3OBFA

Crystal structure of putative transcriptional regulator, iclr family; targeted domain 129...302
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
b'SNAEERRVAYPVLRELTERTGETSALMVWNGNESMCVEQIPSRHQVKHLAPLGARYNEALSSSVQVFLASENEDRVRQLLRSGSITLTGVDEDAVEAYLLRLKESMERGWAVNFGETSIEEVGVASPVYDHRGNMVASVLIPAPKFRVSQDTLNSLGEACAAAAAKVTTRLGGRAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator, IclR family
publication title Crystal structure of putative transcriptional regulator, IclR family; targeted domain 129...302
rcsb
source organism Arthrobacter aurescens
molecule tags Transcription regulator
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3obfA00
2O0YA 5C5KA 5HPFA 2W1RA 3S7NA 2KOIA 2M7VA 4R6LA 4R70A 3NHQA 2G7UA 2GX5A 1YKDA 4IUKA 4LRXC 3W2ZA 4Y2FA 1TD5A 3BJNA 3D3OA 5HPIA 3LFVA 4MDZA 4DMZA 3HCYA 2VJWA 5AJGA 4MMNA 2K2NA 2W3HA 2XROA 4Y3IA 2HGVA 3ZQ5A 4IJGA 3R4KA 3NOUC 4Q0HA 1VHMA 2VZWA 4G3WA 2M7UA 2IA2A 4MN7A 2B18A 3KO6A 1MKMA 3K2NA 3G6OA 3C2WA 5HL6A 4Y5FA 2OOLA 4Q0JA 2O9CA 3OOVA 2W3EA 3MQ0A 1MC0A 4Z1WA 5HSQA 2QYBA 2W1TB 3CITA 2Y79A 2O9BA 3VV4A 1YSPA 2XRNA 3E98A 3S7QA 2KLIA 2K31A 2LB5A 1TF1A 4Q0IA 4YNRA 3O5YA 3KSGA 4MCWA 4LRYC 4EUVA 2VKSA 4O8GA 4G3VA 3DBAA 3CI6A 3EEAA 5L8MA 3S7OA 4ME4A 2XSSA 2VEAA 4RQ9A 3OBFA 4QPRA 2Y8HA 3KSFA 4GLQA 3KSIA 4ETZA 3NOPC 4EU0A 2W3DA 5LBRA 5I5LA 3TRCA 4O0PA 5DFXA 4ETXA 4FOFA 4YOFA 2O9AA 4BWIA 3E0YA 4CQHA 3MMHA 4DN0A 2W1TA 3KSHA 4ZRRA 1F5MA 4O01A 4E04A 2ZMFA 4G3KA 2W3FA 3IBJA 3S7PA 3RFBA 5K5BA 3MF0A 1ZTUA 3IBRA 4PAUA 1STZA 1YSQA 4LRZE 2W3GA 4GW9A 5TJJA 3NOTC 2LB9A 5DFYA 2O99A 4IUHA
chains in the Genus database with same CATH superfamily
4H6JB 3T1XA 2XR0A 4DE2A 2H5SA 4R70A 3RJUA 3A3EA 4L0LA 1YLJA 3G30A 3P98A 1S1ZA 3DTIA 3BQ8A 3LY3A 4HI4A 3SZTA 2K2NA 3T4KA 1Q2PA 4HBTA 4Q0HA 1FILA 1LSXA 5F69A 4IEDA 2B18A 3C4PA 1WA9A 3C2WA 1VB6A 5HL6A 4EQ1A 1RP5A 2PR5A 2PR6A 1KGFA 4JXVA 5FQQA 3PYPA 1F98A 3UO9A 2Z2LB 4OONA 4MNRA 5GHZA 4HP4A 2EX2A 5DTSA 3O5YA 3UB8A 3F1PB 2DCFA 1NYYA 1HTZA 1LI0A 2HDQA 1G5UA 1KE4A 3N8LA 1LL8A 2PBDP 4UEYA 1W8QA 4HJ3A 4FH2A 4CQHA 5A90A 4WEKA 5L10A 3N6IA 4FUWA 3TJZC 4R0QA 1H8MA 4X68A 5DKLA 4HH3A 4LRZE 4E3NA 1CK3A 1AWIA 5F83A 3LIFA 3EOIA 5HPFA 5EOEA 4B4ZA 4PKYA 3W4QA 3PBSA 4EV4A 4MDZA 5G4YA 3BY9A 3FZCA 5AJGA 1PFLA 3BEBA 5HWVA 3TOIA 2V20A 4E3IA 1NRFA 2OLUA 3M6HA 5EVIB 1QMEA 2HDUA 2PRFA 3SS3A 2IA2A 4HOIA 3SH8A 1S1YA 2XA7M 5GLCA 4HH2A 3ZNTA 1XA1A 1H3QA 3T4JA 1CQAA 2XGNA 2EX9A 2Y2NA 2QHKA 2EX6A 3UE3A 5F68A 3MFDA 3M2KA 4BD1A 2ZLYA 1OPXA 3VSLA 1SKOB 2JKFA 5HAQA 3B47A 2QPNA 3IXHA 4PKYG 1S4SA 3VP2A 5I94A 4B9OA 1N9OA 5CGXA 2Z6CA 4S2PA 2EA9A 4YOFA 3HLGA 4BWIA 2HDRA 3CPTA 4E6WA 4ZRRA 4IVIA 5EM1A 2E8JA 3AGFA 4O01A 5EVIA 2ZD8A 4X53A 3BRMA 3GDIA 3RFBA 3MZFA 3MF0A 2XK1A 2P08A 2Y91A 4K0XA 4PAUA 1W5DA 2I9VA 3HREA 2ZC4B 5E43A 3VP1A 5FI6A 2PAVP 4GKUA 5C5KA 3F1OB 1ES2A 2WK0A 1Q2QA 5FA7A 2ACGA 1YKDA 2ZM8A 3ZDJA 2ZM2A 4Y2FA 3HLEA 1W79A 5HL1A 5CERA 3MQOA 1VETA 5MC7A 4C75A 2J3TD 3HLDA 3AGDA 1ZKJA 3Q82A 1ES4A 3LY4A 1S67L 2OWJA 3VOZA 1XJ4A 4IBXA 2X01A 3G6OA 4PHTA 2HDSA 4MLLA 2B5RA 5A92A 4D2OA 2CC1A 3DWKA 2QYBA 2EWVA 1V9YA 4HESA 4QY6A 2R78A 2L0WA 1MBLA 3CMZA 5DF9A 2W0NA 3BLMA 3T1QB 1OMEA 3E4OA 4S2IA 5EVEA 1CI9A 2FFFB 3F1OA 2ZQCA 3T50A 3RTYA 1RGZA 3EEAA 1T19A 3NDEA 3Q1FA 5F6AA 1ZG4A 4OPZA 2P7JA 5CGWA 2Y8HA 3KSIA 2BLSA 3JYIA 4EU0A 4ETXA 4LV3A 3ZVWA 1PWGA 4JGRA 4JLFA 1GHMA 1ERQA 4LV0A 4DE1A 2J9PA 2WAEA 3E4PA 3LI8A 2V0WA 3MXQA 3BM6A 4GJ4A 4B93A 3QP4A 3VP3A 5EE8A 3FC7A 4KG2A 2LB9A 4GB7A 1ES3A 2W27A 3FPVA 4KZ6A 5G4ZA 5EVIC 4UA6A 5U47A 2DRWA 4R6LA 3W4OA 4KZ8A 1YLTA 1MWUA 4KZ7A 3HCYA 2B95A 3H82B 4LENA 1CEFA 1LL5A 4BD0A 2VGLM 3T4TA 5AQ9A 4MN7A 4F94A 4GS9B 5HX9A 1H8ZA 3A0SA 2X71A 4UQIM 1MC0A 4OOLA 3RXWA 3VE4A 2HP9A 2R9WA 4GOGA 3PR6A 1ALQA 1TS8A 1G28A 1PI5A 2Y2LA 2P9VB 3LR5A 3ITBA 4PM7A 1DJCA 3MS6A 3DWZA 3A0VA 3CHWP 3UE0A 5CXWA 5HAPA 4OH0A 1IOUA 1FCNA 5EFWA 4DF6A 3EGDC 4GHIB 5DFXA 5EOOA 1OJ5A 4N1XA 2PYRA 4KG6A 3KYZA 3H82A 3O86A 2ZMFA 2OV5A 2XQZA 1TS7A 3HLCA 4PM9A 2YKFA 2Y2GA 5FI2A 4BJPA 4MBFA 4KZ3A 1OJGA 1N4OA 1ZG6A 1EROA 4IUHA 3D9YA 2D01A 1AXBA 3IXGA 5FEGA 4EESA 4DDSA 4K08A 4EBPA 5HD5A 3LCEA 4HJ6A 2OAQ1 1KE3A 2QJ7A 4R3JA 3A3IA 3WS2A 1KE0A 2W3HA 2GDNA 5J3WA 4IJGA 5TBMB 5L2FA 1VHMA 3HJKA 1DJBA 3IWQA 4FH4A 3G2ZA 4M3KA 4PM6A 4GHIA 4MBHA 3GVBA 4LGWA 3LUQA 4EWFA 2O9CA 1BSGA 3UPPA 5HSQA 2ZC6B 2WGIA 3LR3A 1CJFA 2NUTC 1K55A 4WZ5A 3WWXA 1OT6A 3BFFA 3V50A 3CITA 2PU2A 3NCKA 4LCMA 4QU3A 3BFEA 4F3LB 1FR6A 1LI9A 3C7VA 2K31A 4Q0IA 3V3RA 4CLCE 4MCWA 1BT5A 2B02A 3PBTA 3NECA 2WKPA 3S7OA 4ZJ3A 5IU1A 5J8XA 2ZMVA 1J9MA 4X1LA 5LBRA 5DVAA 3LI9A 2J3WA 1IYOA 3MJQA 4A5RA 3MXSA 3QP8A 4NXBA 5EECA 1CEGA 1N9BA 2H10A 4R3BA 4XUXA 