4G3WA

Crystal structure of a. aeolicus nlh1 gaf domain in an inactive state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
137
Chain Sequence
NLETTVPYIFRLLKKLMGFERLTLTIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQEPEFLNKVWKRKKKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator nlh1
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 26
structure length 137
sequence length 139
ec nomenclature
pdb deposition date 2012-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3wA00
4DMZA 4EUVA 3KSHA 4Y3IA 1TF1A 2OOLA 2W3FA 3S7OA 3NHQA 5HSQA 3MF0A 4LRYC 4YOFA 2W1RA 4RQ9A 4EU0A 4IUKA 3KSFA 4ETXA 2W3HA 3OBFA 3S7PA 2O9BA 3RFBA 2XSSA 3KO6A 3ZQ5A 2LB9A 2LB5A 3G6OA 4DN0A 1YKDA 4G3VA 3VV4A 2M7VA 4O01A 2K2NA 5K5BA 2GX5A 2Y79A 4QPRA 5L8MA 2W3GA 5DFYA 2B18A 3E98A 4ZRRA 1YSQA 2M7UA 4G3KA 4GLQA 4IUHA 4R70A 4ETZA 4Q0JA 3BJNA 4GW9A 4O0PA 2VJWA 3HCYA 1STZA 5HL6A 3NOTC 3W2ZA 2O0YA 3C2WA 2O9AA 3KSIA 5DFXA 4LRZE 4MMNA 4Y5FA 4MN7A 1YSPA 3LFVA 2QYBA 2XRNA 4Z1WA 2VKSA 2O9CA 3NOUC 3NOPC 3MQ0A 2VZWA 3CITA 4IJGA 2W1TA 2K31A 2HGVA 4Q0HA 1MKMA 3IBJA 1MC0A 4FOFA 5HPIA 2IA2A 2O99A 5LBRA 4O8GA 3K2NA 2G7UA 3CI6A 3IBRA 1TD5A 3MMHA 1F5MA 5C5KA 4LRXC 4YNRA 2XROA 3DBAA 1ZTUA 2KLIA 3TRCA 5I5LA 5TJJA 3KSGA 3O5YA 4G3WA 3S7QA 5AJGA 4MCWA 4E04A 1VHMA 2VEAA 2W3EA 3E0YA 4ME4A 3EEAA 4R6LA 3OOVA 5HPFA 3D3OA 4BWIA 4Y2FA 2W1TB 2KOIA 2W3DA 2Y8HA 2ZMFA 4MDZA 4PAUA 4CQHA 3S7NA 4Q0IA 3R4KA
chains in the Genus database with same CATH superfamily
4CJNA 3B47A 4UQIS 3UE3A 1N9LA 1LSWA 3KSFA 2EWVA 1PIOA 1FILA 2WKQA 1I2SA 1HD8A 3T4KA 4WEJA 2V20A 4S2OA 3G34A 4R3JA 3NJAA 1WYBA 5JYPA 1MPLA 1T1BA 1PFLA 2MJ6A 4LCMA 1PI4A 5FAOA 4PM6A 2UV0E 3G2YA 2M7UA 2ZOIA 3UB6A 1WE4A 2PD7A 1K6SA 2OAQ1 3V5MA 2JBFA 4GW9A 2Y2OA 5EV0A 3OCLA 1UWNX 3C2WA 2ZD8A 3PBOA 1S4RA 1VETB 2Y2JA 3D4FA 3RH8B 4DXBA 4GB7A 2XFTA 3E4OA 4B9OA 3NY4A 2XA7M 5AQAA 1YMXA 5CXWA 1SKFA 3IBRA 4D2OA 3MMHA 1ZHHB 3EQUA 1CEGA 3F1PB 3C8CA 3KSGA 3M2JA 1XJ4A 5AJGA 3VP3A 4S2NA 3IH9A 1K54A 3LICA 2WKRA 3U2AA 5G4ZA 3FG8A 3NI9A 1L2SA 1D06A 3PR6A 3F1NB 3S7NA 2XA7S 3R4KA 5CRFA 3KSHA 3HL9A 3H82B 3KX0X 2HP9A 5FAQA 3NIAA 1L0GA 1G6AA 1N9NA 4MNRA 3S7OA 3UPOA 4H6JA 4Y15A 4WELA 5HDSA 3FYZA 4GJ4A 1PW8A 3KO6A 5FATA 3Q81A 3DTEA 2JKTI 3PBRA 3MXRA 1KVLA 4QPRA 1IKGA 3JVVA 1P9WA 3IQAA 3R7WA 1YSQA 3VE4A 4PKYG 1EWZA 1K56D 3A0SA 4M4XA 3S4XA 4OOMA 2IWBA 1STZA 3LR5A 4S2LA 1K25A 4LPZA 5DFXA 3ITBA 4I3IA 3P09A 1GHMA 2HF6A 4X6TA 2Y2KA 4GCZA 4KZ6A 5E43A 2OLUA 1KE3A 3EOIA 1YLPA 3TE8A 3G31A 3UB9A 5HAPA 5I94A 1ZG4A 3DTMA 3CI6A 5F68A 4Y13A 1FCMA 4R3BA 1MWTA 5J7EA 2V0UA 3E4PA 1F2KA 3TOIA 2FZ0A 1CI8A 3IX4A 4CLCA 2XDMA 3O88A 2Y55A 1W79A 4DF6A 2D01A 5KSCA 3HVFA 5F82A 2ZMAA 1KE4A 3DAVA 3EQVA 4Y3IA 2W3FA 2VGJA 3UDIA 5HARA 4BD0A 3OZHA 4KZAA 3NDGA 5G18A 2BTFP 2GNXA 1CF0A 5DF8A 3IF6C 4WUJA 2EX6A 4LLOB 1CQAA 5FAPA 5GLBA 5GLDA 5F83A 2Y2NA 5A91A 3OPRA 5L2FA 1QMFA 3IHBA 5FQJA 1ACFA 2PDRA 5GLCA 2QWSA 3BQ8A 3MBZA 1AWIA 2ZL1A 4QJGA 2VJWA 2ZM8A 4OONA 3PBSA 1XA1A 3LCEA 2Q0OA 1J9MA 2PD8A 1XXMA 3N6IA 5F1GA 1O07A 1W63Q 4KZ3A 3GRJA 3HBRA 2YKHA 2ZJ9A 4WEKA 4WM9A 4WF0A 2G7UA 1KDSA 2I72A 3BFCA 2X01A 3T50A 3BLSA 3QNBA 4P6ZM 4UEYA 2OSUA 5CHUA 2EA9A 1F98A 3MR0A 2VEAA 1MBLA 3CJMA 3MXQA 4OKPA 3EEAA 5HW3A 4ZTKA 4JGPA 2W1TB 1K4EA 1LL8A 5F5YA 4BENA 4RX2A 2VKSA 3LIDA 4HH3A 3UE0A 3VSKA 2OOLA 2Y2HA 3HJKA 4BQMA 3RXXA 2G2WA 2VX8A 1XJ6A 3SZTA 4HP9A 1LL9A 4ID4A 5A93A 3SS5A 3QNCA 5FDSA 2EX8A 1UWPX 2PU2A 2XEPA 3IXGA 4JGQA 3V50A 1YKDA 2A2LA 3QP1A 3LIEA 1W8YA 1V9ZA 1EI5A 4NXFA 2K2NA 3ZDJA 3LR3A 3FWLA 2WYXA 5F69A 3T1SA 4GOGA 4HJ6A 1NJ4A 4ZRRA 3WS2A 3D9YA 4GS9B 4DRTA 4JF6A 4PM7A 1W8QA 2PRFA 3Q7VB 5IS1A 4OPRA 3ZG5A 2BG1A 3GECA 2NUTC 1JTDA 5FEFA 3HCYA 5HL6A 3C7UA 4FCFA 3Q82A 2WKHA 3Q7ZA 1KOUA 2EX2A 3LFVA 3MZFA 5EVID 5TFQA 3GV9A 5HWVA 3TW8A 1H8ZA 2QHKA 1LL5A 2B5RA 1TEMA 4HEFA 1XJ3A 2PBYA 2HJ9C 4B4XA 2JC7A 1ONGA 5FQKA 3O87A 5FI7A 1MC0A 4MBFA 5DF9A 4DDYA 1GCEA 2IA2A 1IFQA 1VB6A 3CAXA 3TRCA 3K3DA 3PAGA 2PYPA 4MEZA 3CUEC 1GSVA 1X0OA 3EEHA 4MCWA 1DY6A 3PTEA 3NULA 3PXPA 2WUQA 4K08A 2W3EA 4ZDXA 3E4QA 5HDDA 5HPFA 5E2HA 1OTAA 4Y2FA 4JXVA 1JWZA 4U0XA 2UWXA 4CLCB 4KUKA 4WN5A 1ZG6A 4KG6A 3NHQA 2JKFA 1IOUA 1TVFA 3UB5P 4A5RA 1K56A 3HLGA 2ZC6B 5FQ9A 2L1MA 3GR2A 4YWZA 1YT4A 4DXCA 4JXWA 5IT5A 1BZAA 2PU4A 4KQQA 3IT9A 2DCFA 5HDCA 4X53A 3VSLA 3T1QB 4BLMA 4K91A 3M6HA 4R3AA 3CHWP 1RGZA 4QY6A 1L0DA 2RCXA 3W2ZA 2ZL1B 2JE5A 3KSIA 2VA0A 4JXGA 5EOOA 2HDQA 1LT0A 1ES3A 5KIZA 2QYBA 2P9VB 1BUEA 1VEUA 2GDNA 3LR4A 3RJUA 1BLHA 3K2NA 3C4PA 4E6XA 4K0WA 3GTCA 2DRWA 5M19A 5IU1A 2Y4AA 4Q8IA 3NBLA 3NECA 4OQIA 2EX9A 3BRMA 3C30A 4JGOA 3LI8A 3KYZA 4GKUA 4X25A 2ZC7A 1BULA 5TGFA 5D3OA 4R38A 3BQAA 1N9BA 