4G3WA

Crystal structure of a. aeolicus nlh1 gaf domain in an inactive state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
137
Chain Sequence
NLETTVPYIFRLLKKLMGFERLTLTIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQEPEFLNKVWKRKKKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator nlh1
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 26
structure length 137
sequence length 139
ec nomenclature
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3wA00
1YKDA 2W3FA 2O99A 2K31A 4LRXC 4ETXA 4FOFA 4QPRA 4G3KA 4Q0IA 4MN7A 1YSQA 3LFVA 2XSSA 4YNRA 3R4KA 4PAUA 4IUHA 3S7PA 2Y79A 2Y8HA 3C2WA 5C5KA 3BJNA 4BWIA 5K5BA 3RFBA 1TF1A 4G3WA 4LRYC 4DN0A 4EU0A 4R70A 2W3GA 2W1TB 2VKSA 4Z1WA 4MMNA 3K2NA 1STZA 3KO6A 5HL6A 3KSIA 4ZRRA 3O5YA 4GW9A 2M7UA 3E98A 2KOIA 3TRCA 4O0PA 5HPIA 3ZQ5A 2LB9A 2G7UA 2OOLA 1YSPA 3KSHA 2O0YA 3CI6A 3W2ZA 4GLQA 3NOUC 4CQHA 2VZWA 3OBFA 3DBAA 4ME4A 2QYBA 3MMHA 2XROA 3IBJA 3S7OA 5DFYA 3VV4A 2W3HA 4Y3IA 5AJGA 2KLIA 1TD5A 2IA2A 2ZMFA 1MC0A 2W3DA 3IBRA 2W1RA 4MDZA 2VEAA 3G6OA 2W1TA 3NHQA 5TJJA 3OOVA 4IJGA 4R6LA 4EUVA 4Q0HA 4Q0JA 5HSQA 2K2NA 2B18A 3S7NA 4E04A 2GX5A 3NOTC 4O8GA 4Y2FA 1VHMA 4IUKA 3HCYA 2M7VA 2LB5A 5DFXA 4LRZE 5I5LA 2HGVA 4O01A 3S7QA 2O9BA 3MQ0A 4YOFA 2VJWA 3NOPC 4G3VA 1ZTUA 2O9AA 3CITA 5LBRA 3KSGA 5L8MA 2W3EA 4Y5FA 3KSFA 1F5MA 2O9CA 3D3OA 4DMZA 3EEAA 5HPFA 4RQ9A 3MF0A 1MKMA 4ETZA 2XRNA 3E0YA 4MCWA
chains in the Genus database with same CATH superfamily
3IH8A 3M6HA 2EWVA 3VP1A 1H0MA 4LFUA 1LLBA 4Z9QA 1PWGA 2ZQDA 3C8CA 1YLWA 1DP6A 3GSGA 1XX2A 1YPRA 4GNUA 2JC7A 1TF1A 4UA9A 4Y7PA 3PBRA 4DN0A 2R78A 4R70A 2XFTA 3A3DA 2EX2A 4WL9A 4MNRA 3TE8A 4FTXA 2ZD8A 1TDGA 1P97A 1K56D 3QP5A 3BFEA 4S2NA 4KZ3A 2WYXA 1FR1A 1XKZA 4E6XA 4N92A 3LUQA 4B4XA 1F9IA 2A49A 4E3KA 4Y3IA 5AJGA 4N9LA 1KGEA 4GOGA 5FQJA 2WKPA 3DTIA 3IBRA 4JXSA 5FI6A 4MLLA 3IX3A 5CECA 1XP4A 2VK3A 1H8YA 4LV0A 3UMEA 4P6ZM 3RXWA 4E04A 5DJUA 3EGXC 2J8YA 3VE3A 3F1OB 4EETB 3HCYA 5AVEA 1JTGA 1BULA 3EQVA 4RX2A 1F2KA 1HZOA 2I9VA 4EBNA 4BBVA 3NI9A 3CPTB 3Q7VA 5HDDA 3I7JA 1BLPA 4QY6A 3G2ZA 1K25A 2R9WA 5HDCA 2W3FA 3G32A 5GLAA 3AGDA 3FKWA 2C6WB 2J3WA 2ZC6B 1DJCA 4GZBA 3PXPA 5FI7A 4CLCC 4EXOA 1XJ6A 2Y8HA 4K91A 5C5KA 5HW3A 5FA7A 4YWZA 1S4RA 5CHJA 2FZ0A 3IF6C 3PBQA 2W3GA 1NZUA 4Z1WA 1W8QA 3B33A 1CJFA 5FQMA 5IT5A 4GW9A 4JGPA 2KOIA 4FUWA 3LO7A 4DXBA 1W63M 3C38A 4ARZA 4B9OA 2HP9A 4OQ0A 1IEMA 5E2FA 4GCZA 2WKHA 3MJQA 3NOUC 1K57C 1KE0A 3SW1A 1KVLA 2EXAA 2OAQ1 3FPVA 1H8MA 5DF8A 3ICYA 2IA2A 5FQIA 1YMXA 3W4OA 1V9YA 1ZKJA 3LIEA 2MJ6A 2B02A 4BLMA 2EXBA 4WYYA 3BECA 3VSLA 1SKOB 1WYBA 4Y2FA 1VHMA 2JKGA 2ZMAA 5HD3A 3FG8A 1N9LA 1JWVA 3PBOA 5HWTA 1E3UD 3FWLA 3A3EA 4PKYA 1IELA 2DMWA 4HESA 3CUEA 2BLSA 3H7WA 3PR6A 2XFSA 3QHYA 4BENA 4X1LA 4EUZA 3MFDA 2GJ3A 1TS8A 1TS0A 4HHDA 4GB7A 1LL9A 2P74A 3G35A 2QKPA 4E3NA 4JXVA 4HH2A 1H8ZA 4WN5A 4GS9A 2WKQA 1OPXA 3OPRA 1ERQA 4WMCD 3C5AA 4BWIA 5EVIB 3QNCA 3B42A 4EEUA 5AQBA 3TSGA 1ES5A 1CEFA 4L0LA 1LSWA 5AQAA 4HJ4A 1IOUA 3F1NA 2Q9MA 4O0PA 2Y2OA 3C4PA 2OOLA 2I72A 4LGWA 2ZL1B 4L9EA 2WGWB 4GHIA 4DKIA 1K56A 1PI5A 2KLIA 3ZDJA 2QJ7A 4Y0UA 2G2WA 4NEED 2HDUA 3UE3A 3VP4A 3LGOA 4HQAA 4KUOA 2OWHA 4KQQA 1A0KA 3W4PA 1GSWA 5HSQA 3Q1FA 1IYSA 1NYYA 2PAVP 1LSXA 2WKIA 3B3XA 3ZG0A 5KSHA 2XF3A 3FC7A 4FH4A 4CLCE 2Y2GA 4ZAMA 1S6RA 1ZTUA 4KENB 1G28A 3ZG7B 2XA7M 3SS3A 3VE4A 4R3JA 4S2MA 1WA9A 1ALQA 3EEAA 2Y2KA 3G4PA 2XD5A 1D1JA 5HZHA 1PWDA 3LY3A 4LRXC 3IX8A 1XA1A 4F94A 4MEZA 2JKFA 3LFVA 3BEBA 1VETB 4S2JA 3MXQA 3SH9A 4JGRA 3T4QA 4LV3A 4HY8A 4BJPA 5L2FA 5A8BA 3K2NA 3PTEA 4HNBA 2B95A 1OT6A 4MBKA 1NLYA 1XGIA 5EOEA 5HWVA 4BBUA 5TFQA 2ZOIA 2RL3A 2L4RA 1ERMA 1LL5A 4KG5A 2ZM8A 1EWZA 1NRFA 3MKFA 3MQOA 4HP9A 3MFXA 2G7UA 2PD7A 3MQQA 5HDSA 3W2ZA 3LR5A 2QWSA 2JKTI 2HP6A 1XJ2A 3LR3A 1E4DA 4GLQA 1OMEA 3ZG5A 2ZOHA 2EFUA 3MMHA 4PMAA 3HLDA 1W63Q 4DXCA 4LPZA 1LI0A 3VOZA 1RGYA 5TJJA 1BSGA 4DE0A 2PBDP 4P6ZS 3ITAA 3BY9A 5KZHA 3UB9A 2B18A 4C3QA 4UAAA 2QJ5A 2Y2LA 4WEKA 4ZBEA 4GJ4A 5EECA 2V1ZA 3F1PB 1E25A 3N6IA 2IWBA 3UN7A 4PM8A 4II7A 3RTYA 3MZFA 4OH0A 4UQIM 1GSXA 4KZAA 2E8IA 3OPHA 4L9GA 3V3SA 3H82B 4WELA 2XRNA 4YINA 1LHYA 2P9VB 5BOHA 4BMWA 4P87A 3CPTA 4KZ5A 5HARA 1WE4A 2V9AA 1S67L 2VGLM 3T4LA 5HL1A 1S66L 2CMNA 5JYPA 3QP1A 3T1SA 1G6OA 3L7HA 4R4RA 1KOUA 3IWOA 4OQHA 3V39A 4RA7A 4PM7A 4ZTKA 3QP8A 2PT7A 2YKFA 2ZM0A 2DRWA 5FDSA 1IYPA 1J9MA 1WYCA 1ACFA 3HUMA 5CEBA 3BFGA 1HTZA 4BL3A 3OBFA 1MPLA 3ZVWA 2JCHA 1T1BA 1PRQA 1CF0A 1FR6A 5CEDA 3G6OA 1VEUB 2EA9A 2W1TA 3HBRA 3QNBA 3LEZA 4IJGA 3W8KA 4PM6A 4UA6A 5FQ9A 2ZQ7A 4HEFA 4NXGA 1X0OA 5A92A 2EX8A 1G6AA 2LB5A 1T19A 2NUPC 2ZLYA 1MWUA 4G3VA 5G4YA 1SKOA 2L1MA 2EX9A 1YMSA 1U60A 1D06A 5L8MA 4GN2A 5CGXA 3E4OA 