3OBFA

Crystal structure of putative transcriptional regulator, iclr family; targeted domain 129...302
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
SNAEERRVAYPVLRELTERTGETSALMVWNGNESMCVEQIPSRHQVKHLAPLGARYNEALSSSVQVFLASENEDRVRQLLRSGSITLTGVDEDAVEAYLLRLKESMERGWAVNFGETSIEEVGVASPVYDHRGNMVASVLIPAPKFRVSQDTLNSLGEACAAAAAKVTTRLGGRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator, IclR family
publication title Crystal structure of putative transcriptional regulator, IclR family; targeted domain 129...302
rcsb
source organism Arthrobacter aurescens
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3obfA00
3C2WA 2M7VA 4R6LA 1YKDA 2O9AA 2XSSA 3E98A 2OOLA 4MCWA 1TF1A 4EUVA 3KSIA 2VKSA 2Y8HA 2LB9A 5K5BA 1ZTUA 3O5YA 4PAUA 3MMHA 4YNRA 3S7QA 1F5MA 4LRYC 2HGVA 3DBAA 3NOUC 2G7UA 5HPFA 4Q0JA 2W3FA 4IJGA 4O8GA 5HL6A 2ZMFA 4G3KA 4Y2FA 2XRNA 3S7NA 2Y79A 4IUHA 5AJGA 4GW9A 4YOFA 2K2NA 3LFVA 5I5LA 5DFYA 3IBRA 2W1TB 2O9CA 1TD5A 4Z1WA 1MKMA 4Y3IA 4CQHA 4DN0A 3KSFA 2M7UA 4LRXC 2W1TA 1VHMA 4ETXA 5LBRA 5C5KA 3NHQA 3CITA 2W1RA 3IBJA 5HPIA 3KSHA 4ETZA 3OOVA 4GLQA 4BWIA 3OBFA 4EU0A 4IUKA 4Y5FA 2W3DA 4R70A 3KSGA 3S7OA 4Q0HA 2B18A 2W3EA 2O99A 2VJWA 5L8MA 4DMZA 3S7PA 2GX5A 4RQ9A 3EEAA 1YSPA 2KLIA 4QPRA 3E0YA 4ME4A 2LB5A 3KO6A 5TJJA 3BJNA 1STZA 2VZWA 2W3HA 3CI6A 3R4KA 2QYBA 4ZRRA 1MC0A 4G3WA 2K31A 2W3GA 5DFXA 4MDZA 2VEAA 3K2NA 4O0PA 3TRCA 3W2ZA 2XROA 3HCYA 4MN7A 4LRZE 3D3OA 3MF0A 3NOPC 3MQ0A 4MMNA 2O0YA 4O01A 5HSQA 1YSQA 2IA2A 3VV4A 4FOFA 3NOTC 4E04A 4G3VA 3ZQ5A 2O9BA 3G6OA 2KOIA 3RFBA 4Q0IA
chains in the Genus database with same CATH superfamily
4GCZA 2OOLA 4EEUA 5DF8A 1P97A 2LB9A 3Q82A 2Y2NA 4PMAA 1ZTUA 2A49A 4WF0A 4ZBEA 3UB8A 4E3MA 1ERQA 2V1AA 5EM1A 2PBDP 1T1BA 3TE8A 3ZDJA 5E43A 2JKRM 4E3IA 4F3LA 2WADA 3R7WB 2XQZA 1M6KA 3K3CA 3O86A 3MQOA 4BENA 1BYWA 2EWVA 2J80A 1IELA 1LL5A 4KZ7A 1OTIA 4LRXC 1T1CA 1MKIA 4K0XA 2Y59A 3Q7VB 4GHIB 3UE1A 5M1AA 2ZD8A 3LR3A 2G2WA 1YM1A 2WGWB 5EECA 1YLPA 1FCMA 4LCMA 4U0XA 4D2OA 1JWVA 1XJ6A 2KLIA 2P7JA 2VLGA 4GD8A 4OPYA 5G18A 5CGWA 5FEGA 1I2WA 3IHBA 3CZDA 3T12B 2Q0OA 4O0PA 4GS9A 5GL9A 2EFXA 3H7WB 1NWZA 1ZG6A 3DTKA 4UEYA 2ZQ9A 1YLJA 3NECA 1XP4A 3VFHA 5IU1A 4WZ4A 1IKIA 5CRFA 3CLOA 4Q0IA 2PT7A 3P09A 5EPHA 1Y54A 5GHXA 4IEDA 4RX3A 2OLUA 1ZG4A 4HH2A 3PBRA 3FKVA 4U0TA 4DXCA 4QWOA 4YWZA 1BZAA 4R38A 3A0VA 1PFLA 3QNCA 3SOIA 4UQIS 3ZG0A 5F68A 1GHMA 2XR0A 2P9VA 3KSFA 4Y15A 3SH7A 1K0KA 3R7WA 3ZFZA 3VMAA 2FFYA 4P6ZM 1FSYA 4BD0A 1KVLA 3NHQA 5HPIA 4IBRA 4K0WA 2WZZA 4LENA 1CQAA 3Q7VA 4GHIA 5E2FA 4X69A 4CJNA 3E2LA 3ULFA 3BLMA 3MXRA 3KX0X 1S67L 2WGWA 4OP5A 3FV7A 1LSWA 2E8JA 1S66L 3G32A 1H5XA 5IS1A 4MLLA 4HOIA 3FZCA 1BLHA 4JF6A 1BULA 4II7A 2VGKA 2AVXA 5FQQA 1PWGA 3MFXA 4OOMA 2IWCA 1IOUA 2O0YA 4I39A 2ZC7A 3W8KA 3OC2A 3H7WA 2Y2QA 5A91A 4H8RA 2FFFB 3LUQA 2X02A 1CI9A 4MEZA 1S1YA 3KYQA 2UWXA 2XFTA 1GSVA 3MKEA 3O5YA 4PAUA 3U4LP 3PTEA 4X1MA 3O3VA 3BFEA 3UY6A 1K54A 2G7UA 3M2KA 4JXVA 3T4KA 2Y79A 3PAGA 4LPZA 4RA7A 4AFIA 1ACFA 5CTMA 1C3BA 2HJ9C 5G4YA 4X6TA 2WK0A 1MWSA 3C8CA 4KZ8A 4P0MA 5I94A 4UA7A 2UV0E 3FKWA 4CPKA 1H0MA 1FCOA 3M6HA 2VV6A 5FASA 1JWPA 2O99A 1VQQA 3G31A 3T4OA 3PXPA 4WBGA 4GD6A 2ZQDA 3CG5A 3L7HA 4JGOA 1SKOB 2RL3A 2V9AA 2VGJA 1N9BA 4QU3A 3W2ZA 4LRZE 3BRMA 2Z6CA 1FSWA 3QP5A 3PBQA 1S4SA 3MZDA 3MQ0A 3IF5A 1LI9A 2QJ7A 3RXWA 5AQAA 2WAEA 3VP4A 1BUEA 3G6OA 2R78A 3N6IA 4Y0OA 4YFMA 3H9WA 2HF6A 1YKDA 1XGIA 1EW0A 3Q1FA 3KSIA 4DKIA 5KIZA 5GLDA 2IWBA 4JGRA 2VK3A 1P9WA 2Y2KA 4ZDXA 2Q9NA 4WELA 3EQUA 4YNRA 1Q2QA 5HWVA 3VOZA 3JVVA 1W63M 2H0TA 2OV5A 5KZHA 1SKFA 3ZVWA 2PR5A 4MN5A 3LEZA 4CQHA 3HUNA 1W7FA 3GR2A 3TW8A 3NCKA 2QWSA 3T4QA 5C5KA 3VFFA 1NYMA 4HP9A 2V1BA 2PD8A 2XF3A 4DXBA 1OTEA 4BD1A 4GJ4A 3ISGA 4BWIA 4IUKA 3HLBA 1IKGA 4Q0HA 1FOFA 2IWDA 2H0YA 4RQ9A 1XJ2A 2J8YA 1AWIA 2WGVA 3E0YA 2PD7A 3NDGA 4FSFA 5TJJA 2VZWA 3PYPA 3CI6A 1L0FA 2WYXA 4G3WA 4PPRA 1S1ZA 2HP6A 3TRCA 2XROA 1MWTA 3BY8A 3EQVA 4MN7A 4HQAA 2PRFA 2L0WA 2ZQAA 3C7VA 4OQ0A 4B9OA 2L4RA 1IYQA 3RH8B 2INWA 1TEMA 2WKEA 4KZ3A 2JC7A 2ZM8A 5HDDA 4I5SA 5FAPA 1F2KA 5DTTA 3E98A 3HJIA 5HD5A 2ZQ7A 4JF4A 3BLSA 1IFQA 4Y7PA 3IXHA 4KG6A 4BMWA 4R23A 3UPOA 4S2PA 1LSXA 3DBAA 1N9LA 5A92A 5CECA 4B4XA 5HL6A 4GKUA 4OLDA 3T1RA 4IUHA 4KG5A 2O9CA 4NETA 5F69A 4E3LA 1QMEA 1PNEA 4PHTA 1P0ZA 3SS5A 4XT2B 5FI6A 4JXGA 4B88A 1I2SA 1GHPA 4R1GA 4D60A 2XD1A 1RGYA 4ESPA 4BBVA 1K38A 5KSCA 2H10A 2HJEA 4OPZA 1OPXA 1TVFA 4GLQA 4E3KA 4PM8A 2XA7M 3VE4A 2ZMAA 2ZC3B 3D72A 2PU4A 4WM9A 3F1NB 4BQMA 4Y17A 1AXBA 4HHDA 4RVAA 4X1LA 2GNXA 3A3EA 2W3HA 3GV9A 4ZRRA 3MQQA 4N1XA 3MJQA 1XA7A 1DP6A 3D3OA 3UB6A 3C4PA 3IWOA 4I3JA 3MF0A 4S2OA 3S4XA 5EOEA 3LY3A 2EFUA 1IYOA 3QP6A 1S6RA 4GS9B 4PM9A 3E4QA 4BJPA 3A3IA 4CLCE 4DRTA 