1T1CA

Late intermediate il3 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1cA00
3UE6A 2K7SA 5HD3A 4EERA 2PYRA 4B9OA 3LIDA 1S4SA 1Y28A 4WF0A 1LSVA 3UB7A 2A24B 3GECA 3H82A 3LYXA 2KX6A 3LI9A 1GSWA 3NHQA 2KDKA 3MJQA 4M4XA 3B33A 3UB6A 3F1OA 5TBMA 4F3LB 4HHDA 1XJ6A 5F5YA 1OTIA 5KIZA 3UB8A 4EEPA 4LPZA 3MFXA 1TS0A 3CWFA 2ZBBA 5DJUA 4PKYA 3MXQA 3LIBA 3ULFA 1TS6A 4EXOA 3EWKA 1N9LA 3NJAA 3OLOA 2PDRA 4GCZA 4K08A 1F98A 1ODVA 2PR5A 4R3AA 4YWZA 2Z6DA 2QJ5A 3RH8B 1EW0A 1KOUA 4EETB 3KX0X 4LRZE 3LIAA 3LIFA 4L9EA 3F1PB 4F3LA 4WUJA 3VE4A 2V0WA 3IBRA 2ZOHA 1DP6A 2WKQA 1XJ3A 4R6LA 1BYWA 2VV7A 3CLOA 1UWNX 4GS9B 1OT6A 4GHIB 5DKLA 3UMEA 5J4EA 4MN5A 2H28A 2YKHA 5HDCA 5EFWA 1OJ5A 2V9AA 2W27A 5AVEA 3VE3A 2QWSA 2V1BA 3HJIA 4KQDA 2QKPA 1V9ZA 3LIEA 4R38A 5HZHA 5G4YA 4I3AA 3E4OA 1T18A 1X0OA 2ZOIA 3NOPC 4LRYC 3F1NB 4I38A 5A8BA 5HD5A 2W0NA 5HWTA 4GW9A 3F1PA 2VEAA 3T50A 4EEUA 1OT9A 3LI8A 4GS9A 5HWWA 5HWVA 2WKPA 4EW7A 1LT0A 4GHIA 2M1CA 4KUOA 4NXFA 1TS7A 4HJ3A 2QJ7A 4RQ9A 4XT2B 4R70A 2D02A 3C8CA 4H6JB 3BWLA 3MR0A 1G28A 2R78A 2V0UA 4BBTA 5F68A 4HOIA 2EA9A 4DJ3A 1UWPX 1S1ZA 3F1NA 4HNBA 1P97A 3IS2B 2B02A 2PYPA 1LL8A 2A24A 4BBVA 1LSWA 4PKYG 1P0ZA 4KUKA 4HH2A 2L4RA 2CMNA 3RTYA 2QHKA 2P7JA 1OTBA 1NWZA 3UMDA 1XJ2A 2D01A 5DJTA 4XT2A 5J3WA 1OJGA 4H6JA 1N9OA 4WN5A 5IU1A 3FG8A 3H9WA 3H82B 3K3DA 2I9VA 4HI4A 5HSQA 4JGPA 4WL9A 1JNUA 3F1OB 3A0SA 5TBMB 3EEHA 3NOTC 1F9IA 3P7NA 3GDIA 4HIAA 4L9GA 1V9YA 3NOUC 2JN7A 4L9FA 1DP8A 3BY9A 1D7EA 5AVFA 2WKRA 2Z6CA 3BY8A 3ZQ5A 1XFQA 3PYPA 2PR6A 4I39A 4JGOA 5G4ZA 1GSXA 2HV1A 1T1BA 4NXGA 3UB9A 1T1CA 4JGQA 3E4PA 1DRMA 3PHYA 2PD7A 3H7WB 4LLOB 4WLAA 3E4QA 4E04A 3CAXA 4HP4A 2OWHA 2VV6A 3D72A 2V1AA 5I5LA 3A0VA 4BBUA 1S4RA 2INWA 5J7EA 5IS1A 4HJ6A 1S66L 1S1YA 5DKKA 3SW1A 1VB6A 3MQQA 4HH3A 4HY8A 1XJ4A 3LICA 2L0WA 4JGRA 4HQAA 5F6AA 4EESA 2L1MA 1LSXA 2JHEA 5HDDA 3C2WA 5HDSA 1D06A 1GSVA 1UGUA 1OTAA 3H7WA 3HJKA 2OWJA 4I5SA 3G6OA 4NXEA 3K3CA 3FC7A 4LRXC 5F69A 2VLGA 2PD8A 1OTEA 3ICYA 1T1AA 1T19A 1XFNA 1DP9A 3IS2A 2BASA 1S67L 2OOLA 4HP9A 4HJ4A 2GJ3A 4EQ1A 2VV8A 1N9NA 2PHYA 2YKFA 3A0RA 4I3IA 4I3JA 4DJ2A 1OTDA 3VOLA 1MZUA 3MQOA 3LUQA 1WA9A 4MN6A 4NXBA 2J80A 1TS8A
chains in the Genus database with same CATH superfamily
5DTKA 2J3TC 1GA9A 2K7SA 2BLSA 1BLCA 5FQMA 4MN7A 1M6KA 3FZCA 4OQ0A 3GR2A 3Q82A 1LSVA 4XUXA 1ONHA 3ZDJA 2Y2IA 3LYXA 1D1JA 2E8IA 1SZVA 2P74A 3LI9A 3VP4A 3A3EA 5TFQA 1G6OA 4Y17A 1ZC2A 5TBMA 3ZVTA 1XA1A 3ZG8B 1OTIA 3ZG5A 5KIZA 1MPLA 3ZHHA 3FYZA 3MKFA 3G4PA 3T4TA 2Y2KA 4EEPA 1TF1A 2H10A 5CEDA 4LPZA 3FKVA 1K57A 4DMZA 3V5MA 3A3IA 2G2WA 3KSHA 3HUMA 1H8ZA 3UE3A 4DXBA 4OH0A 4YWZA 1KOUA 4EETB 4N1HA 3KX0X 1FR1A 1JWPA 3LIAA 2QZ6A 3BFGA 1AWIA 3S7OA 4QJGA 2Y91A 3VE4A 2V0WA 4C3QA 2Y2JA 5FATA 1DP6A 4R6LA 2Y2MA 3WS1A 4KZBA 3S1YA 2HP6A 3MZEA 4ZRRA 4EBPA 5L2FA 3CZDA 1UWNX 4KZAA 3G34A 3M6BA 4FCFA 4NG2A 3MXSA 1LL9A 1ERMA 5DTSA 3UMEA 5J4EA 3KYZA 2PU4A 3C5AA 4BD0A 5AVEA 4FSFA 4LFUA 4PM5A 2WGWB 5EVLA 4IBXA 3LR4A 4KQDA 3NULA 4KQQA 1CK3A 3HVFA 3LCEA 2XR0A 3HLFA 4CLCB 5G4YA 4I3AA 3E4OA 1T18A 4KG5A 2ZC6B 5GLCA 2ZOIA 1W8YA 2WADA 3F1NB 5DFXA 2I72A 4LV1A 3BM6A 5HWTA 2R9XA 2VEAA 1Q2PA 2J3WA 2J9OA 2VA0A 3CI6A 3MZFA 2ZMFA 2VGJA 2CC1A 4U0TA 5EVIB 3U4LP 3RXWA 4GS9A 4E3MA 2XK1A 2WKPA 4D2OA 4EW7A 1LT0A 2XDMA 4UAAA 4WZ4A 2M1CA 2B95A 2H5SA 5HL6A 4KUOA 4NXFA 3E2KA 4HJ3A 2QJ7A 2EWVA 3P01A 4RQ9A 3C38A 4HESA 5E2HA 3S7PA 5EECA 3BWLA 2JKTI 1TDGA 3AGDA 3UPOA 3PAEA 2ZL1B 3IF6B 3FPVA 1UWPX 4QY5A 1S1ZA 3A3DA 2HP5A 1BULA 4EUVA 3DTIA 4ZJ1A 2PYPA 4KENB 3LEQA 3RXXA 3KSGA 1P0ZA 4LV0A 1HVBA 4OPZA 1PWGA 3RTYA 3LY3A 3WS2A 2P7JA 1ONGA 1FILA 3T4QA 2B5RA 1XJ2A 1BLPA 3TW8A 3PBSA 1ALQA 4RX3A 2OSUA 4G3KA 1K6RA 3UN7A 3HUOA 4HI4A 1VEUB 4IEDA 2RCXA 2KOIA 2IWDA 5TBMB 4S2KA 2QYBA 2Y55A 1MWSA 3IXDA 3HLCA 2Y2HA 4C75A 1Q2QA 1CJFA 5IT5A 1C3BA 4OP5A 4YFMA 2JN7A 4ZJ2A 1OMEA 3BY9A 3V39A 1D7EA 2W1RA 2WKRA 1FCMA 1HD8A 3NECA 3BY8A 3ZQ5A 1HLUP 1XFQA 1W5DA 2PR6A 4U3TA 1YSPA 3IHBA 3Q7VB 1KGGA 5FQJA 5CHMA 5FASA 1I2WA 5I94A 3H7WB 2JKGA 2WUQA 3CUEC 3E4QA 3S7QA 4MNRA 4ARZB 2XF3A 5FSRA 4JPMA 1ESUA 4X68A 2XQZA 1S4RA 3FKWA 5DFYA 2EX8A 4HJ6A 4UA9A 3V3SA 1VB6A 3S4XA 3HLEA 4HH3A 4HY8A 1PZPA 4KQRA 4E3LA 4BWIA 1J9MA 3LICA 2L0WA 4EESA 1LSXA 2Z2MB 3R7WA 4LGWA 1PW8A 4HEFA 4BD1A 4NK3A 3HJKA 3OPRA 3IF5A 4O01A 3OPLA 4S2MA 3IXGA 1MKIA 3IX4A 3BFEA 4DF6A 5A93A 1JTDA 2VLGA 4GB7A 2W1TA 3C4OA 1T1AA 3ICYA 3JVVA 4E3OA 2XROA 1DP9A 4FH2A 2BASA 3LFVA 4HJ4A 2MJ6A 4IUKA 4OQIA 5DTTA 3ZG7B 3G30A 1XXMA 1O7EA 2YKFA 1Y4OA 3CUEA 2RL3A 2WGIA 1NRJA 3BFDA 2ZQ8A 3T4OA 4N1XA 4I3JA 1PNEA 1FIKA 2V2FF 3B47A 3MBZA 5AQAA 3PXPA 1FR6A 3ITAA 3UE6A 3HLDA 1W79A 4EERA 4GD8A 3SS3A 1Y28A 1MKMA 4QY6A 5J8XA 2XEPA 4CQHA 4LCLA 4GDNA 4DRTA 1L3LA 4NKPA 2ZQ7A 1GSWA 4XUZA 5CHJA 4OONA 2IA2A 5F82A 4F3LB 2XLNA 2OLUA 4Y2FA 3C7VA 5L09A 4IJGA 1RP5A 4LCMA 4B88A 4LENA 4PM9A 2FFFB 5FI2A 1F5MA 4O7DA 4P87A 4RVAA 5U47A 1N4OA 3OPHA 3VMAA 3MFXA 3CWFA 3IT9A 4P0MA 2ZBBA 4KZ9A 2ZC3B 5DJUA 3JPUA 4PKYA 3MXQA 4II7A 3WS5A 4D60A 3LIBA 3ULFA 