4ZJ2A 1SHVA 3VFFA 1DRMA 3G34A 4KZ7A 2WKRA 5F1GA 2Y91A 3V50A 1DP9A 4XT2B 3DWZA 2P08A 3EEHA 4DJ3A 5HX9A 3N8SA 4JBFA 4M4XA 3BJNA 1HLUP 4JXWA 3T4SA 1ZG6A 4N1XA 1K6RA 3TJZC 2QHKA 4BD1A 3DTMA 2V2FF 3O87A 1ES3A 4FD8A 4HH3A 3B47A 2PRFA 2ZQAA 2ZMVA 4LV2A 2XR0A 5DF7A 5HPIA 2WZZA 5GHXA 4BQMA 4UEYA 1I2SA 2VLGA 5TGFA 4EQIA 1PW1A 5FAOA 1Z6FA 5GLBA 3VOYA 2ZL1A 4U0TA 2WGWA 4EBPA 4K0XA 4OKPA 1SZVA 1T1CA 1NLZA 4JPMA 4I3JA 4U0XA 2ZBBA 2C5WB 3EQUA 4QU3A 4KG2A 3SH8A 1Y4OA 3S7QA 3WS4A 4C75A 3JVUA 1XGJA 3NOPC 5IS1A 4JGOA 3CITA 4PHTA 3D72A 1PYYA 2H28A 5L07A 2XA7S 5F69A 4S2NC 2HJ9C 5KMWA 1UWPX 3UPOA 1N9NA 3D3OA 5GL9A 4P85A 1DJBA 3UB6A 3TOIA 1MWSA 4ETZA 1SDNA 4HJ3A 3SZTA 3BYDA 3M2JA 3IS2B 4QD4A 2PR5A 2W0NA 4LV1A 3ZVTA 2VGJA 4E3OA 1K54A 3E2LA 4WZ4A 1M40A 1LT0A 3GECA 4RYEA 2IWDA 1OJ5A 2JHEA 2X02A 5EFWA 4GD8A 1GA9A 1BT5A 1FSYA 5HWWA 2PYPA 1L0DA 1K54C 1CI9A 3UE6A 4U3TA 1MKIA 2ACGA 3NDGA 2P04A 4KZ6A 1PW8A 3HLCA 4CQHA 4KUKA 2PU4A 3E4QA 4B4ZA 2WKEA 2WUQA 3IF5A 2Y2PA 2OSUA 4H6JB 2W3DA 3DTKA 3GMWA 5GHYA 5EV0A 5FAQA 5DKKA 3N8LA 1KGFA 2JKRI 2WGIA 4R6LA 3S22A 1O7EA 3KYZA 2HDRA 1H5XA 5EM0A 1TVFA 1KE3A 4IVKA 3UNWA 1L0GA 4O8GA 4I5SA 3NECA 5DFXA 2V0UA 4Y13A 3UB7A 5LBRA 4CPKA 4UQIS 5TBMA 1UWNX 4A5RA 3T4KA 1BUEA 4YFMA 4GD6A 5CGSA 3MZEA 4KZ9A 3P01A 3BQAA 3UDFA 4IVIA 4JF5A 4PKYG 3CG5A 2VGLS 1IFQA 2J9PA 3IXHA 1BZAA 2P9VA 2RCXA 4F3LB 4D2OA 4BD0A 5E2HA 4WUJA 4EU0A 3D9YA 2VKSA 5MC7A 3IWQA 4OLDA 2A24B 2BG1A 3LI9A 5J3WA 4ZRRA 3ZGAB 2Y4AA 1I5QA 3CUEC 3IXBA 2ZQ9A 1TS6A 1O07A 4NKPA 1FOFA 1G5UA 1GA0A 1PFLA 4OQIA 2AVXA 1OTAA 1W8YA 4LLOB 4KZ4A 1ODVA 1HVBA 3EOIA 5EM1A 3UPNA 1K0KA 4DE1A 2VEAA 1K4FA 3OOVA 1YT4A 5F83A 1Z09A 3GQZA 3ITBA 1EROA 3S7NA 4NK3A 1RCJA 2KDKA 5DTSA 2M7VA 4PPRA 3H9WA 2PU2A 3T4JA 3HUNA 3DTEA 1N9BA 5L09A 4OPRA 3VOLA 2HP5A 2K31A 4WM9A 3QP4A 2JE5A 4FOFA 1FCMA 4G3KA 2PR6A 3O88A 3SOIA 4GDBA 4PAUA 4QWOA 5CTNA 1ESIA 1S0WA 3O3VA 1ONHA 5F1FA 5IU1A 2Y59A 3WS0A 3R7WA 3O5YA 4EEPA 3CZDA 4E6WA 1PIOA 4E3JA 4QJGA 4OP8A 4HI4A 1XPBA 1YLJA 1BLCA 3CHWP 4ZJ3A 2L0WA 2KX6A 1CI8A 3OCLA 5EVID 4O7DA 1DY6A 4ME4A 3V67A 2QYBA 3V3RA 3P09A 4CLCB 5DFYA 4E3MA 2HF6A 1PI4A 3C7UA 1NRJA 2OLVA 3V5MA 3KX0X 1SKFA 2GDNA 3IF6B 5FDHA 2QMIA 4OONA 2B5RA 4I38A 2ZC5B 3ZG8B 3OPPA 1JWPA 3A0VA 3DAVA 3NOTC 3IX4A 4Y0OA 2Y2JA 4RVAA 3N8RA 1D7EA 1V9ZA 4O01A 3T1RA 2O9BA 2XGNA 4DDSA 1XA7A 3A3JA 3MQ0A 2EFXA 1MWRA 2V1AA 4DRTA 5D3OA 2INWA 4Y5FA 1FCOA 5G4ZA 1F5MA 5L10A 1XFNA 4FCFA 1EI5A 4MCWA 1XXMA 3HLBA 3HLWA 4MBFA 2XK1A 3IQAA 4ARZB 1SDEA 3FZCA 4MN7A 1OJGA 2HJEA 4YNRA 3GVBA 2VV7A 3F1OA 2XD1A 3WRTA 1VM1A 3BFFA 3KYEA 2QZ6A 3IS2A 3UDXA 2FFYA 4I3AA 4MBHA 2Z2LB 4NXFA 1OT9A 4IBXA 4S2OA 5CXWA 3UB5P 3UE1A 4I39A 1W5DA 2VX8A 3C4OA 3HVFA 1YSPA 3OCNA 4RX3A 2ZQCA 3H7WB 1DJAA 4M3KA 2HV1A 3K3DA 1AXBA 5CTMA 3DWKA 5FQKA 3C30A 1NZOA 3UMDA 3ISGA 5FAPA 3G30A 4WLAA 1GHPA 1P9RA 3IT9A 3WS1A 3WS5A 4QB8A 4S2KA 3ULFA 4NG2A 4C6YA 1P0ZA 2D01A 1YM1A 1OTBA 4WEJA 1YLZA 3ZCZA 2VJWA 5FATA 4LCLA 4QY5A 3JPUA 3K3CA 5CGWA 2O9CA 3LIFA 2EWWA 1GSVA 2NUTC 4OP5A 2DNSA 3MF0A 4E3IA 2W27A 3UO9A 2Y2QA 5FI2A 3F1NB 1F98A 1W7FA 2Q9NA 3FPWA 5DJTA 1CQAA 3PBSA 3ZYTA 4MN5A 3RH8B 3ZNTA 4EQ1A 4Q0IA 4GHIB 1ESUA 3LR4A 4IUHA 4OQGA 1L0EA 1XJ4A 5HAQA 5AVFA 1Q2PA 4NXEA 2PHYA 4OOMA 2OV5A 4JGQA 3VP3A 3BFDA 3LICA 4JF4A 3M6BA 4JLFA 4IBRA 3GRJA 3BFCA 1XJ3A 4X6TA 4ID4A 3IXDA 2D02A 4DE2A 2XDMA 3O86A 2QPNA 3NDEA 3U2AA 3ZHHA 1AWIA 3T1XA 3S7OA 3VV4A 2W3HA 3LEQA 2JKTM 1T1AA 4X55A 1VQQA 3VP0A 3NBLA 4R0QA 4OLGA 1JTDA 4NETA 5A91A 1GCEA 5FSRA 1DP8A 3ZFZA 5EVIA 1M6KA 2A3UA 5CRFA 5U47A 1ZC2A 1ES2A 4EUVA 3AGEA 2K2NA 3WRZA 3GR2A 2WAEA 2X01A 4P6BA 4OPZA 1K55A 1NJ4A 2M1CA 3SS4A 1K6SA 2J3TD 1ES4A 1ONGA 4LCMA 4YOFA 3ZG9B 4KZBA 4EWFA 2ZC3B 3NY4A 5EVIC 3KSGA 2W3EA 2ZC7A 5EVEA 2Y2IA 1PZPA 5HPFA 1K55C 4EW7A 1MKMA 2HDQA 1TEMA 2JBFA 3NC8A 1KGGA 2BTFP 4R23A 2GNXA 2XSSA 3T4OA 1LL8A 3FKVA 5FQQA 1CK3A 2HZ5A 2Y79A 1SCWA 5GLDA 5HAIA 3A3FA 3RFBA 3S1YA 4JKTA 1Y54A 1JNUA 1NXYA 2BASA 3JYIA 3LIDA 4FH2A 4JF6A 5GLCA 3TRCA 5EE8A 3NULA 5E43A 5A90A 5DF9A 3NCKA 4R1GA 3G31A 1VETA 2V1BA 1S1ZA 1YLPA 3HLEA 1JWZA 2PBYA 3UE0A 4CLCA 4DJ2A 5IHVA 2EX6A 1OTIA 3IF6A 3M2KA 4X1MA 1PWCA 2Z6CA 4XUXA 1UGUA 3Q81A 4OPYA 3BW6A 2PD8A 4K0WA 1NY0A 1K4EA 4X69A 3BLSA 4H8RA 1KDSA 1I2WA 1N4OA 3IXGA 1FIKA 4RQ9A 3SH7A 2VV8A 4BBTA 1HD8A 4KG6A 1K57A 4Y0TA 5F6AA 5DTTA 4R3AA 4UA7A 5J8XA 3IHAA 3QP6A 4HP4A 4R38A 3HJIA 4K08A 2ZM2A 3F1PA 2V0WA 5K5BA 1EW0A 4X56A 2W1TB 1RGZA 4DE3A 1STZA 3D4FA 3LIBA 1PZOA 1BLHA 5DKLA 2IWCA 2Z6DA 4D60A 3H82A 1QMEA 3EWKA 3LYXA 4X25A 3GTCA 3OPLA 2LB9A 5DTKA 3CMZA 2VGKA 3OZHA 2CC1A 4EESA 4X68A 2VZWA 2HPBA 1IKIA 4ZDXA 1S4SA 2XROA 1NWZA 3MBZA 3VP2A 2OAP1 2W1RA 3IHBA 3MKEA 2J9OA 1C3BA 4IHQA 