3AGFA 2NUPC 1PZOA 5FQJA 3CJMA 4ZJ3A 3G34A 1GSWA 2Y8HA 4OOYA 2PAVP 3LICA 4HI4A 2WAFA 5A90A 1PWCA 2J9PA 5HX9A 1H8YA 4I3IA 1F9IA 3GMWA 3NULA 5HZHA 1K57C 5HDCA 2WUQA 3QP2A 3L9KA 3BFDA 4IJGA 4IHQA 3OPPA 4OQGA 4DE0A 1SDEA 2QPNA 4Y0TA 4HIAA 5DFYA 4DJ3A 1TD5A 4WL9A 4NXFA 3HLEA 1N9NA 3C4OA 4NG2A 2P04A 1UGUA 1MWRA 1FQGA 5EE8A 2W1RA 3OCNA 3SH9A 4DDSA 4QY5A 2Y91A 2P9VB 1QMFA 2J3TC 5CERA 4XT2A 1PYYA 2A24B 2FH5A 3LEQA 1J9MA 3LR0A 3OBFA 4EU0A 1W8YA 5E2GA 4DDYA 1L0DA 3LR4A 3E4OA 4BL2A 2EXBA 4BBUA 2DRWA 3B42A 1STZA 3N4IA 5FAQA 3F1NA 2V2FF 5U47A 1ERMA 1K25A 3F1OB 1V9ZA 3E2KA 3HCYA 3HBRA 3FG8A 4MN6A 5GLBA 2XLNA 5L10A 3VV4A 5HL1A 1G68A 4LV0A 3NC8A 2D02A 4R6LA 4WEJA 3EGXC 1TF1A 5GHZA 3UPNA 1OJGA 5JYPA 1G5UA 3UMDA 2WKHA 2HP9A 3OCLA 1F5MA 2L1MA 1BLSA 4JXSA 4UHUA 1NZUA 1H3QA 3HLCA 5A93A 3WWXA 3IF6A 3A3FA 4EQ1A 3MS6A 3MXSA 3FPVA 1Y4OA 5I5LA 3P98A 1YLZA 2ZC6B 3LIAA 4JGQA 5AQ7A 3C30A 3P7NA 2XEPA 4ETXA 5FI2A 1XA1A 2VGLM 3VP3A 1Q2PA 1FR6A 2ZC5B 4JPMA 3WRZA 3N7WA 5FI7A 2OWJA 3IX3A 3N8LA 4QHCA 3CAXA 4EBNA 4OKPA 1DJAA 5FEFA 2A24A 2Z2LB 4LCLA 1IYPA 2Y2HA 3A3DA 3LO7A 4B4ZA 5DF9A 3R4KA 2QYBA 2K31A 1OJ5A 4KG2A 1WYCA 3T4TA 2HDSA 1YLYA 2PHYA 4WYYA 1TS7A 3F1OA 3G2YA 1SHVA 1I5QA 3V5MA 4EXOA 1HZOA 1L3LA 3NIAA 2Y2MA 2J3TD 5J3WA 5TFQA 2EX9A 2O9BA 1E25A 2KOIA 5KMWA 2EX6A 4XXRA 3JPUA 2M7VA 2XFSA 1LSVA 3V3SA 1Z6FA 4LV3A 5F5YA 2VKSA 3V3RA 1VB6A 1MWUA 1W79A 2EX2A 5L2FA 2I72A 5DTKA 3UNWA 3T1SA 1KVMA 3SH8A 1CJFA 2HDRA 2JCHA 2W3FA 5EV0A 4ZTKA 4S2IA 3T50A 3DTEA 3IF6C 4G3KA 1PIOA 3NBLA 2J3WA 4GW9A 5DJTA 4EWFA 4NKPA 1ES5A 4DN0A 4KQOA 1FCNA 1VHMA 1YAXA 1ZC2A 4L0LA 4JF5A 3KSHA 3ZYTA 4PM6A 3IXDA 2ZC4B 5CXWA 4OONA 2Y2JA 4L9FA 1NRJA 3CWFA 5E2EA 1XFNA 5F82A 2Z6DA 3M2JA 3QHYA 1YSPA 2P08A 4QB8A 1G28A 5F6AA 1FILA 1JVJA 3OZHA 5HAPA 3IX4A 1PRQA 3HLWA 3IH9A 3SZTA 3VP2A 2BG1A 1TS8A 2Y2LA 2OAQ1 3HREA 3NOPC 4KZ9A 3ZVTA 3EWKA 5E2HA 2WKPA 1G6AA 3IX8A 2J9OA 4I3AA 4HNBA 5BOHA 2JKFA 3RFBA 2XSSA 5CHUA 4MCWA 5GHYA 2I9VA 3UB9A 5D3OA 1XPBA 2WKRA 3BFGA 1IEMA 5EUAA 1E3UD 1T1AA 2OLVA 4OPRA 3H82B 2ZBBA 3S1YA 4YINA 5HPFA 4KQDA 5HW3A 3RTYA 2B5RA 4HESA 5DJUA 4YOFA 4S2KA 2CMNA 1KGEA 3C7UA 1WA9A 1FR1A 2ZM0A 2HDUA 5EVLA 1NRFA 2JBFA 1K4EA 4P6BA 5HAIA 2QKPA 4ETZA 4F94A 5EVEA 5FAOA 5G4ZA 4PM7A 3WS2A 4QY6A 2W0NA 2G2UA 1KDWA 1OTBA 3G2ZA 1H8ZA 3EOIA 3EEHA 5FQ9A 1A0KA 3Q07A 2DMWA 4WMCA 5CTNA 4MDZA 4HBTA 2VEAA 5DKKA 1XKZA 3CUEC 1VM1A 5KSHA 4S2LA 3ZNYA 4KZ5A 4NEED 2RCXA 3SW1A 2GJ3A 4ZJ2A 3BQ8A 5HARA 2DNSA 5DTSA 1M40A 5MC7A 3K3DA 1E4DA 1NXYA 4CLCD 3C2WA 4FUWA 1J3WA 3BQAA 1LT0A 3IXGA 1MZUA 1WE4A 2ZL1B 3EGDC 1NY0A 4GDBA 3SS3A 3S7QA 1YLTA 2PYRA 1DJBA 2HDQA 1KE0A 2VV8A 3PBSA 3QP4A 4Q0JA 4EEPA 1H8MA 2ZMFA 1RGZA 5HAQA 2V1ZA 3TG9A 1UWNX 3LIBA 3H82A 3MFDA 4C75A 4OP8A 2V0UA 2W1TB 1MKMA 4C6YA 1ESUA 1PZPA 3C38A 5IT5A 1L2SA 3HJKA 1FIKA 1RCJA 1K57A 1YMSA 3GSGA 5CX7A 1NZOA 3C5AA 4MBFA 1LHYA 2Y2PA 1N9OA 5CEDA 4QJGA 3UPPA 4JXWA 4UAAA 5AVEA 4XUXA 3IXBA 3ITAA 2B18A 4LV1A 4KQRA 3W4QA 3FWLA 2H5SA 1GHIA 1OT6A 2KX6A 4B93A 2GZAA 4K08A 2OSUA 3UO9A 2R9XA 1K6RA 2XA7S 1UWPX 3DW0A 5J7EA 2QZ6A 3HUMA 3P01A 1ZHHB 5TGFA 2YKHA 4Y0UA 2X01A 1LL9A 5FDHA 4DE1A 1GSXA 3F1PB 2D01A 4GOGA 4R0QA 2QHKA 3ZQ5A 2GDNA 3V50A 3UMEA 4DJ2A 2XK1A 2WKIA 3TSGA 3FYZA 3MMHA 2Y2GA 3MZEA 3Q7ZA 1PI5A 3LGOA 2ZL1A 4RYEA 1KOUA 2ZQCA 4OLGA 4Y2FA 1ONGA 5GLCA 5AVFA 3AGEA 3BY9A 3PR6A 2QMIA 2FZ0A 4KZ4A 2JE5A 5F1GA 1IYSA 3IF6B 2W1TA 1V9YA 4WEKA 4I38A 5LBRA 2OWHA 3BEBA 1OT9A 3QNBA 2V8FA 5J4EA 5FQIA 4UA6A 4R3BA 3G30A 4OQHA 4HH3A 4R70A 3T1XA 3S7OA 2E8IA 2W3EA 1XXMA 4N9KA 1P9RA 2JN7A 3OPLA 3JYIA 3KO6A 5FL3A 3LYXA 4CLCB 4MNRA 4FD8A 4EERA 3UE6A 5HWWA 1TS0A 4HP4A 2HZ5A 1KGFA 1CEFA 5HSQA 3PBTA 4KUKA 4PKYA 4Z9QA 3GVBA 1YLWA 3WS0A 4GN2A 2BLSA 3NY4A 4FH2A 3ZG5A 3F1PA 1E3UA 1SCWA 4H6JB 2VV7A 5EVIC 5JYOA 4HJ4A 3NJAA 1NYYA 4HBUA 2NUTC 3HLDA 1BLPA 2HGVA 4WMCD 3S22A 2EXAA 3RJUA 4LLOB 5CHMA 1XGJA 3T4LA 2XGNA 2BASA 2XRNA 2V8CA 2ACGA 2ZOIA 1DY6A 3LI9A 1Z09A 4HEFA 5EOOA 4EQIA 3SS4A 3UDXA 3ITBA 4DE3A 2M7UA 4N9LA 3WS5A 2BTFP 1KE3A 3A3JA 3HL9A 3MBZA 1ZKJA 2HV1A 1YMXA 3O87A 4HY8A 3UB7A 4WZ5A 5CEBA 2W3DA 4S2MA 4S2JA 4OQIA 2VGLS 3V67A 4JKTA 3HVFA 1ES2A 3WS4A 2VX8A 4FCFA 2ZMVA 4X56A 3V39A 1O07A 3BWLA 3TJZC 4EW7A 3B3XA 4N92A 4P6ZS 4R3JA 1XX2A 4CLCA 1PW8A 1W8QA 1HLUP 3ICYA 2KDKA 4C3QA 1K56A 1YQSA 4QD4A 2Y4AA 3NOTC 1L0EA 3QP8A 4G3VA 1NJ4A 3DWZA 2W27A 3BECA 4A5RA 1TS6A 2O9AA 2JKGA 2DCFA 1N4OA 3LCEA 5K5BA 3BYDA 4KUOA 4UQIM 4H6JA 4R3AA 4WUJA 4O8GA 3ZG9B 4N1HA 3O88A 5AJGA 2PR6A 2K2NA 4M3KA 2PYPA 1XJ4A 3GRJA 1PW1A 4FTXA 1MPLA 3MXQA 3IT9A 4BL3A 2K7SA 5F83A 2ZJ9A 2ZM2A 2JHEA 5EVID 4XUZA 1OTDA 1LL8A 3FPWA 1S0WA 3DTMA 5A8BA 2XD5A 4LGWA 3QP1A 1DP9A 1YPRA 4RX2A 4WZ5C 5F1FA 1ES3A 3T4SA 2WKQA 