4G3WA

Crystal structure of a. aeolicus nlh1 gaf domain in an inactive state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
137
Chain Sequence
NLETTVPYIFRLLKKLMGFERLTLTIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQEPEFLNKVWKRKKKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
molecule keywords Transcriptional regulator nlh1
total genus 26
structure length 137
sequence length 139
ec nomenclature
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3wA00
3G6OA 3KSHA 2HGVA 3C2WA 3KSGA 4ZRRA 4MN7A 3S7PA 2O9BA 3R4KA 3D3OA 4MDZA 4LRZE 2VEAA 4PAUA 2OOLA 2VZWA 2M7VA 4IJGA 3RFBA 3IBJA 4EUVA 2W1TB 2KOIA 4YNRA 1TD5A 2O0YA 4EU0A 4R70A 3CI6A 2XRNA 3MF0A 5HL6A 4DN0A 4RQ9A 2B18A 2W3GA 2LB5A 2LB9A 4O8GA 3CITA 3DBAA 3NOTC 3W2ZA 5C5KA 3S7NA 5AJGA 4FOFA 5L8MA 4MMNA 3TRCA 3OBFA 1YSQA 4G3WA 2IA2A 5DFYA 4Y5FA 3OOVA 3VV4A 2XROA 3LFVA 2Y8HA 3S7QA 3IBRA 3MQ0A 4DMZA 2K31A 1ZTUA 4R6LA 4QPRA 2O99A 5LBRA 5I5LA 2W3DA 4MCWA 4Q0IA 3KO6A 2K2NA 4BWIA 3NHQA 2VJWA 4LRXC 3ZQ5A 2KLIA 4ETXA 4ME4A 4O01A 2G7UA 5TJJA 4GW9A 4Y3IA 4GLQA 4YOFA 1F5MA 4ETZA 4IUKA 2VKSA 4E04A 3O5YA 3S7OA 2XSSA 3NOUC 4O0PA 4Y2FA 2QYBA 1YKDA 4Q0HA 4G3KA 4Q0JA 3KSIA 4Z1WA 3K2NA 5HPFA 1TF1A 2W1RA 1MKMA 3MMHA 5HPIA 2O9CA 1YSPA 3E98A 4G3VA 2M7UA 1MC0A 2W3FA 3HCYA 2W3HA 4LRYC 2ZMFA 2O9AA 3E0YA 4IUHA 5DFXA 2Y79A 3NOPC 4CQHA 5HSQA 1VHMA 2W3EA 1STZA 2W1TA 3KSFA 5K5BA 2GX5A 3BJNA 3EEAA
chains in the Genus database with same CATH superfamily
3ITBA 4GHIB 3FC7A 2D02A 3CWFA 4BL3A 4BL2A 2OOLA 3O88A 4E3MA 1YLJA 4JF6A 4YNRA 2Y2JA 3VP2A 3LR3A 4LPZA 3PBQA 3CI6A 3V39A 3W2ZA 5C5KA 1GA9A 3N6IA 4UA9A 2OAQ1 4K0XA 3PBTA 5M1AA 5G4ZA 1LSWA 1QMFA 3C7UA 5A8BA 1XXMA 3T1RA 3RXXA 1K54C 1ES3A 3SH9A 1A0KA 3TSGA 4JBFA 4EQIA 3KYQA 1FCNA 1KE3A 3TG9A 3MKEA 3N7WA 1YLYA 2PT7A 5CEDA 1P9RA 4ETZA 2OAP1 4E04A 5KZHA 3P7NA 3BQAA 1PI4A 4HEFA 3HREA 3LICA 2PAVP 1Y54A 4HESA 2GJ3A 5M19A 4QY6A 1CF0A 4OPRA 4JPMA 4X6TA 3BFGA 1N9LA 3NOPC 1DJAA 4CLCD 2XGNA 2V1ZA 3M6BA 4PM7A 5GLAA 2KX6A 4MN6A 1LLBA 3JPUA 1C3BA 4ZRRA 3CLOA 1GA0A 4PKYG 1KOUA 2DNSA 1S0WA 2XDMA 3WRZA 5HD3A 2QHKA 1HLUP 3FKWA 4XXRA 1Q2PA 3EQVA 3MBZA 2JKRM 2W0NA 3QP4A 2V1BA 4N92A 4S2KA 4DF6A 4DN0A 1ERMA 4KZ5A 5EPHA 4CLCB 4BQMA 3ZVTA 5CGWA 4HQAA 5CHMA 4ZJ1A 4B4ZA 5EM0A 5EUAA 3NY4A 2JKTI 3O3VA 3OBFA 1T1CA 5FASA 4KENB 1VETA 2XQZA 3OPPA 3OCLA 1YLPA 4S2NA 4HI4A 3ZVWA 4RYEA 3GSGA 3IH8A 4UHUA 1ERQA 1K54A 1F9IA 3UDXA 3MZDA 4HIAA 3D9YA 1E3UD 1W79A 3W4PA 3A0RA 2V8FA 2ZOHA 5FQIA 2Z2MB 4EWFA 4EEUA 1ALQA 3VOZA 1N9NA 4Y3IA 4EESA 4WM9A 4Y0OA 1T18A 3OLOA 2EXBA 1DJBA 2EX2A 4IBXA 5AQ9A 3A3IA 3QP5A 2M7UA 2X71A 2XLNA 1SKOB 3F1PB 1CK3A 2Y79A 4KQDA 2J3TD 5K5BA 2JE5A 1IOUA 3MKFA 3UB6A 4ARZA 2Y2IA 1YMSA 5HAIA 2RCXA 4S2LA 3GMWA 5EVID 4IJGA 3VSKA 1PZOA 2FZ0A 4MBHA 3HBRA 3D4FA 1VETB 1NLZA 1CI8A 2W3GA 5FAQA 4R1GA 1H5XA 2Z6CA 3HLGA 1JTGA 1GHMA 3T12B 3CHWP 3CAXA 4FSFA 4BLMA 4NXEA 5IT5A 4X68A 2XA7M 5DKKA 3BM6A 3MZEA 3P98A 2J8YA 1LSVA 3MR0A 2WKRA 3IQAA 4BD1A 2FH5A 2ZD8A 3ISGA 4QPRA 1ZC2A 2ZC5B 5DJUA 5LBRA 1JTDA 2NUPC 2ZJ9A 3UPPA 5F6AA 2ZM2A 3F1NB 4BWIA 3NHQA 3BQ8A 4ZTKA 3LO7A 2G7UA 4IBRA 2B02A 4OLGA 5EOEA 4FH4A 4UQIS 3VMAA 2ZC4B 3B3XA 4PM6A 2ZC6B 5GLCA 3MFDA 2ZM8A 5EV0A 3BFDA 4WN5A 5DF9A 3S1YA 3L9KA 3BRMA 1MWRA 3BJNA 3FG8A 3WS1A 3GV9A 3VP0A 2MJ6A 4MN7A 3S7PA 4GCZA 2V2FF 2PR5A 3QP8A 4EEPA 1KGFA 1XKZA 2WADA 4NEED 1LT0A 3ICYA 3FV7A 1GSXA 4RQ9A 3WS4A 3EQUA 4HJ6A 3ZG8B 1BLPA 4Y15A 2Y91A 3I7JA 5F82A 5F1GA 4S2NC 3Q1FA 3NULA 4E3IA 3CPTB 3AGDA 4R3JA 1NLYA 1OJGA 2JN7A 4EBPA 5I94A 1TDGA 1HD8A 4B93A 4GD6A 4OLDA 3IWQA 3LIBA 4JF5A 4MCWA 3KO6A 5G18A 3VSLA 3ZCZA 5TJJA 2OLUA 2EWVA 1E25A 1XFNA 4OPYA 4MEZA 4Y2FA 4GKUA 3T4JA 2HP5A 1TDLA 4Q0HA 4GHIA 3VE3A 4I3IA 3UE3A 1K57A 2V1AA 4YWZA 1P9WA 3QP6A 3V50A 5CGSA 2WKEA 3LR0A 1DP8A 4Z9QA 4DXBA 4HJ3A 4RX3A 3LY4A 1OTAA 2W3HA 5FI6A 1ACFA 4E6XA 4HHDA 2J3TC 5DTTA 5CHJA 2YKFA 5GL9A 2HJEA 1OT9A 1CJFA 5FQMA 3T1XA 1E3UA 4L0LA 3QNCA 3K3DA 5FQJA 1O07A 3Q7VB 4KZ3A 4KG5A 3RFBA 3ZDJA 1BUEA 3WRTA 1XJ2A 1TD5A 1PI5A 3NIAA 1U60A 4X25A 5E43A 1NXYA 2J9PA 3JVUA 4PMAA 5FAOA 4C3QA 4O8GA 4PHTA 2Y2MA 4GDBA 1NWZA 1SDEA 1ZG4A 2I9VA 3LI9A 2Z2LB 4D2OA 1MBLA 4MMNA 2BASA 3EGXC 3FYZA 3UY6A 4WZ5C 3A3DA 3TE8A 1TS6A 1M40A 3LR4A 4BD0A 4PM8A 3VOYA 4GD8A 4C75A 3ZG7B 4FD8A 1FCMA 5KIZA 3FWLA 1NYYA 1P0ZA 3UE6A 4DMZA 2WUQA 2Y2NA 3IH9A 2WK0A 4ETXA 3V3RA 4GLQA 3W8KA 4BBUA 5FQ9A 3S7OA 5HWWA 4L9EA 1ES4A 1GSWA 2FFYA 5HPFA 2ZC3B 4DJ2A 5IU1A 4ZAMA 2DRWA 3O86A 4DKIA 3HUMA 2H5SA 3F1PA 1V9ZA 1XFQA 3HCYA 1GHPA 3E4PA 2O9AA 4HBTA 4OVDA 1VHMA 3LI8A 4H6JA 1G6OA 1BLHA 3SW1A 5HAPA 3IXBA 3DWKA 2HGVA 1AWIA 4EBLA 2Y2KA 2ZBBA 4MDZA 4EETB 3N8RA 2VEAA 3PBRA 3KYEA 5E2EA 2OWHA 2R9XA 3Q7VA 