3OBFA

Crystal structure of putative transcriptional regulator, iclr family; targeted domain 129...302
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
SNAEERRVAYPVLRELTERTGETSALMVWNGNESMCVEQIPSRHQVKHLAPLGARYNEALSSSVQVFLASENEDRVRQLLRSGSITLTGVDEDAVEAYLLRLKESMERGWAVNFGETSIEEVGVASPVYDHRGNMVASVLIPAPKFRVSQDTLNSLGEACAAAAAKVTTRLGGRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative transcriptional regulator, IclR family; targeted domain 129...302
rcsb
source organism Arthrobacter aurescens
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator, IclR family
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3obfA00
4Z1WA 5HSQA 4LRYC 1ZTUA 4ETZA 4R6LA 1YKDA 2B18A 3BJNA 5AJGA 5K5BA 2K2NA 2VEAA 5I5LA 4EUVA 2W3GA 3C2WA 3KSHA 2Y79A 3RFBA 3MF0A 3D3OA 4MDZA 4Y5FA 5DFYA 2W1TB 3IBJA 2XRNA 2M7VA 2W3EA 3LFVA 3EEAA 2QYBA 4Q0HA 4Y3IA 3ZQ5A 2W3DA 1TF1A 2VKSA 3MQ0A 3IBRA 4GLQA 1VHMA 3MMHA 4Y2FA 2KLIA 2VJWA 4O8GA 4O0PA 1TD5A 3NOUC 3NOPC 3KO6A 5HPIA 3OBFA 3CITA 3DBAA 3S7NA 3G6OA 2O0YA 4LRZE 2M7UA 3E98A 5HL6A 4E04A 3KSIA 2IA2A 4RQ9A 3S7QA 4CQHA 2W1TA 4LRXC 4ETXA 2XSSA 2O99A 2W3FA 4R70A 5C5KA 2VZWA 2O9BA 4G3KA 2OOLA 2O9CA 2LB9A 2K31A 2W1RA 3TRCA 4MMNA 1MKMA 4YNRA 4ME4A 3R4KA 4DN0A 2KOIA 4MCWA 3NOTC 4Q0IA 2W3HA 4GW9A 3CI6A 3W2ZA 1YSQA 2GX5A 4ZRRA 4FOFA 2Y8HA 2ZMFA 3HCYA 5DFXA 3OOVA 3E0YA 4QPRA 1STZA 2O9AA 4Q0JA 4DMZA 3KSFA 4YOFA 5TJJA 3K2NA 3S7PA 2HGVA 4IUHA 4IUKA 4O01A 3KSGA 4EU0A 4G3VA 3VV4A 5HPFA 2LB5A 3NHQA 3O5YA 4BWIA 2XROA 4IJGA 5LBRA 1YSPA 3S7OA 5L8MA 1F5MA 4PAUA 4MN7A 1MC0A 4G3WA 2G7UA
chains in the Genus database with same CATH superfamily
1ERQA 3T12B 2BASA 4KZ3A 2WAFA 1NYYA 4EUVA 3BFCA 2ZJ9A 5EVIA 1PIOA 3IH9A 1OT6A 1ZG6A 1KGEA 4IHQA 1KE4A 3VFHA 1O07A 1K6RA 1ESIA 1U60A 3V39A 5HWWA 1N9LA 2ZBBA 3PR6A 4Y2FA 2VJWA 1WYBA 4NETA 4KG6A 3G32A 4KZAA 3VSKA 1Z09A 3N8RA 4FCFA 4BQMA 3D72A 2WK0A 3K3CA 4UQIM 1K57C 3JYIA 2VLGA 2JKGA 4C3QA 3CJMA 4NEED 3HLEA 3SS4A 3C5AA 2J7VA 4JGPA 4X1MA 4HP4A 1XPBA 3V3RA 2FFFB 2X71A 3S7QA 3G2ZA 1XJ2A 2XR0A 2J8YA 2O9CA 4WEKA 1J9MA 2A49A 1XA7A 5CGWA 2NUPC 3MFXA 4ME4A 2Y59A 3VSLA 4MCWA 1FILA 5A8BA 4X1LA 1FCMA 4GHIB 4GOGA 3OCNA 4OPYA 4HNBA 5KMWA 2H5SA 2ZC5B 3K2NA 3BFGA 4BWIA 1BZAA 1XJ4A 5F69A 1G6AA 2OV5A 1SDNA 4IBRA 3HL9A 4OQ0A 4R0QA 3LR0A 3CAXA 2R78A 2Y2IA 3LEQA 1JTDA 1WA9A 1DJBA 5TR7A 5M18A 2K2NA 3T1QB 1PI4A 3Q07A 4HJ4A 4PM5A 4YINA 4X6TA 2XK1A 3HLWA 4GHIA 4DE2A 3IX8A 2XD1A 3NBLA 1N9BA 2W3EA 4Y13A 3IWOA 4GS9A 1W5DA 5FQQA 1NJ4A 4GKUA 4OP8A 2WKQA 4CLCA 1MZUA 3FYZA 3MQ0A 2OWHA 2OAP1 5FEFA 3ITAA 3N8SA 5HARA 4LFUA 3IX3A 5HL6A 3G4PA 3H82A 2QJ7A 1MWTA 2WKIA 1IKIA 4JGOA 2W1TA 5CGXA 4AFIA 4Q8IA 1T18A 5JYPA 2XSSA 5EPHA 5DJUA 5C5KA 1DJCA 4KZBA 4E3LA 1WE4A 5GLDA 1K55A 2K31A 2PAVP 2WADA 2QPNA 2B5RA 4GD8A 1JWPA 3T1SA 2GX5A 4KUKA 2ZM8A 4DF6A 4LCMA 4PM6A 1GSXA 4DKIA 4MBHA 4MN5A 5DF8A 4K0WA 2KX6A 3BECA 1DP9A 1PWCA 1SZVA 4ARZA 4OQIA 4E3IA 1PW1A 5CTNA 4E3JA 5E2EA 2HDRA 4R1GA 3C38A 3ITBA 2YKFA 5HW3A 4WEJA 1GCEA 1S66L 3IHAA 4F94A 4P6ZM 2Y2LA 2L0WA 4R6LA 2WGIA 3C7VA 4IVKA 2GNXA 2PD7A 2VGKA 3HUNA 5AJGA 1NLZA 5I5LA 4BLMA 2V1ZA 3F1NA 3GQZA 2VGLM 3LIAA 1ES5A 3IF6C 5HZHA 1PRQA 1W8YA 3G35A 3CUEA 3WS2A 5FI6A 3OPRA 3HREA 3E4OA 1CI9A 3V3SA 3IXGA 5CHJA 4JGRA 5U47A 4KZ5A 3PBQA 1L0DA 3GR2A 4PKYG 3WS0A 4BL3A 1ONHA 1K38A 1XFQA 1EW0A 4QY5A 3KYQA 3GSGA 1MKIA 2EWVA 1J3WA 2M7UA 3B3XA 4E04A 4RQ9A 5AQ9A 4LPZA 4WUJA 4E6XA 5DTTA 3NCKA 4HIAA 1KE0A 5J7EA 1K6SA 4OLDA 3UE0A 3OPLA 3MFDA 4R38A 4R70A 1IYOA 5M1AA 4UA6A 1S1YA 1K56A 3L7HA 3VE4A 4BL2A 4XUZA 3OZHA 3PBOA 2V1BA 1Y54A 3HUOA 2M1CA 3VOYA 1L0FA 1G5UA 4E3NA 3LO7A 2K7SA 5A93A 3E4QA 1BLSA 3EWKA 2Z2MB 3AGFA 4IJGA 2V8CA 2HDQA 3B42A 1MC0A 5L09A 4ZJ2A 4H6JB 4ETZA 4ZDXA 5K5BA 2WKRA 1Y28A 2Z6CA 3TJZC 3CG5A 2GDNA 1M6KA 1S1ZA 4DDYA 2XRNA 3ZYTA 1N9OA 5KSHA 1PZOA 3ZQ5A 2WZXA 4NXGA 1TS0A 3HUMA 4MEZA 5J3WA 4UA7A 2H0TA 4E3OA 1H8YA 3MXSA 1D1JA 4GLQA 1GHIA 5CHUA 3UY6A 3CZDA 5EVEA 3MXRA 2QKPA 3SS5A 4DXCA 3OBFA 3S7NA 1LI0A 2Y55A 1BLCA 1SKFA 2ZLYA 1OTDA 5KIZA 3P09A 3G34A 3HBRA 2ZC4B 3HLFA 1FR6A 3EGDC 2DCFA 1T1BA 2W1RA 2L4RA 3NY4A 2JN7A 5TFQA 3NJAA 2V9AA 2KOIA 1P0ZA 1BSGA 4X69A 4U3TA 3CMZA 1E25A 5HAQA 5FI2A 3T4SA 4YFMA 2Y2NA 4OONA 2LB5A 2XROA 5EVIB 2CC1A 2ZMVA 4XT2B 4WZ5C 4HQAA 2BG1A 4EQIA 4EWFA 3F1PB 2VEAA 4BBVA 1GHPA 3UB6A 5DTSA 3UDIA 2EXBA 1SKOB 4N1HA 1V9YA 3TSGA 3LYXA 3OLOA 4EBPA 4RX2A 3H9WA 5FDSA 5FL3A 1OTBA 2ZQ9A 1SKOA 3N7WA 4MLLA 3P01A 4ARZB 4X25A 4I5SA 2H10A 2KLIA 4HHDA 2WGVA 2XFTA 3BRMA 4U0XA 4Y0TA 1K57A 1XA1A 5E2FA 3NIAA 4S2PA 3KSIA 3FPWA 3LUQA 3MSHA 1W8QA 1SCWA 3VE3A 2ZL1B 4JPMA 4ZJ1A 4QD4A 3PYPA 5HD3A 4S2KA 4HJ3A 5IHVA 2P7JA 1BTLA 2R9WA 5EECA 1CQAA 5I94A 2Y8HA 4II7A 5IU1A 2WAEA 1STZA 