1RP5A 1GHMA 4S2PA 4I3IA 1TS7A 3Q07A 5EVLA 2GX5A 5AQ9A 3VFHA 1GHIA 1G68A 4LRZE 3WS2A 5I5LA 2PYRA 5J7EA 1FCNA 2WK0A 2O9AA 2WZXA 4X53A 2Z2MB 1FSWA 2V20A 2VV6A 2J80A 4KQRA 1YKDA 3JVVA 1VEUA 3L9KA 3IH9A 3N7WA 3MS6A 1N9OA 3QP2A 4Y15A 3LR0A 4ETXA 4QPRA 3PAGA 3FV7A 1ZG4A 1FILA 3R4KA 4GDNA 4B93A 2J3TC 1MY8A 4LRYC 4HJ6A 2Y2HA 3CWFA 3NJAA 2XEPA 2V8FA 3UB8A 3MXRA 2UWXA 2XLNA 2A2LA 5F82A 5KIZA 2H0YA 5FASA 1LI9A 4XXRA 2H0TA 3LIAA 3T12B 1K38A 1T18A 5FEFA 2ZC4B 3TW8A 3LY4A 2XQZA 2ZJ9A 3CI6A 2X71A 3PBNA 4XT2A 4HBTA 4GKUA 3HL9A 3CLOA 2H10A 4KZ8A 3BM6A 3IBJA 3TG9A 2ZQ8A 2ZMFA 3FYZA 2OLUA 4EV4A 5E2EA 4ESPA 5M19A 2HDSA 3S4XA 3WWXA 5E2GA 3BY8A 4Q0HA 2R9XA 2J7VA 2WADA 5GHZA 3KYQA 3MR0A 3IWIA 4R4SA 2JKRM 4IUKA 2OWJA 4WBGA 3VMAA 3BQ8A 3MXSA 3Q7VB 4XUZA 2HGVA 3PBTA 5HFOA 3ZNYA 3GV9A 4L9FA 4OOLA 3MZDA 5TR7A 5AQ7A 1QMFA 1TDLA 4DMZA 3BRMA 3E0YA 4AFIA 4BL2A 1PNEA 3VSKA 2O99A 3E2KA 4PM5A 4E3LA 1JVJA 4R3BA 1BTLA 1NYMA 3PAEA 4UHUA 4NXBA 1YSQA 1KE4A 4ZJ1A 3MSHA 4FSFA 3N4IA 3G2YA 1LSVA 2H5SA 3W4QA 1ZHHB 3S7PA 3C2WA 3NIAA 3HLGA 4QHCA 4HOIA 4EERA 5FEGA 3CJMA 4G3WA 5DVAA 5G18A 5A93A 1IKGA 3GDIA 5F68A 3EGDC 4KQDA 3KSIA 3P7NA 4WF0A 1L3LA 3E98A 2G2UA 5M1AA 4PM9A 2VA0A 1XFQA 4S2IA 4MN6A 3UPPA 5EUAA 1S1YA 2O0YA 1YLTA 1IYQA 3UDIA 5TBMB 2PDRA 2Q0OA 3DBAA 4CJNA 3PYPA 1TD5A 1VB6A 1OTDA 3RJUA 4OOYA 2YKHA 3SS5A 3NHQA 3HUOA 1E3UA 1BYWA 1FQGA 4Q0JA 3A0RA 4JXGA 2Y2MA 3T4TA 1KDWA 4IEDA 4CLCD 1Y28A 2UV0E 2XH9A 4WZ5A 3HJKA 2DCFA 3PHYA 3Q7ZA 5HD5A 1Q2QA 5I94A 5EPHA 4H6JA 3BWLA 3P98A 2K7SA 3DW0A 1IYOA 5EOOA 3LCEA 4GS9B 4OVDA 1P9WA 2Y2NA 4WZ5C 5CHUA 4WMCA 3C7VA 4OPQA 2FH5A 1MXOA 3BLMA 3LI8A 5CHMA 4EBLA 4HIAA 4Q8IA 5KSCA 4KQOA 1L0FA 4MMNA 1CEGA 1YLYA 4S2LA 3KO6A 5HL6A 1KVMA 5HAPA 3U4LP 5J4EA 4P0MA 4LENA 2M7UA 1YQSA 5M18A 5CX7A 3A0SA 5CERA 3ZQ5A 1H3QA 4B88A 3KSHA 1MWTA 3CAXA 4F3LA 2JN7A 1MC0A 3E4PA 3OLOA 4DDYA 1YAXA 3HLFA 5JYOA 4MDZA 2GZAA 1MBLA 2FFFB 2A24A 4HBUA 3T1QB 3A3IA 1MZUA 2Y55A 1J3WA 4Y17A 4N1HA 3T50A 3RXXA 4DF6A 3UY6A 2E8JA 3Q82A 3OC2A 5FL3A 1OTEA 5F5YA 2WAFA 4N9KA 1BLSA 3R7WB 3AGFA 2WGVA 1W79A 3KSFA 2V8CA 1L2SA 3HREA 2P7JA
chains in the Genus database with same CATH topology
4BMWA 2EWVA 2K31A 5F6AA 4FOFA 2V9AA 1S67L 2VGLM 4G3KA 4R3AA 2PR6A 3T4LA 1S66L 2CMNA 3C8CA 4HP4A 4R38A 1G6OA 1DP6A 3HJIA 4PAUA 4K08A 1KOUA 3F1PA 2V0WA 5K5BA 1EW0A 1TF1A 3PBRA 4DN0A 2R78A 4R70A 2W1TB 1STZA 5IU1A 3LIBA 2PT7A 5DKLA 4WL9A 2YKFA 3O5YA 3R7WA 4EEPA 2Z6DA 3TE8A 3H82A 3EWKA 1P97A 3LYXA 4HI4A 2LB9A 2L0WA 3LUQA 2KX6A 4EESA 3OCLA 1F9IA 2VZWA 3OBFA 4ME4A 1S4SA 2QYBA 3V67A 2XROA 1NWZA 4CLCB 5DFYA 4Y3IA 5AJGA 2HF6A 1T1BA 1NRJA 2WKPA 3IBRA 2OAP1 2W1RA 3KX0X 3G6OA 2EA9A 2W1TA 4IJGA 4IHQA 3UMEA 4P6ZM 4I38A 4I3IA 3A0VA 1TS7A 4E04A 5DJUA 2GX5A 3EGXC 3NOTC 3VE3A 4NXGA 3F1OB 4EETB 1X0OA 3HCYA 5AVEA 3EQVA 1D7EA 1V9ZA 2LB5A 1T19A 4LRZE 5I5LA 4O01A 2NUPC 2O9BA 2I9VA 2PYRA 5J7EA 3MQ0A 4BBVA 4G3VA 5G4YA 2O9AA 2L1MA 2V1AA 1D06A 5L8MA 2INWA 4Y5FA 5HDDA 3E4OA 5G4ZA 1F5MA 2VV6A 1XFNA 1DRMA 2J80A 4MCWA 1YKDA 2WKRA 3JVVA 5HDCA 2W3FA 1N9OA 4ARZB 3LR0A 4ETXA 4QPRA 1DP9A 4XT2B 4MN7A 2P08A 1OJGA 3EEHA 4DJ3A 2J3WA 2HJEA 4YNRA 2VV7A 3F1OA 3PXPA 3R4KA 4M4XA 4CLCC 4B93A 4EXOA 1XJ6A 2Y8HA 2J3TC 5C5KA 3BJNA 4YWZA 3T4SA 1S4RA 3IS2A 4LRYC 2FZ0A 3PBQA 4HJ6A 2W3GA 4Z1WA 3CWFA 3NJAA 3TJZC 3UB8A 4I3AA 2QHKA 3B33A 4NXFA 5IT5A 2A2LA 1OT9A 5KIZA 4GW9A 4JGPA 2KOIA 4HH3A 3B47A 2ZMVA 1W63M 4I39A 3LIAA 2VX8A 5HPIA 1T18A 3TW8A 3C38A 4ARZA 4B9OA 1YSPA 3OCNA 4GCZA 3CI6A 3PBNA 4XT2A 3MJQA 3H7WB 3NOUC 3SW1A 3CLOA 2HV1A 2OAQ1 3K3DA 3FPVA 1H8MA 3IBJA 3ICYA 2IA2A 2VLGA 4UEYA 2ZMFA 3C30A 1V9YA 3LIEA 2MJ6A 3UMDA 2B02A 4WLAA 1P9RA 3BY8A 4Q0HA 1T1CA 1NLZA 4I3JA 3KYQA 2ZBBA 3MR0A 4Y2FA 1VHMA 2JKRM 4IUKA 5HD3A 3ULFA 3FG8A 1N9LA 2OWJA 3EQUA 1P0ZA 3BQ8A 3PBOA 2D01A 5HWTA 1OTBA 4PKYA 2HGVA 3PBTA 3S7QA 4WEJA 3JVUA 2VJWA 2DMWA 3NOPC 5IS1A 4JGOA 3CITA 4PHTA 3D72A 3CUEA 2H28A 4L9FA 4OOLA 2XA7S 3H7WA 5F69A 3PR6A 2HJ9C 3K3CA 1UWPX 1N9NA 2O9CA 3D3OA 4DMZA 3LIFA 2EWWA 1GSVA 2NUTC 3MF0A 2W27A 3UB6A 4ETZA 3E0YA 2GJ3A 4AFIA 1TS8A 3F1NB 1TS0A 1F98A 4HHDA 2O99A 4HJ3A 3FPWA 5DJTA 3PBSA 3ZYTA 4MN5A 3RH8B 2QKPA 3IS2B 4HH2A 4EQ1A 4Q0IA 4GHIB 4NXBA 1YSQA 4WN5A 2PR5A 4FSFA 3LR4A 4GS9A 1LSVA 2WKQA 1OPXA 2W0NA 4IUHA 1ZHHB 3S7PA 3C2WA 4BWIA 4HOIA 4EERA 4G3WA 1XJ4A 1LT0A 5AVFA 4NXEA 3GECA 2PHYA 4OOMA 3B42A 1OJ5A 3GDIA 2JHEA 3EGDC 5F68A 4KQDA 4JGQA 5EFWA 3KSIA 3P7NA 4WF0A 4BBTA 4EEUA 3LICA 3E98A 4L0LA 2VA0A 5HWWA 1LSWA 1XJ3A 4HJ4A 1IOUA 1XFQA 4MN6A 3F1NA 2PYPA 4O0PA 3UE6A 2OOLA 2P04A 1S1YA 2O0YA 2D02A 4L9EA 4GHIA 4CQHA 4KUKA 5TBMB 3U2AA 2PDRA 3E4QA 3DBAA 3S7OA 3VV4A 2W3HA 2KLIA 1TD5A 3PYPA 1VB6A 2JKTM 4H6JB 1OTDA 1T1AA 2W3DA 2QJ7A 