4DMZA 4GZBA 1S4RA 1SZVA 3S7PA 1DJCA 5FATA 3DWKA 4QPRA 2Y55A 3LI8A 1MBLA 3A0RA 2CC1A 1OTAA 5DF7A 1GA0A 1MC0A 1ESIA 4HJ6A 5DVAA 3MSHA 3A0SA 5M19A 4KZBA 3E4PA 2V20A 4CLCC 5FQKA 3IS2B 4MMNA 2XDMA 4U3TA 4LV2A 4O01A 4OH0A 2P74A 4OPQA 2B02A 3FC7A 2IA2A 5IHVA 3PAEA 4FOFA 4K91A 3VOYA 3MKFA 1BT5A 4KQQA 4EESA 1D7EA 1BTLA 1D1JA 3D4FA 4X53A 4KENB 5HD3A 1TDLA 1W63Q 4EUVA 5J8XA 3VOLA 3IWIA 3W4OA 1JTDA 3KYEA 3VSLA 5M18A 3CUEA 3GDIA 5FDSA 4Y13A 4O7DA 1DP8A 4PKYG 4JLFA 2B95A 4E6WA 3S7NA 1JTGA 4HJ3A 1ODVA 3LIEA 1T19A 5HDSA 3G4PA 3IBRA 5HWTA 3Q81A 4EBPA 4GB7A 3PBOA 1ONHA 4Q8IA 4EBLA 3VSKA 3ZG7B 1JNUA 2Y2OA 2YKFA 3BW6A 4ZAMA 1KDSA 2PBYA 3OOVA 3PBNA 3VP0A 3N8RA 3KSGA 4M4XA 5AQ9A 2VJWA 5L8MA 3DAVA 1WYBA 2GX5A 2JKTI 2HP5A 1VETB 4S2NA 1HD8A 2M1CA 3EEAA 4KZAA 3VE3A 3DTIA 1CK3A 4P85A 5DFXA 2ZQ8A 1RP5A 1K6SA 3NI9A 1CEGA 4X68A 1PI4A 1K54C 4EV4A 3OLOA 5GLAA 5FA7A 3AGDA 1JWZA 1HTZA 3I7JA 2ZLYA 3IS2A 4IBXA 1DRMA 1YT4A 3W4PA 3BFFA 1LI0A 3LIDA 3IHAA 4KZ6A 3G35A 1GA9A 3MZFA 1VEUB 4LRYC 3UDFA 1U60A 2VA0A 3OPRA 3BFCA 5EVIB 4BBTA 5TBMB 1XFQA 1BLCA 2WZXA 4NK3A 4E3OA 1K56D 3LFVA 3WS1A 3ZNTA 4Z1WA 3CPTB 1EI5A 3UE3A 3VP1A 3IQAA 2Z2MB 3GQZA 4IVKA 4IVIA 5EFWA 5CHJA 1TDGA 4E3NA 1BSGA 1LLBA 2X71A 2C6WB 1K55A 3CITA 1MXOA 4ARZB 1NLZA 1ES4A 4E6XA 3KYZA 1HVBA 5L09A 4P87A 3PHYA 1SKOA 4WLAA 5TR7A 4WN5A 4Y5FA 3D9YA 3UN7A 4S2NC 4NXGA 1EROA 2JKTM 3IWQA 3WRTA 1NLYA 3U2AA 3BJNA 5DKLA 2PU2A 1O7EA 4JGPA 4EUZA 1VETA 2QJ5A 3K2NA 4E3JA 1KE4A 3UB5P 2OAP1 2EWWA 3UDIA 1ALQA 2R9WA 4X25A 2HPBA 2J7VA 3LIFA 3UE0A 4ZJ1A 5HFOA 2Q9MA 1SDNA 3ZCZA 2XH9A 3CMZA 4X55A 4OVDA 4UA9A 2MJ6A 3B47A 1D06A 1K4FA 1F98A 4OOLA 3MR0A 4F3LB 3GECA 1CI8A 4LFUA 1W5DA 4MBHA 3NOUC 2JKRI 1L0GA 5L07A 5FSRA 1KGGA 1VEUA 3OPHA 3T1QB 3LR5A 3B33A 2EX8A 4GDNA 1GCEA 3BM6A 1EWZA 2H28A 5EVIA 3GTCA 3ZG8B 1OMEA 4Y3IA 5TBMA 3T4JA 5CGSA 2EA9A 4DF6A 3ZHHA 2V0WA 3IH8A 1K55C 2Y2IA 3CHWP 5FQMA 3CPTA 4ID4A 3IBJA 2PDRA 4FH4A 1XJ3A 2A2LA 4NXBA 4ARZA 3M6BA 4DE2A 4BLMA 1PWDA 4JBFA 1X0OA 3HLGA 3JVUA 4L9EA 3LY4A 1T18A 4R4RA 3TOIA 4NXEA 4ME4A 2LB5A 4GNUA 4MBKA 5EM0A 1G6OA 2WGIA 3RXXA 4L9GA 4R4SA 4EETB 2W3GA 3N8SA 3HLFA 1CF0A 2ZOHA 2C5WB 2A3UA 1Y28A 3NDEA 1YSQA 4PM5A 4E04A 1MY8A 3HUOA 5CGXA 3ZGAB 5AQBA
chains in the Genus database with same CATH topology
2W27A 4GCZA 1TS6A 2O9AA 2XSSA 3E98A 2OOLA 4MCWA 4EEUA 3HJIA 2I9VA 5HD5A 3UB9A 1P97A 2LB9A 2WKRA 1IFQA 5K5BA 1ZTUA 4KUOA 4WF0A 4BMWA 4UQIM 4H6JA 3UB8A 1LSXA 3DBAA 1T1AA 1N9LA 3H82B 2V1AA 2ZBBA 4R3AA 5HPFA 4KQDA 4WUJA 4O8GA 5HL6A 1T1BA 3TE8A 2JKRM 3RTYA 4F3LA 5DJUA 4IUHA 5AJGA 4YOFA 2PR6A 3R7WB 3K3CA 2CMNA 2K2NA 2PYPA 1XJ4A 3MQOA 2O9CA 1BYWA 2EWVA 3MXQA 5F69A 2J80A 1WA9A 4PHTA 1OTIA 2K7SA 1P0ZA 4LRXC 1T1CA 4GHIB 2JHEA 4XT2B 1OTDA 3LR3A 1LL8A 2QKPA 3FPWA 5A8BA 4BBVA 4ETZA 2HJEA 1DP9A 1OPXA 4GLQA 5G4ZA 2XA7M 3VE4A 3T4SA 2WKQA 3D72A 2W0NA 3F1NB 4DMZA 1S4RA 3S7PA 1OTBA 1XJ6A 2KLIA 2P7JA 2VLGA 4QPRA 3LI8A 4HHDA 3RFBA 3A0RA 2GNXA 3EEHA 3EOIA 1OTAA 2W3HA 2DMWA 3MQQA 4ZRRA 1MC0A 4MDZA 4HJ6A 3MJQA 2VEAA 4O0PA 1DP6A 4GS9A 5DKKA 3A0SA 3CUEC 3H7WB 3D3OA 1NWZA 3UB6A 5KSHA 3E4PA 4CLCC 4UEYA 4I3JA 3MF0A 3IS2B 4MMNA 4NEED 4O01A 3SW1A 2B02A 5IU1A 3FC7A 2GJ3A 2IA2A 3BQ8A 4FOFA 4EESA 1D7EA 4BJPA 5MC7A 4GS9B 3CLOA 3E4QA 3K3DA 4CLCE 4Q0IA 4CLCD 2NUPC 3C2WA 2PT7A 5HD3A 3BQAA 1W63Q 1LT0A 4EUVA 3VOLA 1GSWA 1MZUA 2Y8HA 3EGDC 3LICA 4HI4A 3CUEA 3GDIA 4HH2A 3PBRA 4I3IA 3S7QA 1F9IA 2PYRA 5HZHA 2VV8A 1DP8A 3PBSA 5HDCA 4Q0JA 4PKYG 4IJGA 4YWZA 4EEPA 4IHQA 1H8MA 2ZMFA 3S7NA 4R38A 3A0VA 4HJ3A 1ODVA 1UWNX 3LIBA 3H82A 3LIEA 1T19A 4UQIS 5HDSA 4HIAA 5DFYA 3IBRA 4DJ3A 2V0UA 2W1TB 5F68A 5HWTA 1TD5A 1MKMA 4WL9A 3KSFA 4NXFA 3PBOA 3R7WA 3C38A 5IT5A 3HJKA 1N9NA 4P6ZM 5CX7A 2P04A 1UGUA 1JNUA 3NHQA 2W1RA 2YKFA 3OCNA 5HPIA 1N9OA 3BW6A 2J3TC 4GHIA 3OOVA 3PBNA 4XT2A 3ULFA 2A24B 2FH5A 5AVEA 3LR0A 3OBFA 4EU0A 3LR4A 3KX0X 3KSGA 4M4XA 1S67L 2B18A 2VJWA 3E4OA 5L8MA 1LSWA 2GX5A 2JKTI 1S66L 2M1CA 3EEAA 1OT6A 4BBUA 2KX6A 3VE3A 4B93A 2GZAA 3B42A 4K08A 5IS1A 1STZA 3F1NA 2XA7S 1UWPX 4HOIA 5DFXA 3F1OB 1V9ZA 5J7EA 3P01A 3HCYA 1ZHHB 4II7A 3FG8A 2YKHA 3MFXA 4MN6A 4OOMA 1IOUA 2O0YA 1GSXA 4I39A 3F1PB 2D01A 3OC2A 3OLOA 3VV4A 3H7WA 2QHKA 3IS2A 3ZQ5A 1DRMA 3LUQA 2D02A 3UMEA 4R6LA 4DJ2A 4WEJA 3EGXC 1TF1A 1OJGA 1S1YA 3KYQA 3LIDA 3UMDA 1GSVA 3O5YA 4PAUA 3MMHA 3OCLA 1F5MA 4LRYC 2L1MA 2VA0A 2G7UA 4BBTA 1KOUA 1H3QA 5TBMB 4Y2FA 5AVFA 3T4KA 2Y79A 1XFQA 4EQ1A 4LPZA 3FPVA 3LFVA 5I5LA 3BY9A 4Z1WA 3PR6A 4AFIA 2FZ0A 3LIAA 4JGQA 3C30A 3UE3A 2HJ9C 3P7NA 5EFWA 2W1TA 1V9YA 5G4YA 4ETXA 4WEKA 4I38A 2VGLM 5LBRA 3CITA 2OWHA 4ARZB 1NLZA 3C8CA 1OT9A 3KYZA 5J4EA 3PHYA 4WLAA 2OWJA 4WN5A 4Y5FA 4HH3A 4R70A 2VV6A 3S7OA 3CAXA 2W3EA 2O99A 1P9RA 2JN7A 3T4OA 4NXGA 