3MXRA 3FKWA 3CWFA 3T4OA 4WM9A 3ZG9B 1W5DA 3JVUA 3T4QA 3CLOA 4GJ4A 2XDMA 1FOFA 4GKUA 1ONGA 4ZDXA 1F5MA 3H7WB 3LIFA 4CLCB 4HH3A 4OP8A 5JYOA 2H0TA 2O9CA 3CAXA 4RQ9A 3FWLA 3TG9A 5TBMA 1PNEA 1VETA 1EWZA 3HLDA 4DF6A 4MN7A 4HY8A 2EX6A 5A91A 5HL6A 1CI8A 1XJ4A 1ES5A 3SS4A 1IYSA 5G4YA 4HJ3A 4CLCA 3VE4A 1C3BA 2PD7A 1N9BA 4O8GA 4WELA 4LRXC 4B4XA 2L4RA 1NYMA 3GQZA 1MKIA 3IQAA 1N9OA 3UE0A 1XGJA 4CJNA 5GHXA 2HDRA 2BTFP 1JWPA 3EOIA 3BFGA 4EBPA 1OJ5A 1SDNA 3ZFZA 2V20A 3ZG8B 2G2WA 1GSXA 4K0WA 2MJ6A 3DTIA 2YKHA 5HD3A 5CRFA 5HDSA 3A3FA 2OWHA 1MZUA 4EETB 4UEYA 4ARZB 1G68A 5M18A 3GSGA 1DP6A 3GR2A 4HJ4A 4E3KA 4PM8A 5CHUA 2HPBA 3NHQA 3LIAA 1UGUA 2Z6CA 4BBTA 3Q7VB 4OPQA 2WKIA 3O88A 2FZ0A 3ITBA 3HLEA 3BECA 2VX8A 4JXVA 1PW8A 4BENA 1M6KA 5F68A 2WKHA 1G6OA 2Y55A 4S2IA 3PYPA 1S1YA 3F1NB 1VETB 3MQ0A 1GSVA 2ZBBA 4QJGA 3MF0A 2UWXA 4CLCD 4JXGA 5FI2A 2EA9A 3S7PA 1OTEA 5KIZA 3CPTB 5HD5A 4Y3IA 4OKPA 3TJZC 4JLFA 3UY6A 3HLCA 1JWVA 1LLBA 4GHIA 4Q8IA 3C8CA 2OAQ1 3S4XA 2H10A 3LO7A 4O01A 1MPLA 3P09A 5AVEA 2NUPC 1T1AA 2WZZA 1T19A 4II7A 4S2OA 3UB6A 1FIKA 1IKGA 3UDXA 3BW6A 3NJAA 3PAEA 3A3DA 4X53A 3G2YA 4R70A 3BJNA 2Y59A 1DRMA 3H9WA 3T12B 3TOIA 1XA1A 3SW1A 4GD6A 4P87A 5EVIA 2Y2KA 3PBOA 2XSSA 5IS1A 5FAOA 1FSYA 1ZG6A 3H82A 5L09A 2WKRA 5DF8A 1XX2A 5A92A 5HWWA 2Y4AA 3NOPC 1MC0A 4R1GA 3KSIA 4LV3A 4CLCC 1MY8A 2PRFA 2UV0E 4PM9A 3MBZA 4Y17A 3B33A 4OPYA 3ULFA 4KZAA 3G6OA 2ZMVA 4YOFA 5AJGA 3WRZA 1MWUA 2HJEA 1NRFA 3V5MA 3Q7VA 1AWIA 3LIEA 1PRQA 2CMNA 4M3KA 2XA7M 4ZRRA 3CITA 4P85A 3OPRA 4XUZA 2V1BA 1TDGA 5HARA 1ZG4A 5TBMB 1PWCA 5FA7A 4PKYG 5AQBA 3D9YA 4LCLA 4BBUA 4OOLA 1K4EA 2LB9A 1PWGA 3RJUA 4QU3A 2JKRM 3C30A 3O87A 3LR0A 3ZQ5A 4NEED 5HDDA 3GMWA 1PFLA 2W1TB 4NETA 5EOOA 2P7JA 1JTDA 5L8MA 1PW1A 4JXSA 2ZC3B 1KE0A 3RH8B 3F1OA 3VOZA 5A8BA 1I2WA 4JF6A 1GHPA 1CQAA 5M1AA 4YWZA 5KZHA 1W8YA 4RVAA 4PPRA 4LV1A 2HV1A 2A3UA 2W3HA 3HLFA 3P7NA 3BFCA 1K6SA 4P6ZM 3RXXA 4ZTKA 5GLDA 5E43A 5EVID 4ZJ3A 3UB9A 3EGXC 4B4ZA 1PIOA 5C5KA 1ES2A 3VP3A 5EVIC 4S2MA 5FSRA 5DVAA 1IELA 2ZQCA 3LR3A 1M40A 3C38A 3N8RA 2R78A 1KDWA 3IX4A 1K4FA 4Y0OA 3QP6A 4R3BA 3IHBA 1NZUA 3ZG7B 4LENA 1LL8A 1XJ6A 4U0XA 4KQQA 1W63Q 2HGVA 2DRWA 3KYZA 4I3AA 3UPNA 3IX8A 2ZQAA 4UA9A 3HLWA 1MWRA 1HD8A 3I7JA 1K54A 3IS2A 2P08A 1KE4A 4DE3A 2Y2PA 4AFIA 4HIAA 3UB5P 1YMXA 3V67A 4WEJA 4CQHA 5E2GA 5DJUA 1RGZA 4S2JA 4PAUA 3MFDA 3MMHA 3MXSA 1HVBA 2O0YA 1S1ZA 1XJ3A 3MSHA 3W4OA 2E8JA 3CUEA 1BT5A 1GHIA 2XEPA 5F83A 2B18A 2IA2A 4KZ4A 3HLBA 1J9MA 4L9FA 4Y0UA 1KE3A 3MJQA 5GLAA 3OC2A 5F1FA 3BQAA 2W27A 3VOYA 4E3LA 1Z6FA 1YLJA 4IHQA 4B93A 2JKFA 1EI5A 1HLUP 2I72A 1OTDA 3BRMA 3NY4A 2Z6DA 1GA0A 4HNBA 4X69A 4Y15A 3A3IA 3BLMA 3P01A 4LLOB 3C7UA 1YSQA 1OTAA 2YKFA 5DF7A 1QMEA 2XH9A 4C3QA 3T50A 3WS5A 3FZCA 3IT9A 3HBRA 3LICA 3NIAA 3FG8A 4HBTA 4E04A 2ZC5B 2Y2MA 3V3RA 5HSQA 5GLCA 1IYQA 3ZG0A 2XLNA 3W2ZA 3UE3A 1FCMA 3IXHA 1YQSA 2B02A 