5EVLA 1WYBA 2O0YA 1MKIA 5FDHA 1WYCA 4IVIA 4EW7A 3P01A 5A90A 1K4EA 2VGLM 4S2PA 3GR2A 3T50A 3CG5A 3C4OA 3BY9A 2ZLYA 4RVAA 3OPHA 2XROA 1NRFA 4ID4A 3MJQA 1VM1A 4WBGA 5IHVA 4Y0UA 3UE0A 1SHVA 3RXWA 3G34A 3ZQ5A 4H6JB 5GHYA 4YOFA 1J3WA 5DTSA 2WGWA 1K57C 3G32A 2XFSA 4DE3A 1LHYA 4G3KA 4Q0JA 1MXOA 4Z1WA 4XT2B 2OLVA 3LIAA 4KZ4A 3WS5A 2WAEA 3TJZC 5MC7A 1NYMA 3PYPA 4LCLA 3IWOA 1HVBA 2OV5A 1W8YA 5EVIA 3IX8A 3RJUA 1G68A 1S4SA 3IXDA 5EE8A 4I39A 3PXPA 1L0DA 4HP4A 2A3UA 4ZJ3A 4N1XA 5CECA 3GECA 1G28A 3H82A 2GZAA 2HJ9C 3TRCA 2EX9A 1OPXA 3IX3A 3E2LA 1KDWA 5CTNA 4JKTA 2WGIA 3VV4A 2Q0OA 2Y8HA 4Y13A 2EXAA 3S7QA 4CLCE 1PFLA 2GNXA 3BLMA 5FEGA 5HX9A 4CPKA 5BOHA 2B5RA 2JBFA 3L7HA 4KZBA 5TBMB 1V9YA 2V0WA 1XGJA 2E8JA 1F5MA 3EGDC 4WUJA 1YAXA 1LL8A 2XF3A 3S4XA 1JWPA 5A91A 2NUTC 2P9VA 1NJ4A 1Y4OA 5FEFA 4OPQA 1G6AA 1E4DA 2ZL1A 4MN5A 2L4RA 3BFCA 3B33A 4KUKA 4Y0TA 2CC1A 3IF6B 3HLEA 3HLBA 4KG2A 3T4LA 3EEAA 4JF4A 4QWOA 5EVIB 5A92A 4XUXA 1OTIA 2PU2A 3CMZA 4P6ZM 2K7SA 1H8ZA 4GN2A 3GQZA 3MXRA 3F1NA 4EU0A 1QMEA 3V3SA 2Y2HA 1SKOA 5HL6A 1TS7A 1TVFA 4S2OA 3H82B 3S7NA 1K4FA 5AJGA 1XJ4A 2BG1A 5AQ7A 4BBVA 3HLCA 2JCHA 2A2LA 3ZG5A 3NDEA 2XA7S 2BTFP 1Z6FA 4ZBEA 3T4TA 2ZQCA 2HDRA 2J3WA 1TS0A 5E2GA 3OPLA 4Y7PA 1FSWA 3UMDA 2A24B 1OTEA 2WYXA 4JGQA 3IX4A 4U3TA 1IFQA 1T1BA 3UPNA 4WELA 4LRXC 5FQKA 1IELA 3PBSA 4WF0A 4WYYA 3GDIA 1FILA 2WKHA 2VKSA 2QKPA 2IWDA 4OP8A 4NXBA 3E2KA 2ZQDA 3QNBA 2ZOIA 4IVKA 3FPVA 1LL9A 3PHYA 1D06A 2HPBA 5HPIA 3BEBA 3N8SA 1G5UA 1H3QA 3IF5A 3EOIA 2P04A 2H10A 4IUHA 4CQHA 1KGGA 5EVIC 1NRJA 3PR6A 2P74A 1XJ3A 2Y2OA 4K0WA 2VV7A 2O9BA 4LRZE 3HLWA 4DE0A 1KVLA 2XH9A 3ZFZA 2JKRI 3UE1A 2BLSA 2KOIA 4K08A 3MXQA 1S1ZA 3PAGA 1UGUA 4YFMA 1OJ5A 1VEUA 2WGVA 1BT5A 4R0QA 1XA7A 2KDKA 4X56A 2I72A 3F1OB 3IHAA 4OH0A 1K6RA 5HZHA 1K38A 2Y4AA 2DCFA 5J8XA 4IEDA 2P08A 3NECA 4RX2A 3MZFA 2V9AA 4Y5FA 4BENA 1FR1A 3DAVA 3H7WB 5FI7A 3MFXA 4JGOA 3EWKA 2JKTM 3DTIA 4R6LA 3ZHHA 4QB8A 3M2JA 3MSHA 4U0XA 4HOIA 4GB7A 4S2JA 1FSYA 2AVXA 4F94A 4D60A 1MZUA 4DXCA 1H8MA 3P09A 1BZAA 4KUOA 2VGJA 4HH2A 4R3AA 4XT2A 4WL9A 4PM9A 3LIEA 2Y59A 1ODVA 4HH3A 2W1RA 1KGEA 1YSPA 3BLSA 3VP4A 5L2FA 4H8RA 5U47A 4R3BA 3E4OA 4UAAA 2JKFA 4MBKA 2VV6A 4L9FA 3LY3A 5F83A 5F1FA 1BYWA 3PBOA 1UWNX 2HV1A 4L9GA 1I5QA 2A24A 3SZTA 4HBUA 1Z09A 3ZG9B 2M7VA 3NBLA 3JVVA 3T4OA 3CUEC 1BLSA 2Y2GA 5DKLA 2XRNA 2ZC7A 3LGOA 4R4SA 4AFIA 2ZQ8A 4E3OA 4P87A 2WZZA 3IHBA 5CRFA 4Y17A 1K56D 2FFFB 1F98A 2A49A 2J7VA 3Q7ZA 3SS4A 3SS3A 1YT4A 3HJKA 4G3WA 4KZ6A 4IHQA 1OMEA 2H0YA 5E2FA 3VP1A 1S1YA 1IKGA 3LFVA 2G2WA 5GLBA 1DP9A 4WLAA 2DMWA 5GHXA 3MQ0A 1XP4A 4U0TA 3UB9A 4I3AA 1CI9A 5GLDA 1W63Q 2UWXA 4MBFA 1S66L 4LFUA 4GNUA 1AXBA 4GZBA 1EWZA 3QHYA 2VJWA 4X69A 4O01A 2ZQAA 5FL3A 4IUKA 3JYIA 4Q8IA 4O0PA 2L1MA 5KSHA 1BTLA 4FUWA 2V0UA 4M4XA 4S2MA 4OONA 1LI9A 4GS9B 3T4KA 3NI9A 1T19A 1BULA 2WAFA 1BLCA 2R9WA 1FQGA 4OQHA 4GS9A 1LL5A 4N1HA 1W5DA 4WZ5A 5CGXA 2HDSA 3TW8A 2W1TA 3G2ZA 3SH7A 3VOLA 4A5RA 3PTEA 4I5SA 4E6WA 1W63M 2GX5A 1T1AA 4P0MA 3VE4A 5TBMA 3KSHA 3KSGA 3ULFA 2HF6A 4XUZA 3R4KA 4E3LA 3D3OA 2VA0A 3OC2A 4QHCA 2PD8A 3LIFA 3C7VA 1YLTA 2PYPA 1SZVA 4JXSA 4KZ8A 1ZG6A 1W8QA 4GDNA 4B4XA 1DP6A 5HDSA 3LEZA 3CUEA 4ARZB 1KDSA 5FATA 1I2WA 2LB5A 4UA6A 1DJCA 3NOTC 1F2KA 2QMIA 1LI0A 3EEHA 3OCNA 2JHEA 1GHIA 1NY0A 2IA2A 4R4RA 1PW8A 2EA9A 4FTXA 3G2YA 4OOLA 1PNEA 2XFTA 3WS2A 2YKHA 1SDNA 4UEYA 3U4LP 2ZMAA 3BY8A 3IT9A 1L3LA 3DTKA 5I5LA 2EX8A 5EFWA 2HP9A 2QWSA 1RGZA 3O87A 4ME4A 2HDQA 3FPWA 4GW9A 3LYXA 5CERA 1CEFA 4K91A 5JYPA 1NZUA 3FZCA 5M18A 2XR0A 3C5AA 1ZKJA 3UDFA 4QJGA 1TF1A 4DE2A 2XEPA 3ZNTA 3RTYA 1WA9A 3WS0A 4LV3A 4OQIA 2VV8A 2INWA 4YINA 1ESUA 2WGWB 3UB7A 4EUZA 2P9VB 3ITAA 2PR6A 3T4SA 5KMWA 3BYDA 1PRQA 3UMEA 4NXFA 4RA7A 1BSGA 3G35A 3UPOA 1SCWA 3NC8A 1ONHA 3U2AA 4KZ7A 5EM1A 4EUVA 5FDSA 1MWTA 2PHYA 4LENA 2WKQA 3C30A 1D1JA 2B18A 3BECA 3CITA 2H28A 1KE0A 3E4QA 5FQQA 2WKIA 2QZ6A 3OPRA 1O7EA 2V20A 1YMXA 1VEUB 5DFYA 2PU4A 3K3CA 4DRTA 3DTMA 3A0SA 3Q81A 5CHUA 5L07A 2QPNA 5AVFA 2HZ5A 3N8LA 3W4OA 2C6WB 3NCKA 2K31A 2PDRA 2M1CA 3T4QA 3DW0A 4PKYA 3SH8A 1VB6A 4JGRA 1RGYA 4KQQA 1NZOA 2CMNA 5A93A 2VGKA 4QU3A 3AGFA 2QJ5A 4B88A 3HVFA 3UO9A 3KSIA 1JVJA 1J9MA 3LR5A 1JNUA 2PYRA 5JYOA 2ZM0A 3ZNYA 4BMWA 1UWPX 3E98A 1YLZA 5CEBA 1HZOA 5DTKA 3TOIA 4CJNA 1L0EA 5EVEA 3B47A 3C4PA 3RH8B 4OPZA 2RL3A 4I38A 4JXVA 1OTBA 3G30A 1ES2A 5HAQA 1K0KA 4II7A 4X1LA 3LEQA 1IYOA 5AQBA 1PWCA 2R78A 4LV2A 4OP5A 2EFXA 5F69A 3CZDA 3N4IA 4E3JA 1H8YA 5L8MA 1DRMA 2W27A 4LGWA 4LCMA 4CLCA 3G31A 2B95A 2L0WA 1YLWA 3LIDA 1YSQA 1ESIA 3Q07A 5TFQA 3BFEA 2QJ7A 2WKPA 1OTDA 1WE4A 1KVMA 1ZTUA 3B42A 4FCFA 5DVAA 4DDYA 4P85A 2W3DA 5EOOA 1DY6A 2K2NA 3HUNA 2KLIA 1ONGA 3OZHA 1JWVA 2P7JA 3SS5A 2VGLS 3O5YA 1M6KA 