3OBFA

Crystal structure of putative transcriptional regulator, iclr family; targeted domain 129...302
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
SNAEERRVAYPVLRELTERTGETSALMVWNGNESMCVEQIPSRHQVKHLAPLGARYNEALSSSVQVFLASENEDRVRQLLRSGSITLTGVDEDAVEAYLLRLKESMERGWAVNFGETSIEEVGVASPVYDHRGNMVASVLIPAPKFRVSQDTLNSLGEACAAAAAKVTTRLGGRAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator, IclR family
publication title Crystal structure of putative transcriptional regulator, IclR family; targeted domain 129...302
rcsb
source organism Arthrobacter aurescens
molecule tags Transcription regulator
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01614 IclR Bacterial transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3obfA00
2O99A 2W1RA 2XROA 4MMNA 5DFXA 2O9BA 4EU0A 2W3FA 4FOFA 4IJGA 2O9CA 4O01A 4ME4A 2ZMFA 1F5MA 4R6LA 1VHMA 3OBFA 5HL6A 4QPRA 3NOPC 4O8GA 2W1TB 2K2NA 2G7UA 3E98A 4LRYC 5HPFA 4Y2FA 3W2ZA 3KSFA 5L8MA 2VKSA 2IA2A 4Z1WA 3S7QA 5DFYA 3HCYA 3KSIA 2M7VA 5K5BA 1MKMA 4DMZA 5HPIA 3S7NA 4ETXA 4YOFA 2HGVA 3ZQ5A 2W1TA 2W3EA 1YSPA 4O0PA 3NOTC 3IBJA 2OOLA 3KO6A 4BWIA 3K2NA 1MC0A 5HSQA 3D3OA 2W3GA 5TJJA 2O0YA 2M7UA 4Y3IA 4EUVA 2VEAA 1TF1A 3DBAA 3LFVA 3TRCA 4Q0IA 3O5YA 1YSQA 4Q0JA 3MF0A 2Y79A 3S7OA 3E0YA 4CQHA 4LRZE 3C2WA 3CI6A 3BJNA 1ZTUA 5I5LA 3IBRA 4GLQA 4Y5FA 2LB5A 2VJWA 5LBRA 1YKDA 4YNRA 3VV4A 1STZA 2XRNA 2W3HA 4MDZA 3RFBA 4E04A 4IUKA 3MQ0A 2GX5A 2XSSA 4GW9A 2W3DA 2KLIA 2Y8HA 2B18A 2LB9A 4DN0A 4MCWA 3G6OA 3KSHA 4MN7A 4ZRRA 2QYBA 2O9AA 5C5KA 5AJGA 3NOUC 4G3WA 2K31A 2KOIA 4LRXC 4PAUA 4G3KA 4IUHA 4G3VA 2VZWA 4R70A 3EEAA 3OOVA 3CITA 4ETZA 4RQ9A 1TD5A 3R4KA 3MMHA 3NHQA 3KSGA 4Q0HA 3S7PA
chains in the Genus database with same CATH superfamily
3LGOA 5DJUA 1PZPA 2XROA 4F94A 2O9BA 2W27A 1GA0A 2ZMFA 4QU3A 3NECA 3O86A 2ZM0A 4QJGA 3DW0A 4X1LA 2EA9A 3R7WB 1N9OA 1XPBA 2VKSA 5CGSA 3AGFA 2CMNA 3MKFA 3UPOA 5K5BA 2V20A 5A90A 1YM1A 5CTNA 4FSFA 4F3LA 2W1TA 2W3EA 4HH3A 1IYSA 1Z09A 4DXBA 1T18A 5HSQA 1T1CA 3W8KA 1JWPA 4HJ4A 2FFYA 3UB6A 4E3KA 2PBYA 2VV6A 4Q0JA 2HPBA 4KENB 4I3IA 2J3TC 1ZKJA 1BYWA 3UE6A 4NXGA 5G18A 2WGWA 5JYOA 4P6BA 5BOHA 3UDIA 5FDHA 2QYBA 4MBFA 3H82B 2KOIA 2D02A 4PM8A 4U0TA 4FD8A 2OAP1 1CF0A 3ZNTA 3FPVA 4QD4A 1XX2A 2PYPA 4WEKA 3VE3A 1NYYA 2BTFP 1LLBA 1IYPA 3BRMA 1W7FA 4PPRA 4D2OA 4NKPA 1Y54A 3G2ZA 3HLDA 1NZOA 3R7WA 1H8YA 2Q9NA 2WK0A 4MN6A 4E6WA 3F1OB 1I2WA 2Y2JA 2OLUA 4DDYA 1YLTA 4JGPA 1FR6A 2XFTA 3QNBA 5DFYA 1WA9A 3KSIA 3IH8A 4Q8IA 1K4FA 1W8QA 1GHIA 1AWIA 2WKPA 4FH2A 1CQAA 3GMWA 5F68A 4MEZA 1H8MA 4HP4A 3VOLA 1WYBA 2WUQA 3FZCA 5CRFA 3PBNA 4Y3IA 4AFIA 5DTSA 4WM9A 3L7HA 4LPZA 2EFUA 1TDGA 3S7OA 4BL2A 2Y2KA 3IWOA 1BTLA 4HESA 5CGXA 5DJTA 4S2JA 4OP8A 3LR0A 4BD1A 5A92A 1CJFA 1H5XA 5CTMA 3V39A 4XT2B 4MBKA 2J8YA 3PXPA 1K55A 1N4OA 1VM1A 3H82A 3QP2A 3N8RA 3ZCZA 1W63M 5FEGA 3BEBA 1VB6A 2VV7A 4R38A 1IOUA 5FQ9A 3R4KA 1MWUA 1VEUA 3ICYA 1YT4A 3MZDA 4MBHA 4EEPA 1YLPA 5HW3A 4OQIA 3NI9A 2ZLYA 3RJUA 2VGLM 4GKUA 2AVXA 3E4OA 3OPLA 5KSHA 3KX0X 5CERA 4I5SA 5FL3A 2GNXA 2PU4A 1T1BA 1S4SA 3F1OA 1PW8A 4OH0A 4Y2FA 1FQGA 1DP6A 2KX6A 3FV7A 3FC7A 3HCYA 1S1ZA 5IHVA 3T50A 3NDEA 1PNEA 1MKMA 1XJ4A 4PKYG 4WBGA 3NIAA 1LSWA 3A0VA 4RX2A 5FQIA 3Q1FA 2BLSA 3VFFA 4OVDA 3NOTC 4IBRA 5HDCA 1BT5A 4LV3A 1P9WA 5F1GA 3IX3A 5EE8A 2EFXA 3B33A 3VE4A 3NY4A 4EUVA 3O3VA 4JGQA 3UN7A 3HUMA 4HP9A 4WF0A 4X55A 1SDEA 1E3UD 4CPKA 1NRFA 1MBLA 2IWDA 3UDXA 2P9VB 1ZTUA 5LBRA 1YKDA 3VV4A 1M6KA 1WYCA 3O88A 3MQQA 1RGZA 5EV0A 1K57C 4XT2A 4NK3A 3RFBA 4GW9A 4UHUA 3QHYA 4GCZA 2IWCA 2ZQAA 1ALQA 3KYQA 4EQ1A 2C5WB 1G6OA 2JKRM 2P74A 2OV5A 2VZWA 3OOVA 3TSGA 4OQHA 5FQMA 1XGIA 2JHEA 3NHQA 1GSWA 3PAEA 3WS5A 1S0WA 2RCXA 1GHPA 1P9RA 3ZFZA 3EEHA 3EGDC 3A0SA 1H0MA 4B88A 4FCFA 5AVFA 2VX8A 3T4SA 4JXSA 4DXCA 4I3JA 4IHQA 1TDLA 2Y55A 3E2LA 5EPHA 1ESUA 3HBRA 1XJ3A 2HZ5A 5EOOA 1BLCA 1OPXA 3PBRA 2H0TA 5HAIA 4B93A 2W0NA 2NUTC 2E8IA 4R1GA 4EEUA 1YSPA 2QMIA 2PT7A 4E3LA 5HWWA 2XF3A 3C8CA 3PR6A 4OQGA 1FILA 3MFXA 5F6AA 3BYDA 1L3LA 3VOYA 4R3JA 3S22A 2XH9A 4GNUA 4YNRA 3N7WA 3UB9A 5A91A 3IXHA 4DKIA 3W4QA 4I3AA 4QB8A 1JTGA 1OTAA 2EX8A 5HAQA 2Q0OA 1W79A 5KZHA 2ZM2A 3T4JA 3SS3A 2WKIA 4OOMA 4G3VA 1C3BA 3EEAA 3LO7A 4NXBA 4XUXA 4GS9B 2W1RA 3N8SA 1MZUA 4EU0A 5DTKA 4R3BA 4X25A 4DE0A 1IKGA 4R6LA 3ISGA 3NDGA 5F83A 2G7UA 1ACFA 3E98A 5E2GA 4LCMA 1FCNA 4C75A 4OPYA 4Y0UA 1FCOA 1CI9A 2EXAA 5FI7A 3GECA 1LT0A 3UE1A 1CEGA 4R4SA 1JVJA 3KO6A 2PR6A 3IH9A 3TW8A 4BMWA 2M7UA 4KZ8A 3IHAA 2X71A 4II7A 1PZOA 1S1YA 4KQRA 3LIEA 2L0WA 2ZOHA 3FYZA 2HF6A 3MF0A 4Y13A 2FZ0A 2H5SA 5J4EA 1GSXA 3V3SA 3BM6A 1DY6A 1K6SA 3IHBA 3IF6B 4L9EA 1KE0A 5E2EA 4D60A 4EBLA 5FSRA 3JVVA 2PRFA 3BFFA 4MDZA 4GN2A 3FKWA 1GA9A 5E2FA 4N1HA 5E43A 3VSLA 4HBTA 3GVBA 4DJ3A 