2ACGA 2JBFA 1RP5A 4HOIA 4R3JA 3C5AA 4WLAA 4MMNA 2JCHA 5EECA 2J3TC 3LR4A 4OPRA 3T4LA 5FQKA 4DJ3A 3IBRA 4ESPA 4PKYA 4HEFA 5TJJA 2WKPA 5GHZA 4N9LA 3FV7A 2JE5A 1YSPA 5CHMA 3PBRA 3FYZA 5D3OA 4DN0A 4X1MA 3D3OA 4KG5A 4WZ5C 5IT5A 2H0YA 3CHWP 1IYOA 2VV6A 1L0FA 5KSHA 2EWWA 5IHVA 4Z1WA 1NXYA 4QY5A 3M6BA 4EBLA 3LI9A 4EUZA 1KGGA 1PZOA 2V9AA 4BL2A 3IXBA 4R4RA 2K2NA 1S66L 4X68A 1UWPX 4R38A 3NDEA 2XA7S 1L0GA 4EESA 4Y13A 1K57A 2ZQ8A 3LY3A 1H8ZA 4X56A 2VGKA 3IF6A 1W7FA 1VHMA 3Q82A 4I5SA 5FI6A 4L9GA 3IWOA 5F5YA 1TEMA 2QWSA 1YLWA 1V9YA 1VQQA 3GECA 4GS9B 4EWFA 3ISGA 1L0DA 4IBXA 1MWTA 2VZWA 5LBRA 3IWQA 5HFOA 2WGIA 3UO9A 1ZHHB 4UQIM 3C7VA 3IBJA 3MZEA 3CUEC 5I94A 1YM1A 5HZHA 4G3WA 4MNRA 4QHCA 4IBRA 3T1RA 5HAPA 2ZC4B 1WE4A 4NXEA 1SDEA 1VEUA 3IH8A 3O5YA 2WAFA 1HZOA 2W3EA 2QZ6A 5AVFA 5FQIA 1ZC2A 2ZC6B 4OOMA 1FR1A 3LY4A 1TVFA 5CHJA 3NULA 4E3OA 5FQJA 3SOIA 2WYXA 5EM0A 4OH0A 3FC7A 3N8LA 2Y2GA 4I3IA 3T1XA 2PD8A 4FSFA 2JKTI 4Y2FA 5FQQA 1JTGA 3Q7ZA 4HP4A 1MWSA 4MDZA 2Y2HA 3B42A 2OLVA 5CEDA 2GJ3A 1FQGA 2J80A 2L1MA 4ETZA 3KO6A 1E3UD 3FKVA 2QKPA 2WKQA 4KG2A 3S22A 4LV2A 1WA9A 5TFQA 1YPRA 4KZ3A 1N9NA 1KVLA 4R3AA 3N7WA 3SS3A 1H8MA 3UDIA 4GB7A 3IH9A 4XT2B 2VV8A 1Q2QA 4L0LA 1NLYA 1K55C 5CTMA 4WEKA 3VFFA 4UA7A 1L3LA 1LSXA 4WUJA 2HP5A 3P98A 1FILA 2PHYA 1XFQA 1YLPA 2VGLM 3ZNTA 3NDGA 5FAPA 4HQAA 4LGWA 2Y91A 3SH7A 1P0ZA 3G31A 2WADA 5CEBA 2J3WA 4K0XA 4B9OA 1OPXA 1LT0A 2PYRA 4FCFA 2Y2QA 4H6JB 4CPKA 3WRTA 4WZ5A 5L2FA 2HZ5A 1K56D 3BFFA 3VMAA 3V3SA 2XK1A 4X55A 1T1CA 3EEAA 3F1PB 4FOFA 4F3LA 2D01A 1AXBA 1WYCA 5FEFA 4YINA 2H28A 1K56A 5AQ9A 1ERQA 5J4EA 4C6YA 1V9ZA 3NC8A 2W3DA 1YMSA 4KUOA 1W8QA 3UNWA 3E2KA 4H8RA 4YFMA 2XFSA 1TS6A 3IX3A 4OONA 3BWLA 2FH5A 1KGFA 3ICYA 3QP1A 1DJCA 1XXMA 3L9KA 4Y5FA 1H5XA 3MQQA 4WMCD 5HWVA 5EVIB 2GDNA 4PM5A 2ZC7A 1ODVA 2V0UA 3HUNA 3ZHHA 3QP5A 1N9LA 3CZDA 4RA7A 4HBUA 2O9BA 5CX7A 2XR0A 2KX6A 3S1YA 4N92A 4KQOA 3LIBA 2H5SA 4HI4A 3CI6A 4WMCA 3K3CA 4MN6A 2A24B 3S7NA 2ZM8A 1Q2PA 3GRJA 1BLPA 1LSWA 5FL3A 4OPZA 3S7QA 1MKMA 1NRJA 4D60A 1A0KA 1SCWA 4IUKA 4DMZA 4OQGA 2K7SA 3HJIA 1FCNA 4HESA 2PU4A 4IVIA 1NYYA 1TS8A 3OZHA 3MQOA 5HPFA 1F2KA 5G4ZA 4BD0A 4K91A 1FR6A 1NJ4A 3C4OA 1ES4A 3ZCZA 3LFVA 2ZOHA 3BQ8A 4Y0TA 5GLBA 4UAAA 2QPNA 2VGJA 3JYIA 2VK3A 5DTKA 3UMEA 2OAP1 1PYYA 4M4XA 5FDSA 1O7EA 2DMWA 3PBSA 3V50A 1DJAA 4NKPA 1CF0A 4R4SA 1XJ2A 3NECA 1ERMA 2PBDP 4QD4A 5KSCA 4FD8A 2A2LA 4KG6A 2X01A 4BWIA 2PT7A 2X71A 4MEZA 5F1GA 2Y2NA 3BY8A 4DE0A 2HDSA 4GHIB 5HWTA 3ZGAB 4PM7A 1KOUA 5DFYA 3EWKA 4RYEA 1LL9A 1OJGA 2P9VB 1TS0A 3DBAA 3CPTA 4FUWA 3UE1A 1BTLA 3ITAA 1S4RA 3LGOA 4ARZA 4GDNA 5CXWA 3G30A 2LB5A 3BY9A 4MCWA 2GX5A 2OLUA 1BULA 3E0YA 3KSHA 3UB8A 3PR6A 2Q9MA 2JKTM 1BUEA 3E98A 2C6WB 2ZMFA 2OOLA 2DNSA 3LEQA 2HDUA 1MBLA 3IF5A 5DTSA 4NK3A 1XPBA 1P97A 1VM1A 2AVXA 2J7VA 2QJ5A 3MZDA 2PAVP 4FH2A 2ZL1A 4JGPA 4JXWA 3LI8A 3JPUA