2A24A 2JKTM 3PXPA 1NLYA 3KO6A 4JGOA 3U2AA 3BJNA 5DF9A 5DKLA 2V9AA 3R4KA 2QYBA 5FL3A 3LYXA 4JGPA 4CLCB 2K31A 2QJ5A 1OJ5A 4EERA 3K2NA 3UE6A 3W2ZA 5HWWA 3T4TA 4LRZE 1TS0A 2Z6CA 4HP4A 2OAP1 2EWWA 2PHYA 3PBQA 1S4SA 1TS7A 3F1OA 3MQ0A 2QJ7A 5HSQA 3PBTA 4KUKA 4PKYA 4EXOA 2J3TD 5J3WA 3LIFA 2O9BA 3G6OA 2KOIA 2R78A 3H9WA 2HF6A 3F1PA 2M7VA 1YKDA 1EW0A 4H6JB 1LSVA 2VV7A 3KSIA 5KIZA 4HJ4A 5F5YA 2VKSA 2MJ6A 3B47A 4JGRA 1D06A 1VB6A 3NJAA 1P9WA 1F98A 4OOLA 3MR0A 4WELA 3EQUA 4YNRA 2NUTC 2HGVA 4F3LB 3GECA 5HWVA 4LLOB 3NOUC 2JKRI 2W3FA 3T4LA 2BASA 3T50A 4G3KA 3JVVA 2XRNA 1W63M 3LR5A 2J3WA 3B33A 2ZOIA 3LI9A 4GW9A 2H28A 5DJTA 4NKPA 2PR5A 4MN5A 4Y3IA 5TBMA 4CQHA 3T4JA 4DN0A 2EA9A 4KQOA 2M7UA 2V0WA 3TW8A 1VHMA 2QWSA 3T4QA 5C5KA 1YAXA 2HV1A 4L0LA 3IBJA 2PDRA 1XJ3A 2A2LA 3KSHA 4HP9A 2V1BA 2PD8A 3ZYTA 4NXBA 4L9FA 1OTEA 4HY8A 3UB7A 1NRJA 4GJ4A 4BWIA 4ARZA 4IUKA 2W3DA 3CWFA 4Q0HA 1XFNA 2VGLS 1X0OA 3V67A 2Z6DA 3JVUA 4L9EA 4RQ9A 1XJ2A 1T18A 2VX8A 1YSPA 2P08A 1G28A 4NXEA 5F6AA 3E0YA 2PD7A 4ME4A 2LB5A 4FSFA 5TJJA 1G6OA 2VZWA 2ZMVA 4L9GA 3PYPA 3CI6A 4EETB 3BWLA 2W3GA 1S1ZA 4G3WA 3TJZC 4EW7A 3TRCA 2ZOHA 2XROA 3BY8A 3EQVA 4MN7A 4HQAA 1TS8A 2OAQ1 4P6ZS 1Y28A 2L0WA 4B9OA 3NOPC 4CLCA 2L4RA 3RH8B 3ICYA 2INWA 2KDKA 3EWKA 1YSQA 2WKPA 3NOTC 4E04A 4I3AA 4G3VA 4HNBA 5HDDA 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2W A;  2M7V A;  4R6L A;  1YKD A;  2O9A A;  2XSS A;  3E98 A;  2OOL A;  4MCW A;  1TF1 A;  4EUV A;  3KSI A;  2VKS A;  2Y8H A;  2LB9 A;  5K5B A;  1ZTU A;  3O5Y A;  4PAU A;  3MMH A;  4YNR A;  3S7Q A;  1F5M A;  4LRY C;  2HGV A;  3DBA A;  3NOU C;  2G7U A;  5HPF A;  4Q0J A;  2W3F A;  4IJG A;  4O8G A;  5HL6 A;  2ZMF A;  4G3K A;  4Y2F A;  2XRN A;  3S7N A;  2Y79 A;  4IUH A;  5AJG A;  4GW9 A;  4YOF A;  2K2N A;  3LFV A;  5I5L A;  5DFY A;  3IBR A;  2W1T B;  2O9C A;  1TD5 A;  4Z1W A;  1MKM A;  4Y3I A;  4CQH A;  4DN0 A;  3KSF A;  2M7U A;  4LRX C;  2W1T A;  1VHM A;  4ETX A;  5LBR A;  5C5K A;  3NHQ A;  3CIT A;  2W1R A;  3IBJ A;  5HPI A;  3KSH A;  4ETZ A;  3OOV A;  4GLQ A;  4BWI A;  3OBF A;  4EU0 A;  4IUK A;  4Y5F A;  2W3D A;  4R70 A;  3KSG A;  3S7O A;  4Q0H A;  2B18 A;  2W3E A;  2O99 A;  2VJW A;  5L8M A;  4DMZ A;  3S7P A;  2GX5 A;  4RQ9 A;  3EEA A;  1YSP A;  2KLI A;  4QPR A;  3E0Y A;  4ME4 A;  2LB5 A;  3KO6 A;  5TJJ A;  3BJN A;  1STZ A;  2VZW A;  2W3H A;  3CI6 A;  3R4K A;  2QYB A;  4ZRR A;  1MC0 A;  4G3W A;  2K31 A;  2W3G A;  5DFX A;  4MDZ A;  2VEA A;  3K2N A;  4O0P A;  3TRC A;  3W2Z A;  2XRO A;  3HCY A;  4MN7 A;  4LRZ E;  3D3O A;  3MF0 A;  3NOP C;  3MQ0 A;  4MMN A;  2O0Y A;  4O01 A;  5HSQ A;  1YSQ A;  2IA2 A;  3VV4 A;  4FOF A;  3NOT C;  4E04 A;  4G3V A;  3ZQ5 A;  2O9B A;  3G6O A;  2KOI A;  3RFB A;  4Q0I A; 
#chains in the Genus database with same CATH topology
 4GCZ A;  2OOL A;  4EEU A;  5DF8 A;  1P97 A;  2LB9 A;  3Q82 A;  2Y2N A;  4PMA A;  1ZTU A;  2A49 A;  4WF0 A;  4ZBE A;  3UB8 A;  4E3M A;  1ERQ A;  2V1A A;  5EM1 A;  2PBD P;  1T1B A;  3TE8 A;  3ZDJ A;  5E43 A;  2JKR M;  4E3I A;  4F3L A;  2WAD A;  3R7W B;  2XQZ A;  1M6K A;  3K3C A;  3O86 A;  3MQO A;  4BEN A;  1BYW A;  2EWV A;  2J80 A;  1IEL A;  1LL5 A;  4KZ7 A;  1OTI A;  4LRX C;  1T1C A;  1MKI A;  4K0X A;  2Y59 A;  3Q7V B;  4GHI B;  3UE1 A;  5M1A A;  2ZD8 A;  3LR3 A;  2G2W A;  1YM1 A;  2WGW B;  5EEC A;  1YLP A;  1FCM A;  4LCM A;  4U0X A;  4D2O A;  1JWV A;  1XJ6 A;  2KLI A;  2P7J A;  2VLG A;  4GD8 A;  4OPY A;  5G18 A;  5CGW A;  5FEG A;  1I2W A;  3IHB A;  3CZD A;  3T12 B;  2Q0O A;  4O0P A;  4GS9 A;  5GL9 A;  2EFX A;  3H7W B;  1NWZ A;  1ZG6 A;  3DTK A;  4UEY A;  2ZQ9 A;  1YLJ A;  3NEC A;  1XP4 A;  3VFH A;  5IU1 A;  4WZ4 A;  1IKI A;  5CRF A;  3CLO A;  4Q0I A;  2PT7 A;  3P09 A;  5EPH A;  1Y54 A;  5GHX A;  4IED A;  4RX3 A;  2OLU A;  1ZG4 A;  4HH2 A;  3PBR A;  3FKV A;  4U0T A;  4DXC A;  4QWO A;  4YWZ A;  1BZA A;  4R38 A;  3A0V A;  1PFL A;  3QNC A;  3SOI A;  4UQI S;  3ZG0 A;  5F68 A;  1GHM A;  2XR0 A;  2P9V A;  3KSF A;  4Y15 A;  3SH7 A;  1K0K A;  3R7W A;  3ZFZ A;  3VMA A;  2FFY A;  4P6Z M;  1FSY A;  4BD0 A;  1KVL A;  3NHQ A;  5HPI A;  4IBR A;  4K0W A;  2WZZ A;  4LEN A;  1CQA A;  3Q7V A;  4GHI A;  5E2F A;  4X69 A;  4CJN A;  3E2L A;  3ULF A;  3BLM A;  3MXR A;  3KX0 X;  1S67 L;  2WGW A;  4OP5 A;  3FV7 A;  1LSW A;  2E8J A;  1S66 L;  3G32 A;  1H5X A;  5IS1 A;  4MLL A;  4HOI A;  3FZC A;  1BLH A;  4JF6 A;  1BUL A;  4II7 A;  2VGK A;  2AVX A;  5FQQ A;  1PWG A;  3MFX A;  4OOM A;  2IWC A;  1IOU A;  2O0Y A;  4I39 A;  2ZC7 A;  3W8K A;  3OC2 A;  3H7W A;  2Y2Q A;  5A91 A;  4H8R A;  2FFF B;  3LUQ A;  2X02 A;  1CI9 A;  4MEZ A;  1S1Y A;  3KYQ A;  2UWX A;  2XFT A;  1GSV A;  3MKE A;  3O5Y A;  4PAU A;  3U4L