1T1CA

Late intermediate il3 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1cA00
3EEHA 1S4RA 1XJ6A 2VV6A 3UB6A 1EW0A 4M4XA 4LLOB 2K7SA 4EXOA 3E4QA 4EEPA 2L1MA 1S1YA 4PKYA 4R70A 4GHIB 3A0SA 4KUOA 4H6JA 2V1AA 2M1CA 3NHQA 3GECA 2J80A 2QJ7A 4NXBA 2A24A 3H82B 4HP9A 3LIEA 4I3JA 4EEUA 2PR6A 3LIAA 3C8CA 1P97A 5F68A 3MJQA 1XJ3A 4E04A 3VE4A 3H7WB 4LRXC 2WKRA 4L9GA 4DJ2A 3FG8A 3K3CA 2VEAA 1X0OA 3UMEA 1ODVA 4GHIA 1T1AA 2L4RA 4JGQA 2EA9A 1XFQA 4HNBA 2D01A 2JHEA 1D06A 4HJ6A 2KX6A 5F5YA 3P7NA 2R78A 2P7JA 1TS8A 4EESA 1NWZA 3H7WA 1GSXA 4I3IA 3E4OA 3IBRA 3MR0A 4HIAA 1N9OA 1OTDA 2ZOIA 1V9YA 2KDKA 5AVEA 5HWVA 4WF0A 3PHYA 4LPZA 3LIDA 2PDRA 1MZUA 2VLGA 3SW1A 3LIFA 4XT2B 2INWA 4B9OA 3MFXA 1JNUA 1LSWA 5IU1A 3CAXA 3VE3A 4EQ1A 1OTIA 5TBMA 1WA9A 5DKLA 4HJ4A 1S4SA 4PKYG 3NJAA 3CLOA 3OLOA 5J3WA 1D7EA 1S66L 4HY8A 3A0RA 2OWJA 3UE6A 3LYXA 3UB7A 1TS0A 2PYRA 1OTBA 4L9EA 3B33A 5IS1A 4KQDA 4I38A 2W27A 5HWTA 4NXEA 4YWZA 3F1OB 3LUQA 3MXQA 2ZBBA 3BWLA 2QHKA 2YKHA 2QJ5A 2V0UA 4HQAA 4WL9A 3RH8B 3K3DA 4JGRA 2OOLA 4F3LB 3MQQA 3HJIA 4JGPA 3IS2B 4NXFA 4R6LA 1KOUA 1F9IA 1TS7A 4I3AA 2VV7A 4BBVA 1T1CA 1XJ4A 4JGOA 2CMNA 3EWKA 4BBUA 5I5LA 3F1PB 2GJ3A 1OTAA 4HI4A 4I5SA 5HD5A 5G4ZA 3H82A 1T19A 3LI8A 1G28A 2QKPA 2PD8A 5G4YA 3LIBA 1XFNA 4LRZE 4F3LA 3LICA 4RQ9A 3E4PA 1TS6A 3IS2A 1OT9A 4GW9A 3NOTC 3F1NB 3ULFA 1GSWA 1T1BA 1S1ZA 5DKKA 1DP9A 1T18A 2BASA 3PYPA 1S67L 1XJ2A 3F1PA 4DJ3A 3BY9A 3HJKA 4GCZA 3KX0X 2OWHA 2V1BA 2YKFA 2B02A 5F69A 1UWNX 3A0VA 2VV8A 2L0WA 4MN5A 2ZOHA 3D72A 1BYWA 4WLAA 5KIZA 2V0WA 2I9VA 3F1NA 1LSXA 2WKQA 1F98A 5HZHA 1UGUA 2W0NA 1OT6A 5HSQA 4XT2A 4EW7A 3UB8A 1DRMA 5AVFA 3FC7A 5J4EA 4K08A 5EFWA 4HHDA 2PHYA 3BY8A 4KUKA 3MQOA 1Y28A 5F6AA 3NOPC 3C2WA 1LL8A 1VB6A 3CWFA 3ICYA 5DJUA 2D02A 4HJ3A 5J7EA 1N9NA 4GS9B 4I39A 3G6OA 1LT0A 2PR5A 1N9LA 3F1OA 3RTYA 4HP4A 4R38A 5HDDA 4EERA 2QWSA 4HH2A 3ZQ5A 4L9FA 4BBTA 5HDSA 1GSVA 3UMDA 1OTEA 2Z6CA 2WKPA 2H28A 2V9AA 3H9WA 4WUJA 1P0ZA 2PD7A 1DP6A 4NXGA 4LRYC 5TBMB 4WN5A 4MN6A 2JN7A 5A8BA 5HD3A 3VOLA 4GS9A 1UWPX 1V9ZA 1LSVA 1OJ5A 1DP8A 4R3AA 3NOUC 3LI9A 4H6JB 1OJGA 4EETB 5DJTA 3T50A 5HWWA 2A24B 3GDIA 4HH3A 2HV1A 5HDCA 3UB9A 2Z6DA 2PYPA 4HOIA
chains in the Genus database with same CATH superfamily
3UB6A 3TG9A 1JWZA 1MC0A 4QWOA 3V50A 3E4QA 2Y91A 1YT4A 3A3DA 5FEFA 5L10A 1Q2PA 3PBRA 1K57C 1FSYA 2WGWB 2PBDP 3HLGA 4FH4A 4ESPA 1IYPA 2J80A 3W4QA 5E2GA 4BJPA 2ZM2A 3FPWA 4PHTA 1P9WA 1K56D 1TVFA 3C8CA 1P97A 4R3BA 4R3JA 5F68A 1H8MA 1XJ3A 4B4ZA 1FOFA 2GZAA 2WKRA 1DJCA 2ZMVA 4DJ2A 2A3UA 3FG8A 3BQAA 3O86A 3SZTA 3K3CA 2QYBA 1VEUA 4E3KA 5EVLA 3PXPA 2VEAA 5DTSA 4P87A 3IWQA 4CLCA 3FKVA 3VP2A 2VGLM 4MBHA 5DFXA 1VM1A 1FR6A 3E2KA 4U3TA 2JC7A 2R78A 1BLCA 1TS8A 4S2PA 4EESA 2HJ9C 4OQHA 1NWZA 3FWLA 4Q0IA 3VP1A 5KSCA 2P74A 4Y3IA 1OTDA 3HLWA 4Z1WA 3UDXA 3ZG7B 2KDKA 1GA0A 3R4KA 1RP5A 2PU2A 4QU3A 4NK3A 3IF6C 3IT9A 3LIDA 1YLYA 1QMFA 2XFSA 3LIFA 2EX6A 2H0YA 1JNUA 5HAIA 4JBFA 2J3TD 3TRCA 5DF8A 3A3IA 4FUWA 3C4OA 2AVXA 2PBYA 5FAPA 3UDFA 3D3OA 1S4SA 4KZ6A 3BRMA 3LO7A 1RGYA 1PRQA 3CLOA 4KQOA 1YLJA 1YLPA 2CC1A 4MBKA 4C6YA 1KGGA 4PPRA 3UB7A 3Q81A 2PYRA 1FIKA 1XGIA 1EWZA 3QP6A 1KDWA 1PZPA 3IXBA 3B33A 2Y2OA 4I38A 3WS2A 4NXEA 1BULA 4YWZA 4X53A 3F1OB 2H0TA 4X68A 3LUQA 3UY6A 3MXQA 1STZA 2ZBBA 3S7OA 4HQAA 1NY0A 4GD6A 3RH8B 2ZQ8A 4AFIA 2OOLA 3TE8A 1YM1A 4NG2A 4IUHA 1HTZA 4FTXA 3OBFA 4FD8A 1MKIA 3T1XA 3M6BA 3NECA 4LV2A 1HVBA 4PM7A 1G6OA 1T1CA 3GSGA 5A92A 2Y79A 5J8XA 2CMNA 3O3VA 4BBUA 5I5LA 3F1PB 1E3UA 1MWUA 5HD5A 3S1YA 5G4ZA 3H82A 3RFBA 2ZM0A 5EM0A 1TD5A 1L0DA 3HLDA 4F3LA 4KZ8A 3LICA 4RQ9A 3NC8A 1W79A 4ARZB 2JE5A 2ZQAA 3OCLA 1SKOA 4OOLA 2XDMA 1NLYA 2ZQ7A 3MZEA 1OT9A 4S2NA 5HFOA 1I2SA 1ZKJA 3IHBA 5KZHA 4Q0JA 4O7DA 3UE0A 3PBNA 2PRFA 1S1ZA 5HX9A 1IKIA 3MQ0A 5FL3A 1PIOA 1S67L 1YAXA 4DJ3A 2J9OA 3IXDA 3HJKA 4QB8A 1W5DA 4Y13A 1PI4A 3OC2A 2V1BA 2QPNA 4G3KA 2JKRM 4N9LA 2Y2LA 2UWXA 4G3WA 3A0VA 1L2SA 4BLMA 2M7UA 2BLSA 2L0WA 5EVIC 4KQQA 1SDNA 1NLZA 3W4OA 3F1NA 2VA0A 2VX8A 3MXSA 1LLBA 1A0KA 3IXGA 3QP5A 2QZ6A 3PBTA 1VEUB 5HSQA 1Z6FA 4CLCB 3IX4A 4E6XA 3UB8A 1DRMA 2OSUA 1N4OA 5AVFA 2FZ0A 4P0MA 4QY6A 1FCMA 2B18A 4S2LA 4HHDA 4GB7A 4WMCD 3T4SA 3LY3A 5HPFA 1VB6A 3BW6A 2OV5A 3N8SA 4R1GA 1DJAA 1F2KA 2GDNA 4I39A 4DDSA 2PR5A 1S6RA 4OQ0A 3OPPA 1XA7A 3V3SA 3QP1A 3S7NA 4EERA 2QWSA 3HREA 4R0QA 4KZ4A 4L9FA 3C4PA 1GSVA 5E2HA 3UB5P 3UMDA 3CPTB 4A5RA 3N7WA 2V9AA 3AGEA 1CI9A 1YSPA 3I7JA 3H9WA 4LFUA 3WS5A 5F82A 4XUZA 3T4OA 4NXGA 2IA2A 4R23A 3DW0A 3WS1A 1GHMA 3P98A 4GS9A 4KZ5A 1UWPX 2HF6A 1KE3A 1KE4A 3R7WA 3TOIA 5EVID 2EX8A 2O9CA 3NOUC 2Y2GA 4UA6A 4LGWA 4WELA 2XD1A 2HDRA 3VSLA 5HWWA 2JKTM 3QHYA 2VGKA 2HV1A 3GRJA 2EFUA 1ES3A 4JKTA 5HDCA 2Z6DA 4DXBA 2PYPA 1YLWA 1K25A 1CI8A 2O9AA 1PYYA 4LLOB 1IYSA 3GMWA 3ITAA 4UEYA 4EXOA 3IQAA 4EEPA 1VETA 2P9VB 2L1MA 3SS3A 1S1YA 4WZ5A 4GHIB 3A0SA 4KUOA 4RYEA 3UPPA 2ZLYA 1MWSA 2V1AA 1NYYA 1QMEA 1RGZA 2QJ7A 3RJUA 1K54A 2A24A 3H82B 2DCFA 3LIEA 4O01A 5M18A 4DN0A 5F1GA 3C30A 3LIAA 2W1TB 4LENA 4JF4A 4E04A 1F5MA 3NI9A 5DF7A 