chains in the Genus database with same CATH topology
2ACGA 4X25A 1Y4OA 2PRFA 2V8FA 3NECA 3NULA 1ACFA 3CPTA 3MSHA 2E8JA 2BTFP 4FUWA 3LEQA 2JKFA 2HZ5A 2PBDP 3T1SA 1PFLA 1SKOA 3UB5P 4FTXA 5EVEA 5EM0A 1HLUP 3CPTB 1Z09A 3L7HA 3LGOA 1F2KA 2V8CA 4ESPA 2B95A 1PNEA 1VETA 2VK3A 2ZL1B 5EM1A 1FIKA 3T1RA 3T1XA 1D1JA 1J3WA 1SZVA 1K0KA 1VEUB 1VEUA 4QWOA 4D60A 1A0KA 1G5UA 3D9YA 3MS6A 1CQAA 1AWIA 1FILA 5FDSA 3L9KA 2PAVP 1YPRA 5EV0A 5FEFA 4X1MA 1PRQA 4X1LA 3KYEA 1VETB 2ZL1A 1CF0A 3T1QB 3DAVA 2JKGA 3CHWP 3U4LP 3T12B 5FEGA 1CJFA 1SKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACG A;  4X25 A;  1Y4O A;  2PRF A;  2V8F A;  3NEC A;  3NUL A;  1ACF A;  3CPT A;  3MSH A;  2E8J A;  2BTF P;  4FUW A;  3LEQ A;  2JKF A;  2HZ5 A;  2PBD P;  3T1S A;  1PFL A;  1SKO A;  3UB5 P;  4FTX A;  5EVE A;  5EM0 A;  1HLU P;  3CPT B;  1Z09 A;  3L7H A;  3LGO A;  1F2K A;  2V8C A;  4ESP A;  2B95 A;  1PNE A;  1VET A;  2VK3 A;  2ZL1 B;  5EM1 A;  1FIK A;  3T1R A;  3T1X A;  1D1J A;  1J3W A;  1SZV A;  1K0K A;  1VEU B;  1VEU A;  4QWO A;  4D60 A;  1A0K A;  1G5U A;  3D9Y A;  3MS6 A;  1CQA A;  1AWI A;  1FIL A;  5FDS A;  3L9K A;  2PAV P;  1YPR A;  5EV0 A;  5FEF A;  4X1M A;  1PRQ A;  4X1L A;  3KYE A;  1VET B;  2ZL1 A;  1CF0 A;  3T1Q B;  3DAV A;  2JKG A;  3CHW P;  3U4L P;  3T12 B;  5FEG A;  1CJF A;  1SKO B; 
#chains in the Genus database with same CATH topology
 3VOL A;  4OLD A;  2FFY A;  4R23 A;  5F69 A;  3CJM A;  4I3J A;  4C75 A;  5L07 A;  3TRC A;  3HVF A;  3TSG A;  2WUQ A;  2EX2 A;  4F3L B;  3QNC A;  2ZQ7 A;  3A3J A;  1JWZ A;  4A5R A;  4Q0J A;  3BM6 A;  4EQ1 A;  4X25 A;  2V2F F;  3KSG A;  2W3G A;  2ZJ9 A;  1G28 A;  1ESU A;  1BLH A;  1I2S A;  3D4F A;  2Z2L B;  4QY6 A;  5A93 A;  1LHY A;  1LSV A;  3AGE A;  4XUX A;  5AQA A;  5HAI A;  4E6W A;  3PBQ A;  5F82 A;  2XQZ A;  5FAT A;  4WN5 A;  1Y28 A;  2ZM2 A;  4OQI A;  2CC1 A;  4GZB A;  4ID4 A;  2HF6 A;  2EFX A;  3WS0 A;  2WGW A;  5FAS A;  1DJB A;  3EEH A;  5M19 A;  3R4K A;  4YNR A;  3QP2 A;  3DWZ A;  4N1X A;  1SKF A;  4BBV A;  3SH8 A;  1D7E A;  2RCX A;  3VE3 A;  1ONH A;  4WL9 A;  2V0W A;  2G7U A;  5FDH A;  3T4K A;  3C4P A;  3QP4 A;  2J9O A;  1XFN A;  1XGI A;  2XD5 A;  2M7V A;  3VP0 A;  4E6X A;  1W79 A;  1TF1 A;  3KSF A;  4GW9 A;  2X02 A;  5DJT A;  4HP9 A;  3MZF A;  3GVB A;  1GHM A;  3K3D A;  1P9R A;  2PYP A;  4DE2 A;  2IWD A;  4S2P A;  5K5B A;  3PBT A;  4IED A;  4OVD A;  4DKI A;  4N9K A;  2BLS A;  3GDI A;  4KQR A;  4ZAM A;  1E4D A;  4R0Q A;  2ZM0 A;  3IXD A;  2FFF B;  4D2O A;  3NOT C;  3DTE A;  4FH4 A;  4EBN A;  4FTX A;  5A90 A;  3VSK A;  4KUK A;  3IXG A;  4MN5 A;  4R6L A;  4N1H A;  5GHY A;  2Y2O A;  3VV4 A;  5FEG A;  1SKO B;  4IJG A;  5CGX A;  1S67 L;  4LRY C;  5CTN A;  3R7W B;  1ESI A;  4S2N A;  1HTZ A;  1XKZ A;  4CLC E;  3WS1 A;  4U0T A;  1OT9 A;  1J3W A;  3DW0 A;  1S0W A;  3M6H A;  5EE8 A;  2OSU A;  3SZT A;  