1T1CA

Late intermediate il3 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1cA00
2WKRA 4HP9A 1XJ4A 4DJ2A 4HY8A 3E4OA 5DKKA 4HIAA 2OWHA 5HWVA 2A24A 3MJQA 3UB9A 5J4EA 2OWJA 5HDCA 1Y28A 3OLOA 1V9ZA 2D02A 3MFXA 5TBMB 4L9GA 4GHIB 4EESA 3LICA 4GS9A 4HP4A 3LIAA 2OOLA 3IS2A 1S1YA 3MQQA 2WKQA 2V0WA 1OTEA 3MXQA 3CLOA 1WA9A 2CMNA 3LI9A 3E4PA 1T1BA 1LSVA 2L1MA 3VE4A 5DKLA 4I3JA 4HJ3A 3D72A 5F5YA 4EEUA 3NOUC 4LRYC 3HJIA 4EQ1A 3G6OA 3LIFA 4KUOA 4PKYA 4XT2A 4LRXC 3FG8A 1EW0A 1XJ3A 4NXEA 3LYXA 1DRMA 4GW9A 4RQ9A 2V1AA 3H82A 3UMDA 2PD7A 2R78A 3FC7A 5EFWA 3A0RA 1GSXA 2PD8A 4BBUA 1T18A 4L9FA 1OTDA 4LRZE 5G4YA 5J3WA 4HI4A 3E4QA 3F1OA 4KQDA 5F69A 5HWWA 5DJUA 4WUJA 2KDKA 1TS0A 3RH8B 2WKPA 1OJ5A 2VV8A 3PHYA 4JGRA 3SW1A 1OJGA 4HJ6A 3BY8A 1OTBA 1N9OA 3NOPC 3LIBA 1LL8A 5HSQA 3LIDA 2QJ5A 3F1PA 4MN6A 2PYPA 3F1NB 3CWFA 4R70A 3UMEA 4EXOA 2L4RA 3VE3A 5AVEA 1DP9A 1S4SA 4H6JB 1TS6A 1F9IA 2W27A 2INWA 5DJTA 4M4XA 3H7WB 1VB6A 5HDSA 3CAXA 4F3LB 1XFQA 2J80A 5HDDA 2ZOIA 4EERA 3UB6A 5AVFA 4NXBA 3ULFA 4WF0A 3NOTC 5IS1A 1LSWA 2VV6A 3A0VA 4R6LA 1UWNX 4JGPA 2QJ7A 1UWPX 2HV1A 4I3IA 4HQAA 2GJ3A 3EWKA 1LT0A 1F98A 2B02A 5TBMA 3BY9A 4GHIA 1NWZA 2L0WA 1P0ZA 4BBTA 2PR5A 3ICYA 2M1CA 3VOLA 1ODVA 3GECA 2A24B 4BBVA 4H6JA 2QHKA 4YWZA 5I5LA 1MZUA 2BASA 3K3CA 2ZBBA 1OTIA 1S67L 4LLOB 3NHQA 4WN5A 4L9EA 3C2WA 4JGQA 4GS9B 2PHYA 3IS2B 2PDRA 4HHDA 5G4ZA 1OT6A 2V1BA 3IBRA 3A0SA 1S4RA 1XJ6A 1D06A 3KX0X 4R38A 3P7NA 4EETB 1S1ZA 4PKYG 3RTYA 4JGOA 3H9WA 4R3AA 4KUKA 4HJ4A 5KIZA 2KX6A 5F68A 1T1CA 3GDIA 5HD3A 1UGUA 2JN7A 3MR0A 1XFNA 2ZOHA 4I3AA 3BWLA 4NXGA 1T1AA 4XT2B 2VEAA 1GSWA 1P97A 2YKHA 1DP6A 2K7SA 5HZHA 2P7JA 4HNBA 1OTAA 3ZQ5A 1XJ2A 3H82B 4EEPA 1GSVA 2Z6CA 4HH3A 5HD5A 2H28A 2EA9A 3PYPA 3LI8A 4WLAA 4B9OA 2PYRA 5F6AA 1X0OA 2PR6A 4I39A 4E04A 2JHEA 3EEHA 2QKPA 2VLGA 4HOIA 2VV7A 1G28A 1D7EA 5IU1A 4DJ3A 1JNUA 4MN5A 4I5SA 4HH2A 4EW7A 1DP8A 4LPZA 2V0UA 3HJKA 2V9AA 5A8BA 3F1OB 3F1NA 1BYWA 1TS8A 3NJAA 5HWTA 1N9LA 1V9YA 4I38A 3H7WA 5J7EA 4GCZA 4F3LA 3C8CA 2QWSA 4K08A 1LSXA 2D01A 3K3DA 3UB8A 3F1PB 3MQOA 1OT9A 4NXFA 1KOUA 2W0NA 1T19A 1TS7A 4WL9A 3B33A 3UB7A 1N9NA 3LUQA 2I9VA 1S66L 3UE6A 2Z6DA 3LIEA 3T50A 2YKFA
chains in the Genus database with same CATH superfamily
2QZ6A 3SZTA 3R4KA 4S2OA 3HLDA 5EVIA 2Y2NA 2X01A 4HY8A 3LO7A 2H0YA 4DN0A 4X53A 5DKKA 1XGJA 3EGXC 4WMCD 2A24A 4P87A 5CGSA 5EVIC 3UB9A 5J4EA 2XA7M 5E2FA 1VHMA 5HDCA 5HX9A 1YT4A 1KE0A 4A5RA 4DXBA 1PIOA 3N8LA 3LICA 3ZHHA 2XEPA 4X25A 3RXXA 3LIAA 1AWIA 3IS2A 3BQAA 1PW8A 3GRJA 4WBGA 3DAVA 1MXOA 3SH9A 3PBSA 1XKZA 5FQJA 3ZDJA 3AGFA 3CLOA 3MZEA 3HUOA 3RJUA 1L0FA 4C3QA 1T1BA 3VE4A 4Y15A 3AGDA 3ISGA 4KZ6A 4I3JA 5F1GA 4BJPA 4DDSA 5CTNA 3IH8A 2WUQA 4E3IA 3CZDA 3NY4A 4Y0TA 4Z1WA 4CLCB 2HF6A 3RFBA 3LIFA 3OBFA 4RA7A 4RYEA 5EM0A 4DE0A 3FG8A 1NJ4A 2HP6A 1EW0A 4CLCD 4EV4A 4BD0A 3UN7A 3G35A 2R9WA 4JXGA 4P6BA 1IFQA 2V1ZA 2R78A 3T4LA 4MLLA 3BFGA 1J3WA 1K56A 5K5BA 2PD8A 4ARZA 2XD5A 5JYOA 1K4FA 3W4OA 1KVLA 2Y2QA 4Z9QA 2JBFA 3VOZA 4KZ3A 1U60A 1EWZA 4MBFA 4FOFA 1LI9A 2WZXA 2J9PA 1FILA 1H5XA 4DMZA 4B88A 2KDKA 4HESA 1YLPA 1OJ5A 4JGRA 3NBLA 1IEMA 5MC7A 1HLUP 2O9CA 3DWKA 4HJ6A 1ESIA 3GMWA 2Y2JA 4BL2A 4NK3A 1GA9A 4OLDA 2PYPA 2PU4A 2VKSA 3UMEA 2JKTM 5GLDA 5BOHA 2PBYA 4H6JB 3UPPA 1K54A 2INWA 1ZG6A 3C7VA 4ME4A 3SS4A 2W1TA 2EX2A 3NCKA 3PBOA 1XFQA 4ETZA 1LI0A 2B18A 4JKTA 1K54C 4WMCA 3PBTA 5HW3A 3WRZA 2DCFA 3JPUA 3PTEA 3FKWA 4IBXA 2WAEA 2Y2HA 4QU3A 4OVDA 2QJ7A 2ZQAA 4WYYA 1UWPX 2HV1A 3IX8A 3HL9A 5FSRA 4HQAA 4B4ZA 4PMAA 2VZWA 3EWKA 1IYQA 2EX9A 3BY9A 4Y0OA 1NWZA 4KG5A 3E2LA 1P0ZA 1MWUA 3ICYA 3IBJA 2M1CA 4OH0A 5FQMA 3T12B 2QHKA 2J9OA 3NC8A 3ZG5A 2JC7A 1MZUA 1IYPA 3K3CA 2ZBBA 3ZNTA 1OTIA 5FQIA 1L2SA 1IKIA 3MXRA 5A92A 5EECA 4LLOB 4PHTA 4KQOA 4K0WA 4Q0HA 2UWXA 2ZQ9A 4R23A 4PM8A 2ZM0A 1G5UA 5HAIA 2M7VA 4NG2A 3B42A 3FWLA 2VX8A 4Q0IA 3G2YA 1LL5A 4CLCA 4S2KA 1XA1A 4JGOA 3TG9A 3E98A 4R3AA 5LBRA 1MWTA 2VJWA 3IWQA 3KYEA 4MMNA 3LEQA 1T1CA 4R0QA 4CLCC 2HZ5A 3DTKA 1XA7A 4QY5A 3DTMA 1KVMA 3D3OA 3S7PA 3IXBA 2HP5A 2ZOHA 4I3AA 2KLIA 1T1AA 4HBTA 3WS4A 2ZM8A 1P97A 2YKHA 1XP4A 3A3JA 4GDNA 4BWIA 5AQBA 2W3GA 3ZQ5A 1YLWA 2ZL1A 4ZJ2A 5HL1A 3IT9A 3Q07A 2V8FA 2Z6CA 5HD5A 2H28A 2EA9A 3ZNYA 4B9OA 4WLAA 2Q0OA 2Y4AA 4PAUA 1X0OA 4I39A 4ETXA 2ZC6B 1MKIA 1G28A 3IF5A 1K25A 3WS0A 4MN5A 3A3IA 4C6YA 3NECA 2V0UA 4R3BA 3SS3A 4IUKA 5A8BA 5CGXA 2QYBA 3F1OB 3G31A 3HREA 3BFFA 1BYWA 2RCXA 3QP8A 4E6XA 1W79A 5HWTA 4X6TA 1N9LA 3LR4A 4BLMA 2A49A 1O7EA 4GNUA 2QWSA 2C6WB 1LSXA 2O99A 4QPRA 5E43A 1OT9A 1L0EA 3G34A 1G6OA 2W0NA 3VOYA 1QMFA 3QP5A 3P98A 3LUQA 3UO9A 3BFEA 4JXWA 2EWWA 4LCLA 3G2ZA 3UE6A 3UDXA 4XXRA 2YKFA 2ZJ9A 2XSSA 1SKFA 4N1HA 5FAQA 4FUWA 4WZ5A 5KZHA 4HP9A 3GSGA 1EI5A 1YLTA 1XJ4A 4LENA 3BW6A 3T1QB 2BG1A 3IF6C 3UPOA 3OOVA 4HIAA 4DF6A 2OWHA 5HWVA 1K57A 4Q0JA 4KG6A 1TVFA 5FI2A 4JF4A 5CHUA 4P0MA 1KGEA 3PAGA 1GA0A 2ZC5B 1G6AA 1Y28A 1V9ZA 3IX4A 4ZDXA 2HGVA 1K57C 3T4KA 4EESA 4P6ZM 5EOEA 1K38A 1S1YA 4PM6A 2V0WA 4UAAA 4E3LA 3V3SA 2WZZA 3WWXA 3CMZA 1OTEA 3MXQA 2XR0A 