4NEED 2YKHA 3UE3A 5DKKA 3NHQA 1DP8A 2JKRI 4HQAA 4R6LA 4KUOA 4EUVA 2OWHA 3KYZA 1BYWA 1GSWA 4Q0JA 5HSQA 2K2NA 3A0RA 4O8GA 1LSXA 4I5SA 3T4TA 2M1CA 4CLCD 1Y28A 5DFXA 5KSHA 3FC7A 2J3TD 2V0UA 3UB7A 4CLCE 4YOFA 3HJKA 3PHYA 1ZTUA 5LBRA 5HD5A 3KSGA 1G28A 4UQIS 5TBMA 2W3EA 2XA7M 3VE4A 1UWNX 1WA9A 3T4KA 3EEAA 4H6JA 5HPFA 4EW7A 3BWLA 1MKMA 2K7SA 5HZHA 4GS9B 3P01A 3BQAA 1P9WA 4LRXC 4PKYG 2VGLS 1IFQA 3LFVA 2GNXA 2XSSA 2FH5A 3T4OA 1LL8A 3MXQA 2Y79A 4F3LB 3LI8A 4JGRA 3T4QA 3RFBA 4HIAA 4WUJA 4EU0A 4KQOA 2VKSA 4HY8A 4BJPA 4MMNA 5MC7A 5A8BA 1JNUA 3K2NA 2A24B 3LI9A 4HNBA 3KO6A 5HL6A 5J3WA 2BASA 4ZRRA 1OT6A 5J4EA 3LIDA 2M7UA 1NLYA 3CUEC 5HWVA 5CX7A 4BBUA 1TS6A 3TRCA 3A0SA 2ZOIA 2L4RA 3ZQ5A 3MQOA 4HP9A 1H3QA 3MFXA 2G7UA 2PD7A 3MQQA 4NKPA 3KSHA 5DF9A 5HDSA 3W2ZA 3LR5A 2QWSA 2JKTI 3LR3A 1XJ2A 4GLQA 2ZOHA 2V1BA 1OTAA 3MMHA 4LLOB 1S1ZA 3CAXA 1W63Q 1ODVA 3EOIA 4F3LA 2JN7A 3E4PA 1MC0A 3OLOA 4LPZA 1YAXA 4MDZA 2VEAA 2GZAA 5TJJA 3OOVA 2A24A 4P6ZS 3BY9A 4CLCA 4DJ2A 3UB9A 2B18A 3S7NA 2QJ5A 1OTIA 1MZUA 2KDKA 2M7VA 2Z6CA 4WEKA 4GJ4A 1UGUA 3H9WA 3F1PB 3T50A 3OC2A 3BW6A 5FL3A 1OTEA 2PD8A 5F5YA 4II7A 3RTYA 3T4JA 4UQIM 1GSXA 3R7WB 3KSFA 4L9GA 3H82B 4WELA 4RQ9A 2XRNA 2VV8A 3VOLA 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKD A;  2W3F A;  2O99 A;  2K31 A;  4LRX C;  4ETX A;  4FOF A;  4QPR A;  4G3K A;  4Q0I A;  4MN7 A;  1YSQ A;  3LFV A;  2XSS A;  4YNR A;  3R4K A;  4PAU A;  4IUH A;  3S7P A;  2Y79 A;  2Y8H A;  3C2W A;  5C5K A;  3BJN A;  4BWI A;  5K5B A;  3RFB A;  1TF1 A;  4G3W A;  4LRY C;  4DN0 A;  4EU0 A;  4R70 A;  2W3G A;  2W1T B;  2VKS A;  4Z1W A;  4MMN A;  3K2N A;  1STZ A;  3KO6 A;  5HL6 A;  3KSI A;  4ZRR A;  3O5Y A;  4GW9 A;  2M7U A;  3E98 A;  2KOI A;  3TRC A;  4O0P A;  5HPI A;  3ZQ5 A;  2LB9 A;  2G7U A;  2OOL A;  1YSP A;  3KSH A;  2O0Y A;  3CI6 A;  3W2Z A;  4GLQ A;  3NOU C;  4CQH A;  2VZW A;  3OBF A;  3DBA A;  4ME4 A;  2QYB A;  3MMH A;  2XRO A;  3IBJ A;  3S7O A;  5DFY A;  3VV4 A;  2W3H A;  4Y3I A;  5AJG A;  2KLI A;  1TD5 A;  2IA2 A;  2ZMF A;  1MC0 A;  2W3D A;  3IBR A;  2W1R A;  4MDZ A;  2VEA A;  3G6O A;  2W1T A;  3NHQ A;  5TJJ A;  3OOV A;  4IJG A;  4R6L A;  4EUV A;  4Q0H A;  4Q0J A;  5HSQ A;  2K2N A;  2B18 A;  3S7N A;  4E04 A;  2GX5 A;  3NOT C;  4O8G A;  4Y2F A;  1VHM A;  4IUK A;  3HCY A;  2M7V A;  2LB5 A;  5DFX A;  4LRZ E;  5I5L A;  2HGV A;  4O01 A;  3S7Q A;  2O9B A;  3MQ0 A;  4YOF A;  2VJW A;  3NOP C;  4G3V A;  1ZTU A;  2O9A A;  3CIT A;  5LBR A;  3KSG A;  5L8M A;  2W3E A;  4Y5F A;  3KSF A;  1F5M A;  2O9C A;  3D3O A;  4DMZ A;  3EEA A;  5HPF A;  4RQ9 A;  3MF0 A;  1MKM A;  4ETZ A;  2XRN A;  3E0Y A;  4MCW A; 
#chains in the Genus database with same CATH topology
 3IH8 A;  3M6H A;  2EWV A;  3VP1 A;  1H0M A;  4LFU A;  1LLB A;  4Z9Q A;  1PWG A;  2ZQD A;  3C8C A;  1YLW A;  1DP6 A;  3GSG A;  1XX2 A;  1YPR A;  4GNU A;  2JC7 A;  1TF1 A;  4UA9 A;  4Y7P A;  3PBR A;  4DN0 A;  2R78 A;  4R70 A;  2XFT A;  3A3D A;  2EX2 A;  4WL9 A;  4MNR A;  3TE8 A;  4FTX A;  2ZD8 A;  1TDG A;  1P97 A;  1K56 D;  3QP5 A;  3BFE A;  4S2N A;  4KZ3 A;  2WYX A;  1FR1 A;  1XKZ A;  4E6X A;  4N92 A;  3LUQ A;  4B4X A;  1F9I A;  2A49 A;  4E3K A;  4Y3I A;  5AJG A;  4N9L A;  1KGE A;  4GOG A;  5FQJ A;  2WKP A;  3DTI A;  3IBR A;  4JXS A;  5FI6 A;  4MLL A;  3IX3 A;  5CEC A;  1XP4 A;  2VK3 A;  1H8Y A;  4LV0 A;  3UME A;  4P6Z M;  3RXW A;  4E04 A;  5DJU A;  3EGX C;  2J8Y A;  3VE3 A;  3F1O B;  4EET B;  3HCY A;  5AVE A;  1JTG A;  1BUL A;  3EQV A;  4RX2 A;  1F2K A;  1HZO A;  2I9V A;  4EBN A;  4BBV A;  3NI9 A;  3CPT B;  3Q7V A;  5HDD A;  3I7J A;  1BLP A;  4QY6 A;  3G2Z A;  1K25 A;  2R9W A;  5HDC A;  2W3F A;  3G32 A;  5GLA A;  3AGD A;  3FKW A;  2C6W B;  2J3W A;  2ZC6 B;  1DJC A;  4GZB A;  3PXP A;  5FI7 A;  4CLC C;  4EXO A;  1XJ6 A;  2Y8H A;  4K91 A;  5C5K A;  5HW3 A;  5FA7 A;  4YWZ A;  1S4R A;  5CHJ A;  2FZ0 A;  3IF6 C;  3PBQ A;  2W3G A;  1NZU A;  4Z1W A;  1W8Q A;  3B33 A;  1CJF A;  5FQM A;  5IT5 A;  4GW9 A;  4JGP A;  2KOI A;  4FUW A;  3LO7 A;  4DXB A;  1W63 M;  3C38 A;  4ARZ A;  4B9O A;  2HP9 A;  4OQ0 A;  1IEM A;  5E2F A;  4GCZ A;  2WKH A;  3MJQ A;  3NOU C;  1K57 C;  1KE0 A;  3SW1 A;  1KVL A;  2EXA A;  2OAQ 1;  3FPV A;  1H8M A;  5DF8 A;  3ICY A;  2IA2 A;  5FQI A;  1YMX A;  3W4O A;  1V9Y A;  1ZKJ A;  3LIE A;  2MJ6 A;  2B02 A;  4BLM A;  2EXB A;  4WYY A;  3BEC A;  3VSL A;  1SKO B;  1WYB A;  4Y2F A;  1VHM A;  2JKG A;  2ZMA A;  5HD3 A;  3FG8 A;  1N9L A;  1JWV A;  3PBO A;  5HWT A;  1E3U D;  3FWL A;  3A3E A;  4PKY A;  1IEL A;  2DMW A;  4HES A;  3CUE A;  2BLS A;  3H7W A;  3PR6 A;  2XFS A;  3QHY A;  4BEN A;  4X1L A;  4EUZ A;  3MFD A;  2GJ3 A;  1TS8 A;  1TS0 A;  4HHD