3ITAA 3W4OA 3T4OA 4KQDA 3ZVTA 4Z9QA 1XFQA 4EUVA 2VGLM 4L9EA 4BD1A 3G30A 4EXOA 4UAAA 4II7A 4EU0A 3BY8A 3PBNA 4EV4A 3LIAA 1Q2PA 5FDHA 5EUAA 2EFXA 4FTXA 1FR6A 1VQQA 1S67L 2LB9A 3IXHA 4OLDA 3UY6A 2ZQ8A 2EFUA 4OQ0A 5DJUA 1CK3A 5L8MA 3LY3A 3E98A 2Y2LA 4XT2A 3BECA 4G3KA 4RVAA 2Q9NA 3OC2A 4P85A 2VGLS 2C5WB 3C4OA 1NY0A 4KZ5A 3G35A 4EUZA 4OOLA 2Y91A 2XQZA 3A0RA 4MMNA 4EQ1A 4Y5FA 5L07A 1DJBA 4QY5A 5CGSA 4MBHA 2PYRA 1T19A 3HLDA 3NOPC 1NYMA 1DP6A 5TBMB 4GHIB 3IX8A 3EGDC 5HWWA 3ZGAB 4KQOA 1GA0A 4JPMA 3IF6A 2XK1A 3PYPA 4P0MA 4O8GA 2VV7A 1ONHA 2V8FA 1AXBA 3N8RA 1D7EA 4L9GA 3VFFA 3SH9A 4QB8A 4L9FA 1ALQA 5FEGA 4QWOA 4UA9A 4N92A 3ISGA 3CPTA 2WGVA 1G5UA 1ES5A 3A3IA 3LO7A 4FD8A 4HIAA 4ARZB 4R6LA 5GHXA 4BWIA 2J9PA 3WRZA 4BJPA 4OPYA 2H28A 2ZMVA 2XD1A 4HJ3A 3UMDA 2ZC5B 5CERA 5J4EA 4ETXA 4WBGA 2O9BA 3HLBA 3T12B 4GNUA 3ZQ5A 3Q1FA 2LB5A 1KVMA 2ZC4B 1F9IA 3MQQA 1OTBA 1K57C 2XFSA 2BLSA 4XUZA 4LENA 5G4YA 5KMWA 1MWRA 5EVIA 4EETB 4H8RA 2HDUA 3HUNA 1XJ2A 4ETZA 5CGXA 5FSRA 3H7WA 4IBRA 3VP4A 4LV2A 2D02A 4LV1A 3U4LP 3WWXA 2O9AA 1OPXA 3SW1A 3UO9A 2HPBA 3VMAA 1OMEA 1IKIA 4I3AA 3A3EA 1L3LA 3OPPA 3WS0A 4HESA 3DTKA 1M40A 4Q0HA 1Y54A 5HPIA 4FH2A 1DP9A 4HY8A 3PBQA 1MWUA 3SOIA 2WGWA 1VEUB 3ZG7B 4PHTA 2ZQDA 1OT6A 4G3WA 3S7QA 4ZJ1A 2OAP1 4QHCA 3IS2A 3E0YA 5CX7A 4BBTA 4FUWA 3T4TA 1FR1A 5AQ9A 5GLAA 2OLVA 5DTKA 4MDZA 1LI0A 2V9AA 1FOFA 4LRYC 2PAVP 2W1RA 1V9YA 4IUKA 1YMSA 5CHJA 4K0XA 1P97A 3AGDA 1XGJA 1OTIA 1G6OA 3IHAA 4R0QA 4HP4A 5A90A 5FL3A 4OLGA 2FH5A 3T1RA 2CC1A 2P7JA 2W3GA 3NDEA 1W7FA 4R1GA 1ESUA 4GLQA 3CUEA 3O86A 1E25A 2A24A 1XPBA 4O0PA 4N9KA 4S2KA 2HP5A 4U3TA 1PYYA 3RXWA 3EWKA 2JN7A 5HD3A 4UA7A 4WMCD 4AFIA 2Y2QA 4MN7A 3BFGA 1YSPA 4DE0A 3KYEA 1G28A 1MWSA 4E3JA 3NOUC 3TG9A 1XX2A 3MQ0A 5CTMA 4IVKA 4NXBA 3CLOA 1CI9A 3PAEA 4B88A 2WKPA 3WS5A 1PW1A 4GD6A 3UB7A 4FOFA 1M6KA 5AQ7A 1S0WA 2L4RA 5EM0A 3WRTA 4LRXC 2XROA 5I5LA 3IWIA 5TJJA 1BTLA 4NXGA 1YPRA 3GMWA 3ZG0A 1WA9A 2ZBBA 2ACGA 4KUOA 4XXRA 5HX9A 4N9LA 3C7VA 1Y4OA 3F1OA 2JCHA 5HZHA 2YKFA 3IXBA 3SH7A 3LEQA 3IX3A 5FASA 5AQBA 1DJCA 1JWVA 1N4OA 5CEDA 4EBPA 1TF1A 5EVIC 5FQQA 1DP8A 4C75A 4KENB 3A3JA 2JKRM 3UPPA 1RGYA 4O7DA 2R9WA 2V2FF 3UMEA 1DRMA 3L9KA 2KX6A 4XUXA 4G3VA 2JHEA 2Y79A 3OCNA 2WKEA 4Y0UA 1P0ZA 4X68A 3C38A 3UPNA 3NC8A 2QJ7A 3V67A 4P6ZS 4DJ3A 2BASA 4H6JB 2FFFB 1NLYA 4N1XA 4IVIA 3H7WB 1WYCA 2Y2IA 1SDNA 3BY9A 1O7EA 1PWGA 1FSWA 3BFEA 4WL9A 4L0LA 3T4JA 3FPVA 3LUQA 1K38A 2J9OA 4X55A 2VZWA 2M1CA 4IJGA 2ZQ7A 1BSGA 2X71A 4HH2A 1Z09A 3OPLA 4X56A 4OP8A 3R7WB 4WZ5A 1ERMA 5LBRA 1OT9A 4LCLA 2QMIA 4OPQA 5C5KA 2Z2LB 2C6WB 4ZBEA 2Z6CA 1J3WA 5EECA 1K55C 2A3UA 2RL3A 2QJ5A 2Y2PA 2XGNA 2V8CA 5DTSA 4E04A 4KZ8A 4NEED 5AVEA 4B93A 3M2KA 3SS4A 1PZOA 4PAUA 4P6BA 4I39A 3LYXA 3BFFA 1FSYA 2OWHA 4YOFA 4X69A 4RQ9A 3FKVA 2XR0A 3TJZC 4HNBA 1LHYA 3S7PA 3TSGA 3GVBA 5HAIA 1TS6A 4EESA 1TDGA 1VETA 1IYSA 3B33A 4ESPA 5K5BA 2GX5A 3E2KA 4MN6A 3WS4A 1QMEA 2J8YA 2DNSA 1KDWA 4HBUA 1XFNA 1JNUA 4JGRA 2P08A 1OTEA 1HLUP 1SKOA 1H0MA 3BFDA 1FIKA 3F1PA 3BLMA 4JLFA 4WZ4A 1S6RA 1S1YA 2QPNA 3C5AA 4DE2A 3UNWA 2B95A 3MZEA 2ZOHA 3F1NA 1LSXA 3O3VA 3H82A 1TS7A 1HTZA 1ESIA 1ZTUA 1K57A 3A3FA 1PNEA 2X02A 3UB8A 2EXBA 5L10A 5CEBA 4KZBA 1D1JA 4WYYA 4CLCD 3LGOA 4OP5A 3B3XA 1W5DA 3GQZA 4I5SA 2INWA 1L0FA 3D3OA 3BYDA 1CEFA 1EW0A 1Q2QA 3MFXA 3F1OB 5EVLA 4I38A 4EBLA 3P7NA 2V1ZA 4CQHA 2V1BA 5DKKA 5F1FA 5IHVA 1CJFA 1YLWA 4CPKA 2K7SA 2XH9A 1U60A 3MXSA 3UE1A 3WS1A 3H9WA 4I3JA 3I7JA 4KG5A 4B4ZA 1BYWA 2E8JA 2R78A 4WMCA 1XA7A 5EE8A 5HAQA 1T18A 1UGUA 4BL3A 4Y0OA 3G4PA 4Q0JA 4OPZA 1H5XA 3OPHA 4WZ5C 3CZDA 2H10A 3N7WA 3FKWA 3NOTC 2W27A 4UQIM 2O0YA 4LRZE 4MBKA 3MJQA 3MS6A 5EPHA 2GJ3A 2J80A 2OWJA 4Z1WA 1C3BA 5AVFA 2WKIA 3DTIA 3AGEA 4ZJ3A 2B02A 4OVDA 1E3UD 3L7HA 1T1CA 2ZM0A 1F5MA 4JF5A 4PM5A 3DBAA 4BBUA 2WGIA 3ICYA 1DJAA 5JYOA 1VHMA 2XD5A 4E3OA 1YLYA 3QP5A 4F3LA 3MFDA 2KDKA 2PBDP 4N1HA 5GHYA 1E4DA 3LY4A 3QP2A 4Q0IA 4EERA 2ZLYA 4Y17A 4S2MA 2H0TA 1RP5A 1XKZA 1S4SA 3BM6A 5DF7A 3D72A 3ZG8B 4YFMA 3VFHA 4E3LA 3G2ZA 1LI9A 4R4RA 2M7VA 5FI6A 4OOYA 5DTTA 2NUPC 5CECA 3UN7A 3PBTA 5CHMA 4HJ4A 1T1AA 4DJ2A 4IUHA 2Z6DA 4R70A 3DWZA 2HDSA 1RCJA 1H8MA 2IWDA 2IWCA 5DKLA 1NLZA 1NXYA 2HV1A 1TS8A 1SKOB 5A92A 1IYQA 2JKRI 4KG2A 1I5QA 3PHYA 5E2FA 3IF5A 3E2LA 2W1TA 1S66L 5L09A 3IBJA 2A49A 4QD4A 4CLCE 1KGFA 1ODVA 1YM1A 4D60A 2KLIA 5BOHA 4E6WA 3MQOA 1K0KA 5M18A 4OH0A 4HBTA 4S2JA 3LR0A 1OJ5A 4KZ7A 1NZOA 3ZHHA 4EEPA 5J3WA 3V3RA 3LI9A 1JVJA 2PHYA 4X1LA 4GS9A 1PI5A 5E2GA 4YINA 2Y2GA 3Q7VA 3W4QA 5HSQA 2QKPA 3MF0A 3RTYA 2VLGA 4S2PA 4MN5A 2WZZA 4HQAA 4LV3A 3UDFA 1FQGA 1IYOA 2XSSA 3BWLA 3QP8A 3IH8A 2JKGA 5DJTA 4F94A 1PWDA 2WAEA 3CWFA 1YAXA 4KZ9A 1JWPA 4DDSA 1MZUA 1JTGA 1LLBA 4EBNA 2B18A 1K55A 