3T4TA 3E4PA 3UDFA 3FZCA 3EEAA 1VETB 2L1MA 1DJBA 2W3EA 3PXPA 3SS5A 4ID4A 4N92A 4G3VA 5L07A 3ZG7B 2LB5A 3N8RA 4OQHA 3D72A 3ITAA 3NOUC 1Y4OA 3G6OA 3C4PA 4DXCA 2HJEA 5EOOA 4EU0A 2I72A 3Q82A 3IXHA 4S2MA 1WYBA 5GL9A 3NI9A 3MKFA 2X02A 4QWOA 3HLCA 4RQ9A 1W7FA 2V1AA 3JVUA 4EUZA 1YMSA 4UA9A 5L10A 3FC7A 5EFWA 4F94A 1PRQA 2JKTI 3MFDA 2DRWA 1NRFA 2XQZA 1W63Q 1M6KA 1E3UA 4KZ7A 4UQIS 4BBUA 1XGIA 3ITBA 3T1XA 3QP4A 3V67A 5G4YA 5J3WA 4MBHA 2VGJA 1ES4A 2ZD8A 1RP5A 3F1OA 4KQDA 3HLEA 5F69A 4XUZA 5DJUA 3PAEA 1TS0A 5DF8A 2A3UA 1YKDA 2VV8A 3BECA 3PHYA 1JTDA 2B95A 4RVAA 2OLVA 3ZFZA 3KYQA 4PPRA 1IYOA 3N6IA 3WS1A 5FEFA 1N9OA 3NOPC 4PM7A 4QY6A 1OMEA 2LB9A 1LL8A 2Y2GA 5HSQA 3DTIA 2QJ5A 4P85A 3ZYTA 5L2FA 2XH9A 3O3VA 4DKIA 5HAPA 1STZA 4EWFA 1HVBA 1GHMA 1TS6A 3IQAA 1S0WA 4PM5A 4M4XA 2ZQ8A 3H7WB 2PBDP 5HDSA 1KGGA 1XX2A 2G2UA 1NYYA 1TEMA 3OCLA 5HDDA 3BM6A 3E2KA 1GHIA 1W8QA 2ZOIA 3A3FA 3UPNA 4EERA 1MY8A 4WF0A 1ERQA 4JXVA 1LSWA 2VV6A 3EGDC 4OQGA 4JGPA 1BLCA 1PZOA 4E3NA 3LR0A 2XGNA 3LFVA 1D1JA 1KDSA 4O0PA 1ZKJA 4X1LA 1IKGA 1P9RA 1PFLA 3BFDA 2A2LA 3MKEA 3DBAA 4BBTA 3HUMA 3FKVA 5GHZA 5CX7A 4KZAA 3SOIA 3VOLA 1ODVA 1XXMA 5IHVA 4EBLA 4BBVA 4OKPA 4CQHA 2HP9A 4OONA 4S2NA 2BASA 4MDZA 2W3DA 1VETA 5U47A 2M7UA 2PRFA 3L7HA 3C2WA 2ZL1B 5FEGA 3ZGAB 3CG5A 2OLUA 4GS9B 2PHYA 2WKIA 4S2NC 1OPXA 5G4ZA 5JYPA 5E2EA 4OP5A 1S4RA 3BLMA 3HLGA 4R38A 3W8KA 2BTFP 2JCHA 4PKYG 4LGWA 2C5WB 1PI5A 5KIZA 2KX6A 1DY6A 2EFUA 5F68A 3GDIA 5HD3A 3SH7A 3MR0A 3HLWA 1XFNA 3M2JA 4B4XA 5KSCA 3FPVA 1I2SA 4NXGA 3VP2A 3BQ8A 5CERA 1JVJA 2K7SA 1OTAA 5F82A 1WE4A 3GR2A 5FA7A 3H82B 5GHYA 3U2AA 4EEPA 5C5KA 1SKOA 2WK0A 1BTLA 3LI8A 4GKUA 3IH9A 1CI8A 3W2ZA 2XA7S 4G3WA 1E4DA 4R4SA 1D7EA 4HBUA 4E6WA 2IWBA 4HH2A 4EW7A 3IX3A 2NUPC 1IYSA 3ZG0A 1DP8A 4LPZA 1RCJA 2V9AA 2O9BA 1FCNA 2HDRA 1DJAA 4DE3A 4BD1A 4GJ4A 4N1XA 3Q1FA 4GZBA 4X1MA 3A3EA 2IWDA 5EE8A 3H7WA 4FTXA 5J7EA 1W8YA 1E25A 4C75A 3HLFA 2D01A 5HAQA 3K3DA 3LCEA 3T1SA 2O9AA 3G32A 4UEYA 4NXFA 1KOUA 5EPHA 3M6BA 3UB7A 4IUHA 1CK3A 2P74A 3VP3A 3G4PA 1ZG4A 2WGWB 3NDEA 2JKFA 4RX2A 3T50A 3T4QA 3KSHA 2P08A 5L09A 1ES5A 1CEFA 1Q2QA 1FCMA 3PBRA 4QB8A 2HJ9C 4JF6A 3E4OA 2NUTC 4LFUA 3R7WB 4E3KA 4OPYA 3LEZA 2ZC4B 5CRFA 4GD6A 3BEBA 4U0TA 5M1AA 2G2WA 2WGIA 1W63M 3P09A 4N9LA 1H3QA 3OLOA 2D02A 5TBMB 4L9GA 4UA7A 4UA6A 3UE0A 4GS9A 4K0XA 1FCOA 2OOLA 2QPNA 1KE3A 1ES2A 4KENB 3CI6A 2CC1A 1ERMA 2Y59A 2RL3A 4FSFA 5DF9A 5CECA 3HCYA 5EM1A 3V50A 1LSVA 5DKLA 1FQGA 2FFYA 1MKMA 5F1FA 1XPBA 1HD8A 4R3JA 1E3UD 4HJ3A 5F83A 3T4OA 3TE8A 1CI9A 3PBQA 4II7A 4FH2A 1BLPA 4QD4A 3HJIA 1IELA 4EQ1A 4DDYA 3Q81A 4KUOA 2VA0A 4PKYA 4OOYA 3O86A 4LRXC 3V39A 4ZRRA 3ZVWA 3Q7VB 3ZCZA 1H8YA 3WS5A 4NXEA 1CF0A 3LYXA 2V2FF 1DRMA 3TOIA 5DVAA 1F2KA 3H82A 4IHQA 3UMDA 3VFHA 3OZHA 2PD7A 3MZFA 3S1YA 2WGVA 4Y3IA 2KOIA 3A0RA 1GSXA 2K2NA 2DMWA 4L9FA 1FSWA 4IBRA 1OTDA 4LRZE 3K2NA 3IWIA 4WEJA 4HI4A 3M2KA 1Q2PA 5AQ9A 3EQUA 3W4PA 3KYZA 5AQ7A 1PWDA 5HWWA 4WZ5C 3T4SA 3LGOA 3RH8B 3TW8A 4OPRA 4D60A 3SW1A 1K4EA 3FV7A 2XRNA 4S2PA 4FD8A 3LIBA 4U0XA 4KZBA 3LIDA 4LCMA 4MN6A 3F1NB 4R70A 4EXOA 2L4RA 1S4SA 3HUNA 1F9IA 1RGYA 5DJTA 4CPKA 2WGWA 1VB6A 5GLCA 4MNRA 3CUEA 2J80A 2GNXA 4X56A 1EROA 3FPWA 5EV0A 4O7DA 1N4OA 5AVFA 3ULFA 5IS1A 1ZTUA 1ONHA 3R7WA 4U3TA 3CUEC 3N4IA 2GDNA 4LV1A 3NIAA 1YSQA 3NULA 1PWCA 4GN2A 2XD1A 1L3LA 2ZMVA 2H10A 2GJ3A 2GX5A 1F98A 1SDEA 5TBMA 4KQRA 3P01A 2L0WA 5G18A 4KG2A 2Y2MA 3GECA 4ZJ1A 4B93A 4YWZA 1YLZA 3DTEA 5I5LA 2JKGA 1YLJA 4QHCA 2UV0E 1YLYA 1HZOA 1SHVA 3LY3A 2EWVA 5I94A 4OLGA 4GLQA 3D4FA 3NHQA 2H0TA 4OOMA 4L9EA 1ONGA 2EXAA 2Y79A 2BLSA 4NEED 1SKOB 4EBPA 4HHDA 1OT6A 3QP2A 3DW0A 3A0SA 1TDLA 3UE3A 2WKEA 1XJ6A 4PM9A 4X55A 1D06A 1YSPA 3UDIA 3CITA 4S2IA 4EETB 2JKRM 2P9VA 3RTYA 4MCWA 5FQKA 3TRCA 3Q7VA 2VGLM 3JVVA 4BL3A 4KUKA 4HJ4A 2FZ0A 1YQSA 3WS2A 5M18A 3O88A 2JE5A 3W4QA 1KGFA 3C30A 4K91A 1HTZA 4WELA 4XT2B 1I5QA 4MN7A 4Y13A 2PAVP 4HNBA 3L9KA 1XJ2A 2MJ6A 5DF7A 3UE1A 3OCNA 4KZ5A 3KSGA 1NZOA 1GSVA 2E8IA 1VEUB 3PBNA 1SDNA 2ZMAA 2PYRA 4E04A 2JHEA 2H5SA 2Z2MB 3MBZA 2Y2OA 2VV7A 4YOFA 4DJ3A 4HEFA 1MBLA 1L0DA 1ALQA 1JNUA 1L0GA 3CHWP 4P6ZS 2Q9NA 3N8SA 2HPBA 3F1NA 2GZAA 1K55A 4O01A 3NJAA 4R4RA 1CEGA 3MXSA 5FASA 3CPTA 3ZG9B 1V9YA 4MBKA 4E3OA 3IHBA 4GB7A 2P04A 4OQ0A 4NETA 3N7WA 1LL9A 4X69A 5L8MA 1K55C 4GCZA 4GD8A 3UNWA 1ZC2A 5DFXA 5J8XA 3C8CA 3QP1A 1BUEA 4G3KA 5FI7A 4L0LA 2HDQA 1NYMA 3MMHA 3UB8A 3F1PB 1IOUA 1K6SA 4O8GA 1ESUA 1TS7A 4WL9A 1MPLA 3B33A 3OPHA 3S4XA 1QMEA 3ZVTA 4OPQA 5TGFA 4JF5A 1YPRA 1S66L 3O5YA 2Z6DA 3LIEA 2AVXA 3TSGA 5CHJA 4LV0A 5A91A 2WKRA 4JXSA 1JWVA 1I2WA 5KSHA 3S7QA 2QMIA 3PR6A 5EVLA 2OV5A 4DJ2A 5FI6A 2J7VA 3Q7ZA 1GHPA 3IXGA 2Y2LA 3SH8A 2VGKA 5FL3A 1FR6A 3MJQA 4Y17A 5CXWA 5HARA 1ZHHB 2OWJA 3CJMA 3E0YA 4BQMA 2ZM2A 2W3FA 4Y5FA 3MFXA 3VSKA 1JTGA 4GHIB 2XROA 5TR7A 4EUVA 1PWGA 4HP4A 1H8ZA 3MQQA 2WKQA 1MWRA 1LLBA 4ESPA 2ZLYA 1WA9A 3C4OA 5CGWA 2CMNA 1M40A 1SCWA 3LI9A 4AFIA 2VGLS 2Y8HA 4DRTA 2EX8A 3IWOA 1PW1A 3V3RA 1W5DA 2XFTA 2Y2KA 3GVBA 3GQZA 5DFYA 5A93A 4OOLA 5F5YA 3WRTA 1FSYA 4EEUA 