3UB5P 4OQ0A 5DF8A 3QP1A 3ZYTA 4KZAA 3MMHA 5F5YA 4R23A 2V8CA 1GCEA 2GDNA 1FOFA 3H7WA 1N9OA 4G3VA 3UN7A 2ZMFA 1HTZA 5DFXA 5HSQA 3KX0X 5DJTA 2VX8A 1TS8A 2HDUA 4ZJ2A 3G6OA 3UNWA 3GRJA 5J4EA 3F1OA 3HL9A 1H0MA 4EV4A 1K55A 4KQOA 2VZWA 1K25A 4FH2A 3IS2B 4WEJA 4OOMA 3MXSA 3NJAA 3PAEA 3BFFA 4R70A 4LV0A 3KYZA 4F3LA 3MF0A 1D7EA 3T1QB 4PPRA 5L10A 5GHZA 2LB9A 3ZGAB 2C5WB 4OKPA 4KG6A 1EROA 4OQGA 3IWIA 1MWUA 1PW1A 4FOFA 4NK3A 3VFFA 4WMCA 5HDCA 2J9OA 2Q9MA 4I3JA 3R7WB 5AQAA 3SOIA 1CEGA 4KZ9A 3R7WA 4GOGA 2Y2PA 3FKVA 1XJ6A 5E2HA 2XD5A 3BW6A 1ZHHB 4N9LA 1YPRA 3IBRA 4MLLA 3DWZA 4EERA 4X53A 2E8IA 1K55C 4F3LB 2G2UA 4X1MA 1YM1A 4R38A 1Q2QA 2EFUA 3QP2A 5HD5A 2X01A 4NG2A 1XX2A 2JC7A 5HWTA 2QYBA 5DF7A 1YKDA 4BBTA 5KSCA 4UQIM 3HUOA 2ZMVA 4X55A 3A3EA 4OOYA 1MKMA 1MY8A 4ESPA 3Q82A 2Q9NA 2IWCA 4LRYC 4PM5A 1EI5A 1N4OA 4HY8A 5AVEA 5IS1A 1MPLA 3CJMA 4JGPA 1P97A 1S67L 3IXGA 1MWSA 4WEKA 3IBJA 3A0VA 3G4PA 3V5MA 1RCJA 1IKIA 5HL1A 5FA7A 1XA1A 3IF6C 3AGEA 4JXGA 1SKFA 1VQQA 3CPTA 1OT6A 4LV1A 5CX7A 1K56A 4WMCD 2PRFA 3HLFA 2EWWA 1YQSA 1PWGA 4EQ1A 2ZQ9A 1LSXA 4NXGA 2HP6A 4P6BA 1IYQA 3OOVA 3IS2A 2Y2LA 1K6SA 4P6ZS 1N9BA 3NDGA 5HWVA 4S2IA 3C38A 3DTEA 5FI2A 5L09A 2ZQ7A 1S4RA 4DDSA 4EXOA 1I2SA 1PYYA 4NKPA 3VFHA 5HARA 3PBNA 5G4YA 4E3NA 3IXHA 5D3OA 5TGFA 4C6YA 1KE4A 4HNBA 1XPBA 1JWZA 2PBDP 1PWDA 3S22A 2OSUA 4M3KA 3K2NA 5FSRA 2H0TA 3M6HA 3MQOA 3LCEA 2W3FA 5J3WA 3HLDA 4CLCC 1S6RA 3E0YA 3UDIA 1IEMA 1FCOA 4HJ4A 2IWBA 3W4QA 1FR6A 1CQAA 4O7DA 3MQQA 4QY5A 1GSVA 3C2WA 3VP3A 5J7EA 2EX6A 3WWXA 4PAUA 2PD7A 1L0GA 4N9KA 4JLFA 2X02A 3A3FA 1RP5A 3GVBA 2W1TB 4ZDXA 2ZL1B 3A3JA 1Y28A 4WZ4A 5CXWA 4JXWA 2XD1A 3DBAA 2UV0E 3T1SA 1ES5A 3IF6A 5EECA 4NETA 1XGIA 2VLGA 1IYSA 3M2KA 4HP9A 4UA7A 1TEMA 2Y55A 1X0OA 4GJ4A 3GTCA 3ZG0A 3MS6A 4KQRA 1EW0A 5FAPA 5HW3A 3C8CA 4DJ3A 2ACGA 2PBYA 5HDDA 2OWJA 3HJIA 2O99A 3LUQA 2XK1A 4Q0IA 3D72A 4BJPA 4QD4A 2VK3A 1PIOA 4E3KA 1PZPA 2JKGA 3H9WA 2Z6DA 1W7FA 2XSSA 3NOUC 2Y2QA 1L0FA 4B9OA 1L2SA 2WZXA 4MNRA 2J80A 5CTMA 1IYPA 2O9CA 4DE1A 4LLOB 4EBNA 1MC0A 3UB8A 2D01A 3V67A 2W3EA 1FIKA 1STZA 3BWLA 5TR7A 5F68A 3KSFA 5HFOA
chains in the Genus database with same CATH topology
1XJ3A 1OTBA 2YKFA 4GHIB 2VV7A 2O9BA 2HJEA 1OT9A 3FC7A 4LRZE 2D02A 3CWFA 4II7A 4L0LA 3K3DA 2OOLA 2JKRI 3RFBA 2KOIA 4K08A 3MXQA 4YNRA 1XJ2A 1S1ZA 1TD5A 2R78A 1UGUA 3LR3A 4LPZA 1OJ5A 5F69A 3PBQA 3CI6A 3JVUA 2KDKA 3F1OB 4O8GA 4PHTA 5HZHA 3W2ZA 5C5KA 1NWZA 2OAQ1 2I9VA 3LI9A 3PBTA 5L8MA 1DRMA 2W27A 4CLCA 4MMNA 2BASA 2P08A 3EGXC 2L0WA 5G4ZA 1LSWA 3LIDA 1YSQA 5A8BA 2V9AA 3TE8A 4Y5FA 2QJ7A 1TS6A 3H7WB 3LR4A 3MFXA 2WKPA 1OTDA 4JGOA 5KIZA 1P0ZA 3EWKA 2JKTM 3UE6A 1ZTUA 4R6LA 4DMZA 3B42A 4HOIA 2W3DA 3KYQA 2K2NA 2KLIA 4ETXA 2PT7A 1MZUA 2P7JA 4GLQA 1H8MA 1P9RA 4KUOA 4ETZA 2OAP1 4BBUA 4HH2A 4E04A 2VGLS 3O5YA 3S7OA 4L9EA 5HWWA 3P7NA 3BQAA 1GSWA 4R3AA 4XT2A 4WL9A 5HPFA 3LIEA 4HH3A 1ODVA 3LICA 2W1RA 3ZYTA 3MMHA 5F5YA 4DJ2A 5IU1A 1YSPA 2GJ3A 3H7WA 1N9OA 4G3VA 3F1PA 1V9ZA 1XFQA 3HCYA 2ZMFA 3E4OA 2O9AA 3E4PA 1N9LA 5DFXA 3NOPC 5HSQA 1VHMA 3KX0X 3LI8A 2VV6A 4L9FA 5DJTA 4CLCD 4H6JA 2VX8A 1BYWA 1TS8A 3PBOA 1G6OA 2KX6A 3SW1A 4MN6A 3G6OA 1UWNX 2HV1A 2HGVA 4L9GA 4ZRRA 2ZBBA 3CLOA 3F1OA 4MDZA 4EETB 5J4EA 4PKYG 1KOUA 2VEAA 3PBRA 2A24A 4KQOA 2VZWA 2OWHA 2M7VA 3IS2B 4WEJA 3JVVA 3T4OA 4OOMA 5HD3A 3NJAA 2QHKA 3CUEC 2O0YA 5DKLA 4R70A 3KYZA 3EQVA 2JKRM 2W0NA 2XRNA 1D7EA 3MF0A 2V1BA 4F3LA 4DN0A 4AFIA 2LB9A 4EW7A 3P01A 4CLCB 2VGLM 4FOFA 4HQAA 3T50A 5HDCA 1F98A 2JKTI 4I3JA 3R7WB 3HJKA 3OBFA 1T1CA 4G3WA 3BY9A 3R7WA 4IHQA 1XJ6A 3OCLA 4HI4A 1S1YA 2XROA 3LFVA 3BW6A 1DP9A 4WLAA 2DMWA 3MJQA 1ZHHB 3IBRA 3MQ0A 4EERA 1F9IA 3UB9A 4I3AA 4F3LB 1W63Q 4HIAA 1S66L 3A0RA 2ZOHA 4R38A 2VJWA 3ZQ5A 4EEUA 4O01A 5HD5A 4H6JB 1N9NA 4Y3IA 4YOFA 4EESA 5FL3A 4IUKA 5HWTA 1T18A 4O0PA 2L1MA 2QYBA 3OLOA 1YKDA 5KSHA 4G3KA 4BBTA 4Q0JA 4Z1WA 4UQIM 2V0UA 2ZMVA 4XT2B 3LIAA 1MKMA 4M4XA 2M7UA 4GS9B 3TJZC 3T4KA 1T19A 4LRYC 5MC7A 3F1PB 4GS9A 2Y79A 4KQDA 3PYPA 2J3TD 3TW8A 4HY8A 2W1TA 3VOLA 4I5SA 5AVEA 5IS1A 5K5BA 1W63M 2GX5A 1T1AA 3VE4A 1IOUA 5TBMA 3KSHA 3UB6A 4ARZA 3KSGA 3ULFA 2HF6A 3R4KA 3D3OA 4JGPA 2VA0A 1S4SA 3OC2A 1P97A 1S67L 2PD8A 3LIFA 4WEKA 2PYPA 4IJGA 3IBJA 4I39A 3A0VA 2FZ0A 3PXPA 1DP6A 4HP4A 5HDSA 1NLZA 4ARZB 3CUEA 2W3GA 2LB5A 3NOTC 1OT6A 2Z6CA 5CX7A 3GECA 1G28A 3EEHA 3OCNA 3H82A 2GZAA 2HJ9C 3CAXA 3TRCA 4FSFA 2EWWA 1OPXA 2JHEA 4NXEA 4EQ1A 5IT5A 1LSXA 2XA7M 4NXGA 2IA2A 5DKKA 2EA9A 3OOVA 3IS2A 3VV4A 1LSVA 3MR0A 4OOLA 2Y8HA 2WKRA 3S7QA 4CLCE 2YKHA 4UEYA 2FH5A 2GNXA 4QPRA 4P6ZS 5HWVA 5DJUA 3BY8A 5LBRA 3C38A 5I5LA 2NUPC 1S4RA 5TBMB 5F6AA 1V9YA 4EXOA 3F1NB 2V0WA 4NKPA 5EFWA 4BWIA 3NHQA 3BQ8A 3PBNA 5G4YA 2QWSA 4ME4A 3FPWA 2G7UA 4GW9A 