1MWTA 3IBRA 3KX0X 1FSYA 4ZTKA 5AQBA 1W63Q 2BASA 1JNUA 5FEFA 3UPNA 1BZAA 2ZC5B 4EERA 5FQKA 2KOIA 5A91A 1H5XA 2ZQ8A 4OQHA 1ERMA 3VFFA 4F3LA 3C8CA 2OAP1 3B33A 4IUKA 3WRTA 3HLWA 4Y0OA 4RVAA 2VK3A 1D7EA 1N9LA 5EVLA 4X69A 3S4XA 1CI8A 2ZL1A 1G6OA 4MMNA 2XROA 3PBNA 5GLAA 4ZAMA 5FQMA 5KIZA 3CJMA 1YM1A 1HLUP 4BMWA 2FH5A 5TR7A 3K2NA 3IS2A 1I2WA 4Q0JA 4OQIA 2VLGA 4Z1WA 1P9WA 5DF8A 1XA7A 1YAXA 5KSHA 3FPWA 3IF6B 3BFGA 2I72A 3UE6A 2Q9MA 5FL3A 5EVID 4R4RA 4EEUA 4JF5A 3FV7A 3D72A 4I5SA 2ZM0A 3CWFA 4WZ5C 1K55C 1XJ6A 3K3DA 5DKKA 3DBAA 4KZAA 4Y15A 3T4OA 2Z2MB 2XSSA 2XH9A 4WMCA 3KSFA 4ID4A 5HWWA 4LV1A 3KYEA 3CZDA 3AGEA 2J8YA 4BENA 1PIOA 2DMWA 3P01A 3NIAA 1VQQA 1NLYA 1ZTUA 3OLOA 4Q8IA 3IHBA 4GW9A 4EXOA 3T1SA 2Y59A 4JXGA 3NOTC 3LGOA 4GD8A 3VMAA 5E2HA 4HP9A 1C3BA 1T1BA 4RYEA 5J4EA 3IF6A 2UWXA 1L0DA 4KUOA 2R9XA 2VV8A 4S2KA 4I38A 1TD5A 5CX7A 2P74A 4ZBEA 3C4OA 4EBLA 4R4SA 3Q7ZA 2XFTA 1TS6A 4WLAA 4EBNA 2WKQA 4P6ZS 3A0RA 3FKWA 2VZWA 3NOUC 3T4SA 1YLYA 2K7SA 3UB6A 3L9KA 2EFXA 2OOLA 1GHIA 5E2EA 2JC7A 1YQSA 2A24A 3IH9A 5HARA 4KZBA 2X02A 4DJ2A 3CPTB 3F1NA 3I7JA 4GCZA 4EQIA 1DP8A 1YMXA 5F1GA 5F5YA 3PBQA 1NLZA 3TSGA 2PD8A 3OCNA 3HUNA 4WELA 3VP4A 2A3UA 5CGSA 3QP6A 4JGOA 3CI6A 4ME4A 1UGUA 3NI9A 1GHPA 2Y2KA 4L9FA 1BLSA 1K56A 1HZOA 2V0UA 2O9AA 3MMHA 3PTEA 1P0ZA 1MY8A 1OTBA 3OC2A 4N1HA 3ZVTA 1F5MA 4LCLA 1S0WA 4I3JA 1VETB 1A0KA 1JVJA 1IKGA 1LT0A 3TW8A 2WUQA 1KDSA 3WS5A 3E4QA 1UWNX 3T1RA 4XT2A 5FI7A 4Z9QA 1OTAA 1TEMA 2C5WB 2C6WB 3LIDA 3S1YA 2AVXA 3O88A 4X6TA 2H0TA 2Y55A 2PT7A 2QKPA 2GX5A 1DP6A 3EWKA 5CEDA 2JKRI 4X25A 5CEBA 2VJWA 3IF6C 4FTXA 4ZJ2A 3ZQ5A 5FQ9A 3QP5A 2HP6A 3N4IA 4GDNA 3NDGA 2RL3A 5EV0A 1FSWA 2EXAA 3LIEA 4S2OA 1K6SA 4KQOA 4D60A 1FOFA 4OVDA 4HNBA 1NY0A 3P7NA 1VEUA 3VV4A 4S2MA 4MN5A 4JGQA 4OOYA 1SDNA 4FCFA 4KUKA 5AQ7A 1Y28A 4ZJ1A 3UDIA 3KSGA 1KDWA 3UPOA 1PW1A 2HZ5A 4DE0A 3H7WA 5KMWA 3UMDA 1MWRA 5HDDA 2V9AA 4BBTA 2W3DA 2PU4A 5CHMA 2W1TA 3UB5P 4AFIA 1H8YA 2IWBA 4JXWA 4BBUA 1PWDA 2JHEA 2KX6A 1JTDA 1STZA 3IHAA 2VA0A 1YLWA 3MKFA 1OT9A 1SZVA 3MKEA 4KQRA 1JWZA 2EFUA 4GDBA 4OKPA 4PMAA 3GECA 3M6BA 1EI5A 4NXGA 2JKTM 3UNWA 3LFVA 4B88A 1LSWA 5G18A 3MXRA 4E3JA 5E2FA 1YMSA 4DXBA 3FKVA 4Y0UA 1FQGA 1OTEA 2ZJ9A 2RCXA 2JKTI 2Q0OA 1ESIA 3QP2A 4ZDXA 1DJAA 3ZG8B 1YT4A 4OOMA 5J7EA 1Y54A 5TGFA 4KZ4A 1CF0A 2EWWA 1N9NA 2IWCA 5HDSA 2WGWA 4C6YA 3CUEA 2XRNA 1NJ4A 1T18A 1GA0A 4JKTA 1DY6A 5JYOA 3VOLA 2HF6A 2ZQAA 3UB7A 2E8IA 4JXSA 1NZUA 5CTNA 3PHYA 3QHYA 3U4LP 5JYPA 4EW7A 3BFCA 3SOIA 4DN0A 3KSHA 4CLCA 4U0TA 2V1AA 4HJ4A 4E6XA 2WZZA 4XUZA 1E3UA 5L07A 2W3GA 3LICA 3OZHA 4MBKA 3E2LA 1ONHA 3BY8A 2H0YA 3S7NA 4WZ4A 2G7UA 1JWPA 3EQVA 4N9KA 4LV2A 5CRFA 3OPLA 3R7WA 2J9OA 5F82A 3PAGA 3LIAA 3BW6A 4WM9A 1SKFA 1XX2A 2XD5A 2ZOIA 4ARZB 1MZUA 3N8SA 4OLGA 3ZYTA 4KZ5A 4HIAA 3MQ0A 2WAFA 4Y0TA 2OWHA 3SH7A 4OQ0A 3CAXA 5FDSA 4EETB 1LL9A 2XFSA 4R3AA 2ZC7A 1EWZA 4RA7A 1SCWA 3GRJA 2MJ6A 4BBVA 1NRJA 3CG5A 5FQIA 2ZQDA 4OP5A 4DJ3A 5EM0A 1E25A 3UDXA 3A3JA 3GQZA 1EW0A 2ZQ7A 1PI4A 5DF7A 5A8BA 3P09A 2V8FA 5I5LA 1J3WA 5GHYA 1XFNA 3ZHHA 3LO7A 5KZHA 1K38A 4DXCA 3OPHA 1LHYA 3ZNYA 5CHJA 5AQAA 2V2FF 3GV9A 2PD7A 2ZL1B 4NETA 3BFDA 4ARZA 2VV7A 1V9ZA 1L0EA 2Z6DA 4CLCC 4Y7PA 2J80A 5GL9A 3IX3A 1YPRA 3PBOA 3IS2B 2Y2OA 2EXBA 2W1RA 3NY4A 1U60A 1MPLA 3NHQA 2L4RA 3G4PA 4NXEA 4FSFA 2M1CA 4X55A 4LRXC 1RGYA 3BJNA 1W8YA 4JF4A 4WF0A 5DTKA 5FQJA 4DRTA 4P6BA 1SHVA 3IX4A 1FCMA 3BECA 1ES5A 4GZBA 2PHYA 4I39A 1L0FA 2JN7A 3ULFA 2OLVA 3ITAA 3JVUA 1P97A 4G3WA 4R1GA 3GR2A 1IFQA 1G68A 5HWTA 5HW3A 1K56D 3W8KA 2WKIA 3ZCZA 1DRMA 2Y2MA 3T4QA 1K0KA 1E4DA 3HLBA 4FD8A 5DJTA 4LPZA 2NUPC 5AVFA 5GLDA 4LRYC 4KZ9A 4EUVA 3MR0A 5AVEA 4UA9A 2VEAA 4PM5A 3DAVA 4QPRA 3C7UA 3TG9A 4O0PA 3SS4A 4QJGA 1GSVA 1L2SA 1O07A 2JCHA 3NJAA 4G3KA 2VGKA 2UV0E 3SW1A 3S22A 4OPRA 4P87A 4JBFA 2CMNA 3IX8A 4CPKA 4UAAA 1ZC2A 4S2LA 3LEQA 3ICYA 3BYDA 1TVFA 3V39A 4II7A 1P9RA 4QB8A 2A24B 5HFOA 4GNUA 1K25A 3F1NB 3TE8A 3M2JA 3V5MA 1PWCA 1ONGA 4EEPA 1IELA 1MKIA 2IWDA 3N8RA 1PZPA 3G2YA 4H6JA 3O87A 2WKHA 4H8RA 2XA7S 4LFUA 3OOVA 1ZHHB 3IH8A 4R38A 1BLCA 4L9GA 1T1CA 4C3QA 4HHDA 1TDLA 4YWZA 3GSGA 4N9LA 3L7HA 3IF5A 5FDHA 3UMEA 3LR4A 3CLOA 3B42A 3HJIA 3OPPA 2J7VA 1X0OA 2XLNA 4XT2B 3UY6A 5L8MA 3SS5A 1YLZA 4UHUA 2WKEA 4FOFA 3MSHA 4RX2A 1L3LA 1QMFA 2JBFA 3UB9A 2HPBA 5HAIA 2ZQ9A 1XFQA 5FASA 2HJEA 3EQUA 5K5BA 1XP4A 2Y2IA 2V8CA 1XGJA 1YSQA 4KQQA 1HD8A 5TJJA 3F1PA 5DFYA 2HJ9C 1K4FA 1BLHA 2ZMAA 1K54A 1GSWA 2ZOHA 3WS0A 5M18A 3ZG5A 5FAOA 1JWVA 4RX3A 1VM1A 2Y4AA 5CTMA 3W2ZA 1SDEA 3V3SA 2KDKA 4K91A 1VEUB 4IHQA 1M40A 4YINA 3JVVA 4L9EA 4BQMA 4E3KA 2INWA 2QZ6A 2JKRM 4P6ZM 4QHCA 3E2KA 3ISGA 3ZGAB 3VFHA 4WUJA 3ZFZA 1KOUA 1YLPA 1F2KA 3H7WB 1PW8A 3LEZA 4Y5FA 3LR0A 1Z09A 3UDFA 3BQAA 2Y2JA 3IWIA 5KSCA 