2WAFA 4LRYC 3IF6B 1J9MA 4ZBEA 3GTCA 1BLHA 1TD5A 4S2LA 5DTKA 4XT2A 3G30A 2HDUA 3T1RA 5FDHA 3LR5A 4LV3A 5E2GA 2EFXA 1XJ3A 3C7UA 5TFQA 1F5MA 4CLCE 1K6RA 4ZJ3A 3MSHA 4GW9A 5E2HA 3BYDA 2VK3A 3QP6A 3ZG8B 4IJGA 1VEUA 3VP4A 5DTSA 2R9XA 1BZAA 1FOFA 1Y54A 2G7UA 3BRMA 1T18A 1JWPA 3TJZC 2Q9MA 3KO6A 1SZVA 4N9KA 1Z6FA 5FAOA 4BENA 3S22A 2OAP1 2Y55A 3E4QA 4R1GA 3UB5P 4WUJA 5HPFA 3BJNA 1A0KA 3S7NA 2WKPA 4JBFA 4RX3A 1OJGA 1VQQA 5KMWA 5D3OA 5EUAA 1PNEA 4OP8A 5GHXA 3BY8A 3GV9A 4IVIA 1OTBA 2Z2LB 5AQAA 1JWZA 2FH5A 2ZQCA 5CTMA 3F1PA 2E8JA 3CWFA 5GLBA 3A3DA 1MC0A 1WYCA 3VE3A 5AVEA 4DE2A 1DP9A 1CQAA 2ZQ7A 2W27A 5FAPA 2OAQ1 4OQIA 3VFFA 2WADA 1BLSA 2WYXA 3CAXA 4YINA 4F3LB 4FCFA 5FQ9A 1TF1A 4DE1A 3MF0A 2J3WA 2J3TD 5HFOA 4KZ9A 4D2OA 3UB6A 4NXBA 2OSUA 3NOTC 5CEDA 3A0VA 1PI4A 3VV4A 4R6LA 1UWNX 4NKPA 2V8CA 5GLAA 5CHMA 1Z09A 4I3IA 3JYIA 2P9VB 4JLFA 4UQIM 3KSIA 2XK1A 2O0YA 4M3KA 3MZDA 1NRJA 5CEBA 2W1RA 2IWCA 1LT0A 5EVIB 1BSGA 2B02A 2JKRI 2B5RA 1C3BA 4GHIA 3C38A 3RXWA 1LHYA 1VM1A 4WEKA 4S2JA 2PR5A 3D9YA 2XFSA 3BFCA 5HPIA 5EVID 2A24B 3LY4A 1BT5A 4H6JA 3U4LP 1AXBA 3B3XA 4UHUA 4EBNA 3KSFA 4E3MA 3VP0A 3QNBA 4YFMA 2XLNA 1S67L 1PYYA 2ZC7A 3OPPA 4WN5A 3FYZA 4OPZA 3HVFA 4MEZA 3OPLA 3MS6A 4JGQA 5HL6A 3IS2B 1FIKA 5DTTA 2PDRA 4KQQA 2V1BA 3IBRA 4GOGA 4EQIA 3IHAA 4Y2FA 1MWSA 3DWZA 4CJNA 2WKHA 3IF6A 2PT7A 3M6HA 3KX0X 3P7NA 1S1ZA 3EQVA 3I7JA 5A90A 2V20A 1RGZA 3H9WA 1TDGA 2FFFB 3LR3A 2ACGA 3HLBA 2IA2A 1NY0A 1G68A 1ES3A 1YMXA 3QHYA 3QNCA 1UGUA 2JN7A 3VSLA 4E3JA 1YM1A 1H8MA 4Y0UA 2HDSA 2ZQDA 4LV2A 3OPRA 1K0KA 4GDBA 4Q8IA 1S6RA 4KZ8A 3BWLA 1KDWA 2Y2PA 2ZC3B 5TJJA 3T4JA 4Y7PA 2VEAA 3CPTB 3OC2A 3VP1A 1CJFA 2K31A 1GSWA 5FDSA 1DP6A 3UY6A 5HZHA 2P7JA 2J8YA 4BMWA 2EX6A 2PU2A 3S7OA 4HH3A 5M19A 2EXBA 4IVKA 3PYPA 2Y91A 1NZUA 5F6AA 2PR6A 4YNRA 3B47A 2Y2IA 3EEHA 4ARZB 2QKPA 4HOIA 2VLGA 3HBRA 5IU1A 4ZTKA 2XDMA 1KE4A 1FR1A 2X71A 4H8RA 4I5SA 4X68A 1K56D 5AJGA 3EOIA 4FH4A 3HJKA 1H0MA 1BULA 1GCEA 1TS8A 1NLZA 3NDGA 4WZ4A 4I38A 3IXDA 4IEDA 4KZ4A 3V5MA 3AGEA 5EVEA 4JPMA 2ZMFA 4F3LA 4XUXA 3C5AA 4K08A 1PZPA 2DNSA 3MQ0A 1O07A 4QJGA 1NXYA 3O87A 5FATA 1P9WA 3MQOA 4ZAMA 5FQQA 1ACFA 2J3TC 1T19A 1N9BA 2W3HA 1N9NA 5IT5A 3VMAA 2XF3A 4WM9A 1NLYA 1YAXA 2I9VA 1DJCA 2W1TB 3BLSA
chains in the Genus database with same CATH topology
2P08A 2WKRA 3PBRA 3R4KA 4HP9A 5KSHA 3S7QA 3PR6A 2HJ9C 1XJ4A 4DJ2A 4HY8A 3BW6A 4DN0A 3E4OA 2NUTC 3R7WB 5DKKA 3OOVA 4HIAA 2OWHA 5FL3A 5HWVA 3EGXC 2A24A 3MJQA 4Q0JA 3UB9A 5J4EA 1ZHHB 2XA7M 2OWJA 1VHMA 3E0YA 5HDCA 1W63M 2W3FA 1Y28A 1H3QA 4Y5FA 3OLOA 1V9ZA 2D02A 3MFXA 5TBMB 4L9GA 2HGVA 4GHIB 2XROA 3T4KA 4EESA 3LICA 4EUVA 4P6ZM 4GS9A 4HP4A 3LIAA 2OOLA 3IS2A 3BQAA 1S1YA 3MQQA 2WKQA 3CI6A 2V0WA 3PBSA 1OTEA 4FSFA 5DF9A 3MXQA 3CLOA 1WA9A 3T4TA 2CMNA 3HCYA 3LI9A 3E4PA 4AFIA 1T1BA 3EEAA 1LSVA 2L1MA 2W3EA 2VGLS 3VE4A 3PXPA 2Y8HA 5DKLA 1MKMA 4G3VA 4I3JA 2LB5A 4HJ3A 3T4OA 5DFYA 3TE8A 4BJPA 3PBQA 3D72A 4II7A 4OOLA 5F5YA 4EEUA 3NOUC 4LRYC 3HJIA 4EQ1A 4Z1WA 4CLCB 2HF6A 1TD5A 3G6OA 3RFBA 3LIFA 3OBFA 2VA0A 4KUOA 2HJEA 4PKYA 4XT2A 4EU0A 4LRXC 4ZRRA 3FG8A 3LR5A 1EW0A 4CLCD 1XJ3A 1F5MA 4CLCE 4NXEA 3LYXA 1DRMA 4GW9A 4RQ9A 2V1AA 3H82A 3JVUA 4IHQA 3UMDA 2PD7A 1IFQA 4IJGA 2R78A 3FC7A 3T4LA 4Y3IA 5EFWA 2KOIA 2JKTI 3A0RA 1GSXA 1W63Q 2G7UA 5K5BA 2PD8A 4UQIS 4ARZA 4BBUA 1T18A 2K2NA 2DMWA 4L9FA 3TJZC 3KO6A 1OTDA 4LRZE 3K2NA 4WEJA 5G4YA 5J3WA 2OAP1 3V67A 4HI4A 4FOFA 3E4QA 4DMZA 3F1OA 3EQUA 4KQDA 3KYZA 5F69A 5HWWA 3T4SA 5DJUA 4WUJA 2KDKA 1TS0A 3BJNA 3RH8B 3TW8A 5HPFA 3S7NA 1YKDA 2WKPA 1OJ5A 2VV8A 3PHYA 4JGRA 3SW1A 1OJGA 5MC7A 3KYQA 2O9CA 2XRNA 4HJ6A 3BY8A 1OTBA 1N9OA 3NOPC 3LIBA 2LB9A 1LL8A 2FH5A 5HSQA 3LIDA 2QJ5A 3F1PA 4MN6A 2PYPA 3ZYTA 3F1NB 3CWFA 4R70A 2VKSA 3UMEA 1MC0A 4EXOA 2JKTM 2L4RA 3VE3A 5AVEA 1STZA 1DP9A 1S4SA 4H6JB 1TS6A 1F9IA 2W27A 2INWA 5DJTA 4ME4A 4M4XA 2OAQ1 3H7WB 1VB6A 5HDSA 2W1TA 3CAXA 3CUEA 3PBOA 4F3LB 1XFQA 2J80A 4ETZA 1TF1A 3OCLA 5HDDA 3MF0A 2B18A 2GNXA 2J3WA 3FPWA 2J3TD 2ZOIA 3PBTA 4EERA 3UB6A 4NXBA 5AVFA 3ULFA 4WF0A 3NOTC 5IS1A 1ZTUA 3R7WA 1LSWA 2VV6A 3CUEC 3A0VA 3VV4A 3EGDC 1UWNX 4NKPA 4JGPA 4R6LA 2QJ7A 1YSQA 1UWPX 2HV1A 3LR0A 2ZMVA 3LFVA 4I3IA 4UQIM 4O0PA 3KSIA 2O0YA 4HQAA 1NRJA 2W1RA 2GJ3A 2VZWA 3EWKA 2GX5A 1LT0A 1F98A 1P9RA 2B02A 2JKRI 5TBMA 3BY9A 3P01A 4GHIA 1NWZA 3C38A 2L0WA 2A2LA 4WEKA 1P0ZA 3DBAA 4BBTA 2PR5A 3ICYA 3IBJA 2M1CA 5HPIA 5CX7A 3VOLA 1ODVA 3GECA 4B93A 2A24B 4BBVA 4H6JA 2QHKA 4YWZA 4CQHA 5I5LA 1MZUA 2BASA 3KSFA 3K3CA 2ZBBA 1OTIA 2EWVA 2W1TB 4MDZA 2W3DA 1S67L 4LLOB 4PHTA 4KQOA 4GLQA 3NHQA 4WN5A 2M7UA 4OOMA 4L9EA 3C2WA 4JGQA 5HL6A 4GS9B 4Q0HA 2PHYA 2Y79A 3IS2B 4NEED 2PDRA 1OPXA 4HHDA 5G4ZA 1OT6A 2V1BA 2M7VA 3IBRA 3A0SA 3B42A 2VX8A 4Q0IA 4Y2FA 1S4RA 3UE3A 2PT7A 1XJ6A 1D06A 4CLCA 3KX0X 4R38A 1YSPA 3CITA 3P7NA 4EETB 2JKRM 1S1ZA 3EQVA 4PKYG 3RTYA 4JGOA 4MCWA 3H9WA 3E98A 4R3AA 5LBRA 3TRCA 2VGLM 3JVVA 2VJWA 3LR3A 4KUKA 2IA2A 4HJ4A 5KIZA 2KX6A 4MMNA 5F68A 1T1CA 3GDIA 4CLCC 2FZ0A 5HD3A 1UGUA 2JN7A 3MR0A 1XFNA 1H8MA 3D3OA 3S7PA 2ZOHA 