3IHAA 3L9KA 4KQOA 3UO9A 4CJNA 1N9LA 1G6AA 3LR0A 3ZCZA 5FEGA 3NJAA 3GRJA 3OLOA 5KZHA 3VFFA 3D3OA 1OPXA 1ODVA 4R3AA 2ZC7A 2Z6DA 2QJ5A 1QMEA 2A2LA 3D9YA 1I2SA 2XGNA 5CX7A 4LRZE 2WZXA 3TSGA 1IYPA 2XFSA 4OQHA 3IBJA 4GLQA 1XP4A 3F1PB 4WUJA 2HDQA 3IBRA 1CF0A 3DTKA 1BYWA 2JKFA 4IHQA 5GL9A 1IEMA 4P6ZS 2EWWA 2JKRM 3EQVA 3A3JA 1SDEA 4X53A 5HDCA 4HBTA 4UHUA 2V9AA 2Y2LA 3GSGA 3PBRA 2HJEA 2VGLS 3SS5A 3VE3A 2V1BA 3HJIA 1S0WA 4OPYA 4KZ4A 2OV5A 3L7HA 2QKPA 1V9ZA 3N8RA 3DAVA 1XGJA 3LIEA 2ZD8A 4R38A 3SOIA 4OQGA 3MZDA 4KZ7A 3OOVA 1E3UA 1BT5A 1MY8A 4I38A 4Y3IA 3BQ8A 5EPHA 5HD5A 2W0NA 3Q81A 2V1ZA 4GW9A 3CHWP 4ZJ3A 5DF7A 2Q0OA 3LI8A 5CGSA 2ZC5B 3NIAA 3C7UA 1ES5A 4KZ5A 2DCFA 5CGWA 5HWVA 5E2GA 4GHIA 2WAEA 2X71A 2VGLM 1E4DA 1ZG6A 4XT2B 1SKOB 2PBYA 5AJGA 4EU0A 1CI9A 2GDNA 3NDEA 2ZJ9A 2VKSA 1G28A 1L0EA 2R78A 2W3DA 5FAQA 4QHCA 3DTEA 2VK3A 2OAQ1 5GLDA 3ITBA 4M3KA 1P97A 4Y13A 4IBRA 4K91A 4B4XA 2HGVA 1LL8A 5C5KA 2HDUA 4HH2A 5TGFA 2CMNA 1W63M 1NWZA 4KG2A 1GCEA 5HAIA 5CRFA 1K56D 1KDWA 4X1MA 2D01A 3W4OA 2XA7S 5J3WA 2V8CA 4H6JA 4GZBA 4WN5A 5IU1A 1NYYA 5FI6A 4CLCD 5HSQA 4R23A 4WL9A 3C4PA 2XH9A 4X69A 4ME4A 3GQZA 4JXSA 4PAUA 4UEYA 3G32A 1BUEA 3P7NA 4YOFA 1YLZA 2PAVP 3LR3A 3DW0A 1DY6A 4L9GA 3WS0A 1TEMA 3NOUC 1VQQA 3CMZA 3ISGA 5EVID 1KGFA 4A5RA 5EUAA 1HZOA 3I7JA 3N4IA 3OCNA 4EBLA 3PTEA 5AVFA 2XFTA 4E3NA 3ZNYA 5IHVA 5FL3A 2XA7M 4S2NC 1KE4A 3PYPA 4X56A 4JGOA 4QPRA 1GSXA 1SKFA 1BSGA 2HV1A 4JKTA 1ESIA 3LGOA 4KZ8A 3UB9A 4JGQA 2Y2GA 4C6YA 5FQ9A 2PD7A 1P9WA 1KDSA 4LLOB 3HBRA 5FDSA 1LL5A 4E04A 2DNSA 4HP4A 2OWHA 2VV6A 1QMFA 4ZDXA 3P09A 2GX5A 2V1AA 3A0VA 1PFLA 4HBUA 4BBUA 3QNBA 3NY4A 5CGXA 2Q9MA 4R3JA 1E3UD 4IVKA 5HAPA 3ZFZA 3SW1A 1J3WA 3MQQA 2ZM2A 1ERQA 4JXWA 1U60A 1H0MA 3IQAA 3IXHA 2Y59A 2JBFA 3CG5A 3T4LA 1ES2A 4WBGA 2L1MA 3QP8A 5CEBA 1MXOA 4LV2A 5HPIA 5HDDA 3VV4A 4JXVA 3EQUA 2OAP1 1K38A 3RJUA 4OKPA 1UGUA 3HLGA 2EX2A 2BTFP 3HREA 4WEJA 2LB5A 4QD4A 3G6OA 4JBFA 2V20A 4GOGA 3B3XA 4LRXC 1WYCA 3U2AA 4MCWA 2GNXA 1FOFA 4X1LA 4WMCD 4B93A 2FZ0A 5F83A 2XSSA 3BRMA 1FSWA 3IWIA 1LHYA 1XFNA 1K55C 4JF5A 4S2NA 2P9VA 5EOOA 1SDNA 2JKRI 4P85A 4EQ1A 2V8FA 4R0QA 2EXBA 3CPTA 3MSHA 3OCLA 5CHUA 4EBNA 3T4SA 4MMNA 4WZ5C 4EUZA 5DVAA 3A0RA 2M7VA 3C30A 4I3IA 3IWOA 1OTDA 1DJAA 4E3IA 3MQOA 3LUQA 4MN6A 4R1GA 5CECA 2C5WB 2B18A 3KSFA 3PBOA 5HL1A 5AQBA 4WF0A 4WYYA 2HPBA 3GECA 1IFQA 4OPRA 2KX6A 4JXGA 2WAFA 4EV4A 3MF0A 5TR7A 5GHYA 4M4XA 3B33A 3UB6A 3F1OA 4K0WA 2OLVA 4F94A 1XJ6A 5EOEA 4NEED 1ACFA 3KO6A 1I5QA 2PU2A 4FTXA 4DKIA 3UNWA 3BFCA 1TS0A 4BJPA 3SH8A 4GNUA 5HAQA 3BECA 2X01A 3W2ZA 3OPPA 3E98A 5M1AA 3Q1FA 3EWKA 1CEGA 2ZQCA 5CXWA 4PMAA 1K55A 4GCZA 3DBAA 2O9BA 1YMSA 2PR5A 1Y54A 4GN2A 4IUHA 3GV9A 4EWFA 4KG6A 3NCKA 1YPRA 1DJCA 5EVEA 2XRNA 4WZ5A 5A91A 3BW6A 1JWZA 4L9EA 1PI4A 4CPKA 4CLCC 4PM8A 1YM1A 2EFUA 2VV7A 3BFFA 3PBTA 1L0GA 2G2UA 4RYEA 4WM9A 4BQMA 4GS9B 4DDSA 4BL2A 4U0XA 4MN5A 3WRTA 3Q7ZA 5EFWA 1OJ5A 4E6XA 4DN0A 3N8LA 4G3VA 5EVIC 2FFYA 5M19A 4S2JA 1PW1A 4UA6A 3ZYTA 3DWKA 5GHZA 2ACGA 3UDIA 5HZHA 1STZA 1LI9A 2WZZA 4OLDA 1NY0A 3JYIA 1X0OA 2WYXA 3NOPC 5CTNA 3KYEA 2Z2LB 5F1FA 5EV0A 1CI8A 4OOLA 3SH9A 5AQ7A 3TRCA 4N92A 4R4SA 1CQAA 4ZAMA 1NZOA 4BMWA 5MC7A 4DE3A 3MFDA 4EEUA 3MKEA 1K25A 1W63Q 3UDFA 5FA7A 1NLYA 5HWWA 3HUNA 1K56A 1W7FA 4PHTA 1YLYA 1H3QA 2WKHA 1GHIA 2J7VA 4YNRA 2JKTM 2D02A 3C8CA 1PIOA 1H5XA 4L0LA 3MR0A 1IYQA 4GJ4A 5L8MA 2A49A 4CLCA 5L10A 4ESPA 4HOIA 5EE8A 2EA9A 3WS4A 4ID4A 4JF4A 3F1NA 1YQSA 1DJBA 2BG1A 2P9VB 1JVJA 3QNCA 2A24A 4BBVA 1LSWA 1K0KA 5CERA 1VETA 1FCOA 4KUKA 1ZHHB 4DE2A 1N9BA 4Z9QA 5EVIA 1WE4A 1OTBA 2H0TA 2EXAA 2ZC4B 5DJTA 1KVLA 5HFOA 4P6BA 3TOIA 4ZBEA 3FG8A 3H9WA 3K3DA 3AGFA 1MWTA 3BEBA 3VOYA 4JGPA 1A0KA 3F1OB 3IXBA 3NOTC 2AVXA 4OVDA 2VJWA 1FCNA 1PWCA 3ZG9B 2DMWA 1YLJA 1K4FA 1V9YA 2NUTC 3T12B 1EROA 2O0YA 1JTGA 5EM0A 1KVMA 1MWRA 2Z6CA 3GTCA 4R3BA 1XPBA 1YMXA 5E2EA 4PPRA 3G35A 2O9CA 3CJMA 3R7WB 2A3UA 4B4ZA 4GD6A 4I39A 5G4ZA 3AGEA 4P6ZM 3PBQA 3LY4A 4NXGA 5A90A 1T1CA 3E4PA 3V67A 3SS4A 3PHYA 4RA7A 1VEUA 3E0YA 1TD5A 3CAXA 3VSLA 1L0DA 3D72A 5L07A 1P9RA 4OOYA 4QWOA 4CLCE 5J7EA 5IS1A 4WMCA 4RX2A 2W1TB 4KZ3A 3QP2A 5DKKA 5EM1A 4DDYA 1IKIA 3EEAA 2HZ5A 3IX3A 1XJ4A 2KLIA 2Y8HA 4N9KA 3VFHA 3T1QB 1FQGA 1XGIA 3MXRA 4JGRA 4HQAA 1KE0A 4E3KA 2Y4AA 1MBLA 1K54C 4O0PA 2JHEA 2GZAA 3C2WA 1EI5A 4MEZA 2JCHA 3Q7VA 4Q8IA 5G18A 2O9AA 1D06A 1BLSA 4UA7A 2IWCA 5HARA 3H7WA 2OWJA 4I5SA 4NXEA 4ARZA 4YINA 1BZAA 4Z1WA 2O99A 3CITA 5F69A 1O07A 5K5BA 2FH5A 3HLWA 1SCWA 4Y0UA 4MBKA 2WK0A 2HDRA 3W8KA 2Y79A 1H8YA 3FV7A 3IS2A 4Y0OA 3SZTA 2P08A 4HP9A 5FAPA 4S2OA 3P98A 3T1XA 3ZNTA 3B42A 2PHYA 2H0YA 5TJJA 4DJ2A 3TG9A 3VOLA 2ZLYA 1MZUA 3EOIA 3M2JA 4OPQA 3TE8A 1BTLA 5JYPA 5HD3A 2Y2QA 3O88A 2PYRA 4B9OA 3LIDA 4ETZA 1S4SA 1PWDA 2HJ9C 3N7WA 2JC7A 4MDZA 3UB7A 2A24B 3QP1A 1SHVA 4JLFA 4G3WA 3H82A 1VETB 1EWZA 3NHQA 2KDKA 3MJQA 1RGYA 2W3GA 4HHDA 1K54A 3K2NA 3UB5P 5F5YA 1XX2A 1WYBA 3JVUA 2WGVA 1K6SA 5FQKA 4MBHA 4MBFA 3UB8A 3G31A 2J8YA 4JF6A 4Q0IA 1VM1A 2EX9A 1MC0A 3KYQA 4DE1A 2X02A 3BLSA 1TS6A 5E2FA 