1G6AA 1PNEA 4QD4A 2W1TB 2Y79A 3NULA 1GA9A 5E2GA 4CLCD 4O7DA 5FAPA 3G32A 4PM8A 3NBLA 2LB5A 1I5QA 5TFQA 1E3UD 4R23A 4E3OA 4G3VA 1FR1A 2WZXA 5EPHA 3OBFA 5GLBA 3SH9A 1ODVA 2XDMA 2GNXA 2JE5A 2L1MA 4HY8A 3HVFA 4DKIA 1PRQA 4WYYA 1BUEA 1L0GA 2GJ3A 2VGJA 2FFYA 2A49A 3IBJA 3ZG9B 1K6RA 4E3MA 4OP8A 1KVMA 4KG5A 1TDGA 1SKOA 3MFXA 4GN2A 3JPUA 2FZ0A 1XJ2A 3Q07A 3QP1A 1IYPA 1XPBA 1I2SA 2WYXA 4CJNA 3IWOA 4EUZA 3MBZA 1Z6FA 5FATA 1GSXA 3D3OA 2WGWB 3RXXA 2G2WA 4NG2A 3PBRA 3UN7A 2QWSA 1KVLA 1K54C 1XKZA 2PDRA 2VGLS 2WKRA 2Y2QA 3D4FA 3W4PA 3HBRA 5M19A 1LLBA 3KO6A 4HBUA 1MKMA 2D02A 2XEPA 3IXBA 1DP9A 3C38A 1KGEA 4QWOA 4UQIS 1UWPX 1ACFA 5M1AA 3MQQA 2G2UA 1S4RA 1W63M 4UA7A 4I3IA 4CLCB 1YSPA 3WRZA 3MZEA 3FYZA 4U3TA 4X1MA 1BLPA 3A3DA 4OQGA 4K0WA 3PXPA 1OTDA 4DDYA 3C30A 5GHXA 1IYSA 2VV6A 5FSRA 1S6RA 2JKGA 4QY5A 3TRCA 3DTMA 1WE4A 3QNBA 3LYXA 3E0YA 1NWZA 3NC8A 1W7FA 3HUMA 5DTTA 3G34A 1WYCA 1TS0A 2OSUA 2V1BA 4Y17A 1XGIA 2W3FA 3VP0A 3R7WB 5IT5A 4JPMA 1PYYA 1GCEA 5HDCA 3EEHA 4B4XA 2BTFP 1D1JA 2H28A 3IT9A 3O3VA 3T4LA 2XF3A 4BL3A 1K4EA 1FIKA 3HL9A 1HVBA 2XD1A 5HZHA 4IBRA 3LIBA 4XXRA 2QJ5A 1WYBA 5HPIA 3FG8A 4N92A 1MXOA 4DMZA 2Y2HA 1M6KA 4MEZA 1NZOA 4NKPA 1IYQA 1NYMA 4Y3IA 2HGVA 3FWLA 4WEJA 3BLSA 3EGXC 2M7UA 3VOYA 2VX8A 2YKHA 4PPRA 1XXMA 3BWLA 3N7WA 1H0MA 2W3EA 4S2JA 1BTLA 1MWSA 2EX8A 3Q7VB 3MZDA 4BL2A 1T1AA 3HUOA 3H9WA 4OLDA 2KLIA 4S2NA 1JTGA 4MN6A 5A93A 2PBYA 4NXFA 1TF1A 4YNRA 2HP5A 4WBGA 1ESUA 3OPRA 3ZG0A 5HD3A 5L09A 3GMWA 4GS9A 4WMCD 3QNCA 4KENB 4LLOB 4P85A 4RQ9A 4ESPA 3KYQA 4M4XA 2V1ZA 4IVKA 4GD6A 3RH8B 2WADA 1K57A 4E04A 5CECA 5IHVA 1IKIA 1BULA 1F9IA 3Q81A 2GZAA 4I3AA 3CUEC 2P9VA 4WL9A 4YFMA 4NK3A 4U0XA 2O0YA 3G31A 3HLFA 3Q7VA 1Y4OA 2QMIA 4HEFA 3B3XA 1O7EA 3IQAA 2M7VA 4NEED 1OTIA 3VSKA 4BLMA 5IS1A 3T12B 1S66L 1XJ3A 4WN5A 3R4KA 3IXDA 3WS1A 1NXYA 2HV1A 3C5AA 4E3LA 3UE1A 3ZG7B 4OPQA 2BG1A 4JGPA 3GTCA 2O9BA 3VE3A 3E98A 3S7QA 4Y13A 5CHUA 2PYPA 1PZOA 3U2AA 3A3FA 3DTKA 4X56A 5TBMA 5D3OA 4DE3A 2VKSA 1FCOA 1LSVA 2ZBBA 1BYWA 2Q9NA 4O8GA 1IEMA 4KQDA 5EUAA 5F1FA 4S2NC 4HQAA 2J3TC 4GLQA 3WS4A 2A2LA 4ETZA 3NOPC 5BOHA 2ZC3B 1RCJA 3DW0A 3OCLA 1D06A 3PAEA 3DTEA 2Y2PA 3S7PA 1KGGA 3G35A 5DJUA 3V67A 5FAQA 2WGVA 2DNSA 3K3CA 2P04A 2O99A 4OPYA 4P0MA 4JF6A 1K57C
chains in the Genus database with same CATH topology
4H6JB 2D01A 1GSWA 2ZOHA 4EESA 4R70A 3GECA 4L0LA 4K08A 4NXGA 3W2ZA 5HD5A 2JKTM 2KDKA 3LFVA 1LSWA 1S1ZA 4IHQA 4HJ6A 2OAQ1 2QJ7A 3BQ8A 4HI4A 3JVVA 4L9EA 2K2NA 2W3HA 2INWA 5J3WA 3T4KA 2JKRM 4IJGA 1OTEA 5TBMB 4Q0HA 1VHMA 3HJKA 1LSXA 2JKTI 4P6ZM 5F69A 2B18A 4WUJA 1KOUA 3H7WB 1WA9A 4GHIA 4OOMA 3C2WA 1VB6A 5HL6A 4Y5FA 5J7EA 3LR0A 3LUQA 2O9CA 4EQ1A 2EWWA 1N9NA 2PR5A 5HSQA 3LR3A 5HDSA 2NUTC 2PR6A 3BQAA 1OT6A 2W1TB 3CITA 2Y79A 3CUEA 3PYPA 4CLCD 1F98A 2XRNA 4F3LB 1T18A 2K31A 4HP4A 2LB5A 4Q0IA 3O5YA 3UB8A 4CLCE 4MCWA 2B02A 3F1PB 3VOLA 2HF6A 3PBTA 3UB7A 4G3VA 2WKPA 3S7OA 3PHYA 3OBFA 5IU1A 1LL8A 1ODVA 2GNXA 4UEYA 4EW7A 2L1MA 4HJ3A 2ZMVA 4HY8A 5LBRA 3LI9A 4CQHA 4DN0A 2GJ3A 3KSHA 2J3WA 4CLCA 4WEKA 3MJQA 2V1AA 4NXBA 4HJ4A 3TJZC 3IBJA 1H8MA 5DKLA 3IBRA 3KX0X 4HH3A 4LRZE 3MFXA 2W3GA 3LICA 2FZ0A 1XJ2A 1W63Q 2BASA 1JNUA 3LIFA 3BY8A 3EOIA 4EERA 5HPFA 3S7NA 2KOIA 2G7UA 4PKYA 4F3LA 3C8CA 2OAP1 3B33A 4IUKA 3PBSA 1GSXA 3D3OA 4MDZA 5G4YA 3EQVA 3PBRA 1D7EA 1N9LA 2QWSA 3BY9A 5AJGA 3R7WA 1G6OA 4MMNA 5HWVA 2XROA 3PBNA 2PDRA 5KIZA 3LIAA 3BW6A 2VGLS 2WKRA 2IA2A 4HOIA 4BMWA 3KO6A 1MKMA 2D02A 2FH5A 2ZOIA 3K2NA 1S1YA 4ARZB 1MZUA 3IS2A 2XA7M 1DP9A 3C38A 4Q0JA 4HH2A 3ZYTA 2VLGA 4UQIS 4HIAA 1H3QA 3MQ0A 3T4JA 4Z1WA 1UWPX 1P9WA 3MQQA 1S4RA 1YAXA 5KSHA 3FPWA 1W63M 2OWHA 4I3IA 2QHKA 3CAXA 4CLCB 1YSPA 4EETB 3UE3A 4R3AA 3UE6A 5FL3A 5F68A 4EEUA 3D72A 1OPXA 4I5SA 3CWFA 2MJ6A 4BBVA 1NRJA 3B47A 1XJ6A 3K3DA 5DKKA 3DBAA 4PKYG 3T4OA 1S4SA 1OTDA 2XSSA 3PXPA 4DJ3A 4B9OA 3C30A 1N9OA 3KSFA 2VV6A 2Z6CA 1EW0A 5A8BA 5HWWA 2EA9A 5I5LA 3TRCA 4YOFA 4BWIA 3LYXA 3E0YA 1NWZA 1XFNA 4ZRRA 1TS0A 2V1BA 4O01A 2DMWA 3P01A 2W3FA 2PD7A 3GDIA 3RFBA 3R7WB 3MF0A 1NLYA 1ZTUA 3OLOA 5IT5A 2P08A 4PAUA 4ARZA 2VV7A 2I9VA 4GW9A 4EXOA 1V9ZA 3NOTC 2Z6DA 5HDCA 3EEHA 4CLCC 2J80A 2H28A 3T4LA 3PBOA 4HP9A 1T1BA 3IS2B 5C5KA 2W1RA 5J4EA 3F1OB 4KUOA 5HZHA 3NHQA 2L4RA 2VV8A 4NXEA 4I38A 4FSFA 1YKDA 2M1CA 3LIBA 2QJ5A 4LRXC 4Y2FA 1TD5A 5CX7A 3BJNA 5HPIA 3FG8A 4WF0A 4DMZA 3MQOA 1OT9A 5MC7A 2J3TD 4NKPA 1TS6A 1S67L 4Y3IA 2OWJA 2HGVA 2PHYA 4I39A 4WLAA 4WEJA 3A0RA 2WKQA 2JN7A 3NOUC 2VZWA 3EGXC 3JVUA 1P97A 1XJ4A 4G3WA 4P6ZS 2M7UA 2K7SA 2VX8A 3UB6A 2YKHA 3G6OA 4PHTA 1IFQA 2OOLA 3BWLA 5HWTA 2W3EA 2QYBA 2EWVA 2A24A 1V9YA 1DRMA 4DJ2A 1T1AA 2R78A 2L0WA 3H9WA 3F1NA 3T4QA 4GCZA 2KLIA 1DP8A 4MN6A 5DF9A 5DJTA 2W0NA 4NXFA 1TF1A 4LPZA 3PBQA 1NLZA 5F5YA 