4I3AA 3C30A 3BWLA 3FPVA 2KLIA 4NXGA 1T1AA 5TJJA 4WELA 3T4JA 4XT2B 2VEAA 3BQ8A 3OC2A 2K31A 1GSWA 4MN7A 1P97A 2YKHA 1DP6A 2K7SA 4BWIA 2P7JA 4HNBA 5HZHA 1OTAA 2W3GA 3ZQ5A 4BMWA 1XJ2A 2MJ6A 3OCNA 3KSGA 3H82B 3S7OA 3U2AA 1GSVA 2Z6CA 4EEPA 4HH3A 5HD5A 2H28A 5C5KA 2EA9A 3PBNA 3PYPA 3LI8A 4WLAA 4B9OA 3W2ZA 4PAUA 2PYRA 5F6AA 1X0OA 2PR6A 4I39A 3B47A 4YNRA 4E04A 2JHEA 2XA7S 4ETXA 4G3WA 3EEHA 4ARZB 2QKPA 2VLGA 4HOIA 2VV7A 1G28A 1D7EA 4YOFA 5IU1A 4DJ3A 1JNUA 4MN5A 4I5SA 4HH2A 5AJGA 4P6ZS 3EOIA 2NUPC 4EW7A 1DP8A 4LPZA 2V0UA 3HJKA 2V9AA 2O9BA 5A8BA 4IUKA 2QYBA 3F1OB 3F1NA 2GZAA 4O01A 4GJ4A 1BYWA 1TS8A 1NLZA 3NJAA 5HWTA 1N9LA 1V9YA 4I38A 2P04A 3H7WA 3LR4A 5J7EA 5L8MA 4GCZA 2ZMFA 5DFXA 4F3LA 3C8CA 2QWSA 4K08A 3MQ0A 4G3KA 1LSXA 2O99A 4L0LA 4QPRA 2D01A 3K3DA 3MMHA 3UB8A 1P9WA 3F1PB 3MQOA 2O9AA 1OT9A 1IOUA 2J3TC 4NXFA 4UEYA 1KOUA 1G6OA 2W0NA 1T19A 4O8GA 1TS7A 4WL9A 3B33A 2W3HA 4IUHA 3UB7A 1N9NA 5IT5A 3LUQA 1NLYA 1YAXA 2I9VA 2EWWA 1S66L 3O5YA 3UE6A 2Z6DA 3LIEA 3T50A 3T4QA 3KSHA 2YKFA 2XSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKR A;  4HP9 A;  1XJ4 A;  4DJ2 A;  4HY8 A;  3E4O A;  5DKK A;  4HIA A;  2OWH A;  5HWV A;  2A24 A;  3MJQ A;  3UB9 A;  5J4E A;  2OWJ A;  5HDC A;  1Y28 A;  3OLO A;  1V9Z A;  2D02 A;  3MFX A;  5TBM B;  4L9G A;  4GHI B;  4EES A;  3LIC A;  4GS9 A;  4HP4 A;  3LIA A;  2OOL A;  3IS2 A;  1S1Y A;  3MQQ A;  2WKQ A;  2V0W A;  1OTE A;  3MXQ A;  3CLO A;  1WA9 A;  2CMN A;  3LI9 A;  3E4P A;  1T1B A;  1LSV A;  2L1M A;  3VE4 A;  5DKL A;  4I3J A;  4HJ3 A;  3D72 A;  5F5Y A;  4EEU A;  3NOU C;  4LRY C;  3HJI A;  4EQ1 A;  3G6O A;  3LIF A;  4KUO A;  4PKY A;  4XT2 A;  4LRX C;  3FG8 A;  1EW0 A;  1XJ3 A;  4NXE A;  3LYX A;  1DRM A;  4GW9 A;  4RQ9 A;  2V1A A;  3H82 A;  3UMD A;  2PD7 A;  2R78 A;  3FC7 A;  5EFW A;  3A0R A;  1GSX A;  2PD8 A;  4BBU A;  1T18 A;  4L9F A;  1OTD A;  4LRZ E;  5G4Y A;  5J3W A;  4HI4 A;  3E4Q A;  3F1O A;  4KQD A;  5F69 A;  5HWW A;  5DJU A;  4WUJ A;  2KDK A;  1TS0 A;  3RH8 B;  2WKP A;  1OJ5 A;  2VV8 A;  3PHY A;  4JGR A;  3SW1 A;  1OJG A;  4HJ6 A;  3BY8 A;  1OTB A;  1N9O A;  3NOP C;  3LIB A;  1LL8 A;  5HSQ A;  3LID A;  2QJ5 A;  3F1P A;  4MN6 A;  2PYP A;  3F1N B;  3CWF A;  4R70 A;  3UME A;  4EXO A;  2L4R A;  3VE3 A;  5AVE A;  1DP9 A;  1S4S A;  4H6J B;  1TS6 A;  1F9I A;  2W27 A;  2INW A;  5DJT A;  4M4X A;  3H7W B;  1VB6 A;  5HDS A;  3CAX A;  4F3L B;  1XFQ A;  2J80 A;  5HDD A;  2ZOI A;  4EER A;  3UB6 A;  5AVF A;  4NXB A;  3ULF A;  4WF0 A;  3NOT C;  5IS1 A;  1LSW A;  2VV6 A;  3A0V A;  4R6L A;  1UWN X;  4JGP A;  2QJ7 A;  1UWP X;  2HV1 A;  4I3I A;  4HQA A;  2GJ3 A;  3EWK A;  1LT0 A;  1F98 A;  2B02 A;  5TBM A;  3BY9 A;  4GHI A;  1NWZ A;  2L0W A;  1P0Z A;  4BBT A;  2PR5 A;  3ICY A;  2M1C A;  3VOL A;  1ODV A;  3GEC A;  2A24 B;  4BBV A;  4H6J A;  2QHK A;  4YWZ A;  5I5L A;  1MZU A;  2BAS A;  3K3C A;  2ZBB A;  1OTI A;  1S67 L;  4LLO B;  3NHQ A;  4WN5 A;  4L9E A;  3C2W A;  4JGQ A;  4GS9 B;  2PHY A;  3IS2 B;  2PDR A;  4HHD A;  5G4Z A;  1OT6 A;  2V1B A;  3IBR A;  3A0S A;  1S4R A;  1XJ6 A;  1D06 A;  3KX0 X;  4R38 A;  3P7N A;  4EET B;  1S1Z A;  4PKY G;  3RTY A;  4JGO A;  3H9W A;  4R3A A;  4KUK A;  4HJ4 A;  5KIZ A;  2KX6 A;  5F68 A;  1T1C A;  3GDI A;  5HD3 A;  1UGU A;  2JN7 A;  3MR0 A;  1XFN A;  2ZOH A;  4I3A A;  3BWL A;  4NXG A;  1T1A A;  4XT2 B;  2VEA A;  1GSW A;  1P97 A;  2YKH A;  1DP6 A;  2K7S A;  5HZH A;  2P7J A;  4HNB A;  1OTA A;  3ZQ5 A;  1XJ2 A;  3H82 B;  4EEP A;  1GSV A;  2Z6C A;  4HH3 A;  5HD5 A;  2H28 A;  2EA9 A;  3PYP A;  3LI8 A;  4WLA A;  4B9O A;  2PYR A;  5F6A A;  1X0O A;  2PR6 A;  4I39 A;  4E04 A;  2JHE A;  3EEH A;  2QKP A;  2VLG A;  4HOI A;  2VV7 A;  1G28 A;  1D7E A;  5IU1 A;  4DJ3 A;  1JNU A;  4MN5 A;  4I5S A;  4HH2 A;  4EW7 A;  1DP8 A;  4LPZ A;  2V0U A;  3HJK A;  2V9A A;  5A8B A;  3F1O B;  3F1N A;  1BYW A;  1TS8 A;  3NJA A;  5HWT A;  1N9L A;  1V9Y A;  4I38 A;  3H7W A;  5J7E A;  4GCZ A;  4F3L A;  3C8C A;  2QWS A;  4K08 A;  1LSX A;  2D01 A;  3K3D A;  3UB8 A;  3F1P B;  3MQO A;  1OT9 A;  4NXF A;  1KOU A;  2W0N A;  1T19 A;  1TS7 A;  4WL9 A;  3B33 A;  3UB7 A;  1N9N A;  3LUQ A;  2I9V A;  1S66 L;  3UE6 A;  2Z6D A;  3LIE A;  3T50 A;  2YKF A; 
#chains in the Genus database with same CATH topology