2XF3A 5TJJA 4K0XA 3LIEA 4I3AA 5FASA 3T4LA 5L8MA 4PAUA 5F82A 2VA0A 3S22A 2MJ6A 3W4PA 4OOYA 5EV0A 1VETB 1MPLA 1YKDA 1YMXA 3KSHA 3IT9A 3MF0A 1FIKA 2FH5A 4CLCB 4WM9A 3LIFA 2XQZA 1NWZA 3NI9A 4HH2A 4P87A 1DRMA 2YKHA 4DXBA 2BLSA 4HI4A 1K54C 4O0PA 3CLOA 4X56A 4EEPA 1JWZA 4B93A 3ZNYA 2ACGA 2OAQ1 3A3JA 1XKZA 3G30A 2PHYA 4CQHA 3GECA 4BBUA 3HLGA 3BFDA 3TOIA 1IFQA 2VZWA 2JBFA 1PI5A 3ZHHA 4JXGA 3DW0A 1RP5A 2E8IA 4I39A 2J9OA 3Q7ZA 5EOOA 5CRFA 1M40A 2Y2QA 1VM1A 4EW7A 1H8ZA 1NRJA 4S2NC 4N1XA 1DP8A 1OTIA 5DFXA 3FV7A 4N92A 5HAPA 4YOFA 3F1NB 3U2AA 3W4OA 3VP2A 4KUOA 5CHMA 2Z6DA 4EV4A 1ONGA 3UDFA 3EQUA 1BYWA 3EGXC 5MC7A 5GL9A 3SZTA 5EOEA 2XLNA 2H28A 4R4SA 4FSFA 5HSQA 1XX2A 4KG5A 1TDLA 3BLSA 4GJ4A 4DJ2A 4LV0A 1TDGA 3B33A 3T4OA 4Y5FA 1YLPA 4M3KA 3O3VA 4ZTKA 3V5MA 4OKPA 3IWQA 1I2WA 4X55A 2A3UA 1VEUB 3IXHA 4Q0HA 1AXBA 4LV1A 1PZPA 1ZC2A 2Y2PA 1S4RA 1RGZA 4IBXA 3IBRA 1HZOA 4UA9A 1DJAA 3VP4A 2EFXA 5GHXA 4L9FA 3UB7A 4Y7PA 3QP8A 5AQBA 4O7DA 1BULA 3Q7VA 2WGWB 3P7NA 2PRFA 4BMWA 1MWUA 4MMNA 2C5WB 1OJ5A 5FATA 4FH4A 3ULFA 2VGLS 4CPKA 3KX0X 3O86A 2VX8A 1CI8A 3E2LA 3FPVA 3E0YA 4JXWA 4KQOA 5HD5A 4L9GA 3KSGA 3N6IA 4S2OA 3E4PA 5HPFA 3PHYA 4OLGA 1S4SA 3G2YA 4PMAA 4LRYC 2PYRA 4U0TA 1VETA 4JBFA 1D06A 2Q9NA 1MWRA 4CLCD 2W1TB 4JF6A 1P97A 3MZDA 1E3UD 4DE3A 3EOIA 3IS2B 2E8JA 2IWBA 2Y2JA 1KE3A 2V0UA 1P9RA 3QP6A 5CXWA 1PWDA 3N8LA 4OQHA 2JKTM 3KO6A 3QP5A 3M2JA 4D2OA 4EBNA 3M2KA 3BY8A 4PKYA 4ETXA 3V50A 1SHVA 2V20A 2ZC3B 4X53A 1G68A 1E4DA 2Y2GA 3LICA 2LB9A 2HJ9C 3TG9A 4RX3A 1ZHHB 3BM6A 4QHCA 1H0MA 3CI6A 4PM8A 2D02A 3UNWA 5A92A 1K4EA 1P9WA 4FOFA 1OJGA 5HAIA 3SOIA 5EM1A 3UE3A 5CEDA 1LLBA 1HD8A 3BYDA 3IF6B 3H7WA 1RCJA 2ZM0A 4EETB 3OCLA 5G18A 2JKRI 3O87A 1LSVA 1C3BA 4H8RA 3S7OA 3RH8B 4LLOB 5HWTA 2J80A 1Q2QA 4KZ8A 4RVAA 3FC7A 1YT4A 2A2LA 1S0WA 4OOMA 1XJ3A 3DTEA 1YLYA 3D3OA 5JYOA 1W7FA 1FCNA 2A24B 3MXQA 3QNBA 4HEFA 3W4QA 2DRWA 5CGSA 3BW6A 3MBZA 5J4EA 5FQKA 2V8FA 4Y0OA 4XUXA 3GDIA 1VQQA 4IVIA 2INWA 4K91A 4R3JA 4EBLA 3G6OA 2J3TD 2NUTC 5DKLA 5EM0A 5L07A 2PR6A 2DNSA 2JE5A 5F6AA 2JKTI 2O99A 3VP3A 4I38A 5GLBA 2O9BA 4G3KA 2Z2LB 1LSWA 4UEYA 3VP1A 4OPRA 2PD8A 2ZOIA 2XA7M 4P0MA 3QHYA 1TVFA 2H0YA 2ZC6B 3LI8A 1LL9A 1V9ZA 3LIBA 5FDHA 1PWGA 2HP5A 2J3TC 2HDSA 3LI9A 3RTYA 2QJ5A 5GHZA 4F3LA 1F9IA 3O5YA 4JXSA 1F5MA 3SH9A 4QB8A 4G3WA 1L0EA 4WMCA 1L3LA 5F1GA 4Z1WA 4NKPA 4DE1A 4BJPA 1PW8A 4K08A 4S2MA 3IHBA 2HF6A 2EA9A 2Y79A 2AVXA 5TBMA 1FR1A 4C6YA 4OOLA 3WS4A 1YLZA 3CPTB 1LL5A 5FA7A 3UO9A 3C30A 5AVFA 1T1AA 4OQGA 2PR5A 4RA7A 1TF1A 4WBGA 2P9VB 1LT0A 5F1FA 3OPPA 4NG2A 3NECA 4UQIS 4WN5A 4YWZA 5HPIA 3HLBA 4XXRA 4JGQA 3BY9A 3IF6A 4ID4A 2Y2OA 5CTMA 2UV0E 2EXAA 1TS6A 3K3DA 5EVIC 3UB5P 1XGIA 2OLVA 1ZG4A 4OH0A 4I3IA 4H6JA 5AVEA 4DRTA 3UMDA 1KVLA 4FTXA 3GV9A 1BLHA 2Y2KA 3H7WB 4GW9A 3NULA 3OPHA 4C75A 5E2HA 1YM1A 2JCHA 1KDWA 2QHKA 1JTGA 4HY8A 1KDSA 5KZHA 2JKRM 4KZ9A 3KSFA 2Y2HA 4LV2A 1BT5A 2Q9MA 5CECA 3BWLA 3FWLA 3SS3A 5TGFA 1IYPA 1G28A 3LGOA 2XDMA 3PBNA 3LR3A 1GA0A 3MQQA 4CLCE 5KSCA 4FH2A 1ZTUA 5GLCA 2PBDP 4BD0A 2B18A 2BTFP 2XGNA 4BENA 5HDSA 3IX4A 5L10A 2L1MA 5DFYA 5DKKA 3R7WB 4GNUA 2M7VA 5CEBA 3C4PA 4WF0A 4Y3IA 2QYBA 1A0KA 2W3DA 2ZQ8A 2EX2A 3T4JA 3AGEA 2XD5A 5AQAA 4EERA 3C4OA 3IQAA 4HJ6A 1YLTA 3Q1FA 2V1AA 2PDRA 4HP9A 1IKGA 3GMWA 1JVJA 1NYMA 3MJQA 3WS1A 2P08A 3CITA 2D01A 2XH9A 3UE6A 3MS6A 1VB6A 3EEHA 1UWNX 2V2FF 1ODVA 2W3FA 5HWVA 5AQ7A 3LIDA 4KG2A 1YPRA 5A91A 1YSQA 4KQRA 2CMNA 3GVBA 3CHWP 2ZMAA 1Q2PA 1EWZA 2XEPA 3UPOA 2O9AA 4Q0JA 1JWVA 2IWCA 4DMZA 3A0SA 5FEGA 3S7PA 5FAOA 4O01A 3IXDA 3VV4A 1XXMA 4P6ZS 4WZ4A 4P6BA 3SW1A 3ZG5A 1OTEA 1K0KA 5E2GA 1PFLA 2G7UA 3IXBA 3BQAA 4NK3A 2ZD8A 4P85A 5F68A 1XP4A 3V67A 2P74A 4CLCC 1N9NA 4DE0A 1KOUA 4HBUA 1EI5A 1FSWA 2OSUA 3TW8A 3MQOA 3LR4A 2JC7A 3UB9A 3IBJA 4S2NA 1HTZA 3PXPA 1JNUA 1XJ6A 1UWPX 3QP2A 3UPPA 2I72A 4PM9A 4QJGA 1NXYA 1K4FA 1ALQA 4JKTA 1LI9A 4GB7A 4KZ7A 4JXVA 1YLWA 3JVVA 3MR0A 1NZUA 4GS9B 1TS8A 1ERMA 3QP1A 3A0RA 5CX7A 2G2WA 1K25A 5IT5A 3WS5A 1QMEA 3FG8A 1MWSA 3BQ8A 3Q82A 3IF5A 4GDNA 2PU4A 3WWXA 3A3FA 1QMFA 1ES4A 3HJIA 2GJ3A 4ESPA 4E3MA 3A3EA 4DN0A 3F1OB 5CERA 3W2ZA 1H3QA 2X02A 1T1CA 2ZMFA 4LENA 3RXXA 4OP5A 4MBKA 2WUQA 4UAAA 3UN7A 2VV6A 3I7JA 4NXBA 3F1PA 1Y4OA 1T19A 5F5YA 3LR5A 1GSVA 1S6RA 2A24A 3ZGAB 1CK3A 1OPXA 4GZBA 2PYPA 5EE8A 5FQ9A 3HJKA 4PHTA 1G6OA 4Y15A 1W63Q 4EUZA 1CEGA 4GCZA 1OMEA 2OLUA 2WYXA 2PT7A 1GHMA 5HX9A 2W3GA 3C2WA 3RFBA 1CEFA 3S1YA 3ZVWA 3ZCZA 3JVUA 4CJNA 3LFVA 1F2KA 3WRZA 3DWZA 3DTIA 2WZZA 1NRFA 2ZOHA 4E3KA 5E43A 4GDBA 2QZ6A 4QU3A 3ISGA 3LY3A 3U4LP 4BBTA 5GLAA 4WMCD 3IWIA 4EQ1A 5DF7A 5DVAA 2QWSA 2G2UA 4S2JA 4B4ZA 3E98A 1I2SA 3PAGA 5IS1A 4MN6A 2ZQ7A 4S2IA 3W8KA 4OPZA 1L2SA 1H5XA 2J3WA 5FAPA 4JF5A 1MKMA 3BLMA 3ZVTA 5D3OA 3WRTA 