3V3SA 1KGGA 3LEZA 2ZC3B 4R23A 5A8BA 4NKPA 3KYQA 3T4SA 3JVUA 3IWQA 1FCNA 3A3DA 3QP6A 2Y59A 3MKFA 2XRNA 4EWFA 1BLCA 4IHQA 5DVAA 1SZVA 3MSHA 1YLJA 2E8IA 5HL1A 3CITA 3GDIA 3EGXC 2K31A 3W8KA 1MKMA 4X1MA 4XT2B 3ZNYA 1BLSA 5GHZA 3SH8A 3N4IA 4DE3A 3S22A 3JYIA 3BEBA 1PWCA 3O5YA 4KZ4A 1Y28A 2HP6A 3N8SA 3HREA 4NETA 1TS0A 3JPUA 1MKIA 4GDBA 3SS3A 4Y0TA 2HZ5A 3VE3A 3ZNTA 4F3LB 1VM1A 4BBVA 3IF6B 5KSHA 1OJGA 4E3IA 2P04A 1A0KA 4RX3A 4FH4A 4PMAA 1IELA 4JKTA 4FSFA 4UA6A 1IEMA 3OBFA 1TDLA 3LIBA 4PPRA 4KQRA 3CPTB 3VOYA 1P9RA 5HFOA 2ZQ9A 2P9VA 2OV5A 3G32A 3CMZA 4S2NC 5HD5A 5TR7A 3VOZA 4U0TA 1K54C 3CG5A 5KZHA 1NRFA 3W4PA 2WK0A 1K4FA 1E3UA 2GZAA 4GD8A 1S1ZA 4ZJ2A 1HZOA 3MKEA 3T1XA 2V0WA 2QZ6A 4HI4A 1H3QA 5FQMA 2H5SA 5EVIB 4UHUA 4JBFA 5FQIA 5EOEA 4EW7A 2HDRA 1TD5A 4WLAA 1MY8A 2JKTM 3VP2A 4IBXA 3ZG9B 4OQHA 3HLWA 3ZFZA 5F6AA 3OOVA 1GSWA 1OTDA 1GA9A 3BW6A 2PR5A 2Y8HA 4HHDA 4LGWA 1G68A 1YLTA 4E3KA 1L0EA 1H8YA 1NYYA 3HLEA 2I9VA 3A0VA 2HJEA 2WGWB 4LFUA 2WZXA 4MLLA 4RYEA 1ES2A 3T4QA 2W3HA 2VGKA 2P74A 3RFBA 1SCWA 3G6OA 4DN0A 3P01A 4O01A 2XLNA 3IS2B 5M1AA 5TBMA 2EXAA 3T4LA 2Z2MB 2EWWA 4GHIA 4PKYA 4C6YA 5EM1A 2V1AA 4IEDA 1BLPA 5FA7A 3ZCZA 3UE6A 2AVXA 3B42A 3BJNA 2XF3A 4CLCC 1GHPA 2R9XA 3VOLA 2J3TC 4OQGA 4LV0A 1ZKJA 2FFYA 5EFWA 3HJIA 4GN2A 1LSVA 5HWTA 2O9CA 5CGWA 4ARZA 3ZVWA 3DW0A 2Q9MA 3ULFA 3HUMA 4QU3A 4HOIA 1EROA 2WAFA 1ZC2A 1GSXA 2HGVA 2W0NA 4S2IA 2VV6A 5MC7A 1KGEA 3IWOA 2A24B 3VP1A 1XGIA 4EEUA 3FZCA 3IXDA 1IYPA 2ZQCA 1YLZA 3V39A 4JF4A 4R4SA 3NCKA 4E3MA 1SHVA 4PM9A 4ME4A 4NXEA 4RA7A 3P98A 1NRJA 1PZPA 5CTNA 4ZAMA 5FI2A 1BT5A 2J7VA 1PRQA 4DMZA 3QHYA 1YQSA 3S1YA 3HUOA 3OLOA 1NWZA 3VP0A 4GDNA 2PT7A 1ERQA 3N8LA 2J3TD 2ZM2A 3VV4A 1N9OA 4BMWA 2Y2MA 5DFYA 3UDXA 2VV8A 4PM8A 3FV7A 2CMNA 1MXOA 4Y7PA 1GHIA 3MZDA 3LIFA 3M6BA 2VK3A 4GZBA 3HLFA 2L0WA 3DWKA 2G2UA 4JXSA 3FC7A 5E2EA 4C3QA 1W63M 3FPWA 2J3WA 3Q07A 5GL9A 2O99A 4BL2A 4NG2A 2WADA 2ZQAA 1I2WA 4DE1A 1HVBA 5U47A 1FCOA 4YNRA 4EQIA 2PR6A 3GSGA 4DKIA 1KE0A 4NK3A 3AGFA 5EVEA 1NZUA 3QP4A 4P87A 1SDEA 1Z6FA 4E3NA 3ZYTA 1K6RA 5J8XA 1XP4A 1ES4A 3HLCA 3K3CA 2DMWA 2KOIA 4M3KA 2W3DA 2ZMFA 2H0YA
chains in the Genus database with same CATH topology
3B47A 4KUKA 4WN5A 1TF1A 4UQIS 1DP8A 5HSQA 2QKPA 3NHQA 3MF0A 3UE3A 1N9LA 3RTYA 1LSWA 2VLGA 3KSFA 2JKRM 2EWVA 4MN5A 1IOUA 4HQAA 3UMEA 1DRMA 2XSSA 3BWLA 2KX6A 2L1MA 2WKQA 5DJTA 3T4KA 4YWZA 4G3VA 4WEJA 5IT5A 3CWFA 1YAXA 2JHEA 1MZUA 3NJAA 2Y79A 3OCNA 1T1BA 2MJ6A 5HDCA 1P0ZA 2B18A 3C38A 2M7UA 2QJ7A 2ZOIA 3V67A 3UB6A 2PD7A 2OAQ1 4P6ZS 4R3AA 4DJ3A 4GW9A 3OCLA 2BASA 4H6JB 1UWNX 1NLYA 3W2ZA 5A8BA 4NKPA 3C2WA 3KSIA 3H7WB 3KYQA 3T4SA 2VA0A 3JVUA 3PBOA 1LT0A 3BY9A 5KIZA 1S4RA 2QYBA 2XRNA 4WL9A 4L0LA 3T4JA 3FPVA 4IHQA 3LUQA 3RH8B 2VZWA 2M1CA 3CITA 3E4OA 3GDIA 4IJGA 3EGXC 2K31A 4B9OA 4HH2A 1MKMA 4XT2B 3R7WB 2XA7M 5LBRA 3LR4A 1OT9A 3K2NA 3IBRA 3MMHA 5C5KA 1ZHHB 2Z6CA 3EQUA 5IU1A 3F1PB 3C8CA 2QJ5A 3KSGA 1XJ4A 3O5YA 3C30A 4JGOA 1Y28A 3LI8A 5AJGA 4E04A 3KYZA 1TS0A 4NEED 3LICA 4R38A 5AVEA 3BQAA 4B93A 2WKRA 3T4OA 3U2AA 5G4ZA 3VE3A 4KQDA 3FG8A 1D06A 3PR6A 3F1NB 4PAUA 3S7NA 4F3LB 2XA7S 3R4KA 1XFQA 4I39A 4EUVA 3KSHA 4BBVA 3H82B 3LYXA 3KX0X 2VGLM 4L9EA 5KSHA 1OJGA 1N9NA 3S7OA 2P04A 2OWHA 4H6JA 4EXOA 4YOFA 4WELA 4II7A 4RQ9A 4EU0A 3BY8A 3PBNA 3LIAA 4FSFA 3TJZC 5HDSA 4HNBA 3OBFA 3S7PA 4GJ4A 3LIBA 1S67L 3KO6A 2LB9A 1TS6A 4EESA 2JKTI 3PBRA 3B33A 5K5BA 5DJUA 2GX5A 4QPRA 5L8MA 4MN6A 3JVVA 1P9WA 1P9RA 3E98A 4XT2A 3R7WA 1YSQA 4G3KA 5HD5A 3VE4A 3OC2A 4PKYG 1XFNA 2VGLS 3A0SA 4M4XA 4OOMA 1JNUA 4JGRA 2P08A 1OTEA 1STZA 3LR5A 2GZAA 1S1ZA 4OOLA 3F1PA 4LPZA 5DFXA 3A0RA 4MMNA 4EQ1A 1S1YA 4I3IA 4Y5FA 2V0WA 4HI4A 2HF6A 2PYRA 1T19A 3NOPC 5TBMB 1DP6A 4GCZA 4GHIB 1H3QA 3EGDC 5HWWA 4KQOA 2ZOHA 3F1NA 3EOIA 3TE8A 1LSXA 3UB9A 3H82A 3PYPA 4O8GA 1TS7A 4EW7A 2VV7A 3CI6A 1D7EA 4L9GA 1TD5A 4WLAA 1ZTUA 5F68A 2JKTM 4L9FA 3UB8A 5J7EA 2V0UA 3E4PA 4CLCD 5F6AA 4HIAA 2FZ0A 4ARZB 4CLCA 4I5SA 2INWA 4R6LA 3OOVA 3D3OA 1GSWA 3MFXA 1EW0A 4BWIA 1OTDA 3F1OB 4I38A 3BW6A 2D01A 2PR5A 2Y8HA 3P7NA 4CQHA 4BJPA 4HHDA 2V1BA 5DKKA 3EQVA 4Y3IA 2H28A 2W3FA 2ZMVA 4HJ3A 3UMDA 2I9VA 3A0VA 2HJEA 4ETXA 5J4EA 2K7SA 3T4QA 2W3HA 2GNXA 2O9BA 4WUJA 3RFBA 3ZQ5A 4LLOB 2LB5A 3G6OA 4DN0A 1F9IA 3H9WA 3MQQA 4I3JA 1OTBA 3P01A 4O01A 3IS2B 5TBMA 3T4LA 2EWWA 4GHIA 4PKYA 1BYWA 2R78A 1T18A 1UGUA 5G4YA 2V1AA 4EETB 2PDRA 2QWSA 3BQ8A 1XJ2A 4ETZA 4Q0JA 3UE6A 3B42A 3BJNA 3H7WA 4CLCC 3VOLA 2VJWA 2J3TC 2D02A 3NOTC 2W27A 4UQIM 2O0YA 2O9AA 4LRZE 5EFWA 1OPXA 3HJIA 3SW1A 3MJQA 1LSVA 3PBSA 2GJ3A 2J80A 2OWJA 4Z1WA 4I3AA 5AVFA 5HWTA 2O9CA 2PD8A 4ARZA 2B02A 3ULFA 4HOIA 1W63Q 1GSXA 2HGVA 4Q0HA 2W0NA 5HPIA 2VV6A 2YKHA 5MC7A 4WEKA 1DP9A 1T1CA 4HY8A 4WF0A 2G7UA 