P;  3PTE A;  4X1M A;  3O3V A;  3BFE A;  3UY6 A;  1K54 A;  2G7U A;  3M2K A;  4JXV A;  3T4K A;  2Y79 A;  3PAG A;  4LPZ A;  4RA7 A;  4AFI A;  1ACF A;  5CTM A;  1C3B A;  2HJ9 C;  5G4Y A;  4X6T A;  2WK0 A;  1MWS A;  3C8C A;  4KZ8 A;  4P0M A;  5I94 A;  4UA7 A;  2UV0 E;  3FKW A;  4CPK A;  1H0M A;  1FCO A;  3M6H A;  2VV6 A;  5FAS A;  1JWP A;  2O99 A;  1VQQ A;  3G31 A;  3T4O A;  3PXP A;  4WBG A;  4GD6 A;  2ZQD A;  3CG5 A;  3L7H A;  4JGO A;  1SKO B;  2RL3 A;  2V9A A;  2VGJ A;  1N9B A;  4QU3 A;  3W2Z A;  4LRZ E;  3BRM A;  2Z6C A;  1FSW A;  3QP5 A;  3PBQ A;  1S4S A;  3MZD A;  3MQ0 A;  3IF5 A;  1LI9 A;  2QJ7 A;  3RXW A;  5AQA A;  2WAE A;  3VP4 A;  1BUE A;  3G6O A;  2R78 A;  3N6I A;  4Y0O A;  4YFM A;  3H9W A;  2HF6 A;  1YKD A;  1XGI A;  1EW0 A;  3Q1F A;  3KSI A;  4DKI A;  5KIZ A;  5GLD A;  2IWB A;  4JGR A;  2VK3 A;  1P9W A;  2Y2K A;  4ZDX A;  2Q9N A;  4WEL A;  3EQU A;  4YNR A;  1Q2Q A;  5HWV A;  3VOZ A;  3JVV A;  1W63 M;  2H0T A;  2OV5 A;  5KZH A;  1SKF A;  3ZVW A;  2PR5 A;  4MN5 A;  3LEZ A;  4CQH A;  3HUN A;  1W7F A;  3GR2 A;  3TW8 A;  3NCK A;  2QWS A;  3T4Q A;  5C5K A;  3VFF A;  1NYM A;  4HP9 A;  2V1B A;  2PD8 A;  2XF3 A;  4DXB A;  1OTE A;  4BD1 A;  4GJ4 A;  3ISG A;  4BWI A;  4IUK A;  3HLB A;  1IKG A;  4Q0H A;  1FOF A;  2IWD A;  2H0Y A;  4RQ9 A;  1XJ2 A;  2J8Y A;  1AWI A;  2WGV A;  3E0Y A;  2PD7 A;  3NDG A;  4FSF A;  5TJJ A;  2VZW A;  3PYP A;  3CI6 A;  1L0F A;  2WYX A;  4G3W A;  4PPR A;  1S1Z A;  2HP6 A;  3TRC A;  2XRO A;  1MWT A;  3BY8 A;  3EQV A;  4MN7 A;  4HQA A;  2PRF A;  2L0W A;  2ZQA A;  3C7V A;  4OQ0 A;  4B9O A;  2L4R A;  1IYQ A;  3RH8 B;  2INW A;  1TEM A;  2WKE A;  4KZ3 A;  2JC7 A;  2ZM8 A;  5HDD A;  4I5S A;  5FAP A;  1F2K A;  5DTT A;  3E98 A;  3HJI A;  5HD5 A;  2ZQ7 A;  4JF4 A;  3BLS A;  1IFQ A;  4Y7P A;  3IXH A;  4KG6 A;  4BMW A;  4R23 A;  3UPO A;  4S2P A;  1LSX A;  3DBA A;  1N9L A;  5A92 A;  5CEC A;  4B4X A;  5HL6 A;  4GKU A;  4OLD A;  3T1R A;  4IUH A;  4KG5 A;  2O9C A;  4NET A;  5F69 A;  4E3L A;  1QME A;  1PNE A;  4PHT A;  1P0Z A;  3SS5 A;  4XT2 B;  5FI6 A;  4JXG A;  4B88 A;  1I2S A;  1GHP A;  4R1G A;  4D60 A;  2XD1 A;  1RGY A;  4ESP A;  4BBV A;  1K38 A;  5KSC A;  2H10 A;  2HJE A;  4OPZ A;  1OPX A;  1TVF A;  4GLQ A;  4E3K A;  4PM8 A;  2XA7 M;  3VE4 A;  2ZMA A;  2ZC3 B;  3D72 A;  2PU4 A;  4WM9 A;  3F1N B;  4BQM A;  4Y17 A;  1AXB A;  4HHD A;  4RVA A;  4X1L A;  2GNX A;  3A3E A;  2W3H A;  3GV9 A;  4ZRR A;  3MQQ A;  4N1X A;  3MJQ A;  1XA7 A;  1DP6 A;  3D3O A;  3UB6 A;  3C4P A;  3IWO A;  4I3J A;  3MF0 A;  4S2O A;  3S4X A;  5EOE A;  3LY3 A;  2EFU A;  1IYO A;  3QP6 A;  1S6R A;  4GS9 B;  4PM9 A;  3E4Q A;  4BJP A;  3A3I A;  4CLC E;  4DRT A;  3AGF A;  2NUP C;  1PZO A;  5FQJ A;  3CJM A;  4ZJ3 A;  3G34 A;  1GSW A;  2Y8H A;  4OOY A;  2PAV P;  3LIC A;  4HI4 A;  2WAF A;  5A90 A;  1PWC A;  2J9P A;  5HX9 A;  1H8Y A;  4I3I A;  1F9I A;  3GMW A;  3NUL A;  5HZH A;  1K57 C;  5HDC A;  2WUQ A;  3QP2 A;  3L9K A;  3BFD A;  4IJG A;  4IHQ A;  3OPP A;  4OQG A;  4DE0 A;  1SDE A;  2QPN A;  4Y0T A;  4HIA A;  5DFY A;  4DJ3 A;  1TD5 A;  4WL9 A;  4NXF A;  3HLE A;  1N9N A;  3C4O A;  4NG2 A;  2P04 A;  1UGU A;  1MWR A;  1FQG A;  5EE8 A;  2W1R A;  3OCN A;  3SH9 A;  4DDS A;  4QY5 A;  2Y91 A;  2P9V B;  1QMF A;  2J3T C;  5CER A;  4XT2 A;  1PYY A;  2A24 B;  2FH5 A;  3LEQ A;  1J9M A;  3LR0 A;  3OBF A;  4EU0 A;  1W8Y A;  5E2G A;  4DDY A;  1L0D A;  3LR4 A;  3E4O A;  4BL2 A;  2EXB A;  4BBU A;  2DRW A;  3B42 A;  1STZ A;  3N4I A;  5FAQ A;  3F1N A;  2V2F F;  5U47 A;  1ERM A;  1K25 A;  3F1O B;  1V9Z A;  3E2K A;  3HCY A;  3HBR A;  3FG8 A;  4MN6 A;  5GLB A;  2XLN A;  5L10 A;  3VV4 A;  5HL1 A;  1G68 A;  4LV0 A;  3NC8 A;  2D02 A;  4R6L A;  4WEJ A;  3EGX C;  1TF1 A;  5GHZ A;  3UPN A;  1OJG A;  5JYP A;  1G5U A;  3UMD A;  2WKH A;  2HP9 A;  3OCL A;  1F5M A;  2L1M A;  1BLS A;  4JXS A;  4UHU A;  1NZU A;  1H3Q A;  3HLC A;  5A93 A;  3WWX A;  3IF6 A;  3A3F A;  4EQ1 A;  3MS6 A;  3MXS A;  3FPV A;  1Y4O A;  5I5L A;  3P98 A;  1YLZ A;  2ZC6 B;  3LIA A;  4JGQ A;  5AQ7 A;  3C30 A;  3P7N A;  2XEP A;  4ETX A;  5FI2 A;  1XA1 A;  2VGL M;  3VP3 A;  1Q2P A;  1FR6 A;  2ZC5 B;  4JPM A;  3WRZ A;  3N7W A;  5FI7 A;  2OWJ A;  3IX3 A;  3N8L A;  4QHC A;  3CAX A;  4EBN A;  4OKP A;  1DJA A;  5FEF A;  2A24 A;  2Z2L B;  4LCL A;  1IYP A;  2Y2H A;  3A3D A;  3LO7 A;  4B4Z A;  5DF9 A;  3R4K A;  2QYB A;  2K31 A;  1OJ5 A;  4KG2 A;  1WYC A;  3T4T A;  2HDS A;  1YLY A;  2PHY A;  4WYY A;  1TS7 A;  3F1O A;  3G2Y A;  1SHV A;  1I5Q A;  3V5M A;  4EXO A;  1HZO A;  1L3L A;  3NIA A;  2Y2M A;  2J3T D;  5J3W A;  5TFQ A;  2EX9 A;  2O9B A;  1E25 A;  2KOI A;  5KMW A;  2EX6 A;  4XXR A;  3JPU A;  2M7V A;  