2B18A 1M40A 4HJ3A 4P87A 4K0XA 3FPWA 3MJQA 1LSVA 4QY5A 4IUHA 1PIOA 4L0LA 1XP4A 3SH8A 3CITA 4GS9A 4RQ9A 1W5DA 1ESIA 3UMEA 3MR0A 4Y0OA 3IQAA 3GQZA 4OOLA 5IT5A 5FASA 2EX2A 4HJ6A 1ERQA 1JTDA 1D06A 3NULA 2HP9A 1CK3A 3UB7A 3LEZA 3KSFA 5F69A 3CJMA 4KG5A 1Y4OA 1D7EA 5HPIA 1PI4A 3PYPA 2ZL1A 4E3MA 1ES5A 1NLZA 1K38A 4H6JA 5GL9A 1F2KA 2J7VA 3N6IA 4LV2A 3PBSA 3AGDA 1OTEA 1KE4A 1PFLA 3VSKA 4MN5A 4B9OA 5KMWA 4KUOA 1J9MA 5CHUA 4U0XA 3A3JA 1K55C 4EQIA 1KGEA 3E0YA 1FSYA 4Y5FA 1BULA 3NC8A 4EETB 1NYMA 3LIAA 3T1QB 5FAQA 4LV1A 2WADA 2WKEA 2ZC7A 5GLCA 5AQ9A 4MCWA 1YMSA 3T4TA 4GDNA 1KVLA 2R9WA 4NETA 3G32A 2C6WB 2XD5A 3GDIA 3LIFA 4HHDA 2QWSA 1TD5A 2OWJA 2GJ3A 3IX8A 4HEFA 2JBFA 4JKTA 4KZ9A 3CUEA 4B4XA 2QJ7A 1FCMA 4K0WA 4YINA 2VGLS 3V67A 1O07A 1ES2A 5CGWA 1HZOA 3NOPC 5AQBA 3F1PB 3ZDJA 5FAOA 1G5UA 1DJCA 1P0ZA 2IA2A 3T4QA 2PD8A 1DJAA 4UQIS 2M7VA 3BFEA 4HY8A 2V1BA 3C7VA 2DRWA 1NLYA 4ETXA 1TVFA 1SKOB 3OPPA 5EVIB 5IS1A 1EW0A 1KDWA 3Q7VB 3PTEA 1DP9A 4R23A 1YLYA 3ZYTA 1IYOA 1H3QA 1XA1A 1TF1A 3DBAA 3P09A 1L0DA 1O7EA 2A49A 1MXOA 1YMXA 1N9NA 2P7JA 4LRZE 3EQVA 4GLQA 4DJ2A 4R4RA 3T4OA 2BG1A 4ZJ1A 1X0OA 3B42A 3CLOA 1G6AA 2XSSA 2BASA 2XDMA 4ZJ2A 5DKKA 4E3JA 4PMAA 5AQ7A 5C5KA 4OPQA 2MJ6A 3HLGA 5AVEA 3D72A 1Q2QA 3N8LA 1RGYA 2HDUA 2ZQCA 3GRJA 5HDDA 3ZVWA 4OQ0A 1IEMA 1KVMA 3OCNA 3A3IA 2Y2NA 1KDSA 4X1MA 3MXQA 4U3TA 1P97A 1K4EA 1TS8A 2XR0A 3W4OA 4KZBA 4C3QA 2O9CA 3ZG7B 3EGXC 1F9IA 2V1ZA 4E6XA 2PDRA 4QPRA 3W4PA 3JPUA 3SH9A 3HLCA 5J7EA 4LRYC 2M1CA 4JPMA 1EI5A 1OT9A 3G31A 1DRMA 5EVEA 4GD8A 3UPPA 3DTIA 1QMFA 2R78A 3Q82A 2PHYA 1XXMA 4PM7A 1SKOA 3G34A 4WN5A 3PAGA 4YOFA 5I94A 1T19A 4WEJA 2P08A 2H0YA 4UQIM 2JKRI 1E3UA 4HQAA 5CEDA 2Y2MA 3Q7ZA 2A3UA 3PHYA 3QP4A 1BLSA 1KE3A 3CMZA 2EX9A 4JLFA 4LCLA 4UAAA 3K3CA 2XRNA 5GLAA 1SKFA 4OPRA 1PI5A 4EW7A 3MQ0A 4HOIA 3VP3A 2V0UA 2PBDP 5EVLA 5EVID 4BBVA 2FH5A 3WS4A 3UDFA 4ZRRA 2Z6CA 1LHYA 1SHVA 2WZZA 3ZG5A 2ZQDA 3MFDA 1PWDA 4JXVA 3C4OA 1FR1A 5DF7A 4KZ3A 5DVAA 5J8XA 1XKZA 4DE2A 5D3OA 5EOEA 4LGWA 4EERA 2L4RA 4Y17A 4ME4A 1H8ZA 2J9PA 4K08A 3SW1A 4GZBA 4CLCB 2Y59A 4CLCE 1VHMA 5GHZA 1F98A 2Z2MB 1ONGA 5TBMB 1ES3A 1V9ZA 3VP0A 1Y28A 3QP8A 3W2ZA 1NZUA 2ZMVA 5L8MA 3IXDA 1OTIA 2V0WA 1DJBA 4X56A 4N9LA 3CPTB 3CG5A 5HDSA 4O0PA 3D4FA 3IBJA 4LV0A 4N92A 1N9BA 2J3WA 2PR5A 2VV8A 3TOIA 3RXWA 5HL1A 4Q0IA 2OWHA 4P85A 4EXOA 3CI6A 1UWPX 3HJIA 3BJNA 3HLFA 5HAPA 1BSGA 3U2AA 2CC1A 3WS1A 1YLWA 2XA7S 5HFOA 4NXFA 2KLIA 4S2MA 4EV4A 2LB9A 5CECA 2A2LA 2HDQA 2XGNA 4CJNA 4UA6A 1KGGA 2HJEA 4RYEA 5L09A 3PBOA 2P9VA 4LRXC 1MY8A 1OTDA 4GOGA 4FH4A 2I72A 3CAXA 5HWVA 4WZ4A 2QHKA 5CHJA 1PWCA 2ZC5B 3FG8A 2ZC6B 4Q0HA 1KGFA 3S7PA 4R3AA 5A8BA 4GDBA 4S2NC 4WMCD 2ZD8A 4BBUA 1XA7A 4OKPA 1YAXA 4FOFA 2XEPA 4IVIA 4BL3A 2WZXA 2JKTM 3O87A 3ZVTA 4BD0A 3BFGA 4O8GA 4LLOB 2NUPC 2G2WA 4YWZA 2H28A 4HNBA 4P6ZM 3KYEA 4IBXA 4HH2A 5HD5A 3CPTA 4OONA 1N9LA 3VOZA 3IF6C 4JF5A 1VETB 1EROA 2ZC3B 2J9OA 2OOLA 3C4PA 1YPRA 2D01A 3T1RA 3LI9A 2ZQ9A 1ONHA 3D3OA 4CLCD 1HTZA 2EWWA 5TJJA 3BECA 3F1NB 3P7NA 2JKGA 3LFVA 4UEYA 3TJZC 2QZ6A 2XQZA 5FQKA 5HX9A 3SOIA 3IBRA 4GB7A 4NEED 2OSUA 2Y91A 2Y4AA 3UB5P 5GLDA 4KQDA 4KQOA 2INWA 1VQQA 4N1XA 3S1YA 3M6HA 3RXXA 4DE3A 3TG9A 1L0EA 3HJKA 4DN0A 4X68A 4MN7A 2P04A 2Y2OA 4HIAA 3CUEC 4PAUA 2XA7M 1HD8A 1OT6A 3IT9A 3BQ8A 4ZAMA 5FQQA 3JVUA 4WLAA 5M19A 4KZ5A 3BW6A 3ZG0A 3B47A 1XFQA 3IXGA 2IWBA 4DDSA 3PBQA 3HUOA 4F3LB 2Y2LA 2Z2LB 2Y2HA 2W1TB 2K2NA 5EFWA 4QHCA 4M3KA 3MXSA 4JXWA 2WGIA 3IXBA 1YQSA 1A0KA 1PWGA 1ERMA 5EUAA 1FOFA 2E8JA 4HI4A 3RTYA 4WUJA 1L2SA 3EQUA 3S4XA 3SS4A 4WZ5C 3GTCA 3G2YA 5FAPA 2V8CA 3UB8A 4S2NA 2W3GA 2WGWB 3F1NA 3QP6A 3ZNYA 3CHWP 4MLLA 3EOIA 3MZFA 4QY6A 3CWFA 4EUZA 3VMAA 1JWZA 4WYYA 1UGUA 5HARA 5CEBA 1CEFA 3GSGA 1LI0A 5I5LA 3UMDA 2LB5A 2VJWA 4X69A 3VP2A 1E4DA 2VLGA 3DWKA 3ZHHA 5J3WA 3WS2A 1OJGA 1SDNA 2GX5A 4LFUA 1TEMA 5DTTA 2Z6DA 3IF6A 3NOUC 5FATA 3OLOA 5TR7A 3LICA 1K6RA 2V8FA 3LY4A 1K25A 4OLGA 3LIDA 3KYZA 1Q2PA 3P98A 1IYQA 5A93A 3LY3A 1E25A 4S2IA 2EXBA 1EWZA 3G30A 5DFXA 2XLNA 3C7UA 2WAEA 3G35A 1HLUP 4JXGA 3A0RA 4PM6A 1S66L 1MPLA 3LR4A 4MNRA 5EVIC 1L0FA 1OMEA 5HWTA 1FSWA 5TFQA 4X6TA 5HD3A 2ZOIA 2PU2A 2VGKA 3B3XA 1XGJA 2PD7A 5E2HA 4FUWA 2ZMAA 3DWZA 2HGVA 4A5RA 2JC7A 2JKFA 2I9VA 4BWIA 5JYPA 4E3OA 4JGRA 2B02A 4S2PA 4H8RA 4BJPA 3IX4A 3O5YA 2XK1A 3IS2B 1YSQA 3OC2A 3LEQA 2JE5A 3IF5A 1VEUB 4DF6A 1ES4A 3VFHA 1T1AA 2O9AA 4WZ5A 4G3KA 2GZAA 1S67L 5DKLA 2K7SA 2EWVA 1PW1A 1NY0A 3KSGA 3E4PA 4K91A 1UWNX 4WL9A 3DAVA 4P0MA 2B95A 3CZDA 4MMNA 1KOUA 3WWXA 1FIKA 5FEFA 5F82A 4S2LA 1MWTA 5G4YA 3M2JA 4OOYA 3ITAA 3GV9A 3OPRA 3SH7A 4Y0TA 3LI8A 4ESPA 3BY9A 2Y2IA 2EX6A 2J80A 4DMZA 3MSHA 1U60A 1IELA 1W63Q 4ARZB 1J3WA 5FDSA 1LI9A 4HBUA 1JNUA 3F1PA 3T12B 3HUNA 2WAFA 1CI8A 2WKHA 4KG6A 3I7JA 