4EXOA 4NETA 5AQ9A 1IOUA 1ES3A 5CTMA 4Y15A 2PDRA 2ZM0A 2WKEA 2HF6A 2VZWA 4K08A 1F98A 3FWLA 3N6IA 1EW0A 3RH8B 1NYMA 1MWUA 5GLAA 1NXYA 2C6WB 2VGKA 4Q0HA 5M18A 1G68A 3LIFA 2Q9NA 3S22A 4F3LA 3FPWA 4FUWA 3ZG0A 2ZOHA 4EQIA 2WKQA 3KSIA 1XJ3A 3VP1A 1NRFA 3ZVWA 3CLOA 5FEFA 1YT4A 3VSKA 2UV0E 3BQAA 1OT6A 1FSYA 4GHIB 3W4QA 5DKLA 4QB8A 1HTZA 3A3FA 2H28A 2YKHA 2IWBA 4BLMA 2W27A 3EGDC 2W3EA 4N9LA 3OBFA 3G2ZA 3M6HA 2QWSA 5DF9A 3IH9A 2W3HA 3MS6A 1VHMA 2HP9A 3IWQA 2ZMAA 4BL3A 2UWXA 4Q0JA 2P04A 3MQ0A 3QP6A 3O3VA 3V50A 4WEKA 4LRYC 1AXBA 1YKDA 1IKGA 1LI0A 1PYYA 5A8BA 2XD1A 3VOZA 1BLHA 3NI9A 3NDGA 3F1PA 3T50A 1PZOA 2ZQAA 4K0XA 1OT9A 4GKUA 4OP8A 4Y7PA 5FAOA 2J3TD 1IYSA 3D4FA 3BLMA 3PR6A 3T4JA 2WKIA 1RGZA 4LV3A 2Y2OA 2ZMVA 1YLWA 3V3RA 4UQIS 4Y0TA 1TS7A 3UE0A 2ZQ9A 3MMHA 5JYOA 4R70A 5GLBA 1S6RA 4IVIA 4KZ6A 1KGEA 5DF8A 1XA7A 4H6JB 2M7UA 3QP5A 3VP2A 2V0UA 1Z6FA 4BBTA 2G7UA 1IYOA 5F68A 2PRFA 5HX9A 4DJ3A 1PRQA 2K31A 5FI7A 2PT7A 4E6WA 4H8RA 4HNBA 5FQQA 4S2PA 3IS2B 4GDBA 4ETXA 2B02A 5BOHA 1NZUA 3EGXC 1JWVA 2EX6A 3UY6A 3O86A 4PKYG 3E2LA 3PBNA 5F1GA 4E3JA 2L4RA 2QHKA 4FH4A 4WELA 1YAXA 1L2SA 3UPNA 3OC2A 4UQIM 4X6TA 3UMDA 3UPPA 1YSQA 2NUPC 4XT2A 5KSCA 1OJGA 1SKOA 1F2KA 1N9OA 2HDSA 3H82B 1IELA 3NBLA 2I9VA 3W4PA 3N8SA 1JNUA 2QMIA 3G2YA 3A0SA 2VX8A 1YLPA 4X55A 3EEHA 1F9IA 4Y5FA 4ZTKA 3SH7A 4FD8A 3DTMA 3GDIA 3LO7A 3M2KA 4HIAA 5A92A 3QHYA 3LR5A 1K4EA 1XKZA 4L9FA 1Z09A 1DP8A 3UDXA 3ZGAB 3IF6C 3T4KA 4MLLA 5GHXA 4S2LA 4QU3A 2XD5A 4AFIA 1TVFA 1T1BA 3NC8A 1RCJA 3R4KA 3TJZC 1DRMA 5FDHA 1TDLA 4WLAA 1KE3A 1W8QA 3O87A 4OLGA 2WGWA 1ES4A 4PM7A 3GVBA 4S2IA 5I5LA 3UE1A 2ZM8A 3HLBA 2PBDP 1L0FA 2INWA 2W3FA 3PAGA 2LB9A 1YLTA 4FOFA 3S7NA 3T1RA 2ZQDA 1E25A 4DE0A 1S66L 1S1YA 2J9PA 3RFBA 3O5YA 5FQIA 4PM6A 1GA0A 3CPTB 5F6AA 1GHMA 2EFXA 3Q07A 3OZHA 4BENA 1LLBA 3BYDA 1G5UA 2QPNA 5HDSA 3IX8A 4OOMA 1GSVA 2Y2PA 1PI5A 2E8JA 2Y2NA 1OTAA 3HCYA 4R4RA 1CEFA 3VP0A 3K3CA 1GHPA 3WRZA 5HPFA 4XXRA 2K2NA 3FC7A 4O8GA 1K57C 2ZL1A 3LEZA 3IF6A 2PD8A 3GMWA 1OTEA 1NLZA 1T19A 5KMWA 4DXCA 3VP3A 4X25A 5KSHA 2R9WA 5LBRA 3WWXA 1S67L 2OOLA 5HW3A 2GJ3A 1ZKJA 1ZG4A 2VV8A 1N9NA 2DRWA 5D3OA 5E43A 3IH8A 1H8MA 1NJ4A 1M40A 1ZTUA 2JE5A 3T1SA 3HL9A 3DWZA 1WA9A 3QP4A 4NXBA 2J80A 1TS8A 3BJNA
chains in the Genus database with same CATH topology
2J3TC 3UE6A 3KSFA 2K7SA 5HD3A 4EERA 4MN7A 2PYRA 3PBOA 4B9OA 3LIDA 4ETZA 1S4SA 1Y28A 2HJ9C 1MKMA 4WF0A 4MDZA 1LSVA 3UB7A 2A24B 4CQHA 3GECA 1IFQA 4G3WA 4NKPA 3H82A 3LYXA 2KX6A 3LI9A 1GSWA 3NHQA 2KDKA 3MF0A 3MJQA 2W3GA 4M4XA 3B33A 3UB6A 1G6OA 3F1OA 2IA2A 5TBMA 4F3LB 4HHDA 4Y2FA 1XJ6A 4IJGA 3K2NA 4NEED 5F5YA 1OTIA 3KO6A 5KIZA 1F5MA 3JVUA 3T4TA 3UB8A 4EEPA 1TF1A 4LPZA 3MFXA 1TS0A 3CWFA 4Q0IA 2ZBBA 4BJPA 5DJUA 4PKYA 1MC0A 3KYQA 3MXQA 4II7A 3W2ZA 4DMZA 3LIBA 3ULFA 1TS6A 3E98A 4EXOA 4KQOA 3EWKA 1N9LA 3LR0A 1IOUA 3KSHA 3NJAA 3OLOA 2PDRA 2HF6A 2VZWA 4GCZA 3D3OA 1F98A 2O9BA 3DBAA 1OPXA 4K08A 1ODVA 2PR5A 4R3AA 4YWZA 3UE3A 2Z6DA 2QJ5A 4IUHA 2A2LA 3RH8B 1EW0A 1KOUA 4EETB 3KX0X 5CX7A 4LRZE 2XRNA 4Q0HA 3IBJA 3BW6A 3LIAA 4GLQA 3LIFA 4L9EA 3F1PB 3S7OA 4F3LA 3FPWA 4WUJA 3VE4A 2V0WA 3IBRA 2ZOHA 4CLCC 1DP6A 2WKQA 3KSIA 1XJ3A 4R6LA 1BYWA 2VV7A 3CLOA 3PBTA 4IHQA 3BQAA 4ZRRA 1UWNX 4GS9B 1OT6A 4GHIB 4P6ZS 2EWWA 2JKRM 5DKLA 3UMEA 3EQVA 3KYZA 4MN5A 5J4EA 2H28A 2YKHA 5HDCA 5EFWA 1OJ5A 2V9AA 2W27A 3EGDC 2W3EA 5AVEA 3PBRA 2HJEA 2VGLS 3OBFA 3VE3A 2QWSA 2V1BA 3HJIA 4FSFA 4DN0A 5DF9A 4G3VA 2W3HA 3LR4A 4KQDA 1VHMA 2QKPA 3ZYTA 1V9ZA 3LIEA 4R38A 5HZHA 4CLCB 5G4YA 4I3AA 4Q0JA 3E4OA 1T18A 1STZA 2P04A 3MQ0A 4WEKA 1X0OA 2ZOIA 3NOPC 4LRYC 3OOVA 1YKDA 3F1NB 4I38A 5DFXA 5A8BA 4OOLA 4Y3IA 3BQ8A 3TRCA 5HD5A 2W0NA 5HWTA 4GW9A 3F1PA 4BMWA 2VEAA 3T50A 5MC7A 4EEUA 2J3WA 2VA0A 3CI6A 2ZMFA 1OT9A 3LI8A 1W63Q 2J3TD 3PR6A 4GS9A 3T4JA 1NLYA 5HWVA 2WKPA 5HWWA 4EW7A 1LT0A 4GHIA 2M1CA 2ZMVA 5HL6A 4UQIS 4KUOA 4NXFA 1TS7A 4HJ3A 2QJ7A 4PHTA 2VGLM 2EWVA 1H3QA 3P01A 4RQ9A 4XT2B 3MMHA 4YNRA 4R70A 5AJGA 3C38A 2JKTM 2D02A 4EU0A 3S7PA 3C8CA 4H6JB 3BWLA 2JKTI 4L0LA 2M7UA 2VKSA 1G28A 3MR0A 2R78A 2W3DA 4GJ4A 2V0UA 5L8MA 4BBTA 4CLCA 2G7UA 5F68A 4HOIA 2EA9A 4DJ3A 3FPVA 2K31A 2OAQ1 1UWPX 2PT7A 1S1ZA 3F1NA 4HNBA 1P97A 3IS2B 4EUVA 4ETXA 2B02A 2PYPA 2HGVA 3EGXC 1LL8A 5C5KA 2A24A 4BBVA 1LSWA 4PKYG 3KSGA 1P0ZA 3PBNA 4KUKA 1ZHHB 4HH2A 2L4RA 2CMNA 3RTYA 1W63M 2QHKA 4WELA 1YAXA 1OTBA 2P7JA 1NWZA 3T4QA 3OC2A 4UQIM 3UMDA 1XJ2A 2D01A 1YSQA 5DJTA 2NUPC 2XA7S 3TW8A 4XT2A 5J3WA 1OJGA 3PBSA 4H6JA 1N9OA 4G3KA 4WN5A 5IU1A 3FG8A 3H9WA 3H82B 3K3DA 4CLCD 2I9VA 4HI4A 5HSQA 4JGPA 4WL9A 1JNUA 3F1OB 3A0SA 2VX8A 2KOIA 5TBMB 3EEHA 3NOTC 1F9IA 4ME4A 4Y5FA 2VJWA 4PAUA 4UEYA 2QYBA 3P7NA 3GDIA 2DMWA 4YOFA 3LR3A 4HIAA 4L9GA 1V9YA 2NUTC 3NOUC 2O0YA 3LR5A 5IT5A 2JN7A 4L9FA 1DP8A 3OCNA 3BY9A 1D7EA 2W1RA 5AVFA 2WKRA 3T4KA 2Z6CA 5FL3A 2XA7M 3BY8A 3ZQ5A 1XFQA 2O9CA 2PR6A 3PYPA 3R7WB 4AFIA 4I39A 1YSPA 4JGOA 5G4ZA 4QPRA 1GSXA 2HV1A 4P6ZM 1T1BA 3PBQA 4NXGA 3UB9A 1T1CA 4JGQA 3E4PA 3V67A 3R4KA 3TJZC 1DRMA 3PHYA 2PD7A 3H7WB 1P9WA 4LLOB 