1FCNA 3H7WB 1IEMA 4LRXC 3ISGA 4L9GA 3HLCA 1EI5A 5FQ9A 4U0XA 1G68A 5IHVA 1LL9A 5TJJA 1X0OA 3UMEA 1ODVA 2WK0A 1CJFA 1NJ4A 2W3HA 1T1AA 4JF5A 5K5BA 2EA9A 5FA7A 1IOUA 1YQSA 5FQQA 4Y0TA 3KYQA 2JHEA 4O8GA 2XLNA 4E3LA 3NBLA 4GDNA 4CPKA 4HJ6A 1H8YA 2P7JA 2H10A 5FDHA 4YOFA 3ZNTA 4S2KA 3LEQA 4I3IA 2XROA 3UO9A 3V39A 3IBRA 3MR0A 4IVIA 3A3EA 1V9YA 3MBZA 5AVEA 1JTDA 5HWVA 3T1SA 2EWWA 4WF0A 3IWOA 4LCLA 4WM9A 5L07A 3PTEA 3IF5A 4E3MA 2EX9A 2W3DA 4Y7PA 4OONA 1XGJA 3VE3A 3MKFA 5F83A 1SDEA 2HPBA 5DKLA 4HJ4A 5DTKA 5M1AA 3BJNA 3MMHA 1S66L 3M2KA 2J3TC 3CUEA 1TS0A 4L0LA 2HP6A 3IXHA 1OTBA 1TDGA 4PAUA 1K6SA 3ZG8B 2XGNA 4CLCD 4OVDA 3HUMA 2W27A 4DMZA 5AQ9A 2XRNA 3BWLA 4KZBA 2Z2MB 5CXWA 2QJ5A 1J3WA 4WL9A 4B88A 2ZL1B 3FKWA 1NRJA 3G30A 4MCWA 2E8JA 2W3EA 4WYYA 3WRTA 3QNBA 4ZBEA 1NXYA 2DRWA 1O07A 5EOOA 5U47A 5A93A 4R6LA 4IJGA 5A90A 4C3QA 1F9IA 4N1HA 1TS7A 2WKHA 3M2JA 4LV1A 3ZGAB 5DF9A 4E6WA 4EBNA 4BENA 2ZQ9A 2GJ3A 1OTAA 4NEED 1H3QA 2WGVA 1G28A 1NZOA 3HUNA 4WEKA 1G5UA 4KZ3A 1EROA 1BT5A 4GLQA 3LIBA 3ZFZA 2Z2LB 4LRZE 2Y8HA 3E4PA 2HDQA 3S7PA 1K56A 4KG6A 3IS2A 3EGDC 3WS0A 3N6IA 4X1LA 3D9YA 4UHUA 3EEAA 3NOTC 3ZG9B 5E2FA 3ULFA 4S2OA 4CLCE 3PR6A 2W3GA 3FZCA 4Z9QA 1YKDA 1E25A 1XJ2A 5EVEA 3BY9A 5GL9A 4GCZA 3KX0X 3Q82A 4X1MA 4N9KA 2YKFA 2ZD8A 3NY4A 2Y2HA 2RCXA 3VP3A 4BWIA 4E3OA 5GLCA 1UWNX 4PM5A 1JWVA 4JF6A 1W7FA 2VV8A 4ME4A 2JBFA 4MN7A 5EUAA 3DTIA 5GHZA 4FOFA 1BYWA 3G34A 3GR2A 4P6BA 1ESUA 2Y2PA 2WKQA 3C7UA 2K31A 1K0KA 1F98A 3V67A 4DE2A 5HZHA 5M19A 4ZJ2A 2DMWA 3A3JA 4B4XA 4UAAA 4YNRA 2LB5A 2JKGA 5J4EA 3BFDA 3QP8A 5FI6A 5L09A 1CQAA 2PHYA 2X02A 4BD1A 3HBRA 4MLLA 5CHJA 4ZDXA 2XSSA 3MQOA 1Y28A 1K57A 5I94A 3NOPC 3C2WA 4EUZA 2XFTA 5FQIA 3B3XA 1FQGA 4JLFA 2OAQ1 5E43A 5CECA 2X01A 3MXRA 3AGDA 3UNWA 1OMEA 5J7EA 4MNRA 2HDSA 5FQKA 3ZG5A 2RL3A 3TW8A 2J3WA 5FSRA 3Q7VB 2A2LA 4G3VA 3RTYA 4UQIS 1I2WA 2FH5A 2A49A 1MY8A 5GLAA 5FQMA 3WRZA 3ZVTA 1ZHHB 1IYQA 4GJ4A 5HDSA 1OTEA 2FFYA 4YFMA 3SH7A 3IX8A 2G7UA 5DTTA 1P0ZA 3U4LP 4DE3A 2BG1A 4OP5A 4CQHA 3BFFA 1SKFA 1WE4A 3DAVA 2HZ5A 5HD3A 1NZUA 2DNSA 1U60A 2VKSA 4XXRA 5CERA 3WS4A 4CJNA 1BLHA 1DP8A 1I5QA 4KENB 1H0MA 3P09A 1H8ZA 4UA7A 3W4PA 3AGFA 1IKGA 4K0XA 5DJTA 3LR0A 1PNEA 1W63M 1WYCA 3VMAA 3OZHA 2ZMAA 2VGJA 2ZJ9A 4Y17A 2Y2NA 3IF6A 1S4RA 1XJ6A 2VV6A 3S4XA 1EW0A 4ZJ1A 2JKFA 5L8MA 3VFFA 2K7SA 3HL9A 5JYOA 3S22A 1ES2A 4JXWA 5CGWA 3HVFA 4R70A 2R9WA 4H6JA 4ZTKA 3IH8A 2GX5A 4NXBA 1HD8A 1VHMA 3BFEA 1CK3A 3LR5A 4I3JA 2PR6A 3CITA 3MJQA 1S0WA 2WGIA 3HLFA 3MF0A 5CHUA 3LFVA 3N8RA 4ZAMA 3PAEA 3KSGA 2ZMFA 4ID4A 1KVLA 4EQIA 4Y2FA 3M6HA 4NETA 2WAEA 5FAQA 3G2YA 5AQ7A 1XFQA 2WGWA 1ES5A 2D01A 4HNBA 2Y2KA 5HARA 1PW8A 1D06A 3HCYA 3G31A 4OPQA 2KX6A 4JPMA 3CMZA 5F5YA 1LHYA 5EV0A 1P9RA 4UQIM 4WMCA 2WKEA 1H5XA 4H8RA 5HAPA 4B93A 2WKIA 1NRFA 2XH9A 3E4OA 3LR3A 4KG2A 4HIAA 4OOMA 1GA9A 2H5SA 2JCHA 1CEGA 3PBOA 1NYMA 4X6TA 3PHYA 2ZC7A 3UE1A 4ZRRA 1HLUP 4LPZA 5GLDA 3SS4A 3ZYTA 2KLIA 3EQUA 2PDRA 4PM6A 5DFYA 5JYPA 3TJZC 1CF0A 3EGXC 2INWA 3O88A 3MFXA 2ZC3B 1LSWA 1Y54A 2W3FA 1PI5A 1Y4OA 3CAXA 4MMNA 3EOIA 5HPIA 2Q0OA 1OTIA 5TBMA 1WA9A 1MBLA 3IH9A 4XUXA 4DKIA 4EBPA 4RX3A 3OLOA 3E2LA 3BYDA 1YLTA 1D7EA 3BECA 1YLZA 3T4QA 5KMWA 3A0RA 2OWJA 3UE6A 3LYXA 2B95A 3VP0A 3IHAA 3D4FA 1ZG6A 5A91A 3T12B 1BUEA 2VZWA 4EWFA 4L9EA 2R9XA 5EVIA 4KQDA 5HWTA 4QJGA 2V2FF 1LL5A 5IT5A 1L0GA 3A3FA 3L7HA 2YKHA 2V0UA 4E3NA 3K2NA 2EXAA 3LY4A 5G18A 4GZBA 4JGRA 4F3LB 1ERMA 2HP9A 4JGPA 1HZOA 4CLCC 1SKOB 4NXFA 4PM9A 2X71A 4I3AA 3UE3A 1PWDA 2P08A 2VV7A 4BBVA 1JVJA 4OPRA 5F1FA 1K38A 2EFXA 1TEMA 2J7VA 2Y4AA 4Q0HA 4HI4A 4DDYA 4I5SA 1C3BA 1T19A 3LI8A 4RA7A 4GDBA 1MWTA 2QKPA 2PD8A 3PAGA 5G4YA 1SCWA 2ACGA 1XFNA 3NCKA 3CHWP 3IWIA 3C38A 3OPRA 4MDZA 1TS6A 1LI9A 2HDUA 4OPYA 2EX2A 3IF6B 4GW9A 2NUTC 3F1NB 1YPRA 1GSWA 3MZFA 1RCJA 3CG5A 2OAP1 5DKKA 3JPUA 5CHMA 1TF1A 3F1PA 3GV9A 4IVKA 3DBAA 5CX7A 4C75A 1IELA 4HESA 5FATA 3FPVA 4DF6A 2QMIA 3CJMA 4D2OA 4QY5A 2J9PA 3ZCZA 4ARZA 3SOIA 4RX2A 4IBXA 2IWCA 1YMXA 2MJ6A 4WLAA 5KIZA 2I9VA 4R4SA 1KGFA 4K91A 2GNXA 1ERQA 1UGUA 3RXWA 2W0NA 1OT6A 3G35A 3MSHA 4XT2A 1BTLA 3NDGA 4S2JA 1YMSA 3FC7A 4K08A 4Q8IA 4KZ7A 4KZ9A 2XK1A 3OPLA 1N9BA 4ZJ3A 4LV0A 3ICYA 5DJUA 4ETXA 4OOYA 5FDSA 5HW3A 1PFLA 2D02A 4HJ3A 5CEBA 5CEDA 4GS9B 4EBLA 1M6KA 2UV0E 2WZXA 1LT0A 4OPZA 3C7VA 3R7WB 2Y2QA 3FV7A 4HP4A 4R38A 2PT7A 5HDDA 2C6WB 2WUQA 3MFDA 2V1ZA 2ZC5B 2WYXA 4S2NC 4S2IA 4BBTA 3VOZA 3W8KA 2Z6CA 2WKPA 4OP8A 3UN7A 3HLBA 4E3JA 2WZZA 2XA7S 1ES4A 3G2ZA 4D60A 1DP6A 5DVAA 3SH9A 2Y2MA 4EUVA 5TBMB 3SH8A 4DE1A 4MN6A 2JN7A 5A8BA 5HAQA 3KSHA 1XPBA 5L2FA 1IFQA 1DJBA 1SHVA 3P01A 5HL1A 1VETB 1XKZA 1V9ZA 3WWXA 4R3AA 1MWRA 2Y59A 4PM8A 3BQ8A 4WEJA 3T4LA 4DXCA 3JYIA 5EVIB 1WYBA 3T50A 1ONGA 2A24B 3T4JA 2E8IA 1JTGA 3ZNYA 5EOEA 3VV4A 2O9BA 3CPTA 3DWKA 3S7QA 3UB9A 4HOIA 1FR1A 3EEHA 4ETZA 4RVAA 4M4XA 3FYZA 2ZM8A 3BLMA 5GHXA 3MZDA 3G4PA 4K0WA 2XEPA 4NKPA 1ZG4A 1E3UD 3ZHHA 4PKYA 4GKUA 3CZDA 2M1CA 3NHQA 4UA9A 3GECA 3VP4A 5CGSA 4HP9A 5CGXA 2G2WA 1CEFA 3LGOA 4U0TA 4EEUA 1BLPA 3O87A 1BLSA 3BLSA 3LCEA 