3PBQA 1F5MA 2A24B 3DBAA 3T50A 4P6ZM 4UEYA 4EEUA 4PHTA 4BBUA 1OT6A 4G3WA 3S7QA 2EA9A 3ICYA 1VHMA 1F98A 2OAP1 3MR0A 2VEAA 3IS2A 3MXQA 3E0YA 4ME4A 5CX7A 4BBTA 3T4TA 4F3LA 3EEAA 4NXEA 2KDKA 1NRJA 4JGPA 2W1TB 1LL8A 5F5YA 4MDZA 4Q0IA 3LIDA 2VKSA 4DMZA 4HH3A 4EERA 2OOLA 3HJKA 3OLOA 1NWZA 2V9AA 2VX8A 4LRYC 1XJ6A 2PT7A 2W1RA 4HP9A 1V9YA 4IUKA 1S4SA 3D72A 1P97A 1UWPX 4JGQA 1YKDA 2A2LA 2J3TD 3LIEA 1OTIA 1V9ZA 1G6OA 3VV4A 4HP4A 4NXFA 2M7VA 5FL3A 2K2NA 2FH5A 1N9OA 3LR3A 2P7JA 5F69A 2NUPC 2W3GA 4HJ6A 4BMWA 5DFYA 2VV8A 4ZRRA 3PBTA 4GS9B 4HJ4A 1T1AA 2CMNA 4GLQA 4DJ2A 4IUHA 2Z6DA 3CUEA 4R70A 5IS1A 3GECA 2A24A 2NUTC 4O0PA 3HCYA 3LIFA 5HL6A 1H8MA 3EWKA 2JN7A 5HD3A 5DKLA 1NLZA 4AFIA 2HV1A 1TS8A 4MN7A 2L0WA 1YSPA 1KOUA 3LFVA 5HWVA 2JKRI 3TW8A 2QHKA 1G28A 3PHYA 3NOUC 3MQ0A 3FC7A 1XJ3A 4NXBA 3CLOA 2HJ9C 1W63M 2W1TA 3FPWA 2WKPA 1S66L 2J3WA 3UB7A 1MC0A 3IBJA 4FOFA 5DF9A 2IA2A 2O99A 1IFQA 1VB6A 4CLCE 2L4RA 1ODVA 3CAXA 4LRXC 4YNRA 2XROA 2KLIA 3TRCA 3MQOA 3K3DA 5I5LA 2PR6A 5TJJA 4NXGA 2PYPA 1WA9A 3CUEC 1GSVA 1X0OA 3EEHA 2ZBBA 3LR0A 1OJ5A 4KUOA 4MCWA 3PXPA 4K08A 3F1OA 2W3EA 3ZYTA 4EEPA 5HZHA 5J3WA 3E4QA 2YKFA 3LI9A 5HDDA 2PHYA 5HPFA 3K3CA 1OTAA 4GS9A 2DMWA 2KOIA 4Y2FA 2W3DA 2ZMFA 4CLCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMZ A;  4EUV A;  3KSH A;  4Y3I A;  1TF1 A;  2OOL A;  2W3F A;  3S7O A;  3NHQ A;  5HSQ A;  3MF0 A;  4LRY C;  4YOF A;  2W1R A;  4RQ9 A;  4EU0 A;  4IUK A;  3KSF A;  4ETX A;  2W3H A;  3OBF A;  3S7P A;  2O9B A;  3RFB A;  2XSS A;  3KO6 A;  3ZQ5 A;  2LB9 A;  2LB5 A;  3G6O A;  4DN0 A;  1YKD A;  4G3V A;  3VV4 A;  2M7V A;  4O01 A;  2K2N A;  5K5B A;  2GX5 A;  2Y79 A;  4QPR A;  5L8M A;  2W3G A;  5DFY A;  2B18 A;  3E98 A;  4ZRR A;  1YSQ A;  2M7U A;  4G3K A;  4GLQ A;  4IUH A;  4R70 A;  4ETZ A;  4Q0J A;  3BJN A;  4GW9 A;  4O0P A;  2VJW A;  3HCY A;  1STZ A;  5HL6 A;  3NOT C;  3W2Z A;  2O0Y A;  3C2W A;  2O9A A;  3KSI A;  5DFX A;  4LRZ E;  4MMN A;  4Y5F A;  4MN7 A;  1YSP A;  3LFV A;  2QYB A;  2XRN A;  4Z1W A;  2VKS A;  2O9C A;  3NOU C;  3NOP C;  3MQ0 A;  2VZW A;  3CIT A;  4IJG A;  2W1T A;  2K31 A;  2HGV A;  4Q0H A;  1MKM A;  3IBJ A;  1MC0 A;  4FOF A;  5HPI A;  2IA2 A;  2O99 A;  5LBR A;  4O8G A;  3K2N A;  2G7U A;  3CI6 A;  3IBR A;  1TD5 A;  3MMH A;  1F5M A;  5C5K A;  4LRX C;  4YNR A;  2XRO A;  3DBA A;  1ZTU A;  2KLI A;  3TRC A;  5I5L A;  5TJJ A;  3KSG A;  3O5Y A;  4G3W A;  3S7Q A;  5AJG A;  4MCW A;  4E04 A;  1VHM A;  2VEA A;  2W3E A;  3E0Y A;  4ME4 A;  3EEA A;  4R6L A;  3OOV A;  5HPF A;  3D3O A;  4BWI A;  4Y2F A;  2W1T B;  2KOI A;  2W3D A;  2Y8H A;  2ZMF A;  4MDZ A;  4PAU A;  4CQH A;  3S7N A;  4Q0I A;  3R4K A; 
#chains in the Genus database with same CATH topology
 4CJN A;  3B47 A;  4UQI S;  3UE3 A;  1N9L A;  1LSW A;  3KSF A;  2EWV A;  1PIO A;  1FIL A;  2WKQ A;  1I2S A;  1HD8 A;  3T4K A;  4WEJ A;  2V20 A;  4S2O A;  3G34 A;  4R3J A;  3NJA A;  1WYB A;  5JYP A;  1MPL A;  1T1B A;  1PFL A;  2MJ6 A;  4LCM A;  1PI4 A;  5FAO A;  4PM6 A;  2UV0 E;  3G2Y A;  2M7U A;  2ZOI A;  3UB6 A;  1WE4 A;  2PD7 A;  1K6S A;  2OAQ 1;  3V5M A;  2JBF A;  4GW9 A;  2Y2O A;  5EV0 A;  3OCL A;  1UWN X;  3C2W A;  2ZD8 A;  3PBO A;  1S4R A;  1VET B;  2Y2J A;  3D4F A;  3RH8 B;  4DXB A;  4GB7 A;  2XFT A;  3E4O A;  4B9O A;  3NY4 A;  2XA7 M;  5AQA A;  1YMX A;  5CXW A;  1SKF A;  3IBR A;  4D2O A;  3MMH A;  1ZHH B;  3EQU A;  1CEG A;  3F1P B;  3C8C A;  3KSG A;  3M2J A;  1XJ4 A;  5AJG A;  3VP3 A;  4S2N A;  3IH9 A;  1K54 A;  3LIC A;  2WKR A;  3U2A A;  5G4Z A;  3FG8 A;  3NI9 A;  1L2S A;  1D06 A;  3PR6 A;  3F1N B;  3S7N A;  2XA7 S;  3R4K A;  5CRF A;  3KSH A;  3HL9 A;  3H82 B;  3KX0 X;  2HP9 A;  5FAQ A;  3NIA A;  1L0G A;  1G6A A;  1N9N A;  4MNR A;  3S7O A;  3UPO A;  4H6J A;  4Y15 A;  4WEL A;  5HDS A;  3FYZ A;  4GJ4 A;  1PW8 A;  3KO6 A;  5FAT A;  3Q81 A;  3DTE A;  2JKT I;  3PBR A;  3MXR A;  1KVL A;  4QPR A;  1IKG A;  3JVV A;  1P9W A;  3IQA A;  3R7W A;  1YSQ A;  3VE4 A;  4PKY G;  1EWZ A;  1K56 D;  3A0S A;  4M4X A;  3S4X A;  4OOM A;  2IWB A;  1STZ A;  3LR5 A;  4S2L A;  1K25 A;  4LPZ A;  5DFX A;  3ITB A;  4I3I A;  3P09 A;  1GHM A;  2HF6 A;  4X6T A;  2Y2K A;  4GCZ A;  4KZ6 A;  5E43 A;  2OLU A;  1KE3 A;  3EOI A;  1YLP A;  3TE8 A;  3G31 A;  3UB9 A;  5HAP A;  5I94 A;  1ZG4 A;  3DTM A;  3CI6 A;  5F68 A;  4Y13 A;  1FCM A;  4R3B A;  1MWT A;  5J7E A;  2V0U A;  3E4P A;  1F2K A;  3TOI A;  2FZ0 A;  1CI8 A;  3IX4 A;  4CLC A;  2XDM A;  3O88 A;  2Y55 A;  1W79 A;  4DF6 A;  2D01 A;  5KSC A;  3HVF A;  5F82 A;  2ZMA A;  1KE4 A;  3DAV A;  3EQV A;  4Y3I A;  2W3F A;  2VGJ A;  3UDI A;  5HAR A;  4BD0 A;  3OZH A;  4KZA A;  3NDG A;  5G18 A;  2BTF P;  2GNX A;  1CF0 A;  5DF8 