3CUEC 4WLAA 3E4QA 3S7QA 4E04A 3E0YA 1TD5A 3CAXA 4ARZB 4HP4A 2OWHA 2VV6A 3D72A 2GX5A 2V1AA 5I5LA 3A0VA 4BBUA 1S4RA 1P9RA 2INWA 2W3FA 4CLCE 5J7EA 5IS1A 2LB9A 5DFYA 4FOFA 2W1TB 4HJ6A 3S7NA 1S66L 1S1YA 5DKKA 3SW1A 1VB6A 3MQQA 3EEAA 4HH3A 4HY8A 3RFBA 1XJ4A 2KLIA 3O5YA 4BWIA 2Y8HA 3T4LA 3LICA 2L0WA 4JGRA 4HQAA 5F6AA 4EESA 2L1MA 1LSXA 4O0PA 5HPIA 2JHEA 5HDDA 3R7WA 3VV4A 2GZAA 3C2WA 3EQUA 5HDSA 2O9AA 1D06A 4OOMA 1GSVA 2OAP1 1UGUA 1OTAA 3H7WA 3HJKA 4O01A 3HCYA 2OWJA 4I5SA 4WEJA 2LB5A 3G6OA 4NXEA 3K3CA 4ARZA 5HPFA 2K2NA 3FC7A 4O8GA 4LRXC 4Z1WA 2O99A 3CITA 3U2AA 4MCWA 5F69A 5K5BA 2FH5A 2GNXA 2VLGA 4B93A 2FZ0A 2XSSA 2PD8A 1OTEA 1NLZA 3ICYA 2W1TA 1T1AA 1T19A 1XFNA 3JVVA 2XROA 1DP9A 5KSHA 5LBRA 2Y79A 3IS2A 2BASA 1S67L 2P08A 3LFVA 2OOLA 4HP9A 4HJ4A 2GJ3A 2JKRI 2MJ6A 4EQ1A 2VV8A 1N9NA 4IUKA 3B42A 1H8MA 3OCLA 3T4SA 4MMNA 2PHYA 2YKFA 2M7VA 3A0RA 3C30A 3CUEA 4I3IA 1ZTUA 5TJJA 1NRJA 3T4OA 4I3JA 4DJ2A 1OTDA 3VOLA 3B47A 1MZUA 3MQOA 3EOIA 3LUQA 1WA9A 4MN6A 4NXBA 2J80A 1TS8A 3BJNA 3PXPA 3TE8A 2B18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE6 A;  2K7S A;  5HD3 A;  4EER A;  2PYR A;  4B9O A;  3LID A;  1S4S A;  1Y28 A;  4WF0 A;  1LSV A;  3UB7 A;  2A24 B;  3GEC A;  3H82 A;  3LYX A;  2KX6 A;  3LI9 A;  1GSW A;  3NHQ A;  2KDK A;  3MJQ A;  4M4X A;  3B33 A;  3UB6 A;  3F1O A;  5TBM A;  4F3L B;  4HHD A;  1XJ6 A;  5F5Y A;  1OTI A;  5KIZ A;  3UB8 A;  4EEP A;  4LPZ A;  3MFX A;  1TS0 A;  3CWF A;  2ZBB A;  5DJU A;  4PKY A;  3MXQ A;  3LIB A;  3ULF A;  1TS6 A;  4EXO A;  3EWK A;  1N9L A;  3NJA A;  3OLO A;  2PDR A;  4GCZ A;  4K08 A;  1F98 A;  1ODV A;  2PR5 A;  4R3A A;  4YWZ A;  2Z6D A;  2QJ5 A;  3RH8 B;  1EW0 A;  1KOU A;  4EET B;  3KX0 X;  4LRZ E;  3LIA A;  3LIF A;  4L9E A;  3F1P B;  4F3L A;  4WUJ A;  3VE4 A;  2V0W A;  3IBR A;  2ZOH A;  1DP6 A;  2WKQ A;  1XJ3 A;  4R6L A;  1BYW A;  2VV7 A;  3CLO A;  1UWN X;  4GS9 B;  1OT6 A;  4GHI B;  5DKL A;  3UME A;  5J4E A;  4MN5 A;  2H28 A;  2YKH A;  5HDC A;  5EFW A;  1OJ5 A;  2V9A A;  2W27 A;  5AVE A;  3VE3 A;  2QWS A;  2V1B A;  3HJI A;  4KQD A;  2QKP A;  1V9Z A;  3LIE A;  4R38 A;  5HZH A;  5G4Y A;  4I3A A;  3E4O A;  1T18 A;  1X0O A;  2ZOI A;  3NOP C;  4LRY C;  3F1N B;  4I38 A;  5A8B A;  5HD5 A;  2W0N A;  5HWT A;  4GW9 A;  3F1P A;  2VEA A;  3T50 A;  4EEU A;  1OT9 A;  3LI8 A;  4GS9 A;  5HWW A;  5HWV A;  2WKP A;  4EW7 A;  1LT0 A;  4GHI A;  2M1C A;  4KUO A;  4NXF A;  1TS7 A;  4HJ3 A;  2QJ7 A;  4RQ9 A;  4XT2 B;  4R70 A;  2D02 A;  3C8C A;  4H6J B;  3BWL A;  3MR0 A;  1G28 A;  2R78 A;  2V0U A;  4BBT A;  5F68 A;  4HOI A;  2EA9 A;  4DJ3 A;  1UWP X;  1S1Z A;  3F1N A;  4HNB A;  1P97 A;  3IS2 B;  2B02 A;  2PYP A;  1LL8 A;  2A24 A;  4BBV A;  1LSW A;  4PKY G;  1P0Z A;  4KUK A;  4HH2 A;  2L4R A;  2CMN A;  3RTY A;  2QHK A;  2P7J A;  1OTB A;  1NWZ A;  3UMD A;  1XJ2 A;  2D01 A;  5DJT A;  4XT2 A;  5J3W A;  1OJG A;  4H6J A;  1N9O A;  4WN5 A;  5IU1 A;  3FG8 A;  3H9W A;  3H82 B;  3K3D A;  2I9V A;  4HI4 A;  5HSQ A;  4JGP A;  4WL9 A;  1JNU A;  3F1O B;  3A0S A;  5TBM B;  3EEH A;  3NOT C;  1F9I A;  3P7N A;  3GDI A;  4HIA A;  4L9G A;  1V9Y A;  3NOU C;  2JN7 A;  4L9F A;  1DP8 A;  3BY9 A;  1D7E A;  5AVF A;  2WKR A;  2Z6C A;  3BY8 A;  3ZQ5 A;  1XFQ A;  3PYP A;  2PR6 A;  4I39 A;  4JGO A;  5G4Z A;  1GSX A;  2HV1 A;  1T1B A;  4NXG A;  3UB9 A;  1T1C A;  4JGQ A;  3E4P A;  1DRM A;  3PHY A;  2PD7 A;  3H7W B;  4LLO B;  4WLA A;  3E4Q A;  4E04 A;  3CAX A;  4HP4 A;  2OWH A;  2VV6 A;  3D72 A;  2V1A A;  5I5L A;  3A0V A;  4BBU A;  1S4R A;  2INW A;  5J7E A;  5IS1 A;  4HJ6 A;  1S66 L;  1S1Y A;  5DKK A;  3SW1 A;  1VB6 A;  3MQQ A;  4HH3 A;  4HY8 A;  1XJ4 A;  3LIC A;  2L0W A;  4JGR A;  4HQA A;  5F6A A;  4EES A;  2L1M A;  1LSX A;  2JHE A;  5HDD A;  3C2W A;  5HDS A;  1D06 A;  1GSV A;  1UGU A;  1OTA A;  3H7W A;  3HJK A;  2OWJ A;  4I5S A;  3G6O A;  4NXE A;  3K3C A;  3FC7 A;  4LRX C;  5F69 A;  2VLG A;  2PD8 A;  1OTE A;  3ICY A;  1T1A A;  1T19 A;  1XFN A;  1DP9 A;  3IS2 A;  2BAS A;  1S67 L;  2OOL A;  4HP9 A;  4HJ4 A;  2GJ3 A;  4EQ1 A;  2VV8 A;  1N9N A;  2PHY A;  2YKF A;  3A0R A;  4I3I A;  4I3J A;  4DJ2 A;  1OTD A;  3VOL A;  1MZU A;  3MQO A;  3LUQ A;  1WA9 A;  4MN6 A;  4NXB A;  2J80 A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 5DTK A;  2J3T C;  1GA9 A;  2K7S A;  2BLS A;  1BLC A;  5FQM A;  4MN7 A;  1M6K A;  3FZC A;  4OQ0 A;  3GR2 A;  3Q82 A;  1LSV A;  4XUX A;  1ONH A;  3ZDJ A;  2Y2I A;  3LYX A;  1D1J A;  2E8I A;  1SZV A;  2P74 A;  3LI9 A;  3VP4 A;  3A3E A;  5TFQ A;  1G6O A;  4Y17 A;  1ZC2 A;  5TBM A;  3ZVT A;  1XA1 A;  3ZG8 B;  1OTI A;  3ZG5 A;  5KIZ A;  1MPL A;  3ZHH A;  3FYZ A;  3MKF A;  3G4P A;  3T4T A;  2Y2K A;  4EEP A;  1TF1 A;  2H10 A;  5CED A;  4LPZ A;  3FKV A;  1K57 A;  4DMZ A;  3V5M A;  3A3I A;  2G2W A;  3KSH A;  3HUM A;  1H8Z A;  3UE3 A;  4DXB A;  4OH0 A;  4YWZ A;  1KOU A;  4EET B;  4N1H A;  3KX0 X;  1FR1 A;  1JWP A;  3LIA A;  2QZ6 A;  3BFG A;  1AWI A;  3S7O A;  4QJG A;  2Y91 A;  3VE4 A;  2V0W A;  