4OKPA 3UDIA 4E3IA 5LBRA 1W8YA 4MBFA 3VE4A 4X56A 2O0YA 3T1RA 3EQVA 3BM6A 2B5RA 1L3LA 4QD4A 1IYOA 3T4TA 4FH2A 2P9VA 1AXBA 5HL6A 4GHIA 2L4RA 4M3KA 4JGQA 2VK3A 1PWCA 2Q9MA 2WAFA 2O99A 4S2MA 1YSQA 3QNCA 3N4IA 1ZC2A 3P7NA 2OLVA 2W1TA 5TR7A 2IWBA 1GHPA 3LEZA 3VFHA 3H7WA 1GSXA 4GD8A 2WADA 1N9OA 2ZOIA 1MPLA 4IUKA 2IWDA 2G2UA 4OLDA 5FAOA 1ALQA 5CRFA 2XQZA 2XA7M 1KE0A 4Y0UA 3KYEA 4N1XA 5TFQA 1VQQA 1ZTUA 3ITBA 1AWIA 1ONHA 2Q9NA 1MZUA 2VLGA 3GVBA 3SW1A 2I72A 4XT2B 1KGEA 3OPHA 2XR0A 4YINA 4B9OA 2P04A 4IBRA 4QPRA 5IU1A 2PAVP 3KYZA 4IHQA 4EQ1A 4WZ5C 4DRTA 2Y2IA 5AQAA 3ZDJA 3N8LA 4PKYG 3NJAA 1OPXA 2HJEA 1W8QA 5J3WA 4HBUA 4HY8A 3BEBA 1K54C 2JKRI 5GLBA 2V20A 5IS1A 1K55C 3B42A 4OH0A 5KSHA 4X55A 5CTMA 3HLEA 3QP2A 1JWPA 2QHKA 3CI6A 1FSWA 4BL2A 1KDSA 1PZOA 3K3DA 3W2ZA 4JXGA 2ZQCA 3NULA 5FASA 3MQQA 4EU0A 3HJIA 3IS2B 4BQMA 1KOUA 2ZC6B 3JVVA 2LB9A 5AQBA 2NUPC 3NDEA 3KSFA 1XJ4A 4JGOA 5EM1A 3V5MA 2K2NA 3T1QB 2XD5A 3PBSA 3EWKA 4WZ4A 1LI0A 2FFFB 5FQJA 1SZVA 4LCMA 2ZL1A 1FCOA 2XF3A 5C5KA 1MKMA 3B47A 5E2EA 4DE0A 3DTMA 5FI2A 1J9MA 5EE8A 3G32A 2BTFP 4JXVA 1XA1A 1K6RA 4LV3A 5BOHA 4X25A 1L0EA 4FCFA 2V8CA 5MC7A 1T1BA 3TSGA 3E98A 2HGVA 3DWZA 4PMAA 1DP9A 1T18A 2BASA 3PYPA 4P6ZS 1Z09A 2ZC4B 3KO6A 1D1JA 3T4KA 2OWHA 3KSIA 1K4EA 3Q7ZA 3JVUA 4Y15A 3IX3A 2B02A 2M7VA 4P85A 5F69A 3ZVWA 3CUEC 1G6AA 1PW1A 4N92A 3LR4A 3HUOA 4KG5A 1O7EA 4MN5A 5CTNA 1XXMA 2ZOHA 2KOIA 1PWGA 3D72A 4IEDA 4X69A 3RXXA 2V0WA 3GTCA 1LSXA 2JKTI 2V8FA 4QHCA 4OQGA 4F94A 4EW7A 3VSKA 4MEZA 5GHYA 1BZAA 4R4RA 1TDLA 5AJGA 4Y5FA 1Q2QA 5D3OA 4FSFA 5EFWA 4EV4A 3BY8A 4KUKA 5F6AA 3VOYA 2PU4A 2VGLS 4BL3A 5EPHA 1LL8A 3CWFA 3UPOA 1K4FA 2J8YA 4OLGA 1KVMA 1K55A 2Y55A 3IBJA 5FI7A 1N9NA 1BSGA 3NIAA 3BFGA 3G6OA 3SS5A 3DTEA 1N9LA 2EWVA 3F1OA 4KZAA 1MXOA 3PBQA 1W63Q 4GNUA 3UPNA 4HH2A 5FEGA 2VJWA 5TGFA 2C5WB 3Q07A 3ZQ5A 3DTKA 3MKEA 3QP4A 4Y0OA 1GCEA 2H28A 2Y2JA 1XX2A 3MS6A 4II7A 4WUJA 2PD7A 3OCNA 1E4DA 4HEFA 4LRYC 1ACFA 4WN5A 2OLUA 4WBGA 3E0YA 2ZQDA 3BFCA 3VOLA 4HBTA 1LSVA 1OJ5A 3Q7VA 3OOVA 4BMWA 1DY6A 4BD0A 4JXSA 4GN2A 3ZG0A 3LI9A 1M40A 4H6JB 1FILA 1OJGA 4EETB 3O5YA 5EECA 4O0PA 1ESIA 3U2AA 3V3RA 3Q1FA 3GDIA 4HH3A 2W1RA 4OQIA 1XP4A 4P6ZM 4KQRA 1GHIA 4GOGA 1L0FA 3C5AA 3L9KA 2HP5A 3GQZA 2EXBA
chains in the Genus database with same CATH topology
3EEHA 1S4RA 4ETZA 1XJ6A 2VV6A 2O9AA 3UB6A 1EW0A 5L8MA 4M4XA 4LLOB 2K7SA 1MC0A 4UEYA 4EXOA 3E4QA 4EEPA 2L1MA 4NKPA 1S1YA 3PBRA 4PKYA 4R70A 4GHIB 3A0SA 4KUOA 4H6JA 2V1AA 2M1CA 3NHQA 3GECA 2J80A 2GX5A 2QJ7A 4NXBA 4BJPA 2A24A 3H82B 4HP9A 3LIEA 4O01A 3FPWA 4PHTA 1VHMA 4DN0A 3C30A 1P9WA 3LR5A 4I3JA 4EEUA 2PR6A 3LIAA 3CITA 2W1TB 3C8CA 1P97A 5F68A 3MJQA 1H8MA 1XJ3A 5LBRA 4E04A 3VE4A 1F5MA 3MF0A 3H7WB 2O0YA 4LRXC 2GZAA 3EQVA 2WKRA 2ZMVA 4L9GA 3LFVA 4DJ2A 3FG8A 3BQAA 3T4TA 3KSGA 2ZMFA 3K3CA 2QYBA 3PXPA 2VEAA 5TJJA 4Y2FA 1X0OA 3UMEA 1ODVA 4CLCA 5HL6A 4GHIA 2VGLM 2W3HA 1T1AA 2L4RA 4JGQA 5K5BA 2EA9A 1XFQA 4HNBA 2D01A 1IOUA 5DFXA 2O99A 3KYQA 1YSQA 2JHEA 1D06A 4O8GA 3HCYA 4HJ6A 2KX6A 5F5YA 3P7NA 2R78A 2W1TA 2P7JA 1P9RA 1TS8A 4UQIM 4YOFA 4EESA 2HJ9C 1NWZA 4B93A 3H7WA 1GSXA 4I3IA 2XROA 4Q0IA 3E4OA 3IBRA 3LR3A 3MR0A 4HIAA 1N9OA 1OTDA 2ZOIA 4OOMA 4Y3IA 4IUKA 4Z1WA 3PBOA 1V9YA 2KDKA 5AVEA 5HWVA 2EWWA 4WF0A 3R4KA 2XA7M 3PHYA 1ZTUA 4ZRRA 4LPZA 3ZYTA 2KLIA 3EQUA 3LIDA 2PDRA 1MZUA 2VLGA 3SW1A 5DFYA 3LIFA 3TJZC 4XT2B 3EGXC 2INWA 4B9OA 3MFXA 2P04A 1JNUA 1LSWA 2W3DA 4QPRA 5IU1A 2J3TD 2W3FA 3TRCA 3CAXA 4MMNA 3EOIA 3VE3A 5HPIA 3KYZA 4IHQA 4EQ1A 1OTIA 5TBMA 1WA9A 5DKLA 3D3OA 4HJ4A 1S4SA 4PKYG 3NJAA 3CLOA 3BJNA 1OPXA 3OLOA 4KQOA 2HJEA 3MMHA 5J3WA 1D7EA 1S66L 4HY8A 3T4QA 3A0RA 2OWJA 3UE6A 3LYXA 2J3TC 3UB7A 2JKRI 3CUEA 1TS0A 2PYRA 4L0LA 1OTBA 4PAUA 2VZWA 4L9EA 3B33A 5IS1A 4KQDA 4CLCD 4I38A 2W27A 5HWTA 4NXEA 5IT5A 4YWZA 4DMZA 3F1OB 3B42A 5KSHA 3LUQA 3MXQA 1STZA 2XRNA 2ZBBA 3BWLA 2QHKA 2YKHA 3S7OA 2QJ5A 2V0UA 3CI6A 3K2NA 4HQAA 4WL9A 1NRJA 4MCWA 3RH8B 2W3EA 3K3DA 4AFIA 4JGRA 2OOLA 3W2ZA 4F3LB 3TE8A 3MQQA 4EU0A 3HJIA 4JGPA 4CLCC 3IS2B 4IUHA 4NXFA 4R6LA 4IJGA 1KOUA 1F9IA 1TS7A 3OBFA 4I3AA 3UE3A 2P08A 2VV7A 3JVVA 2LB9A 2NUPC 5DF9A 4BBVA 1G6OA 3KSFA 1T1CA 1XJ4A 2Y79A 4JGOA 2CMNA 2K2NA 3PBSA 3EWKA 4BBUA 5I5LA 3F1PB 2GJ3A 1OTAA 4Q0HA 4HI4A 4NEED 4I5SA 1H3QA 5HD5A 5G4ZA 3H82A 1T19A 3LI8A 1G28A 3RFBA 2QKPA 2PD8A 4WEKA 5G4YA 4GLQA 3LIBA 1XFNA 1TD5A 3C38A 5C5KA 4LRZE 2Y8HA 4F3LA 4MDZA 3LICA 4RQ9A 1MKMA 3B47A 3E4PA 3S7PA 1TS6A 4ARZB 3OCLA 3IS2A 4OOLA 3EGDC 1NLYA 1OT9A 3EEAA 4GW9A 2NUTC 3NOTC 3F1NB 5MC7A 3ULFA 1GSWA 1T1BA 4CLCE 4Q0JA 3E98A 3PR6A 3PBNA 1S1ZA 2HGVA 2OAP1 2W3GA 5DKKA 1DP9A 1T18A 3MQ0A 2BASA 3PYPA 1YKDA 5FL3A 1S67L 1YAXA 4P6ZS 1TF1A 1XJ2A 3F1PA 4DJ3A 3BY9A 3KO6A 3HJKA 3T4KA 4GCZA 5CX7A 3DBAA 2OWHA 3KSIA 3KX0X 3OC2A 2V1BA 3JVUA 2YKFA 3FPVA 2B02A 4G3KA 2JKRM 4BWIA 2M7VA 5F69A 1UWNX 4G3WA 3A0VA 2M7UA 3CUEC 4ARZA 2VV8A 4ME4A 3LR4A 2L0WA 4MN5A 4MN7A 2ZOHA 2KOIA 3D72A 2MJ6A 1NLZA 4FOFA 1BYWA 4WLAA 5KIZA 2V0WA 2I9VA 3F1NA 2VA0A 2VX8A 1LSXA 2WKQA 2JKTI 2K31A 1F98A 2GNXA 