3LYXA 2B02A 1F5MA 3EGDC 4HNBA 4WUJA 1YAXA 4UQIS 1LL8A 3K2NA 1TF1A 2NUTC 3MQOA 3RTYA 1WA9A 2W3FA 5J3WA 2VV8A 2INWA 2L4RA 4MN5A 4CLCC 3E0YA 3UB7A 3B33A 4KUKA 4WN5A 5DF9A 4HJ4A 2PR6A 3T4SA 3T4LA 3UMEA 3BJNA 3FG8A 3MQQA 3EEAA 4NXFA 1GSVA 3C2WA 5J7EA 2MJ6A 4MN7A 3S7PA 4GCZA 2PR5A 4EEPA 4PAUA 2PD7A 1OTIA 4P6ZM 2K7SA 3U2AA 4EUVA 2W1TB 2PHYA 3F1NA 4NEED 4EU0A 1LT0A 1Y28A 2WKQA 3ICYA 1GSXA 3C30A 5HL6A 1TS7A 4RQ9A 2B18A 3CITA 2H28A 3EQUA 3DBAA 3H82B 4HJ6A 3S7NA 5AJGA 3E4QA 1XJ4A 4BBVA 2VLGA 2A2LA 4HP9A 2XA7S 1X0OA 4GJ4A 3T4TA 5DFYA 3K3CA 2J3WA 3A0SA 1EW0A 3C8CA 1TS0A 4DJ3A 1NLYA 1OJGA 5AVFA 2JN7A 2K31A 5HDDA 2PDRA 2A24B 2OWJA 3UMDA 2M1CA 3T4QA 4PKYA 3HJIA 2O99A 1OTEA 3LUQA 1VB6A 4B93A 4JGRA 4JGQA 1IFQA 3LIBA 1T1BA 4MCWA 4Q0IA 2CMNA 4WELA 3KO6A 3D72A 4BJPA 4LRXC 3PBSA 4WF0A 5TJJA 2EWVA 2QJ5A 3GDIA 2VKSA 2QKPA 3H9WA 1XFNA 4NXBA 2Z6DA 2XSSA 3NOUC 4B9OA 2ZOIA 4Y2FA 3T4JA 3FPVA 4Q0HA 4GHIA 3VE3A 4I3IA 3UE3A 3KSIA 3LR5A 2V1AA 3PHYA 1JNUA 2PYRA 4YWZA 1P9WA 4BMWA 1D06A 2J80A 5HPIA 2O9CA 1UWPX 3LR0A 4LLOB 1DP8A 3E98A 4HJ3A 1H3QA 1MC0A 3EOIA 3UB8A 1OTAA 2W3HA 2P04A 4IUHA 4CQHA 2D01A 3V67A 3B47A 2W3EA 1STZA 3BWLA 1NRJA 4HHDA 5F68A 3KSFA 3RH8B 3PR6A 4I38A 2J3TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6O A;  3KSH A;  2HGV A;  3C2W A;  3KSG A;  4ZRR A;  4MN7 A;  3S7P A;  2O9B A;  3R4K A;  3D3O A;  4MDZ A;  4LRZ E;  2VEA A;  4PAU A;  2OOL A;  2VZW A;  2M7V A;  4IJG A;  3RFB A;  3IBJ A;  4EUV A;  2W1T B;  2KOI A;  4YNR A;  1TD5 A;  2O0Y A;  4EU0 A;  4R70 A;  3CI6 A;  2XRN A;  3MF0 A;  5HL6 A;  4DN0 A;  4RQ9 A;  2B18 A;  2W3G A;  2LB5 A;  2LB9 A;  4O8G A;  3CIT A;  3DBA A;  3NOT C;  3W2Z A;  5C5K A;  3S7N A;  5AJG A;  4FOF A;  5L8M A;  4MMN A;  3TRC A;  3OBF A;  1YSQ A;  4G3W A;  2IA2 A;  5DFY A;  4Y5F A;  3OOV A;  3VV4 A;  2XRO A;  3LFV A;  2Y8H A;  3S7Q A;  3IBR A;  3MQ0 A;  4DMZ A;  2K31 A;  1ZTU A;  4R6L A;  4QPR A;  2O99 A;  5LBR A;  5I5L A;  2W3D A;  4MCW A;  4Q0I A;  3KO6 A;  2K2N A;  4BWI A;  3NHQ A;  2VJW A;  4LRX C;  3ZQ5 A;  2KLI A;  4ETX A;  4ME4 A;  4O01 A;  2G7U A;  5TJJ A;  4GW9 A;  4Y3I A;  4GLQ A;  4YOF A;  1F5M A;  4ETZ A;  4IUK A;  2VKS A;  4E04 A;  3O5Y A;  3S7O A;  2XSS A;  3NOU C;  4O0P A;  4Y2F A;  2QYB A;  1YKD A;  4Q0H A;  4G3K A;  4Q0J A;  3KSI A;  4Z1W A;  3K2N A;  5HPF A;  1TF1 A;  2W1R A;  1MKM A;  3MMH A;  5HPI A;  2O9C A;  1YSP A;  3E98 A;  4G3V A;  2M7U A;  1MC0 A;  2W3F A;  3HCY A;  2W3H A;  4LRY C;  2ZMF A;  2O9A A;  3E0Y A;  4IUH A;  5DFX A;  2Y79 A;  3NOP C;  4CQH A;  5HSQ A;  1VHM A;  2W3E A;  1STZ A;  2W1T A;  3KSF A;  5K5B A;  2GX5 A;  3BJN A;  3EEA A; 
#chains in the Genus database with same CATH topology
 3ITB A;  4GHI B;  3FC7 A;  2D02 A;  3CWF A;  4BL3 A;  4BL2 A;  2OOL A;  3O88 A;  4E3M A;  1YLJ A;  4JF6 A;  4YNR A;  2Y2J A;  3VP2 A;  3LR3 A;  4LPZ A;  3PBQ A;  3CI6 A;  3V39 A;  3W2Z A;  5C5K A;  1GA9 A;  3N6I A;  4UA9 A;  2OAQ 1;  4K0X A;  3PBT A;  5M1A A;  5G4Z A;  1LSW A;  1QMF A;  3C7U A;  5A8B A;  1XXM A;  3T1R A;  3RXX A;  1K54 C;  1ES3 A;  3SH9 A;  1A0K A;  3TSG A;  4JBF A;  4EQI A;  3KYQ A;  1FCN A;  1KE3 A;  3TG9 A;  3MKE A;  3N7W A;  1YLY A;  2PT7 A;  5CED A;  1P9R A;  4ETZ A;  2OAP 1;  4E04 A;  5KZH A;  3P7N A;  3BQA A;  1PI4 A;  4HEF A;  3HRE A;  3LIC A;  2PAV P;  1Y54 A;  4HES A;  2GJ3 A;  5M19 A;  4QY6 A;  1CF0 A;  4OPR A;  4JPM A;  4X6T A;  3BFG A;  1N9L A;  3NOP C;  1DJA A;  4CLC D;  2XGN A;  2V1Z A;  3M6B A;  4PM7 A;  5GLA A;  2KX6 A;  4MN6 A;  1LLB A;  3JPU A;  1C3B A;  4ZRR A;  3CLO A;  1GA0 A;  4PKY G;  1KOU A;  2DNS A;  1S0W A;  2XDM A;  3WRZ A;  5HD3 A;  2QHK A;  1HLU P;  3FKW A;  4XXR A;  1Q2P A;  3EQV A;  3MBZ A;  2JKR M;  2W0N A;  3QP4 A;  2V1B A;  4N92 A;  4S2K A;  4DF6 A;  4DN0 A;  1ERM A;  4KZ5 A;  5EPH A;  4CLC B;  4BQM A;  3ZVT A;  5CGW A;  4HQA A;  5CHM A;  4ZJ1 A;  4B4Z A;  5EM0 A;  5EUA A;  3NY4 A;  2JKT I;  3O3V A;  3OBF A;  1T1C A;  5FAS A;  4KEN B;  1VET A;  2XQZ A;  3OPP A;  3OCL A;  1YLP A;  4S2N A;  4HI4 A;  3ZVW A;  4RYE A;  3GSG A;  3IH8 A;  4UHU A;  1ERQ A;  1K54 A;  1F9I A;  3UDX A;  3MZD A;  4HIA A;  3D9Y A;  1E3U D;  1W79 A;  3W4P A;  3A0R A;  2V8F A;  2ZOH A;  5FQI A;  2Z2M B;  4EWF A;  4EEU A;  1ALQ A;  3VOZ A;  1N9N A;  4Y3I A;  4EES A;  4WM9 A;  4Y0O A;  1T18 A;  3OLO A;  2EXB A;  1DJB A;  2EX2 A;  4IBX A;  5AQ9 A;  3A3I A;  3QP5 A;  2M7U A;  2X71 A;  2XLN A;  1SKO B;  3F1P B;  1CK3 A;  2Y79 A;  4KQD A;  2J3T D;  5K5B A;  2JE5 A;  1IOU A;  3MKF A;  3UB6 A;  4ARZ A;  2Y2I A;  1YMS A;  5HAI A;  2RCX A;  4S2L A;  3GMW A;  5EVI D;  4IJG A;  3VSK A;  1PZO A;  2FZ0 A;  4MBH A;  3HBR A;  3D4F A;  1VET B;  