2XFS A;  1LSV A;  3V3S A;  1Z6F A;  4LV3 A;  5F5Y A;  2VKS A;  3V3R A;  1VB6 A;  1MWU A;  1W79 A;  2EX2 A;  5L2F A;  2I72 A;  5DTK A;  3UNW A;  3T1S A;  1KVM A;  3SH8 A;  1CJF A;  2HDR A;  2JCH A;  2W3F A;  5EV0 A;  4ZTK A;  4S2I A;  3T50 A;  3DTE A;  3IF6 C;  4G3K A;  1PIO A;  3NBL A;  2J3W A;  4GW9 A;  5DJT A;  4EWF A;  4NKP A;  1ES5 A;  4DN0 A;  4KQO A;  1FCN A;  1VHM A;  1YAX A;  1ZC2 A;  4L0L A;  4JF5 A;  3KSH A;  3ZYT A;  4PM6 A;  3IXD A;  2ZC4 B;  5CXW A;  4OON A;  2Y2J A;  4L9F A;  1NRJ A;  3CWF A;  5E2E A;  1XFN A;  5F82 A;  2Z6D A;  3M2J A;  3QHY A;  1YSP A;  2P08 A;  4QB8 A;  1G28 A;  5F6A A;  1FIL A;  1JVJ A;  3OZH A;  5HAP A;  3IX4 A;  1PRQ A;  3HLW A;  3IH9 A;  3SZT A;  3VP2 A;  2BG1 A;  1TS8 A;  2Y2L A;  2OAQ 1;  3HRE A;  3NOP C;  4KZ9 A;  3ZVT A;  3EWK A;  5E2H A;  2WKP A;  1G6A A;  3IX8 A;  2J9O A;  4I3A A;  4HNB A;  5BOH A;  2JKF A;  3RFB A;  2XSS A;  5CHU A;  4MCW A;  5GHY A;  2I9V A;  3UB9 A;  5D3O A;  1XPB A;  2WKR A;  3BFG A;  1IEM A;  5EUA A;  1E3U D;  1T1A A;  2OLV A;  4OPR A;  3H82 B;  2ZBB A;  3S1Y A;  4YIN A;  5HPF A;  4KQD A;  5HW3 A;  3RTY A;  2B5R A;  4HES A;  5DJU A;  4YOF A;  4S2K A;  2CMN A;  1KGE A;  3C7U A;  1WA9 A;  1FR1 A;  2ZM0 A;  2HDU A;  5EVL A;  1NRF A;  2JBF A;  1K4E A;  4P6B A;  5HAI A;  2QKP A;  4ETZ A;  4F94 A;  5EVE A;  5FAO A;  5G4Z A;  4PM7 A;  3WS2 A;  4QY6 A;  2W0N A;  2G2U A;  1KDW A;  1OTB A;  3G2Z A;  1H8Z A;  3EOI A;  3EEH A;  5FQ9 A;  1A0K A;  3Q07 A;  2DMW A;  4WMC A;  5CTN A;  4MDZ A;  4HBT A;  2VEA A;  5DKK A;  1XKZ A;  3CUE C;  1VM1 A;  5KSH A;  4S2L A;  3ZNY A;  4KZ5 A;  4NEE D;  2RCX A;  3SW1 A;  2GJ3 A;  4ZJ2 A;  3BQ8 A;  5HAR A;  2DNS A;  5DTS A;  1M40 A;  5MC7 A;  3K3D A;  1E4D A;  1NXY A;  4CLC D;  3C2W A;  4FUW A;  1J3W A;  3BQA A;  1LT0 A;  3IXG A;  1MZU A;  1WE4 A;  2ZL1 B;  3EGD C;  1NY0 A;  4GDB A;  3SS3 A;  3S7Q A;  1YLT A;  2PYR A;  1DJB A;  2HDQ A;  1KE0 A;  2VV8 A;  3PBS A;  3QP4 A;  4Q0J A;  4EEP A;  1H8M A;  2ZMF A;  1RGZ A;  5HAQ A;  2V1Z A;  3TG9 A;  1UWN X;  3LIB A;  3H82 A;  3MFD A;  4C75 A;  4OP8 A;  2V0U A;  2W1T B;  1MKM A;  4C6Y A;  1ESU A;  1PZP A;  3C38 A;  5IT5 A;  1L2S A;  3HJK A;  1FIK A;  1RCJ A;  1K57 A;  1YMS A;  3GSG A;  5CX7 A;  1NZO A;  3C5A A;  4MBF A;  1LHY A;  2Y2P A;  1N9O A;  5CED A;  4QJG A;  3UPP A;  4JXW A;  4UAA A;  5AVE A;  4XUX A;  3IXB A;  3ITA A;  2B18 A;  4LV1 A;  4KQR A;  3W4Q A;  3FWL A;  2H5S A;  1GHI A;  1OT6 A;  2KX6 A;  4B93 A;  2GZA A;  4K08 A;  2OSU A;  3UO9 A;  2R9X A;  1K6R A;  2XA7 S;  1UWP X;  3DW0 A;  5J7E A;  2QZ6 A;  3HUM A;  3P01 A;  1ZHH B;  5TGF A;  2YKH A;  4Y0U A;  2X01 A;  1LL9 A;  5FDH A;  4DE1 A;  1GSX A;  3F1P B;  2D01 A;  4GOG A;  4R0Q A;  2QHK A;  3ZQ5 A;  2GDN A;  3V50 A;  3UME A;  4DJ2 A;  2XK1 A;  2WKI A;  3TSG A;  3FYZ A;  3MMH A;  2Y2G A;  3MZE A;  3Q7Z A;  1PI5 A;  3LGO A;  2ZL1 A;  4RYE A;  1KOU A;  2ZQC A;  4OLG A;  4Y2F A;  1ONG A;  5GLC A;  5AVF A;  3AGE A;  3BY9 A;  3PR6 A;  2QMI A;  2FZ0 A;  4KZ4 A;  2JE5 A;  5F1G A;  1IYS A;  3IF6 B;  2W1T A;  1V9Y A;  4WEK A;  4I38 A;  5LBR A;  2OWH A;  3BEB A;  1OT9 A;  3QNB A;  2V8F A;  5J4E A;  5FQI A;  4UA6 A;  4R3B A;  3G30 A;  4OQH A;  4HH3 A;  4R70 A;  3T1X A;  3S7O A;  2E8I A;  2W3E A;  1XXM A;  4N9K A;  1P9R A;  2JN7 A;  3OPL A;  3JYI A;  3KO6 A;  5FL3 A;  3LYX A;  4CLC B;  4MNR A;  4FD8 A;  4EER A;  3UE6 A;  5HWW A;  1TS0 A;  4HP4 A;  2HZ5 A;  1KGF A;  1CEF A;  5HSQ A;  3PBT A;  4KUK A;  4PKY A;  4Z9Q A;  3GVB A;  1YLW A;  3WS0 A;  4GN2 A;  2BLS A;  3NY4 A;  4FH2 A;  3ZG5 A;  3F1P A;  1E3U A;  1SCW A;  4H6J B;  2VV7 A;  5EVI C;  5JYO A;  4HJ4 A;  3NJA A;  1NYY A;  4HBU A;  2NUT C;  3HLD A;  1BLP A;  2HGV A;  4WMC D;  3S22 A;  2EXA A;  3RJU A;  4LLO B;  5CHM A;  1XGJ A;  3T4L A;  2XGN A;  2BAS A;  2XRN A;  2V8C A;  2ACG A;  2ZOI A;  1DY6 A;  3LI9 A;  1Z09 A;  4HEF A;  5EOO A;  4EQI A;  3SS4 A;  3UDX A;  3ITB A;  4DE3 A;  2M7U A;  4N9L A;  3WS5 A;  2BTF P;  1KE3 A;  3A3J A;  3HL9 A;  3MBZ A;  1ZKJ A;  2HV1 A;  1YMX A;  3O87 A;  4HY8 A;  3UB7 A;  4WZ5 A;  5CEB A;  2W3D A;  4S2M A;  4S2J A;  4OQI A;  2VGL S;  3V67 A;  4JKT A;  3HVF A;  1ES2 A;  3WS4 A;  2VX8 A;  4FCF A;  2ZMV A;  4X56 A;  3V39 A;  1O07 A;  3BWL A;  3TJZ C;  4EW7 A;  3B3X A;  4N92 A;  4P6Z S;  4R3J A;  1XX2 A;  4CLC A;  1PW8 A;  1W8Q A;  1HLU P;  3ICY A;  2KDK A;  4C3Q A;  1K56 A;  1YQS A;  4QD4 A;  2Y4A A;  3NOT C;  1L0E A;  3QP8 A;  4G3V A;  1NJ4 A;  3DWZ A;  2W27 A;  3BEC A;  4A5R A;  1TS6 A;  2O9A A;  2JKG A;  2DCF A;  1N4O A;  3LCE A;  5K5B A;  3BYD A;  4KUO A;  4UQI M;  4H6J A;  4R3A A;  4WUJ A;  4O8G A;  3ZG9 B;  4N1H A;  3O88 A;  