4S2L A;  3T1Q B;  3VP4 A;  3ZG5 A;  3HLG A;  4IUH A;  1GCE A;  4KZ8 A;  4X6T A;  3VFH A;  3UPO A;  4KZ5 A;  4GS9 A;  1H0M A;  3UPP A;  5EVE A;  5L10 A;  1NZO A;  3CG5 A;  1E3U A;  3C2W A;  3LCE A;  4RX2 A;  4JGR A;  5EUA A;  3G2Z A;  3DWK A;  4KZB A;  2W3F A;  2K31 A;  1S4S A;  4ETX A;  1IYP A;  4O7D A;  3HUM A;  3H7W A;  1GSW A;  3G35 A;  1ZTU A;  2INW A;  3OPH A;  3E4O A;  4OQ0 A;  4U3T A;  2R9X A;  4LPZ A;  4MBH A;  3MKF A;  1PI4 A;  1CI9 A;  3A3E A;  4MLL A;  5G18 A;  4P0M A;  1VEU B;  3FPV A;  3TE8 A;  3G34 A;  3MKE A;  2J9P A;  5CGS A;  1NY0 A;  3M2J A;  4PM6 A;  3BLS A;  3T1S A;  1DP8 A;  2VEA A;  3F1O B;  3L7H A;  4KZ7 A;  3OPL A;  1K55 A;  3RFB A;  1CEG A;  3PBN A;  5EFW A;  4B88 A;  1JNU A;  3DAV A;  1W63 M;  3HUO A;  1BSG A;  3EQV A;  5EPH A;  1X0O A;  1SKO A;  2V1A A;  1FSW A;  3LR5 A;  5FI7 A;  2VA0 A;  4NXG A;  2V8C A;  4GLQ A;  3OCN A;  3HL9 A;  4JGO A;  3UE6 A;  4WBG A;  4BL3 A;  5HPI A;  4OOY A;  2KLI A;  4EQI A;  4ZJ1 A;  3MXQ A;  2EXA A;  3NI9 A;  3PTE A;  3PXP A;  3W4Q A;  1YAX A;  3RXW A;  1ACF A;  2Y8H A;  4EEU A;  1DY6 A;  3OBF A;  1YLT A;  2B95 A;  2IWB A;  4JBF A;  1TS7 A;  2B5R A;  4S2K A;  1IOU A;  3WS4 A;  3Q81 A;  5DKL A;  2VGL S;  4BJP A;  2XD1 A;  1TD5 A;  5AQ7 A;  5MC7 A;  3AGF A;  1O07 A;  2KDK A;  2JN7 A;  3Q1F A;  3VP1 A;  5U47 A;  1SZV A;  1VB6 A;  4WF0 A;  1I5Q A;  3IS2 B;  2ZQD A;  5HAQ A;  4EER A;  2O99 A;  2Z2M B;  4WZ4 A;  4NXF A;  3NCK A;  4ZJ2 A;  5J3W A;  4DRT A;  2V1Z A;  1K57 C;  3QP8 A;  2WGW B;  3F1P A;  1L2S A;  3O86 A;  4DDS A;  3QHY A;  2EX9 A;  2V8F A;  2PBY A;  3W8K A;  1KGE A;  4BLM A;  4E3M A;  5HX9 A;  4HHD A;  4JF4 A;  3OPP A;  3B47 A;  5EM1 A;  4E3I A;  3TW8 A;  2WGV A;  4O0P A;  3KYQ A;  2XRO A;  2W0N A;  1BLS A;  2VJW A;  2PR6 A;  2Y79 A;  2XF3 A;  2A49 A;  3RTY A;  1PZP A;  3W4P A;  2J8Y A;  2RL3 A;  3ZYT A;  2EWV A;  4PMA A;  2I9V A;  1KVM A;  2WAE A;  1PI5 A;  1H8Y A;  5KMW A;  4G3K A;  3DTK A;  4NXB A;  4DXB A;  1Y54 A;  1ZKJ A;  4P6B A;  4MBK A;  3F1N A;  1T18 A;  1U60 A;  3OLO A;  3QNB A;  2JHE A;  4XT2 A;  1F98 A;  2Q9N A;  2PU2 A;  3WWX A;  1XP4 A;  1RGY A;  2G2U A;  3H82 B;  4QB8 A;  4K08 A;  3G4P A;  3UDF A;  5IU1 A;  2OV5 A;  3E2L A;  2JC7 A;  4L9E A;  1IKI A;  4ME4 A;  3JVV A;  1OME A;  2JKG A;  2O9A A;  4Y7P A;  3S7O A;  1MXO A;  3WS2 A;  4DXC A;  1BZA A;  4I39 A;  4OP5 A;  3BYD A;  1D1J A;  2VLG A;  4JPM A;  2Y2J A;  2BG1 A;  1BYW A;  4EUV A;  3HRE A;  4UA6 A;  2ZLY A;  3N6I A;  3KYE A;  4P6Z S;  2QYB A;  3HCY A;  2EX8 A;  1BLC A;  5F6A A;  3T4J A;  2P9V A;  2JKR I;  3OCL A;  1EW0 A;  1TDL A;  1YT4 A;  5JYP A;  4MBF A;  2A24 A;  2EXB A;  3MR0 A;  4DJ2 A;  4GCZ A;  3D72 A;  3V39 A;  4LFU A;  5DKK A;  4JKT A;  2P74 A;  4E3J A;  4EU0 A;  1ALQ A;  4EXO A;  1NWZ A;  2E8I A;  3E4Q A;  4HH2 A;  4KEN B;  4GDB A;  