A;  3IF6 C;  4WUJ A;  2EX6 A;  4LLO B;  1CQA A;  5FAP A;  5GLB A;  5GLD A;  5F83 A;  2Y2N A;  5A91 A;  3OPR A;  5L2F A;  1QMF A;  3IHB A;  5FQJ A;  1ACF A;  2PDR A;  5GLC A;  2QWS A;  3BQ8 A;  3MBZ A;  1AWI A;  2ZL1 A;  4QJG A;  2VJW A;  2ZM8 A;  4OON A;  3PBS A;  1XA1 A;  3LCE A;  2Q0O A;  1J9M A;  2PD8 A;  1XXM A;  3N6I A;  5F1G A;  1O07 A;  1W63 Q;  4KZ3 A;  3GRJ A;  3HBR A;  2YKH A;  2ZJ9 A;  4WEK A;  4WM9 A;  4WF0 A;  2G7U A;  1KDS A;  2I72 A;  3BFC A;  2X01 A;  3T50 A;  3BLS A;  3QNB A;  4P6Z M;  4UEY A;  2OSU A;  5CHU A;  2EA9 A;  1F98 A;  3MR0 A;  2VEA A;  1MBL A;  3CJM A;  3MXQ A;  4OKP A;  3EEA A;  5HW3 A;  4ZTK A;  4JGP A;  2W1T B;  1K4E A;  1LL8 A;  5F5Y A;  4BEN A;  4RX2 A;  2VKS A;  3LID A;  4HH3 A;  3UE0 A;  3VSK A;  2OOL A;  2Y2H A;  3HJK A;  4BQM A;  3RXX A;  2G2W A;  2VX8 A;  1XJ6 A;  3SZT A;  4HP9 A;  1LL9 A;  4ID4 A;  5A93 A;  3SS5 A;  3QNC A;  5FDS A;  2EX8 A;  1UWP X;  2PU2 A;  2XEP A;  3IXG A;  4JGQ A;  3V50 A;  1YKD A;  2A2L A;  3QP1 A;  3LIE A;  1W8Y A;  1V9Z A;  1EI5 A;  4NXF A;  2K2N A;  3ZDJ A;  3LR3 A;  3FWL A;  2WYX A;  5F69 A;  3T1S A;  4GOG A;  4HJ6 A;  1NJ4 A;  4ZRR A;  3WS2 A;  3D9Y A;  4GS9 B;  4DRT A;  4JF6 A;  4PM7 A;  1W8Q A;  2PRF A;  3Q7V B;  5IS1 A;  4OPR A;  3ZG5 A;  2BG1 A;  3GEC A;  2NUT C;  1JTD A;  5FEF A;  3HCY A;  5HL6 A;  3C7U A;  4FCF A;  3Q82 A;  2WKH A;  3Q7Z A;  1KOU A;  2EX2 A;  3LFV A;  3MZF A;  5EVI D;  5TFQ A;  3GV9 A;  5HWV A;  3TW8 A;  1H8Z A;  2QHK A;  1LL5 A;  2B5R A;  1TEM A;  4HEF A;  1XJ3 A;  2PBY A;  2HJ9 C;  4B4X A;  2JC7 A;  1ONG A;  5FQK A;  3O87 A;  5FI7 A;  1MC0 A;  4MBF A;  5DF9 A;  4DDY A;  1GCE A;  2IA2 A;  1IFQ A;  1VB6 A;  3CAX A;  3TRC A;  3K3D A;  3PAG A;  2PYP A;  4MEZ A;  3CUE C;  1GSV A;  1X0O A;  3EEH A;  4MCW A;  1DY6 A;  3PTE A;  3NUL A;  3PXP A;  2WUQ A;  4K08 A;  2W3E A;  4ZDX A;  3E4Q A;  5HDD A;  5HPF A;  5E2H A;  1OTA A;  4Y2F A;  4JXV A;  1JWZ A;  4U0X A;  2UWX A;  4CLC B;  4KUK A;  4WN5 A;  1ZG6 A;  4KG6 A;  3NHQ A;  2JKF A;  1IOU A;  1TVF A;  3UB5 P;  4A5R A;  1K56 A;  3HLG A;  2ZC6 B;  5FQ9 A;  2L1M A;  3GR2 A;  4YWZ A;  1YT4 A;  4DXC A;  4JXW A;  5IT5 A;  1BZA A;  2PU4 A;  4KQQ A;  3IT9 A;  2DCF A;  5HDC A;  4X53 A;  3VSL A;  3T1Q B;  4BLM A;  4K91 A;  3M6H A;  4R3A A;  3CHW P;  1RGZ A;  4QY6 A;  1L0D A;  2RCX A;  3W2Z A;  2ZL1 B;  2JE5 A;  3KSI A;  2VA0 A;  4JXG A;  5EOO A;  2HDQ A;  1LT0 A;  1ES3 A;  5KIZ A;  2QYB A;  2P9V B;  1BUE A;  1VEU A;  2GDN A;  3LR4 A;  3RJU A;  1BLH A;  3K2N A;  3C4P A;  4E6X A;  4K0W A;  3GTC A;  2DRW A;  5M19 A;  5IU1 A;  2Y4A A;  4Q8I A;  3NBL A;  3NEC A;  4OQI A;  2EX9 A;  3BRM A;  3C30 A;  4JGO A;  3LI8 A;  3KYZ A;  4GKU A;  4X25 A;  2ZC7 A;  1BUL A;  5TGF A;  5D3O A;  4R38 A;  3BQA A;  1N9B A;  3ITA A;  3W4O A;  3T4O A;  4KQD A;  3ZVT A;  4Z9Q A;  1XFQ A;  4EUV A;  2VGL M;  4L9E A;  4BD1 A;  3G30 A;  4EXO A;  4UAA A;  4II7 A;  4EU0 A;  3BY8 A;  3PBN A;  4EV4 A;  3LIA A;  1Q2P A;  5FDH A;  5EUA A;  2EFX A;  4FTX A;  1FR6 A;  1VQQ A;  1S67 L;  2LB9 A;  3IXH A;  4OLD A;  3UY6 A;  2ZQ8 A;  2EFU A;  4OQ0 A;  5DJU A;  1CK3 A;  5L8M A;  3LY3 A;  3E98 A;  2Y2L A;  4XT2 A;  3BEC A;  4G3K A;  4RVA A;  2Q9N A;  3OC2 A;  4P85 A;  2VGL S;  2C5W B;  3C4O A;  1NY0 A;  4KZ5 A;  3G35 A;  4EUZ A;  4OOL A;  2Y91 A;  2XQZ A;  3A0R A;  4MMN A;  4EQ1 A;  4Y5F A;  5L07 A;  1DJB A;  4QY5 A;  5CGS A;  4MBH A;  2PYR A;  1T19 A;  3HLD A;  3NOP C;  1NYM A;  1DP6 A;  5TBM B;  4GHI B;  3IX8 A;  3EGD C;  5HWW A;  3ZGA B;  4KQO A;  1GA0 A;  4JPM A;  3IF6 A;  2XK1 A;  3PYP A;  4P0M A;  4O8G A;  2VV7 A;  1ONH A;  2V8F A;  1AXB A;  3N8R A;  1D7E A;  4L9G A;  3VFF A;  3SH9 A;  4QB8 A;  4L9F A;  1ALQ A;  5FEG A;  4QWO A;  4UA9 A;  4N92 A;  3ISG A;  3CPT A;  2WGV A;  1G5U A;  1ES5 A;  3A3I A;  3LO7 A;  4FD8 A;  4HIA A;  4ARZ B;  4R6L A;  5GHX A;  4BWI A;  2J9P A;  3WRZ A;  4BJP A;  4OPY A;  2H28 A;  2ZMV A;  2XD1 A;  4HJ3 A;  3UMD A;  2ZC5 B;  5CER A;  5J4E A;  4ETX A;  4WBG A;  2O9B A;  3HLB A;  3T12 B;  4GNU A;  3ZQ5 A;  3Q1F A;  2LB5 A;  1KVM A;  2ZC4 B;  1F9I A;  3MQQ A;  1OTB A;  1K57 C;  2XFS A;  2BLS A;  4XUZ A;  4LEN A;  5G4Y A;  5KMW A;  1MWR A;  5EVI A;  4EET B;  4H8R A;  2HDU A;  3HUN A;  1XJ2 A;  4ETZ A;  5CGX A;  5FSR A;  3H7W A;  4IBR A;  3VP4 A;  4LV2 A;  2D02 A;  4LV1 A;  3U4L P;  3WWX A;  2O9A A;  1OPX A;  3SW1 A;  3UO9 A;  2HPB A;  3VMA A;  1OME A;  1IKI A;  4I3A A;  3A3E A;  1L3L A;  3OPP A;  3WS0 A;  4HES A;  3DTK A;  1M40 A;  4Q0H A;  1Y54 A;  5HPI A;  4FH2 A;  1DP9 A;  4HY8 A;  3PBQ A;  1MWU A;  3SOI A;  2WGW A;  1VEU B;  3ZG7 B;  4PHT A;  2ZQD A;  1OT6 A;  4G3W A;  