3NJAA 3OZHA 3TE8A 5U47A 3IS2A 2VEAA 2G2UA 3TRCA 3ITBA 3MXRA 3HVFA 5EVIA 3C30A 2B5RA 3Q7VA 5IU1A 1K54C 4GJ4A 4UA9A 1JWVA 2QKPA 3MKEA 3A3EA 1GCEA 4OP5A 1AXBA 1QMEA 2V2FF 2Y8HA 1OTBA 5KSCA 3IWIA 3LR5A 3EWKA 3P01A 4BBTA 1BLPA 4I38A 5G4ZA 4C6YA 5HZHA 4CLCC 4PM9A 3V5MA 3M2KA 1GHMA 3FKVA 3QP1A 3HLBA 2KDKA 4M4XA 3H7WB 4QWOA 5GLBA 5GHXA 2W3FA 3NBLA 4O01A 1LL8A 2X02A 1TS0A 5CXWA 1IFQA 4DE1A 3T1SA 3UE0A 2Y2PA 4OLDA 2J3TD 3UE3A 4EBPA 1D1JA 2YKFA 4Z1WA 1NJ4A 2DNSA 4KZ6A 2UWXA 2A24B 4L9GA 1PRQA 4P6ZS 3BQAA 3N4IA 4O7DA 4BENA 4ARZA 3S7NA 3BLMA 2GDNA 3UPNA 1BUEA 4JF4A 2WKQA 4KZAA 1MWSA 3A3DA 3RH8B 4NG2A 3BWLA 3PBTA 1K0KA 5L2FA 2JCHA 1NXYA 3T1XA 1OJ5A 2PAVP 1MC0A 1XJ6A 3E4QA 4KZ4A 2JN7A 3LCEA 5EECA 4R0QA 4EWFA 4JBFA 4BLMA 3SS5A 1DP8A 4RA7A 4GD6A 1MKIA 5KIZA 5FQJA 1YLJA 2OLVA 2Y79A 3WRZA 3MQOA 2HDSA 3HLWA 1STZA 1YLZA 2JKTI 1TS6A 3BFDA 3LIBA 1I2SA 1K56A 2W3DA 1XFNA 3DTMA 3G6OA 3OCLA 1I5QA 5AJGA 3ULFA 2K31A 4KQQA 4WMCA 2HP6A 4KG2A 4EESA 3A3FA 2H10A 3H7WA 5FI6A 1V9YA 4S2OA 1NWZA 5DF9A 3T4LA 3HREA 1S4RA 4GHIB 1F5MA 2ZC4B 1K54A 1LL9A 3OBFA 3VP1A 1ODVA 5HL6A 1K56D 3BY8A 2L1MA 5FI2A 4B4ZA 3UNWA 2VK3A 5L10A 2A24A 3S7QA 3T4KA 4JF6A 3FWLA 1GSVA 1ZG4A 4EBNA 2R9XA 3HL9A 5F5YA 4L9FA 5EM1A 4CLCA 2X01A 4S2KA 2Q9MA 5TGFA 3U4LP 3AGEA 3ZQ5A 1IKIA 5TBMA 3DTEA 3E2KA 3OPHA 4Y15A 3GR2A 3K2NA 2OAQ1 3HLEA 5EM0A 3QNCA 1HVBA 1XJ2A 2XD1A 2DCFA 4KZ7A 1WE4A 1RCJA 1SCWA 2VGJA 1NRJA 4E3IA 3C2WA 4FTXA 2RL3A 3NCKA 1TS7A 3V3RA 4ID4A 4ZBEA 1W8YA 5FA7A 4E04A 2HDRA 5F1FA 2HP5A 2ZBBA 2VA0A 3WRTA 4WELA 4G3WA 1RP5A 1S6RA 2ZQ8A 4JGOA 4R70A 3K3DA 4ETZA 1K57A 3UO9A 2ZQ7A 3BLSA 1SZVA 1ZC2A 1ZG6A 2O99A 2PYRA 3ZG8B 4BQMA 4I39A 3LR3A 2WGVA 1ZHHB 3ZG9B 3V50A 3D9YA 4GHIA 4IJGA 2ZL1B 5AQAA 3UY6A 4IVKA 4Y7PA 2DMWA 2QJ5A 3G4PA 4H6JB 4DRTA 4RX3A 4OPZA 2QPNA 5M18A 3VP4A 5HPFA 1BLHA 3WS0A 4UA7A 3C5AA 4KUKA 1PYYA 1G68A 2UV0E 2HV1A 2ZM8A 1LL5A 2HJ9C 2XFSA 3IWQA 5DF8A 4RVAA 3C38A 2WKRA 3LYXA 2Y2GA 3LUQA 2FFFB 4ZJ3A 3H9WA 4YFMA 4PM5A 2O0YA 2V1AA 2WYXA 3JYIA 3Q07A 3M6BA 2ACGA 4ZTKA 4IEDA 4XUZA 1G28A 3L9KA 4PHTA 4XXRA 4CQHA 3DTKA 1VETA 4NXEA 4ZDXA 5M1AA 5MC7A 4N9KA 4LENA 2Y2QA 2W3HA 3QP5A 1L0GA 3ZGAB 4IUKA 4E3NA 1BZAA 2YKHA 3SZTA 2V9AA 3MS6A 5L07A 1Z6FA 3KSHA 5CHMA 3MZEA 4Z9QA 5CX7A 1LSXA 3BFCA 3Q81A 3MBZA 4PKYA 3MMHA 4X53A 1MWRA 5GHYA 2ZJ9A
chains in the Genus database with same CATH topology
2W1RA 4WL9A 5DJUA 2XROA 4MMNA 1KOUA 2O9BA 1MZUA 4EU0A 2W27A 4EERA 2L4RA 4ME4A 3SW1A 4K08A 5G4YA 2ZMFA 4CLCB 4CLCE 4R6LA 1VHMA 1F98A 5TBMB 2G7UA 1V9ZA 3E98A 2EA9A 1Y28A 3R7WB 3W2ZA 1N9OA 2ZMVA 5L8MA 2VKSA 3LI8A 1OTIA 2CMNA 2V0WA 5K5BA 3BY9A 2J80A 4DMZA 4FSFA 3GECA 1W63Q 4ARZB 4F3LA 1LT0A 5HDSA 2W1TA 2W3EA 4O0PA 1JNUA 3F1PA 4HH3A 3IBJA 1T18A 3KO6A 2PR6A 5HSQA 3TW8A 3NJAA 1T1CA 4BMWA 2M7UA 4HJ4A 3TE8A 2J3WA 2PR5A 2VV8A 3UB6A 3IS2A 2VEAA 4II7A 3TRCA 1S1YA 4Q0IA 2VV6A 3LIEA 2L0WA 2ZOHA 4Q0JA 2HF6A 3MF0A 2FZ0A 2OWHA 4EXOA 1GSXA 5J4EA 4I3IA 3CI6A 2J3TC 4L9EA 1UWPX 3HJIA 3BJNA 3C30A 1BYWA 5IU1A 4GJ4A 3U2AA 3JVVA 3UE6A 2QKPA 4NXGA 4MDZA 2XA7S 4NXFA 4DJ3A 2KLIA 2Y8HA 2B18A 2LB9A 1OTBA 2A2LA 3EWKA 3LR5A 4HJ3A 2QYBA 3P01A 4BBTA 3FPWA 4I38A 5G4ZA 2HJEA 3MJQA 3H82B 3PBOA 2KOIA 4LRXC 5HZHA 1LSVA 4CLCC 2D02A 1OTDA 4IUHA 5HWVA 3CAXA 4L0LA 2QHKA 3CITA 4GS9A 2OAP1 4RQ9A 3FG8A 2KDKA 3FPVA 4M4XA 2PYPA 4WEKA 3H7WB 3MR0A 4Q0HA 3S7PA 3UMEA 3VE3A 4R3AA 5A8BA 4OOLA 4BBUA 5IT5A 2W3FA 4HJ6A 1YAXA 4FOFA 4O01A 1D06A 1LL8A 2JKTM 4NKPA 1TS0A 1IFQA 4O8GA 4LLOB 2NUPC 3R7WA 4YWZA 4MN6A 3UB7A 2H28A 3F1OB 4HNBA 4P6ZM 2J3TD 3KSFA 3UE3A 4JGPA 2YKFA 5F69A 4Z1WA 5DFYA 1WA9A 3KSIA 2A24B 4L9GA 4P6ZS 1D7EA 3BQAA 5HPIA 4ARZA 3PYPA 4HH2A 5HD5A 3S7NA 2WKQA 1NLZA 1N9LA 2WKPA 3RH8B 3BWLA 4H6JA 3PBTA 5F68A 1H8MA 4HP4A 2OOLA 3PBSA 3VOLA 2D01A 3LI9A 1OTEA 1OJ5A 1MC0A 1XJ6A 3D3OA 3E4QA 4CLCD 2EWWA 5TJJA 2JN7A 3PBNA 4Y3IA 4AFIA 4MN5A 4B9OA 3F1NB 4KUOA 3P7NA 1DP8A 3LFVA 4LPZA 4UEYA 3TJZC 5KIZA 2Y79A 3S7OA 3E0YA 3MQOA 3IBRA 4Y5FA 5DJTA 4NEED 1STZA 3LR0A 2JKTI 4EETB 1TS6A 4KQDA 3LIAA 2INWA 4KQOA 3LIBA 4XT2B 2W3DA 1XFNA 3PXPA 3HJKA 4DN0A 4MCWA 3G6OA 4MN7A 3OCLA 2P04A 3T4TA 3H82A 4HIAA 3CUEC 1W63M 5AJGA 3ULFA 2K31A 4PAUA 2XA7M 1VB6A 2VV7A 4R38A 3GDIA 3LIFA 1IOUA 1OT6A 4EESA 4HHDA 2QWSA 1TD5A 3BQ8A 3R4KA 3ICYA 3H7WA 2OWJA 2GJ3A 3JVUA 4EEPA 1V9YA 4WLAA 1NWZA 2VGLM 5DF9A 3BW6A 3B47A 1XFQA 3CUEA 3T4LA 3E4OA 1S4RA 2QJ7A 5KSHA 3KX0X 3PBQA 4GHIB 1F5MA 2VGLS 3V67A 4I5SA 5FL3A 3OBFA 4F3LB 1ODVA 2GNXA 5HL6A 3NOPC 1T1BA 2K2NA 2W1TB 1S4SA 3BY8A 3F1PB 5EFWA 3F1OA 2L1MA 4Y2FA 1P0ZA 1DP6A 2KX6A 2IA2A 3T4QA 2PD8A 2A24A 3S7QA 3FC7A 3T4KA 4UQIS 3HCYA 2M7VA 1S1ZA 3T50A 4HY8A 2V1BA 1GSVA 1MKMA 1XJ4A 4HI4A 3RTYA 4PKYG 1NLYA 4WUJA 5F5YA 4L9FA 4CLCA 4ETXA 1LSWA 3A0VA 3EQUA 3ZQ5A 