A;  4GB7 A;  1LL9 A;  2P74 A;  3G35 A;  2QKP A;  4E3N A;  4JXV A;  4HH2 A;  1H8Z A;  4WN5 A;  4GS9 A;  2WKQ A;  1OPX A;  3OPR A;  1ERQ A;  4WMC D;  3C5A A;  4BWI A;  5EVI B;  3QNC A;  3B42 A;  4EEU A;  5AQB A;  3TSG A;  1ES5 A;  1CEF A;  4L0L A;  1LSW A;  5AQA A;  4HJ4 A;  1IOU A;  3F1N A;  2Q9M A;  4O0P A;  2Y2O A;  3C4P A;  2OOL A;  2I72 A;  4LGW A;  2ZL1 B;  4L9E A;  2WGW B;  4GHI A;  4DKI A;  1K56 A;  1PI5 A;  2KLI A;  3ZDJ A;  2QJ7 A;  4Y0U A;  2G2W A;  4NEE D;  2HDU A;  3UE3 A;  3VP4 A;  3LGO A;  4HQA A;  4KUO A;  2OWH A;  4KQQ A;  1A0K A;  3W4P A;  1GSW A;  5HSQ A;  3Q1F A;  1IYS A;  1NYY A;  2PAV P;  1LSX A;  2WKI A;  3B3X A;  3ZG0 A;  5KSH A;  2XF3 A;  3FC7 A;  4FH4 A;  4CLC E;  2Y2G A;  4ZAM A;  1S6R A;  1ZTU A;  4KEN B;  1G28 A;  3ZG7 B;  2XA7 M;  3SS3 A;  3VE4 A;  4R3J A;  4S2M A;  1WA9 A;  1ALQ A;  3EEA A;  2Y2K A;  3G4P A;  2XD5 A;  1D1J A;  5HZH A;  1PWD A;  3LY3 A;  4LRX C;  3IX8 A;  1XA1 A;  4F94 A;  4MEZ A;  2JKF A;  3LFV A;  3BEB A;  1VET B;  4S2J A;  3MXQ A;  3SH9 A;  4JGR A;  3T4Q A;  4LV3 A;  4HY8 A;  4BJP A;  5L2F A;  5A8B A;  3K2N A;  3PTE A;  4HNB A;  2B95 A;  1OT6 A;  4MBK A;  1NLY A;  1XGI A;  5EOE A;  5HWV A;  4BBU A;  5TFQ A;  2ZOI A;  2RL3 A;  2L4R A;  1ERM A;  1LL5 A;  4KG5 A;  2ZM8 A;  1EWZ A;  1NRF A;  3MKF A;  3MQO A;  4HP9 A;  3MFX A;  2G7U A;  2PD7 A;  3MQQ A;  5HDS A;  3W2Z A;  3LR5 A;  2QWS A;  2JKT I;  2HP6 A;  1XJ2 A;  3LR3 A;  1E4D A;  4GLQ A;  1OME A;  3ZG5 A;  2ZOH A;  2EFU A;  3MMH A;  4PMA A;  3HLD A;  1W63 Q;  4DXC A;  4LPZ A;  1LI0 A;  3VOZ A;  1RGY A;  5TJJ A;  1BSG A;  4DE0 A;  2PBD P;  4P6Z S;  3ITA A;  3BY9 A;  5KZH A;  3UB9 A;  2B18 A;  4C3Q A;  4UAA A;  2QJ5 A;  2Y2L A;  4WEK A;  4ZBE A;  4GJ4 A;  5EEC A;  2V1Z A;  3F1P B;  1E25 A;  3N6I A;  2IWB A;  3UN7 A;  4PM8 A;  4II7 A;  3RTY A;  3MZF A;  4OH0 A;  4UQI M;  1GSX A;  4KZA A;  2E8I A;  3OPH A;  4L9G A;  3V3S A;  3H82 B;  4WEL A;  2XRN A;  4YIN A;  1LHY A;  2P9V B;  5BOH A;  4BMW A;  4P87 A;  3CPT A;  4KZ5 A;  5HAR A;  1WE4 A;  2V9A A;  1S67 L;  2VGL M;  3T4L A;  5HL1 A;  1S66 L;  2CMN A;  5JYP A;  3QP1 A;  3T1S A;  1G6O A;  3L7H A;  4R4R A;  1KOU A;  3IWO A;  4OQH A;  3V39 A;  4RA7 A;  4PM7 A;  4ZTK A;  3QP8 A;  2PT7 A;  2YKF A;  2ZM0 A;  2DRW A;  5FDS A;  1IYP A;  1J9M A;  1WYC A;  1ACF A;  3HUM A;  5CEB A;  3BFG A;  1HTZ A;  4BL3 A;  3OBF A;  1MPL A;  3ZVW A;  2JCH A;  1T1B A;  1PRQ A;  1CF0 A;  1FR6 A;  5CED A;  3G6O A;  1VEU B;  2EA9 A;  2W1T A;  3HBR A;  3QNB A;  3LEZ A;  4IJG A;  3W8K A;  4PM6 A;  4UA6 A;  5FQ9 A;  2ZQ7 A;  4HEF A;  4NXG A;  1X0O A;  5A92 A;  2EX8 A;  1G6A A;  2LB5 A;  1T19 A;  2NUP C;  2ZLY A;  1MWU A;  4G3V A;  5G4Y A;  1SKO A;  2L1M A;  2EX9 A;  1YMS A;  1U60 A;  1D06 A;  5L8M A;  4GN2 A;  5CGX A;  3E4O A;  4ZJ2 A;  1SHV A;  3VFF A;  1DRM A;  3G34 A;  4KZ7 A;  2WKR A;  5F1G A;  2Y91 A;  3V50 A;  1DP9 A;  4XT2 B;  3DWZ A;  2P08 A;  3EEH A;  4DJ3 A;  5HX9 A;  3N8S A;  4JBF A;  4M4X A;  3BJN A;  1HLU P;  4JXW A;  3T4S A;  1ZG6 A;  4N1X A;  1K6R A;  3TJZ C;  2QHK A;  4BD1 A;  3DTM A;  2V2F F;  3O87 A;  1ES3 A;  4FD8 A;  4HH3 A;  3B47 A;  2PRF A;  2ZQA A;  2ZMV A;  4LV2 A;  2XR0 A;  5DF7 A;  5HPI A;  2WZZ A;  5GHX A;  4BQM A;  4UEY A;  1I2S A;  2VLG A;  5TGF A;  4EQI A;  1PW1 A;  5FAO A;  1Z6F A;  5GLB A;  3VOY A;  2ZL1 A;  4U0T A;  2WGW A;  4EBP A;  4K0X A;  4OKP A;  1SZV A;  1T1C A;  1NLZ A;  4JPM A;  4I3J A;  4U0X A;  2ZBB A;  2C5W B;  3EQU A;  4QU3 A;  4KG2 A;  3SH8 A;  1Y4O A;  3S7Q A;  3WS4 A;  4C75 A;  3JVU A;  1XGJ A;  3NOP C;  5IS1 A;  4JGO A;  3CIT A;  4PHT A;  3D72 A;  1PYY A;  2H28 A;  5L07 A;  2XA7 S;  5F69 A;  4S2N C;  2HJ9 C;  5KMW A;  1UWP X;  3UPO A;  1N9N A;  3D3O A;  5GL9 A;  4P85 A;  1DJB A;  3UB6 A;  3TOI A;  1MWS A;  4ETZ A;  1SDN A;  4HJ3 A;  3SZT A;  3BYD A;  3M2J A;  3IS2 B;  4QD4 A;  2PR5 A;  2W0N A;  4LV1 A;  3ZVT A;  2VGJ A;  4E3O A;  1K54 A;  3E2L A;  4WZ4 A;  1M40 A;  1LT0 A;  3GEC A;  4RYE A;  2IWD A;  1OJ5 A;  2JHE A;  2X02 A;  5EFW A;  4GD8 A;  1GA9 A;  1BT5 A;  1FSY A;  5HWW A;  2PYP A;  1L0D A;  1K54 C;  1CI9 A;  3UE6 A;  4U3T A;  1MKI A;  2ACG A;  3NDG A;  2P04 A;  4KZ6 A;  1PW8 A;  3HLC A;  4CQH A;  4KUK A;  2PU4 A;  3E4Q A;  4B4Z A;  2WKE A;  2WUQ A;  3IF5 A;  2Y2P A;  2OSU A;  4H6J B;  2W3D A;  3DTK A;  3GMW A;  5GHY A;  5EV0 A;  5FAQ A;  5DKK A;  3N8L A;  1KGF A;  2JKR I;  2WGI A;  4R6L A;  3S22 A;  1O7E A;  3KYZ A;  2HDR A;  1H5X A;  5EM0 A;  1TVF A;  1KE3 A;  4IVK A;  3UNW A;  1L0G A;  4O8G A;  4I5S A;  3NEC A;  5DFX A;  2V0U A;  4Y13 A;  3UB7 A;  5LBR A;  4CPK A;  4UQI S;  5TBM A;  1UWN X;  4A5R A;  3T4K