 2QZ6 A;  3SZT A;  3R4K A;  4S2O A;  3HLD A;  5EVI A;  2Y2N A;  2X01 A;  4HY8 A;  3LO7 A;  2H0Y A;  4DN0 A;  4X53 A;  5DKK A;  1XGJ A;  3EGX C;  4WMC D;  2A24 A;  4P87 A;  5CGS A;  5EVI C;  3UB9 A;  5J4E A;  2XA7 M;  5E2F A;  1VHM A;  5HDC A;  5HX9 A;  1YT4 A;  1KE0 A;  4A5R A;  4DXB A;  1PIO A;  3N8L A;  3LIC A;  3ZHH A;  2XEP A;  4X25 A;  3RXX A;  3LIA A;  1AWI A;  3IS2 A;  3BQA A;  1PW8 A;  3GRJ A;  4WBG A;  3DAV A;  1MXO A;  3SH9 A;  3PBS A;  1XKZ A;  5FQJ A;  3ZDJ A;  3AGF A;  3CLO A;  3MZE A;  3HUO A;  3RJU A;  1L0F A;  4C3Q A;  1T1B A;  3VE4 A;  4Y15 A;  3AGD A;  3ISG A;  4KZ6 A;  4I3J A;  5F1G A;  4BJP A;  4DDS A;  5CTN A;  3IH8 A;  2WUQ A;  4E3I A;  3CZD A;  3NY4 A;  4Y0T A;  4Z1W A;  4CLC B;  2HF6 A;  3RFB A;  3LIF A;  3OBF A;  4RA7 A;  4RYE A;  5EM0 A;  4DE0 A;  3FG8 A;  1NJ4 A;  2HP6 A;  1EW0 A;  4CLC D;  4EV4 A;  4BD0 A;  3UN7 A;  3G35 A;  2R9W A;  4JXG A;  4P6B A;  1IFQ A;  2V1Z A;  2R78 A;  3T4L A;  4MLL A;  3BFG A;  1J3W A;  1K56 A;  5K5B A;  2PD8 A;  4ARZ A;  2XD5 A;  5JYO A;  1K4F A;  3W4O A;  1KVL A;  2Y2Q A;  4Z9Q A;  2JBF A;  3VOZ A;  4KZ3 A;  1U60 A;  1EWZ A;  4MBF A;  4FOF A;  1LI9 A;  2WZX A;  2J9P A;  1FIL A;  1H5X A;  4DMZ A;  4B88 A;  2KDK A;  4HES A;  1YLP A;  1OJ5 A;  4JGR A;  3NBL A;  1IEM A;  5MC7 A;  1HLU P;  2O9C A;  3DWK A;  4HJ6 A;  1ESI A;  3GMW A;  2Y2J A;  4BL2 A;  4NK3 A;  1GA9 A;  4OLD A;  2PYP A;  2PU4 A;  2VKS A;  3UME A;  2JKT M;  5GLD A;  5BOH A;  2PBY A;  4H6J B;  3UPP A;  1K54 A;  2INW A;  1ZG6 A;  3C7V A;  4ME4 A;  3SS4 A;  2W1T A;  2EX2 A;  3NCK A;  3PBO A;  1XFQ A;  4ETZ A;  1LI0 A;  2B18 A;  4JKT A;  1K54 C;  4WMC A;  3PBT A;  5HW3 A;  3WRZ A;  2DCF A;  3JPU A;  3PTE A;  3FKW A;  4IBX A;  2WAE A;  2Y2H A;  4QU3 A;  4OVD A;  2QJ7 A;  2ZQA A;  4WYY A;  1UWP X;  2HV1 A;  3IX8 A;  3HL9 A;  5FSR A;  4HQA A;  4B4Z A;  4PMA A;  2VZW A;  3EWK A;  1IYQ A;  2EX9 A;  3BY9 A;  4Y0O A;  1NWZ A;  4KG5 A;  3E2L A;  1P0Z A;  1MWU A;  3ICY A;  3IBJ A;  2M1C A;  4OH0 A;  5FQM A;  3T12 B;  2QHK A;  2J9O A;  3NC8 A;  3ZG5 A;  2JC7 A;  1MZU A;  1IYP A;  3K3C A;  2ZBB A;  3ZNT A;  1OTI A;  5FQI A;  1L2S A;  1IKI A;  3MXR A;  5A92 A;  5EEC A;  4LLO B;  4PHT A;  4KQO A;  4K0W A;  4Q0H A;  2UWX A;  2ZQ9 A;  4R23 A;  4PM8 A;  2ZM0 A;  1G5U A;  5HAI A;  2M7V A;  4NG2 A;  3B42 A;  3FWL A;  2VX8 A;  4Q0I A;  3G2Y A;  1LL5 A;  4CLC A;  4S2K A;  1XA1 A;  4JGO A;  3TG9 A;  3E98 A;  4R3A A;  5LBR A;  1MWT A;  2VJW A;  3IWQ A;  3KYE A;  4MMN A;  3LEQ A;  1T1C A;  4R0Q A;  4CLC C;  2HZ5 A;  3DTK A;  1XA7 A;  4QY5 A;  3DTM A;  1KVM A;  3D3O A;  3S7P A;  3IXB A;  2HP5 A;  2ZOH A;  4I3A A;  2KLI A;  1T1A A;  4HBT A;  3WS4 A;  2ZM8 A;  1P97 A;  2YKH A;  1XP4 A;  3A3J A;  4GDN A;  4BWI A;  5AQB A;  2W3G A;  3ZQ5 A;  1YLW A;  2ZL1 A;  4ZJ2 A;  5HL1 A;  3IT9 A;  3Q07 A;  2V8F A;  2Z6C A;  5HD5 A;  2H28 A;  2EA9 A;  3ZNY A;  4B9O A;  4WLA A;  2Q0O A;  2Y4A A;  4PAU A;  1X0O A;  4I39 A;  4ETX A;  2ZC6 B;  1MKI A;  1G28 A;  3IF5 A;  1K25 A;  3WS0 A;  4MN5 A;  3A3I A;  4C6Y A;  3NEC A;  2V0U A;  4R3B A;  3SS3 A;  4IUK A;  5A8B A;  5CGX A;  2QYB A;  3F1O B;  3G31 A;  3HRE A;  3BFF A;  1BYW A;  2RCX A;  3QP8 A;  4E6X A;  1W79 A;  5HWT A;  4X6T A;  1N9L A;  3LR4 A;  4BLM A;  2A49 A;  1O7E A;  4GNU A;  2QWS A;  2C6W B;  1LSX A;  2O99 A;  4QPR A;  5E43 A;  1OT9 A;  1L0E A;  3G34 A;  1G6O A;  2W0N A;  3VOY A;  1QMF A;  3QP5 A;  3P98 A;  3LUQ A;  3UO9 A;  3BFE A;  4JXW A;  2EWW A;  4LCL A;  3G2Z A;  3UE6 A;  3UDX A;  4XXR A;  2YKF A;  2ZJ9 A;  2XSS A;  1SKF A;  4N1H A;  5FAQ A;  4FUW A;  4WZ5 A;  5KZH A;  4HP9 A;  3GSG A;  1EI5 A;  1YLT A;  1XJ4 A;  4LEN A;  3BW6 A;  3T1Q B;  2BG1 A;  3IF6 C;  3UPO A;  3OOV A;  4HIA A;  4DF6 A;  2OWH A;  5HWV A;  1K57 A;  4Q0J A;  4KG6 A;  1TVF A;  5FI2 A;  4JF4 A;  5CHU A;  4P0M A;  1KGE A;  3PAG A;  1GA0 A;  2ZC5 B;  1G6A A;  1Y28 A;  1V9Z A;  3IX4 A;  4ZDX A;  2HGV A;  1K57 C;  3T4K A;  4EES A;  4P6Z M;  5EOE A;  1K38 A;  1S1Y A;  4PM6 A;  2V0W A;  4UAA A;  4E3L A;  3V3S A;  2WZZ A;  3WWX A;  3CMZ A;  1OTE A;  3MXQ A;  2XR0 A;  3T4T A;  3E4P A;  3UDF A;  3FZC A;  3EEA A;  1VET B;  2L1M A;  1DJB A;  2W3E A;  3PXP A;  3SS5 A;  4ID4 A;  4N92 A;  4G3V A;  5L07 A;  3ZG7 B;  2LB5 A;  3N8R A;  4OQH A;  3D72 A;  3ITA A;  3NOU C;  1Y4O A;  3G6O A;  3C4P A;  4DXC A;  2HJE A;  5EOO A;  4EU0 A;  2I72 A;  3Q82 A;  3IXH A;  4S2M A;  1WYB A;  5GL9 A;  3NI9 A;  3MKF A;  2X02 A;  4QWO A;  3HLC A;  4RQ9 A;  1W7F A;  2V1A A;  3JVU A;  4EUZ A;  1YMS A;  4UA9 A;  5L10 A;  3FC7 A;  5EFW A;  4F94 A;  1PRQ A;  2JKT I;  3MFD A;  2DRW A;  1NRF A;  2XQZ A;  1W63 Q;  1M6K A;  1E3U A;  4KZ7 A;  4UQI S;  4BBU A;  1XGI A;  3ITB A;  3T1X A;  3QP4 A;  3V67 A;  5G4Y A;  5J3W A;  4MBH A;  2VGJ A;  1ES4 A;  2ZD8 A;  1RP5 A;  3F1O A;  4KQD A;  3HLE A;  5F69 A;  4XUZ A;  5DJU A;  3PAE A;  1TS0 A;  5DF8 A;  2A3U A;  1YKD A;  2VV8 A;  3BEC A;  3PHY A;  1JTD A;  2B95 A;  4RVA A;  2OLV A;  3ZFZ A;  3KYQ A;  4PPR A;  1IYO A;  3N6I A;  3WS1 A;  5FEF A;  1N9O A;  3NOP C;  4PM7 A;  4QY6 A;  1OME A;  2LB9 A;  1LL8 A;  2Y2G A;  5HSQ A;  3DTI A;  2QJ5 A;  4P85 A;  3ZYT A;  5L2F A;  2XH9 A;  3O3V A;  4DKI A;  5HAP A;  1STZ A;  4EWF A;  1HVB A;  1GHM A;  1TS6 A;  3IQA A;  1S0W A;  4PM5 A;  4M4X A;  2ZQ8 A;  3H7W B;  2PBD P;  5HDS A;  1KGG A;  1XX2 A;  2G2U A;  1NYY A;  1TEM A;  3OCL A;  5HDD A;  3BM6 A;  3E2K A;  1GHI A;  1W8Q A;  2ZOI A;  3A3F A;  3UPN A;  4EER A;  1MY8 A;  4WF0 A;  1ERQ A;  4JXV A;  1LSW A;  2VV6 A;  3EGD C;  4OQG A;  4JGP A;  1BLC A;  1PZO A;  4E3N A;  3LR0 A;  2XGN A;  3LFV A;  1D1J A;  1KDS A;  4O0P A;  1ZKJ A;  4X1L A;  1IKG A;  1P9R