3V67A 5HZHA 1UGUA 2W0NA 3PBTA 1OT6A 2DMWA 5HSQA 4XT2A 4YNRA 2LB5A 4EW7A 4CLCB 3UB8A 1DRMA 5AVFA 3FC7A 2FZ0A 5J4EA 4K08A 5AJGA 4Y5FA 2B18A 4FSFA 5EFWA 4HHDA 2PHYA 3BY8A 3T4SA 4KUKA 2XSSA 3MQOA 1Y28A 5F6AA 3NOPC 3C2WA 5HPFA 2VGLS 1LL8A 1VB6A 3CWFA 3ICYA 5DJUA 2OAQ1 4ETXA 3BW6A 2D02A 4HJ3A 5J7EA 3IBJA 1N9NA 4GS9B 4I39A 3G6OA 3TW8A 2J3WA 1LT0A 2PR5A 3R7WB 1N9LA 2A2LA 4G3VA 2EWVA 3F1OA 3RTYA 4HP4A 4R38A 2PT7A 4UQIS 3S7NA 2FH5A 5HDDA 3PBQA 4EERA 1W63Q 2QWSA 4HH2A 2VJWA 3ZQ5A 4L9FA 4BBTA 1ZHHB 4GJ4A 5HDSA 1GSVA 3UMDA 1OTEA 2Z6CA 2WKPA 2H28A 2V9AA 1YSPA 3H9WA 4II7A 2XA7S 4WUJA 2G7UA 1P0ZA 2PD7A 1DP6A 4CQHA 3OCNA 3T4OA 4NXGA 4LRYC 4EUVA 5TBMB 2IA2A 4MN6A 4WN5A 2JN7A 5A8BA 3E0YA 5HD3A 3VOLA 3KSHA 1IFQA 4GS9A 1UWPX 2HF6A 3P01A 2VKSA 1V9ZA 1LSVA 1OJ5A 3R7WA 1DP8A 4R3AA 3OOVA 2O9CA 4BMWA 3NOUC 3BQ8A 4WEJA 3LI9A 3T4LA 4H6JB 1OJGA 4EETB 4WELA 3O5YA 5DJTA 4O0PA 3LR0A 3T50A 3U2AA 5HWWA 2JKTM 2A24B 3T4JA 1W63M 3GDIA 4HH3A 2HV1A 2W1RA 3VV4A 2O9BA 4P6ZM 5HDCA 3S7QA 3UB9A 2Z6DA 2PYPA 4HOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEH A;  1S4R A;  1XJ6 A;  2VV6 A;  3UB6 A;  1EW0 A;  4M4X A;  4LLO B;  2K7S A;  4EXO A;  3E4Q A;  4EEP A;  2L1M A;  1S1Y A;  4PKY A;  4R70 A;  4GHI B;  3A0S A;  4KUO A;  4H6J A;  2V1A A;  2M1C A;  3NHQ A;  3GEC A;  2J80 A;  2QJ7 A;  4NXB A;  2A24 A;  3H82 B;  4HP9 A;  3LIE A;  4I3J A;  4EEU A;  2PR6 A;  3LIA A;  3C8C A;  1P97 A;  5F68 A;  3MJQ A;  1XJ3 A;  4E04 A;  3VE4 A;  3H7W B;  4LRX C;  2WKR A;  4L9G A;  4DJ2 A;  3FG8 A;  3K3C A;  2VEA A;  1X0O A;  3UME A;  1ODV A;  4GHI A;  1T1A A;  2L4R A;  4JGQ A;  2EA9 A;  1XFQ A;  4HNB A;  2D01 A;  2JHE A;  1D06 A;  4HJ6 A;  2KX6 A;  5F5Y A;  3P7N A;  2R78 A;  2P7J A;  1TS8 A;  4EES A;  1NWZ A;  3H7W A;  1GSX A;  4I3I A;  3E4O A;  3IBR A;  3MR0 A;  4HIA A;  1N9O A;  1OTD A;  2ZOI A;  1V9Y A;  2KDK A;  5AVE A;  5HWV A;  4WF0 A;  3PHY A;  4LPZ A;  3LID A;  2PDR A;  1MZU A;  2VLG A;  3SW1 A;  3LIF A;  4XT2 B;  2INW A;  4B9O A;  3MFX A;  1JNU A;  1LSW A;  5IU1 A;  3CAX A;  3VE3 A;  4EQ1 A;  1OTI A;  5TBM A;  1WA9 A;  5DKL A;  4HJ4 A;  1S4S A;  4PKY G;  3NJA A;  3CLO A;  3OLO A;  5J3W A;  1D7E A;  1S66 L;  4HY8 A;  3A0R A;  2OWJ A;  3UE6 A;  3LYX A;  3UB7 A;  1TS0 A;  2PYR A;  1OTB A;  4L9E A;  3B33 A;  5IS1 A;  4KQD A;  4I38 A;  2W27 A;  5HWT A;  4NXE A;  4YWZ A;  3F1O B;  3LUQ A;  3MXQ A;  2ZBB A;  3BWL A;  2QHK A;  2YKH A;  2QJ5 A;  2V0U A;  4HQA A;  4WL9 A;  3RH8 B;  3K3D A;  4JGR A;  2OOL A;  4F3L B;  3MQQ A;  3HJI A;  4JGP A;  3IS2 B;  4NXF A;  4R6L A;  1KOU A;  1F9I A;  1TS7 A;  4I3A A;  2VV7 A;  4BBV A;  1T1C A;  1XJ4 A;  4JGO A;  2CMN A;  3EWK A;  4BBU A;  5I5L A;  3F1P B;  2GJ3 A;  1OTA A;  4HI4 A;  4I5S A;  5HD5 A;  5G4Z A;  3H82 A;  1T19 A;  3LI8 A;  1G28 A;  2QKP A;  2PD8 A;  5G4Y A;  3LIB A;  1XFN A;  4LRZ E;  4F3L A;  3LIC A;  4RQ9 A;  3E4P A;  1TS6 A;  3IS2 A;  1OT9 A;  4GW9 A;  3NOT C;  3F1N B;  3ULF A;  1GSW A;  1T1B A;  1S1Z A;  5DKK A;  1DP9 A;  1T18 A;  2BAS A;  3PYP A;  1S67 L;  1XJ2 A;  3F1P A;  4DJ3 A;  3BY9 A;  3HJK A;  4GCZ A;  3KX0 X;  2OWH A;  2V1B A;  2YKF A;  2B02 A;  5F69 A;  1UWN X;  3A0V A;  2VV8 A;  2L0W A;  4MN5 A;  2ZOH A;  3D72 A;  1BYW A;  4WLA A;  5KIZ A;  2V0W A;  2I9V A;  3F1N A;  1LSX A;  2WKQ A;  1F98 A;  5HZH A;  1UGU A;  2W0N A;  1OT6 A;  5HSQ A;  4XT2 A;  4EW7 A;  3UB8 A;  1DRM A;  5AVF A;  3FC7 A;  5J4E A;  4K08 A;  5EFW A;  4HHD A;  2PHY A;  3BY8 A;  4KUK A;  3MQO A;  1Y28 A;  5F6A A;  3NOP C;  3C2W A;  1LL8 A;  1VB6 A;  3CWF A;  3ICY A;  5DJU A;  2D02 A;  4HJ3 A;  5J7E A;  1N9N A;  4GS9 B;  4I39 A;  3G6O A;  1LT0 A;  2PR5 A;  1N9L A;  3F1O A;  3RTY A;  4HP4 A;  4R38 A;  5HDD A;  4EER A;  2QWS A;  4HH2 A;  3ZQ5 A;  4L9F A;  4BBT A;  5HDS A;  1GSV A;  3UMD A;  1OTE A;  2Z6C A;  2WKP A;  2H28 A;  2V9A A;  3H9W A;  4WUJ A;  1P0Z A;  2PD7 A;  1DP6 A;  4NXG A;  4LRY C;  5TBM B;  4WN5 A;  4MN6 A;  2JN7 A;  5A8B A;  5HD3 A;  3VOL A;  4GS9 A;  1UWP X;  1V9Z A;  1LSV A;  1OJ5 A;  1DP8 A;  4R3A A;  3NOU C;  3LI9 A;  4H6J B;  1OJG A;  4EET B;  5DJT A;  3T50 A;  5HWW A;  2A24 B;  3GDI A;  4HH3 A;  2HV1 A;  5HDC A;  3UB9 A;  2Z6D A;  2PYP A;  4HOI A; 
#chains in the Genus database with same CATH topology