1NLZ A;  1CI8 A;  2W3G A;  5FAQ A;  4R1G A;  1H5X A;  2Z6C A;  3HLG A;  1JTG A;  1GHM A;  3T12 B;  3CHW P;  3CAX A;  4FSF A;  4BLM A;  4NXE A;  5IT5 A;  4X68 A;  2XA7 M;  5DKK A;  3BM6 A;  3MZE A;  3P98 A;  2J8Y A;  1LSV A;  3MR0 A;  2WKR A;  3IQA A;  4BD1 A;  2FH5 A;  2ZD8 A;  3ISG A;  4QPR A;  1ZC2 A;  2ZC5 B;  5DJU A;  5LBR A;  1JTD A;  2NUP C;  2ZJ9 A;  3UPP A;  5F6A A;  2ZM2 A;  3F1N B;  4BWI A;  3NHQ A;  3BQ8 A;  4ZTK A;  3LO7 A;  2G7U A;  4IBR A;  2B02 A;  4OLG A;  5EOE A;  4FH4 A;  4UQI S;  3VMA A;  2ZC4 B;  3B3X A;  4PM6 A;  2ZC6 B;  5GLC A;  3MFD A;  2ZM8 A;  5EV0 A;  3BFD A;  4WN5 A;  5DF9 A;  3S1Y A;  3L9K A;  3BRM A;  1MWR A;  3BJN A;  3FG8 A;  3WS1 A;  3GV9 A;  3VP0 A;  2MJ6 A;  4MN7 A;  3S7P A;  4GCZ A;  2V2F F;  2PR5 A;  3QP8 A;  4EEP A;  1KGF A;  1XKZ A;  2WAD A;  4NEE D;  1LT0 A;  3ICY A;  3FV7 A;  1GSX A;  4RQ9 A;  3WS4 A;  3EQU A;  4HJ6 A;  3ZG8 B;  1BLP A;  4Y15 A;  2Y91 A;  3I7J A;  5F82 A;  5F1G A;  4S2N C;  3Q1F A;  3NUL A;  4E3I A;  3CPT B;  3AGD A;  4R3J A;  1NLY A;  1OJG A;  2JN7 A;  4EBP A;  5I94 A;  1TDG A;  1HD8 A;  4B93 A;  4GD6 A;  4OLD A;  3IWQ A;  3LIB A;  4JF5 A;  4MCW A;  3KO6 A;  5G18 A;  3VSL A;  3ZCZ A;  5TJJ A;  2OLU A;  2EWV A;  1E25 A;  1XFN A;  4OPY A;  4MEZ A;  4Y2F A;  4GKU A;  3T4J A;  2HP5 A;  1TDL A;  4Q0H A;  4GHI A;  3VE3 A;  4I3I A;  3UE3 A;  1K57 A;  2V1A A;  4YWZ A;  1P9W A;  3QP6 A;  3V50 A;  5CGS A;  2WKE A;  3LR0 A;  1DP8 A;  4Z9Q A;  4DXB A;  4HJ3 A;  4RX3 A;  3LY4 A;  1OTA A;  2W3H A;  5FI6 A;  1ACF A;  4E6X A;  4HHD A;  2J3T C;  5DTT A;  5CHJ A;  2YKF A;  5GL9 A;  2HJE A;  1OT9 A;  1CJF A;  5FQM A;  3T1X A;  1E3U A;  4L0L A;  3QNC A;  3K3D A;  5FQJ A;  1O07 A;  3Q7V B;  4KZ3 A;  4KG5 A;  3RFB A;  3ZDJ A;  1BUE A;  3WRT A;  1XJ2 A;  1TD5 A;  1PI5 A;  3NIA A;  1U60 A;  4X25 A;  5E43 A;  1NXY A;  2J9P A;  3JVU A;  4PMA A;  5FAO A;  4C3Q A;  4O8G A;  4PHT A;  2Y2M A;  4GDB A;  1NWZ A;  1SDE A;  1ZG4 A;  2I9V A;  3LI9 A;  2Z2L B;  4D2O A;  1MBL A;  4MMN A;  2BAS A;  3EGX C;  3FYZ A;  3UY6 A;  4WZ5 C;  3A3D A;  3TE8 A;  1TS6 A;  1M40 A;  3LR4 A;  4BD0 A;  4PM8 A;  3VOY A;  4GD8 A;  4C75 A;  3ZG7 B;  4FD8 A;  1FCM A;  5KIZ A;  3FWL A;  1NYY A;  1P0Z A;  3UE6 A;  4DMZ A;  2WUQ A;  2Y2N A;  3IH9 A;  2WK0 A;  4ETX A;  3V3R A;  4GLQ A;  3W8K A;  4BBU A;  5FQ9 A;  3S7O A;  5HWW A;  4L9E A;  1ES4 A;  1GSW A;  2FFY A;  5HPF A;  2ZC3 B;  4DJ2 A;  5IU1 A;  4ZAM A;  2DRW A;  3O86 A;  4DKI A;  3HUM A;  2H5S A;  3F1P A;  1V9Z A;  1XFQ A;  3HCY A;  1GHP A;  3E4P A;  2O9A A;  4HBT A;  4OVD A;  1VHM A;  3LI8 A;  4H6J A;  1G6O A;  1BLH A;  3SW1 A;  5HAP A;  3IXB A;  3DWK A;  2HGV A;  1AWI A;  4EBL A;  2Y2K A;  2ZBB A;  4MDZ A;  4EET B;  3N8R A;  2VEA A;  3PBR A;  3KYE A;  5E2E A;  2OWH A;  2R9X A;  3Q7V A;  5EVL A;  1WYB A;  2O0Y A;  1MKI A;  5FDH A;  1WYC A;  4IVI A;  4EW7 A;  3P01 A;  5A90 A;  1K4E A;  2VGL M;  4S2P A;  3GR2 A;  3T50 A;  3CG5 A;  3C4O A;  3BY9 A;  2ZLY A;  4RVA A;  3OPH A;  2XRO A;  1NRF A;  4ID4 A;  3MJQ A;  1VM1 A;  4WBG A;  5IHV A;  4Y0U A;  3UE0 A;  1SHV A;  3RXW A;  3G34 A;  3ZQ5 A;  4H6J B;  5GHY A;  4YOF A;  1J3W A;  5DTS A;  2WGW A;  1K57 C;  3G32 A;  2XFS A;  4DE3 A;  1LHY A;  4G3K A;  4Q0J A;  1MXO A;  4Z1W A;  4XT2 B;  2OLV A;  3LIA A;  4KZ4 A;  3WS5 A;  2WAE A;  3TJZ C;  5MC7 A;  1NYM A;  3PYP A;  4LCL A;  3IWO A;  1HVB A;  2OV5 A;  1W8Y A;  5EVI A;  3IX8 A;  3RJU A;  1G68 A;  1S4S A;  3IXD A;  5EE8 A;  4I39 A;  3PXP A;  1L0D A;  4HP4 A;  2A3U A;  4ZJ3 A;  4N1X A;  5CEC A;  3GEC A;  1G28 A;  3H82 A;  2GZA A;  2HJ9 C;  3TRC A;  2EX9 A;  1OPX A;  3IX3 A;  3E2L A;  1KDW A;  5CTN A;  4JKT A;  2WGI A;  3VV4 A;  2Q0O A;  2Y8H A;  4Y13 A;  2EXA A;  3S7Q A;  4CLC E;  1PFL A;  2GNX A;  3BLM A;  5FEG A;  5HX9 A;  4CPK A;  5BOH A;  2B5R A;  2JBF A;  3L7H A;  4KZB A;  5TBM B;  1V9Y A;  2V0W A;  1XGJ A;  2E8J A;  1F5M A;  3EGD C;  4WUJ A;  1YAX A;  1LL8 A;  2XF3 A;  3S4X A;  1JWP A;  5A91 A;  2NUT C;  2P9V A;  1NJ4 A;  1Y4O A;  5FEF A;  4OPQ A;  1G6A A;  1E4D A;  2ZL1 A;  4MN5 A;  2L4R A;  3BFC A;  3B33 A;  4KUK A;  4Y0T A;  2CC1 A;  3IF6 B;  3HLE A;  3HLB A;  4KG2 A;  3T4L A;  3EEA A;  4JF4 A;  4QWO A;  5EVI B;  5A92 A;  4XUX A;  1OTI A;  2PU2 A;  3CMZ A;  4P6Z M;  2K7S A;  1H8Z A;  4GN2 A;  3GQZ A;  3MXR A;  3F1N A;  4EU0 A;  1QME A;  3V3S A;  2Y2H A;  1SKO A;  5HL6 A;  1TS7 A;  1TVF A;  4S2O A;  3H82 B;  3S7N A;  1K4F A;  5AJG A;  1XJ4 A;  2BG1 A;  5AQ7 A;  4BBV A;  3HLC A;  2JCH A;  2A2L A;  3ZG5 A;  3NDE A;  2XA7 S;  2BTF P;  1Z6F A;  4ZBE A;  3T4T A;  2ZQC A;  2HDR A;  2J3W A;  1TS0 A;  5E2G A;  3OPL A;  4Y7P A;  