4C3Q A;  2Y2J A;  5FAT A;  1DP6 A;  4R6L A;  2Y2M A;  3WS1 A;  4KZB A;  3S1Y A;  2HP6 A;  3MZE A;  4ZRR A;  4EBP A;  5L2F A;  3CZD A;  1UWN X;  4KZA A;  3G34 A;  3M6B A;  4FCF A;  4NG2 A;  3MXS A;  1LL9 A;  1ERM A;  5DTS A;  3UME A;  5J4E A;  3KYZ A;  2PU4 A;  3C5A A;  4BD0 A;  5AVE A;  4FSF A;  4LFU A;  4PM5 A;  2WGW B;  5EVL A;  4IBX A;  3LR4 A;  4KQD A;  3NUL A;  4KQQ A;  1CK3 A;  3HVF A;  3LCE A;  2XR0 A;  3HLF A;  4CLC B;  5G4Y A;  4I3A A;  3E4O A;  1T18 A;  4KG5 A;  2ZC6 B;  5GLC A;  2ZOI A;  1W8Y A;  2WAD A;  3F1N B;  5DFX A;  2I72 A;  4LV1 A;  3BM6 A;  5HWT A;  2R9X A;  2VEA A;  1Q2P A;  2J3W A;  2J9O A;  2VA0 A;  3CI6 A;  3MZF A;  2ZMF A;  2VGJ A;  2CC1 A;  4U0T A;  5EVI B;  3U4L P;  3RXW A;  4GS9 A;  4E3M A;  2XK1 A;  2WKP A;  4D2O A;  4EW7 A;  1LT0 A;  2XDM A;  4UAA A;  4WZ4 A;  2M1C A;  2B95 A;  2H5S A;  5HL6 A;  4KUO A;  4NXF A;  3E2K A;  4HJ3 A;  2QJ7 A;  2EWV A;  3P01 A;  4RQ9 A;  3C38 A;  4HES A;  5E2H A;  3S7P A;  5EEC A;  3BWL A;  2JKT I;  1TDG A;  3AGD A;  3UPO A;  3PAE A;  2ZL1 B;  3IF6 B;  3FPV A;  1UWP X;  4QY5 A;  1S1Z A;  3A3D A;  2HP5 A;  1BUL A;  4EUV A;  3DTI A;  4ZJ1 A;  2PYP A;  4KEN B;  3LEQ A;  3RXX A;  3KSG A;  1P0Z A;  4LV0 A;  1HVB A;  4OPZ A;  1PWG A;  3RTY A;  3LY3 A;  3WS2 A;  2P7J A;  1ONG A;  1FIL A;  3T4Q A;  2B5R A;  1XJ2 A;  1BLP A;  3TW8 A;  3PBS A;  1ALQ A;  4RX3 A;  2OSU A;  4G3K A;  1K6R A;  3UN7 A;  3HUO A;  4HI4 A;  1VEU B;  4IED A;  2RCX A;  2KOI A;  2IWD A;  5TBM B;  4S2K A;  2QYB A;  2Y55 A;  1MWS A;  3IXD A;  3HLC A;  2Y2H A;  4C75 A;  1Q2Q A;  1CJF A;  5IT5 A;  1C3B A;  4OP5 A;  4YFM A;  2JN7 A;  4ZJ2 A;  1OME A;  3BY9 A;  3V39 A;  1D7E A;  2W1R A;  2WKR A;  1FCM A;  1HD8 A;  3NEC A;  3BY8 A;  3ZQ5 A;  1HLU P;  1XFQ A;  1W5D A;  2PR6 A;  4U3T A;  1YSP A;  3IHB A;  3Q7V B;  1KGG A;  5FQJ A;  5CHM A;  5FAS A;  1I2W A;  5I94 A;  3H7W B;  2JKG A;  2WUQ A;  3CUE C;  3E4Q A;  3S7Q A;  4MNR A;  4ARZ B;  2XF3 A;  5FSR A;  4JPM A;  1ESU A;  4X68 A;  2XQZ A;  1S4R A;  3FKW A;  5DFY A;  2EX8 A;  4HJ6 A;  4UA9 A;  3V3S A;  1VB6 A;  3S4X A;  3HLE A;  4HH3 A;  4HY8 A;  1PZP A;  4KQR A;  4E3L A;  4BWI A;  1J9M A;  3LIC A;  2L0W A;  4EES A;  1LSX A;  2Z2M B;  3R7W A;  4LGW A;  1PW8 A;  4HEF A;  4BD1 A;  4NK3 A;  3HJK A;  3OPR A;  3IF5 A;  4O01 A;  3OPL A;  4S2M A;  3IXG A;  1MKI A;  3IX4 A;  3BFE A;  4DF6 A;  5A93 A;  1JTD A;  2VLG A;  4GB7 A;  2W1T A;  3C4O A;  1T1A A;  3ICY A;  3JVV A;  4E3O A;  2XRO A;  1DP9 A;  4FH2 A;  2BAS A;  3LFV A;  4HJ4 A;  2MJ6 A;  4IUK A;  4OQI A;  5DTT A;  3ZG7 B;  3G30 A;  1XXM A;  1O7E A;  2YKF A;  1Y4O A;  3CUE A;  2RL3 A;  2WGI A;  1NRJ A;  3BFD A;  2ZQ8 A;  3T4O A;  4N1X A;  4I3J A;  1PNE A;  1FIK A;  2V2F F;  3B47 A;  3MBZ A;  5AQA A;  3PXP A;  1FR6 A;  3ITA A;  3UE6 A;  3HLD A;  1W79 A;  4EER A;  4GD8 A;  3SS3 A;  1Y28 A;  1MKM A;  4QY6 A;  5J8X A;  2XEP A;  4CQH A;  4LCL A;  4GDN A;  4DRT A;  1L3L A;  4NKP A;  2ZQ7 A;  1GSW A;  4XUZ A;  5CHJ A;  4OON A;  2IA2 A;  5F82 A;  4F3L B;  2XLN A;  2OLU A;  4Y2F A;  3C7V A;  5L09 A;  4IJG A;  1RP5 A;  4LCM A;  4B88 A;  4LEN A;  4PM9 A;  2FFF B;  5FI2 A;  1F5M A;  4O7D A;  4P87 A;  4RVA A;  5U47 A;  1N4O A;  3OPH A;  3VMA A;  3MFX A;  3CWF A;  3IT9 A;  4P0M A;  2ZBB A;  4KZ9 A;  2ZC3 B;  5DJU A;  3JPU A;  4PKY A;  3MXQ A;  4II7 A;  3WS5 A;  4D60 A;  3LIB A;  3ULF A;  3IHA A;  3L9K A;  4KQO A;  3UO9 A;  4CJN A;  1N9L A;  1G6A A;  3LR0 A;  3ZCZ A;  5FEG A;  3NJA A;  3GRJ A;  3OLO A;  5KZH A;  3VFF A;  3D3O A;  1OPX A;  1ODV A;  4R3A A;  2ZC7 A;  2Z6D A;  2QJ5 A;  1QME A;  2A2L A;  3D9Y A;  1I2S A;  2XGN A;  5CX7 A;  4LRZ E;  2WZX A;  3TSG A;  1IYP A;  2XFS A;  4OQH A;  3IBJ A;  4GLQ A;  1XP4 A;  3F1P B;  4WUJ A;  2HDQ A;  3IBR A;  1CF0 A;  3DTK A;  1BYW A;  2JKF A;  4IHQ A;  5GL9 A;  1IEM A;  4P6Z S;  2EWW A;  2JKR M;  3EQV A;  3A3J A;  1SDE A;  4X53 A;  5HDC A;  4HBT A;  4UHU A;  2V9A A;  2Y2L A;  3GSG A;  3PBR A;  2HJE A;  2VGL S;  3SS5 A;  3VE3 A;  2V1B A;  3HJI A;  1S0W A;  4OPY A;  4KZ4 A;  2OV5 A;  3L7H A;  2QKP A;  1V9Z A;  3N8R A;  3DAV A;  1XGJ A;  3LIE A;  2ZD8 A;  4R38 A;  3SOI A;  4OQG A;  3MZD A;  4KZ7 A;  3OOV A;  1E3U A;  1BT5 A;  1MY8 A;  4I38 A;  4Y3I A;  3BQ8 A;  5EPH A;  5HD5 A;  2W0N A;  3Q81 A;  2V1Z A;  4GW9 A;  3CHW P;  4ZJ3 A;  5DF7 A;  2Q0O A;  3LI8 A;  5CGS A;  2ZC5 B;  3NIA A;  3C7U A;  1ES5 A;  4KZ5 A;  2DCF A;  5CGW A;  5HWV A;  5E2G A;  4GHI A;  2WAE A;  2X71 A;  2VGL M;  1E4D A;  1ZG6 A;  4XT2 B;  1SKO B;  2PBY A;  5AJG A;  4EU0 A;  1CI9 A;  2GDN A;  3NDE A;  2ZJ9 A;  2VKS A;  1G28 A;  1L0E A;  2R78 A;  2W3D A;  5FAQ A;  4QHC A;  3DTE A;  2VK3 A;  2OAQ 1;  5GLD A;  3ITB A;  4M3K A;  1P97 A;  4Y13 A;  4IBR A;  4K91 A;  4B4X A;  2HGV A;  1LL8 A;  5C5K A;  2HDU A;  4HH2 A;  5TGF A;  2CMN A;  1W63 M;  1NWZ A;  4KG2 A;  1GCE A;  5HAI A;  5CRF A;  1K56 D;  1KDW A;  4X1M A;  2D01 A;  3W4O A;  2XA7 S;  5J3W A;  2V8C A;  4H6J A;  