 3UB6 A;  3TG9 A;  1JWZ A;  1MC0 A;  4QWO A;  3V50 A;  3E4Q A;  2Y91 A;  1YT4 A;  3A3D A;  5FEF A;  5L10 A;  1Q2P A;  3PBR A;  1K57 C;  1FSY A;  2WGW B;  2PBD P;  3HLG A;  4FH4 A;  4ESP A;  1IYP A;  2J80 A;  3W4Q A;  5E2G A;  4BJP A;  2ZM2 A;  3FPW A;  4PHT A;  1P9W A;  1K56 D;  1TVF A;  3C8C A;  1P97 A;  4R3B A;  4R3J A;  5F68 A;  1H8M A;  1XJ3 A;  4B4Z A;  1FOF A;  2GZA A;  2WKR A;  1DJC A;  2ZMV A;  4DJ2 A;  2A3U A;  3FG8 A;  3BQA A;  3O86 A;  3SZT A;  3K3C A;  2QYB A;  1VEU A;  4E3K A;  5EVL A;  3PXP A;  2VEA A;  5DTS A;  4P87 A;  3IWQ A;  4CLC A;  3FKV A;  3VP2 A;  2VGL M;  4MBH A;  5DFX A;  1VM1 A;  1FR6 A;  3E2K A;  4U3T A;  2JC7 A;  2R78 A;  1BLC A;  1TS8 A;  4S2P A;  4EES A;  2HJ9 C;  4OQH A;  1NWZ A;  3FWL A;  4Q0I A;  3VP1 A;  5KSC A;  2P74 A;  4Y3I A;  1OTD A;  3HLW A;  4Z1W A;  3UDX A;  3ZG7 B;  2KDK A;  1GA0 A;  3R4K A;  1RP5 A;  2PU2 A;  4QU3 A;  4NK3 A;  3IF6 C;  3IT9 A;  3LID A;  1YLY A;  1QMF A;  2XFS A;  3LIF A;  2EX6 A;  2H0Y A;  1JNU A;  5HAI A;  4JBF A;  2J3T D;  3TRC A;  5DF8 A;  3A3I A;  4FUW A;  3C4O A;  2AVX A;  2PBY A;  5FAP A;  3UDF A;  3D3O A;  1S4S A;  4KZ6 A;  3BRM A;  3LO7 A;  1RGY A;  1PRQ A;  3CLO A;  4KQO A;  1YLJ A;  1YLP A;  2CC1 A;  4MBK A;  4C6Y A;  1KGG A;  4PPR A;  3UB7 A;  3Q81 A;  2PYR A;  1FIK A;  1XGI A;  1EWZ A;  3QP6 A;  1KDW A;  1PZP A;  3IXB A;  3B33 A;  2Y2O A;  4I38 A;  3WS2 A;  4NXE A;  1BUL A;  4YWZ A;  4X53 A;  3F1O B;  2H0T A;  4X68 A;  3LUQ A;  3UY6 A;  3MXQ A;  1STZ A;  2ZBB A;  3S7O A;  4HQA A;  1NY0 A;  4GD6 A;  3RH8 B;  2ZQ8 A;  4AFI A;  2OOL A;  3TE8 A;  1YM1 A;  4NG2 A;  4IUH A;  1HTZ A;  4FTX A;  3OBF A;  4FD8 A;  1MKI A;  3T1X A;  3M6B A;  3NEC A;  4LV2 A;  1HVB A;  4PM7 A;  1G6O A;  1T1C A;  3GSG A;  5A92 A;  2Y79 A;  5J8X A;  2CMN A;  3O3V A;  4BBU A;  5I5L A;  3F1P B;  1E3U A;  1MWU A;  5HD5 A;  3S1Y A;  5G4Z A;  3H82 A;  3RFB A;  2ZM0 A;  5EM0 A;  1TD5 A;  1L0D A;  3HLD A;  4F3L A;  4KZ8 A;  3LIC A;  4RQ9 A;  3NC8 A;  1W79 A;  4ARZ B;  2JE5 A;  2ZQA A;  3OCL A;  1SKO A;  4OOL A;  2XDM A;  1NLY A;  2ZQ7 A;  3MZE A;  1OT9 A;  4S2N A;  5HFO A;  1I2S A;  1ZKJ A;  3IHB A;  5KZH A;  4Q0J A;  4O7D A;  3UE0 A;  3PBN A;  2PRF A;  1S1Z A;  5HX9 A;  1IKI A;  3MQ0 A;  5FL3 A;  1PIO A;  1S67 L;  1YAX A;  4DJ3 A;  2J9O A;  3IXD A;  3HJK A;  4QB8 A;  1W5D A;  4Y13 A;  1PI4 A;  3OC2 A;  2V1B A;  2QPN A;  4G3K A;  2JKR M;  4N9L A;  2Y2L A;  2UWX A;  4G3W A;  3A0V A;  1L2S A;  4BLM A;  2M7U A;  2BLS A;  2L0W A;  5EVI C;  4KQQ A;  1SDN A;  1NLZ A;  3W4O A;  3F1N A;  2VA0 A;  2VX8 A;  3MXS A;  1LLB A;  1A0K A;  3IXG A;  3QP5 A;  2QZ6 A;  3PBT A;  1VEU B;  5HSQ A;  1Z6F A;  4CLC B;  3IX4 A;  4E6X A;  3UB8 A;  1DRM A;  2OSU A;  1N4O A;  5AVF A;  2FZ0 A;  4P0M A;  4QY6 A;  1FCM A;  2B18 A;  4S2L A;  4HHD A;  4GB7 A;  4WMC D;  3T4S A;  3LY3 A;  5HPF A;  1VB6 A;  3BW6 A;  2OV5 A;  3N8S A;  4R1G A;  1DJA A;  1F2K A;  2GDN A;  4I39 A;  4DDS A;  2PR5 A;  1S6R A;  4OQ0 A;  3OPP A;  1XA7 A;  3V3S A;  3QP1 A;  3S7N A;  4EER A;  2QWS A;  3HRE A;  4R0Q A;  4KZ4 A;  4L9F A;  3C4P A;  1GSV A;  5E2H A;  3UB5 P;  3UMD A;  3CPT B;  4A5R A;  3N7W A;  2V9A A;  3AGE A;  1CI9 A;  1YSP A;  3I7J A;  3H9W A;  4LFU A;  3WS5 A;  5F82 A;  4XUZ A;  3T4O A;  4NXG A;  2IA2 A;  4R23 A;  3DW0 A;  3WS1 A;  1GHM A;  3P98 A;  4GS9 A;  4KZ5 A;  1UWP X;  2HF6 A;  1KE3 A;  1KE4 A;  3R7W A;  3TOI A;  5EVI D;  2EX8 A;  2O9C A;  3NOU C;  2Y2G A;  4UA6 A;  4LGW A;  4WEL A;  2XD1 A;  2HDR A;  3VSL A;  5HWW A;  2JKT M;  3QHY A;  2VGK A;  2HV1 A;  3GRJ A;  2EFU A;  1ES3 A;  4JKT A;  5HDC A;  2Z6D A;  4DXB A;  2PYP A;  1YLW A;  1K25 A;  1CI8 A;  2O9A A;  1PYY A;  4LLO B;  1IYS A;  3GMW A;  3ITA A;  4UEY A;  4EXO A;  3IQA A;  4EEP A;  1VET A;  2P9V B;  2L1M A;  3SS3 A;  1S1Y A;  4WZ5 A;  4GHI B;  3A0S A;  4KUO A;  4RYE A;  3UPP A;  2ZLY A;  1MWS A;  2V1A A;  1NYY A;  1QME A;  1RGZ A;  2QJ7 A;  3RJU A;  1K54 A;  2A24 A;  3H82 B;  2DCF A;  3LIE A;  4O01 A;  5M18 A;  4DN0 A;  5F1G A;  3C30 A;  3LIA A;  2W1T B;  4LEN A;  4JF4 A;  4E04 A;  1F5M A;  3NI9 A;  5DF7 A;  1FCN A;  3H7W B;  1IEM A;  4LRX C;  3ISG A;  4L9G A;  3HLC A;  1EI5 A;  5FQ9 A;  4U0X A;  1G68 A;  5IHV A;  1LL9 A;  5TJJ A;  1X0O A;  3UME A;  1ODV A;  2WK0 A;  1CJF A;  1NJ4 A;  2W3H A;  1T1A A;  4JF5 A;  5K5B A;  2EA9 A;  5FA7 A;  1IOU A;  1YQS A;  5FQQ A;  4Y0T A;  3KYQ A;  2JHE A;  4O8G A;  2XLN A;  4E3L A;  3NBL A;  4GDN A;  4CPK A;  4HJ6 A;  1H8Y A;  2P7J A;  2H10 A;  5FDH A;  4YOF A;  3ZNT A;  4S2K A;  3LEQ A;  4I3I A;  2XRO A;  3UO9 A;  3V39 A;  3IBR A;  3MR0 A;  4IVI A;  3A3E A;  1V9Y A;  3MBZ A;  5AVE A;  1JTD A;  5HWV A;  3T1S A;  2EWW A;  4WF0 A;  3IWO A;  4LCL A;  4WM9 A;  5L07 A;  3PTE A;  3IF5 A;  4E3M A;  2EX9 A;  2W3D A;  4Y7P A;  4OON A;  1XGJ A;  3VE3 A;  3MKF A;  5F83 A;  1SDE A;  2HPB A;  5DKL A;  4HJ4 A;  5DTK A;  5M1A A;  3BJN A;  3MMH A;  1S66 L;  3M2K A;  2J3T C;  3CUE A;  1TS0 A;  4L0L A;  2HP6 A;  3IXH A;  1OTB A;  1TDG A;  4PAU A;  1K6S A;  3ZG8 B;  2XGN A;  4CLC D;  4OVD A;  3HUM A;  2W27 A;  4DMZ A;  5AQ9 A;  2XRN A;  3BWL A;  4KZB A;  2Z2M B;  5CXW A;  2QJ5 A;  1J3W A;  4WL9 A;  4B88 A;  2ZL1 B;  3FKW A;  1NRJ A;  3G30 A;  4MCW A;  2E8J A;  2W3E A;  4WYY A;  3WRT A;  3QNB A;  4ZBE A;  1NXY A;  2DRW A;  1O07 A;  5EOO A;  5U47 A;  5A93 A;  4R6L A;  4IJG A;  5A90 A;  4C3Q A;  1F9I A;  4N1H A;  1TS7 A;  2WKH A;  3M2J A;  4LV1 A;  3ZGA B;  5DF9 A;  4E6W A;  4EBN A;  4BEN A;  2ZQ9 A;  2GJ3 A;  1OTA A;  4NEE D;  1H3Q A;  2WGV A;  1G28 A;  1NZO A;  3HUN A;  4WEK A;  1G5U A;  4KZ3 A;  1ERO A;  1BT5 A;  4GLQ A;  3LIB A;  3ZFZ A;  2Z2L B;  4LRZ E;  2Y8H A;  3E4P