5IS1A 5TBMA 1EW0A 3NOTC 5HDCA 1DP9A 1P9WA 3ZYTA 3UB8A 3K2NA 2W3GA 3F1NA 3EOIA 3B33A 2OAQ1 3VE4A 1H3QA 4EUVA 4JGQA 1TF1A 3CWFA 3DBAA 1XJ2A 4HP9A 4WF0A 1N9NA 2P7JA 1UGUA 1NRJA 3EQVA 3C2WA 4LRZE 1ZTUA 5I5LA 4GLQA 3UMDA 2LB5A 2VJWA 5LBRA 1YKDA 3VV4A 4DJ2A 2VLGA 1TS7A 3T4OA 3MQQA 5J3WA 1X0OA 3B42A 4XT2A 3RFBA 4E04A 1OJGA 3CLOA 2GX5A 2XSSA 4GW9A 2BASA 4GCZA 2ZBBA 2VA0A 5DKKA 2Z6DA 3KYQA 5C5KA 2MJ6A 5AVEA 4EQ1A 3D72A 4WELA 3NOUC 4G3WA 3OLOA 1G6OA 2JKRM 3LICA 4JGOA 2VZWA 4R70A 3OOVA 3K3DA 4ETZA 3LIDA 5HDDA 2JHEA 3KYZA 3NHQA 1GSWA 2O99A 2PYRA 4I39A 3OCNA 3LR3A 1ZHHB 3MXQA 5DFXA 1P97A 1P9RA 1TS8A 4GHIA 4IJGA 2O9CA 3A0RA 3EGXC 3EEHA 3EGDC 3A0SA 1F9IA 5AVFA 1S66L 2DMWA 3LR4A 2PDRA 2QJ5A 4QPRA 2VX8A 4H6JB 3T4SA 5HWTA 5J7EA 4LRYC 5HPFA 4I3JA 4IHQA 2M1CA 5HD3A 1OT9A 1DRMA 2ZOIA 4KUKA 1XJ3A 2HV1A 2R78A 2PHYA 2HJ9C 1OPXA 3PBRA 4WN5A 3C38A 2PD7A 2WKRA 4YOFA 3LYXA 4B93A 2W0NA 1T19A 2HGVA 2NUTC 4EEUA 1YSPA 4WEJA 2P08A 3LUQA 2PT7A 4UQIM 3H9WA 2JKRI 5HWWA 2I9VA 4BWIA 4HQAA 2O0YA 2B02A 2V1AA 4JGRA 3C8CA 3PR6A 3PHYA 4BJPA 3MFXA 5F6AA 3O5YA 3IS2B 1G28A 1YSQA 3OC2A 4PHTA 4CQHA 4NXEA 5MC7A 4YNRA 3K3CA 2XRNA 2W3HA 3UB9A 4I3AA 4IUKA 3MQ0A 4HOIA 4EW7A 2V0UA 1OTAA 2YKHA 2V9AA 4BBVA 2FH5A 3KSHA 1T1AA 4ZRRA 2Z6CA 2O9AA 3T4JA 5CX7A 4OOMA 1LSXA 4G3KA 2GZAA 4G3VA 1S67L 3EEAA 5DKLA 4NXBA 4PKYA 2K7SA 2EWVA 3MMHA 4GS9B 3KSGA 3E4PA 1UWNX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O99 A;  2W1R A;  2XRO A;  4MMN A;  5DFX A;  2O9B A;  4EU0 A;  2W3F A;  4FOF A;  4IJG A;  2O9C A;  4O01 A;  4ME4 A;  2ZMF A;  1F5M A;  4R6L A;  1VHM A;  3OBF A;  5HL6 A;  4QPR A;  3NOP C;  4O8G A;  2W1T B;  2K2N A;  2G7U A;  3E98 A;  4LRY C;  5HPF A;  4Y2F A;  3W2Z A;  3KSF A;  5L8M A;  2VKS A;  2IA2 A;  4Z1W A;  3S7Q A;  5DFY A;  3HCY A;  3KSI A;  2M7V A;  5K5B A;  1MKM A;  4DMZ A;  5HPI A;  3S7N A;  4ETX A;  4YOF A;  2HGV A;  3ZQ5 A;  2W1T A;  2W3E A;  1YSP A;  4O0P A;  3NOT C;  3IBJ A;  2OOL A;  3KO6 A;  4BWI A;  3K2N A;  1MC0 A;  5HSQ A;  3D3O A;  2W3G A;  5TJJ A;  2O0Y A;  2M7U A;  4Y3I A;  4EUV A;  2VEA A;  1TF1 A;  3DBA A;  3LFV A;  3TRC A;  4Q0I A;  3O5Y A;  1YSQ A;  4Q0J A;  3MF0 A;  2Y79 A;  3S7O A;  3E0Y A;  4CQH A;  4LRZ E;  3C2W A;  3CI6 A;  3BJN A;  1ZTU A;  5I5L A;  3IBR A;  4GLQ A;  4Y5F A;  2LB5 A;  2VJW A;  5LBR A;  1YKD A;  4YNR A;  3VV4 A;  1STZ A;  2XRN A;  2W3H A;  4MDZ A;  3RFB A;  4E04 A;  4IUK A;  3MQ0 A;  2GX5 A;  2XSS A;  4GW9 A;  2W3D A;  2KLI A;  2Y8H A;  2B18 A;  2LB9 A;  4DN0 A;  4MCW A;  3G6O A;  3KSH A;  4MN7 A;  4ZRR A;  2QYB A;  2O9A A;  5C5K A;  5AJG A;  3NOU C;  4G3W A;  2K31 A;  2KOI A;  4LRX C;  4PAU A;  4G3K A;  4IUH A;  4G3V A;  2VZW A;  4R70 A;  3EEA A;  3OOV A;  3CIT A;  4ETZ A;  4RQ9 A;  1TD5 A;  3R4K A;  3MMH A;  3NHQ A;  3KSG A;  4Q0H A;  3S7P A; 
#chains in the Genus database with same CATH topology
 3LGO A;  5DJU A;  1PZP A;  2XRO A;  4F94 A;  2O9B A;  2W27 A;  1GA0 A;  2ZMF A;  4QU3 A;  3NEC A;  3O86 A;  2ZM0 A;  4QJG A;  3DW0 A;  4X1L A;  2EA9 A;  3R7W B;  1N9O A;  1XPB A;  2VKS A;  5CGS A;  3AGF A;  2CMN A;  3MKF A;  3UPO A;  5K5B A;  2V20 A;  5A90 A;  1YM1 A;  5CTN A;  4FSF A;  4F3L A;  2W1T A;  2W3E A;  4HH3 A;  1IYS A;  1Z09 A;  4DXB A;  1T18 A;  5HSQ A;  1T1C A;  3W8K A;  1JWP A;  4HJ4 A;  2FFY A;  3UB6 A;  4E3K A;  2PBY A;  2VV6 A;  4Q0J A;  2HPB A;  4KEN B;  4I3I A;  2J3T C;  1ZKJ A;  1BYW A;  3UE6 A;  4NXG A;  5G18 A;  2WGW A;  5JYO A;  4P6B A;  5BOH A;  3UDI A;  5FDH A;  2QYB A;  4MBF A;  3H82 B;  2KOI A;  2D02 A;  4PM8 A;  4U0T A;  4FD8 A;  2OAP 1;  1CF0 A;  3ZNT A;  3FPV A;  4QD4 A;  1XX2 A;  2PYP A;  4WEK A;  3VE3 A;  1NYY A;  2BTF P;  1LLB A;  1IYP A;  3BRM A;  1W7F A;  4PPR A;  4D2O A;  4NKP A;  1Y54 A;  3G2Z A;  3HLD A;  1NZO A;  3R7W A;  1H8Y A;  2Q9N A;  2WK0 A;  4MN6 A;  4E6W A;  3F1O B;  1I2W A;  2Y2J A;  2OLU A;  4DDY A;  1YLT A;  4JGP A;  1FR6 A;  2XFT A;  3QNB A;  5DFY A;  1WA9 A;  3KSI A;  3IH8 A;  4Q8I A;  1K4F A;  1W8Q A;  1GHI A;  1AWI A;  2WKP A;  4FH2 A;  1CQA A;  3GMW A;  5F68 A;  4MEZ A;  1H8M A;  4HP4 A;  3VOL A;  1WYB A;  2WUQ A;  3FZC A;  5CRF A;  3PBN A;  4Y3I A;  4AFI A;  5DTS A;  4WM9 A;  3L7H A;  4LPZ A;  2EFU A;  1TDG A;  3S7O A;  4BL2 A;  2Y2K A;  3IWO A;  1BTL A;  4HES A;  5CGX A;  5DJT A;  4S2J A;  4OP8 A;  3LR0 A;  4BD1 A;  5A92 A;  1CJF A;  1H5X A;  5CTM A;  3V39 A;  4XT2 B;  4MBK A;  2J8Y A;  3PXP A;  1K55 A;  1N4O A;  1VM1 A;  3H82 A;  3QP2 A;  3N8R A;  3ZCZ A;  1W63 M;  5FEG A;  3BEB A;  1VB6 A;  2VV7 A;  4R38 A;  1IOU A;  5FQ9 A;  3R4K A;  1MWU A;  1VEU A;  3ICY A;  1YT4 A;  3MZD A;  4MBH A;  4EEP A;  1YLP A;  5HW3 A;  4OQI A;  3NI9 A;  2ZLY A;  3RJU A;  2VGL M;  4GKU