A;  1BUE A;  4YFM A;  4GD6 A;  5CGS A;  3MZE A;  4KZ9 A;  3P01 A;  3BQA A;  3UDF A;  4IVI A;  4JF5 A;  4PKY G;  3CG5 A;  2VGL S;  1IFQ A;  2J9P A;  3IXH A;  1BZA A;  2P9V A;  2RCX A;  4F3L B;  4D2O A;  4BD0 A;  5E2H A;  4WUJ A;  4EU0 A;  3D9Y A;  2VKS A;  5MC7 A;  3IWQ A;  4OLD A;  2A24 B;  2BG1 A;  3LI9 A;  5J3W A;  4ZRR A;  3ZGA B;  2Y4A A;  1I5Q A;  3CUE C;  3IXB A;  2ZQ9 A;  1TS6 A;  1O07 A;  4NKP A;  1FOF A;  1G5U A;  1GA0 A;  1PFL A;  4OQI A;  2AVX A;  1OTA A;  1W8Y A;  4LLO B;  4KZ4 A;  1ODV A;  1HVB A;  3EOI A;  5EM1 A;  3UPN A;  1K0K A;  4DE1 A;  2VEA A;  1K4F A;  3OOV A;  1YT4 A;  5F83 A;  1Z09 A;  3GQZ A;  3ITB A;  1ERO A;  3S7N A;  4NK3 A;  1RCJ A;  2KDK A;  5DTS A;  2M7V A;  4PPR A;  3H9W A;  2PU2 A;  3T4J A;  3HUN A;  3DTE A;  1N9B A;  5L09 A;  4OPR A;  3VOL A;  2HP5 A;  2K31 A;  4WM9 A;  3QP4 A;  2JE5 A;  4FOF A;  1FCM A;  4G3K A;  2PR6 A;  3O88 A;  3SOI A;  4GDB A;  4PAU A;  4QWO A;  5CTN A;  1ESI A;  1S0W A;  3O3V A;  1ONH A;  5F1F A;  5IU1 A;  2Y59 A;  3WS0 A;  3R7W A;  3O5Y A;  4EEP A;  3CZD A;  4E6W A;  1PIO A;  4E3J A;  4QJG A;  4OP8 A;  4HI4 A;  1XPB A;  1YLJ A;  1BLC A;  3CHW P;  4ZJ3 A;  2L0W A;  2KX6 A;  1CI8 A;  3OCL A;  5EVI D;  4O7D A;  1DY6 A;  4ME4 A;  3V67 A;  2QYB A;  3V3R A;  3P09 A;  4CLC B;  5DFY A;  4E3M A;  2HF6 A;  1PI4 A;  3C7U A;  1NRJ A;  2OLV A;  3V5M A;  3KX0 X;  1SKF A;  2GDN A;  3IF6 B;  5FDH A;  2QMI A;  4OON A;  2B5R A;  4I38 A;  2ZC5 B;  3ZG8 B;  3OPP A;  1JWP A;  3A0V A;  3DAV A;  3NOT C;  3IX4 A;  4Y0O A;  2Y2J A;  4RVA A;  3N8R A;  1D7E A;  1V9Z A;  4O01 A;  3T1R A;  2O9B A;  2XGN A;  4DDS A;  1XA7 A;  3A3J A;  3MQ0 A;  2EFX A;  1MWR A;  2V1A A;  4DRT A;  5D3O A;  2INW A;  4Y5F A;  1FCO A;  5G4Z A;  1F5M A;  5L10 A;  1XFN A;  4FCF A;  1EI5 A;  4MCW A;  1XXM A;  3HLB A;  3HLW A;  4MBF A;  2XK1 A;  3IQA A;  4ARZ B;  1SDE A;  3FZC A;  4MN7 A;  1OJG A;  2HJE A;  4YNR A;  3GVB A;  2VV7 A;  3F1O A;  2XD1 A;  3WRT A;  1VM1 A;  3BFF A;  3KYE A;  2QZ6 A;  3IS2 A;  3UDX A;  2FFY A;  4I3A A;  4MBH A;  2Z2L B;  4NXF A;  1OT9 A;  4IBX A;  4S2O A;  5CXW A;  3UB5 P;  3UE1 A;  4I39 A;  1W5D A;  2VX8 A;  3C4O A;  3HVF A;  1YSP A;  3OCN A;  4RX3 A;  2ZQC A;  3H7W B;  1DJA A;  4M3K A;  2HV1 A;  3K3D A;  1AXB A;  5CTM A;  3DWK A;  5FQK A;  3C30 A;  1NZO A;  3UMD A;  3ISG A;  5FAP A;  3G30 A;  4WLA A;  1GHP A;  1P9R A;  3IT9 A;  3WS1 A;  3WS5 A;  4QB8 A;  4S2K A;  3ULF A;  4NG2 A;  4C6Y A;  1P0Z A;  2D01 A;  1YM1 A;  1OTB A;  4WEJ A;  1YLZ A;  3ZCZ A;  2VJW A;  5FAT A;  4LCL A;  4QY5 A;  3JPU A;  3K3C A;  5CGW A;  2O9C A;  3LIF A;  2EWW A;  1GSV A;  2NUT C;  4OP5 A;  2DNS A;  3MF0 A;  4E3I A;  2W27 A;  3UO9 A;  2Y2Q A;  5FI2 A;  3F1N B;  1F98 A;  1W7F A;  2Q9N A;  3FPW A;  5DJT A;  1CQA A;  3PBS A;  3ZYT A;  4MN5 A;  3RH8 B;  3ZNT A;  4EQ1 A;  4Q0I A;  4GHI B;  1ESU A;  3LR4 A;  4IUH A;  4OQG A;  1L0E A;  1XJ4 A;  5HAQ A;  5AVF A;  1Q2P A;  4NXE A;  2PHY A;  4OOM A;  2OV5 A;  4JGQ A;  3VP3 A;  3BFD A;  3LIC A;  4JF4 A;  3M6B A;  4JLF A;  4IBR A;  3GRJ A;  3BFC A;  1XJ3 A;  4X6T A;  4ID4 A;  3IXD A;  2D02 A;  4DE2 A;  2XDM A;  3O86 A;  2QPN A;  3NDE A;  3U2A A;  3ZHH A;  1AWI A;  3T1X A;  3S7O A;  3VV4 A;  2W3H A;  3LEQ A;  2JKT M;  1T1A A;  4X55 A;  1VQQ A;  3VP0 A;  3NBL A;  4R0Q A;  4OLG A;  1JTD A;  4NET A;  5A91 A;  1GCE A;  5FSR A;  1DP8 A;  3ZFZ A;  5EVI A;  1M6K A;  2A3U A;  5CRF A;  5U47 A;  1ZC2 A;  1ES2 A;  4EUV A;  3AGE A;  2K2N A;  3WRZ A;  3GR2 A;  2WAE A;  2X01 A;  4P6B A;  4OPZ A;  1K55 A;  1NJ4 A;  2M1C A;  3SS4 A;  1K6S A;  2J3T D;  1ES4 A;  1ONG A;  4LCM A;  4YOF A;  3ZG9 B;  4KZB A;  4EWF A;  2ZC3 B;  3NY4 A;  5EVI C;  3KSG A;  2W3E A;  2ZC7 A;  5EVE A;  2Y2I A;  1PZP A;  5HPF A;  1K55 C;  4EW7 A;  1MKM A;  2HDQ A;  1TEM A;  2JBF A;  3NC8 A;  1KGG A;  2BTF P;  4R23 A;  2GNX A;  2XSS A;  3T4O A;  1LL8 A;  3FKV A;  5FQQ A;  1CK3 A;  2HZ5 A;  2Y79 A;  1SCW A;  5GLD A;  5HAI A;  3A3F A;  3RFB A;  3S1Y A;  4JKT A;  1Y54 A;  1JNU A;  1NXY A;  2BAS A;  3JYI A;  3LID A;  4FH2 A;  4JF6 A;  5GLC A;  3TRC A;  5EE8 A;  3NUL A;  5E43 A;  5A90 A;  5DF9 A;  3NCK A;  4R1G A;  3G31 A;  1VET A;  2V1B A;  1S1Z A;  1YLP A;  3HLE A;  1JWZ A;  2PBY A;  3UE0 A;  4CLC A;  4DJ2 A;  5IHV A;  2EX6 A;  1OTI A;  3IF6 A;  3M2K A;  4X1M A;  1PWC A;  2Z6C A;  4XUX A;  1UGU A;  3Q81 A;  4OPY A;  3BW6 A;  2PD8 A;  4K0W A;  1NY0 A;  1K4E A;  4X69 A;  3BLS A;  4H8R A;  1KDS A;  1I2W A;  1N4O A;  3IXG A;  1FIK A;  4RQ9 A;  3SH7 A;  2VV8 A;  4BBT A;  1HD8 A;  4KG6 A;  1K57 A;  4Y0T A;  5F6A A;  5DTT A;  4R3A A;  4UA7 A;  5J8X A;  3IHA A;  3QP6 A;  4HP4 A;  4R38 A;  