A;  2HDQ A;  3S7P A;  1K56 A;  4KG6 A;  3IS2 A;  3EGD C;  3WS0 A;  3N6I A;  4X1L A;  3D9Y A;  4UHU A;  3EEA A;  3NOT C;  3ZG9 B;  5E2F A;  3ULF A;  4S2O A;  4CLC E;  3PR6 A;  2W3G A;  3FZC A;  4Z9Q A;  1YKD A;  1E25 A;  1XJ2 A;  5EVE A;  3BY9 A;  5GL9 A;  4GCZ A;  3KX0 X;  3Q82 A;  4X1M A;  4N9K A;  2YKF A;  2ZD8 A;  3NY4 A;  2Y2H A;  2RCX A;  3VP3 A;  4BWI A;  4E3O A;  5GLC A;  1UWN X;  4PM5 A;  1JWV A;  4JF6 A;  1W7F A;  2VV8 A;  4ME4 A;  2JBF A;  4MN7 A;  5EUA A;  3DTI A;  5GHZ A;  4FOF A;  1BYW A;  3G34 A;  3GR2 A;  4P6B A;  1ESU A;  2Y2P A;  2WKQ A;  3C7U A;  2K31 A;  1K0K A;  1F98 A;  3V67 A;  4DE2 A;  5HZH A;  5M19 A;  4ZJ2 A;  2DMW A;  3A3J A;  4B4X A;  4UAA A;  4YNR A;  2LB5 A;  2JKG A;  5J4E A;  3BFD A;  3QP8 A;  5FI6 A;  5L09 A;  1CQA A;  2PHY A;  2X02 A;  4BD1 A;  3HBR A;  4MLL A;  5CHJ A;  4ZDX A;  2XSS A;  3MQO A;  1Y28 A;  1K57 A;  5I94 A;  3NOP C;  3C2W A;  4EUZ A;  2XFT A;  5FQI A;  3B3X A;  1FQG A;  4JLF A;  2OAQ 1;  5E43 A;  5CEC A;  2X01 A;  3MXR A;  3AGD A;  3UNW A;  1OME A;  5J7E A;  4MNR A;  2HDS A;  5FQK A;  3ZG5 A;  2RL3 A;  3TW8 A;  2J3W A;  5FSR A;  3Q7V B;  2A2L A;  4G3V A;  3RTY A;  4UQI S;  1I2W A;  2FH5 A;  2A49 A;  1MY8 A;  5GLA A;  5FQM A;  3WRZ A;  3ZVT A;  1ZHH B;  1IYQ A;  4GJ4 A;  5HDS A;  1OTE A;  2FFY A;  4YFM A;  3SH7 A;  3IX8 A;  2G7U A;  5DTT A;  1P0Z A;  3U4L P;  4DE3 A;  2BG1 A;  4OP5 A;  4CQH A;  3BFF A;  1SKF A;  1WE4 A;  3DAV A;  2HZ5 A;  5HD3 A;  1NZU A;  2DNS A;  1U60 A;  2VKS A;  4XXR A;  5CER A;  3WS4 A;  4CJN A;  1BLH A;  1DP8 A;  1I5Q A;  4KEN B;  1H0M A;  3P09 A;  1H8Z A;  4UA7 A;  3W4P A;  3AGF A;  1IKG A;  4K0X A;  5DJT A;  3LR0 A;  1PNE A;  1W63 M;  1WYC A;  3VMA A;  3OZH A;  2ZMA A;  2VGJ A;  2ZJ9 A;  4Y17 A;  2Y2N A;  3IF6 A;  1S4R A;  1XJ6 A;  2VV6 A;  3S4X A;  1EW0 A;  4ZJ1 A;  2JKF A;  5L8M A;  3VFF A;  2K7S A;  3HL9 A;  5JYO A;  3S22 A;  1ES2 A;  4JXW A;  5CGW A;  3HVF A;  4R70 A;  2R9W A;  4H6J A;  4ZTK A;  3IH8 A;  2GX5 A;  4NXB A;  1HD8 A;  1VHM A;  3BFE A;  1CK3 A;  3LR5 A;  4I3J A;  2PR6 A;  3CIT A;  3MJQ A;  1S0W A;  2WGI A;  3HLF A;  3MF0 A;  5CHU A;  3LFV A;  3N8R A;  4ZAM A;  3PAE A;  3KSG A;  2ZMF A;  4ID4 A;  1KVL A;  4EQI A;  4Y2F A;  3M6H A;  4NET A;  2WAE A;  5FAQ A;  3G2Y A;  5AQ7 A;  1XFQ A;  2WGW A;  1ES5 A;  2D01 A;  4HNB A;  2Y2K A;  5HAR A;  1PW8 A;  1D06 A;  3HCY A;  3G31 A;  4OPQ A;  2KX6 A;  4JPM A;  3CMZ A;  5F5Y A;  1LHY A;  5EV0 A;  1P9R A;  4UQI M;  4WMC A;  2WKE A;  1H5X A;  4H8R A;  5HAP A;  4B93 A;  2WKI A;  1NRF A;  2XH9 A;  3E4O A;  3LR3 A;  4KG2 A;  4HIA A;  4OOM A;  1GA9 A;  2H5S A;  2JCH A;  1CEG A;  3PBO A;  1NYM A;  4X6T A;  3PHY A;  2ZC7 A;  3UE1 A;  4ZRR A;  1HLU P;  4LPZ A;  5GLD A;  3SS4 A;  3ZYT A;  2KLI A;  3EQU A;  2PDR A;  4PM6 A;  5DFY A;  5JYP A;  3TJZ C;  1CF0 A;  3EGX C;  2INW A;  3O88 A;  3MFX A;  2ZC3 B;  1LSW A;  1Y54 A;  2W3F A;  1PI5 A;  1Y4O A;  3CAX A;  4MMN A;  3EOI A;  5HPI A;  2Q0O A;  1OTI A;  5TBM A;  1WA9 A;  1MBL A;  3IH9 A;  4XUX A;  4DKI A;  4EBP A;  4RX3 A;  3OLO A;  3E2L A;  3BYD A;  1YLT A;  1D7E A;  3BEC A;  1YLZ A;  3T4Q A;  5KMW A;  3A0R A;  2OWJ A;  3UE6 A;  3LYX A;  2B95 A;  3VP0 A;  3IHA A;  3D4F A;  1ZG6 A;  5A91 A;  3T12 B;  1BUE A;  2VZW A;  4EWF A;  4L9E A;  2R9X A;  5EVI A;  4KQD A;  5HWT A;  4QJG A;  2V2F F;  1LL5 A;  5IT5 A;  1L0G A;  3A3F A;  3L7H A;  2YKH A;  2V0U A;  4E3N A;  3K2N A;  2EXA A;  3LY4 A;  5G18 A;  4GZB A;  4JGR A;  4F3L B;  1ERM A;  2HP9 A;  4JGP A;  1HZO A;  4CLC C;  1SKO B;  4NXF A;  4PM9 A;  2X71 A;  4I3A A;  3UE3 A;  1PWD A;  2P08 A;  2VV7 A;  4BBV A;  1JVJ A;  4OPR A;  5F1F A;  1K38 A;  2EFX A;  1TEM A;  2J7V A;  2Y4A A;  4Q0H A;  4HI4 A;  4DDY A;  4I5S A;  1C3B A;  1T19 A;  3LI8 A;  4RA7 A;  4GDB A;  1MWT A;  2QKP A;  2PD8 A;  3PAG A;  5G4Y A;  1SCW A;  2ACG A;  1XFN A;  3NCK A;  3CHW P;  3IWI A;  3C38 A;  3OPR A;  4MDZ A;  1TS6 A;  1LI9 A;  2HDU A;  4OPY A;  2EX2 A;  3IF6 B;  4GW9 A;  2NUT C;  3F1N B;  1YPR A;  1GSW A;  3MZF A;  1RCJ A;  3CG5 A;  2OAP 1;  5DKK A;  3JPU A;  5CHM A;  1TF1 A;  3F1P A;  3GV9 A;  4IVK A;  3DBA A;  5CX7 A;  4C75 A;  1IEL A;  4HES A;  5FAT A;  3FPV A;  4DF6 A;  2QMI A;  3CJM A;  4D2O A;  4QY5 A;  2J9P A;  3ZCZ A;  4ARZ A;  3SOI A;  4RX2 A;  4IBX A;  2IWC A;  1YMX A;  2MJ6 A;  4WLA A;  5KIZ A;  2I9V A;  4R4S A;  1KGF A;  4K91 A;  2GNX A;  1ERQ A;  1UGU A;  3RXW A;  2W0N A;  1OT6 A;  3G35 A;  3MSH A;  4XT2 A;  1BTL A;  3NDG A;  4S2J A;  1YMS A;  3FC7 A;  4K08 A;  4Q8I A;  4KZ7 A;  4KZ9 A;  2XK1 A;  3OPL A;  1N9B A;  4ZJ3 A;  4LV0 A;  3ICY A;  5DJU A;  4ETX A;  4OOY A;  5FDS A;  5HW3 A;  1PFL A;  2D02 A;  4HJ3 A;  5CEB A;  5CED A;  4GS9 B;  4EBL A;  1M6K A;  2UV0 E;  2WZX A;  1LT0 A;  4OPZ A;  3C7V A;  3R7W B;  2Y2Q A;  3FV7 A;  4HP4 A;  4R38 A;  2PT7 A;  5HDD A;  2C6W B;  2WUQ A;  3MFD A;  2V1Z A;  2ZC5 B;  2WYX A;  4S2N C;  4S2I A;  4BBT A;  3VOZ A;  3W8K A;  2Z6C A;  2WKP A;  