2NUPC 2PD8A 3OCNA 4YNRA 5AVFA 3E4OA 3T4SA 4WELA 4LRYC 4EUVA 3MR0A 3F1OA 5AVEA 4JGOA 5HD3A 3T50A 3RTYA 4GS9A 3CI6A 3EEAA 1T19A 4ME4A 5F6AA 2VEAA 4LLOB 4RQ9A 1UGUA 2P7JA 4QPRA 2Y8HA 3KSIA 4L9FA 3KYQA 4M4XA 4EU0A 4ETXA 4O0PA 2V0UA 2O9AA 4JGRA 3MMHA 3RH8B 1GSVA 1P0ZA 1OTBA 3OC2A 1F5MA 4I3JA 3E4PA 4E04A 3NJAA 3LI8A 4G3KA 1F9IA 2V0WA 3MXQA 3SW1A 4GJ4A 4B93A 2GZAA 1LT0A 4I3AA 3CUEC 3TW8A 3E4QA 1UWNX 4WL9A 2LB9A 2CMNA 4XT2A 2W27A 2O0YA 1OTAA 3FPVA 5G4ZA 3ICYA 3LIDA 4II7A 1P9RA 2M7VA 4R6LA 2PT7A 2QKPA 2GX5A 4NEED 2A24B 1DP6A 3EWKA 1OTIA 2JKRI 3F1NB 3TE8A 5IS1A 3HCYA 2VJWA 1S66L 4EEPA 1XJ3A 4WN5A 3ULFA 3H82B 3ZQ5A 3R4KA 2VGLM 3T4TA 4MN7A 4H6JA 4GS9B 2XA7S 3A0SA 2HV1A 3OOVA 1ZHHB 3LIEA 4UQIM 4KQOA 1MC0A 4OOLA 4R38A 4L9GA 1T1CA 4HHDA 3VE4A 4JGPA 4YWZA 4HNBA 2O9BA 3P7NA 3VE3A 3VV4A 3PR6A 3E98A 3S7QA 4MN5A 4JGQA 3UMEA 2PYPA 3LR4A 3CLOA 1TS8A 3B42A 3HJIA 1G28A 3U2AA 4KUKA 1Y28A 3KSGA 5TBMA 3LR5A 2VKSA 1LSVA 2ZBBA 1BYWA 3A0VA 4O8GA 1X0OA 3H7WA 4XT2B 5L8MA 3UMDA 4KQDA 1IOUA 5EFWA 4HQAA 2J3TC 4GLQA 5HDDA 2A2LA 4ETZA 3NOPC 3EGDC 2V9AA 4BBTA 4GHIB 2W3DA 5DFXA 1OJ5A 4FOFA 2W1TA 2PYRA 3UB9A 3KYZA 3OCLA 1D06A 3H82A 4AFIA 1XFQA 2HJEA 2ZMFA 4BBUA 3S7PA 3EQUA 1TS7A 5K5BA 2JHEA 5DJUA 2KX6A 2YKFA 1STZA 1YSQA 5TJJA 4BJPA 3F1PA 3V67A 2VA0A 1OJGA 5DFYA 3K3CA 2P04A 2O99A 2HJ9C 3FC7A 4IUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0Y A;  5C5K A;  5HPF A;  2W1R A;  3S7N A;  2KOI A;  2M7V A;  4R6L A;  4R70 A;  3NHQ A;  2G7U A;  2GX5 A;  1YKD A;  4IUK A;  4LRX C;  3W2Z A;  4Y2F A;  1TD5 A;  3BJN A;  3D3O A;  5HPI A;  3LFV A;  4MDZ A;  4DMZ A;  3HCY A;  2VJW A;  5AJG A;  4MMN A;  2K2N A;  2W3H A;  2XRO A;  4Y3I A;  2HGV A;  3ZQ5 A;  4IJG A;  3R4K A;  3NOU C;  4Q0H A;  1VHM A;  2VZW A;  4G3W A;  2M7U A;  2IA2 A;  4MN7 A;  2B18 A;  3KO6 A;  1MKM A;  3K2N A;  3G6O A;  3C2W A;  5HL6 A;  4Y5F A;  2OOL A;  4Q0J A;  2O9C A;  3OOV A;  2W3E A;  3MQ0 A;  1MC0 A;  4Z1W A;  5HSQ A;  2QYB A;  2W1T B;  3CIT A;  2Y79 A;  2O9B A;  3VV4 A;  1YSP A;  2XRN A;  3E98 A;  3S7Q A;  2KLI A;  2K31 A;  2LB5 A;  1TF1 A;  4Q0I A;  4YNR A;  3O5Y A;  3KSG A;  4MCW A;  4LRY C;  4EUV A;  2VKS A;  4O8G A;  4G3V A;  3DBA A;  3CI6 A;  3EEA A;  5L8M A;  3S7O A;  4ME4 A;  2XSS A;  2VEA A;  4RQ9 A;  3OBF A;  4QPR A;  2Y8H A;  3KSF A;  4GLQ A;  3KSI A;  4ETZ A;  3NOP C;  4EU0 A;  2W3D A;  5LBR A;  5I5L A;  3TRC A;  4O0P A;  5DFX A;  4ETX A;  4FOF A;  4YOF A;  2O9A A;  4BWI A;  3E0Y A;  4CQH A;  3MMH A;  4DN0 A;  2W1T A;  3KSH A;  4ZRR A;  1F5M A;  4O01 A;  4E04 A;  2ZMF A;  4G3K A;  2W3F A;  3IBJ A;  3S7P A;  3RFB A;  5K5B A;  3MF0 A;  1ZTU A;  3IBR A;  4PAU A;  1STZ A;  1YSQ A;  4LRZ E;  2W3G A;  4GW9 A;  5TJJ A;  3NOT C;  2LB9 A;  5DFY A;  2O99 A;  4IUH A; 
#chains in the Genus database with same CATH topology
 4H6J B;  3T1X A;  2XR0 A;  4DE2 A;  2H5S A;  4R70 A;  3RJU A;  3A3E A;  4L0L A;  1YLJ A;  3G30 A;  3P98 A;  1S1Z A;  3DTI A;  3BQ8 A;  3LY3 A;  4HI4 A;  3SZT A;  2K2N A;  3T4K A;  1Q2P A;  4HBT A;  4Q0H A;  1FIL A;  1LSX A;  5F69 A;  4IED A;  2B18 A;  3C4P A;  1WA9 A;  3C2W A;  1VB6 A;  5HL6 A;  4EQ1 A;  1RP5 A;  2PR5 A;  2PR6 A;  1KGF A;  4JXV A;  5FQQ A;  3PYP A;  1F98 A;  3UO9 A;  2Z2L B;  4OON A;  4MNR A;  5GHZ A;  4HP4 A;  2EX2 A;  5DTS A;  3O5Y A;  3UB8 A;  3F1P B;  2DCF A;  1NYY A;  1HTZ A;  1LI0 A;  2HDQ A;  1G5U A;  1KE4 A;  3N8L A;  1LL8 A;  2PBD P;  4UEY A;  1W8Q A;  4HJ3 A;  4FH2 A;  4CQH A;  5A90 A;  4WEK A;  5L10 A;  3N6I A;  4FUW A;  3TJZ C;  4R0Q A;  1H8M A;  4X68 A;  5DKL A;  4HH3 A;  4LRZ E;  4E3N A;  1CK3 A;  1AWI A;  5F83 A;  3LIF A;  3EOI A;  5HPF A;  5EOE A;  4B4Z A;  4PKY A;  3W4Q A;  3PBS A;  4EV4 A;  4MDZ A;  5G4Y A;  3BY9 A;  3FZC A;  5AJG A;  1PFL A;  3BEB A;  5HWV A;  3TOI A;  2V20 A;  4E3I A;  1NRF A;  2OLU A;  3M6H A;  5EVI B;  1QME A;  2HDU A;  2PRF A;  3SS3 A;  2IA2 A;  4HOI A;  3SH8 A;  1S1Y A;  2XA7 M;  5GLC A;  4HH2 A;  3ZNT A;  1XA1 A;  1H3Q A;  3T4J A;  1CQA A;  2XGN A;  2EX9 A;  2Y2N A;  2QHK A;  2EX6 A;  3UE3 A;  5F68 A;  3MFD A;  3M2K A;  4BD1 A;  2ZLY A;  1OPX A;  3VSL A;  1SKO B;  2JKF A;  5HAQ A;  3B47 A;  2QPN A;  3IXH A;  4PKY G;  1S4S A;  3VP2 A;  5I94 A;  4B9O A;  1N9O A;  5CGX A;  2Z6C A;  4S2P A;  2EA9 A;  4YOF A;  3HLG A;  4BWI A;  2HDR A;  3CPT A;  4E6W A;  4ZRR A;  4IVI A;  5EM1 A;  2E8J A;  3AGF A;  4O01 A;  5EVI A;  2ZD8 A;  4X53 A;  3BRM A;  3GDI A;  3RFB A;  3MZF A;  3MF0 A;  2XK1 A;  2P08 A;  2Y91 A;  4K0X A;  4PAU A;  1W5D A;  2I9V A;  3HRE A;  2ZC4 B;  5E43 A;  3VP1 A;  5FI6 A;  2PAV P;  4GKU A;  5C5K A;  3F1O B;  1ES2 A;  2WK0 A;  1Q2Q A;  5FA7 A;  2ACG A;  1YKD A;  2ZM8 A;  3ZDJ A;  2ZM2 A;  4Y2F