3HJI A;  4K08 A;  2ZM2 A;  3F1P A;  2V0W A;  5K5B A;  1EW0 A;  4X56 A;  2W1T B;  1RGZ A;  4DE3 A;  1STZ A;  3D4F A;  3LIB A;  1PZO A;  1BLH A;  5DKL A;  2IWC A;  2Z6D A;  4D60 A;  3H82 A;  1QME A;  3EWK A;  3LYX A;  4X25 A;  3GTC A;  3OPL A;  2LB9 A;  5DTK A;  3CMZ A;  2VGK A;  3OZH A;  2CC1 A;  4EES A;  4X68 A;  2VZW A;  2HPB A;  1IKI A;  4ZDX A;  1S4S A;  2XRO A;  1NWZ A;  3MBZ A;  3VP2 A;  2OAP 1;  2W1R A;  3IHB A;  3MKE A;  2J9O A;  1C3B A;  4IHQ A;  1RP5 A;  1GHM A;  4S2P A;  4I3I A;  1TS7 A;  3Q07 A;  5EVL A;  2GX5 A;  5AQ9 A;  3VFH A;  1GHI A;  1G68 A;  4LRZ E;  3WS2 A;  5I5L A;  2PYR A;  5J7E A;  1FCN A;  2WK0 A;  2O9A A;  2WZX A;  4X53 A;  2Z2M B;  1FSW A;  2V20 A;  2VV6 A;  2J80 A;  4KQR A;  1YKD A;  3JVV A;  1VEU A;  3L9K A;  3IH9 A;  3N7W A;  3MS6 A;  1N9O A;  3QP2 A;  4Y15 A;  3LR0 A;  4ETX A;  4QPR A;  3PAG A;  3FV7 A;  1ZG4 A;  1FIL A;  3R4K A;  4GDN A;  4B93 A;  2J3T C;  1MY8 A;  4LRY C;  4HJ6 A;  2Y2H A;  3CWF A;  3NJA A;  2XEP A;  2V8F A;  3UB8 A;  3MXR A;  2UWX A;  2XLN A;  2A2L A;  5F82 A;  5KIZ A;  2H0Y A;  5FAS A;  1LI9 A;  4XXR A;  2H0T A;  3LIA A;  3T12 B;  1K38 A;  1T18 A;  5FEF A;  2ZC4 B;  3TW8 A;  3LY4 A;  2XQZ A;  2ZJ9 A;  3CI6 A;  2X71 A;  3PBN A;  4XT2 A;  4HBT A;  4GKU A;  3HL9 A;  3CLO A;  2H10 A;  4KZ8 A;  3BM6 A;  3IBJ A;  3TG9 A;  2ZQ8 A;  2ZMF A;  3FYZ A;  2OLU A;  4EV4 A;  5E2E A;  4ESP A;  5M19 A;  2HDS A;  3S4X A;  3WWX A;  5E2G A;  3BY8 A;  4Q0H A;  2R9X A;  2J7V A;  2WAD A;  5GHZ A;  3KYQ A;  3MR0 A;  3IWI A;  4R4S A;  2JKR M;  4IUK A;  2OWJ A;  4WBG A;  3VMA A;  3BQ8 A;  3MXS A;  3Q7V B;  4XUZ A;  2HGV A;  3PBT A;  5HFO A;  3ZNY A;  3GV9 A;  4L9F A;  4OOL A;  3MZD A;  5TR7 A;  5AQ7 A;  1QMF A;  1TDL A;  4DMZ A;  3BRM A;  3E0Y A;  4AFI A;  4BL2 A;  1PNE A;  3VSK A;  2O99 A;  3E2K A;  4PM5 A;  4E3L A;  1JVJ A;  4R3B A;  1BTL A;  1NYM A;  3PAE A;  4UHU A;  4NXB A;  1YSQ A;  1KE4 A;  4ZJ1 A;  3MSH A;  4FSF A;  3N4I A;  3G2Y A;  1LSV A;  2H5S A;  3W4Q A;  1ZHH B;  3S7P A;  3C2W A;  3NIA A;  3HLG A;  4QHC A;  4HOI A;  4EER A;  5FEG A;  3CJM A;  4G3W A;  5DVA A;  5G18 A;  5A93 A;  1IKG A;  3GDI A;  5F68 A;  3EGD C;  4KQD A;  3KSI A;  3P7N A;  4WF0 A;  1L3L A;  3E98 A;  2G2U A;  5M1A A;  4PM9 A;  2VA0 A;  1XFQ A;  4S2I A;  4MN6 A;  3UPP A;  5EUA A;  1S1Y A;  2O0Y A;  1YLT A;  1IYQ A;  3UDI A;  5TBM B;  2PDR A;  2Q0O A;  3DBA A;  4CJN A;  3PYP A;  1TD5 A;  1VB6 A;  1OTD A;  3RJU A;  4OOY A;  2YKH A;  3SS5 A;  3NHQ A;  3HUO A;  1E3U A;  1BYW A;  1FQG A;  4Q0J A;  3A0R A;  4JXG A;  2Y2M A;  3T4T A;  1KDW A;  4IED A;  4CLC D;  1Y28 A;  2UV0 E;  2XH9 A;  4WZ5 A;  3HJK A;  2DCF A;  3PHY A;  3Q7Z A;  5HD5 A;  1Q2Q A;  5I94 A;  5EPH A;  4H6J A;  3BWL A;  3P98 A;  2K7S A;  3DW0 A;  1IYO A;  5EOO A;  3LCE A;  4GS9 B;  4OVD A;  1P9W A;  2Y2N A;  4WZ5 C;  5CHU A;  4WMC A;  3C7V A;  4OPQ A;  2FH5 A;  1MXO A;  3BLM A;  3LI8 A;  5CHM A;  4EBL A;  4HIA A;  4Q8I A;  5KSC A;  4KQO A;  1L0F A;  4MMN A;  1CEG A;  1YLY A;  4S2L A;  3KO6 A;  5HL6 A;  1KVM A;  5HAP A;  3U4L P;  5J4E A;  4P0M A;  4LEN A;  2M7U A;  1YQS A;  5M18 A;  5CX7 A;  3A0S A;  5CER A;  3ZQ5 A;  1H3Q A;  4B88 A;  3KSH A;  1MWT A;  3CAX A;  4F3L A;  2JN7 A;  1MC0 A;  3E4P A;  3OLO A;  4DDY A;  1YAX A;  3HLF A;  5JYO A;  4MDZ A;  2GZA A;  1MBL A;  2FFF B;  2A24 A;  4HBU A;  3T1Q B;  3A3I A;  1MZU A;  2Y55 A;  1J3W A;  4Y17 A;  4N1H A;  3T50 A;  3RXX A;  4DF6 A;  3UY6 A;  2E8J A;  3Q82 A;  3OC2 A;  5FL3 A;  1OTE A;  5F5Y A;  2WAF A;  4N9K A;  1BLS A;  3R7W B;  3AGF A;  2WGV A;  1W79 A;  3KSF A;  2V8C A;  1L2S A;  3HRE A;  2P7J A; 
#chains in the Genus database with same CATH homology
 4BMW A;  2EWV A;  2K31 A;  5F6A A;  4FOF A;  2V9A A;  1S67 L;  2VGL M;  4G3K A;  4R3A A;  2PR6 A;  3T4L A;  1S66 L;  2CMN A;  3C8C A;  4HP4 A;  4R38 A;  1G6O A;  1DP6 A;  3HJI A;  4PAU A;  4K08 A;  1KOU A;  3F1P A;  2V0W A;  5K5B A;  1EW0 A;  1TF1 A;  3PBR A;  4DN0 A;  2R78 A;  4R70 A;  2W1T B;  1STZ A;  5IU1 A;  3LIB A;  2PT7 A;  5DKL A;  4WL9 A;  2YKF A;  3O5Y A;  3R7W A;  4EEP A;  2Z6D A;  3TE8 A;  3H82 A;  3EWK A;  1P97 A;  3LYX A;  4HI4 A;  2LB9 A;  2L0W A;  3LUQ A;  2KX6 A;  4EES A;  3OCL A;  1F9I A;  2VZW A;  3OBF A;  4ME4 A;  1S4S A;  2QYB A;  3V67 A;  2XRO A;  1NWZ A;  4CLC B;  5DFY A;  4Y3I A;  5AJG A;  2HF6 A;  1T1B A;  1NRJ A;  2WKP A;  3IBR A;  2OAP 1;  2W1R A;  3KX0 X;  3G6O A;  2EA9 A;  2W1T A;  4IJG A;  4IHQ A;  3UME A;  4P6Z M;  4I38 A;  4I3I A;  3A0V A;  1TS7 A;  4E04 A;  5DJU A;  2GX5 A;  3EGX C;  3NOT C;  3VE3 A;  4NXG A;  3F1O B;  4EET B;  1X0O A;  3HCY A;  5AVE A;  3EQV A;  1D7E A;  1V9Z A;  