1FSYA 3MKEA 3M6HA 3DTKA 2XFSA 4HH3A 3B47A 4FUWA 4GN2A 2HGVA 1FQGA 4IUKA 4ZAMA 4OPQA 4D60A 2HDUA 3UDXA 5FQJA 2IWDA 1D7EA 5FSRA 3T1RA 2ZL1A 5HDDA 4GD6A 3PTEA 3CPTA 3Q81A 1X0OA 1DY6A 1IELA 1YLJA 1S67L 2C6WB 5TBMB 4R3BA 4RYEA 2QMIA 2WKPA 2WKHA 1MBLA 4MDZA 3T50A 4ZBEA 3UPNA 2HV1A 3DAVA 3ZG7B 3SH7A 3ICYA 4LCLA 2W27A 3EEAA 4Z9QA 4B9OA 1ES3A 4MBFA 1K56D 3E2KA 3T1XA 2FZ0A 2ZQDA 1VHMA 3M6BA 3IS2A 3MMHA 5FI7A 4I3JA 1PNEA 2X01A 3LY4A 3NOUC 1ES2A 3D9YA 3ZG9B 3QNCA 3KYZA 1KVMA 2HZ5A 4QY6A 3H82B 2VK3A 3DBAA 4N9KA 4S2LA 3DTMA 4JF4A 4R23A 4F3LB 3NC8A 4KQQA 4KZ4A 4KENB 4LRXC 4WL9A 4N9LA 4KZ6A 1BLPA 3LCEA 4XT2A 5HFOA 4WLAA 2OOLA 3RJUA 2Y2MA 3OC2A 3TRCA 4MNRA 1GSWA 2J9PA 2VV7A 1ACFA 2WGWA 2W0NA 3N4IA 1IYSA 4OVDA 2HP9A 2EX6A 3OOVA 4JLFA 4NXFA 4WELA 5FQIA 4PM7A 3R7WA 2JKFA 4DJ3A 3SH8A 5G4YA 2PU2A 2HPBA 2B02A 2R9XA 3CWFA 5LBRA 1YSPA 2XA7S 5BOHA 3A3DA 3JPUA 4MN7A 2B95A 3VMAA 2ZC7A 4Y17A 1VEUA 3KYEA 4R4RA 3T4TA 3BJNA 1I5QA 4A5RA 4LV3A 3VOZA 4R3AA 1KGFA 4E6WA 1TEMA 3CUEC 1WYCA 4ZJ3A 3NDGA 1IEMA 3FZCA 1CF0A 5EVID 1IYQA 3PBTA 4B4XA 2ZQCA 5DF9A 4O8GA 2EWWA 5EUAA 1GA9A 1UGUA 3BFEA 3MZEA 3NOPC 3ZFZA 2P04A 4NXEA 2JHEA 3O88A 4WYYA 3AGDA 3IH8A 2O0YA 2ZQAA 4LRZE 2IA2A 1DP6A 3ZG8B 3A0VA 5GHYA 1YAXA 4WZ5A 5J8XA 4B88A 3FKVA 2RL3A 1K55C 1ESUA 3FKWA 4YNRA 2ZM2A 2PBYA 3A3IA 3NOTC 4Q0IA 4HOIA 2W3HA 1XFNA 2P9VA 3ZG0A 4FD8A 4ZRRA 4LGWA 1K54A 1W63M 3P98A 1LSXA 1FCOA 4EEUA 4PPRA 1HVBA 2OWJA 3EQVA 2HJEA 1H8MA 3LEZA 4IUHA 1IOUA 3G31A 3PAEA 4EU0A 4DDSA 1ZKJA 1HLUP 4G3VA 3C7UA 2HP6A 1O7EA 3DWKA 4L0LA 2Y91A 5EVLA 5HDCA 1TS7A 3RXWA 5DJTA 1PYYA 2I9VA 4HBTA 1F98A 4Y0UA 1NY0A 3HLDA 2UWXA 4IEDA 3BFFA 2DMWA 1N4OA 4L9EA 3UMEA 3NDEA 1AWIA 2EX9A 4M4XA 3HVFA 5M19A 3QP4A 1NZOA 3D4FA 3T4KA 2VV8A 3HLCA 3UE1A 2VKSA 3T4QA 1MY8A 1MXOA 4EXOA 2EFUA 1TD5A 5DTKA 3VP0A 5FQMA 1XGJA 3VFFA 1RGYA 1LHYA 2WKEA 1BUEA 3GTCA 2GZAA 2Y4AA 5FAQA 3UB8A 1OTAA 5G4ZA 1Z6FA 5EFWA 1OT9A 1EROA 3GRJA 2VGJA 3PBRA 1SDEA 3F1OA 2V0WA 3L9KA 5L2FA 1LL8A 3R4KA 1CJFA 1YMSA 3MKFA 1YQSA 1E3UA 1FOFA 4KQDA 2Q0OA 5A90A 4EESA 5F83A 4BD1A 3HCYA 1NLYA 4UHUA 2KDKA 4HESA 3PBSA 4QWOA 4QPRA 3BEBA 1W79A 5HL1A 4X68A 2EX8A 3VOLA 3TE8A 3C8CA 3Q7VB 1L0GA 3NHQA 3ZNTA 2FFYA 3ZDJA 1KGGA 3MZFA 2RCXA 3S4XA
chains in the Genus database with same CATH topology
5HWTA 4HQAA 2J80A 4GCZA 2BASA 3FC7A 3F1PB 2PT7A 2VEAA 4EUVA 2W3GA 2A2LA 4BBVA 4OOMA 3C2WA 3UB6A 3RFBA 1XJ3A 3D3OA 1V9YA 1OT6A 3LYXA 2A24B 3OLOA 4IHQA 3H9WA 3MXQA 3JVUA 5FL3A 1OTBA 3LFVA 3BW6A 5HWWA 1N9LA 3P01A 4ARZB 2ZOHA 5J4EA 2ZBBA 3PR6A 4I5SA 4Y2FA 2KLIA 2VJWA 4HHDA 3GDIA 2INWA 4BBTA 4EQ1A 3D72A 2QWSA 3G6OA 2J3TD 3K3CA 4UQIM 2VLGA 2NUTC 3E98A 5DKLA 3KSIA 4NEED 5IS1A 3FPWA 3LUQA 4MN6A 4JGPA 4HP4A 2PR6A 3S7QA 2J3WA 5F6AA 3VE3A 2JKTI 2O99A 1XJ2A 4I38A 2O9BA 4G3KA 2O9CA 4WEKA 1LSWA 3PYPA 4UEYA 1MKMA 2NUPC 3MFXA 2PD8A 2ZOIA 2XA7M 4ME4A 5HD3A 3LI8A 4HJ3A 4MCWA 2P7JA 5A8BA 1V9ZA 3LIBA 4GHIB 2Y8HA 4II7A 5IU1A 4HH3A 3OCNA 4HNBA 3B47A 1STZA 5TJJA 3K2NA 2HGVA 2J3TC 4IUKA 3LIEA 3LI9A 3RTYA 2QJ5A 4I3AA 4F3LA 1F9IA 3O5YA 3T4LA 4BWIA 1D7EA 1XJ4A 5F69A 5L8MA 1F5MA 5HDDA 4PAUA 4G3WA 2VA0A 1X0OA 2MJ6A 4Z1WA 3LR0A 4NKPA 3CAXA 1S67L 2R78A 5TBMB 1YKDA 1WA9A 2K2NA 4BJPA 4K08A 4HJ4A 2WKPA 2HF6A 3KSHA 2EA9A 2Y79A 5TBMA 3MF0A 4MDZA 4OOLA 2FH5A 3T50A 4GHIA 4CLCB 2HV1A 3ICYA 2W27A 3LIFA 2W3EA 3C30A 5AVFA 3EEAA 1T1AA 4GS9A 2PR5A 1NWZA 2WKQA 1TF1A 4B9OA 4CLCA 1MZUA 3MQ0A 2OWHA 4HH2A 1DRMA 2FZ0A 2YKHA 1VHMA 3MMHA 1LT0A 3IS2A 2OAP1 4HI4A 4I3JA 4O0PA 3CLOA 4UQIS 3NOUC 4WN5A 4YWZA 3KYZA 5HPIA 4EEPA 4B93A 3H82B 4JGQA 3DBAA 3BY9A 2OAQ1 5HL6A 3H82A 4F3LB 2QJ7A 1TS6A 2PHYA 2W1TA 4JGOA 3K3DA 4AFIA 4CQHA 3GECA 1T18A 4LRXC 4BBUA 2XSSA 4WL9A 4XT2A 5DJUA 5C5KA 1IFQA 2VZWA 4I3IA 4WLAA 4H6JA 2OOLA 5AVEA 2K31A 3OC2A 3TRCA 3UMDA 1GSWA 4I39A 3H7WB 4GW9A 2VV7A 2GX5A 4EW7A 2W0NA 1NRJA 4KUKA 1DP8A 1OTIA 2QHKA 5DFXA 1GSXA 3OOVA 4MN5A 4HY8A 4NXFA 4WELA 2KX6A 2JKRM 3KSFA 4YOFA 3F1NB 3R7WA 1DP9A 4DJ3A 3U2AA 4ARZA 5G4YA 3BWLA 2B02A 3CWFA 4KUOA 5LBRA 1YSPA 2XA7S 2Z6DA 3C38A 2YKFA 4WEJA 3EQUA 1G28A 1BYWA 4MN7A 3EGXC 5MC7A 3PBNA 1S66L 4P6ZM 2H28A 4FSFA 3LR3A 5HSQA 3MQQA 4CLCE 2L0WA 1ZTUA 4R6LA 2GNXA 2PD7A 3T4TA 2B18A 3BJNA 1NLZA 5AJGA 4GJ4A 5I5LA 4DJ2A 5HDSA 2L1MA 3B33A 3T4OA 4Y5FA 5DFYA 5DKKA 4R3AA 3F1NA 3R7WB 2VGLM 3LIAA 2M7VA 3CUEC 5HZHA 4WF0A 2QYBA 4Q0HA 4Y3IA 3CUEA 2W3DA 3T4JA 1S4RA 3E4OA 3IBRA 4EERA 3PBTA 4HJ6A 5DF9A 4O8GA 2V1AA 2EWWA 2PDRA 4JGRA 1UGUA 3PBQA 3NOPC 4HP9A 4PKYG 4L9FA 3UB7A 1XFQA 3MJQA 1EW0A 2P08A 3CITA 3KYQA 2P04A 4NXEA 2JHEA 2D01A 2EWVA 2O0YA 3UE6A 4LRZE 2M7UA 4E04A 2IA2A 4RQ9A 4LPZA 4WUJA 1VB6A 1DP6A 4HIAA 3A0VA 5J7EA 3EEHA 1UWNX 1YAXA 3P7NA 4BMWA 4R38A 1ODVA 2W3FA 4R70A 1S1YA 4MMNA 3VE4A 5HWVA 