1K38 A;  3ZDJ A;  3ZVW A;  2XRN A;  1OT6 A;  3A0S A;  3T4T A;  1YLZ A;  5DF9 A;  3MS6 A;  4NG2 A;  1LL5 A;  1OTI A;  2ZQ9 A;  2M1C A;  4PHT A;  5E2E A;  4DE1 A;  2HP9 A;  1G6A A;  1QMF A;  2C5W B;  2QHK A;  5E2H A;  1N4O A;  4OQH A;  1K0K A;  1G5U A;  1NLZ A;  1JVJ A;  3G32 A;  3BFD A;  1GA9 A;  4Q0H A;  5HL1 A;  4Z9Q A;  4H6J A;  3U4L P;  1FCO A;  2R9W A;  3PHY A;  2ZMA A;  2WKE A;  1F9I A;  5CER A;  1UWN X;  1IEM A;  3KX0 X;  4WYY A;  4UQI S;  5CGW A;  3UN7 A;  3Q07 A;  4KZ9 A;  5FAQ A;  1K54 C;  1WYB A;  2DCF A;  3NOU C;  1H3Q A;  2NUT C;  4BQM A;  4EV4 A;  3FPW A;  3E4P A;  4HJ6 A;  4ZBE A;  4BMW A;  2HDQ A;  3GTC A;  1Z09 A;  5EVL A;  3UB7 A;  2J3T D;  3LID A;  1YLY A;  3HJK A;  2OWJ A;  2XGN A;  3SS5 A;  3T4S A;  4EEP A;  2BAS A;  5CEC A;  2ZOI A;  3IWI A;  2Y2I A;  2GNX A;  2W1T A;  1YKD A;  5FQM A;  4G3V A;  2WZX A;  4EW7 A;  3LUQ A;  5E2F A;  1L0E A;  1CK3 A;  2EFU A;  3EQU A;  2ZL1 B;  2VKS A;  4LCM A;  1K25 A;  3VP2 A;  5BOH A;  2M7U A;  4OLG A;  3B3X A;  3SH9 A;  3N4I A;  1SHV A;  2HP6 A;  5DTT A;  1KDS A;  2P04 A;  3A0V A;  4QPR A;  1LI0 A;  4RX3 A;  2Y2L A;  2GZA A;  4DDY A;  4E3N A;  3R7W A;  3AGD A;  5I5L A;  1T1B A;  4GOG A;  4QWO A;  2D02 A;  2IWC A;  3M2K A;  4JGQ A;  5EV0 A;  4KZ6 A;  2HJ9 C;  3O3V A;  3IF6 C;  2XFT A;  3CMZ A;  2VV7 A;  5GL9 A;  5DFX A;  1K6R A;  3IF6 B;  4Q0I A;  4GNU A;  3EGD C;  5J8X A;  1CEF A;  1D06 A;  2Q0O A;  3LYX A;  4I38 A;  4F94 A;  4GN2 A;  2QMI A;  3UMD A;  3A0R A;  5J7E A;  1STZ A;  4GD8 A;  2PDR A;  1PWD A;  3OOV A;  3PAG A;  3BEB A;  3MFX A;  3VSL A;  1RCJ A;  5FQ9 A;  3U2A A;  1DP9 A;  2WK0 A;  4S2N C;  4BD1 A;  4IVK A;  4UHU A;  3DTM A;  4JF5 A;  4KQD A;  2W1R A;  3IHA A;  3BFE A;  4X1L A;  2L0W A;  1S6R A;  5TGF A;  3ZVT A;  2KOI A;  1CJF A;  1Y4O A;  3K2N A;  4LRZ E;  1OTB A;  5HDC A;  1ERO A;  4LV0 A;  1E25 A;  2QJ7 A;  3LEZ A;  3N8S A;  4XXR A;  5TR7 A;  1XA7 A;  1LI9 A;  3ZNY A;  1ES3 A;  5HW3 A;  3NBL A;  2ZD8 A;  3GV9 A;  5EOE A;  1P9W A;  2PR5 A;  1IFQ A;  3MXR A;  3FKW A;  3CWF A;  3T4O A;  4WM9 A;  3ZG9 B;  1W5D A;  3JVU A;  3T4Q A;  3CLO A;  4GJ4 A;  2XDM A;  1FOF A;  4GKU A;  1ONG A;  4ZDX A;  1F5M A;  3H7W B;  3LIF A;  4CLC B;  4HH3 A;  4OP8 A;  5JYO A;  2H0T A;  2O9C A;  3CAX A;  4RQ9 A;  3FWL A;  3TG9 A;  5TBM A;  1PNE A;  1VET A;  1EWZ A;  3HLD A;  4DF6 A;  4MN7 A;  4HY8 A;  2EX6 A;  5A91 A;  5HL6 A;  1CI8 A;  1XJ4 A;  1ES5 A;  3SS4 A;  1IYS A;  5G4Y A;  4HJ3 A;  4CLC A;  3VE4 A;  1C3B A;  2PD7 A;  1N9B A;  4O8G A;  4WEL A;  4LRX C;  4B4X A;  2L4R A;  1NYM A;  3GQZ A;  1MKI A;  3IQA A;  1N9O A;  3UE0 A;  1XGJ A;  4CJN A;  5GHX A;  2HDR A;  2BTF P;  1JWP A;  3EOI A;  3BFG A;  4EBP A;  1OJ5 A;  1SDN A;  3ZFZ A;  2V20 A;  3ZG8 B;  2G2W A;  1GSX A;  4K0W A;  2MJ6 A;  3DTI A;  2YKH A;  5HD3 A;  5CRF A;  5HDS A;  3A3F