A;  2AVX A;  3E4O A;  3OPL A;  5KSH A;  3KX0 X;  5CER A;  4I5S A;  5FL3 A;  2GNX A;  2PU4 A;  1T1B A;  1S4S A;  3F1O A;  1PW8 A;  4OH0 A;  4Y2F A;  1FQG A;  1DP6 A;  2KX6 A;  3FV7 A;  3FC7 A;  3HCY A;  1S1Z A;  5IHV A;  3T50 A;  3NDE A;  1PNE A;  1MKM A;  1XJ4 A;  4PKY G;  4WBG A;  3NIA A;  1LSW A;  3A0V A;  4RX2 A;  5FQI A;  3Q1F A;  2BLS A;  3VFF A;  4OVD A;  3NOT C;  4IBR A;  5HDC A;  1BT5 A;  4LV3 A;  1P9W A;  5F1G A;  3IX3 A;  5EE8 A;  2EFX A;  3B33 A;  3VE4 A;  3NY4 A;  4EUV A;  3O3V A;  4JGQ A;  3UN7 A;  3HUM A;  4HP9 A;  4WF0 A;  4X55 A;  1SDE A;  1E3U D;  4CPK A;  1NRF A;  1MBL A;  2IWD A;  3UDX A;  2P9V B;  1ZTU A;  5LBR A;  1YKD A;  3VV4 A;  1M6K A;  1WYC A;  3O88 A;  3MQQ A;  1RGZ A;  5EV0 A;  1K57 C;  4XT2 A;  4NK3 A;  3RFB A;  4GW9 A;  4UHU A;  3QHY A;  4GCZ A;  2IWC A;  2ZQA A;  1ALQ A;  3KYQ A;  4EQ1 A;  2C5W B;  1G6O A;  2JKR M;  2P74 A;  2OV5 A;  2VZW A;  3OOV A;  3TSG A;  4OQH A;  5FQM A;  1XGI A;  2JHE A;  3NHQ A;  1GSW A;  3PAE A;  3WS5 A;  1S0W A;  2RCX A;  1GHP A;  1P9R A;  3ZFZ A;  3EEH A;  3EGD C;  3A0S A;  1H0M A;  4B88 A;  4FCF A;  5AVF A;  2VX8 A;  3T4S A;  4JXS A;  4DXC A;  4I3J A;  4IHQ A;  1TDL A;  2Y55 A;  3E2L A;  5EPH A;  1ESU A;  3HBR A;  1XJ3 A;  2HZ5 A;  5EOO A;  1BLC A;  1OPX A;  3PBR A;  2H0T A;  5HAI A;  4B93 A;  2W0N A;  2NUT C;  2E8I A;  4R1G A;  4EEU A;  1YSP A;  2QMI A;  2PT7 A;  4E3L A;  5HWW A;  2XF3 A;  3C8C A;  3PR6 A;  4OQG A;  1FIL A;  3MFX A;  5F6A A;  3BYD A;  1L3L A;  3VOY A;  4R3J A;  3S22 A;  2XH9 A;  4GNU A;  4YNR A;  3N7W A;  3UB9 A;  5A91 A;  3IXH A;  4DKI A;  3W4Q A;  4I3A A;  4QB8 A;  1JTG A;  1OTA A;  2EX8 A;  5HAQ A;  2Q0O A;  1W79 A;  5KZH A;  2ZM2 A;  3T4J A;  3SS3 A;  2WKI A;  4OOM A;  4G3V A;  1C3B A;  3EEA A;  3LO7 A;  4NXB A;  4XUX A;  4GS9 B;  2W1R A;  3N8S A;  1MZU A;  4EU0 A;  5DTK A;  4R3B A;  4X25 A;  4DE0 A;  1IKG A;  4R6L A;  3ISG A;  3NDG A;  5F83 A;  2G7U A;  1ACF A;  3E98 A;  5E2G A;  4LCM A;  1FCN A;  4C75 A;  4OPY A;  4Y0U A;  1FCO A;  1CI9 A;  2EXA A;  5FI7 A;  3GEC A;  1LT0 A;  3UE1 A;  1CEG A;  4R4S A;  1JVJ A;  3KO6 A;  2PR6 A;  3IH9 A;  3TW8 A;  4BMW A;  2M7U A;  4KZ8 A;  3IHA A;  2X71 A;  4II7 A;  1PZO A;  1S1Y A;  4KQR A;  3LIE A;  2L0W A;  2ZOH A;  3FYZ A;  2HF6 A;  3MF0 A;  4Y13 A;  2FZ0 A;  2H5S A;  5J4E A;  1GSX A;  3V3S A;  3BM6 A;  1DY6 A;  1K6S A;  3IHB A;  3IF6 B;  4L9E A;  1KE0 A;  5E2E A;  4D60 A;  4EBL A;  5FSR A;  3JVV A;  2PRF A;  3BFF A;  4MDZ A;  4GN2 A;  3FKW A;  1GA9 A;  5E2F A;  4N1H A;  5E43 A;  3VSL A;  4HBT A;  3GVB A;  4DJ3 A;  2B18 A;  1M40 A;  4HJ3 A;  4P87 A;  4K0X A;  3FPW A;  3MJQ A;  1LSV A;  4QY5 A;  4IUH A;  1PIO A;  4L0L A;  1XP4 A;  3SH8 A;  3CIT A;  4GS9 A;  4RQ9 A;  1W5D A;  1ESI A;  3UME A;  3MR0 A;  4Y0O A;  3IQA A;  3GQZ A;  4OOL A;  5IT5 A;  5FAS A;  2EX2 A;  4HJ6 A;  1ERQ A;  1JTD A;  1D06 A;  3NUL A;  2HP9 A;  1CK3 A;  3UB7 A;  3LEZ A;  3KSF A;  5F69 A;  3CJM A;  4KG5 A;  1Y4O A;  1D7E A;  5HPI A;  1PI4 A;  3PYP A;  2ZL1 A;  4E3M A;  1ES5 A;  1NLZ A;  1K38 A;  4H6J A;  5GL9 A;  1F2K A;  2J7V A;  3N6I A;  4LV2 A;  3PBS A;  3AGD A;  1OTE A;  1KE4 A;  1PFL A;  3VSK A;  4MN5 A;  4B9O A;  5KMW A;  4KUO A;  1J9M A;  5CHU A;  4U0X A;  3A3J A;  1K55 C;  4EQI A;  1KGE A;  3E0Y A;  1FSY A;  4Y5F A;  1BUL A;  3NC8 A;  4EET B;  1NYM A;  3LIA A;  3T1Q B;  5FAQ A;  4LV1 A;  2WAD A;  2WKE A;  2ZC7 A;  5GLC A;  5AQ9 A;  4MCW A;  1YMS A;  3T4T A;  4GDN A;  1KVL A;  2R9W A;  4NET A;  3G32 A;  2C6W B;  2XD5 A;  3GDI A;  3LIF A;  4HHD A;  2QWS A;  1TD5 A;  2OWJ A;  2GJ3 A;  3IX8 A;  4HEF A;  2JBF A;  4JKT A;  4KZ9 A;  3CUE A;  4B4X A;  2QJ7 A;  1FCM A;  4K0W A;  4YIN A;  2VGL S;  3V67 A;  1O07 A;  1ES2 A;  5CGW A;  1HZO A;  3NOP C;  5AQB A;  3F1P B;  3ZDJ A;  5FAO A;  1G5U A;  1DJC A;  1P0Z A;  2IA2 A;  3T4Q A;  2PD8 A;  1DJA A;  4UQI S;  2M7V A;  3BFE A;  4HY8 A;  2V1B A;  3C7V A;  2DRW A;  1NLY A;  4ETX A;  1TVF A;  1SKO B;  3OPP A;  5EVI B;  5IS1 A;  1EW0 A;  1KDW A;  3Q7V B;  3PTE A;  1DP9 A;  4R23 A;  1YLY A;  3ZYT A;  1IYO A;  1H3Q A;  1XA1 A;  1TF1 A;  3DBA A;  3P09 A;  1L0D A;  1O7E A;  2A49 A;  1MXO A;  1YMX A;  1N9N A;  2P7J A;  4LRZ E;  3EQV A;  4GLQ A;  4DJ2 A;  4R4R A;  3T4O A;  2BG1 A;  4ZJ1 A;  1X0O A;  3B42 A;  3CLO A;  1G6A A;  2XSS A;  2BAS A;  2XDM A;  4ZJ2 A;  5DKK A;  4E3J A;  4PMA A;  5AQ7 A;  5C5K A;  4OPQ A;  2MJ6 A;  3HLG A;  5AVE A;  3D72 A;  1Q2Q A;  3N8L A;  1RGY A;  2HDU A;  2ZQC A;  3GRJ A;  5HDD A;  3ZVW A;  4OQ0 A;  1IEM A;  1KVM A;  3OCN A;  3A3I A;  2Y2N A;  1KDS A;  4X1M A;  3MXQ A;  4U3T A;  1P97 A;  1K4E A;  1TS8 A;  2XR0 A;  3W4O A;  4KZB A;  4C3Q A;  2O9C A;  