A;  1PFL A;  3BFD A;  2A2L A;  3MKE A;  3DBA A;  4BBT A;  3HUM A;  3FKV A;  5GHZ A;  5CX7 A;  4KZA A;  3SOI A;  3VOL A;  1ODV A;  1XXM A;  5IHV A;  4EBL A;  4BBV A;  4OKP A;  4CQH A;  2HP9 A;  4OON A;  4S2N A;  2BAS A;  4MDZ A;  2W3D A;  1VET A;  5U47 A;  2M7U A;  2PRF A;  3L7H A;  3C2W A;  2ZL1 B;  5FEG A;  3ZGA B;  3CG5 A;  2OLU A;  4GS9 B;  2PHY A;  2WKI A;  4S2N C;  1OPX A;  5G4Z A;  5JYP A;  5E2E A;  4OP5 A;  1S4R A;  3BLM A;  3HLG A;  4R38 A;  3W8K A;  2BTF P;  2JCH A;  4PKY G;  4LGW A;  2C5W B;  1PI5 A;  5KIZ A;  2KX6 A;  1DY6 A;  2EFU A;  5F68 A;  3GDI A;  5HD3 A;  3SH7 A;  3MR0 A;  3HLW A;  1XFN A;  3M2J A;  4B4X A;  5KSC A;  3FPV A;  1I2S A;  4NXG A;  3VP2 A;  3BQ8 A;  5CER A;  1JVJ A;  2K7S A;  1OTA A;  5F82 A;  1WE4 A;  3GR2 A;  5FA7 A;  3H82 B;  5GHY A;  3U2A A;  4EEP A;  5C5K A;  1SKO A;  2WK0 A;  1BTL A;  3LI8 A;  4GKU A;  3IH9 A;  1CI8 A;  3W2Z A;  2XA7 S;  4G3W A;  1E4D A;  4R4S A;  1D7E A;  4HBU A;  4E6W A;  2IWB A;  4HH2 A;  4EW7 A;  3IX3 A;  2NUP C;  1IYS A;  3ZG0 A;  1DP8 A;  4LPZ A;  1RCJ A;  2V9A A;  2O9B A;  1FCN A;  2HDR A;  1DJA A;  4DE3 A;  4BD1 A;  4GJ4 A;  4N1X A;  3Q1F A;  4GZB A;  4X1M A;  3A3E A;  2IWD A;  5EE8 A;  3H7W A;  4FTX A;  5J7E A;  1W8Y A;  1E25 A;  4C75 A;  3HLF A;  2D01 A;  5HAQ A;  3K3D A;  3LCE A;  3T1S A;  2O9A A;  3G32 A;  4UEY A;  4NXF A;  1KOU A;  5EPH A;  3M6B A;  3UB7 A;  4IUH A;  1CK3 A;  2P74 A;  3VP3 A;  3G4P A;  1ZG4 A;  2WGW B;  3NDE A;  2JKF A;  4RX2 A;  3T50 A;  3T4Q A;  3KSH A;  2P08 A;  5L09 A;  1ES5 A;  1CEF A;  1Q2Q A;  1FCM A;  3PBR A;  4QB8 A;  2HJ9 C;  4JF6 A;  3E4O A;  2NUT C;  4LFU A;  3R7W B;  4E3K A;  4OPY A;  3LEZ A;  2ZC4 B;  5CRF A;  4GD6 A;  3BEB A;  4U0T A;  5M1A A;  2G2W A;  2WGI A;  1W63 M;  3P09 A;  4N9L A;  1H3Q A;  3OLO A;  2D02 A;  5TBM B;  4L9G A;  4UA7 A;  4UA6 A;  3UE0 A;  4GS9 A;  4K0X A;  1FCO A;  2OOL A;  2QPN A;  1KE3 A;  1ES2 A;  4KEN B;  3CI6 A;  2CC1 A;  1ERM A;  2Y59 A;  2RL3 A;  4FSF A;  5DF9 A;  5CEC A;  3HCY A;  5EM1 A;  3V50 A;  1LSV A;  5DKL A;  1FQG A;  2FFY A;  1MKM A;  5F1F A;  1XPB A;  1HD8 A;  4R3J A;  1E3U D;  4HJ3 A;  5F83 A;  3T4O A;  3TE8 A;  1CI9 A;  3PBQ A;  4II7 A;  4FH2 A;  1BLP A;  4QD4 A;  3HJI A;  1IEL A;  4EQ1 A;  4DDY A;  3Q81 A;  4KUO A;  2VA0 A;  4PKY A;  4OOY A;  3O86 A;  4LRX C;  3V39 A;  4ZRR A;  3ZVW A;  3Q7V B;  3ZCZ A;  1H8Y A;  3WS5 A;  4NXE A;  1CF0 A;  3LYX A;  2V2F F;  1DRM A;  3TOI A;  5DVA A;  1F2K A;  3H82 A;  4IHQ A;  3UMD A;  3VFH A;  3OZH A;  2PD7 A;  3MZF A;  3S1Y A;  2WGV A;  4Y3I A;  2KOI A;  3A0R A;  1GSX A;  2K2N A;  2DMW A;  4L9F A;  1FSW A;  4IBR A;  1OTD A;  4LRZ E;  3K2N A;  3IWI A;  4WEJ A;  4HI4 A;  3M2K A;  1Q2P A;  5AQ9 A;  3EQU A;  3W4P A;  3KYZ A;  5AQ7 A;  1PWD A;  5HWW A;  4WZ5 C;  3T4S A;  3LGO A;  3RH8 B;  3TW8 A;  4OPR A;  4D60 A;  3SW1 A;  1K4E A;  3FV7 A;  2XRN A;  4S2P A;  4FD8 A;  3LIB A;  4U0X A;  4KZB A;  3LID A;  4LCM A;  4MN6 A;  3F1N B;  4R70 A;  4EXO A;  2L4R A;  1S4S A;  3HUN A;  1F9I A;  1RGY A;  5DJT A;  4CPK A;  2WGW A;  1VB6 A;  5GLC A;  4MNR A;  3CUE A;  2J80 A;  2GNX A;  4X56 A;  1ERO A;  3FPW A;  5EV0 A;  4O7D A;  1N4O A;  5AVF A;  3ULF A;  5IS1 A;  1ZTU A;  1ONH A;  3R7W A;  4U3T A;  3CUE C;  3N4I A;  2GDN A;  4LV1 A;  3NIA A;  1YSQ A;  3NUL A;  1PWC A;  4GN2 A;  2XD1 A;  1L3L A;  2ZMV A;  2H10 A;  2GJ3 A;  2GX5 A;  1F98 A;  1SDE A;  5TBM A;  4KQR A;  3P01 A;  2L0W A;  5G18 A;  4KG2 A;  2Y2M A;  3GEC A;  4ZJ1 A;  4B93 A;  4YWZ A;  1YLZ A;  3DTE A;  5I5L A;  2JKG A;  1YLJ A;  4QHC A;  2UV0 E;  1YLY A;  1HZO A;  1SHV A;  3LY3 A;  2EWV A;  5I94 A;  4OLG A;  4GLQ A;  3D4F A;  3NHQ A;  2H0T A;  4OOM A;  4L9E A;  1ONG A;  2EXA A;  2Y79 A;  2BLS A;  4NEE D;  1SKO B;  4EBP A;  4HHD A;  1OT6 A;  3QP2 A;  3DW0 A;  3A0S A;  1TDL A;  3UE3 A;  2WKE A;  1XJ6 A;  4PM9 A;  4X55 A;  1D06 A;  1YSP A;  3UDI A;  3CIT A;  4S2I A;  4EET B;  2JKR M;  2P9V A;  3RTY A;  4MCW A;  5FQK A;  3TRC A;  3Q7V A;  2VGL M;  3JVV A;  4BL3 A;  4KUK A;  4HJ4 A;  2FZ0 A;  1YQS A;  3WS2 A;  5M18 A;  3O88 A;  2JE5 A;  3W4Q A;  1KGF A;  3C30 A;  4K91 A;  1HTZ A;  4WEL A;  4XT2 B;  1I5Q A;  4MN7 A;  4Y13 A;  2PAV P;  4HNB A;  3L9K A;  1XJ2 A;  2MJ6 A;  5DF7 A;  3UE1 A;  3OCN A;  4KZ5 A;  3KSG A;  1NZO A;  1GSV A;  2E8I A;  1VEU B;  3PBN A;  1SDN A;  2ZMA A;  2PYR A;  4E04 A;  2JHE A;  2H5S A;  2Z2M B;  3MBZ A;  2Y2O A;  2VV7 A;  4YOF A;  4DJ3 A;  4HEF A;  1MBL A;  1L0D A;  1ALQ A;  1JNU A;  1L0G A;  3CHW P;  4P6Z S;  2Q9N A;  3N8S A;  2HPB A;  3F1N A;  2GZA A;  1K55 A;  4O01 A;  3NJA A;  4R4R A;  1CEG A;  3MXS A;  5FAS A;  3CPT A;  3ZG9 B;  1V9Y A;  4MBK A;  4E3O A;  3IHB A;  4GB7 A;  2P04 A;  4OQ0 A;  4NET A;  3N7W A;  1LL9 A;  4X69 A;  5L8M A;  1K55 C;  4GCZ A;  4GD8 A;  3UNW A;  1ZC2 A;  5DFX A;  5J8X A;  3C8C A;  3QP1 A;  1BUE A;  4G3K A;  5FI7 A;  4L0L A;  2HDQ A;  1NYM A;  3MMH A;  3UB8 A;  3F1P B;  1IOU A;  1K6S A;  4O8G A;  1ESU A;  