4YNRA 1OJ5A 3LIDA 3PBOA 3ULFA 2V1BA 2VGLS 3NOTC 4HOIA 2W3HA 1XFNA 4Q0IA 3KX0X 1YSQA 2CMNA 4ZRRA 2M1CA 2VX8A 1W63M 1LSXA 4EEUA 3FPVA 3E0YA 2K7SA 4KQOA 2O9AA 3E4QA 4Q0JA 4DMZA 2OWJA 3A0SA 3EQVA 2HJEA 3EWKA 5HD5A 3S7PA 1H8MA 4O01A 4IUHA 1IOUA 4L9GA 3KSGA 4EU0A 4G3VA 3VV4A 3E4PA 4P6ZS 5HPFA 3SW1A 4IJGA 4L0LA 1OTEA 3PHYA 5HDCA 1TS7A 3B42A 1MC0A 1S4SA 2G7UA 5DJTA 3BQAA 4H6JB 4LRYC 5F68A 2I9VA 4ETZA 4CLCC 3V67A 1F98A 1N9NA 1KOUA 2PYRA 5K5BA 2WKRA 1Y28A 2DMWA 3TW8A 3MQOA 2Z6CA 4L9EA 1D06A 3TJZC 1S1ZA 3UMEA 3LR4A 4CLCD 2W1TB 3UB9A 4M4XA 3IBJA 2XRNA 3ZYTA 1P97A 3EOIA 1N9OA 5KSHA 3PXPA 3T4KA 1JNUA 1XJ6A 2VV8A 1UWPX 3ZQ5A 3IS2B 4NXGA 1TS0A 5J3WA 2VKSA 3T4QA 4GLQA 2V0UA 1P9RA 4EXOA 1TD5A 2JKTM 3KO6A 2QKPA 3JVVA 3MR0A 3OBFA 4GS9B 3S7NA 1TS8A 3A0RA 5CX7A 2GZAA 3UB8A 5IT5A 3BY8A 1OTAA 1OTDA 5G4ZA 5KIZA 4PKYA 5EFWA 1OT9A 3FG8A 3BQ8A 4ETXA 3EGDC 3PBRA 3LICA 1T1BA 2LB9A 2HJ9C 3F1OA 2W1RA 2L4RA 2V0WA 3HJIA 2GJ3A 2JN7A 1ZHHB 3NJAA 1LL8A 3R4KA 2V9AA 4DN0A 2KOIA 3F1OB 1P0ZA 3CI6A 3W2ZA 2D02A 4KQDA 1H3QA 1P9WA 4FOFA 4EESA 1OJGA 1T1CA 2ZMFA 3HCYA 3UE3A 1NLYA 2KDKA 3PBSA 3H7WA 4QPRA 2VV6A 4NXBA 3F1PA 4EETB 1T19A 5F5YA 3T4SA 3LR5A 1GSVA 3VOLA 3TE8A 2A24A 3OCLA 3C8CA 2JKRI 3NHQA 1OPXA 2LB5A 1LSVA 2XROA 2PYPA 3S7OA 3HJKA 4PHTA 2ZMVA 4XT2B 1G6OA 1W63Q 3RH8B 4LLOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z1W A;  5HSQ A;  4LRY C;  1ZTU A;  4ETZ A;  4R6L A;  1YKD A;  2B18 A;  3BJN A;  5AJG A;  5K5B A;  2K2N A;  2VEA A;  5I5L A;  4EUV A;  2W3G A;  3C2W A;  3KSH A;  2Y79 A;  3RFB A;  3MF0 A;  3D3O A;  4MDZ A;  4Y5F A;  5DFY A;  2W1T B;  3IBJ A;  2XRN A;  2M7V A;  2W3E A;  3LFV A;  3EEA A;  2QYB A;  4Q0H A;  4Y3I A;  3ZQ5 A;  2W3D A;  1TF1 A;  2VKS A;  3MQ0 A;  3IBR A;  4GLQ A;  1VHM A;  3MMH A;  4Y2F A;  2KLI A;  2VJW A;  4O8G A;  4O0P A;  1TD5 A;  3NOU C;  3NOP C;  3KO6 A;  5HPI A;  3OBF A;  3CIT A;  3DBA A;  3S7N A;  3G6O A;  2O0Y A;  4LRZ E;  2M7U A;  3E98 A;  5HL6 A;  4E04 A;  3KSI A;  2IA2 A;  4RQ9 A;  3S7Q A;  4CQH A;  2W1T A;  4LRX C;  4ETX A;  2XSS A;  2O99 A;  2W3F A;  4R70 A;  5C5K A;  2VZW A;  2O9B A;  4G3K A;  2OOL A;  2O9C A;  2LB9 A;  2K31 A;  2W1R A;  3TRC A;  4MMN A;  1MKM A;  4YNR A;  4ME4 A;  3R4K A;  4DN0 A;  2KOI A;  4MCW A;  3NOT C;  4Q0I A;  2W3H A;  4GW9 A;  3CI6 A;  3W2Z A;  1YSQ A;  2GX5 A;  4ZRR A;  4FOF A;  2Y8H A;  2ZMF A;  3HCY A;  5DFX A;  3OOV A;  3E0Y A;  4QPR A;  1STZ A;  2O9A A;  4Q0J A;  4DMZ A;  3KSF A;  4YOF A;  5TJJ A;  3K2N A;  3S7P A;  2HGV A;  4IUH A;  4IUK A;  4O01 A;  3KSG A;  4EU0 A;  4G3V A;  3VV4 A;  5HPF A;  2LB5 A;  3NHQ A;  3O5Y A;  4BWI A;  2XRO A;  4IJG A;  5LBR A;  1YSP A;  3S7O A;  5L8M A;  1F5M A;  4PAU A;  4MN7 A;  1MC0 A;  4G3W A;  2G7U A; 
#chains in the Genus database with same CATH topology
 1ERQ A;  3T12 B;  2BAS A;  4KZ3 A;  2WAF A;  1NYY A;  4EUV A;  3BFC A;  2ZJ9 A;  5EVI A;  1PIO A;  3IH9 A;  1OT6 A;  1ZG6 A;  1KGE A;  4IHQ A;  1KE4 A;  3VFH A;  1O07 A;  1K6R A;  1ESI A;  1U60 A;  3V39 A;  5HWW A;  1N9L A;  2ZBB A;  3PR6 A;  4Y2F A;  2VJW A;  1WYB A;  4NET A;  4KG6 A;  3G32 A;  4KZA A;  3VSK A;  1Z09 A;  3N8R A;  4FCF A;  4BQM A;  3D72 A;  2WK0 A;  3K3C A;  4UQI M;  1K57 C;  3JYI A;  2VLG A;  2JKG A;  4C3Q A;  3CJM A;  4NEE D;  3HLE A;  3SS4 A;  3C5A A;  2J7V A;  4JGP A;  4X1M A;  4HP4 A;  1XPB A;  3V3R A;  2FFF B;  2X71 A;  3S7Q A;  3G2Z A;  1XJ2 A;  2XR0 A;  2J8Y A;  2O9C A;  4WEK A;  1J9M A;  2A49 A;  1XA7 A;  5CGW A;  2NUP C;  3MFX A;  4ME4 A;  2Y59 A;  3VSL A;  4MCW A;  1FIL A;  5A8B A;  4X1L A;  1FCM A;  4GHI B;  4GOG A;  3OCN A;  4OPY A;  4HNB A;  5KMW A;  2H5S A;  2ZC5 B;  3K2N A;  3BFG A;  4BWI A;  1BZA A;  1XJ4 A;  5F69 A;  1G6A A;  2OV5 A;  1SDN A;  4IBR A;  3HL9 A;  4OQ0 A;  4R0Q A;  3LR0 A;  3CAX A;  2R78 A;  2Y2I A;  3LEQ A;  1JTD A;  1WA9 A;  1DJB A;  5TR7 A;  5M18 A;  2K2N A;  3T1Q B;  1PI4 A;  3Q07 A;  4HJ4 A;  4PM5 A;  4YIN A;  4X6T A;  2XK1 A;  3HLW A;  4GHI A;  4DE2 A;  3IX8 A;  2XD1 A;  3NBL A;  1N9B A;  2W3E A;  4Y13 A;  3IWO A;  4GS9 A;  1W5D A;  5FQQ A;  1NJ4 A;  4GKU A;  4OP8 A;  2WKQ A;  4CLC A;  1MZU A;  3FYZ A;  3MQ0 A;  2OWH A;  2OAP 1;  5FEF A;  3ITA A;  3N8S A;  5HAR A;  4LFU A;  3IX3 A;  5HL6 A;  3G4P A;  3H82 A;  2QJ7 A;  1MWT A;  2WKI A;  1IKI A;  4JGO A;  2W1T A;  5CGX A;  4AFI A;  4Q8I A;  1T18 A;  5JYP A;  2XSS A;  5EPH A;  5DJU A;  5C5K A;  1DJC A;  4KZB A;  4E3L A;  1WE4 A;  5GLD A;  1K55 A;  2K31 A;  2PAV P;  2WAD A;  2QPN A;  2B5R A;  4GD8 A;  1JWP A;  3T1S A;  2GX5 A;  4KUK A;  2ZM8 A;  4DF6 A;  4LCM A;  4PM6 A;  1GSX A;  4DKI A;  4MBH A;  4MN5 A;  5DF8 A;  4K0W A;  2KX6 A;  3BEC A;  1DP9 A;  1PWC A;  1SZV A;  