4GZB A;  4WN5 A;  5IU1 A;  1NYY A;  5FI6 A;  4CLC D;  5HSQ A;  4R23 A;  4WL9 A;  3C4P A;  2XH9 A;  4X69 A;  4ME4 A;  3GQZ A;  4JXS A;  4PAU A;  4UEY A;  3G32 A;  1BUE A;  3P7N A;  4YOF A;  1YLZ A;  2PAV P;  3LR3 A;  3DW0 A;  1DY6 A;  4L9G A;  3WS0 A;  1TEM A;  3NOU C;  1VQQ A;  3CMZ A;  3ISG A;  5EVI D;  1KGF A;  4A5R A;  5EUA A;  1HZO A;  3I7J A;  3N4I A;  3OCN A;  4EBL A;  3PTE A;  5AVF A;  2XFT A;  4E3N A;  3ZNY A;  5IHV A;  5FL3 A;  2XA7 M;  4S2N C;  1KE4 A;  3PYP A;  4X56 A;  4JGO A;  4QPR A;  1GSX A;  1SKF A;  1BSG A;  2HV1 A;  4JKT A;  1ESI A;  3LGO A;  4KZ8 A;  3UB9 A;  4JGQ A;  2Y2G A;  4C6Y A;  5FQ9 A;  2PD7 A;  1P9W A;  1KDS A;  4LLO B;  3HBR A;  5FDS A;  1LL5 A;  4E04 A;  2DNS A;  4HP4 A;  2OWH A;  2VV6 A;  1QMF A;  4ZDX A;  3P09 A;  2GX5 A;  2V1A A;  3A0V A;  1PFL A;  4HBU A;  4BBU A;  3QNB A;  3NY4 A;  5CGX A;  2Q9M A;  4R3J A;  1E3U D;  4IVK A;  5HAP A;  3ZFZ A;  3SW1 A;  1J3W A;  3MQQ A;  2ZM2 A;  1ERQ A;  4JXW A;  1U60 A;  1H0M A;  3IQA A;  3IXH A;  2Y59 A;  2JBF A;  3CG5 A;  3T4L A;  1ES2 A;  4WBG A;  2L1M A;  3QP8 A;  5CEB A;  1MXO A;  4LV2 A;  5HPI A;  5HDD A;  3VV4 A;  4JXV A;  3EQU A;  2OAP 1;  1K38 A;  3RJU A;  4OKP A;  1UGU A;  3HLG A;  2EX2 A;  2BTF P;  3HRE A;  4WEJ A;  2LB5 A;  4QD4 A;  3G6O A;  4JBF A;  2V20 A;  4GOG A;  3B3X A;  4LRX C;  1WYC A;  3U2A A;  4MCW A;  2GNX A;  1FOF A;  4X1L A;  4WMC D;  4B93 A;  2FZ0 A;  5F83 A;  2XSS A;  3BRM A;  1FSW A;  3IWI A;  1LHY A;  1XFN A;  1K55 C;  4JF5 A;  4S2N A;  2P9V A;  5EOO A;  1SDN A;  2JKR I;  4P85 A;  4EQ1 A;  2V8F A;  4R0Q A;  2EXB A;  3CPT A;  3MSH A;  3OCL A;  5CHU A;  4EBN A;  3T4S A;  4MMN A;  4WZ5 C;  4EUZ A;  5DVA A;  3A0R A;  2M7V A;  3C30 A;  4I3I A;  3IWO A;  1OTD A;  1DJA A;  4E3I A;  3MQO A;  3LUQ A;  4MN6 A;  4R1G A;  5CEC A;  2C5W B;  2B18 A;  3KSF A;  3PBO A;  5HL1 A;  5AQB A;  4WF0 A;  4WYY A;  2HPB A;  3GEC A;  1IFQ A;  4OPR A;  2KX6 A;  4JXG A;  2WAF A;  4EV4 A;  3MF0 A;  5TR7 A;  5GHY A;  4M4X A;  3B33 A;  3UB6 A;  3F1O A;  4K0W A;  2OLV A;  4F94 A;  1XJ6 A;  5EOE A;  4NEE D;  1ACF A;  3KO6 A;  1I5Q A;  2PU2 A;  4FTX A;  4DKI A;  3UNW A;  3BFC A;  1TS0 A;  4BJP A;  3SH8 A;  4GNU A;  5HAQ A;  3BEC A;  2X01 A;  3W2Z A;  3OPP A;  3E98 A;  5M1A A;  3Q1F A;  3EWK A;  1CEG A;  2ZQC A;  5CXW A;  4PMA A;  1K55 A;  4GCZ A;  3DBA A;  2O9B A;  1YMS A;  2PR5 A;  1Y54 A;  4GN2 A;  4IUH A;  3GV9 A;  4EWF A;  4KG6 A;  3NCK A;  1YPR A;  1DJC A;  5EVE A;  2XRN A;  4WZ5 A;  5A91 A;  3BW6 A;  1JWZ A;  4L9E A;  1PI4 A;  4CPK A;  4CLC C;  4PM8 A;  1YM1 A;  2EFU A;  2VV7 A;  3BFF A;  3PBT A;  1L0G A;  2G2U A;  4RYE A;  4WM9 A;  4BQM A;  4GS9 B;  4DDS A;  4BL2 A;  4U0X A;  4MN5 A;  3WRT A;  3Q7Z A;  5EFW A;  1OJ5 A;  4E6X A;  4DN0 A;  3N8L A;  4G3V A;  5EVI C;  2FFY A;  5M19 A;  4S2J A;  1PW1 A;  4UA6 A;  3ZYT A;  3DWK A;  5GHZ A;  2ACG A;  3UDI A;  5HZH A;  1STZ A;  1LI9 A;  2WZZ A;  4OLD A;  1NY0 A;  3JYI A;  1X0O A;  2WYX A;  3NOP C;  5CTN A;  3KYE A;  2Z2L B;  5F1F A;  5EV0 A;  1CI8 A;  4OOL A;  3SH9 A;  5AQ7 A;  3TRC A;  4N92 A;  4R4S A;  1CQA A;  4ZAM A;  1NZO A;  4BMW A;  5MC7 A;  4DE3 A;  3MFD A;  4EEU A;  3MKE A;  1K25 A;  1W63 Q;  3UDF A;  5FA7 A;  1NLY A;  5HWW A;  3HUN A;  1K56 A;  1W7F A;  4PHT A;  1YLY A;  1H3Q A;  2WKH A;  1GHI A;  2J7V A;  4YNR A;  2JKT M;  2D02 A;  3C8C A;  1PIO A;  1H5X A;  4L0L A;  3MR0 A;  1IYQ A;  4GJ4 A;  5L8M A;  2A49 A;  4CLC A;  5L10 A;  4ESP A;  4HOI A;  5EE8 A;  2EA9 A;  3WS4 A;  4ID4 A;  4JF4 A;  3F1N A;  1YQS A;  1DJB A;  2BG1 A;  2P9V B;  1JVJ A;  3QNC A;  2A24 A;  4BBV A;  1LSW A;  1K0K A;  5CER A;  1VET A;  1FCO A;  4KUK A;  1ZHH B;  4DE2 A;  1N9B A;  4Z9Q A;  5EVI A;  1WE4 A;  1OTB A;  2H0T A;  2EXA A;  2ZC4 B;  5DJT A;  1KVL A;  5HFO A;  4P6B A;  3TOI A;  4ZBE A;  3FG8 A;  3H9W A;  3K3D A;  3AGF A;  1MWT A;  3BEB A;  3VOY A;  4JGP A;  1A0K A;  3F1O B;  3IXB A;  3NOT C;  2AVX A;  4OVD A;  2VJW A;  1FCN A;  1PWC A;  3ZG9 B;  2DMW A;  1YLJ A;  1K4F A;  1V9Y A;  2NUT C;  3T12 B;  1ERO A;  2O0Y A;  1JTG A;  5EM0 A;  1KVM A;  1MWR A;  2Z6C A;  3GTC A;  4R3B A;  1XPB A;  1YMX A;  5E2E A;  4PPR A;  3G35 A;  2O9C A;  3CJM A;  3R7W B;  2A3U A;  4B4Z A;  4GD6 A;  4I39 A;  5G4Z A;  3AGE A;  4P6Z M;  3PBQ A;  3LY4 A;  4NXG A;  5A90 A;  1T1C A;  3E4P A;  3V67 A;  3SS4 A;  3PHY A;  4RA7 A;  1VEU A;  3E0Y A;  1TD5 A;  3CAX A;  3VSL A;  1L0D A;  3D72 A;  5L07 A;  1P9R A;  4OOY A;  4QWO A;  4CLC E;  5J7E A;  5IS1 A;  4WMC A;  4RX2 A;  2W1T B;  4KZ3 A;  3QP2 A;  5DKK A;  5EM1 A;  4DDY A;  1IKI A;  3EEA A;  2HZ5 A;  3IX3 A;  1XJ4 A;  2KLI A;  2Y8H A;  4N9K A;  3VFH A;  3T1Q B;  1FQG A;  1XGI A;  3MXR A;  4JGR A;  4HQA A;  1KE0 A;  4E3K A;  2Y4A A;  1MBL A;  1K54 C;  4O0P A;  2JHE A;  2GZA A;  3C2W A;  1EI5 A;  4MEZ A;  2JCH A;  3Q7V A;  4Q8I A;  5G18 A;  2O9A A;  1D06 A;  1BLS A;  4UA7 A;  2IWC A;  5HAR A;  3H7W A;  2OWJ A;  4I5S A;  4NXE A;  4ARZ A;  4YIN A;  1BZA