3S7Q A;  4ZJ1 A;  2OAP 1;  4QHC A;  3IS2 A;  3E0Y A;  5CX7 A;  4BBT A;  4FUW A;  3T4T A;  1FR1 A;  5AQ9 A;  5GLA A;  2OLV A;  5DTK A;  4MDZ A;  1LI0 A;  2V9A A;  1FOF A;  4LRY C;  2PAV P;  2W1R A;  1V9Y A;  4IUK A;  1YMS A;  5CHJ A;  4K0X A;  1P97 A;  3AGD A;  1XGJ A;  1OTI A;  1G6O A;  3IHA A;  4R0Q A;  4HP4 A;  5A90 A;  5FL3 A;  4OLG A;  2FH5 A;  3T1R A;  2CC1 A;  2P7J A;  2W3G A;  3NDE A;  1W7F A;  4R1G A;  1ESU A;  4GLQ A;  3CUE A;  3O86 A;  1E25 A;  2A24 A;  1XPB A;  4O0P A;  4N9K A;  4S2K A;  2HP5 A;  4U3T A;  1PYY A;  3RXW A;  3EWK A;  2JN7 A;  5HD3 A;  4UA7 A;  4WMC D;  4AFI A;  2Y2Q A;  4MN7 A;  3BFG A;  1YSP A;  4DE0 A;  3KYE A;  1G28 A;  1MWS A;  4E3J A;  3NOU C;  3TG9 A;  1XX2 A;  3MQ0 A;  5CTM A;  4IVK A;  4NXB A;  3CLO A;  1CI9 A;  3PAE A;  4B88 A;  2WKP A;  3WS5 A;  1PW1 A;  4GD6 A;  3UB7 A;  4FOF A;  1M6K A;  5AQ7 A;  1S0W A;  2L4R A;  5EM0 A;  3WRT A;  4LRX C;  2XRO A;  5I5L A;  3IWI A;  5TJJ A;  1BTL A;  4NXG A;  1YPR A;  3GMW A;  3ZG0 A;  1WA9 A;  2ZBB A;  2ACG A;  4KUO A;  4XXR A;  5HX9 A;  4N9L A;  3C7V A;  1Y4O A;  3F1O A;  2JCH A;  5HZH A;  2YKF A;  3IXB A;  3SH7 A;  3LEQ A;  3IX3 A;  5FAS A;  5AQB A;  1DJC A;  1JWV A;  1N4O A;  5CED A;  4EBP A;  1TF1 A;  5EVI C;  5FQQ A;  1DP8 A;  4C75 A;  4KEN B;  3A3J A;  2JKR M;  3UPP A;  1RGY A;  4O7D A;  2R9W A;  2V2F F;  3UME A;  1DRM A;  3L9K A;  2KX6 A;  4XUX A;  4G3V A;  2JHE A;  2Y79 A;  3OCN A;  2WKE A;  4Y0U A;  1P0Z A;  4X68 A;  3C38 A;  3UPN A;  3NC8 A;  2QJ7 A;  3V67 A;  4P6Z S;  4DJ3 A;  2BAS A;  4H6J B;  2FFF B;  1NLY A;  4N1X A;  4IVI A;  3H7W B;  1WYC A;  2Y2I A;  1SDN A;  3BY9 A;  1O7E A;  1PWG A;  1FSW A;  3BFE A;  4WL9 A;  4L0L A;  3T4J A;  3FPV A;  3LUQ A;  1K38 A;  2J9O A;  4X55 A;  2VZW A;  2M1C A;  4IJG A;  2ZQ7 A;  1BSG A;  2X71 A;  4HH2 A;  1Z09 A;  3OPL A;  4X56 A;  4OP8 A;  3R7W B;  4WZ5 A;  1ERM A;  5LBR A;  1OT9 A;  4LCL A;  2QMI A;  4OPQ A;  5C5K A;  2Z2L B;  2C6W B;  4ZBE A;  2Z6C A;  1J3W A;  5EEC A;  1K55 C;  2A3U A;  2RL3 A;  2QJ5 A;  2Y2P A;  2XGN A;  2V8C A;  5DTS A;  4E04 A;  4KZ8 A;  4NEE D;  5AVE A;  4B93 A;  3M2K A;  3SS4 A;  1PZO A;  4PAU A;  4P6B A;  4I39 A;  3LYX A;  3BFF A;  1FSY A;  2OWH A;  4YOF A;  4X69 A;  4RQ9 A;  3FKV A;  2XR0 A;  3TJZ C;  4HNB A;  1LHY A;  3S7P A;  3TSG A;  3GVB A;  5HAI A;  1TS6 A;  4EES A;  1TDG A;  1VET A;  1IYS A;  3B33 A;  4ESP A;  5K5B A;  2GX5 A;  3E2K A;  4MN6 A;  3WS4 A;  1QME A;  2J8Y A;  2DNS A;  1KDW A;  4HBU A;  1XFN A;  1JNU A;  4JGR A;  2P08 A;  1OTE A;  1HLU P;  1SKO A;  1H0M A;  3BFD A;  1FIK A;  3F1P A;  3BLM A;  4JLF A;  4WZ4 A;  1S6R A;  1S1Y A;  2QPN A;  3C5A A;  4DE2 A;  3UNW A;  2B95 A;  3MZE A;  2ZOH A;  3F1N A;  1LSX A;  3O3V A;  3H82 A;  1TS7 A;  1HTZ A;  1ESI A;  1ZTU A;  1K57 A;  3A3F A;  1PNE A;  2X02 A;  3UB8 A;  2EXB A;  5L10 A;  5CEB A;  4KZB A;  1D1J A;  4WYY A;  4CLC D;  3LGO A;  4OP5 A;  3B3X A;  1W5D A;  3GQZ A;  4I5S A;  2INW A;  1L0F A;  3D3O A;  3BYD A;  1CEF A;  1EW0 A;  1Q2Q A;  3MFX A;  3F1O B;  5EVL A;  4I38 A;  4EBL A;  3P7N A;  2V1Z A;  4CQH A;  2V1B A;  5DKK A;  5F1F A;  5IHV A;  1CJF A;  1YLW A;  4CPK A;  2K7S A;  2XH9 A;  1U60 A;  3MXS A;  3UE1 A;  3WS1 A;  3H9W A;  4I3J A;  3I7J A;  4KG5 A;  4B4Z A;  1BYW A;  2E8J A;  2R78 A;  4WMC A;  1XA7 A;  5EE8 A;  5HAQ A;  1T18 A;  1UGU A;  4BL3 A;  4Y0O A;  3G4P A;  4Q0J A;  4OPZ A;  1H5X A;  3OPH A;  4WZ5 C;  3CZD A;  2H10 A;  3N7W A;  3FKW A;  3NOT C;  2W27 A;  4UQI M;  2O0Y A;  4LRZ E;  4MBK A;  3MJQ A;  3MS6 A;  5EPH A;  2GJ3 A;  2J80 A;  2OWJ A;  4Z1W A;  1C3B A;  5AVF A;  2WKI A;  3DTI A;  3AGE A;  4ZJ3 A;  2B02 A;  4OVD A;  1E3U D;  3L7H A;  1T1C A;  2ZM0 A;  1F5M A;  4JF5 A;  4PM5 A;  3DBA A;  4BBU A;  2WGI A;  3ICY A;  1DJA A;  5JYO A;  1VHM A;  2XD5 A;  4E3O A;  1YLY A;  3QP5 A;  4F3L A;  3MFD A;  2KDK A;  2PBD P;  4N1H A;  5GHY A;  1E4D A;  3LY4 A;  3QP2 A;  4Q0I A;  4EER A;  2ZLY A;  4Y17 A;  4S2M A;  2H0T A;  1RP5 A;  1XKZ A;  1S4S A;  3BM6 A;  5DF7 A;  3D72 A;  3ZG8 B;  4YFM A;  3VFH A;  4E3L A;  3G2Z A;  1LI9 A;  4R4R A;  2M7V A;  5FI6 A;  4OOY A;  5DTT A;  2NUP C;  5CEC A;  3UN7 A;  3PBT A;  5CHM A;  4HJ4 A;  1T1A A;  4DJ2 A;  4IUH A;  2Z6D A;  4R70 A;  3DWZ A;  2HDS A;  1RCJ A;  1H8M A;  2IWD A;  2IWC A;  5DKL A;  1NLZ A;  1NXY A;  2HV1 A;  1TS8 A;  1SKO B;  5A92 A;  1IYQ A;  2JKR I;  4KG2 A;  1I5Q A;  3PHY A;  5E2F A;  3IF5 A;  3E2L A;  2W1T A;  1S66 L;  5L09 A;  3IBJ A;  2A49 A;  4QD4 A;  4CLC E;  1KGF A;  1ODV A;  1YM1 A;  4D60 A;  2KLI A;  5BOH A;  4E6W A;  3MQO A;  1K0K A;  5M18 A;  4OH0 A;  4HBT A;  4S2J A;  3LR0 A;  1OJ5 A;  4KZ7 A;  1NZO