4ARZ A;  4OQI A;  4E3I A;  1PW1 A;  5CTN A;  4E3J A;  5E2E A;  2HDR A;  4R1G A;  3C38 A;  3ITB A;  2YKF A;  5HW3 A;  4WEJ A;  1GCE A;  1S66 L;  3IHA A;  4F94 A;  4P6Z M;  2Y2L A;  2L0W A;  4R6L A;  2WGI A;  3C7V A;  4IVK A;  2GNX A;  2PD7 A;  2VGK A;  3HUN A;  5AJG A;  1NLZ A;  5I5L A;  4BLM A;  2V1Z A;  3F1N A;  3GQZ A;  2VGL M;  3LIA A;  1ES5 A;  3IF6 C;  5HZH A;  1PRQ A;  1W8Y A;  3G35 A;  3CUE A;  3WS2 A;  5FI6 A;  3OPR A;  3HRE A;  3E4O A;  1CI9 A;  3V3S A;  3IXG A;  5CHJ A;  4JGR A;  5U47 A;  4KZ5 A;  3PBQ A;  1L0D A;  3GR2 A;  4PKY G;  3WS0 A;  4BL3 A;  1ONH A;  1K38 A;  1XFQ A;  1EW0 A;  4QY5 A;  3KYQ A;  3GSG A;  1MKI A;  2EWV A;  1J3W A;  2M7U A;  3B3X A;  4E04 A;  4RQ9 A;  5AQ9 A;  4LPZ A;  4WUJ A;  4E6X A;  5DTT A;  3NCK A;  4HIA A;  1KE0 A;  5J7E A;  1K6S A;  4OLD A;  3UE0 A;  3OPL A;  3MFD A;  4R38 A;  4R70 A;  1IYO A;  5M1A A;  4UA6 A;  1S1Y A;  1K56 A;  3L7H A;  3VE4 A;  4BL2 A;  4XUZ A;  3OZH A;  3PBO A;  2V1B A;  1Y54 A;  3HUO A;  2M1C A;  3VOY A;  1L0F A;  1G5U A;  4E3N A;  3LO7 A;  2K7S A;  5A93 A;  3E4Q A;  1BLS A;  3EWK A;  2Z2M B;  3AGF A;  4IJG A;  2V8C A;  2HDQ A;  3B42 A;  1MC0 A;  5L09 A;  4ZJ2 A;  4H6J B;  4ETZ A;  4ZDX A;  5K5B A;  2WKR A;  1Y28 A;  2Z6C A;  3TJZ C;  3CG5 A;  2GDN A;  1M6K A;  1S1Z A;  4DDY A;  2XRN A;  3ZYT A;  1N9O A;  5KSH A;  1PZO A;  3ZQ5 A;  2WZX A;  4NXG A;  1TS0 A;  3HUM A;  4MEZ A;  5J3W A;  4UA7 A;  2H0T A;  4E3O A;  1H8Y A;  3MXS A;  1D1J A;  4GLQ A;  1GHI A;  5CHU A;  3UY6 A;  3CZD A;  5EVE A;  3MXR A;  2QKP A;  3SS5 A;  4DXC A;  3OBF A;  3S7N A;  1LI0 A;  2Y55 A;  1BLC A;  1SKF A;  2ZLY A;  1OTD A;  5KIZ A;  3P09 A;  3G34 A;  3HBR A;  2ZC4 B;  3HLF A;  1FR6 A;  3EGD C;  2DCF A;  1T1B A;  2W1R A;  2L4R A;  3NY4 A;  2JN7 A;  5TFQ A;  3NJA A;  2V9A A;  2KOI A;  1P0Z A;  1BSG A;  4X69 A;  4U3T A;  3CMZ A;  1E25 A;  5HAQ A;  5FI2 A;  3T4S A;  4YFM A;  2Y2N A;  4OON A;  2LB5 A;  2XRO A;  5EVI B;  2CC1 A;  2ZMV A;  4XT2 B;  4WZ5 C;  4HQA A;  2BG1 A;  4EQI A;  4EWF A;  3F1P B;  2VEA A;  4BBV A;  1GHP A;  3UB6 A;  5DTS A;  3UDI A;  2EXB A;  1SKO B;  4N1H A;  1V9Y A;  3TSG A;  3LYX A;  3OLO A;  4EBP A;  4RX2 A;  3H9W A;  5FDS A;  5FL3 A;  1OTB A;  2ZQ9 A;  1SKO A;  3N7W A;  4MLL A;  3P01 A;  4ARZ B;  4X25 A;  4I5S A;  2H10 A;  2KLI A;  4HHD A;  2WGV A;  2XFT A;  3BRM A;  4U0X A;  4Y0T A;  1K57 A;  1XA1 A;  5E2F A;  3NIA A;  4S2P A;  3KSI A;  3FPW A;  3LUQ A;  3MSH A;  1W8Q A;  1SCW A;  3VE3 A;  2ZL1 B;  4JPM A;  4ZJ1 A;  4QD4 A;  3PYP A;  5HD3 A;  4S2K A;  4HJ3 A;  5IHV A;  2P7J A;  1BTL A;  2R9W A;  5EEC A;  1CQA A;  5I94 A;  2Y8H A;  4II7 A;  5IU1 A;  2WAE A;  1STZ A;  2XF3 A;  5TJJ A;  4K0X A;  3LIE A;  4I3A A;  5FAS A;  3T4L A;  5L8M A;  4PAU A;  5F82 A;  2VA0 A;  3S22 A;  2MJ6 A;  3W4P A;  4OOY A;  5EV0 A;  1VET B;  1MPL A;  1YKD A;  1YMX A;  3KSH A;  3IT9 A;  3MF0 A;  1FIK A;  2FH5 A;  4CLC B;  4WM9 A;  3LIF A;  2XQZ A;  1NWZ A;  3NI9 A;  4HH2 A;  4P87 A;  1DRM A;  2YKH A;  4DXB A;  2BLS A;  4HI4 A;  1K54 C;  4O0P A;  3CLO A;  4X56 A;  4EEP A;  1JWZ A;  4B93 A;  3ZNY A;  2ACG A;  2OAQ 1;  3A3J A;  1XKZ A;  3G30 A;  2PHY A;  4CQH A;  3GEC A;  4BBU A;  3HLG A;  3BFD A;  3TOI A;  1IFQ A;  2VZW A;  2JBF A;  1PI5 A;  3ZHH A;  4JXG A;  3DW0 A;  1RP5 A;  2E8I A;  4I39 A;  2J9O A;  3Q7Z A;  5EOO A;  5CRF A;  1M40 A;  2Y2Q A;  1VM1 A;  4EW7 A;  1H8Z A;  1NRJ A;  4S2N C;  4N1X A;  1DP8 A;  1OTI A;  5DFX A;  3FV7 A;  4N92 A;  5HAP A;  4YOF A;  3F1N B;  3U2A A;  3W4O A;  3VP2 A;  4KUO A;  5CHM A;  2Z6D A;  4EV4 A;  1ONG A;  3UDF A;  3EQU A;  1BYW A;  3EGX C;  5MC7 A;  5GL9 A;  3SZT A;  5EOE A;  2XLN A;  2H28 A;  4R4S A;  4FSF A;  5HSQ A;  1XX2 A;  4KG5 A;  1TDL A;  3BLS A;  4GJ4 A;  4DJ2 A;  4LV0 A;  1TDG A;  3B33 A;  3T4O A;  4Y5F A;  1YLP A;  4M3K A;  3O3V A;  4ZTK A;  3V5M A;  4OKP A;  3IWQ A;  1I2W A;  4X55 A;  2A3U A;  1VEU B;  3IXH A;  4Q0H A;  1AXB A;  4LV1 A;  1PZP A;  1ZC2 A;  2Y2P A;  1S4R A;  1RGZ A;  4IBX A;  3IBR A;  1HZO A;  4UA9 A;  1DJA A;  3VP4 A;  2EFX A;  5GHX A;  4L9F A;  3UB7 A;  4Y7P A;  3QP8 A;  5AQB A;  4O7D A;  1BUL A;  3Q7V A;  2WGW B;  3P7N A;  2PRF A;  4BMW A;  1MWU A;  4MMN A;  2C5W B;  1OJ5 A;  5FAT A;  4FH4 A;  3ULF A;  2VGL S;  4CPK A;  3KX0 X;  3O86 A;  2VX8 A;  1CI8 A;  3E2L A;  3FPV A;  3E0Y A;  4JXW A;  4KQO A;  5HD5 A;  4L9G A;  3KSG A;  3N6I A;  4S2O A;  3E4P A;  5HPF A;  3PHY A;  4OLG A;  1S4S A;  3G2Y A;  4PMA A;  4LRY C;  2PYR A;  4U0T A;  1VET A;  4JBF A;  1D06 A;  2Q9N A;  1MWR A;  4CLC D;  2W1T B;  4JF6 A;  1P97 A;  3MZD A;  1E3U D;  4DE3 A;  3EOI A;  3IS2 B;  2E8J A;  2IWB A;  2Y2J A;  1KE3 A;  2V0U A;  1P9R