1FSW A;  3UMD A;  2A24 B;  1OTE A;  2WYX A;  4JGQ A;  3IX4 A;  4U3T A;  1IFQ A;  1T1B A;  3UPN A;  4WEL A;  4LRX C;  5FQK A;  1IEL A;  3PBS A;  4WF0 A;  4WYY A;  3GDI A;  1FIL A;  2WKH A;  2VKS A;  2QKP A;  2IWD A;  4OP8 A;  4NXB A;  3E2K A;  2ZQD A;  3QNB A;  2ZOI A;  4IVK A;  3FPV A;  1LL9 A;  3PHY A;  1D06 A;  2HPB A;  5HPI A;  3BEB A;  3N8S A;  1G5U A;  1H3Q A;  3IF5 A;  3EOI A;  2P04 A;  2H10 A;  4IUH A;  4CQH A;  1KGG A;  5EVI C;  1NRJ A;  3PR6 A;  2P74 A;  1XJ3 A;  2Y2O A;  4K0W A;  2VV7 A;  2O9B A;  4LRZ E;  3HLW A;  4DE0 A;  1KVL A;  2XH9 A;  3ZFZ A;  2JKR I;  3UE1 A;  2BLS A;  2KOI A;  4K08 A;  3MXQ A;  1S1Z A;  3PAG A;  1UGU A;  4YFM A;  1OJ5 A;  1VEU A;  2WGV A;  1BT5 A;  4R0Q A;  1XA7 A;  2KDK A;  4X56 A;  2I72 A;  3F1O B;  3IHA A;  4OH0 A;  1K6R A;  5HZH A;  1K38 A;  2Y4A A;  2DCF A;  5J8X A;  4IED A;  2P08 A;  3NEC A;  4RX2 A;  3MZF A;  2V9A A;  4Y5F A;  4BEN A;  1FR1 A;  3DAV A;  3H7W B;  5FI7 A;  3MFX A;  4JGO A;  3EWK A;  2JKT M;  3DTI A;  4R6L A;  3ZHH A;  4QB8 A;  3M2J A;  3MSH A;  4U0X A;  4HOI A;  4GB7 A;  4S2J A;  1FSY A;  2AVX A;  4F94 A;  4D60 A;  1MZU A;  4DXC A;  1H8M A;  3P09 A;  1BZA A;  4KUO A;  2VGJ A;  4HH2 A;  4R3A A;  4XT2 A;  4WL9 A;  4PM9 A;  3LIE A;  2Y59 A;  1ODV A;  4HH3 A;  2W1R A;  1KGE A;  1YSP A;  3BLS A;  3VP4 A;  5L2F A;  4H8R A;  5U47 A;  4R3B A;  3E4O A;  4UAA A;  2JKF A;  4MBK A;  2VV6 A;  4L9F A;  3LY3 A;  5F83 A;  5F1F A;  1BYW A;  3PBO A;  1UWN X;  2HV1 A;  4L9G A;  1I5Q A;  2A24 A;  3SZT A;  4HBU A;  1Z09 A;  3ZG9 B;  2M7V A;  3NBL A;  3JVV A;  3T4O A;  3CUE C;  1BLS A;  2Y2G A;  5DKL A;  2XRN A;  2ZC7 A;  3LGO A;  4R4S A;  4AFI A;  2ZQ8 A;  4E3O A;  4P87 A;  2WZZ A;  3IHB A;  5CRF A;  4Y17 A;  1K56 D;  2FFF B;  1F98 A;  2A49 A;  2J7V A;  3Q7Z A;  3SS4 A;  3SS3 A;  1YT4 A;  3HJK A;  4G3W A;  4KZ6 A;  4IHQ A;  1OME A;  2H0Y A;  5E2F A;  3VP1 A;  1S1Y A;  1IKG A;  3LFV A;  2G2W A;  5GLB A;  1DP9 A;  4WLA A;  2DMW A;  5GHX A;  3MQ0 A;  1XP4 A;  4U0T A;  3UB9 A;  4I3A A;  1CI9 A;  5GLD A;  1W63 Q;  2UWX A;  4MBF A;  1S66 L;  4LFU A;  4GNU A;  1AXB A;  4GZB A;  1EWZ A;  3QHY A;  2VJW A;  4X69 A;  4O01 A;  2ZQA A;  5FL3 A;  4IUK A;  3JYI A;  4Q8I A;  4O0P A;  2L1M A;  5KSH A;  1BTL A;  4FUW A;  2V0U A;  4M4X A;  4S2M A;  4OON A;  1LI9 A;  4GS9 B;  3T4K A;  3NI9 A;  1T19 A;  1BUL A;  2WAF A;  1BLC A;  2R9W A;  1FQG A;  4OQH A;  4GS9 A;  1LL5 A;  4N1H A;  1W5D A;  4WZ5 A;  5CGX A;  2HDS A;  3TW8 A;  2W1T A;  3G2Z A;  3SH7 A;  3VOL A;  4A5R A;  3PTE A;  4I5S A;  4E6W A;  1W63 M;  2GX5 A;  1T1A A;  4P0M A;  3VE4 A;  5TBM A;  3KSH A;  3KSG A;  3ULF A;  2HF6 A;  4XUZ A;  3R4K A;  4E3L A;  3D3O A;  2VA0 A;  3OC2 A;  4QHC A;  2PD8 A;  3LIF A;  3C7V A;  1YLT A;  2PYP A;  1SZV A;  4JXS A;  4KZ8 A;  1ZG6 A;  1W8Q A;  4GDN A;  4B4X A;  1DP6 A;  5HDS A;  3LEZ A;  3CUE A;  4ARZ B;  1KDS A;  5FAT A;  1I2W A;  2LB5 A;  4UA6 A;  1DJC A;  3NOT C;  1F2K A;  2QMI A;  1LI0 A;  3EEH A;  3OCN A;  2JHE A;  1GHI A;  1NY0 A;  2IA2 A;  4R4R A;  1PW8 A;  2EA9 A;  4FTX A;  3G2Y A;  4OOL A;  1PNE A;  2XFT A;  3WS2 A;  2YKH A;  1SDN A;  4UEY A;  3U4L P;  2ZMA A;  3BY8 A;  3IT9 A;  1L3L A;  3DTK A;  5I5L A;  2EX8 A;  5EFW A;  2HP9 A;  2QWS A;  1RGZ A;  3O87 A;  4ME4 A;  2HDQ A;  3FPW A;  4GW9 A;  3LYX A;  5CER A;  1CEF A;  4K91 A;  5JYP A;  1NZU A;  3FZC A;  5M18 A;  2XR0 A;  3C5A A;  1ZKJ A;  3UDF A;  4QJG A;  1TF1 A;  4DE2 A;  2XEP A;  3ZNT A;  3RTY A;  1WA9 A;  3WS0 A;  4LV3 A;  4OQI A;  2VV8 A;  2INW A;  4YIN A;  1ESU A;  2WGW B;  3UB7 A;  4EUZ A;  2P9V B;  3ITA A;  2PR6 A;  3T4S A;  5KMW A;  3BYD A;  1PRQ A;  3UME A;  4NXF A;  4RA7 A;  1BSG A;  3G35 A;  3UPO A;  1SCW A;  3NC8 A;  1ONH A;  3U2A A;  4KZ7 A;  5EM1 A;  4EUV A;  5FDS A;  1MWT A;  2PHY A;  4LEN A;  2WKQ A;  3C30 A;  1D1J A;  2B18 A;  3BEC A;  3CIT A;  2H28 A;  1KE0 A;  3E4Q A;  5FQQ A;  2WKI A;  2QZ6 A;  3OPR A;  1O7E A;  2V20 A;  1YMX A;  1VEU B;  5DFY A;  2PU4 A;  3K3C A;  4DRT A;  3DTM A;  3A0S A;  3Q81 A;  5CHU A;  5L07 A;  2QPN A;  5AVF A;  2HZ5 A;  3N8L A;  3W4O A;  2C6W B;  3NCK A;  2K31 A;  2PDR A;  2M1C A;  3T4Q A;  3DW0 A;  4PKY A;  3SH8 A;  1VB6 A;  4JGR A;  1RGY A;  4KQQ A;  1NZO A;  2CMN A;  5A93 A;  2VGK A;  4QU3 A;  3AGF A;  2QJ5 A;  4B88 A;  3HVF A;  3UO9 A;  3KSI A;  1JVJ A;  1J9M A;  3LR5 A;  1JNU A;  2PYR A;  5JYO A;  2ZM0 A;  3ZNY A;  4BMW A;  1UWP X;  3E98 A;  1YLZ A;  5CEB A;  1HZO A;  5DTK A;  3TOI A;  4CJN A;  1L0E A;  5EVE A;  3B47 A;  3C4P A;  3RH8 B;  4OPZ A;  2RL3 A;  4I38 A;  4JXV A;  1OTB A;  3G30 A;  1ES2 A;  5HAQ A;  1K0K A;  4II7 A;  4X1L A;  3LEQ A;  1IYO A;  5AQB