A;  2OWH A;  1MZU A;  4EET B;  4UEY A;  4ARZ B;  1G68 A;  5M18 A;  3GSG A;  1DP6 A;  3GR2 A;  4HJ4 A;  4E3K A;  4PM8 A;  5CHU A;  2HPB A;  3NHQ A;  3LIA A;  1UGU A;  2Z6C A;  4BBT A;  3Q7V B;  4OPQ A;  2WKI A;  3O88 A;  2FZ0 A;  3ITB A;  3HLE A;  3BEC A;  2VX8 A;  4JXV A;  1PW8 A;  4BEN A;  1M6K A;  5F68 A;  2WKH A;  1G6O A;  2Y55 A;  4S2I A;  3PYP A;  1S1Y A;  3F1N B;  1VET B;  3MQ0 A;  1GSV A;  2ZBB A;  4QJG A;  3MF0 A;  2UWX A;  4CLC D;  4JXG A;  5FI2 A;  2EA9 A;  3S7P A;  1OTE A;  5KIZ A;  3CPT B;  5HD5 A;  4Y3I A;  4OKP A;  3TJZ C;  4JLF A;  3UY6 A;  3HLC A;  1JWV A;  1LLB A;  4GHI A;  4Q8I A;  3C8C A;  2OAQ 1;  3S4X A;  2H10 A;  3LO7 A;  4O01 A;  1MPL A;  3P09 A;  5AVE A;  2NUP C;  1T1A A;  2WZZ A;  1T19 A;  4II7 A;  4S2O A;  3UB6 A;  1FIK A;  1IKG A;  3UDX A;  3BW6 A;  3NJA A;  3PAE A;  3A3D A;  4X53 A;  3G2Y A;  4R70 A;  3BJN A;  2Y59 A;  1DRM A;  3H9W A;  3T12 B;  3TOI A;  1XA1 A;  3SW1 A;  4GD6 A;  4P87 A;  5EVI A;  2Y2K A;  3PBO A;  2XSS A;  5IS1 A;  5FAO A;  1FSY A;  1ZG6 A;  3H82 A;  5L09 A;  2WKR A;  5DF8 A;  1XX2 A;  5A92 A;  5HWW A;  2Y4A A;  3NOP C;  1MC0 A;  4R1G A;  3KSI A;  4LV3 A;  4CLC C;  1MY8 A;  2PRF A;  2UV0 E;  4PM9 A;  3MBZ A;  4Y17 A;  3B33 A;  4OPY A;  3ULF A;  4KZA A;  3G6O A;  2ZMV A;  4YOF A;  5AJG A;  3WRZ A;  1MWU A;  2HJE A;  1NRF A;  3V5M A;  3Q7V A;  1AWI A;  3LIE A;  1PRQ A;  2CMN A;  4M3K A;  2XA7 M;  4ZRR A;  3CIT A;  4P85 A;  3OPR A;  4XUZ A;  2V1B A;  1TDG A;  5HAR A;  1ZG4 A;  5TBM B;  1PWC A;  5FA7 A;  4PKY G;  5AQB A;  3D9Y A;  4LCL A;  4BBU A;  4OOL A;  1K4E A;  2LB9 A;  1PWG A;  3RJU A;  4QU3 A;  2JKR M;  3C30 A;  3O87 A;  3LR0 A;  3ZQ5 A;  4NEE D;  5HDD A;  3GMW A;  1PFL A;  2W1T B;  4NET A;  5EOO A;  2P7J A;  1JTD A;  5L8M A;  1PW1 A;  4JXS A;  2ZC3 B;  1KE0 A;  3RH8 B;  3F1O A;  3VOZ A;  5A8B A;  1I2W A;  4JF6 A;  1GHP A;  1CQA A;  5M1A A;  4YWZ A;  5KZH A;  1W8Y A;  4RVA A;  4PPR A;  4LV1 A;  2HV1 A;  2A3U A;  2W3H A;  3HLF A;  3P7N A;  3BFC A;  1K6S A;  4P6Z M;  3RXX A;  4ZTK A;  5GLD A;  5E43 A;  5EVI D;  4ZJ3 A;  3UB9 A;  3EGX C;  4B4Z A;  1PIO A;  5C5K A;  1ES2 A;  3VP3 A;  5EVI C;  4S2M A;  5FSR A;  5DVA A;  1IEL A;  2ZQC A;  3LR3 A;  1M40 A;  3C38 A;  3N8R A;  2R78 A;  1KDW A;  3IX4 A;  1K4F A;  4Y0O A;  3QP6 A;  4R3B A;  3IHB A;  1NZU A;  3ZG7 B;  4LEN A;  1LL8 A;  1XJ6 A;  4U0X A;  4KQQ A;  1W63 Q;  2HGV A;  2DRW A;  3KYZ A;  4I3A A;  3UPN A;  3IX8 A;  2ZQA A;  4UA9 A;  3HLW A;  1MWR A;  1HD8 A;  3I7J A;  1K54 A;  3IS2 A;  2P08 A;  1KE4 A;  4DE3 A;  2Y2P A;  4AFI A;  4HIA A;  3UB5 P;  1YMX A;  3V67 A;  4WEJ A;  4CQH A;  5E2G A;  5DJU A;  1RGZ A;  4S2J A;  4PAU A;  3MFD A;  3MMH A;  3MXS A;  1HVB A;  2O0Y A;  1S1Z A;  1XJ3 A;  3MSH A;  3W4O A;  2E8J A;  3CUE A;  1BT5 A;  1GHI A;  2XEP A;  5F83 A;  2B18 A;  2IA2 A;  4KZ4 A;  