A;  4Z1W A;  2O99 A;  3CIT A;  5F69 A;  1O07 A;  5K5B A;  2FH5 A;  3HLW A;  1SCW A;  4Y0U A;  4MBK A;  2WK0 A;  2HDR A;  3W8K A;  2Y79 A;  1H8Y A;  3FV7 A;  3IS2 A;  4Y0O A;  3SZT A;  2P08 A;  4HP9 A;  5FAP A;  4S2O A;  3P98 A;  3T1X A;  3ZNT A;  3B42 A;  2PHY A;  2H0Y A;  5TJJ A;  4DJ2 A;  3TG9 A;  3VOL A;  2ZLY A;  1MZU A;  3EOI A;  3M2J A;  4OPQ A;  3TE8 A;  1BTL A;  5JYP A;  5HD3 A;  2Y2Q A;  3O88 A;  2PYR A;  4B9O A;  3LID A;  4ETZ A;  1S4S A;  1PWD A;  2HJ9 C;  3N7W A;  2JC7 A;  4MDZ A;  3UB7 A;  2A24 B;  3QP1 A;  1SHV A;  4JLF A;  4G3W A;  3H82 A;  1VET B;  1EWZ A;  3NHQ A;  2KDK A;  3MJQ A;  1RGY A;  2W3G A;  4HHD A;  1K54 A;  3K2N A;  3UB5 P;  5F5Y A;  1XX2 A;  1WYB A;  3JVU A;  2WGV A;  1K6S A;  5FQK A;  4MBH A;  4MBF A;  3UB8 A;  3G31 A;  2J8Y A;  4JF6 A;  4Q0I A;  1VM1 A;  2EX9 A;  1MC0 A;  3KYQ A;  4DE1 A;  2X02 A;  3BLS A;  1TS6 A;  5E2F A;  4EXO A;  4NET A;  5AQ9 A;  1IOU A;  1ES3 A;  5CTM A;  4Y15 A;  2PDR A;  2ZM0 A;  2WKE A;  2HF6 A;  2VZW A;  4K08 A;  1F98 A;  3FWL A;  3N6I A;  1EW0 A;  3RH8 B;  1NYM A;  1MWU A;  5GLA A;  1NXY A;  2C6W B;  2VGK A;  4Q0H A;  5M18 A;  1G68 A;  3LIF A;  2Q9N A;  3S22 A;  4F3L A;  3FPW A;  4FUW A;  3ZG0 A;  2ZOH A;  4EQI A;  2WKQ A;  3KSI A;  1XJ3 A;  3VP1 A;  1NRF A;  3ZVW A;  3CLO A;  5FEF A;  1YT4 A;  3VSK A;  2UV0 E;  3BQA A;  1OT6 A;  1FSY A;  4GHI B;  3W4Q A;  5DKL A;  4QB8 A;  1HTZ A;  3A3F A;  2H28 A;  2YKH A;  2IWB A;  4BLM A;  2W27 A;  3EGD C;  2W3E A;  4N9L A;  3OBF A;  3G2Z A;  3M6H A;  2QWS A;  5DF9 A;  3IH9 A;  2W3H A;  3MS6 A;  1VHM A;  2HP9 A;  3IWQ A;  2ZMA A;  4BL3 A;  2UWX A;  4Q0J A;  2P04 A;  3MQ0 A;  3QP6 A;  3O3V A;  3V50 A;  4WEK A;  4LRY C;  1AXB A;  1YKD A;  1IKG A;  1LI0 A;  1PYY A;  5A8B A;  2XD1 A;  3VOZ A;  1BLH A;  3NI9 A;  3NDG A;  3F1P A;  3T50 A;  1PZO A;  2ZQA A;  4K0X A;  1OT9 A;  4GKU A;  4OP8 A;  4Y7P A;  5FAO A;  2J3T D;  1IYS A;  3D4F A;  3BLM A;  3PR6 A;  3T4J A;  2WKI A;  1RGZ A;  4LV3 A;  2Y2O A;  2ZMV A;  1YLW A;  3V3R A;  4UQI S;  4Y0T A;  1TS7 A;  3UE0 A;  2ZQ9 A;  3MMH A;  5JYO A;  4R70 A;  5GLB A;  1S6R A;  4IVI A;  4KZ6 A;  1KGE A;  5DF8 A;  1XA7 A;  4H6J B;  2M7U A;  3QP5 A;  3VP2 A;  2V0U A;  1Z6F A;  4BBT A;  2G7U A;  1IYO A;  5F68 A;  2PRF A;  5HX9 A;  4DJ3 A;  1PRQ A;  2K31 A;  5FI7 A;  2PT7 A;  4E6W A;  4H8R A;  4HNB A;  5FQQ A;  4S2P A;  3IS2 B;  4GDB A;  4ETX A;  2B02 A;  5BOH A;  1NZU A;  3EGX C;  1JWV A;  2EX6 A;  3UY6 A;  3O86 A;  4PKY G;  3E2L A;  3PBN A;  5F1G A;  4E3J A;  2L4R A;  2QHK A;  4FH4 A;  4WEL A;  1YAX A;  1L2S A;  3UPN A;  3OC2 A;  4UQI M;  4X6T A;  3UMD A;  3UPP A;  1YSQ A;  2NUP C;  4XT2 A;  5KSC A;  1OJG A;  1SKO A;  1F2K A;  1N9O A;  2HDS A;  3H82 B;  1IEL A;  3NBL A;  2I9V A;  3W4P A;  3N8S A;  1JNU A;  2QMI A;  3G2Y A;  3A0S A;  2VX8 A;  1YLP A;  4X55 A;  3EEH A;  1F9I A;  4Y5F A;  4ZTK A;  3SH7 A;  4FD8 A;  3DTM A;  3GDI A;  3LO7 A;  3M2K A;  4HIA A;  5A92 A;  3QHY A;  3LR5 A;  1K4E A;  1XKZ A;  4L9F A;  1Z09 A;  1DP8 A;  3UDX A;  3ZGA B;  3IF6 C;  3T4K A;  4MLL A;  5GHX A;  4S2L A;  4QU3 A;  2XD5 A;  4AFI A;  1TVF A;  1T1B A;  3NC8 A;  1RCJ A;  3R4K A;  3TJZ C;  1DRM A;  5FDH A;  1TDL A;  4WLA A;  1KE3 A;  1W8Q A;  3O87 A;  4OLG A;  2WGW A;  1ES4 A;  4PM7 A;  3GVB A;  4S2I A;  5I5L A;  3UE1 A;  2ZM8 A;  3HLB A;  2PBD P;  1L0F A;  2INW A;  2W3F A;  3PAG A;  2LB9 A;  1YLT A;  4FOF A;  3S7N A;  3T1R A;  2ZQD A;  1E25 A;  4DE0 A;  1S66 L;  1S1Y A;  2J9P A;  3RFB A;  3O5Y A;  5FQI A;  4PM6 A;  1GA0 A;  3CPT B;  5F6A A;  1GHM A;  2EFX A;  3Q07 A;  3OZH A;  4BEN A;  1LLB A;  3BYD A;  1G5U A;  2QPN A;  5HDS A;  3IX8 A;  4OOM A;  1GSV A;  2Y2P A;  1PI5 A;  2E8J A;  2Y2N A;  1OTA A;  3HCY A;  4R4R A;  1CEF A;  3VP0 A;  3K3C A;  1GHP A;  3WRZ A;  5HPF A;  4XXR A;  2K2N A;  3FC7 A;  4O8G A;  1K57 C;  2ZL1 A;  3LEZ A;  3IF6 A;  2PD8 A;  3GMW A;  1OTE A;  1NLZ A;  1T19 A;  5KMW A;  4DXC A;  3VP3 A;  4X25 A;  5KSH A;  2R9W A;  5LBR A;  3WWX A;  1S67 L;  2OOL A;  5HW3 A;  2GJ3 A;  1ZKJ A;  1ZG4 A;  2VV8 A;  1N9N A;  2DRW A;  5D3O A;  5E43 A;  3IH8 A;  1H8M A;  1NJ4 A;  1M40 A;  1ZTU A;  2JE5 A;  3T1S A;  3HL9 A;  3DWZ A;  1WA9 A;  3QP4 A;  4NXB A;  2J80 A;  1TS8 A;  3BJN A; 
#chains in the Genus database with same CATH homology