A;  3HLE A;  1W79 A;  5HL1 A;  5CER A;  3MQO A;  1VET A;  5MC7 A;  4C75 A;  2J3T D;  3HLD A;  3AGD A;  1ZKJ A;  3Q82 A;  1ES4 A;  3LY4 A;  1S67 L;  2OWJ A;  3VOZ A;  1XJ4 A;  4IBX A;  2X01 A;  3G6O A;  4PHT A;  2HDS A;  4MLL A;  2B5R A;  5A92 A;  4D2O A;  2CC1 A;  3DWK A;  2QYB A;  2EWV A;  1V9Y A;  4HES A;  4QY6 A;  2R78 A;  2L0W A;  1MBL A;  3CMZ A;  5DF9 A;  2W0N A;  3BLM A;  3T1Q B;  1OME A;  3E4O A;  4S2I A;  5EVE A;  1CI9 A;  2FFF B;  3F1O A;  2ZQC A;  3T50 A;  3RTY A;  1RGZ A;  3EEA A;  1T19 A;  3NDE A;  3Q1F A;  5F6A A;  1ZG4 A;  4OPZ A;  2P7J A;  5CGW A;  2Y8H A;  3KSI A;  2BLS A;  3JYI A;  4EU0 A;  4ETX A;  4LV3 A;  3ZVW A;  1PWG A;  4JGR A;  4JLF A;  1GHM A;  1ERQ A;  4LV0 A;  4DE1 A;  2J9P A;  2WAE A;  3E4P A;  3LI8 A;  2V0W A;  3MXQ A;  3BM6 A;  4GJ4 A;  4B93 A;  3QP4 A;  3VP3 A;  5EE8 A;  3FC7 A;  4KG2 A;  2LB9 A;  4GB7 A;  1ES3 A;  2W27 A;  3FPV A;  4KZ6 A;  5G4Z A;  5EVI C;  4UA6 A;  5U47 A;  2DRW A;  4R6L A;  3W4O A;  4KZ8 A;  1YLT A;  1MWU A;  4KZ7 A;  3HCY A;  2B95 A;  3H82 B;  4LEN A;  1CEF A;  1LL5 A;  4BD0 A;  2VGL M;  3T4T A;  5AQ9 A;  4MN7 A;  4F94 A;  4GS9 B;  5HX9 A;  1H8Z A;  3A0S A;  2X71 A;  4UQI M;  1MC0 A;  4OOL A;  3RXW A;  3VE4 A;  2HP9 A;  2R9W A;  4GOG A;  3PR6 A;  1ALQ A;  1TS8 A;  1G28 A;  1PI5 A;  2Y2L A;  2P9V B;  3LR5 A;  3ITB A;  4PM7 A;  1DJC A;  3MS6 A;  3DWZ A;  3A0V A;  3CHW P;  3UE0 A;  5CXW A;  5HAP A;  4OH0 A;  1IOU A;  1FCN A;  5EFW A;  4DF6 A;  3EGD C;  4GHI B;  5DFX A;  5EOO A;  1OJ5 A;  4N1X A;  2PYR A;  4KG6 A;  3KYZ A;  3H82 A;  3O86 A;  2ZMF A;  2OV5 A;  2XQZ A;  1TS7 A;  3HLC A;  4PM9 A;  2YKF A;  2Y2G A;  5FI2 A;  4BJP A;  4MBF A;  4KZ3 A;  1OJG A;  1N4O A;  1ZG6 A;  1ERO A;  4IUH A;  3D9Y A;  2D01 A;  1AXB A;  3IXG A;  5FEG A;  4EES A;  4DDS A;  4K08 A;  4EBP A;  5HD5 A;  3LCE A;  4HJ6 A;  2OAQ 1;  1KE3 A;  2QJ7 A;  4R3J A;  3A3I A;  3WS2 A;  1KE0 A;  2W3H A;  2GDN A;  5J3W A;  4IJG A;  5TBM B;  5L2F A;  1VHM A;  3HJK A;  1DJB A;  3IWQ A;  4FH4 A;  3G2Z A;  4M3K A;  4PM6 A;  4GHI A;  4MBH A;  3GVB A;  4LGW A;  3LUQ A;  4EWF A;  2O9C A;  1BSG A;  3UPP A;  5HSQ A;  2ZC6 B;  2WGI A;  3LR3 A;  1CJF A;  2NUT C;  1K55 A;  4WZ5 A;  3WWX A;  1OT6 A;  3BFF A;  3V50 A;  3CIT A;  2PU2 A;  3NCK A;  4LCM A;  4QU3 A;  3BFE A;  4F3L B;  1FR6 A;  1LI9 A;  3C7V A;  2K31 A;  4Q0I A;  3V3R A;  4CLC E;  4MCW A;  1BT5 A;  2B02 A;  3PBT A;  3NEC A;  2WKP A;  3S7O A;  4ZJ3 A;  5IU1 A;  5J8X A;  2ZMV A;  1J9M A;  4X1L A;  5LBR A;  5DVA A;  3LI9 A;  2J3W A;  1IYO A;  3MJQ A;  4A5R A;  3MXS A;  3QP8 A;  4NXB A;  5EEC A;  1CEG A;  1N9B A;  2H10 A;  4R3B A;  4XUX A;  1MWT A;  3IBR A;  3KX0 X;  1FSY A;  4ZTK A;  5AQB A;  1W63 Q;  2BAS A;  1JNU A;  5FEF A;  3UPN A;  1BZA A;  2ZC5 B;  4EER A;  5FQK A;  2KOI A;  5A91 A;  1H5X A;  2ZQ8 A;  4OQH A;  1ERM A;  3VFF A;  4F3L A;  3C8C A;  2OAP 1;  3B33 A;  4IUK A;  3WRT A;  3HLW A;  4Y0O A;  4RVA A;  2VK3 A;  1D7E A;  1N9L A;  5EVL A;  4X69 A;  3S4X A;  1CI8 A;  2ZL1 A;  1G6O A;  4MMN A;  2XRO A;  3PBN A;  5GLA A;  4ZAM A;  5FQM A;  5KIZ A;  3CJM A;  1YM1 A;  1HLU P;  4BMW A;  2FH5 A;  5TR7 A;  3K2N A;  3IS2 A;  1I2W A;  4Q0J A;  4OQI A;  2VLG A;  4Z1W A;  1P9W A;  5DF8 A;  1XA7 A;  1YAX A;  5KSH A;  3FPW A;  3IF6 B;  3BFG A;  2I72 A;  3UE6 A;  2Q9M A;  5FL3 A;  5EVI D;  4R4R A;  4EEU A;  4JF5 A;  3FV7 A;  3D72 A;  4I5S A;  2ZM0 A;  3CWF A;  4WZ5 C;  1K55 C;  1XJ6 A;  3K3D A;  5DKK A;  3DBA A;  4KZA A;  4Y15 A;  3T4O A;  2Z2M B;  2XSS A;  2XH9 A;  4WMC A;  3KSF A;  4ID4 A;  5HWW A;  4LV1 A;  3KYE A;  3CZD A;  3AGE A;  2J8Y A;  4BEN A;  1PIO A;  2DMW A;  3P01 A;  3NIA A;  1VQQ A;  1NLY A;  1ZTU A;  3OLO A;  4Q8I A;  3IHB A;  4GW9 A;  4EXO A;  3T1S A;  2Y59 A;  4JXG A;  3NOT C;  3LGO A;  4GD8 A;  3VMA A;  5E2H A;  4HP9 A;  1C3B A;  1T1B A;  4RYE A;  5J4E A;  3IF6 A;  2UWX A;  1L0D A;  4KUO A;  2R9X A;  2VV8 A;  4S2K A;  4I38 A;  1TD5 A;  5CX7 A;  2P74 A;  4ZBE A;  3C4O A;  4EBL A;  4R4S A;  3Q7Z A;  2XFT A;  1TS6 A;  4WLA A;  4EBN A;  2WKQ A;  4P6Z S;  3A0R A;  3FKW A;  2VZW A;  3NOU C;  3T4S A;  1YLY A;  2K7S A;  3UB6 A;  3L9K A;  2EFX A;  2OOL A;  1GHI A;  5E2E A;  2JC7 A;  1YQS A;  2A24 A;  3IH9 A;  5HAR A;  4KZB A;  2X02 A;  4DJ2 A;  3CPT B;  3F1N A;  3I7J A;  4GCZ A;  4EQI A;  1DP8 A;  1YMX A;  5F1G A;  5F5Y A;  3PBQ A;  1NLZ A;  3TSG A;  2PD8 A;  3OCN A;  3HUN A;  4WEL A;  3VP4 A;  2A3U A;  5CGS A;  3QP6 A;  4JGO A;  3CI6 A;  4ME4 A;  1UGU A;  3NI9 A;  1GHP A;  2Y2K A;  4L9F A;  1BLS A;  1K56 A;  1HZO A;  2V0U A;  2O9A A;  3MMH A;  3PTE A;  1P0Z A;  1MY8 A;  1OTB A;  3OC2 A;  4N1H A;  3ZVT A;  1F5M A;  4LCL A;  1S0W A;  4I3J