3HLB A;  1J9M A;  4L9F A;  4Y0U A;  1KE3 A;  3MJQ A;  5GLA A;  3OC2 A;  5F1F A;  3BQA A;  2W27 A;  3VOY A;  4E3L A;  1Z6F A;  1YLJ A;  4IHQ A;  4B93 A;  2JKF A;  1EI5 A;  1HLU P;  2I72 A;  1OTD A;  3BRM A;  3NY4 A;  2Z6D A;  1GA0 A;  4HNB A;  4X69 A;  4Y15 A;  3A3I A;  3BLM A;  3P01 A;  4LLO B;  3C7U A;  1YSQ A;  1OTA A;  2YKF A;  5DF7 A;  1QME A;  2XH9 A;  4C3Q A;  3T50 A;  3WS5 A;  3FZC A;  3IT9 A;  3HBR A;  3LIC A;  3NIA A;  3FG8 A;  4HBT A;  4E04 A;  2ZC5 B;  2Y2M A;  3V3R A;  5HSQ A;  5GLC A;  1IYQ A;  3ZG0 A;  2XLN A;  3W2Z A;  3UE3 A;  1FCM A;  3IXH A;  1YQS A;  2B02 A;  2ACG A;  2JBF A;  1RP5 A;  4HOI A;  4R3J A;  3C5A A;  4WLA A;  4MMN A;  2JCH A;  5EEC A;  2J3T C;  3LR4 A;  4OPR A;  3T4L A;  5FQK A;  4DJ3 A;  3IBR A;  4ESP A;  4PKY A;  4HEF A;  5TJJ A;  2WKP A;  5GHZ A;  4N9L A;  3FV7 A;  2JE5 A;  1YSP A;  5CHM A;  3PBR A;  3FYZ A;  5D3O A;  4DN0 A;  4X1M A;  3D3O A;  4KG5 A;  4WZ5 C;  5IT5 A;  2H0Y A;  3CHW P;  1IYO A;  2VV6 A;  1L0F A;  5KSH A;  2EWW A;  5IHV A;  4Z1W A;  1NXY A;  4QY5 A;  3M6B A;  4EBL A;  3LI9 A;  4EUZ A;  1KGG A;  1PZO A;  2V9A A;  4BL2 A;  3IXB A;  4R4R A;  2K2N A;  1S66 L;  4X68 A;  1UWP X;  4R38 A;  3NDE A;  2XA7 S;  1L0G A;  4EES A;  4Y13 A;  1K57 A;  2ZQ8 A;  3LY3 A;  1H8Z A;  4X56 A;  2VGK A;  3IF6 A;  1W7F A;  1VHM A;  3Q82 A;  4I5S A;  5FI6 A;  4L9G A;  3IWO A;  5F5Y A;  1TEM A;  2QWS A;  1YLW A;  1V9Y A;  1VQQ A;  3GEC A;  4GS9 B;  4EWF A;  3ISG A;  1L0D A;  4IBX A;  1MWT A;  2VZW A;  5LBR A;  3IWQ A;  5HFO A;  2WGI A;  3UO9 A;  1ZHH B;  4UQI M;  3C7V A;  3IBJ A;  3MZE A;  3CUE C;  5I94 A;  1YM1 A;  5HZH A;  4G3W A;  4MNR A;  4QHC A;  4IBR A;  3T1R A;  5HAP A;  2ZC4 B;  1WE4 A;  4NXE A;  1SDE A;  1VEU A;  3IH8 A;  3O5Y A;  2WAF A;  1HZO A;  2W3E A;  2QZ6 A;  5AVF A;  5FQI A;  1ZC2 A;  2ZC6 B;  4OOM A;  1FR1 A;  3LY4 A;  1TVF A;  5CHJ A;  3NUL A;  4E3O A;  5FQJ A;  3SOI A;  2WYX A;  5EM0 A;  4OH0 A;  3FC7 A;  3N8L A;  2Y2G A;  4I3I A;  3T1X A;  2PD8 A;  4FSF A;  2JKT I;  4Y2F A;  5FQQ A;  1JTG A;  3Q7Z A;  4HP4 A;  1MWS A;  4MDZ A;  2Y2H A;  3B42 A;  2OLV A;  5CED A;  2GJ3 A;  1FQG A;  2J80 A;  2L1M A;  4ETZ A;  3KO6 A;  1E3U D;  3FKV A;  2QKP A;  2WKQ A;  4KG2 A;  3S22 A;  4LV2 A;  1WA9 A;  5TFQ A;  1YPR A;  4KZ3 A;  1N9N A;  1KVL A;  4R3A A;  3N7W A;  3SS3 A;  1H8M A;  3UDI A;  4GB7 A;  3IH9 A;  4XT2 B;  2VV8 A;  1Q2Q A;  4L0L A;  1NLY A;  1K55 C;  5CTM A;  4WEK A;  3VFF A;  4UA7 A;  1L3L A;  1LSX A;  4WUJ A;  2HP5 A;  3P98 A;  1FIL A;  2PHY A;  1XFQ A;  1YLP A;  2VGL M;  3ZNT A;  3NDG A;  5FAP A;  4HQA A;  4LGW A;  2Y91 A;  3SH7 A;  1P0Z A;  3G31 A;  2WAD A;  5CEB A;  2J3W A;  4K0X A;  4B9O A;  1OPX A;  1LT0 A;  2PYR A;  4FCF A;  2Y2Q A;  4H6J B;  4CPK A;  3WRT A;  4WZ5 A;  5L2F A;  2HZ5 A;  1K56 D;  3BFF A;  3VMA A;  3V3S A;  2XK1 A;  4X55 