5AJG A;  2PR6 A;  2K2N A;  4M3K A;  2PYP A;  1XJ4 A;  3GRJ A;  1PW1 A;  4FTX A;  1MPL A;  3MXQ A;  3IT9 A;  4BL3 A;  2K7S A;  5F83 A;  2ZJ9 A;  2ZM2 A;  2JHE A;  5EVI D;  4XUZ A;  1OTD A;  1LL8 A;  3FPW A;  1S0W A;  3DTM A;  5A8B A;  2XD5 A;  4LGW A;  3QP1 A;  1DP9 A;  1YPR A;  4RX2 A;  4WZ5 C;  5F1F A;  1ES3 A;  3T4S A;  2WKQ A;  4DMZ A;  4GZB A;  1S4R A;  1SZV A;  3S7P A;  1DJC A;  5FAT A;  3DWK A;  4QPR A;  2Y55 A;  3LI8 A;  1MBL A;  3A0R A;  2CC1 A;  1OTA A;  5DF7 A;  1GA0 A;  1MC0 A;  1ESI A;  4HJ6 A;  5DVA A;  3MSH A;  3A0S A;  5M19 A;  4KZB A;  3E4P A;  2V20 A;  4CLC C;  5FQK A;  3IS2 B;  4MMN A;  2XDM A;  4U3T A;  4LV2 A;  4O01 A;  4OH0 A;  2P74 A;  4OPQ A;  2B02 A;  3FC7 A;  2IA2 A;  5IHV A;  3PAE A;  4FOF A;  4K91 A;  3VOY A;  3MKF A;  1BT5 A;  4KQQ A;  4EES A;  1D7E A;  1BTL A;  1D1J A;  3D4F A;  4X53 A;  4KEN B;  5HD3 A;  1TDL A;  1W63 Q;  4EUV A;  5J8X A;  3VOL A;  3IWI A;  3W4O A;  1JTD A;  3KYE A;  3VSL A;  5M18 A;  3CUE A;  3GDI A;  5FDS A;  4Y13 A;  4O7D A;  1DP8 A;  4PKY G;  4JLF A;  2B95 A;  4E6W A;  3S7N A;  1JTG A;  4HJ3 A;  1ODV A;  3LIE A;  1T19 A;  5HDS A;  3G4P A;  3IBR A;  5HWT A;  3Q81 A;  4EBP A;  4GB7 A;  3PBO A;  1ONH A;  4Q8I A;  4EBL A;  3VSK A;  3ZG7 B;  1JNU A;  2Y2O A;  2YKF A;  3BW6 A;  4ZAM A;  1KDS A;  2PBY A;  3OOV A;  3PBN A;  3VP0 A;  3N8R A;  3KSG A;  4M4X A;  5AQ9 A;  2VJW A;  5L8M A;  3DAV A;  1WYB A;  2GX5 A;  2JKT I;  2HP5 A;  1VET B;  4S2N A;  1HD8 A;  2M1C A;  3EEA A;  4KZA A;  3VE3 A;  3DTI A;  1CK3 A;  4P85 A;  5DFX A;  2ZQ8 A;  1RP5 A;  1K6S A;  3NI9 A;  1CEG A;  4X68 A;  1PI4 A;  1K54 C;  4EV4 A;  3OLO A;  5GLA A;  5FA7 A;  3AGD A;  1JWZ A;  1HTZ A;  3I7J A;  2ZLY A;  3IS2 A;  4IBX A;  1DRM A;  1YT4 A;  3W4P A;  3BFF A;  1LI0 A;  3LID A;  3IHA A;  4KZ6 A;  3G35 A;  1GA9 A;  3MZF A;  1VEU B;  4LRY C;  3UDF A;  1U60 A;  2VA0 A;  3OPR A;  3BFC A;  5EVI B;  4BBT A;  5TBM B;  1XFQ A;  1BLC A;  2WZX A;  4NK3 A;  4E3O A;  1K56 D;  3LFV A;  3WS1 A;  3ZNT A;  4Z1W A;  3CPT B;  1EI5 A;  3UE3 A;  3VP1 A;  3IQA A;  2Z2M B;  3GQZ A;  4IVK A;  4IVI A;  5EFW A;  5CHJ A;  1TDG A;  4E3N A;  1BSG A;  1LLB A;  2X71 A;  2C6W B;  1K55 A;  3CIT A;  1MXO A;  4ARZ B;  1NLZ A;  1ES4 A;  4E6X A;  3KYZ A;  1HVB A;  5L09 A;  4P87 A;  3PHY A;  1SKO A;  4WLA A;  5TR7 A;  4WN5 A;  4Y5F A;  3D9Y A;  3UN7 A;  4S2N C;  4NXG A;  1ERO A;  2JKT M;  3IWQ A;  3WRT A;  1NLY A;  3U2A A;  3BJN A;  5DKL A;  2PU2 A;  1O7E A;  4JGP A;  4EUZ A;  1VET A;  2QJ5 A;  3K2N A;  4E3J A;  1KE4 A;  3UB5 P;  2OAP 1;  2EWW A;  3UDI A;  1ALQ A;  2R9W A;  4X25 A;  2HPB A;  2J7V A;  3LIF A;  3UE0 A;  4ZJ1 A;  5HFO A;  2Q9M A;  1SDN A;  3ZCZ A;  2XH9 A;  3CMZ A;  4X55 A;  4OVD A;  4UA9 A;  2MJ6 A;  3B47 A;  1D06 A;  1K4F A;  1F98 A;  4OOL A;  3MR0 A;  4F3L B;  3GEC A;  1CI8 A;  4LFU A;  1W5D A;  4MBH A;  3NOU C;  2JKR I;  1L0G A;  5L07 A;  5FSR A;  1KGG A;  1VEU A;  3OPH A;  3T1Q B;  3LR5 A;  3B33 A;  2EX8 A;  4GDN A;  1GCE A;  3BM6 A;  1EWZ A;  2H28 A;  5EVI A;  3GTC A;  3ZG8 B;  1OME A;  4Y3I A;  5TBM A;  3T4J A;  5CGS A;  2EA9 A;  4DF6 A;  3ZHH A;  2V0W A;  3IH8 A;  1K55 C;  2Y2I A;  3CHW P;  5FQM A;  3CPT A;  4ID4 A;  3IBJ A;  2PDR A;  4FH4 A;  1XJ3 A;  2A2L A;  4NXB A;  4ARZ A;  3M6B A;  4DE2 A;  4BLM A;  1PWD A;  4JBF A;  1X0O A;  3HLG A;  3JVU A;  4L9E A;  3LY4 A;  1T18 A;  4R4R A;  3TOI A;  4NXE A;  4ME4 A;  2LB5 A;  4GNU A;  4MBK A;  5EM0 A;  1G6O A;  2WGI A;  3RXX A;  4L9G A;  4R4S A;  4EET B;  2W3G A;  3N8S A;  3HLF A;  1CF0 A;  2ZOH A;  2C5W B;  2A3U A;  1Y28 A;  3NDE A;  1YSQ A;  4PM5 A;  4E04 A;  1MY8 A;  3HUO A;  5CGX A;  3ZGA B;  5AQB A; 
#chains in the Genus database with same CATH homology
 2W27 A;  4GCZ A;  1TS6 A;  2O9A A;  2XSS A;  3E98 A;  2OOL A;  4MCW A;  4EEU A;  3HJI A;  2I9V A;  5HD5 A;  3UB9 A;  1P97 A;  2LB9 A;  2WKR A;  1IFQ A;  5K5B A;  1ZTU A;  4KUO A;  4WF0 A;  4BMW A;  4UQI M;  4H6J A;  3UB8 A;  1LSX A;  3DBA A;  1T1A A;  1N9L A;  3H82 B;  2V1A A;  2ZBB A;  4R3A A;  5HPF A;  4KQD A;  4WUJ A;  4O8G A;  5HL6 A;  1T1B A;  3TE8 A;  2JKR M;  3RTY A;  4F3L A;  5DJU A;  4IUH A;  5AJG A;  4YOF A;  2PR6 A;  3R7W B;  3K3C A;  2CMN A;  2K2N A;  2PYP A;  1XJ4 A;  3MQO A;  2O9C A;  1BYW A;  2EWV A;  3MXQ A;  5F69 A;  2J80 A;  1WA9 A;  4PHT A;  1OTI A;  2K7S A;  1P0Z A;  4LRX C;  1T1C A;  4GHI B;  2JHE A;  4XT2 B;  1OTD A;  3LR3 A;  1LL8 A;  2QKP A;  3FPW A;  5A8B A;  4BBV A;  4ETZ A;  2HJE A;  1DP9 A;  1OPX A;  4GLQ A;  5G4Z A;  2XA7 M;  3VE4 A;  3T4S A;  2WKQ A;  3D72 A;  2W0N A;  3F1N B;  4DMZ A;  1S4R A;  3S7P A;  1OTB A;  1XJ6 A;  2KLI A;  2P7J A;  2VLG A;  4QPR A;  3LI8 A;  