A;  1VET B;  1A0K A;  1JVJ A;  1IKG A;  1LT0 A;  3TW8 A;  2WUQ A;  1KDS A;  3WS5 A;  3E4Q A;  1UWN X;  3T1R A;  4XT2 A;  5FI7 A;  4Z9Q A;  1OTA A;  1TEM A;  2C5W B;  2C6W B;  3LID A;  3S1Y A;  2AVX A;  3O88 A;  4X6T A;  2H0T A;  2Y55 A;  2PT7 A;  2QKP A;  2GX5 A;  1DP6 A;  3EWK A;  5CED A;  2JKR I;  4X25 A;  5CEB A;  2VJW A;  3IF6 C;  4FTX A;  4ZJ2 A;  3ZQ5 A;  5FQ9 A;  3QP5 A;  2HP6 A;  3N4I A;  4GDN A;  3NDG A;  2RL3 A;  5EV0 A;  1FSW A;  2EXA A;  3LIE A;  4S2O A;  1K6S A;  4KQO A;  4D60 A;  1FOF A;  4OVD A;  4HNB A;  1NY0 A;  3P7N A;  1VEU A;  3VV4 A;  4S2M A;  4MN5 A;  4JGQ A;  4OOY A;  1SDN A;  4FCF A;  4KUK A;  5AQ7 A;  1Y28 A;  4ZJ1 A;  3UDI A;  3KSG A;  1KDW A;  3UPO A;  1PW1 A;  2HZ5 A;  4DE0 A;  3H7W A;  5KMW A;  3UMD A;  1MWR A;  5HDD A;  2V9A A;  4BBT A;  2W3D A;  2PU4 A;  5CHM A;  2W1T A;  3UB5 P;  4AFI A;  1H8Y A;  2IWB A;  4JXW A;  4BBU A;  1PWD A;  2JHE A;  2KX6 A;  1JTD A;  1STZ A;  3IHA A;  2VA0 A;  1YLW A;  3MKF A;  1OT9 A;  1SZV A;  3MKE A;  4KQR A;  1JWZ A;  2EFU A;  4GDB A;  4OKP A;  4PMA A;  3GEC A;  3M6B A;  1EI5 A;  4NXG A;  2JKT M;  3UNW A;  3LFV A;  4B88 A;  1LSW A;  5G18 A;  3MXR A;  4E3J A;  5E2F A;  1YMS A;  4DXB A;  3FKV A;  4Y0U A;  1FQG A;  1OTE A;  2ZJ9 A;  2RCX A;  2JKT I;  2Q0O A;  1ESI A;  3QP2 A;  4ZDX A;  1DJA A;  3ZG8 B;  1YT4 A;  4OOM A;  5J7E A;  1Y54 A;  5TGF A;  4KZ4 A;  1CF0 A;  2EWW A;  1N9N A;  2IWC A;  5HDS A;  2WGW A;  4C6Y A;  3CUE A;  2XRN A;  1NJ4 A;  1T18 A;  1GA0 A;  4JKT A;  1DY6 A;  5JYO A;  3VOL A;  2HF6 A;  2ZQA A;  3UB7 A;  2E8I A;  4JXS A;  1NZU A;  5CTN A;  3PHY A;  3QHY A;  3U4L P;  5JYP A;  4EW7 A;  3BFC A;  3SOI A;  4DN0 A;  3KSH A;  4CLC A;  4U0T A;  2V1A A;  4HJ4 A;  4E6X A;  2WZZ A;  4XUZ A;  1E3U A;  5L07 A;  2W3G A;  3LIC A;  3OZH A;  4MBK A;  3E2L A;  1ONH A;  3BY8 A;  2H0Y A;  3S7N A;  4WZ4 A;  2G7U A;  1JWP A;  3EQV A;  4N9K A;  4LV2 A;  5CRF A;  3OPL A;  3R7W A;  2J9O A;  5F82 A;  3PAG A;  3LIA A;  3BW6 A;  4WM9 A;  1SKF A;  1XX2 A;  2XD5 A;  2ZOI A;  4ARZ B;  1MZU A;  3N8S A;  4OLG A;  3ZYT A;  4KZ5 A;  4HIA A;  3MQ0 A;  2WAF A;  4Y0T A;  2OWH A;  3SH7 A;  4OQ0 A;  3CAX A;  5FDS A;  4EET B;  1LL9 A;  2XFS A;  4R3A A;  2ZC7 A;  1EWZ A;  4RA7 A;  1SCW A;  3GRJ A;  2MJ6 A;  4BBV A;  1NRJ A;  3CG5 A;  5FQI A;  2ZQD A;  4OP5 A;  4DJ3 A;  5EM0 A;  1E25 A;  3UDX A;  3A3J A;  3GQZ A;  1EW0 A;  2ZQ7 A;  1PI4 A;  5DF7 A;  5A8B A;  3P09 A;  2V8F A;  5I5L A;  1J3W A;  5GHY A;  1XFN A;  3ZHH A;  3LO7 A;  5KZH A;  1K38 A;  4DXC A;  3OPH A;  1LHY A;  3ZNY A;  5CHJ A;  5AQA A;  2V2F F;  3GV9 A;  2PD7 A;  2ZL1 B;  4NET A;  3BFD A;  4ARZ A;  2VV7 A;  1V9Z A;  1L0E A;  2Z6D A;  4CLC C;  4Y7P A;  2J80 A;  5GL9 A;  3IX3 A;  1YPR A;  3PBO A;  3IS2 B;  2Y2O A;  2EXB A;  2W1R A;  3NY4 A;  1U60 A;  1MPL A;  3NHQ A;  2L4R A;  3G4P A;  4NXE A;  4FSF A;  2M1C A;  4X55 A;  4LRX C;  1RGY A;  3BJN A;  1W8Y A;  4JF4 A;  4WF0 A;  5DTK A;  5FQJ A;  4DRT A;  4P6B A;  1SHV A;  3IX4 A;  1FCM A;  3BEC A;  1ES5 A;  4GZB A;  2PHY A;  4I39 A;  1L0F A;  2JN7 A;  3ULF A;  2OLV A;  3ITA A;  3JVU A;  1P97 A;  4G3W A;  4R1G A;  3GR2 A;  1IFQ A;  1G68 A;  5HWT A;  5HW3 A;  1K56 D;  3W8K A;  2WKI A;  3ZCZ A;  1DRM A;  2Y2M A;  3T4Q A;  1K0K A;  1E4D A;  3HLB A;  4FD8 A;  5DJT A;  4LPZ A;  2NUP C;  5AVF A;  5GLD A;  4LRY C;  4KZ9 A;  4EUV A;  3MR0 A;  5AVE A;  4UA9 A;  2VEA A;  4PM5 A;  3DAV A;  4QPR A;  3C7U A;  3TG9 A;  4O0P A;  3SS4 A;  4QJG A;  1GSV A;  1L2S A;  1O07 A;  2JCH A;  3NJA A;  4G3K A;  2VGK A;  2UV0 E;  3SW1 A;  3S22 A;  4OPR A;  4P87 A;  4JBF A;  2CMN A;  3IX8 A;  4CPK A;  4UAA A;  1ZC2 A;  4S2L A;  3LEQ A;  3ICY A;  3BYD A;  1TVF A;  3V39 A;  4II7 A;  1P9R A;  4QB8 A;  2A24 B;  5HFO A;  4GNU A;  1K25 A;  3F1N B;  3TE8 A;  3M2J A;  3V5M A;  1PWC A;  1ONG A;  4EEP A;  1IEL A;  1MKI A;  2IWD A;  3N8R A;  1PZP A;  3G2Y A;  4H6J A;  3O87 A;  2WKH A;  4H8R A;  2XA7 S;  4LFU A;  3OOV A;  1ZHH B;  3IH8 A;  4R38 A;  1BLC A;  4L9G A;  1T1C A;  4C3Q A;  4HHD A;  1TDL A;  4YWZ A;  3GSG A;  4N9L A;  3L7H A;  3IF5 A;  5FDH A;  3UME A;  3LR4 A;  3CLO A;  3B42 A;  3HJI A;  3OPP A;  2J7V A;  1X0O A;  2XLN A;  4XT2 B;  3UY6 A;  5L8M A;  3SS5 A;  1YLZ A;  4UHU A;  2WKE A;  4FOF A;  3MSH A;  4RX2 A;  1L3L A;  1QMF A;  2JBF A;  3UB9 A;  2HPB A;  5HAI A;  2ZQ9 A;  1XFQ A;  5FAS A;  2HJE A;  3EQU A;  5K5B A;  1XP4 A;  2Y2I A;  2V8C A;  1XGJ A;  1YSQ A;  4KQQ A;  1HD8 A;  5TJJ A;  3F1P A;  5DFY A;  2HJ9 C;  1K4F A;  1BLH A;  2ZMA A;  1K54 A;  1GSW A;  2ZOH A;  3WS0 A;  5M18 A;  3ZG5 A;  5FAO A;  1JWV A;  4RX3 A;  1VM1 A;  2Y4A A;  5CTM A;  3W2Z A;  1SDE A;  3V3S A;  2KDK A;  