A;  3ZHH A;  4EEP A;  5J3W A;  3V3R A;  3LI9 A;  1JVJ A;  2PHY A;  4X1L A;  4GS9 A;  1PI5 A;  5E2G A;  4YIN A;  2Y2G A;  3Q7V A;  3W4Q A;  5HSQ A;  2QKP A;  3MF0 A;  3RTY A;  2VLG A;  4S2P A;  4MN5 A;  2WZZ A;  4HQA A;  4LV3 A;  3UDF A;  1FQG A;  1IYO A;  2XSS A;  3BWL A;  3QP8 A;  3IH8 A;  2JKG A;  5DJT A;  4F94 A;  1PWD A;  2WAE A;  3CWF A;  1YAX A;  4KZ9 A;  1JWP A;  4DDS A;  1MZU A;  1JTG A;  1LLB A;  4EBN A;  2B18 A;  1K55 A;  3V3S A;  1KGG A;  3LEZ A;  2ZC3 B;  4R23 A;  5A8B A;  4NKP A;  3KYQ A;  3T4S A;  3JVU A;  3IWQ A;  1FCN A;  3A3D A;  3QP6 A;  2Y59 A;  3MKF A;  2XRN A;  4EWF A;  1BLC A;  4IHQ A;  5DVA A;  1SZV A;  3MSH A;  1YLJ A;  2E8I A;  5HL1 A;  3CIT A;  3GDI A;  3EGX C;  2K31 A;  3W8K A;  1MKM A;  4X1M A;  4XT2 B;  3ZNY A;  1BLS A;  5GHZ A;  3SH8 A;  3N4I A;  4DE3 A;  3S22 A;  3JYI A;  3BEB A;  1PWC A;  3O5Y A;  4KZ4 A;  1Y28 A;  2HP6 A;  3N8S A;  3HRE A;  4NET A;  1TS0 A;  3JPU A;  1MKI A;  4GDB A;  3SS3 A;  4Y0T A;  2HZ5 A;  3VE3 A;  3ZNT A;  4F3L B;  1VM1 A;  4BBV A;  3IF6 B;  5KSH A;  1OJG A;  4E3I A;  2P04 A;  1A0K A;  4RX3 A;  4FH4 A;  4PMA A;  1IEL A;  4JKT A;  4FSF A;  4UA6 A;  1IEM A;  3OBF A;  1TDL A;  3LIB A;  4PPR A;  4KQR A;  3CPT B;  3VOY A;  1P9R A;  5HFO A;  2ZQ9 A;  2P9V A;  2OV5 A;  3G32 A;  3CMZ A;  4S2N C;  5HD5 A;  5TR7 A;  3VOZ A;  4U0T A;  1K54 C;  3CG5 A;  5KZH A;  1NRF A;  3W4P A;  2WK0 A;  1K4F A;  1E3U A;  2GZA A;  4GD8 A;  1S1Z A;  4ZJ2 A;  1HZO A;  3MKE A;  3T1X A;  2V0W A;  2QZ6 A;  4HI4 A;  1H3Q A;  5FQM A;  2H5S A;  5EVI B;  4UHU A;  4JBF A;  5FQI A;  5EOE A;  4EW7 A;  2HDR A;  1TD5 A;  4WLA A;  1MY8 A;  2JKT M;  3VP2 A;  4IBX A;  3ZG9 B;  4OQH A;  3HLW A;  3ZFZ A;  5F6A A;  3OOV A;  1GSW A;  1OTD A;  1GA9 A;  3BW6 A;  2PR5 A;  2Y8H A;  4HHD A;  4LGW A;  1G68 A;  1YLT A;  4E3K A;  1L0E A;  1H8Y A;  1NYY A;  3HLE A;  2I9V A;  3A0V A;  2HJE A;  2WGW B;  4LFU A;  2WZX A;  4MLL A;  4RYE A;  1ES2 A;  3T4Q A;  2W3H A;  2VGK A;  2P74 A;  3RFB A;  1SCW A;  3G6O A;  4DN0 A;  3P01 A;  4O01 A;  2XLN A;  3IS2 B;  5M1A A;  5TBM A;  2EXA A;  3T4L A;  2Z2M B;  2EWW A;  4GHI A;  4PKY A;  4C6Y A;  5EM1 A;  2V1A A;  4IED A;  1BLP A;  5FA7 A;  3ZCZ A;  3UE6 A;  2AVX A;  3B42 A;  3BJN A;  2XF3 A;  4CLC C;  1GHP A;  2R9X A;  3VOL A;  2J3T C;  4OQG A;  4LV0 A;  1ZKJ A;  2FFY A;  5EFW A;  3HJI A;  4GN2 A;  1LSV A;  5HWT A;  2O9C A;  5CGW A;  4ARZ A;  3ZVW A;  3DW0 A;  2Q9M A;  3ULF A;  3HUM A;  4QU3 A;  4HOI A;  1ERO A;  2WAF A;  1ZC2 A;  1GSX A;  2HGV A;  2W0N A;  4S2I A;  2VV6 A;  5MC7 A;  1KGE A;  3IWO A;  2A24 B;  3VP1 A;  1XGI A;  4EEU A;  3FZC A;  3IXD A;  1IYP A;  2ZQC A;  1YLZ A;  3V39 A;  4JF4 A;  4R4S A;  3NCK A;  4E3M A;  1SHV A;  4PM9 A;  4ME4 A;  4NXE A;  4RA7 A;  3P98 A;  1NRJ A;  1PZP A;  5CTN A;  4ZAM A;  5FI2 A;  1BT5 A;  2J7V A;  1PRQ A;  4DMZ A;  3QHY A;  1YQS A;  3S1Y A;  3HUO A;  3OLO A;  1NWZ A;  3VP0 A;  4GDN A;  2PT7 A;  1ERQ A;  3N8L A;  2J3T D;  2ZM2 A;  3VV4 A;  1N9O A;  4BMW A;  2Y2M A;  5DFY A;  3UDX A;  2VV8 A;  4PM8 A;  3FV7 A;  2CMN A;  1MXO A;  4Y7P A;  1GHI A;  3MZD A;  3LIF A;  3M6B A;  2VK3 A;  4GZB A;  3HLF A;  2L0W A;  3DWK A;  2G2U A;  4JXS A;  3FC7 A;  5E2E A;  4C3Q A;  1W63 M;  3FPW A;  2J3W A;  3Q07 A;  5GL9 A;  2O99 A;  4BL2 A;  4NG2 A;  2WAD A;  2ZQA A;  1I2W A;  4DE1 A;  1HVB A;  5U47 A;  1FCO A;  4YNR A;  4EQI A;  2PR6 A;  3GSG A;  4DKI A;  1KE0 A;  4NK3 A;  3AGF A;  5EVE A;  1NZU A;  3QP4 A;  4P87 A;  1SDE A;  1Z6F A;  4E3N A;  3ZYT A;  1K6R A;  5J8X A;  1XP4 A;  1ES4 A;  3HLC A;  3K3C A;  2DMW A;  2KOI A;  4M3K A;  2W3D A;  2ZMF A;  2H0Y A; 
#chains in the Genus database with same CATH homology
 3B47 A;  4KUK A;  4WN5 A;  1TF1 A;  4UQI S;  1DP8 A;  5HSQ A;  2QKP A;  3NHQ A;  3MF0 A;  3UE3 A;  1N9L A;  3RTY A;  1LSW A;  2VLG A;  3KSF A;  2JKR M;  2EWV A;  4MN5 A;  1IOU A;  4HQA A;  3UME A;  1DRM A;  2XSS A;  3BWL A;  2KX6 A;  2L1M A;  2WKQ A;  5DJT A;  3T4K A;  4YWZ A;  4G3V A;  4WEJ A;  5IT5 A;  3CWF A;  1YAX A;  2JHE A;  1MZU A;  3NJA A;  2Y79 A;  3OCN A;  1T1B A;  2MJ6 A;  5HDC A;  1P0Z A;  2B18 A;  3C38 A;  2M7U A;  2QJ7 A;  2ZOI A;  3V67 A;  3UB6 A;  2PD7 A;  2OAQ 1;  4P6Z S;  4R3A A;  4DJ3 A;  4GW9 A;  3OCL A;  2BAS A;  4H6J B;  1UWN X;  1NLY A;  3W2Z A;  5A8B A;  4NKP A;  3C2W A;  3KSI A;  3H7W B;  3KYQ A;  3T4S A;  2VA0 A;  3JVU A;  3PBO A;  1LT0 A;  3BY9 A;  5KIZ A;  1S4R A;  2QYB A;  2XRN A;  4WL9 A;  4L0L A;  3T4J A;  3FPV A;  4IHQ A;  3LUQ A;  3RH8 B;  2VZW A;  2M1C A;  3CIT A;  3E4O A;  3GDI A;  4IJG A;  3EGX C;  2K31 A;  4B9O A;  4HH2 A;  1MKM A;  4XT2 B;  3R7W B;  2XA7 M;  5LBR A;  3LR4 A;  