3ZG7 B;  3EGX C;  1F9I A;  2V1Z A;  4E6X A;  2PDR A;  4QPR A;  3W4P A;  3JPU A;  3SH9 A;  3HLC A;  5J7E A;  4LRY C;  2M1C A;  4JPM A;  1EI5 A;  1OT9 A;  3G31 A;  1DRM A;  5EVE A;  4GD8 A;  3UPP A;  3DTI A;  1QMF A;  2R78 A;  3Q82 A;  2PHY A;  1XXM A;  4PM7 A;  1SKO A;  3G34 A;  4WN5 A;  3PAG A;  4YOF A;  5I94 A;  1T19 A;  4WEJ A;  2P08 A;  2H0Y A;  4UQI M;  2JKR I;  1E3U A;  4HQA A;  5CED A;  2Y2M A;  3Q7Z A;  2A3U A;  3PHY A;  3QP4 A;  1BLS A;  1KE3 A;  3CMZ A;  2EX9 A;  4JLF A;  4LCL A;  4UAA A;  3K3C A;  2XRN A;  5GLA A;  1SKF A;  4OPR A;  1PI5 A;  4EW7 A;  3MQ0 A;  4HOI A;  3VP3 A;  2V0U A;  2PBD P;  5EVL A;  5EVI D;  4BBV A;  2FH5 A;  3WS4 A;  3UDF A;  4ZRR A;  2Z6C A;  1LHY A;  1SHV A;  2WZZ A;  3ZG5 A;  2ZQD A;  3MFD A;  1PWD A;  4JXV A;  3C4O A;  1FR1 A;  5DF7 A;  4KZ3 A;  5DVA A;  5J8X A;  1XKZ A;  4DE2 A;  5D3O A;  5EOE A;  4LGW A;  4EER A;  2L4R A;  4Y17 A;  4ME4 A;  1H8Z A;  2J9P A;  4K08 A;  3SW1 A;  4GZB A;  4CLC B;  2Y59 A;  4CLC E;  1VHM A;  5GHZ A;  1F98 A;  2Z2M B;  1ONG A;  5TBM B;  1ES3 A;  1V9Z A;  3VP0 A;  1Y28 A;  3QP8 A;  3W2Z A;  1NZU A;  2ZMV A;  5L8M A;  3IXD A;  1OTI A;  2V0W A;  1DJB A;  4X56 A;  4N9L A;  3CPT B;  3CG5 A;  5HDS A;  4O0P A;  3D4F A;  3IBJ A;  4LV0 A;  4N92 A;  1N9B A;  2J3W A;  2PR5 A;  2VV8 A;  3TOI A;  3RXW A;  5HL1 A;  4Q0I A;  2OWH A;  4P85 A;  4EXO A;  3CI6 A;  1UWP X;  3HJI A;  3BJN A;  3HLF A;  5HAP A;  1BSG A;  3U2A A;  2CC1 A;  3WS1 A;  1YLW A;  2XA7 S;  5HFO A;  4NXF A;  2KLI A;  4S2M A;  4EV4 A;  2LB9 A;  5CEC A;  2A2L A;  2HDQ A;  2XGN A;  4CJN A;  4UA6 A;  1KGG A;  2HJE A;  4RYE A;  5L09 A;  3PBO A;  2P9V A;  4LRX C;  1MY8 A;  1OTD A;  4GOG A;  4FH4 A;  2I72 A;  3CAX A;  5HWV A;  4WZ4 A;  2QHK A;  5CHJ A;  1PWC A;  2ZC5 B;  3FG8 A;  2ZC6 B;  4Q0H A;  1KGF A;  3S7P A;  4R3A A;  5A8B A;  4GDB A;  4S2N C;  4WMC D;  2ZD8 A;  4BBU A;  1XA7 A;  4OKP A;  1YAX A;  4FOF A;  2XEP A;  4IVI A;  4BL3 A;  2WZX A;  2JKT M;  3O87 A;  3ZVT A;  4BD0 A;  3BFG A;  4O8G A;  4LLO B;  2NUP C;  2G2W A;  4YWZ A;  2H28 A;  4HNB A;  4P6Z M;  3KYE A;  4IBX A;  4HH2 A;  5HD5 A;  3CPT A;  4OON A;  1N9L A;  3VOZ A;  3IF6 C;  4JF5 A;  1VET B;  1ERO A;  2ZC3 B;  2J9O A;  2OOL A;  3C4P A;  1YPR A;  2D01 A;  3T1R A;  3LI9 A;  2ZQ9 A;  1ONH A;  3D3O A;  4CLC D;  1HTZ A;  2EWW A;  5TJJ A;  3BEC A;  3F1N B;  3P7N A;  2JKG A;  3LFV A;  4UEY A;  3TJZ C;  2QZ6 A;  2XQZ A;  5FQK A;  5HX9 A;  3SOI A;  3IBR A;  4GB7 A;  4NEE D;  2OSU A;  2Y91 A;  2Y4A A;  3UB5 P;  5GLD A;  4KQD A;  4KQO A;  2INW A;  1VQQ A;  4N1X A;  3S1Y A;  3M6H A;  3RXX A;  4DE3 A;  3TG9 A;  1L0E A;  3HJK A;  4DN0 A;  4X68 A;  4MN7 A;  2P04 A;  2Y2O A;  4HIA A;  3CUE C;  4PAU A;  2XA7 M;  1HD8 A;  1OT6 A;  3IT9 A;  3BQ8 A;  4ZAM A;  5FQQ A;  3JVU A;  4WLA A;  5M19 A;  4KZ5 A;  3BW6 A;  3ZG0 A;  3B47 A;  1XFQ A;  3IXG A;  2IWB A;  4DDS A;  3PBQ A;  3HUO A;  4F3L B;  2Y2L A;  2Z2L B;  2Y2H A;  2W1T B;  2K2N A;  5EFW A;  4QHC A;  4M3K A;  3MXS A;  4JXW A;  2WGI A;  3IXB A;  1YQS A;  1A0K A;  1PWG A;  1ERM A;  5EUA A;  1FOF A;  2E8J A;  4HI4 A;  3RTY A;  4WUJ A;  1L2S A;  3EQU A;  3S4X A;  3SS4 A;  4WZ5 C;  3GTC A;  3G2Y A;  5FAP A;  2V8C A;  3UB8 A;  4S2N A;  2W3G A;  2WGW B;  3F1N A;  3QP6 A;  3ZNY A;  3CHW P;  4MLL A;  3EOI A;  3MZF A;  4QY6 A;  3CWF A;  4EUZ A;  3VMA A;  1JWZ A;  4WYY A;  1UGU A;  5HAR A;  5CEB A;  1CEF A;  3GSG A;  1LI0 A;  5I5L A;  3UMD A;  2LB5 A;  2VJW A;  4X69 A;  3VP2 A;  1E4D A;  2VLG A;  3DWK A;  3ZHH A;  5J3W A;  3WS2 A;  1OJG A;  1SDN A;  2GX5 A;  4LFU A;  1TEM A;  5DTT A;  2Z6D A;  3IF6 A;  3NOU C;  5FAT A;  3OLO A;  5TR7 A;  3LIC A;  1K6R A;  2V8F A;  3LY4 A;  1K25 A;  4OLG A;  3LID A;  3KYZ A;  1Q2P A;  3P98 A;  1IYQ A;  5A93 A;  3LY3 A;  1E25 A;  4S2I A;  2EXB A;  1EWZ A;  3G30 A;  5DFX A;  2XLN A;  3C7U A;  2WAE A;  3G35 A;  1HLU P;  4JXG A;  3A0R A;  4PM6 A;  1S66 L;  1MPL A;  3LR4 A;  4MNR A;  5EVI C;  1L0F A;  1OME A;  5HWT A;  1FSW A;  5TFQ A;  4X6T A;  5HD3 A;  2ZOI A;  2PU2 A;  2VGK A;  3B3X A;  1XGJ A;  2PD7 A;  5E2H A;  4FUW A;  2ZMA A;  3DWZ A;  2HGV A;  4A5R A;  2JC7 A;  2JKF A;  2I9V A;  4BWI A;  5JYP A;  4E3O A;  4JGR A;  2B02 A;  4S2P A;  4H8R A;  4BJP A;  3IX4 A;  3O5Y A;  2XK1 A;  3IS2 B;  1YSQ A;  3OC2 A;  3LEQ A;  2JE5 A;  3IF5 A;  1VEU B;  4DF6 A;  1ES4 A;  3VFH A;  1T1A A;  2O9A A;  4WZ5 A;  4G3K A;  2GZA A;  1S67 L;  5DKL A;  2K7S A;  2EWV A;  1PW1 A;  1NY0 A;  3KSG A;  3E4P A;  4K91 A;  1UWN X;  4WL9 A;  3DAV A;  4P0M A;  2B95 A;  3CZD A;  4MMN A;  1KOU A;  3WWX A;  1FIK A;  5FEF A;  5F82 A;  4S2L A;  1MWT A;  5G4Y A;  3M2J A;  4OOY A;  3ITA A;  3GV9 A;  3OPR A;  3SH7 A;  