4K91 A;  1VEU B;  4IHQ A;  1M40 A;  4YIN A;  3JVV A;  4L9E A;  4BQM A;  4E3K A;  2INW A;  2QZ6 A;  2JKR M;  4P6Z M;  4QHC A;  3E2K A;  3ISG A;  3ZGA B;  3VFH A;  4WUJ A;  3ZFZ A;  1KOU A;  1YLP A;  1F2K A;  3H7W B;  1PW8 A;  3LEZ A;  4Y5F A;  3LR0 A;  1Z09 A;  3UDF A;  3BQA A;  2Y2J A;  3IWI A;  5KSC A;  1G6A A;  1PNE A;  4QD4 A;  2W1T B;  2Y79 A;  3NUL A;  1GA9 A;  5E2G A;  4CLC D;  4O7D A;  5FAP A;  3G32 A;  4PM8 A;  3NBL A;  2LB5 A;  1I5Q A;  5TFQ A;  1E3U D;  4R23 A;  4E3O A;  4G3V A;  1FR1 A;  2WZX A;  5EPH A;  3OBF A;  5GLB A;  3SH9 A;  1ODV A;  2XDM A;  2GNX A;  2JE5 A;  2L1M A;  4HY8 A;  3HVF A;  4DKI A;  1PRQ A;  4WYY A;  1BUE A;  1L0G A;  2GJ3 A;  2VGJ A;  2FFY A;  2A49 A;  3IBJ A;  3ZG9 B;  1K6R A;  4E3M A;  4OP8 A;  1KVM A;  4KG5 A;  1TDG A;  1SKO A;  3MFX A;  4GN2 A;  3JPU A;  2FZ0 A;  1XJ2 A;  3Q07 A;  3QP1 A;  1IYP A;  1XPB A;  1I2S A;  2WYX A;  4CJN A;  3IWO A;  4EUZ A;  3MBZ A;  1Z6F A;  5FAT A;  1GSX A;  3D3O A;  2WGW B;  3RXX A;  2G2W A;  4NG2 A;  3PBR A;  3UN7 A;  2QWS A;  1KVL A;  1K54 C;  1XKZ A;  2PDR A;  2VGL S;  2WKR A;  2Y2Q A;  3D4F A;  3W4P A;  3HBR A;  5M19 A;  1LLB A;  3KO6 A;  4HBU A;  1MKM A;  2D02 A;  2XEP A;  3IXB A;  1DP9 A;  3C38 A;  1KGE A;  4QWO A;  4UQI S;  1UWP X;  1ACF A;  5M1A A;  3MQQ A;  2G2U A;  1S4R A;  1W63 M;  4UA7 A;  4I3I A;  4CLC B;  1YSP A;  3WRZ A;  3MZE A;  3FYZ A;  4U3T A;  4X1M A;  1BLP A;  3A3D A;  4OQG A;  4K0W A;  3PXP A;  1OTD A;  4DDY A;  3C30 A;  5GHX A;  1IYS A;  2VV6 A;  5FSR A;  1S6R A;  2JKG A;  4QY5 A;  3TRC A;  3DTM A;  1WE4 A;  3QNB A;  3LYX A;  3E0Y A;  1NWZ A;  3NC8 A;  1W7F A;  3HUM A;  5DTT A;  3G34 A;  1WYC A;  1TS0 A;  2OSU A;  2V1B A;  4Y17 A;  1XGI A;  2W3F A;  3VP0 A;  3R7W B;  5IT5 A;  4JPM A;  1PYY A;  1GCE A;  5HDC A;  3EEH A;  4B4X A;  2BTF P;  1D1J A;  2H28 A;  3IT9 A;  3O3V A;  3T4L A;  2XF3 A;  4BL3 A;  1K4E A;  1FIK A;  3HL9 A;  1HVB A;  2XD1 A;  5HZH A;  4IBR A;  3LIB A;  4XXR A;  2QJ5 A;  1WYB A;  5HPI A;  3FG8 A;  4N92 A;  1MXO A;  4DMZ A;  2Y2H A;  1M6K A;  4MEZ A;  1NZO A;  4NKP A;  1IYQ A;  1NYM A;  4Y3I A;  2HGV A;  3FWL A;  4WEJ A;  3BLS A;  3EGX C;  2M7U A;  3VOY A;  2VX8 A;  2YKH A;  4PPR A;  1XXM A;  3BWL A;  3N7W A;  1H0M A;  2W3E A;  4S2J A;  1BTL A;  1MWS A;  2EX8 A;  3Q7V B;  3MZD A;  4BL2 A;  1T1A A;  3HUO A;  3H9W A;  4OLD A;  2KLI A;  4S2N A;  1JTG A;  4MN6 A;  5A93 A;  2PBY A;  4NXF A;  1TF1 A;  4YNR A;  2HP5 A;  4WBG A;  1ESU A;  3OPR A;  3ZG0 A;  5HD3 A;  5L09 A;  3GMW A;  4GS9 A;  4WMC D;  3QNC A;  4KEN B;  4LLO B;  4P85 A;  4RQ9 A;  4ESP A;  3KYQ A;  4M4X A;  2V1Z A;  4IVK A;  4GD6 A;  3RH8 B;  2WAD A;  1K57 A;  4E04 A;  5CEC A;  5IHV A;  1IKI A;  1BUL A;  1F9I A;  3Q81 A;  2GZA A;  4I3A A;  3CUE C;  2P9V A;  4WL9 A;  4YFM A;  4NK3 A;  4U0X A;  2O0Y A;  3G31 A;  3HLF A;  3Q7V A;  1Y4O A;  2QMI A;  4HEF A;  3B3X A;  1O7E A;  3IQA A;  2M7V A;  4NEE D;  1OTI A;  3VSK A;  4BLM A;  5IS1 A;  3T12 B;  1S66 L;  1XJ3 A;  4WN5 A;  3R4K A;  3IXD A;  3WS1 A;  1NXY A;  2HV1 A;  3C5A A;  4E3L A;  3UE1 A;  3ZG7 B;  4OPQ A;  2BG1 A;  4JGP A;  3GTC A;  2O9B A;  3VE3 A;  3E98 A;  3S7Q A;  4Y13 A;  5CHU A;  2PYP A;  1PZO A;  3U2A A;  3A3F A;  3DTK A;  4X56 A;  5TBM A;  5D3O A;  4DE3 A;  2VKS A;  1FCO A;  1LSV A;  2ZBB A;  1BYW A;  2Q9N A;  4O8G A;  1IEM A;  4KQD A;  5EUA A;  5F1F A;  4S2N C;  4HQA A;  2J3T C;  4GLQ A;  3WS4 A;  2A2L A;  4ETZ A;  3NOP C;  5BOH A;  2ZC3 B;  1RCJ A;  3DW0 A;  3OCL A;  1D06 A;  3PAE A;  3DTE A;  2Y2P A;  3S7P A;  1KGG A;  3G35 A;  5DJU A;  3V67 A;  5FAQ A;  2WGV A;  2DNS A;  3K3C A;  2P04 A;  2O99 A;  4OPY A;  4P0M A;  4JF6 A;  1K57 C; 
#chains in the Genus database with same CATH homology
 4H6J B;  2D01 A;  1GSW A;  2ZOH A;  4EES A;  4R70 A;  3GEC A;  4L0L A;  4K08 A;  4NXG A;  3W2Z A;  5HD5 A;  2JKT M;  2KDK A;  3LFV A;  1LSW A;  1S1Z A;  4IHQ A;  4HJ6 A;  2OAQ 1;  2QJ7 A;  3BQ8 A;  4HI4 A;  3JVV A;  4L9E A;  2K2N A;  2W3H A;  2INW A;  5J3W A;  3T4K A;  2JKR M;  4IJG A;  1OTE A;  5TBM B;  4Q0H A;  1VHM A;  3HJK A;  1LSX A;  2JKT I;  4P6Z M;  5F69 A;  2B18 A;  4WUJ A;  1KOU A;  3H7W B;  1WA9 A;  4GHI A;  4OOM A;  3C2W A;  1VB6 A;  5HL6 A;  4Y5F A;  5J7E A;  3LR0 A;  3LUQ A;  2O9C A;  4EQ1 A;  2EWW A;  1N9N A;  2PR5 A;  5HSQ A;  3LR3 A;  5HDS A;  2NUT C;  2PR6 A;  3BQA A;  1OT6 A;  2W1T B;  3CIT A;  2Y79 A;  3CUE A;  3PYP A;  4CLC D;  1F98 A;  2XRN A;  4F3L B;  1T18 A;  2K31 A;  4HP4 A;  2LB5 A;  4Q0I A;  3O5Y A;  3UB8 A;  4CLC E;  4MCW A;  2B02 A;  3F1P B;  3VOL A;  2HF6 A;  3PBT A;  3UB7 A;  4G3V A;  2WKP A;  3S7O A;  3PHY A;  3OBF A;  5IU1 A;  1LL8 A;  1ODV A;  2GNX A;  4UEY A;  