1TS7 A;  4WL9 A;  1MPL A;  3B33 A;  3OPH A;  3S4X A;  1QME A;  3ZVT A;  4OPQ A;  5TGF A;  4JF5 A;  1YPR A;  1S66 L;  3O5Y A;  2Z6D A;  3LIE A;  2AVX A;  3TSG A;  5CHJ A;  4LV0 A;  5A91 A;  2WKR A;  4JXS A;  1JWV A;  1I2W A;  5KSH A;  3S7Q A;  2QMI A;  3PR6 A;  5EVL A;  2OV5 A;  4DJ2 A;  5FI6 A;  2J7V A;  3Q7Z A;  1GHP A;  3IXG A;  2Y2L A;  3SH8 A;  2VGK A;  5FL3 A;  1FR6 A;  3MJQ A;  4Y17 A;  5CXW A;  5HAR A;  1ZHH B;  2OWJ A;  3CJM A;  3E0Y A;  4BQM A;  2ZM2 A;  2W3F A;  4Y5F A;  3MFX A;  3VSK A;  1JTG A;  4GHI B;  2XRO A;  5TR7 A;  4EUV A;  1PWG A;  4HP4 A;  1H8Z A;  3MQQ A;  2WKQ A;  1MWR A;  1LLB A;  4ESP A;  2ZLY A;  1WA9 A;  3C4O A;  5CGW A;  2CMN A;  1M40 A;  1SCW A;  3LI9 A;  4AFI A;  2VGL S;  2Y8H A;  4DRT A;  2EX8 A;  3IWO A;  1PW1 A;  3V3R A;  1W5D A;  2XFT A;  2Y2K A;  3GVB A;  3GQZ A;  5DFY A;  5A93 A;  4OOL A;  5F5Y A;  3WRT A;  1FSY A;  4EEU A;  2WAF A;  4LRY C;  3IF6 B;  1J9M A;  4ZBE A;  3GTC A;  1BLH A;  1TD5 A;  4S2L A;  5DTK A;  4XT2 A;  3G30 A;  2HDU A;  3T1R A;  5FDH A;  3LR5 A;  4LV3 A;  5E2G A;  2EFX A;  1XJ3 A;  3C7U A;  5TFQ A;  1F5M A;  4CLC E;  1K6R A;  4ZJ3 A;  3MSH A;  4GW9 A;  5E2H A;  3BYD A;  2VK3 A;  3QP6 A;  3ZG8 B;  4IJG A;  1VEU A;  3VP4 A;  5DTS A;  2R9X A;  1BZA A;  1FOF A;  1Y54 A;  2G7U A;  3BRM A;  1T18 A;  1JWP A;  3TJZ C;  2Q9M A;  3KO6 A;  1SZV A;  4N9K A;  1Z6F A;  5FAO A;  4BEN A;  3S22 A;  2OAP 1;  2Y55 A;  3E4Q A;  4R1G A;  3UB5 P;  4WUJ A;  5HPF A;  3BJN A;  1A0K A;  3S7N A;  2WKP A;  4JBF A;  4RX3 A;  1OJG A;  1VQQ A;  5KMW A;  5D3O A;  5EUA A;  1PNE A;  4OP8 A;  5GHX A;  3BY8 A;  3GV9 A;  4IVI A;  1OTB A;  2Z2L B;  5AQA A;  1JWZ A;  2FH5 A;  2ZQC A;  5CTM A;  3F1P A;  2E8J A;  3CWF A;  5GLB A;  3A3D A;  1MC0 A;  1WYC A;  3VE3 A;  5AVE A;  4DE2 A;  1DP9 A;  1CQA A;  2ZQ7 A;  2W27 A;  5FAP A;  2OAQ 1;  4OQI A;  3VFF A;  2WAD A;  1BLS A;  2WYX A;  3CAX A;  4YIN A;  4F3L B;  4FCF A;  5FQ9 A;  1TF1 A;  4DE1 A;  3MF0 A;  2J3W A;  2J3T D;  5HFO A;  4KZ9 A;  4D2O A;  3UB6 A;  4NXB A;  2OSU A;  3NOT C;  5CED A;  3A0V A;  1PI4 A;  3VV4 A;  4R6L A;  1UWN X;  4NKP A;  2V8C A;  5GLA A;  5CHM A;  1Z09 A;  4I3I A;  3JYI A;  2P9V B;  4JLF A;  4UQI M;  3KSI A;  2XK1 A;  2O0Y A;  4M3K A;  3MZD A;  1NRJ A;  5CEB A;  2W1R A;  2IWC A;  1LT0 A;  5EVI B;  1BSG A;  2B02 A;  2JKR I;  2B5R A;  1C3B A;  4GHI A;  3C38 A;  3RXW A;  1LHY A;  1VM1 A;  4WEK A;  4S2J A;  2PR5 A;  3D9Y A;  2XFS A;  3BFC A;  5HPI A;  5EVI D;  2A24 B;  3LY4 A;  1BT5 A;  4H6J A;  3U4L P;  1AXB A;  3B3X A;  4UHU A;  4EBN A;  3KSF A;  4E3M A;  3VP0 A;  3QNB A;  4YFM A;  2XLN A;  1S67 L;  1PYY A;  2ZC7 A;  3OPP A;  4WN5 A;  3FYZ A;  4OPZ A;  3HVF A;  4MEZ A;  3OPL A;  3MS6 A;  4JGQ A;  5HL6 A;  3IS2 B;  1FIK A;  5DTT A;  2PDR A;  4KQQ A;  2V1B A;  3IBR A;  4GOG A;  4EQI A;  3IHA A;  4Y2F A;  1MWS A;  3DWZ A;  4CJN A;  2WKH A;  3IF6 A;  2PT7 A;  3M6H A;  3KX0 X;  3P7N A;  1S1Z A;  3EQV A;  3I7J A;  5A90 A;  2V20 A;  1RGZ A;  3H9W A;  1TDG A;  2FFF B;  3LR3 A;  2ACG A;  3HLB A;  2IA2 A;  1NY0 A;  1G68 A;  1ES3 A;  1YMX A;  3QHY A;  3QNC A;  1UGU A;  2JN7 A;  3VSL A;  4E3J A;  1YM1 A;  1H8M A;  4Y0U A;  2HDS A;  2ZQD A;  4LV2 A;  3OPR A;  1K0K A;  4GDB A;  4Q8I A;  1S6R A;  4KZ8 A;  3BWL A;  1KDW A;  2Y2P A;  2ZC3 B;  5TJJ A;  3T4J A;  4Y7P A;  2VEA A;  3CPT B;  3OC2 A;  3VP1 A;  1CJF A;  2K31 A;  1GSW A;  5FDS A;  1DP6 A;  3UY6 A;  5HZH A;  2P7J A;  2J8Y A;  4BMW A;  2EX6 A;  2PU2 A;  3S7O A;  4HH3 A;  5M19 A;  2EXB A;  4IVK A;  3PYP A;  2Y91 A;  1NZU A;  5F6A A;  2PR6 A;  4YNR A;  3B47 A;  2Y2I A;  3EEH A;  4ARZ B;  2QKP A;  4HOI A;  2VLG A;  3HBR A;  5IU1 A;  4ZTK A;  2XDM A;  1KE4 A;  1FR1 A;  2X71 A;  4H8R A;  4I5S A;  4X68 A;  1K56 D;  5AJG A;  3EOI A;  4FH4 A;  3HJK A;  1H0M A;  1BUL A;  1GCE A;  1TS8 A;  1NLZ A;  3NDG A;  4WZ4 A;  4I38 A;  3IXD A;  4IED A;  4KZ4 A;  3V5M A;  3AGE A;  5EVE A;  4JPM A;  2ZMF A;  4F3L A;  4XUX A;  3C5A A;  4K08 A;  1PZP A;  2DNS A;  3MQ0 A;  1O07 A;  4QJG A;  1NXY A;  3O87 A;  5FAT A;  1P9W A;  3MQO A;  4ZAM A;  5FQQ A;  1ACF A;  2J3T C;  1T19 A;  1N9B A;  2W3H A;  1N9N A;  5IT5 A;  3VMA A;  2XF3 A;  4WM9 A;  1NLY A;  1YAX A;  2I9V A;  1DJC A;  2W1T B;  3BLS A; 
#chains in the Genus database with same CATH homology