A;  1PWC A;  2R78 A;  4LV2 A;  4OP5 A;  2EFX A;  5F69 A;  3CZD A;  3N4I A;  4E3J A;  1H8Y A;  5L8M A;  1DRM A;  2W27 A;  4LGW A;  4LCM A;  4CLC A;  3G31 A;  2B95 A;  2L0W A;  1YLW A;  3LID A;  1YSQ A;  1ESI A;  3Q07 A;  5TFQ A;  3BFE A;  2QJ7 A;  2WKP A;  1OTD A;  1WE4 A;  1KVM A;  1ZTU A;  3B42 A;  4FCF A;  5DVA A;  4DDY A;  4P85 A;  2W3D A;  5EOO A;  1DY6 A;  2K2N A;  3HUN A;  2KLI A;  1ONG A;  3OZH A;  1JWV A;  2P7J A;  3SS5 A;  2VGL S;  3O5Y A;  1M6K A;  3UB5 P;  4OQ0 A;  5DF8 A;  3QP1 A;  3ZYT A;  4KZA A;  3MMH A;  5F5Y A;  4R23 A;  2V8C A;  1GCE A;  2GDN A;  1FOF A;  3H7W A;  1N9O A;  4G3V A;  3UN7 A;  2ZMF A;  1HTZ A;  5DFX A;  5HSQ A;  3KX0 X;  5DJT A;  2VX8 A;  1TS8 A;  2HDU A;  4ZJ2 A;  3G6O A;  3UNW A;  3GRJ A;  5J4E A;  3F1O A;  3HL9 A;  1H0M A;  4EV4 A;  1K55 A;  4KQO A;  2VZW A;  1K25 A;  4FH2 A;  3IS2 B;  4WEJ A;  4OOM A;  3MXS A;  3NJA A;  3PAE A;  3BFF A;  4R70 A;  4LV0 A;  3KYZ A;  4F3L A;  3MF0 A;  1D7E A;  3T1Q B;  4PPR A;  5L10 A;  5GHZ A;  2LB9 A;  3ZGA B;  2C5W B;  4OKP A;  4KG6 A;  1ERO A;  4OQG A;  3IWI A;  1MWU A;  1PW1 A;  4FOF A;  4NK3 A;  3VFF A;  4WMC A;  5HDC A;  2J9O A;  2Q9M A;  4I3J A;  3R7W B;  5AQA A;  3SOI A;  1CEG A;  4KZ9 A;  3R7W A;  4GOG A;  2Y2P A;  3FKV A;  1XJ6 A;  5E2H A;  2XD5 A;  3BW6 A;  1ZHH B;  4N9L A;  1YPR A;  3IBR A;  4MLL A;  3DWZ A;  4EER A;  4X53 A;  2E8I A;  1K55 C;  4F3L B;  2G2U A;  4X1M A;  1YM1 A;  4R38 A;  1Q2Q A;  2EFU A;  3QP2 A;  5HD5 A;  2X01 A;  4NG2 A;  1XX2 A;  2JC7 A;  5HWT A;  2QYB A;  5DF7 A;  1YKD A;  4BBT A;  5KSC A;  4UQI M;  3HUO A;  2ZMV A;  4X55 A;  3A3E A;  4OOY A;  1MKM A;  1MY8 A;  4ESP A;  3Q82 A;  2Q9N A;  2IWC A;  4LRY C;  4PM5 A;  1EI5 A;  1N4O A;  4HY8 A;  5AVE A;  5IS1 A;  1MPL A;  3CJM A;  4JGP A;  1P97 A;  1S67 L;  3IXG A;  1MWS A;  4WEK A;  3IBJ A;  3A0V A;  3G4P A;  3V5M A;  1RCJ A;  1IKI A;  5HL1 A;  5FA7 A;  1XA1 A;  3IF6 C;  3AGE A;  4JXG A;  1SKF A;  1VQQ A;  3CPT A;  1OT6 A;  4LV1 A;  5CX7 A;  1K56 A;  4WMC D;  2PRF A;  3HLF A;  2EWW A;  1YQS A;  1PWG A;  4EQ1 A;  2ZQ9 A;  1LSX A;  4NXG A;  2HP6 A;  4P6B A;  1IYQ A;  3OOV A;  3IS2 A;  2Y2L A;  1K6S A;  4P6Z S;  1N9B A;  3NDG A;  5HWV A;  4S2I A;  3C38 A;  3DTE A;  5FI2 A;  5L09 A;  2ZQ7 A;  1S4R A;  4DDS A;  4EXO A;  1I2S A;  1PYY A;  4NKP A;  3VFH A;  5HAR A;  3PBN A;  5G4Y A;  4E3N A;  3IXH A;  5D3O A;  5TGF A;  4C6Y A;  1KE4 A;  4HNB A;  1XPB A;  1JWZ A;  2PBD P;  1PWD A;  3S22 A;  2OSU A;  4M3K A;  3K2N A;  5FSR A;  2H0T A;  3M6H A;  3MQO A;  3LCE A;  2W3F A;  5J3W A;  3HLD A;  4CLC C;  1S6R A;  3E0Y A;  3UDI A;  1IEM A;  1FCO A;  4HJ4 A;  2IWB A;  3W4Q A;  1FR6 A;  1CQA A;  4O7D A;  3MQQ A;  4QY5 A;  1GSV A;  3C2W A;  3VP3 A;  5J7E A;  2EX6 A;  3WWX A;  4PAU A;  2PD7 A;  1L0G A;  4N9K A;  4JLF A;  2X02 A;  3A3F A;  1RP5 A;  3GVB A;  2W1T B;  4ZDX A;  2ZL1 B;  3A3J A;  1Y28 A;  4WZ4 A;  5CXW A;  4JXW A;  2XD1 A;  3DBA A;  2UV0 E;  3T1S A;  1ES5 A;  3IF6 A;  5EEC A;  4NET A;  1XGI A;  2VLG A;  1IYS A;  3M2K A;  4HP9 A;  4UA7 A;  1TEM A;  2Y55 A;  1X0O A;  4GJ4 A;  3GTC A;  3ZG0 A;  3MS6 A;  4KQR A;  1EW0 A;  5FAP A;  5HW3 A;  3C8C A;  4DJ3 A;  2ACG A;  2PBY A;  5HDD A;  2OWJ A;  3HJI A;  2O99 A;  3LUQ A;  2XK1 A;  4Q0I A;  3D72 A;  4BJP A;  4QD4 A;  2VK3 A;  1PIO A;  4E3K A;  1PZP A;  2JKG A;  3H9W A;  2Z6D A;  1W7F A;  2XSS A;  3NOU C;  2Y2Q A;  1L0F A;  4B9O A;  1L2S A;  2WZX A;  4MNR A;  2J80 A;  5CTM A;  1IYP A;  2O9C A;  4DE1 A;  4LLO B;  4EBN A;  1MC0 A;  3UB8 A;  2D01 A;  3V67 A;  2W3E A;  1FIK A;  1STZ A;  3BWL A;  5TR7 A;  5F68 A;  3KSF A;  5HFO A; 
#chains in the Genus database with same CATH homology
 1XJ3 A;  1OTB A;  2YKF A;  4GHI B;  2VV7 A;  2O9B A;  2HJE A;  1OT9 A;  3FC7 A;  4LRZ E;  2D02 A;  3CWF A;  4II7 A;  4L0L A;  3K3D A;  2OOL A;  2JKR I;  3RFB A;  2KOI A;  4K08 A;  3MXQ A;  4YNR A;  1XJ2 A;  1S1Z A;  1TD5 A;  2R78 A;  1UGU A;  3LR3 A;  4LPZ A;  1OJ5 A;  5F69 A;  3PBQ A;  3CI6 A;  3JVU A;  2KDK A;  3F1O B;  4O8G A;  4PHT A;  5HZH A;  3W2Z A;  5C5K A;  1NWZ A;  2OAQ 1;  2I9V A;  3LI9 A;  3PBT A;  5L8M A;  1DRM A;  2W27 A;  4CLC A;  4MMN A;  2BAS A;  2P08 A;  3EGX C;  2L0W A;  5G4Z A;  1LSW A;  3LID A;  1YSQ A;  5A8B A;  2V9A A;  3TE8 A;  4Y5F A;  2QJ7 A;  1TS6 A;  3H7W B;  3LR4 A;  3MFX A;  2WKP A;  1OTD A;  4JGO A;  5KIZ A;  1P0Z A;  3EWK A;  2JKT M;  3UE6 A;  1ZTU A;  4R6L A;  4DMZ A;  3B42 A;  4HOI A;  2W3D A;  3KYQ A;  2K2N A;  2KLI A;  4ETX A;  2PT7 A;  1MZU A;  2P7J A;  4GLQ A;  1H8M A;  1P9R A;  4KUO A;  4ETZ A;  2OAP 1;  4BBU A;  4HH2 A;  4E04 A;  2VGL S;  3O5Y A;  3S7O A;  4L9E A;  5HWW A;  3P7N