1OT9 A;  3K2N A;  3IBR A;  3MMH A;  5C5K A;  1ZHH B;  2Z6C A;  3EQU A;  5IU1 A;  3F1P B;  3C8C A;  2QJ5 A;  3KSG A;  1XJ4 A;  3O5Y A;  3C30 A;  4JGO A;  1Y28 A;  3LI8 A;  5AJG A;  4E04 A;  3KYZ A;  1TS0 A;  4NEE D;  3LIC A;  4R38 A;  5AVE A;  3BQA A;  4B93 A;  2WKR A;  3T4O A;  3U2A A;  5G4Z A;  3VE3 A;  4KQD A;  3FG8 A;  1D06 A;  3PR6 A;  3F1N B;  4PAU A;  3S7N A;  4F3L B;  2XA7 S;  3R4K A;  1XFQ A;  4I39 A;  4EUV A;  3KSH A;  4BBV A;  3H82 B;  3LYX A;  3KX0 X;  2VGL M;  4L9E A;  5KSH A;  1OJG A;  1N9N A;  3S7O A;  2P04 A;  2OWH A;  4H6J A;  4EXO A;  4YOF A;  4WEL A;  4II7 A;  4RQ9 A;  4EU0 A;  3BY8 A;  3PBN A;  3LIA A;  4FSF A;  3TJZ C;  5HDS A;  4HNB A;  3OBF A;  3S7P A;  4GJ4 A;  3LIB A;  1S67 L;  3KO6 A;  2LB9 A;  1TS6 A;  4EES A;  2JKT I;  3PBR A;  3B33 A;  5K5B A;  5DJU A;  2GX5 A;  4QPR A;  5L8M A;  4MN6 A;  3JVV A;  1P9W A;  1P9R A;  3E98 A;  4XT2 A;  3R7W A;  1YSQ A;  4G3K A;  5HD5 A;  3VE4 A;  3OC2 A;  4PKY G;  1XFN A;  2VGL S;  3A0S A;  4M4X A;  4OOM A;  1JNU A;  4JGR A;  2P08 A;  1OTE A;  1STZ A;  3LR5 A;  2GZA A;  1S1Z A;  4OOL A;  3F1P A;  4LPZ A;  5DFX A;  3A0R A;  4MMN A;  4EQ1 A;  1S1Y A;  4I3I A;  4Y5F A;  2V0W A;  4HI4 A;  2HF6 A;  2PYR A;  1T19 A;  3NOP C;  5TBM B;  1DP6 A;  4GCZ A;  4GHI B;  1H3Q A;  3EGD C;  5HWW A;  4KQO A;  2ZOH A;  3F1N A;  3EOI A;  3TE8 A;  1LSX A;  3UB9 A;  3H82 A;  3PYP A;  4O8G A;  1TS7 A;  4EW7 A;  2VV7 A;  3CI6 A;  1D7E A;  4L9G A;  1TD5 A;  4WLA A;  1ZTU A;  5F68 A;  2JKT M;  4L9F A;  3UB8 A;  5J7E A;  2V0U A;  3E4P A;  4CLC D;  5F6A A;  4HIA A;  2FZ0 A;  4ARZ B;  4CLC A;  4I5S A;  2INW A;  4R6L A;  3OOV A;  3D3O A;  1GSW A;  3MFX A;  1EW0 A;  4BWI A;  1OTD A;  3F1O B;  4I38 A;  3BW6 A;  2D01 A;  2PR5 A;  2Y8H A;  3P7N A;  4CQH A;  4BJP A;  4HHD A;  2V1B A;  5DKK A;  3EQV A;  4Y3I A;  2H28 A;  2W3F A;  2ZMV A;  4HJ3 A;  3UMD A;  2I9V A;  3A0V A;  2HJE A;  4ETX A;  5J4E A;  2K7S A;  3T4Q A;  2W3H A;  2GNX A;  2O9B A;  4WUJ A;  3RFB A;  3ZQ5 A;  4LLO B;  2LB5 A;  3G6O A;  4DN0 A;  1F9I A;  3H9W A;  3MQQ A;  4I3J A;  1OTB A;  3P01 A;  4O01 A;  3IS2 B;  5TBM A;  3T4L A;  2EWW A;  4GHI A;  4PKY A;  1BYW A;  2R78 A;  1T18 A;  1UGU A;  5G4Y A;  2V1A A;  4EET B;  2PDR A;  2QWS A;  3BQ8 A;  1XJ2 A;  4ETZ A;  4Q0J A;  3UE6 A;  3B42 A;  3BJN A;  3H7W A;  4CLC C;  3VOL A;  2VJW A;  2J3T C;  2D02 A;  3NOT C;  2W27 A;  4UQI M;  2O0Y A;  2O9A A;  4LRZ E;  5EFW A;  1OPX A;  3HJI A;  3SW1 A;  3MJQ A;  1LSV A;  3PBS A;  2GJ3 A;  2J80 A;  2OWJ A;  4Z1W A;  4I3A A;  5AVF A;  5HWT A;  2O9C A;  2PD8 A;  4ARZ A;  2B02 A;  3ULF A;  4HOI A;  1W63 Q;  1GSX A;  2HGV A;  4Q0H A;  2W0N A;  5HPI A;  2VV6 A;  2YKH A;  5MC7 A;  4WEK A;  1DP9 A;  1T1C A;  4HY8 A;  4WF0 A;  2G7U A;  3PBQ A;  1F5M A;  2A24 B;  3DBA A;  3T50 A;  4P6Z M;  4UEY A;  4EEU A;  4PHT A;  4BBU A;  1OT6 A;  4G3W A;  3S7Q A;  2EA9 A;  3ICY A;  1VHM A;  1F98 A;  2OAP 1;  3MR0 A;  2VEA A;  3IS2 A;  3MXQ A;  3E0Y A;  4ME4 A;  5CX7 A;  4BBT A;  3T4T A;  4F3L A;  3EEA A;  4NXE A;  2KDK A;  1NRJ A;  4JGP A;  2W1T B;  1LL8 A;  5F5Y A;  4MDZ A;  4Q0I A;  3LID A;  2VKS A;  4DMZ A;  4HH3 A;  4EER A;  2OOL A;  3HJK A;  3OLO A;  1NWZ A;  2V9A A;  2VX8 A;  4LRY C;  1XJ6 A;  2PT7 A;  2W1R A;  4HP9 A;  1V9Y A;  4IUK A;  1S4S A;  3D72 A;  1P97 A;  1UWP X;  4JGQ A;  1YKD A;  2A2L A;  2J3T D;  3LIE A;  1OTI A;  1V9Z A;  1G6O A;  3VV4 A;  4HP4 A;  4NXF A;  2M7V A;  5FL3 A;  2K2N A;  2FH5 A;  1N9O A;  3LR3 A;  2P7J A;  5F69 A;  2NUP C;  2W3G A;  4HJ6 A;  4BMW A;  5DFY A;  2VV8 A;  4ZRR A;  3PBT A;  4GS9 B;  4HJ4 A;  1T1A A;  2CMN A;  4GLQ A;  4DJ2 A;  4IUH A;  2Z6D A;  3CUE A;  4R70 A;  5IS1 A;  3GEC A;  2A24 A;  2NUT C;  4O0P A;  3HCY A;  3LIF A;  5HL6 A;  1H8M A;  3EWK A;  2JN7 A;  5HD3 A;  5DKL A;  1NLZ A;  4AFI A;  2HV1 A;  1TS8 A;  4MN7 A;  2L0W A;  1YSP A;  1KOU A;  3LFV A;  5HWV A;  2JKR I;  3TW8 A;  2QHK A;  1G28 A;  3PHY A;  3NOU C;  3MQ0 A;  3FC7 A;  1XJ3 A;  4NXB A;  3CLO A;  2HJ9 C;  1W63 M;  2W1T A;  3FPW A;  2WKP A;  1S66 L;  2J3W A;  3UB7 A;  1MC0 A;  3IBJ A;  4FOF A;  5DF9 A;  2IA2 A;  2O99 A;  1IFQ A;  1VB6 A;  4CLC E;  2L4R A;  1ODV A;  3CAX A;  4LRX C;  4YNR A;  2XRO A;  2KLI A;  3TRC A;  3MQO A;  3K3D A;  5I5L A;  2PR6 A;  5TJJ A;  4NXG A;  2PYP A;  1WA9 A;  3CUE C;  1GSV A;  1X0O A;  3EEH A;  2ZBB A;  3LR0 A;  1OJ5 A;  4KUO A;  4MCW A;  3PXP A;  4K08 A;  3F1O A;  2W3E A;  3ZYT A;  4EEP A;  5HZH A;  5J3W A;  3E4Q A;  2YKF A;  3LI9 A;  5HDD A;  2PHY A;  5HPF A;  3K3C A;  1OTA A;  4GS9 A;  2DMW A;  2KOI A;  4Y2F A;  2W3D A;  2ZMF A;  4CLC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...