A;  3QP6 A;  5CXW A;  1PWD A;  3N8L A;  4OQH A;  2JKT M;  3KO6 A;  3QP5 A;  3M2J A;  4D2O A;  4EBN A;  3M2K A;  3BY8 A;  4PKY A;  4ETX A;  3V50 A;  1SHV A;  2V20 A;  2ZC3 B;  4X53 A;  1G68 A;  1E4D A;  2Y2G A;  3LIC A;  2LB9 A;  2HJ9 C;  3TG9 A;  4RX3 A;  1ZHH B;  3BM6 A;  4QHC A;  1H0M A;  3CI6 A;  4PM8 A;  2D02 A;  3UNW A;  5A92 A;  1K4E A;  1P9W A;  4FOF A;  1OJG A;  5HAI A;  3SOI A;  5EM1 A;  3UE3 A;  5CED A;  1LLB A;  1HD8 A;  3BYD A;  3IF6 B;  3H7W A;  1RCJ A;  2ZM0 A;  4EET B;  3OCL A;  5G18 A;  2JKR I;  3O87 A;  1LSV A;  1C3B A;  4H8R A;  3S7O A;  3RH8 B;  4LLO B;  5HWT A;  2J80 A;  1Q2Q A;  4KZ8 A;  4RVA A;  3FC7 A;  1YT4 A;  2A2L A;  1S0W A;  4OOM A;  1XJ3 A;  3DTE A;  1YLY A;  3D3O A;  5JYO A;  1W7F A;  1FCN A;  2A24 B;  3MXQ A;  3QNB A;  4HEF A;  3W4Q A;  2DRW A;  5CGS A;  3BW6 A;  3MBZ A;  5J4E A;  5FQK A;  2V8F A;  4Y0O A;  4XUX A;  3GDI A;  1VQQ A;  4IVI A;  2INW A;  4K91 A;  4R3J A;  4EBL A;  3G6O A;  2J3T D;  2NUT C;  5DKL A;  5EM0 A;  5L07 A;  2PR6 A;  2DNS A;  2JE5 A;  5F6A A;  2JKT I;  2O99 A;  3VP3 A;  4I38 A;  5GLB A;  2O9B A;  4G3K A;  2Z2L B;  1LSW A;  4UEY A;  3VP1 A;  4OPR A;  2PD8 A;  2ZOI A;  2XA7 M;  4P0M A;  3QHY A;  1TVF A;  2H0Y A;  2ZC6 B;  3LI8 A;  1LL9 A;  1V9Z A;  3LIB A;  5FDH A;  1PWG A;  2HP5 A;  2J3T C;  2HDS A;  3LI9 A;  3RTY A;  2QJ5 A;  5GHZ A;  4F3L A;  1F9I A;  3O5Y A;  4JXS A;  1F5M A;  3SH9 A;  4QB8 A;  4G3W A;  1L0E A;  4WMC A;  1L3L A;  5F1G A;  4Z1W A;  4NKP A;  4DE1 A;  4BJP A;  1PW8 A;  4K08 A;  4S2M A;  3IHB A;  2HF6 A;  2EA9 A;  2Y79 A;  2AVX A;  5TBM A;  1FR1 A;  4C6Y A;  4OOL A;  3WS4 A;  1YLZ A;  3CPT B;  1LL5 A;  5FA7 A;  3UO9 A;  3C30 A;  5AVF A;  1T1A A;  4OQG A;  2PR5 A;  4RA7 A;  1TF1 A;  4WBG A;  2P9V B;  1LT0 A;  5F1F A;  3OPP A;  4NG2 A;  3NEC A;  4UQI S;  4WN5 A;  4YWZ A;  5HPI A;  3HLB A;  4XXR A;  4JGQ A;  3BY9 A;  3IF6 A;  4ID4 A;  2Y2O A;  5CTM A;  2UV0 E;  2EXA A;  1TS6 A;  3K3D A;  5EVI C;  3UB5 P;  1XGI A;  2OLV A;  1ZG4 A;  4OH0 A;  4I3I A;  4H6J A;  5AVE A;  4DRT A;  3UMD A;  1KVL A;  4FTX A;  3GV9 A;  1BLH A;  2Y2K A;  3H7W B;  4GW9 A;  3NUL A;  3OPH A;  4C75 A;  5E2H A;  1YM1 A;  2JCH A;  1KDW A;  2QHK A;  1JTG A;  4HY8 A;  1KDS A;  5KZH A;  2JKR M;  4KZ9 A;  3KSF A;  2Y2H A;  4LV2 A;  1BT5 A;  2Q9M A;  5CEC A;  3BWL A;  3FWL A;  3SS3 A;  5TGF A;  1IYP A;  1G28 A;  3LGO A;  2XDM A;  3PBN A;  3LR3 A;  1GA0 A;  3MQQ A;  4CLC E;  5KSC A;  4FH2 A;  1ZTU A;  5GLC A;  2PBD P;  4BD0 A;  2B18 A;  2BTF P;  2XGN A;  4BEN A;  5HDS A;  3IX4 A;  5L10 A;  2L1M A;  5DFY A;  5DKK A;  3R7W B;  4GNU A;  2M7V A;  5CEB A;  3C4P A;  4WF0 A;  4Y3I A;  2QYB A;  1A0K A;  2W3D A;  2ZQ8 A;  2EX2 A;  3T4J A;  3AGE A;  2XD5 A;  5AQA A;  4EER A;  3C4O A;  3IQA A;  4HJ6 A;  1YLT A;  3Q1F A;  2V1A A;  2PDR A;  4HP9 A;  1IKG A;  3GMW A;  1JVJ A;  1NYM A;  3MJQ A;  3WS1 A;  2P08 A;  3CIT A;  2D01 A;  2XH9 A;  3UE6 A;  3MS6 A;  1VB6 A;  3EEH A;  1UWN X;  2V2F F;  1ODV A;  2W3F A;  5HWV A;  5AQ7 A;  3LID A;  4KG2 A;  1YPR A;  5A91 A;  1YSQ A;  4KQR A;  2CMN A;  3GVB A;  3CHW P;  2ZMA A;  1Q2P A;  1EWZ A;  2XEP A;  3UPO A;  2O9A A;  4Q0J A;  1JWV A;  2IWC A;  4DMZ A;  3A0S A;  5FEG A;  3S7P A;  5FAO A;  4O01 A;  3IXD A;  3VV4 A;  1XXM A;  4P6Z S;  4WZ4 A;  4P6B A;  3SW1 A;  3ZG5 A;  1OTE A;  1K0K A;  5E2G A;  1PFL A;  2G7U A;  3IXB A;  3BQA A;  4NK3 A;  2ZD8 A;  4P85 A;  5F68 A;  1XP4 A;  3V67 A;  2P74 A;  4CLC C;  1N9N A;  4DE0 A;  1KOU A;  4HBU A;  1EI5 A;  1FSW A;  2OSU A;  3TW8 A;  3MQO A;  3LR4 A;  2JC7 A;  3UB9 A;  3IBJ A;  4S2N A;  1HTZ A;  3PXP A;  1JNU A;  1XJ6 A;  1UWP X;  3QP2 A;  3UPP A;  2I72 A;  4PM9 A;  4QJG A;  1NXY A;  1K4F A;  1ALQ A;  4JKT A;  1LI9 A;  4GB7 A;  4KZ7 A;  4JXV A;  1YLW A;  3JVV A;  3MR0 A;  1NZU A;  4GS9 B;  1TS8 A;  1ERM A;  3QP1 A;  3A0R A;  5CX7 A;  2G2W A;  1K25 A;  5IT5 A;  3WS5 A;  1QME A;  3FG8 A;  1MWS A;  3BQ8 A;  3Q82 A;  3IF5 A;  4GDN A;  2PU4 A;  3WWX A;  3A3F A;  1QMF A;  1ES4 A;  3HJI A;  2GJ3 A;  4ESP A;  4E3M A;  3A3E A;  4DN0 A;  3F1O B;  5CER A;  3W2Z A;  1H3Q A;  2X02 A;  1T1C A;  2ZMF A;  4LEN A;  3RXX A;  4OP5 A;  4MBK A;  2WUQ A;  4UAA A;  3UN7 A;  2VV6 A;  3I7J A;  4NXB A;  3F1P A;  1Y4O A;  1T19 A;  5F5Y A;  3LR5 A;  1GSV A;  1S6R A;  2A24 A;  3ZGA B;  1CK3 A;  1OPX A;  4GZB A;  2PYP A;  5EE8 A;  5FQ9 A;  3HJK A;  4PHT A;  1G6O A;  4Y15 A;  1W63 Q;  4EUZ A;  1CEG A;  4GCZ A;  1OME A;  2OLU A;  2WYX A;  2PT7 A;  1GHM A;  5HX9 A;  2W3G A;  3C2W A;  3RFB A;  1CEF A;  3S1Y A;  3ZVW A;  3ZCZ A;  3JVU A;  4CJN A;  3LFV A;  1F2K A;  3WRZ A;  3DWZ A;  3DTI A;  2WZZ A;  1NRF A;  2ZOH A;  4E3K A;  5E43 A;  