A;  3BQA A;  1GSW A;  4R3A A;  4XT2 A;  4WL9 A;  5HPF A;  3LIE A;  4HH3 A;  1ODV A;  3LIC A;  2W1R A;  3ZYT A;  3MMH A;  5F5Y A;  4DJ2 A;  5IU1 A;  1YSP A;  2GJ3 A;  3H7W A;  1N9O A;  4G3V A;  3F1P A;  1V9Z A;  1XFQ A;  3HCY A;  2ZMF A;  3E4O A;  2O9A A;  3E4P A;  1N9L A;  5DFX A;  3NOP C;  5HSQ A;  1VHM A;  3KX0 X;  3LI8 A;  2VV6 A;  4L9F A;  5DJT A;  4CLC D;  4H6J A;  2VX8 A;  1BYW A;  1TS8 A;  3PBO A;  1G6O A;  2KX6 A;  3SW1 A;  4MN6 A;  3G6O A;  1UWN X;  2HV1 A;  2HGV A;  4L9G A;  4ZRR A;  2ZBB A;  3CLO A;  3F1O A;  4MDZ A;  4EET B;  5J4E A;  4PKY G;  1KOU A;  2VEA A;  3PBR A;  2A24 A;  4KQO A;  2VZW A;  2OWH A;  2M7V A;  3IS2 B;  4WEJ A;  3JVV A;  3T4O A;  4OOM A;  5HD3 A;  3NJA A;  2QHK A;  3CUE C;  2O0Y A;  5DKL A;  4R70 A;  3KYZ A;  3EQV A;  2JKR M;  2W0N A;  2XRN A;  1D7E A;  3MF0 A;  2V1B A;  4F3L A;  4DN0 A;  4AFI A;  2LB9 A;  4EW7 A;  3P01 A;  4CLC B;  2VGL M;  4FOF A;  4HQA A;  3T50 A;  5HDC A;  1F98 A;  2JKT I;  4I3J A;  3R7W B;  3HJK A;  3OBF A;  1T1C A;  4G3W A;  3BY9 A;  3R7W A;  4IHQ A;  1XJ6 A;  3OCL A;  4HI4 A;  1S1Y A;  2XRO A;  3LFV A;  3BW6 A;  1DP9 A;  4WLA A;  2DMW A;  3MJQ A;  1ZHH B;  3IBR A;  3MQ0 A;  4EER A;  1F9I A;  3UB9 A;  4I3A A;  4F3L B;  1W63 Q;  4HIA A;  1S66 L;  3A0R A;  2ZOH A;  4R38 A;  2VJW A;  3ZQ5 A;  4EEU A;  4O01 A;  5HD5 A;  4H6J B;  1N9N A;  4Y3I A;  4YOF A;  4EES A;  5FL3 A;  4IUK A;  5HWT A;  1T18 A;  4O0P A;  2L1M A;  2QYB A;  3OLO A;  1YKD A;  5KSH A;  4G3K A;  4BBT A;  4Q0J A;  4Z1W A;  4UQI M;  2V0U A;  2ZMV A;  4XT2 B;  3LIA A;  1MKM A;  4M4X A;  2M7U A;  4GS9 B;  3TJZ C;  3T4K A;  1T19 A;  4LRY C;  5MC7 A;  3F1P B;  4GS9 A;  2Y79 A;  4KQD A;  3PYP A;  2J3T D;  3TW8 A;  4HY8 A;  2W1T A;  3VOL A;  4I5S A;  5AVE A;  5IS1 A;  5K5B A;  1W63 M;  2GX5 A;  1T1A A;  3VE4 A;  1IOU A;  5TBM A;  3KSH A;  3UB6 A;  4ARZ A;  3KSG A;  3ULF A;  2HF6 A;  3R4K A;  3D3O A;  4JGP A;  2VA0 A;  1S4S A;  3OC2 A;  1P97 A;  1S67 L;  2PD8 A;  3LIF A;  4WEK A;  2PYP A;  4IJG A;  3IBJ A;  4I39 A;  3A0V A;  2FZ0 A;  3PXP A;  1DP6 A;  4HP4 A;  5HDS A;  1NLZ A;  4ARZ B;  3CUE A;  2W3G A;  2LB5 A;  3NOT C;  1OT6 A;  2Z6C A;  5CX7 A;  3GEC A;  1G28 A;  3EEH A;  3OCN A;  3H82 A;  2GZA A;  2HJ9 C;  3CAX A;  3TRC A;  4FSF A;  2EWW A;  1OPX A;  2JHE A;  4NXE A;  4EQ1 A;  5IT5 A;  1LSX A;  2XA7 M;  4NXG A;  2IA2 A;  5DKK A;  2EA9 A;  3OOV A;  3IS2 A;  3VV4 A;  1LSV A;  3MR0 A;  4OOL A;  2Y8H A;  2WKR A;  3S7Q A;  4CLC E;  2YKH A;  4UEY A;  2FH5 A;  2GNX A;  4QPR A;  4P6Z S;  5HWV A;  5DJU A;  3BY8 A;  5LBR A;  3C38 A;  5I5L A;  2NUP C;  1S4R A;  5TBM B;  5F6A A;  1V9Y A;  4EXO A;  3F1N B;  2V0W A;  4NKP A;  5EFW A;  4BWI A;  3NHQ A;  3BQ8 A;  3PBN A;  5G4Y A;  2QWS A;  4ME4 A;  3FPW A;  2G7U A;  4GW9 A;  3LYX A;  2B02 A;  1F5M A;  3EGD C;  4HNB A;  4WUJ A;  1YAX A;  4UQI S;  1LL8 A;  3K2N A;  1TF1 A;  2NUT C;  3MQO A;  3RTY A;  1WA9 A;  2W3F A;  5J3W A;  2VV8 A;  2INW A;  2L4R A;  4MN5 A;  4CLC C;  3E0Y A;  3UB7 A;  3B33 A;  4KUK A;  4WN5 A;  5DF9 A;  4HJ4 A;  2PR6 A;  3T4S A;  3T4L A;  3UME A;  3BJN A;  3FG8 A;  3MQQ A;  3EEA A;  4NXF A;  1GSV A;  3C2W A;  5J7E A;  2MJ6 A;  4MN7 A;  3S7P A;  4GCZ A;  2PR5 A;  4EEP A;  4PAU A;  2PD7 A;  1OTI A;  4P6Z M;  2K7S A;  3U2A A;  4EUV A;  2W1T B;  2PHY A;  3F1N A;  4NEE D;  4EU0 A;  1LT0 A;  1Y28 A;  2WKQ A;  3ICY A;  1GSX A;  3C30 A;  5HL6 A;  1TS7 A;  4RQ9 A;  2B18 A;  3CIT A;  2H28 A;  3EQU A;  3DBA A;  3H82 B;  4HJ6 A;  3S7N A;  5AJG A;  3E4Q A;  1XJ4 A;  4BBV A;  2VLG A;  2A2L A;  4HP9 A;  2XA7 S;  1X0O A;  4GJ4 A;  3T4T A;  5DFY A;  3K3C A;  2J3W A;  3A0S A;  1EW0 A;  3C8C A;  1TS0 A;  4DJ3 A;  1NLY A;  1OJG A;  5AVF A;  2JN7 A;  2K31 A;  5HDD A;  2PDR A;  2A24 B;  2OWJ A;  3UMD A;  2M1C A;  3T4Q A;  4PKY A;  3HJI A;  2O99 A;  1OTE A;  3LUQ A;  1VB6 A;  4B93 A;  4JGR A;  4JGQ A;  1IFQ A;  3LIB A;  1T1B A;  4MCW A;  4Q0I A;  2CMN A;  4WEL A;  3KO6 A;  3D72 A;  4BJP A;  4LRX C;  3PBS A;  4WF0 A;  5TJJ A;  2EWV A;  2QJ5 A;  3GDI A;  2VKS A;  2QKP A;  3H9W A;  1XFN A;  4NXB A;  2Z6D A;  2XSS A;  3NOU C;  4B9O A;  2ZOI A;  4Y2F A;  3T4J A;  3FPV A;  4Q0H A;  4GHI A;  3VE3 A;  4I3I A;  3UE3 A;  3KSI A;  3LR5 A;  2V1A A;  3PHY A;  1JNU A;  2PYR A;  4YWZ A;  1P9W A;  4BMW A;  1D06 A;  2J80 A;  5HPI A;  2O9C A;  1UWP X;  3LR0 A;  4LLO B;  1DP8 A;  3E98 A;  4HJ3 A;  1H3Q A;  1MC0 A;  3EOI A;  3UB8 A;  1OTA A;  2W3H A;  2P04 A;  4IUH A;  4CQH A;  2D01 A;  3V67 A;  3B47 A;  2W3E A;  1STZ A;  3BWL A;  1NRJ A;  4HHD A;  5F68 A;  3KSF A;  3RH8 B;  3PR6 A;  4I38 A;  2J3T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...