 2P08 A;  2WKR A;  3PBR A;  3R4K A;  4HP9 A;  5KSH A;  3S7Q A;  3PR6 A;  2HJ9 C;  1XJ4 A;  4DJ2 A;  4HY8 A;  3BW6 A;  4DN0 A;  3E4O A;  2NUT C;  3R7W B;  5DKK A;  3OOV A;  4HIA A;  2OWH A;  5FL3 A;  5HWV A;  3EGX C;  2A24 A;  3MJQ A;  4Q0J A;  3UB9 A;  5J4E A;  1ZHH B;  2XA7 M;  2OWJ A;  1VHM A;  3E0Y A;  5HDC A;  1W63 M;  2W3F A;  1Y28 A;  1H3Q A;  4Y5F A;  3OLO A;  1V9Z A;  2D02 A;  3MFX A;  5TBM B;  4L9G A;  2HGV A;  4GHI B;  2XRO A;  3T4K A;  4EES A;  3LIC A;  4EUV A;  4P6Z M;  4GS9 A;  4HP4 A;  3LIA A;  2OOL A;  3IS2 A;  3BQA A;  1S1Y A;  3MQQ A;  2WKQ A;  3CI6 A;  2V0W A;  3PBS A;  1OTE A;  4FSF A;  5DF9 A;  3MXQ A;  3CLO A;  1WA9 A;  3T4T A;  2CMN A;  3HCY A;  3LI9 A;  3E4P A;  4AFI A;  1T1B A;  3EEA A;  1LSV A;  2L1M A;  2W3E A;  2VGL S;  3VE4 A;  3PXP A;  2Y8H A;  5DKL A;  1MKM A;  4G3V A;  4I3J A;  2LB5 A;  4HJ3 A;  3T4O A;  5DFY A;  3TE8 A;  4BJP A;  3PBQ A;  3D72 A;  4II7 A;  4OOL A;  5F5Y A;  4EEU A;  3NOU C;  4LRY C;  3HJI A;  4EQ1 A;  4Z1W A;  4CLC B;  2HF6 A;  1TD5 A;  3G6O A;  3RFB A;  3LIF A;  3OBF A;  2VA0 A;  4KUO A;  2HJE A;  4PKY A;  4XT2 A;  4EU0 A;  4LRX C;  4ZRR A;  3FG8 A;  3LR5 A;  1EW0 A;  4CLC D;  1XJ3 A;  1F5M A;  4CLC E;  4NXE A;  3LYX A;  1DRM A;  4GW9 A;  4RQ9 A;  2V1A A;  3H82 A;  3JVU A;  4IHQ A;  3UMD A;  2PD7 A;  1IFQ A;  4IJG A;  2R78 A;  3FC7 A;  3T4L A;  4Y3I A;  5EFW A;  2KOI A;  2JKT I;  3A0R A;  1GSX A;  1W63 Q;  2G7U A;  5K5B A;  2PD8 A;  4UQI S;  4ARZ A;  4BBU A;  1T18 A;  2K2N A;  2DMW A;  4L9F A;  3TJZ C;  3KO6 A;  1OTD A;  4LRZ E;  3K2N A;  4WEJ A;  5G4Y A;  5J3W A;  2OAP 1;  3V67 A;  4HI4 A;  4FOF A;  3E4Q A;  4DMZ A;  3F1O A;  3EQU A;  4KQD A;  3KYZ A;  5F69 A;  5HWW A;  3T4S A;  5DJU A;  4WUJ A;  2KDK A;  1TS0 A;  3BJN A;  3RH8 B;  3TW8 A;  5HPF A;  3S7N A;  1YKD A;  2WKP A;  1OJ5 A;  2VV8 A;  3PHY A;  4JGR A;  3SW1 A;  1OJG A;  5MC7 A;  3KYQ A;  2O9C A;  2XRN A;  4HJ6 A;  3BY8 A;  1OTB A;  1N9O A;  3NOP C;  3LIB A;  2LB9 A;  1LL8 A;  2FH5 A;  5HSQ A;  3LID A;  2QJ5 A;  3F1P A;  4MN6 A;  2PYP A;  3ZYT A;  3F1N B;  3CWF A;  4R70 A;  2VKS A;  3UME A;  1MC0 A;  4EXO A;  2JKT M;  2L4R A;  3VE3 A;  5AVE A;  1STZ A;  1DP9 A;  1S4S A;  4H6J B;  1TS6 A;  1F9I A;  2W27 A;  2INW A;  5DJT A;  4ME4 A;  4M4X A;  2OAQ 1;  3H7W B;  1VB6 A;  5HDS A;  2W1T A;  3CAX A;  3CUE A;  3PBO A;  4F3L B;  1XFQ A;  2J80 A;  4ETZ A;  1TF1 A;  3OCL A;  5HDD A;  3MF0 A;  2B18 A;  2GNX A;  2J3W A;  3FPW A;  2J3T D;  2ZOI A;  3PBT A;  4EER A;  3UB6 A;  4NXB A;  5AVF A;  3ULF A;  4WF0 A;  3NOT C;  5IS1 A;  1ZTU A;  3R7W A;  1LSW A;  2VV6 A;  3CUE C;  3A0V A;  3VV4 A;  3EGD C;  1UWN X;  4NKP A;  4JGP A;  4R6L A;  2QJ7 A;  1YSQ A;  1UWP X;  2HV1 A;  3LR0 A;  2ZMV A;  3LFV A;  4I3I A;  4UQI M;  4O0P A;  3KSI A;  2O0Y A;  4HQA A;  1NRJ A;  2W1R A;  2GJ3 A;  2VZW A;  3EWK A;  2GX5 A;  1LT0 A;  1F98 A;  1P9R A;  2B02 A;  2JKR I;  5TBM A;  3BY9 A;  3P01 A;  4GHI A;  1NWZ A;  3C38 A;  2L0W A;  2A2L A;  4WEK A;  1P0Z A;  3DBA A;  4BBT A;  2PR5 A;  3ICY A;  3IBJ A;  2M1C A;  5HPI A;  5CX7 A;  3VOL A;  1ODV A;  3GEC A;  4B93 A;  2A24 B;  4BBV A;  4H6J A;  2QHK A;  4YWZ A;  4CQH A;  5I5L A;  1MZU A;  2BAS A;  3KSF A;  3K3C A;  2ZBB A;  1OTI A;  2EWV A;  2W1T B;  4MDZ A;  2W3D A;  1S67 L;  4LLO B;  4PHT A;  4KQO A;  4GLQ A;  3NHQ A;  4WN5 A;  2M7U A;  4OOM A;  4L9E A;  3C2W A;  4JGQ A;  5HL6 A;  4GS9 B;  4Q0H A;  2PHY A;  2Y79 A;  3IS2 B;  4NEE D;  2PDR A;  1OPX A;  4HHD A;  5G4Z A;  1OT6 A;  2V1B A;  2M7V A;  3IBR A;  3A0S A;  3B42 A;  2VX8 A;  4Q0I A;  4Y2F A;  1S4R A;  3UE3 A;  2PT7 A;  1XJ6 A;  1D06 A;  4CLC A;  3KX0 X;  4R38 A;  1YSP A;  3CIT A;  3P7N A;  4EET B;  2JKR M;  1S1Z A;  3EQV A;  4PKY G;  3RTY A;  4JGO A;  4MCW A;  3H9W A;  3E98 A;  4R3A A;  5LBR A;  3TRC A;  2VGL M;  3JVV A;  2VJW A;  3LR3 A;  4KUK A;  2IA2 A;  4HJ4 A;  5KIZ A;  2KX6 A;  4MMN A;  5F68 A;  1T1C A;  3GDI A;  4CLC C;  2FZ0 A;  5HD3 A;  1UGU A;  2JN7 A;  3MR0 A;  1XFN A;  1H8M A;  3D3O A;  3S7P A;  2ZOH A;  4I3A A;  3C30 A;  3BWL A;  3FPV A;  2KLI A;  4NXG A;  1T1A A;  5TJJ A;  4WEL A;  3T4J A;  4XT2 B;  2VEA A;  3BQ8 A;  3OC2 A;  2K31 A;  1GSW A;  4MN7 A;  1P97 A;  2YKH A;  1DP6 A;  2K7S A;  4BWI A;  2P7J A;  4HNB A;  5HZH A;  1OTA A;  2W3G A;  3ZQ5 A;  4BMW A;  1XJ2 A;  2MJ6 A;  3OCN A;  3KSG A;  3H82 B;  3S7O A;  3U2A A;  1GSV A;  2Z6C A;  4EEP A;  4HH3 A;  5HD5 A;  2H28 A;  5C5K A;  2EA9 A;  3PBN A;  3PYP A;  3LI8 A;  4WLA A;  4B9O A;  3W2Z A;  4PAU A;  2PYR A;  5F6A A;  1X0O A;  2PR6 A;  4I39 A;  3B47 A;  4YNR A;  4E04 A;  2JHE A;  2XA7 S;  4ETX A;  4G3W A;  3EEH A;  4ARZ B;  2QKP A;  2VLG A;  4HOI A;  2VV7 A;  1G28 A;  1D7E A;  4YOF A;  5IU1 A;  4DJ3 A;  1JNU A;  4MN5 A;  4I5S A;  4HH2 A;  5AJG A;  4P6Z S;  3EOI A;  2NUP C;  4EW7 A;  1DP8 A;  4LPZ A;  2V0U A;  3HJK A;  2V9A A;  2O9B A;  5A8B A;  4IUK A;  2QYB A;  3F1O B;  3F1N A;  2GZA A;  4O01 A;  4GJ4 A;  1BYW A;  1TS8 A;  1NLZ A;  3NJA A;  5HWT A;  1N9L A;  1V9Y A;  4I38 A;  2P04 A;  3H7W A;  3LR4 A;  5J7E A;  5L8M A;  4GCZ A;  2ZMF A;  5DFX A;  4F3L A;  3C8C A;  2QWS A;  4K08 A;  3MQ0 A;  4G3K A;  1LSX A;  2O99 A;  4L0L A;  4QPR A;  2D01 A;  3K3D A;  3MMH A;  3UB8 A;  1P9W A;  3F1P B;  3MQO A;  2O9A A;  1OT9 A;  1IOU A;  2J3T C;  4NXF A;  4UEY A;  1KOU A;  1G6O A;  2W0N A;  1T19 A;  4O8G A;  1TS7 A;  4WL9 A;  3B33 A;  2W3H A;  4IUH A;  3UB7 A;  1N9N A;  5IT5 A;  3LUQ A;  1NLY A;  1YAX A;  2I9V A;  2EWW A;  1S66 L;  3O5Y A;  3UE6 A;  2Z6D A;  3LIE A;  3T50 A;  3T4Q A;  3KSH A;  2YKF A;  2XSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...