A;  1T1C A;  3EEA A;  3F1P B;  4FOF A;  4F3L A;  2D01 A;  1AXB A;  1WYC A;  5FEF A;  4YIN A;  2H28 A;  1K56 A;  5AQ9 A;  1ERQ A;  5J4E A;  4C6Y A;  1V9Z A;  3NC8 A;  2W3D A;  1YMS A;  4KUO A;  1W8Q A;  3UNW A;  3E2K A;  4H8R A;  4YFM A;  2XFS A;  1TS6 A;  3IX3 A;  4OON A;  3BWL A;  2FH5 A;  1KGF A;  3ICY A;  3QP1 A;  1DJC A;  1XXM A;  3L9K A;  4Y5F A;  1H5X A;  3MQQ A;  4WMC D;  5HWV A;  5EVI B;  2GDN A;  4PM5 A;  2ZC7 A;  1ODV A;  2V0U A;  3HUN A;  3ZHH A;  3QP5 A;  1N9L A;  3CZD A;  4RA7 A;  4HBU A;  2O9B A;  5CX7 A;  2XR0 A;  2KX6 A;  3S1Y A;  4N92 A;  4KQO A;  3LIB A;  2H5S A;  4HI4 A;  3CI6 A;  4WMC A;  3K3C A;  4MN6 A;  2A24 B;  3S7N A;  2ZM8 A;  1Q2P A;  3GRJ A;  1BLP A;  1LSW A;  5FL3 A;  4OPZ A;  3S7Q A;  1MKM A;  1NRJ A;  4D60 A;  1A0K A;  1SCW A;  4IUK A;  4DMZ A;  4OQG A;  2K7S A;  3HJI A;  1FCN A;  4HES A;  2PU4 A;  4IVI A;  1NYY A;  1TS8 A;  3OZH A;  3MQO A;  5HPF A;  1F2K A;  5G4Z A;  4BD0 A;  4K91 A;  1FR6 A;  1NJ4 A;  3C4O A;  1ES4 A;  3ZCZ A;  3LFV A;  2ZOH A;  3BQ8 A;  4Y0T A;  5GLB A;  4UAA A;  2QPN A;  2VGJ A;  3JYI A;  2VK3 A;  5DTK A;  3UME A;  2OAP 1;  1PYY A;  4M4X A;  5FDS A;  1O7E A;  2DMW A;  3PBS A;  3V50 A;  1DJA A;  4NKP A;  1CF0 A;  4R4S A;  1XJ2 A;  3NEC A;  1ERM A;  2PBD P;  4QD4 A;  5KSC A;  4FD8 A;  2A2L A;  4KG6 A;  2X01 A;  4BWI A;  2PT7 A;  2X71 A;  4MEZ A;  5F1G A;  2Y2N A;  3BY8 A;  4DE0 A;  2HDS A;  4GHI B;  5HWT A;  3ZGA B;  4PM7 A;  1KOU A;  5DFY A;  3EWK A;  4RYE A;  1LL9 A;  1OJG A;  2P9V B;  1TS0 A;  3DBA A;  3CPT A;  4FUW A;  3UE1 A;  1BTL A;  3ITA A;  1S4R A;  3LGO A;  4ARZ A;  4GDN A;  5CXW A;  3G30 A;  2LB5 A;  3BY9 A;  4MCW A;  2GX5 A;  2OLU A;  1BUL A;  3E0Y A;  3KSH A;  3UB8 A;  3PR6 A;  2Q9M A;  2JKT M;  1BUE A;  3E98 A;  2C6W B;  2ZMF A;  2OOL A;  2DNS A;  3LEQ A;  2HDU A;  1MBL A;  3IF5 A;  5DTS A;  4NK3 A;  1XPB A;  1P97 A;  1VM1 A;  2AVX A;  2J7V A;  2QJ5 A;  3MZD A;  2PAV P;  4FH2 A;  2ZL1 A;  4JGP A;  4JXW A;  3LI8 A;  3JPU A; 
#chains in the Genus database with same CATH homology
 2ACG A;  4X25 A;  1Y4O A;  2PRF A;  2V8F A;  3NEC A;  3NUL A;  1ACF A;  3CPT A;  3MSH A;  2E8J A;  2BTF P;  4FUW A;  3LEQ A;  2JKF A;  2HZ5 A;  2PBD P;  3T1S A;  1PFL A;  1SKO A;  3UB5 P;  4FTX A;  5EVE A;  5EM0 A;  1HLU P;  3CPT B;  1Z09 A;  3L7H A;  3LGO A;  1F2K A;  2V8C A;  4ESP A;  2B95 A;  1PNE A;  1VET A;  2VK3 A;  2ZL1 B;  5EM1 A;  1FIK A;  3T1R A;  3T1X A;  1D1J A;  1J3W A;  1SZV A;  1K0K A;  1VEU B;  1VEU A;  4QWO A;  4D60 A;  1A0K A;  1G5U A;  3D9Y A;  3MS6 A;  1CQA A;  1AWI A;  1FIL A;  5FDS A;  3L9K A;  2PAV P;  1YPR A;  5EV0 A;  5FEF A;  4X1M A;  1PRQ A;  4X1L A;  3KYE A;  1VET B;  2ZL1 A;  1CF0 A;  3T1Q B;  3DAV A;  2JKG A;  3CHW P;  3U4L P;  3T12 B;  5FEG A;  1CJF A;  1SKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...