 2J3T C;  3UE6 A;  3KSF A;  2K7S A;  5HD3 A;  4EER A;  4MN7 A;  2PYR A;  3PBO A;  4B9O A;  3LID A;  4ETZ A;  1S4S A;  1Y28 A;  2HJ9 C;  1MKM A;  4WF0 A;  4MDZ A;  1LSV A;  3UB7 A;  2A24 B;  4CQH A;  3GEC A;  1IFQ A;  4G3W A;  4NKP A;  3H82 A;  3LYX A;  2KX6 A;  3LI9 A;  1GSW A;  3NHQ A;  2KDK A;  3MF0 A;  3MJQ A;  2W3G A;  4M4X A;  3B33 A;  3UB6 A;  1G6O A;  3F1O A;  2IA2 A;  5TBM A;  4F3L B;  4HHD A;  4Y2F A;  1XJ6 A;  4IJG A;  3K2N A;  4NEE D;  5F5Y A;  1OTI A;  3KO6 A;  5KIZ A;  1F5M A;  3JVU A;  3T4T A;  3UB8 A;  4EEP A;  1TF1 A;  4LPZ A;  3MFX A;  1TS0 A;  3CWF A;  4Q0I A;  2ZBB A;  4BJP A;  5DJU A;  4PKY A;  1MC0 A;  3KYQ A;  3MXQ A;  4II7 A;  3W2Z A;  4DMZ A;  3LIB A;  3ULF A;  1TS6 A;  3E98 A;  4EXO A;  4KQO A;  3EWK A;  1N9L A;  3LR0 A;  1IOU A;  3KSH A;  3NJA A;  3OLO A;  2PDR A;  2HF6 A;  2VZW A;  4GCZ A;  3D3O A;  1F98 A;  2O9B A;  3DBA A;  1OPX A;  4K08 A;  1ODV A;  2PR5 A;  4R3A A;  4YWZ A;  3UE3 A;  2Z6D A;  2QJ5 A;  4IUH A;  2A2L A;  3RH8 B;  1EW0 A;  1KOU A;  4EET B;  3KX0 X;  5CX7 A;  4LRZ E;  2XRN A;  4Q0H A;  3IBJ A;  3BW6 A;  3LIA A;  4GLQ A;  3LIF A;  4L9E A;  3F1P B;  3S7O A;  4F3L A;  3FPW A;  4WUJ A;  3VE4 A;  2V0W A;  3IBR A;  2ZOH A;  4CLC C;  1DP6 A;  2WKQ A;  3KSI A;  1XJ3 A;  4R6L A;  1BYW A;  2VV7 A;  3CLO A;  3PBT A;  4IHQ A;  3BQA A;  4ZRR A;  1UWN X;  4GS9 B;  1OT6 A;  4GHI B;  4P6Z S;  2EWW A;  2JKR M;  5DKL A;  3UME A;  3EQV A;  3KYZ A;  4MN5 A;  5J4E A;  2H28 A;  2YKH A;  5HDC A;  5EFW A;  1OJ5 A;  2V9A A;  2W27 A;  3EGD C;  2W3E A;  5AVE A;  3PBR A;  2HJE A;  2VGL S;  3OBF A;  3VE3 A;  2QWS A;  2V1B A;  3HJI A;  4FSF A;  4DN0 A;  5DF9 A;  4G3V A;  2W3H A;  3LR4 A;  4KQD A;  1VHM A;  2QKP A;  3ZYT A;  1V9Z A;  3LIE A;  4R38 A;  5HZH A;  4CLC B;  5G4Y A;  4I3A A;  4Q0J A;  3E4O A;  1T18 A;  1STZ A;  2P04 A;  3MQ0 A;  4WEK A;  1X0O A;  2ZOI A;  3NOP C;  4LRY C;  3OOV A;  1YKD A;  3F1N B;  4I38 A;  5DFX A;  5A8B A;  4OOL A;  4Y3I A;  3BQ8 A;  3TRC A;  5HD5 A;  2W0N A;  5HWT A;  4GW9 A;  3F1P A;  4BMW A;  2VEA A;  3T50 A;  5MC7 A;  4EEU A;  2J3W A;  2VA0 A;  3CI6 A;  2ZMF A;  1OT9 A;  3LI8 A;  1W63 Q;  2J3T D;  3PR6 A;  4GS9 A;  3T4J A;  1NLY A;  5HWV A;  2WKP A;  5HWW A;  4EW7 A;  1LT0 A;  4GHI A;  2M1C A;  2ZMV A;  5HL6 A;  4UQI S;  4KUO A;  4NXF A;  1TS7 A;  4HJ3 A;  2QJ7 A;  4PHT A;  2VGL M;  2EWV A;  1H3Q A;  3P01 A;  4RQ9 A;  4XT2 B;  3MMH A;  4YNR A;  4R70 A;  5AJG A;  3C38 A;  2JKT M;  2D02 A;  4EU0 A;  3S7P A;  3C8C A;  4H6J B;  3BWL A;  2JKT I;  4L0L A;  2M7U A;  2VKS A;  1G28 A;  3MR0 A;  2R78 A;  2W3D A;  4GJ4 A;  2V0U A;  5L8M A;  4BBT A;  4CLC A;  2G7U A;  5F68 A;  4HOI A;  2EA9 A;  4DJ3 A;  3FPV A;  2K31 A;  2OAQ 1;  1UWP X;  2PT7 A;  1S1Z A;  3F1N A;  4HNB A;  1P97 A;  3IS2 B;  4EUV A;  4ETX A;  2B02 A;  2PYP A;  2HGV A;  3EGX C;  1LL8 A;  5C5K A;  2A24 A;  4BBV A;  1LSW A;  4PKY G;  3KSG A;  1P0Z A;  3PBN A;  4KUK A;  1ZHH B;  4HH2 A;  2L4R A;  2CMN A;  3RTY A;  1W63 M;  2QHK A;  4WEL A;  1YAX A;  1OTB A;  2P7J A;  1NWZ A;  3T4Q A;  3OC2 A;  4UQI M;  3UMD A;  1XJ2 A;  2D01 A;  1YSQ A;  5DJT A;  2NUP C;  2XA7 S;  3TW8 A;  4XT2 A;  5J3W A;  1OJG A;  3PBS A;  4H6J A;  1N9O A;  4G3K A;  4WN5 A;  5IU1 A;  3FG8 A;  3H9W A;  3H82 B;  3K3D A;  4CLC D;  2I9V A;  4HI4 A;  5HSQ A;  4JGP A;  4WL9 A;  1JNU A;  3F1O B;  3A0S A;  2VX8 A;  2KOI A;  5TBM B;  3EEH A;  3NOT C;  1F9I A;  4ME4 A;  4Y5F A;  2VJW A;  4PAU A;  4UEY A;  2QYB A;  3P7N A;  3GDI A;  2DMW A;  4YOF A;  3LR3 A;  4HIA A;  4L9G A;  1V9Y A;  2NUT C;  3NOU C;  2O0Y A;  3LR5 A;  5IT5 A;  2JN7 A;  4L9F A;  1DP8 A;  3OCN A;  3BY9 A;  1D7E A;  2W1R A;  5AVF A;  2WKR A;  3T4K A;  2Z6C A;  5FL3 A;  2XA7 M;  3BY8 A;  3ZQ5 A;  1XFQ A;  2O9C A;  2PR6 A;  3PYP A;  3R7W B;  4AFI A;  4I39 A;  1YSP A;  4JGO A;  5G4Z A;  4QPR A;  1GSX A;  2HV1 A;  4P6Z M;  1T1B A;  3PBQ A;  4NXG A;  3UB9 A;  1T1C A;  4JGQ A;  3E4P A;  3V67 A;  3R4K A;  3TJZ C;  1DRM A;  3PHY A;  2PD7 A;  3H7W B;  1P9W A;  4LLO B;  3CUE C;  4WLA A;  3E4Q A;  3S7Q A;  4E04 A;  3E0Y A;  1TD5 A;  3CAX A;  4ARZ B;  4HP4 A;  2OWH A;  2VV6 A;  3D72 A;  2GX5 A;  2V1A A;  5I5L A;  3A0V A;  4BBU A;  1S4R A;  1P9R A;  2INW A;  2W3F A;  4CLC E;  5J7E A;  5IS1 A;  2LB9 A;  5DFY A;  4FOF A;  2W1T B;  4HJ6 A;  3S7N A;  1S66 L;  1S1Y A;  5DKK A;  3SW1 A;  1VB6 A;  3MQQ A;  3EEA A;  4HH3 A;  4HY8 A;  3RFB A;  1XJ4 A;  2KLI A;  3O5Y A;  4BWI A;  2Y8H A;  3T4L A;  3LIC A;  2L0W A;  4JGR A;  4HQA A;  5F6A A;  4EES A;  2L1M A;  1LSX A;  4O0P A;  5HPI A;  2JHE A;  5HDD A;  3R7W A;  3VV4 A;  2GZA A;  3C2W A;  3EQU A;  5HDS A;  2O9A A;  1D06 A;  4OOM A;  1GSV A;  2OAP 1;  1UGU A;  1OTA A;  3H7W A;  3HJK A;  4O01 A;  3HCY A;  2OWJ A;  4I5S A;  4WEJ A;  2LB5 A;  3G6O A;  4NXE A;  3K3C A;  4ARZ A;  5HPF A;  2K2N A;  3FC7 A;  4O8G A;  4LRX C;  4Z1W A;  2O99 A;  3CIT A;  3U2A A;  4MCW A;  5F69 A;  5K5B A;  2FH5 A;  2GNX A;  2VLG A;  4B93 A;  2FZ0 A;  2XSS A;  2PD8 A;  1OTE A;  1NLZ A;  3ICY A;  2W1T A;  1T1A A;  1T19 A;  1XFN A;  3JVV A;  2XRO A;  1DP9 A;  5KSH A;  5LBR A;  2Y79 A;  3IS2 A;  2BAS A;  1S67 L;  2P08 A;  3LFV A;  2OOL A;  4HP9 A;  4HJ4 A;  2GJ3 A;  2JKR I;  2MJ6 A;  4EQ1 A;  2VV8 A;  1N9N A;  4IUK A;  3B42 A;  1H8M A;  3OCL A;  3T4S A;  4MMN A;  2PHY A;  2YKF A;  2M7V A;  3A0R A;  3C30 A;  3CUE A;  4I3I A;  1ZTU A;  5TJJ A;  1NRJ A;  3T4O A;  4I3J A;  4DJ2 A;  1OTD A;  3VOL A;  3B47 A;  1MZU A;  3MQO A;  3EOI A;  3LUQ A;  1WA9 A;  4MN6 A;  4NXB A;  2J80 A;  1TS8 A;  3BJN A;  3PXP A;  3TE8 A;  2B18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...