4GDB A;  2QZ6 A;  4QU3 A;  3ISG A;  3LY3 A;  3U4L P;  4BBT A;  5GLA A;  4WMC D;  3IWI A;  4EQ1 A;  5DF7 A;  5DVA A;  2QWS A;  2G2U A;  4S2J A;  4B4Z A;  3E98 A;  1I2S A;  3PAG A;  5IS1 A;  4MN6 A;  2ZQ7 A;  4S2I A;  3W8K A;  4OPZ A;  1L2S A;  1H5X A;  2J3W A;  5FAP A;  4JF5 A;  1MKM A;  3BLM A;  3ZVT A;  5D3O A;  3WRT A;  1FSY A;  3MKE A;  3M6H A;  3DTK A;  2XFS A;  4HH3 A;  3B47 A;  4FUW A;  4GN2 A;  2HGV A;  1FQG A;  4IUK A;  4ZAM A;  4OPQ A;  4D60 A;  2HDU A;  3UDX A;  5FQJ A;  2IWD A;  1D7E A;  5FSR A;  3T1R A;  2ZL1 A;  5HDD A;  4GD6 A;  3PTE A;  3CPT A;  3Q81 A;  1X0O A;  1DY6 A;  1IEL A;  1YLJ A;  1S67 L;  2C6W B;  5TBM B;  4R3B A;  4RYE A;  2QMI A;  2WKP A;  2WKH A;  1MBL A;  4MDZ A;  3T50 A;  4ZBE A;  3UPN A;  2HV1 A;  3DAV A;  3ZG7 B;  3SH7 A;  3ICY A;  4LCL A;  2W27 A;  3EEA A;  4Z9Q A;  4B9O A;  1ES3 A;  4MBF A;  1K56 D;  3E2K A;  3T1X A;  2FZ0 A;  2ZQD A;  1VHM A;  3M6B A;  3IS2 A;  3MMH A;  5FI7 A;  4I3J A;  1PNE A;  2X01 A;  3LY4 A;  3NOU C;  1ES2 A;  3D9Y A;  3ZG9 B;  3QNC A;  3KYZ A;  1KVM A;  2HZ5 A;  4QY6 A;  3H82 B;  2VK3 A;  3DBA A;  4N9K A;  4S2L A;  3DTM A;  4JF4 A;  4R23 A;  4F3L B;  3NC8 A;  4KQQ A;  4KZ4 A;  4KEN B;  4LRX C;  4WL9 A;  4N9L A;  4KZ6 A;  1BLP A;  3LCE A;  4XT2 A;  5HFO A;  4WLA A;  2OOL A;  3RJU A;  2Y2M A;  3OC2 A;  3TRC A;  4MNR A;  1GSW A;  2J9P A;  2VV7 A;  1ACF A;  2WGW A;  2W0N A;  3N4I A;  1IYS A;  4OVD A;  2HP9 A;  2EX6 A;  3OOV A;  4JLF A;  4NXF A;  4WEL A;  5FQI A;  4PM7 A;  3R7W A;  2JKF A;  4DJ3 A;  3SH8 A;  5G4Y A;  2PU2 A;  2HPB A;  2B02 A;  2R9X A;  3CWF A;  5LBR A;  1YSP A;  2XA7 S;  5BOH A;  3A3D A;  3JPU A;  4MN7 A;  2B95 A;  3VMA A;  2ZC7 A;  4Y17 A;  1VEU A;  3KYE A;  4R4R A;  3T4T A;  3BJN A;  1I5Q A;  4A5R A;  4LV3 A;  3VOZ A;  4R3A A;  1KGF A;  4E6W A;  1TEM A;  3CUE C;  1WYC A;  4ZJ3 A;  3NDG A;  1IEM A;  3FZC A;  1CF0 A;  5EVI D;  1IYQ A;  3PBT A;  4B4X A;  2ZQC A;  5DF9 A;  4O8G A;  2EWW A;  5EUA A;  1GA9 A;  1UGU A;  3BFE A;  3MZE A;  3NOP C;  3ZFZ A;  2P04 A;  4NXE A;  2JHE A;  3O88 A;  4WYY A;  3AGD A;  3IH8 A;  2O0Y A;  2ZQA A;  4LRZ E;  2IA2 A;  1DP6 A;  3ZG8 B;  3A0V A;  5GHY A;  1YAX A;  4WZ5 A;  5J8X A;  4B88 A;  3FKV A;  2RL3 A;  1K55 C;  1ESU A;  3FKW A;  4YNR A;  2ZM2 A;  2PBY A;  3A3I A;  3NOT C;  4Q0I A;  4HOI A;  2W3H A;  1XFN A;  2P9V A;  3ZG0 A;  4FD8 A;  4ZRR A;  4LGW A;  1K54 A;  1W63 M;  3P98 A;  1LSX A;  1FCO A;  4EEU A;  4PPR A;  1HVB A;  2OWJ A;  3EQV A;  2HJE A;  1H8M A;  3LEZ A;  4IUH A;  1IOU A;  3G31 A;  3PAE A;  4EU0 A;  4DDS A;  1ZKJ A;  1HLU P;  4G3V A;  3C7U A;  2HP6 A;  1O7E A;  3DWK A;  4L0L A;  2Y91 A;  5EVL A;  5HDC A;  1TS7 A;  3RXW A;  5DJT A;  1PYY A;  2I9V A;  4HBT A;  1F98 A;  4Y0U A;  1NY0 A;  3HLD A;  2UWX A;  4IED A;  3BFF A;  2DMW A;  1N4O A;  4L9E A;  3UME A;  3NDE A;  1AWI A;  2EX9 A;  4M4X A;  3HVF A;  5M19 A;  3QP4 A;  1NZO A;  3D4F A;  3T4K A;  2VV8 A;  3HLC A;  3UE1 A;  2VKS A;  3T4Q A;  1MY8 A;  1MXO A;  4EXO A;  2EFU A;  1TD5 A;  5DTK A;  3VP0 A;  5FQM A;  1XGJ A;  3VFF A;  1RGY A;  1LHY A;  2WKE A;  1BUE A;  3GTC A;  2GZA A;  2Y4A A;  5FAQ A;  3UB8 A;  1OTA A;  5G4Z A;  1Z6F A;  5EFW A;  1OT9 A;  1ERO A;  3GRJ A;  2VGJ A;  3PBR A;  1SDE A;  3F1O A;  2V0W A;  3L9K A;  5L2F A;  1LL8 A;  3R4K A;  1CJF A;  1YMS A;  3MKF A;  1YQS A;  1E3U A;  1FOF A;  4KQD A;  2Q0O A;  5A90 A;  4EES A;  5F83 A;  4BD1 A;  3HCY A;  1NLY A;  4UHU A;  2KDK A;  4HES A;  3PBS A;  4QWO A;  4QPR A;  3BEB A;  1W79 A;  5HL1 A;  4X68 A;  2EX8 A;  3VOL A;  3TE8 A;  3C8C A;  3Q7V B;  1L0G A;  3NHQ A;  3ZNT A;  2FFY A;  3ZDJ A;  1KGG A;  3MZF A;  2RCX A;  3S4X A; 
#chains in the Genus database with same CATH homology
 5HWT A;  4HQA A;  2J80 A;  4GCZ A;  2BAS A;  3FC7 A;  3F1P B;  2PT7 A;  2VEA A;  4EUV A;  2W3G A;  2A2L A;  4BBV A;  4OOM A;  3C2W A;  3UB6 A;  3RFB A;  1XJ3 A;  3D3O A;  1V9Y A;  1OT6 A;  3LYX A;  2A24 B;  3OLO A;  4IHQ A;  3H9W A;  3MXQ A;  3JVU A;  5FL3 A;  1OTB A;  3LFV A;  3BW6 A;  5HWW A;  1N9L A;  3P01 A;  4ARZ B;  2ZOH A;  5J4E A;  2ZBB A;  3PR6 A;  4I5S A;  4Y2F A;  2KLI A;  2VJW A;  4HHD A;  3GDI A;  2INW A;  4BBT A;  4EQ1 A;  3D72 A;  2QWS A;  3G6O A;  2J3T D;  3K3C A;  4UQI M;  2VLG A;  2NUT C;  3E98 A;  5DKL A;  3KSI A;  4NEE D;  5IS1 A;  3FPW A;  3LUQ A;  4MN6 A;  4JGP A;  4HP4 A;  2PR6 A;  3S7Q A;  2J3W A;  5F6A A;  3VE3 A;  2JKT I;  2O99 A;  1XJ2 A;  4I38 A;  2O9B A;  4G3K A;  2O9C A;  4WEK A;  1LSW A;  3PYP A;  4UEY A;  1MKM A;  2NUP C;  3MFX A;  2PD8 A;  2ZOI A;  2XA7 M;  4ME4 A;  5HD3 A;  3LI8 A;  4HJ3 A;  4MCW A;  2P7J A;  5A8B A;  1V9Z A;  3LIB A;  4GHI B;  2Y8H A;  4II7 A;  