2LB5 A;  1T19 A;  4LRZ E;  5I5L A;  4O01 A;  2NUP C;  2O9B A;  2I9V A;  2PYR A;  5J7E A;  3MQ0 A;  4BBV A;  4G3V A;  5G4Y A;  2O9A A;  2L1M A;  2V1A A;  1D06 A;  5L8M A;  2INW A;  4Y5F A;  5HDD A;  3E4O A;  5G4Z A;  1F5M A;  2VV6 A;  1XFN A;  1DRM A;  2J80 A;  4MCW A;  1YKD A;  2WKR A;  3JVV A;  5HDC A;  2W3F A;  1N9O A;  4ARZ B;  3LR0 A;  4ETX A;  4QPR A;  1DP9 A;  4XT2 B;  4MN7 A;  2P08 A;  1OJG A;  3EEH A;  4DJ3 A;  2J3W A;  2HJE A;  4YNR A;  2VV7 A;  3F1O A;  3PXP A;  3R4K A;  4M4X A;  4CLC C;  4B93 A;  4EXO A;  1XJ6 A;  2Y8H A;  2J3T C;  5C5K A;  3BJN A;  4YWZ A;  3T4S A;  1S4R A;  3IS2 A;  4LRY C;  2FZ0 A;  3PBQ A;  4HJ6 A;  2W3G A;  4Z1W A;  3CWF A;  3NJA A;  3TJZ C;  3UB8 A;  4I3A A;  2QHK A;  3B33 A;  4NXF A;  5IT5 A;  2A2L A;  1OT9 A;  5KIZ A;  4GW9 A;  4JGP A;  2KOI A;  4HH3 A;  3B47 A;  2ZMV A;  1W63 M;  4I39 A;  3LIA A;  2VX8 A;  5HPI A;  1T18 A;  3TW8 A;  3C38 A;  4ARZ A;  4B9O A;  1YSP A;  3OCN A;  4GCZ A;  3CI6 A;  3PBN A;  4XT2 A;  3MJQ A;  3H7W B;  3NOU C;  3SW1 A;  3CLO A;  2HV1 A;  2OAQ 1;  3K3D A;  3FPV A;  1H8M A;  3IBJ A;  3ICY A;  2IA2 A;  2VLG A;  4UEY A;  2ZMF A;  3C30 A;  1V9Y A;  3LIE A;  2MJ6 A;  3UMD A;  2B02 A;  4WLA A;  1P9R A;  3BY8 A;  4Q0H A;  1T1C A;  1NLZ A;  4I3J A;  3KYQ A;  2ZBB A;  3MR0 A;  4Y2F A;  1VHM A;  2JKR M;  4IUK A;  5HD3 A;  3ULF A;  3FG8 A;  1N9L A;  2OWJ A;  3EQU A;  1P0Z A;  3BQ8 A;  3PBO A;  2D01 A;  5HWT A;  1OTB A;  4PKY A;  2HGV A;  3PBT A;  3S7Q A;  4WEJ A;  3JVU A;  2VJW A;  2DMW A;  3NOP C;  5IS1 A;  4JGO A;  3CIT A;  4PHT A;  3D72 A;  3CUE A;  2H28 A;  4L9F A;  4OOL A;  2XA7 S;  3H7W A;  5F69 A;  3PR6 A;  2HJ9 C;  3K3C A;  1UWP X;  1N9N A;  2O9C A;  3D3O A;  4DMZ A;  3LIF A;  2EWW A;  1GSV A;  2NUT C;  3MF0 A;  2W27 A;  3UB6 A;  4ETZ A;  3E0Y A;  2GJ3 A;  4AFI A;  1TS8 A;  3F1N B;  1TS0 A;  1F98 A;  4HHD A;  2O99 A;  4HJ3 A;  3FPW A;  5DJT A;  3PBS A;  3ZYT A;  4MN5 A;  3RH8 B;  2QKP A;  3IS2 B;  4HH2 A;  4EQ1 A;  4Q0I A;  4GHI B;  4NXB A;  1YSQ A;  4WN5 A;  2PR5 A;  4FSF A;  3LR4 A;  4GS9 A;  1LSV A;  2WKQ A;  1OPX A;  2W0N A;  4IUH A;  1ZHH B;  3S7P A;  3C2W A;  4BWI A;  4HOI A;  4EER A;  4G3W A;  1XJ4 A;  1LT0 A;  5AVF A;  4NXE A;  3GEC A;  2PHY A;  4OOM A;  3B42 A;  1OJ5 A;  3GDI A;  2JHE A;  3EGD C;  5F68 A;  4KQD A;  4JGQ A;  5EFW A;  3KSI A;  3P7N A;  4WF0 A;  4BBT A;  4EEU A;  3LIC A;  3E98 A;  4L0L A;  2VA0 A;  5HWW A;  1LSW A;  1XJ3 A;  4HJ4 A;  1IOU A;  1XFQ A;  4MN6 A;  3F1N A;  2PYP A;  4O0P A;  3UE6 A;  2OOL A;  2P04 A;  1S1Y A;  2O0Y A;  2D02 A;  4L9E A;  4GHI A;  4CQH A;  4KUK A;  5TBM B;  3U2A A;  2PDR A;  3E4Q A;  3DBA A;  3S7O A;  3VV4 A;  2W3H A;  2KLI A;  1TD5 A;  3PYP A;  1VB6 A;  2JKT M;  4H6J B;  1OTD A;  1T1A A;  2W3D A;  2QJ7 A;  4NEE D;  2YKH A;  3UE3 A;  5DKK A;  3NHQ A;  1DP8 A;  2JKR I;  4HQA A;  4R6L A;  4KUO A;  4EUV A;  2OWH A;  3KYZ A;  1BYW A;  1GSW A;  4Q0J A;  5HSQ A;  2K2N A;  3A0R A;  4O8G A;  1LSX A;  4I5S A;  3T4T A;  2M1C A;  4CLC D;  1Y28 A;  5DFX A;  5KSH A;  3FC7 A;  2J3T D;  2V0U A;  3UB7 A;  4CLC E;  4YOF A;  3HJK A;  3PHY A;  1ZTU A;  5LBR A;  5HD5 A;  3KSG A;  1G28 A;  4UQI S;  5TBM A;  2W3E A;  2XA7 M;  3VE4 A;  1UWN X;  1WA9 A;  3T4K A;  3EEA A;  4H6J A;  5HPF A;  4EW7 A;  3BWL A;  1MKM A;  2K7S A;  5HZH A;  4GS9 B;  3P01 A;  3BQA A;  1P9W A;  4LRX C;  4PKY G;  2VGL S;  1IFQ A;  3LFV A;  2GNX A;  2XSS A;  2FH5 A;  3T4O A;  1LL8 A;  3MXQ A;  2Y79 A;  4F3L B;  3LI8 A;  4JGR A;  3T4Q A;  3RFB A;  4HIA A;  4WUJ A;  4EU0 A;  4KQO A;  2VKS A;  4HY8 A;  4BJP A;  4MMN A;  5MC7 A;  5A8B A;  1JNU A;  3K2N A;  2A24 B;  3LI9 A;  4HNB A;  3KO6 A;  5HL6 A;  5J3W A;  2BAS A;  4ZRR A;  1OT6 A;  5J4E A;  3LID A;  2M7U A;  1NLY A;  3CUE C;  5HWV A;  5CX7 A;  4BBU A;  1TS6 A;  3TRC A;  3A0S A;  2ZOI A;  2L4R A;  3ZQ5 A;  3MQO A;  4HP9 A;  1H3Q A;  3MFX A;  2G7U A;  2PD7 A;  3MQQ A;  4NKP A;  3KSH A;  5DF9 A;  5HDS A;  3W2Z A;  3LR5 A;  2QWS A;  2JKT I;  3LR3 A;  1XJ2 A;  4GLQ A;  2ZOH A;  2V1B A;  1OTA A;  3MMH A;  4LLO B;  1S1Z A;  3CAX A;  1W63 Q;  1ODV A;  3EOI A;  4F3L A;  2JN7 A;  3E4P A;  1MC0 A;  3OLO A;  4LPZ A;  1YAX A;  4MDZ A;  2VEA A;  2GZA A;  5TJJ A;  3OOV A;  2A24 A;  4P6Z S;  3BY9 A;  4CLC A;  4DJ2 A;  3UB9 A;  2B18 A;  3S7N A;  2QJ5 A;  1OTI A;  1MZU A;  2KDK A;  2M7V A;  2Z6C A;  4WEK A;  4GJ4 A;  1UGU A;  3H9W A;  3F1P B;  3T50 A;  3OC2 A;  3BW6 A;  5FL3 A;  1OTE A;  2PD8 A;  5F5Y A;  4II7 A;  3RTY A;  3T4J A;  4UQI M;  1GSX A;  3R7W B;  3KSF A;  4L9G A;  3H82 B;  4WEL A;  4RQ9 A;  2XRN A;  2VV8 A;  3VOL A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...