4OP8 A;  3UN7 A;  3HLB A;  4E3J A;  2WZZ A;  2XA7 S;  1ES4 A;  3G2Z A;  4D60 A;  1DP6 A;  5DVA A;  3SH9 A;  2Y2M A;  4EUV A;  5TBM B;  3SH8 A;  4DE1 A;  4MN6 A;  2JN7 A;  5A8B A;  5HAQ A;  3KSH A;  1XPB A;  5L2F A;  1IFQ A;  1DJB A;  1SHV A;  3P01 A;  5HL1 A;  1VET B;  1XKZ A;  1V9Z A;  3WWX A;  4R3A A;  1MWR A;  2Y59 A;  4PM8 A;  3BQ8 A;  4WEJ A;  3T4L A;  4DXC A;  3JYI A;  5EVI B;  1WYB A;  3T50 A;  1ONG A;  2A24 B;  3T4J A;  2E8I A;  1JTG A;  3ZNY A;  5EOE A;  3VV4 A;  2O9B A;  3CPT A;  3DWK A;  3S7Q A;  3UB9 A;  4HOI A;  1FR1 A;  3EEH A;  4ETZ A;  4RVA A;  4M4X A;  3FYZ A;  2ZM8 A;  3BLM A;  5GHX A;  3MZD A;  3G4P A;  4K0W A;  2XEP A;  4NKP A;  1ZG4 A;  1E3U D;  3ZHH A;  4PKY A;  4GKU A;  3CZD A;  2M1C A;  3NHQ A;  4UA9 A;  3GEC A;  3VP4 A;  5CGS A;  4HP9 A;  5CGX A;  2G2W A;  1CEF A;  3LGO A;  4U0T A;  4EEU A;  1BLP A;  3O87 A;  1BLS A;  3BLS A;  3LCE A;  4OKP A;  3UDI A;  4E3I A;  5LBR A;  1W8Y A;  4MBF A;  3VE4 A;  4X56 A;  2O0Y A;  3T1R A;  3EQV A;  3BM6 A;  2B5R A;  1L3L A;  4QD4 A;  1IYO A;  3T4T A;  4FH2 A;  2P9V A;  1AXB A;  5HL6 A;  4GHI A;  2L4R A;  4M3K A;  4JGQ A;  2VK3 A;  1PWC A;  2Q9M A;  2WAF A;  2O99 A;  4S2M A;  1YSQ A;  3QNC A;  3N4I A;  1ZC2 A;  3P7N A;  2OLV A;  2W1T A;  5TR7 A;  2IWB A;  1GHP A;  3LEZ A;  3VFH A;  3H7W A;  1GSX A;  4GD8 A;  2WAD A;  1N9O A;  2ZOI A;  1MPL A;  4IUK A;  2IWD A;  2G2U A;  4OLD A;  5FAO A;  1ALQ A;  5CRF A;  2XQZ A;  2XA7 M;  1KE0 A;  4Y0U A;  3KYE A;  4N1X A;  5TFQ A;  1VQQ A;  1ZTU A;  3ITB A;  1AWI A;  1ONH A;  2Q9N A;  1MZU A;  2VLG A;  3GVB A;  3SW1 A;  2I72 A;  4XT2 B;  1KGE A;  3OPH A;  2XR0 A;  4YIN A;  4B9O A;  2P04 A;  4IBR A;  4QPR A;  5IU1 A;  2PAV P;  3KYZ A;  4IHQ A;  4EQ1 A;  4WZ5 C;  4DRT A;  2Y2I A;  5AQA A;  3ZDJ A;  3N8L A;  4PKY G;  3NJA A;  1OPX A;  2HJE A;  1W8Q A;  5J3W A;  4HBU A;  4HY8 A;  3BEB A;  1K54 C;  2JKR I;  5GLB A;  2V20 A;  5IS1 A;  1K55 C;  3B42 A;  4OH0 A;  5KSH A;  4X55 A;  5CTM A;  3HLE A;  3QP2 A;  1JWP A;  2QHK A;  3CI6 A;  1FSW A;  4BL2 A;  1KDS A;  1PZO A;  3K3D A;  3W2Z A;  4JXG A;  2ZQC A;  3NUL A;  5FAS A;  3MQQ A;  4EU0 A;  3HJI A;  3IS2 B;  4BQM A;  1KOU A;  2ZC6 B;  3JVV A;  2LB9 A;  5AQB A;  2NUP C;  3NDE A;  3KSF A;  1XJ4 A;  4JGO A;  5EM1 A;  3V5M A;  2K2N A;  3T1Q B;  2XD5 A;  3PBS A;  3EWK A;  4WZ4 A;  1LI0 A;  2FFF B;  5FQJ A;  1SZV A;  4LCM A;  2ZL1 A;  1FCO A;  2XF3 A;  5C5K A;  1MKM A;  3B47 A;  5E2E A;  4DE0 A;  3DTM A;  5FI2 A;  1J9M A;  5EE8 A;  3G32 A;  2BTF P;  4JXV A;  1XA1 A;  1K6R A;  4LV3 A;  5BOH A;  4X25 A;  1L0E A;  4FCF A;  2V8C A;  5MC7 A;  1T1B A;  3TSG A;  3E98 A;  2HGV A;  3DWZ A;  4PMA A;  1DP9 A;  1T18 A;  2BAS A;  3PYP A;  4P6Z S;  1Z09 A;  2ZC4 B;  3KO6 A;  1D1J A;  3T4K A;  2OWH A;  3KSI A;  1K4E A;  3Q7Z A;  3JVU A;  4Y15 A;  3IX3 A;  2B02 A;  2M7V A;  4P85 A;  5F69 A;  3ZVW A;  3CUE C;  1G6A A;  1PW1 A;  4N92 A;  3LR4 A;  3HUO A;  4KG5 A;  1O7E A;  4MN5 A;  5CTN A;  1XXM A;  2ZOH A;  2KOI A;  1PWG A;  3D72 A;  4IED A;  4X69 A;  3RXX A;  2V0W A;  3GTC A;  1LSX A;  2JKT I;  2V8F A;  4QHC A;  4OQG A;  4F94 A;  4EW7 A;  3VSK A;  4MEZ A;  5GHY A;  1BZA A;  4R4R A;  1TDL A;  5AJG A;  4Y5F A;  1Q2Q A;  5D3O A;  4FSF A;  5EFW A;  4EV4 A;  3BY8 A;  4KUK A;  5F6A A;  3VOY A;  2PU4 A;  2VGL S;  4BL3 A;  5EPH A;  1LL8 A;  3CWF A;  3UPO A;  1K4F A;  2J8Y A;  4OLG A;  1KVM A;  1K55 A;  2Y55 A;  3IBJ A;  5FI7 A;  1N9N A;  1BSG A;  3NIA A;  3BFG A;  3G6O A;  3SS5 A;  3DTE A;  1N9L A;  2EWV A;  3F1O A;  4KZA A;  1MXO A;  3PBQ A;  1W63 Q;  4GNU A;  3UPN A;  4HH2 A;  5FEG A;  2VJW A;  5TGF A;  2C5W B;  3Q07 A;  3ZQ5 A;  3DTK A;  3MKE A;  3QP4 A;  4Y0O A;  1GCE A;  2H28 A;  2Y2J A;  1XX2 A;  3MS6 A;  4II7 A;  4WUJ A;  2PD7 A;  3OCN A;  1E4D A;  4HEF A;  4LRY C;  1ACF A;  4WN5 A;  2OLU A;  4WBG A;  3E0Y A;  2ZQD A;  3BFC A;  3VOL A;  4HBT A;  1LSV A;  1OJ5 A;  3Q7V A;  3OOV A;  4BMW A;  1DY6 A;  4BD0 A;  4JXS A;  4GN2 A;  3ZG0 A;  3LI9 A;  1M40 A;  4H6J B;  1FIL A;  1OJG A;  4EET B;  3O5Y A;  5EEC A;  4O0P A;  1ESI A;  3U2A A;  3V3R A;  3Q1F A;  3GDI A;  4HH3 A;  2W1R A;  4OQI A;  1XP4 A;  4P6Z M;  4KQR A;  1GHI A;  4GOG A;  1L0F A;  3C5A A;  3L9K A;  2HP5 A;  3GQZ A;  2EXB A; 
#chains in the Genus database with same CATH homology