4Y0T A;  3LI8 A;  4ESP A;  3BY9 A;  2Y2I A;  2EX6 A;  2J80 A;  4DMZ A;  3MSH A;  1U60 A;  1IEL A;  1W63 Q;  4ARZ B;  1J3W A;  5FDS A;  1LI9 A;  4HBU A;  1JNU A;  3F1P A;  3T12 B;  3HUN A;  2WAF A;  1CI8 A;  2WKH A;  4KG6 A;  3I7J A;  3NJA A;  3OZH A;  3TE8 A;  5U47 A;  3IS2 A;  2VEA A;  2G2U A;  3TRC A;  3ITB A;  3MXR A;  3HVF A;  5EVI A;  3C30 A;  2B5R A;  3Q7V A;  5IU1 A;  1K54 C;  4GJ4 A;  4UA9 A;  1JWV A;  2QKP A;  3MKE A;  3A3E A;  1GCE A;  4OP5 A;  1AXB A;  1QME A;  2V2F F;  2Y8H A;  1OTB A;  5KSC A;  3IWI A;  3LR5 A;  3EWK A;  3P01 A;  4BBT A;  1BLP A;  4I38 A;  5G4Z A;  4C6Y A;  5HZH A;  4CLC C;  4PM9 A;  3V5M A;  3M2K A;  1GHM A;  3FKV A;  3QP1 A;  3HLB A;  2KDK A;  4M4X A;  3H7W B;  4QWO A;  5GLB A;  5GHX A;  2W3F A;  3NBL A;  4O01 A;  1LL8 A;  2X02 A;  1TS0 A;  5CXW A;  1IFQ A;  4DE1 A;  3T1S A;  3UE0 A;  2Y2P A;  4OLD A;  2J3T D;  3UE3 A;  4EBP A;  1D1J A;  2YKF A;  4Z1W A;  1NJ4 A;  2DNS A;  4KZ6 A;  2UWX A;  2A24 B;  4L9G A;  1PRQ A;  4P6Z S;  3BQA A;  3N4I A;  4O7D A;  4BEN A;  4ARZ A;  3S7N A;  3BLM A;  2GDN A;  3UPN A;  1BUE A;  4JF4 A;  2WKQ A;  4KZA A;  1MWS A;  3A3D A;  3RH8 B;  4NG2 A;  3BWL A;  3PBT A;  1K0K A;  5L2F A;  2JCH A;  1NXY A;  3T1X A;  1OJ5 A;  2PAV P;  1MC0 A;  1XJ6 A;  3E4Q A;  4KZ4 A;  2JN7 A;  3LCE A;  5EEC A;  4R0Q A;  4EWF A;  4JBF A;  4BLM A;  3SS5 A;  1DP8 A;  4RA7 A;  4GD6 A;  1MKI A;  5KIZ A;  5FQJ A;  1YLJ A;  2OLV A;  2Y79 A;  3WRZ A;  3MQO A;  2HDS A;  3HLW A;  1STZ A;  1YLZ A;  2JKT I;  1TS6 A;  3BFD A;  3LIB A;  1I2S A;  1K56 A;  2W3D A;  1XFN A;  3DTM A;  3G6O A;  3OCL A;  1I5Q A;  5AJG A;  3ULF A;  2K31 A;  4KQQ A;  4WMC A;  2HP6 A;  4KG2 A;  4EES A;  3A3F A;  2H10 A;  3H7W A;  5FI6 A;  1V9Y A;  4S2O A;  1NWZ A;  5DF9 A;  3T4L A;  3HRE A;  1S4R A;  4GHI B;  1F5M A;  2ZC4 B;  1K54 A;  1LL9 A;  3OBF A;  3VP1 A;  1ODV A;  5HL6 A;  1K56 D;  3BY8 A;  2L1M A;  5FI2 A;  4B4Z A;  3UNW A;  2VK3 A;  5L10 A;  2A24 A;  3S7Q A;  3T4K A;  4JF6 A;  3FWL A;  1GSV A;  1ZG4 A;  4EBN A;  2R9X A;  3HL9 A;  5F5Y A;  4L9F A;  5EM1 A;  4CLC A;  2X01 A;  4S2K A;  2Q9M A;  5TGF A;  3U4L P;  3AGE A;  3ZQ5 A;  1IKI A;  5TBM A;  3DTE A;  3E2K A;  3OPH A;  4Y15 A;  3GR2 A;  3K2N A;  2OAQ 1;  3HLE A;  5EM0 A;  3QNC A;  1HVB A;  1XJ2 A;  2XD1 A;  2DCF A;  4KZ7 A;  1WE4 A;  1RCJ A;  1SCW A;  2VGJ A;  1NRJ A;  4E3I A;  3C2W A;  4FTX A;  2RL3 A;  3NCK A;  1TS7 A;  3V3R A;  4ID4 A;  4ZBE A;  1W8Y A;  5FA7 A;  4E04 A;  2HDR A;  5F1F A;  2HP5 A;  2ZBB A;  2VA0 A;  3WRT A;  4WEL A;  4G3W A;  1RP5 A;  1S6R A;  2ZQ8 A;  4JGO A;  4R70 A;  3K3D A;  4ETZ A;  1K57 A;  3UO9 A;  2ZQ7 A;  3BLS A;  1SZV A;  1ZC2 A;  1ZG6 A;  2O99 A;  2PYR A;  3ZG8 B;  4BQM A;  4I39 A;  3LR3 A;  2WGV A;  1ZHH B;  3ZG9 B;  3V50 A;  3D9Y A;  4GHI A;  4IJG A;  2ZL1 B;  5AQA A;  3UY6 A;  4IVK A;  4Y7P A;  2DMW A;  2QJ5 A;  3G4P A;  4H6J B;  4DRT A;  4RX3 A;  4OPZ A;  2QPN A;  5M18 A;  3VP4 A;  5HPF A;  1BLH A;  3WS0 A;  4UA7 A;  3C5A A;  4KUK A;  1PYY A;  1G68 A;  2UV0 E;  2HV1 A;  2ZM8 A;  1LL5 A;  2HJ9 C;  2XFS A;  3IWQ A;  5DF8 A;  4RVA A;  3C38 A;  2WKR A;  3LYX A;  2Y2G A;  3LUQ A;  2FFF B;  4ZJ3 A;  3H9W A;  4YFM A;  4PM5 A;  2O0Y A;  2V1A A;  2WYX A;  3JYI A;  3Q07 A;  3M6B A;  2ACG A;  4ZTK A;  4IED A;  4XUZ A;  1G28 A;  3L9K A;  4PHT A;  4XXR A;  4CQH A;  3DTK A;  1VET A;  4NXE A;  4ZDX A;  5M1A A;  5MC7 A;  4N9K A;  4LEN A;  2Y2Q A;  2W3H A;  3QP5 A;  1L0G A;  3ZGA B;  4IUK A;  4E3N A;  1BZA A;  2YKH A;  3SZT A;  2V9A A;  3MS6 A;  5L07 A;  1Z6F A;  3KSH A;  5CHM A;  3MZE A;  4Z9Q A;  5CX7 A;  1LSX A;  3BFC A;  3Q81 A;  3MBZ A;  4PKY A;  3MMH A;  4X53 A;  1MWR A;  5GHY A;  2ZJ9 A; 
#chains in the Genus database with same CATH homology
 2W1R A;  4WL9 A;  5DJU A;  2XRO A;  4MMN A;  1KOU A;  2O9B A;  1MZU A;  4EU0 A;  2W27 A;  4EER A;  2L4R A;  4ME4 A;  3SW1 A;  4K08 A;  5G4Y A;  2ZMF A;  4CLC B;  4CLC E;  4R6L A;  1VHM A;  1F98 A;  5TBM B;  2G7U A;  1V9Z A;  3E98 A;  2EA9 A;  1Y28 A;  3R7W B;  3W2Z A;  1N9O A;  2ZMV A;  5L8M A;  2VKS A;  3LI8 A;  1OTI A;  2CMN A;  2V0W A;  5K5B A;  3BY9 A;  2J80 A;  4DMZ A;  4FSF A;  3GEC A;  1W63 Q;  4ARZ B;  4F3L A;  1LT0 A;  5HDS A;  2W1T A;  2W3E A;  4O0P A;  1JNU A;  3F1P A;  4HH3 A;  3IBJ A;  1T18 A;  3KO6 A;  2PR6 A;  5HSQ A;  3TW8 A;  3NJA A;  1T1C A;  4BMW A;  2M7U A;  4HJ4 A;  3TE8 A;  2J3W A;  2PR5 A;  2VV8 A;  3UB6 A;  3IS2 A;  2VEA A;  4II7 A;  3TRC A;  1S1Y A;  4Q0I A;  2VV6 A;  3LIE A;  2L0W A;  2ZOH A;  4Q0J A;  2HF6 A;  3MF0 A;  2FZ0 A;  2OWH A;  4EXO A;  1GSX A;  5J4E A;  4I3I A;  3CI6 A;  2J3T C;  4L9E A;  1UWP X;  3HJI A;  3BJN A;  3C30 A;  1BYW A;  5IU1 A;  4GJ4 A;  