4EW7 A;  2L1M A;  4HJ3 A;  2ZMV A;  4HY8 A;  5LBR A;  3LI9 A;  4CQH A;  4DN0 A;  2GJ3 A;  3KSH A;  2J3W A;  4CLC A;  4WEK A;  3MJQ A;  2V1A A;  4NXB A;  4HJ4 A;  3TJZ C;  3IBJ A;  1H8M A;  5DKL A;  3IBR A;  3KX0 X;  4HH3 A;  4LRZ E;  3MFX A;  2W3G A;  3LIC A;  2FZ0 A;  1XJ2 A;  1W63 Q;  2BAS A;  1JNU A;  3LIF A;  3BY8 A;  3EOI A;  4EER A;  5HPF A;  3S7N A;  2KOI A;  2G7U A;  4PKY A;  4F3L A;  3C8C A;  2OAP 1;  3B33 A;  4IUK A;  3PBS A;  1GSX A;  3D3O A;  4MDZ A;  5G4Y A;  3EQV A;  3PBR A;  1D7E A;  1N9L A;  2QWS A;  3BY9 A;  5AJG A;  3R7W A;  1G6O A;  4MMN A;  5HWV A;  2XRO A;  3PBN A;  2PDR A;  5KIZ A;  3LIA A;  3BW6 A;  2VGL S;  2WKR A;  2IA2 A;  4HOI A;  4BMW A;  3KO6 A;  1MKM A;  2D02 A;  2FH5 A;  2ZOI A;  3K2N A;  1S1Y A;  4ARZ B;  1MZU A;  3IS2 A;  2XA7 M;  1DP9 A;  3C38 A;  4Q0J A;  4HH2 A;  3ZYT A;  2VLG A;  4UQI S;  4HIA A;  1H3Q A;  3MQ0 A;  3T4J A;  4Z1W A;  1UWP X;  1P9W A;  3MQQ A;  1S4R A;  1YAX A;  5KSH A;  3FPW A;  1W63 M;  2OWH A;  4I3I A;  2QHK A;  3CAX A;  4CLC B;  1YSP A;  4EET B;  3UE3 A;  4R3A A;  3UE6 A;  5FL3 A;  5F68 A;  4EEU A;  3D72 A;  1OPX A;  4I5S A;  3CWF A;  2MJ6 A;  4BBV A;  1NRJ A;  3B47 A;  1XJ6 A;  3K3D A;  5DKK A;  3DBA A;  4PKY G;  3T4O A;  1S4S A;  1OTD A;  2XSS A;  3PXP A;  4DJ3 A;  4B9O A;  3C30 A;  1N9O A;  3KSF A;  2VV6 A;  2Z6C A;  1EW0 A;  5A8B A;  5HWW A;  2EA9 A;  5I5L A;  3TRC A;  4YOF A;  4BWI A;  3LYX A;  3E0Y A;  1NWZ A;  1XFN A;  4ZRR A;  1TS0 A;  2V1B A;  4O01 A;  2DMW A;  3P01 A;  2W3F A;  2PD7 A;  3GDI A;  3RFB A;  3R7W B;  3MF0 A;  1NLY A;  1ZTU A;  3OLO A;  5IT5 A;  2P08 A;  4PAU A;  4ARZ A;  2VV7 A;  2I9V A;  4GW9 A;  4EXO A;  1V9Z A;  3NOT C;  2Z6D A;  5HDC A;  3EEH A;  4CLC C;  2J80 A;  2H28 A;  3T4L A;  3PBO A;  4HP9 A;  1T1B A;  3IS2 B;  5C5K A;  2W1R A;  5J4E A;  3F1O B;  4KUO A;  5HZH A;  3NHQ A;  2L4R A;  2VV8 A;  4NXE A;  4I38 A;  4FSF A;  1YKD A;  2M1C A;  3LIB A;  2QJ5 A;  4LRX C;  4Y2F A;  1TD5 A;  5CX7 A;  3BJN A;  5HPI A;  3FG8 A;  4WF0 A;  4DMZ A;  3MQO A;  1OT9 A;  5MC7 A;  2J3T D;  4NKP A;  1TS6 A;  1S67 L;  4Y3I A;  2OWJ A;  2HGV A;  2PHY A;  4I39 A;  4WLA A;  4WEJ A;  3A0R A;  2WKQ A;  2JN7 A;  3NOU C;  2VZW A;  3EGX C;  3JVU A;  1P97 A;  1XJ4 A;  4G3W A;  4P6Z S;  2M7U A;  2K7S A;  2VX8 A;  3UB6 A;  2YKH A;  3G6O A;  4PHT A;  1IFQ A;  2OOL A;  3BWL A;  5HWT A;  2W3E A;  2QYB A;  2EWV A;  2A24 A;  1V9Y A;  1DRM A;  4DJ2 A;  1T1A A;  2R78 A;  2L0W A;  3H9W A;  3F1N A;  3T4Q A;  4GCZ A;  2KLI A;  1DP8 A;  4MN6 A;  5DF9 A;  5DJT A;  2W0N A;  4NXF A;  1TF1 A;  4LPZ A;  3PBQ A;  1NLZ A;  5F5Y A;  2NUP C;  2PD8 A;  3OCN A;  4YNR A;  5AVF A;  3E4O A;  3T4S A;  4WEL A;  4LRY C;  4EUV A;  3MR0 A;  3F1O A;  5AVE A;  4JGO A;  5HD3 A;  3T50 A;  3RTY A;  4GS9 A;  3CI6 A;  3EEA A;  1T19 A;  4ME4 A;  5F6A A;  2VEA A;  4LLO B;  4RQ9 A;  1UGU A;  2P7J A;  4QPR A;  2Y8H A;  3KSI A;  4L9F A;  3KYQ A;  4M4X A;  4EU0 A;  4ETX A;  4O0P A;  2V0U A;  2O9A A;  4JGR A;  3MMH A;  3RH8 B;  1GSV A;  1P0Z A;  1OTB A;  3OC2 A;  1F5M A;  4I3J A;  3E4P A;  4E04 A;  3NJA A;  3LI8 A;  4G3K A;  1F9I A;  2V0W A;  3MXQ A;  3SW1 A;  4GJ4 A;  4B93 A;  2GZA A;  1LT0 A;  4I3A A;  3CUE C;  3TW8 A;  3E4Q A;  1UWN X;  4WL9 A;  2LB9 A;  2CMN A;  4XT2 A;  2W27 A;  2O0Y A;  1OTA A;  3FPV A;  5G4Z A;  3ICY A;  3LID A;  4II7 A;  1P9R A;  2M7V A;  4R6L A;  2PT7 A;  2QKP A;  2GX5 A;  4NEE D;  2A24 B;  1DP6 A;  3EWK A;  1OTI A;  2JKR I;  3F1N B;  3TE8 A;  5IS1 A;  3HCY A;  2VJW A;  1S66 L;  4EEP A;  1XJ3 A;  4WN5 A;  3ULF A;  3H82 B;  3ZQ5 A;  3R4K A;  2VGL M;  3T4T A;  4MN7 A;  4H6J A;  4GS9 B;  2XA7 S;  3A0S A;  2HV1 A;  3OOV A;  1ZHH B;  3LIE A;  4UQI M;  4KQO A;  1MC0 A;  4OOL A;  4R38 A;  4L9G A;  1T1C A;  4HHD A;  3VE4 A;  4JGP A;  4YWZ A;  4HNB A;  2O9B A;  3P7N A;  3VE3 A;  3VV4 A;  3PR6 A;  3E98 A;  3S7Q A;  4MN5 A;  4JGQ A;  3UME A;  2PYP A;  3LR4 A;  3CLO A;  1TS8 A;  3B42 A;  3HJI A;  1G28 A;  3U2A A;  4KUK A;  1Y28 A;  3KSG A;  5TBM A;  3LR5 A;  2VKS A;  1LSV A;  2ZBB A;  1BYW A;  3A0V A;  4O8G A;  1X0O A;  3H7W A;  4XT2 B;  5L8M A;  3UMD A;  4KQD A;  1IOU A;  5EFW A;  4HQA A;  2J3T C;  4GLQ A;  5HDD A;  2A2L A;  4ETZ A;  3NOP C;  3EGD C;  2V9A A;  4BBT A;  4GHI B;  2W3D A;  5DFX A;  1OJ5 A;  4FOF A;  2W1T A;  2PYR A;  3UB9 A;  3KYZ A;  3OCL A;  1D06 A;  3H82 A;  4AFI A;  1XFQ A;  2HJE A;  2ZMF A;  4BBU A;  3S7P A;  3EQU A;  1TS7 A;  5K5B A;  2JHE A;  5DJU A;  2KX6 A;  2YKF A;  1STZ A;  1YSQ A;  5TJJ A;  4BJP A;  3F1P A;  3V67 A;  2VA0 A;  1OJG A;  5DFY A;  3K3C A;  2P04 A;  2O99 A;  2HJ9 C;  3FC7 A;  4IUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...