 3EEH A;  1S4R A;  4ETZ A;  1XJ6 A;  2VV6 A;  2O9A A;  3UB6 A;  1EW0 A;  5L8M A;  4M4X A;  4LLO B;  2K7S A;  1MC0 A;  4UEY A;  4EXO A;  3E4Q A;  4EEP A;  2L1M A;  4NKP A;  1S1Y A;  3PBR A;  4PKY A;  4R70 A;  4GHI B;  3A0S A;  4KUO A;  4H6J A;  2V1A A;  2M1C A;  3NHQ A;  3GEC A;  2J80 A;  2GX5 A;  2QJ7 A;  4NXB A;  4BJP A;  2A24 A;  3H82 B;  4HP9 A;  3LIE A;  4O01 A;  3FPW A;  4PHT A;  1VHM A;  4DN0 A;  3C30 A;  1P9W A;  3LR5 A;  4I3J A;  4EEU A;  2PR6 A;  3LIA A;  3CIT A;  2W1T B;  3C8C A;  1P97 A;  5F68 A;  3MJQ A;  1H8M A;  1XJ3 A;  5LBR A;  4E04 A;  3VE4 A;  1F5M A;  3MF0 A;  3H7W B;  2O0Y A;  4LRX C;  2GZA A;  3EQV A;  2WKR A;  2ZMV A;  4L9G A;  3LFV A;  4DJ2 A;  3FG8 A;  3BQA A;  3T4T A;  3KSG A;  2ZMF A;  3K3C A;  2QYB A;  3PXP A;  2VEA A;  5TJJ A;  4Y2F A;  1X0O A;  3UME A;  1ODV A;  4CLC A;  5HL6 A;  4GHI A;  2VGL M;  2W3H A;  1T1A A;  2L4R A;  4JGQ A;  5K5B A;  2EA9 A;  1XFQ A;  4HNB A;  2D01 A;  1IOU A;  5DFX A;  2O99 A;  3KYQ A;  1YSQ A;  2JHE A;  1D06 A;  4O8G A;  3HCY A;  4HJ6 A;  2KX6 A;  5F5Y A;  3P7N A;  2R78 A;  2W1T A;  2P7J A;  1P9R A;  1TS8 A;  4UQI M;  4YOF A;  4EES A;  2HJ9 C;  1NWZ A;  4B93 A;  3H7W A;  1GSX A;  4I3I A;  2XRO A;  4Q0I A;  3E4O A;  3IBR A;  3LR3 A;  3MR0 A;  4HIA A;  1N9O A;  1OTD A;  2ZOI A;  4OOM A;  4Y3I A;  4IUK A;  4Z1W A;  3PBO A;  1V9Y A;  2KDK A;  5AVE A;  5HWV A;  2EWW A;  4WF0 A;  3R4K A;  2XA7 M;  3PHY A;  1ZTU A;  4ZRR A;  4LPZ A;  3ZYT A;  2KLI A;  3EQU A;  3LID A;  2PDR A;  1MZU A;  2VLG A;  3SW1 A;  5DFY A;  3LIF A;  3TJZ C;  4XT2 B;  3EGX C;  2INW A;  4B9O A;  3MFX A;  2P04 A;  1JNU A;  1LSW A;  2W3D A;  4QPR A;  5IU1 A;  2J3T D;  2W3F A;  3TRC A;  3CAX A;  4MMN A;  3EOI A;  3VE3 A;  5HPI A;  3KYZ A;  4IHQ A;  4EQ1 A;  1OTI A;  5TBM A;  1WA9 A;  5DKL A;  3D3O A;  4HJ4 A;  1S4S A;  4PKY G;  3NJA A;  3CLO A;  3BJN A;  1OPX A;  3OLO A;  4KQO A;  2HJE A;  3MMH A;  5J3W A;  1D7E A;  1S66 L;  4HY8 A;  3T4Q A;  3A0R A;  2OWJ A;  3UE6 A;  3LYX A;  2J3T C;  3UB7 A;  2JKR I;  3CUE A;  1TS0 A;  2PYR A;  4L0L A;  1OTB A;  4PAU A;  2VZW A;  4L9E A;  3B33 A;  5IS1 A;  4KQD A;  4CLC D;  4I38 A;  2W27 A;  5HWT A;  4NXE A;  5IT5 A;  4YWZ A;  4DMZ A;  3F1O B;  3B42 A;  5KSH A;  3LUQ A;  3MXQ A;  1STZ A;  2XRN A;  2ZBB A;  3BWL A;  2QHK A;  2YKH A;  3S7O A;  2QJ5 A;  2V0U A;  3CI6 A;  3K2N A;  4HQA A;  4WL9 A;  1NRJ A;  4MCW A;  3RH8 B;  2W3E A;  3K3D A;  4AFI A;  4JGR A;  2OOL A;  3W2Z A;  4F3L B;  3TE8 A;  3MQQ A;  4EU0 A;  3HJI A;  4JGP A;  4CLC C;  3IS2 B;  4IUH A;  4NXF A;  4R6L A;  4IJG A;  1KOU A;  1F9I A;  1TS7 A;  3OBF A;  4I3A A;  3UE3 A;  2P08 A;  2VV7 A;  3JVV A;  2LB9 A;  2NUP C;  5DF9 A;  4BBV A;  1G6O A;  3KSF A;  1T1C A;  1XJ4 A;  2Y79 A;  4JGO A;  2CMN A;  2K2N A;  3PBS A;  3EWK A;  4BBU A;  5I5L A;  3F1P B;  2GJ3 A;  1OTA A;  4Q0H A;  4HI4 A;  4NEE D;  4I5S A;  1H3Q A;  5HD5 A;  5G4Z A;  3H82 A;  1T19 A;  3LI8 A;  1G28 A;  3RFB A;  2QKP A;  2PD8 A;  4WEK A;  5G4Y A;  4GLQ A;  3LIB A;  1XFN A;  1TD5 A;  3C38 A;  5C5K A;  4LRZ E;  2Y8H A;  4F3L A;  4MDZ A;  3LIC A;  4RQ9 A;  1MKM A;  3B47 A;  3E4P A;  3S7P A;  1TS6 A;  4ARZ B;  3OCL A;  3IS2 A;  4OOL A;  3EGD C;  1NLY A;  1OT9 A;  3EEA A;  4GW9 A;  2NUT C;  3NOT C;  3F1N B;  5MC7 A;  3ULF A;  1GSW A;  1T1B A;  4CLC E;  4Q0J A;  3E98 A;  3PR6 A;  3PBN A;  1S1Z A;  2HGV A;  2OAP 1;  2W3G A;  5DKK A;  1DP9 A;  1T18 A;  3MQ0 A;  2BAS A;  3PYP A;  1YKD A;  5FL3 A;  1S67 L;  1YAX A;  4P6Z S;  1TF1 A;  1XJ2 A;  3F1P A;  4DJ3 A;  3BY9 A;  3KO6 A;  3HJK A;  3T4K A;  4GCZ A;  5CX7 A;  3DBA A;  2OWH A;  3KSI A;  3KX0 X;  3OC2 A;  2V1B A;  3JVU A;  2YKF A;  3FPV A;  2B02 A;  4G3K A;  2JKR M;  4BWI A;  2M7V A;  5F69 A;  1UWN X;  4G3W A;  3A0V A;  2M7U A;  3CUE C;  4ARZ A;  2VV8 A;  4ME4 A;  3LR4 A;  2L0W A;  4MN5 A;  4MN7 A;  2ZOH A;  2KOI A;  3D72 A;  2MJ6 A;  1NLZ A;  4FOF A;  1BYW A;  4WLA A;  5KIZ A;  2V0W A;  2I9V A;  3F1N A;  2VA0 A;  2VX8 A;  1LSX A;  2WKQ A;  2JKT I;  2K31 A;  1F98 A;  2GNX A;  3V67 A;  5HZH A;  1UGU A;  2W0N A;  3PBT A;  1OT6 A;  2DMW A;  5HSQ A;  4XT2 A;  4YNR A;  2LB5 A;  4EW7 A;  4CLC B;  3UB8 A;  1DRM A;  5AVF A;  3FC7 A;  2FZ0 A;  5J4E A;  4K08 A;  5AJG A;  4Y5F A;  2B18 A;  4FSF A;  5EFW A;  4HHD A;  2PHY A;  3BY8 A;  3T4S A;  4KUK A;  2XSS A;  3MQO A;  1Y28 A;  5F6A A;  3NOP C;  3C2W A;  5HPF A;  2VGL S;  1LL8 A;  1VB6 A;  3CWF A;  3ICY A;  5DJU A;  2OAQ 1;  4ETX A;  3BW6 A;  2D02 A;  4HJ3 A;  5J7E A;  3IBJ A;  1N9N A;  4GS9 B;  4I39 A;  3G6O A;  3TW8 A;  2J3W A;  1LT0 A;  2PR5 A;  3R7W B;  1N9L A;  2A2L A;  4G3V A;  2EWV A;  3F1O A;  3RTY A;  4HP4 A;  4R38 A;  2PT7 A;  4UQI S;  3S7N A;  2FH5 A;  5HDD A;  3PBQ A;  4EER A;  1W63 Q;  2QWS A;  4HH2 A;  2VJW A;  3ZQ5 A;  4L9F A;  4BBT A;  1ZHH B;  4GJ4 A;  5HDS A;  1GSV A;  3UMD A;  1OTE A;  2Z6C A;  2WKP A;  2H28 A;  2V9A A;  1YSP A;  3H9W A;  4II7 A;  2XA7 S;  4WUJ A;  2G7U A;  1P0Z A;  2PD7 A;  1DP6 A;  4CQH A;  3OCN A;  3T4O A;  4NXG A;  4LRY C;  4EUV A;  5TBM B;  2IA2 A;  4MN6 A;  4WN5 A;  2JN7 A;  5A8B A;  3E0Y A;  5HD3 A;  3VOL A;  3KSH A;  1IFQ A;  4GS9 A;  1UWP X;  2HF6 A;  3P01 A;  2VKS A;  1V9Z A;  1LSV A;  1OJ5 A;  3R7W A;  1DP8 A;  4R3A A;  3OOV A;  2O9C A;  4BMW A;  3NOU C;  3BQ8 A;  4WEJ A;  3LI9 A;  3T4L A;  4H6J B;  1OJG A;  4EET B;  4WEL A;  3O5Y A;  5DJT A;  4O0P A;  3LR0 A;  3T50 A;  3U2A A;  5HWW A;  2JKT M;  2A24 B;  3T4J A;  1W63 M;  3GDI A;  4HH3 A;  2HV1 A;  2W1R A;  3VV4 A;  2O9B A;  4P6Z M;  5HDC A;  3S7Q A;  3UB9 A;  2Z6D A;  2PYP A;  4HOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...