3U2A A;  3JVV A;  3UE6 A;  2QKP A;  4NXG A;  4MDZ A;  2XA7 S;  4NXF A;  4DJ3 A;  2KLI A;  2Y8H A;  2B18 A;  2LB9 A;  1OTB A;  2A2L A;  3EWK A;  3LR5 A;  4HJ3 A;  2QYB A;  3P01 A;  4BBT A;  3FPW A;  4I38 A;  5G4Z A;  2HJE A;  3MJQ A;  3H82 B;  3PBO A;  2KOI A;  4LRX C;  5HZH A;  1LSV A;  4CLC C;  2D02 A;  1OTD A;  4IUH A;  5HWV A;  3CAX A;  4L0L A;  2QHK A;  3CIT A;  4GS9 A;  2OAP 1;  4RQ9 A;  3FG8 A;  2KDK A;  3FPV A;  4M4X A;  2PYP A;  4WEK A;  3H7W B;  3MR0 A;  4Q0H A;  3S7P A;  3UME A;  3VE3 A;  4R3A A;  5A8B A;  4OOL A;  4BBU A;  5IT5 A;  2W3F A;  4HJ6 A;  1YAX A;  4FOF A;  4O01 A;  1D06 A;  1LL8 A;  2JKT M;  4NKP A;  1TS0 A;  1IFQ A;  4O8G A;  4LLO B;  2NUP C;  3R7W A;  4YWZ A;  4MN6 A;  3UB7 A;  2H28 A;  3F1O B;  4HNB A;  4P6Z M;  2J3T D;  3KSF A;  3UE3 A;  4JGP A;  2YKF A;  5F69 A;  4Z1W A;  5DFY A;  1WA9 A;  3KSI A;  2A24 B;  4L9G A;  4P6Z S;  1D7E A;  3BQA A;  5HPI A;  4ARZ A;  3PYP A;  4HH2 A;  5HD5 A;  3S7N A;  2WKQ A;  1NLZ A;  1N9L A;  2WKP A;  3RH8 B;  3BWL A;  4H6J A;  3PBT A;  5F68 A;  1H8M A;  4HP4 A;  2OOL A;  3PBS A;  3VOL A;  2D01 A;  3LI9 A;  1OTE A;  1OJ5 A;  1MC0 A;  1XJ6 A;  3D3O A;  3E4Q A;  4CLC D;  2EWW A;  5TJJ A;  2JN7 A;  3PBN A;  4Y3I A;  4AFI A;  4MN5 A;  4B9O A;  3F1N B;  4KUO A;  3P7N A;  1DP8 A;  3LFV A;  4LPZ A;  4UEY A;  3TJZ C;  5KIZ A;  2Y79 A;  3S7O A;  3E0Y A;  3MQO A;  3IBR A;  4Y5F A;  5DJT A;  4NEE D;  1STZ A;  3LR0 A;  2JKT I;  4EET B;  1TS6 A;  4KQD A;  3LIA A;  2INW A;  4KQO A;  3LIB A;  4XT2 B;  2W3D A;  1XFN A;  3PXP A;  3HJK A;  4DN0 A;  4MCW A;  3G6O A;  4MN7 A;  3OCL A;  2P04 A;  3T4T A;  3H82 A;  4HIA A;  3CUE C;  1W63 M;  5AJG A;  3ULF A;  2K31 A;  4PAU A;  2XA7 M;  1VB6 A;  2VV7 A;  4R38 A;  3GDI A;  3LIF A;  1IOU A;  1OT6 A;  4EES A;  4HHD A;  2QWS A;  1TD5 A;  3BQ8 A;  3R4K A;  3ICY A;  3H7W A;  2OWJ A;  2GJ3 A;  3JVU A;  4EEP A;  1V9Y A;  4WLA A;  1NWZ A;  2VGL M;  5DF9 A;  3BW6 A;  3B47 A;  1XFQ A;  3CUE A;  3T4L A;  3E4O A;  1S4R A;  2QJ7 A;  5KSH A;  3KX0 X;  3PBQ A;  4GHI B;  1F5M A;  2VGL S;  3V67 A;  4I5S A;  5FL3 A;  3OBF A;  4F3L B;  1ODV A;  2GNX A;  5HL6 A;  3NOP C;  1T1B A;  2K2N A;  2W1T B;  1S4S A;  3BY8 A;  3F1P B;  5EFW A;  3F1O A;  2L1M A;  4Y2F A;  1P0Z A;  1DP6 A;  2KX6 A;  2IA2 A;  3T4Q A;  2PD8 A;  2A24 A;  3S7Q A;  3FC7 A;  3T4K A;  4UQI S;  3HCY A;  2M7V A;  1S1Z A;  3T50 A;  4HY8 A;  2V1B A;  1GSV A;  1MKM A;  1XJ4 A;  4HI4 A;  3RTY A;  4PKY G;  1NLY A;  4WUJ A;  5F5Y A;  4L9F A;  4CLC A;  4ETX A;  1LSW A;  3A0V A;  3EQU A;  3ZQ5 A;  5IS1 A;  5TBM A;  1EW0 A;  3NOT C;  5HDC A;  1DP9 A;  1P9W A;  3ZYT A;  3UB8 A;  3K2N A;  2W3G A;  3F1N A;  3EOI A;  3B33 A;  2OAQ 1;  3VE4 A;  1H3Q A;  4EUV A;  4JGQ A;  1TF1 A;  3CWF A;  3DBA A;  1XJ2 A;  4HP9 A;  4WF0 A;  1N9N A;  2P7J A;  1UGU A;  1NRJ A;  3EQV A;  3C2W A;  4LRZ E;  1ZTU A;  5I5L A;  4GLQ A;  3UMD A;  2LB5 A;  2VJW A;  5LBR A;  1YKD A;  3VV4 A;  4DJ2 A;  2VLG A;  1TS7 A;  3T4O A;  3MQQ A;  5J3W A;  1X0O A;  3B42 A;  4XT2 A;  3RFB A;  4E04 A;  1OJG A;  3CLO A;  2GX5 A;  2XSS A;  4GW9 A;  2BAS A;  4GCZ A;  2ZBB A;  2VA0 A;  5DKK A;  2Z6D A;  3KYQ A;  5C5K A;  2MJ6 A;  5AVE A;  4EQ1 A;  3D72 A;  4WEL A;  3NOU C;  4G3W A;  3OLO A;  1G6O A;  2JKR M;  3LIC A;  4JGO A;  2VZW A;  4R70 A;  3OOV A;  3K3D A;  4ETZ A;  3LID A;  5HDD A;  2JHE A;  3KYZ A;  3NHQ A;  1GSW A;  2O99 A;  2PYR A;  4I39 A;  3OCN A;  3LR3 A;  1ZHH B;  3MXQ A;  5DFX A;  1P97 A;  1P9R A;  1TS8 A;  4GHI A;  4IJG A;  2O9C A;  3A0R A;  3EGX C;  3EEH A;  3EGD C;  3A0S A;  1F9I A;  5AVF A;  1S66 L;  2DMW A;  3LR4 A;  2PDR A;  2QJ5 A;  4QPR A;  2VX8 A;  4H6J B;  3T4S A;  5HWT A;  5J7E A;  4LRY C;  5HPF A;  4I3J A;  4IHQ A;  2M1C A;  5HD3 A;  1OT9 A;  1DRM A;  2ZOI A;  4KUK A;  1XJ3 A;  2HV1 A;  2R78 A;  2PHY A;  2HJ9 C;  1OPX A;  3PBR A;  4WN5 A;  3C38 A;  2PD7 A;  2WKR A;  4YOF A;  3LYX A;  4B93 A;  2W0N A;  1T19 A;  2HGV A;  2NUT C;  4EEU A;  1YSP A;  4WEJ A;  2P08 A;  3LUQ A;  2PT7 A;  4UQI M;  3H9W A;  2JKR I;  5HWW A;  2I9V A;  4BWI A;  4HQA A;  2O0Y A;  2B02 A;  2V1A A;  4JGR A;  3C8C A;  3PR6 A;  3PHY A;  4BJP A;  3MFX A;  5F6A A;  3O5Y A;  3IS2 B;  1G28 A;  1YSQ A;  3OC2 A;  4PHT A;  4CQH A;  4NXE A;  5MC7 A;  4YNR A;  3K3C A;  2XRN A;  2W3H A;  3UB9 A;  4I3A A;  4IUK A;  3MQ0 A;  4HOI A;  4EW7 A;  2V0U A;  1OTA A;  2YKH A;  2V9A A;  4BBV A;  2FH5 A;  3KSH A;  1T1A A;  4ZRR A;  2Z6C A;  2O9A A;  3T4J A;  5CX7 A;  4OOM A;  1LSX A;  4G3K A;  2GZA A;  4G3V A;  1S67 L;  3EEA A;  5DKL A;  4NXB A;  4PKY A;  2K7S A;  2EWV A;  3MMH A;  4GS9 B;  3KSG A;  3E4P A;  1UWN X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...