5IU1 A;  4HH3 A;  3OCN A;  4HNB A;  3B47 A;  1STZ A;  5TJJ A;  3K2N A;  2HGV A;  2J3T C;  4IUK A;  3LIE A;  3LI9 A;  3RTY A;  2QJ5 A;  4I3A A;  4F3L A;  1F9I A;  3O5Y A;  3T4L A;  4BWI A;  1D7E A;  1XJ4 A;  5F69 A;  5L8M A;  1F5M A;  5HDD A;  4PAU A;  4G3W A;  2VA0 A;  1X0O A;  2MJ6 A;  4Z1W A;  3LR0 A;  4NKP A;  3CAX A;  1S67 L;  2R78 A;  5TBM B;  1YKD A;  1WA9 A;  2K2N A;  4BJP A;  4K08 A;  4HJ4 A;  2WKP A;  2HF6 A;  3KSH A;  2EA9 A;  2Y79 A;  5TBM A;  3MF0 A;  4MDZ A;  4OOL A;  2FH5 A;  3T50 A;  4GHI A;  4CLC B;  2HV1 A;  3ICY A;  2W27 A;  3LIF A;  2W3E A;  3C30 A;  5AVF A;  3EEA A;  1T1A A;  4GS9 A;  2PR5 A;  1NWZ A;  2WKQ A;  1TF1 A;  4B9O A;  4CLC A;  1MZU A;  3MQ0 A;  2OWH A;  4HH2 A;  1DRM A;  2FZ0 A;  2YKH A;  1VHM A;  3MMH A;  1LT0 A;  3IS2 A;  2OAP 1;  4HI4 A;  4I3J A;  4O0P A;  3CLO A;  4UQI S;  3NOU C;  4WN5 A;  4YWZ A;  3KYZ A;  5HPI A;  4EEP A;  4B93 A;  3H82 B;  4JGQ A;  3DBA A;  3BY9 A;  2OAQ 1;  5HL6 A;  3H82 A;  4F3L B;  2QJ7 A;  1TS6 A;  2PHY A;  2W1T A;  4JGO A;  3K3D A;  4AFI A;  4CQH A;  3GEC A;  1T18 A;  4LRX C;  4BBU A;  2XSS A;  4WL9 A;  4XT2 A;  5DJU A;  5C5K A;  1IFQ A;  2VZW A;  4I3I A;  4WLA A;  4H6J A;  2OOL A;  5AVE A;  2K31 A;  3OC2 A;  3TRC A;  3UMD A;  1GSW A;  4I39 A;  3H7W B;  4GW9 A;  2VV7 A;  2GX5 A;  4EW7 A;  2W0N A;  1NRJ A;  4KUK A;  1DP8 A;  1OTI A;  2QHK A;  5DFX A;  1GSX A;  3OOV A;  4MN5 A;  4HY8 A;  4NXF A;  4WEL A;  2KX6 A;  2JKR M;  3KSF A;  4YOF A;  3F1N B;  3R7W A;  1DP9 A;  4DJ3 A;  3U2A A;  4ARZ A;  5G4Y A;  3BWL A;  2B02 A;  3CWF A;  4KUO A;  5LBR A;  1YSP A;  2XA7 S;  2Z6D A;  3C38 A;  2YKF A;  4WEJ A;  3EQU A;  1G28 A;  1BYW A;  4MN7 A;  3EGX C;  5MC7 A;  3PBN A;  1S66 L;  4P6Z M;  2H28 A;  4FSF A;  3LR3 A;  5HSQ A;  3MQQ A;  4CLC E;  2L0W A;  1ZTU A;  4R6L A;  2GNX A;  2PD7 A;  3T4T A;  2B18 A;  3BJN A;  1NLZ A;  5AJG A;  4GJ4 A;  5I5L A;  4DJ2 A;  5HDS A;  2L1M A;  3B33 A;  3T4O A;  4Y5F A;  5DFY A;  5DKK A;  4R3A A;  3F1N A;  3R7W B;  2VGL M;  3LIA A;  2M7V A;  3CUE C;  5HZH A;  4WF0 A;  2QYB A;  4Q0H A;  4Y3I A;  3CUE A;  2W3D A;  3T4J A;  1S4R A;  3E4O A;  3IBR A;  4EER A;  3PBT A;  4HJ6 A;  5DF9 A;  4O8G A;  2V1A A;  2EWW A;  2PDR A;  4JGR A;  1UGU A;  3PBQ A;  3NOP C;  4HP9 A;  4PKY G;  4L9F A;  3UB7 A;  1XFQ A;  3MJQ A;  1EW0 A;  2P08 A;  3CIT A;  3KYQ A;  2P04 A;  4NXE A;  2JHE A;  2D01 A;  2EWV A;  2O0Y A;  3UE6 A;  4LRZ E;  2M7U A;  4E04 A;  2IA2 A;  4RQ9 A;  4LPZ A;  4WUJ A;  1VB6 A;  1DP6 A;  4HIA A;  3A0V A;  5J7E A;  3EEH A;  1UWN X;  1YAX A;  3P7N A;  4BMW A;  4R38 A;  1ODV A;  2W3F A;  4R70 A;  1S1Y A;  4MMN A;  3VE4 A;  5HWV A;  4YNR A;  1OJ5 A;  3LID A;  3PBO A;  3ULF A;  2V1B A;  2VGL S;  3NOT C;  4HOI A;  2W3H A;  1XFN A;  4Q0I A;  3KX0 X;  1YSQ A;  2CMN A;  4ZRR A;  2M1C A;  2VX8 A;  1W63 M;  1LSX A;  4EEU A;  3FPV A;  3E0Y A;  2K7S A;  4KQO A;  2O9A A;  3E4Q A;  4Q0J A;  4DMZ A;  2OWJ A;  3A0S A;  3EQV A;  2HJE A;  3EWK A;  5HD5 A;  3S7P A;  1H8M A;  4O01 A;  4IUH A;  1IOU A;  4L9G A;  3KSG A;  4EU0 A;  4G3V A;  3VV4 A;  3E4P A;  4P6Z S;  5HPF A;  3SW1 A;  4IJG A;  4L0L A;  1OTE A;  3PHY A;  5HDC A;  1TS7 A;  3B42 A;  1MC0 A;  1S4S A;  2G7U A;  5DJT A;  3BQA A;  4H6J B;  4LRY C;  5F68 A;  2I9V A;  4ETZ A;  4CLC C;  3V67 A;  1F98 A;  1N9N A;  1KOU A;  2PYR A;  5K5B A;  2WKR A;  1Y28 A;  2DMW A;  3TW8 A;  3MQO A;  2Z6C A;  4L9E A;  1D06 A;  3TJZ C;  1S1Z A;  3UME A;  3LR4 A;  4CLC D;  2W1T B;  3UB9 A;  4M4X A;  3IBJ A;  2XRN A;  3ZYT A;  1P97 A;  3EOI A;  1N9O A;  5KSH A;  3PXP A;  3T4K A;  1JNU A;  1XJ6 A;  2VV8 A;  1UWP X;  3ZQ5 A;  3IS2 B;  4NXG A;  1TS0 A;  5J3W A;  2VKS A;  3T4Q A;  4GLQ A;  2V0U A;  1P9R A;  4EXO A;  1TD5 A;  2JKT M;  3KO6 A;  2QKP A;  3JVV A;  3MR0 A;  3OBF A;  4GS9 B;  3S7N A;  1TS8 A;  3A0R A;  5CX7 A;  2GZA A;  3UB8 A;  5IT5 A;  3BY8 A;  1OTA A;  1OTD A;  5G4Z A;  5KIZ A;  4PKY A;  5EFW A;  1OT9 A;  3FG8 A;  3BQ8 A;  4ETX A;  3EGD C;  3PBR A;  3LIC A;  1T1B A;  2LB9 A;  2HJ9 C;  3F1O A;  2W1R A;  2L4R A;  2V0W A;  3HJI A;  2GJ3 A;  2JN7 A;  1ZHH B;  3NJA A;  1LL8 A;  3R4K A;  2V9A A;  4DN0 A;  2KOI A;  3F1O B;  1P0Z A;  3CI6 A;  3W2Z A;  2D02 A;  4KQD A;  1H3Q A;  1P9W A;  4FOF A;  4EES A;  1OJG A;  1T1C A;  2ZMF A;  3HCY A;  3UE3 A;  1NLY A;  2KDK A;  3PBS A;  3H7W A;  4QPR A;  2VV6 A;  4NXB A;  3F1P A;  4EET B;  1T19 A;  5F5Y A;  3T4S A;  3LR5 A;  1GSV A;  3VOL A;  3TE8 A;  2A24 A;  3OCL A;  3C8C A;  2JKR I;  3NHQ A;  1OPX A;  2LB5 A;  1LSV A;  2XRO A;  2PYP A;  3S7O A;  3HJK A;  4PHT A;  2ZMV A;  4XT2 B;  1G6O A;  1W63 Q;  3RH8 B;  4LLO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...