4HHD A;  3RFB A;  3A0R A;  2GNX A;  3EEH A;  3EOI A;  1OTA A;  2W3H A;  2DMW A;  3MQQ A;  4ZRR A;  1MC0 A;  4MDZ A;  4HJ6 A;  3MJQ A;  2VEA A;  4O0P A;  1DP6 A;  4GS9 A;  5DKK A;  3A0S A;  3CUE C;  3H7W B;  3D3O A;  1NWZ A;  3UB6 A;  5KSH A;  3E4P A;  4CLC C;  4UEY A;  4I3J A;  3MF0 A;  3IS2 B;  4MMN A;  4NEE D;  4O01 A;  3SW1 A;  2B02 A;  5IU1 A;  3FC7 A;  2GJ3 A;  2IA2 A;  3BQ8 A;  4FOF A;  4EES A;  1D7E A;  4BJP A;  5MC7 A;  4GS9 B;  3CLO A;  3E4Q A;  3K3D A;  4CLC E;  4Q0I A;  4CLC D;  2NUP C;  3C2W A;  2PT7 A;  5HD3 A;  3BQA A;  1W63 Q;  1LT0 A;  4EUV A;  3VOL A;  1GSW A;  1MZU A;  2Y8H A;  3EGD C;  3LIC A;  4HI4 A;  3CUE A;  3GDI A;  4HH2 A;  3PBR A;  4I3I A;  3S7Q A;  1F9I A;  2PYR A;  5HZH A;  2VV8 A;  1DP8 A;  3PBS A;  5HDC A;  4Q0J A;  4PKY G;  4IJG A;  4YWZ A;  4EEP A;  4IHQ A;  1H8M A;  2ZMF A;  3S7N A;  4R38 A;  3A0V A;  4HJ3 A;  1ODV A;  1UWN X;  3LIB A;  3H82 A;  3LIE A;  1T19 A;  4UQI S;  5HDS A;  4HIA A;  5DFY A;  3IBR A;  4DJ3 A;  2V0U A;  2W1T B;  5F68 A;  5HWT A;  1TD5 A;  1MKM A;  4WL9 A;  3KSF A;  4NXF A;  3PBO A;  3R7W A;  3C38 A;  5IT5 A;  3HJK A;  1N9N A;  4P6Z M;  5CX7 A;  2P04 A;  1UGU A;  1JNU A;  3NHQ A;  2W1R A;  2YKF A;  3OCN A;  5HPI A;  1N9O A;  3BW6 A;  2J3T C;  4GHI A;  3OOV A;  3PBN A;  4XT2 A;  3ULF A;  2A24 B;  2FH5 A;  5AVE A;  3LR0 A;  3OBF A;  4EU0 A;  3LR4 A;  3KX0 X;  3KSG A;  4M4X A;  1S67 L;  2B18 A;  2VJW A;  3E4O A;  5L8M A;  1LSW A;  2GX5 A;  2JKT I;  1S66 L;  2M1C A;  3EEA A;  1OT6 A;  4BBU A;  2KX6 A;  3VE3 A;  4B93 A;  2GZA A;  3B42 A;  4K08 A;  5IS1 A;  1STZ A;  3F1N A;  2XA7 S;  1UWP X;  4HOI A;  5DFX A;  3F1O B;  1V9Z A;  5J7E A;  3P01 A;  3HCY A;  1ZHH B;  4II7 A;  3FG8 A;  2YKH A;  3MFX A;  4MN6 A;  4OOM A;  1IOU A;  2O0Y A;  1GSX A;  4I39 A;  3F1P B;  2D01 A;  3OC2 A;  3OLO A;  3VV4 A;  3H7W A;  2QHK A;  3IS2 A;  3ZQ5 A;  1DRM A;  3LUQ A;  2D02 A;  3UME A;  4R6L A;  4DJ2 A;  4WEJ A;  3EGX C;  1TF1 A;  1OJG A;  1S1Y A;  3KYQ A;  3LID A;  3UMD A;  1GSV A;  3O5Y A;  4PAU A;  3MMH A;  3OCL A;  1F5M A;  4LRY C;  2L1M A;  2VA0 A;  2G7U A;  4BBT A;  1KOU A;  1H3Q A;  5TBM B;  4Y2F A;  5AVF A;  3T4K A;  2Y79 A;  1XFQ A;  4EQ1 A;  4LPZ A;  3FPV A;  3LFV A;  5I5L A;  3BY9 A;  4Z1W A;  3PR6 A;  4AFI A;  2FZ0 A;  3LIA A;  4JGQ A;  3C30 A;  3UE3 A;  2HJ9 C;  3P7N A;  5EFW A;  2W1T A;  1V9Y A;  5G4Y A;  4ETX A;  4WEK A;  4I38 A;  2VGL M;  5LBR A;  3CIT A;  2OWH A;  4ARZ B;  1NLZ A;  3C8C A;  1OT9 A;  3KYZ A;  5J4E A;  3PHY A;  4WLA A;  2OWJ A;  4WN5 A;  4Y5F A;  4HH3 A;  4R70 A;  2VV6 A;  3S7O A;  3CAX A;  2W3E A;  2O99 A;  1P9R A;  2JN7 A;  3T4O A;  4NXG A;  2A24 A;  2JKT M;  3PXP A;  1NLY A;  3KO6 A;  4JGO A;  3U2A A;  3BJN A;  5DF9 A;  5DKL A;  2V9A A;  3R4K A;  2QYB A;  5FL3 A;  3LYX A;  4JGP A;  4CLC B;  2K31 A;  2QJ5 A;  1OJ5 A;  4EER A;  3K2N A;  3UE6 A;  3W2Z A;  5HWW A;  3T4T A;  4LRZ E;  1TS0 A;  2Z6C A;  4HP4 A;  2OAP 1;  2EWW A;  2PHY A;  3PBQ A;  1S4S A;  1TS7 A;  3F1O A;  3MQ0 A;  2QJ7 A;  5HSQ A;  3PBT A;  4KUK A;  4PKY A;  4EXO A;  2J3T D;  5J3W A;  3LIF A;  2O9B A;  3G6O A;  2KOI A;  2R78 A;  3H9W A;  2HF6 A;  3F1P A;  2M7V A;  1YKD A;  1EW0 A;  4H6J B;  1LSV A;  2VV7 A;  3KSI A;  5KIZ A;  4HJ4 A;  5F5Y A;  2VKS A;  2MJ6 A;  3B47 A;  4JGR A;  1D06 A;  1VB6 A;  3NJA A;  1P9W A;  1F98 A;  4OOL A;  3MR0 A;  4WEL A;  3EQU A;  4YNR A;  2NUT C;  2HGV A;  4F3L B;  3GEC A;  5HWV A;  4LLO B;  3NOU C;  2JKR I;  2W3F A;  3T4L A;  2BAS A;  3T50 A;  4G3K A;  3JVV A;  2XRN A;  1W63 M;  3LR5 A;  2J3W A;  3B33 A;  2ZOI A;  3LI9 A;  4GW9 A;  2H28 A;  5DJT A;  4NKP A;  2PR5 A;  4MN5 A;  4Y3I A;  5TBM A;  4CQH A;  3T4J A;  4DN0 A;  2EA9 A;  4KQO A;  2M7U A;  2V0W A;  3TW8 A;  1VHM A;  2QWS A;  3T4Q A;  5C5K A;  1YAX A;  2HV1 A;  4L0L A;  3IBJ A;  2PDR A;  1XJ3 A;  2A2L A;  3KSH A;  4HP9 A;  2V1B A;  2PD8 A;  3ZYT A;  4NXB A;  4L9F A;  1OTE A;  4HY8 A;  3UB7 A;  1NRJ A;  4GJ4 A;  4BWI A;  4ARZ A;  4IUK A;  2W3D A;  3CWF A;  4Q0H A;  1XFN A;  2VGL S;  1X0O A;  3V67 A;  2Z6D A;  3JVU A;  4L9E A;  4RQ9 A;  1XJ2 A;  1T18 A;  2VX8 A;  1YSP A;  2P08 A;  1G28 A;  4NXE A;  5F6A A;  3E0Y A;  2PD7 A;  4ME4 A;  2LB5 A;  4FSF A;  5TJJ A;  1G6O A;  2VZW A;  2ZMV A;  4L9G A;  3PYP A;  3CI6 A;  4EET B;  3BWL A;  2W3G A;  1S1Z A;  4G3W A;  3TJZ C;  4EW7 A;  3TRC A;  2ZOH A;  2XRO A;  3BY8 A;  3EQV A;  4MN7 A;  4HQA A;  1TS8 A;  2OAQ 1;  4P6Z S;  1Y28 A;  2L0W A;  4B9O A;  3NOP C;  4CLC A;  2L4R A;  3RH8 B;  3ICY A;  2INW A;  2KDK A;  3EWK A;  1YSQ A;  2WKP A;  3NOT C;  4E04 A;  4I3A A;  4G3V A;  4HNB A;  5HDD A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...