1T1CA

Late intermediate il3 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1cA00
3MR0A 2L0WA 1UWNX 1S1ZA 1LSWA 1N9NA 4XT2B 5I5LA 5HSQA 3E4QA 2ZOHA 4I39A 2V9AA 4EESA 1S66L 2WKQA 1V9YA 1UWPX 2Z6DA 3E4PA 4HIAA 4M4XA 4GS9B 5HD5A 4NXEA 5AVEA 3A0RA 1DP8A 3VE3A 1TS0A 1TS7A 3IBRA 4XT2A 4HHDA 3A0SA 4HI4A 4EW7A 2QKPA 4I3AA 4HP4A 4GHIA 3VE4A 1JNUA 3LIAA 5G4YA 2QJ7A 4YWZA 2V0UA 3UB7A 2EA9A 1S4SA 3NJAA 2BASA 3ULFA 4EQ1A 4KUOA 1F9IA 4R70A 1P0ZA 3HJKA 4LRZE 4WF0A 2KX6A 4HOIA 3UMDA 2VLGA 1XJ2A 3BY8A 3SW1A 1GSVA 3LI9A 3CLOA 1G28A 2VV7A 4HH2A 2Z6CA 5F68A 1F98A 2OOLA 4PKYG 3PHYA 1S67L 3NOUC 3CAXA 3H7WB 2PR6A 4EERA 1OJGA 3K3CA 2VV8A 5F69A 2KDKA 1TS8A 4HNBA 4BBTA 1X0OA 3G6OA 4R3AA 5HZHA 5DKLA 2V1AA 3E4OA 2L1MA 4HP9A 3GECA 5G4ZA 1OT9A 2QHKA 4I38A 3UB8A 3MQOA 3EEHA 4L9GA 3P7NA 1OTBA 3MQQA 5AVFA 3H7WA 4GHIB 3FC7A 1S4RA 3UMEA 5DJTA 1N9LA 1LT0A 3VOLA 3CWFA 4PKYA 3MXQA 5DKKA 1GSWA 2QJ5A 3F1NB 1T18A 1ODVA 1LL8A 4KUKA 5EFWA 2PDRA 5J4EA 3MJQA 4GW9A 3PYPA 3IS2A 2YKFA 4EXOA 1XJ3A 2HV1A 1OT6A 3B33A 1DP9A 1T1BA 2PD7A 4I3IA 2QWSA 4B9OA 4H6JB 3F1NA 4R6LA 5HWVA 3H82B 1LSXA 3FG8A 2VEAA 1KOUA 3T50A 5DJUA 1XJ4A 1NWZA 2A24B 4WLAA 1N9OA 4L9FA 2V0WA 4BBVA 1P97A 4EETB 2ZBBA 3NHQA 4HJ6A 2W0NA 1WA9A 1D7EA 2YKHA 3ZQ5A 4L9EA 2H28A 4H6JA 5TBMB 3H82A 1LSVA 1S1YA 4I3JA 3C8CA 4NXBA 2INWA 3UB9A 2OWJA 2B02A 4NXGA 2P7JA 2A24A 1T1CA 2R78A 4WUJA 4LRYC 2D02A 5IU1A 2I9VA 3LIBA 1EW0A 5HDDA 4JGQA 2VV6A 2K7SA 4JGRA 4K08A 1OTAA 3F1OB 5TBMA 5HDSA 2JN7A 4NXFA 3LI8A 3IS2B 3D72A 2D01A 1D06A 1DRMA 4DJ3A 3RH8B 4JGPA 3LUQA 3NOTC 4MN6A 5A8BA 3BY9A 3K3DA 4LLOB 1V9ZA 1OTEA 1OJ5A 4LRXC 1GSXA 5J3WA 3BWLA 3F1OA 2OWHA 5IS1A 3MFXA 3ICYA 1OTDA 2ZOIA 1XFQA 3F1PB 4GCZA 2CMNA 4HJ3A 1UGUA 3HJIA 4BBUA 5HWWA 4HH3A 4WL9A 5J7EA 2W27A 3LIDA 4R38A 3GDIA 3UB6A 5HWTA 1XJ6A 3OLOA 1XFNA 1Y28A 3RTYA 5HDCA 1OTIA 3KX0X 4LPZA 4DJ2A 2WKRA 4E04A 4GS9A 4F3LB 4JGOA 5F5YA 3LIEA 2L4RA 3F1PA 1T1AA 3UE6A 3EWKA 4MN5A 4EEUA 4WN5A 3LYXA 4HQAA 4EEPA 5KIZA 3NOPC 3LICA 2PD8A 1TS6A 4HY8A 2PR5A 3A0VA 2PYRA 5HD3A 2M1CA 5F6AA 2GJ3A 2V1BA 4HJ4A 4F3LA 2PYPA 1DP6A 4I5SA 1MZUA 1VB6A 2JHEA 4RQ9A 1BYWA 3C2WA 2PHYA 3H9WA 3LIFA 4KQDA 2WKPA 2J80A 1T19A
chains in the Genus database with same CATH superfamily
1ZC2A 4JXWA 3MR0A 2ZQ9A 2ZD8A 3V50A 3E4QA 4B4ZA 1ERMA 2ZOHA 3LR5A 1K38A 1VQQA 4CLCE 1XPBA 5CGXA 3SH8A 3M6BA 2XSSA 4ESPA 2LB9A 2WKQA 2JKRI 2Y55A 3W8KA 1OPXA 2JC7A 2Z6DA 3E4PA 1BTLA 4MLLA 3K2NA 4QB8A 2PU4A 2XR0A 5FA7A 1K6RA 3M2JA 2WZXA 1C3BA 1CF0A 4NXEA 4XUZA 5AVEA 5HX9A 1TS7A 4EU0A 5DF7A 4U0XA 4R1GA 2P9VA 2XLNA 4XT2A 5CHMA 4HI4A 2QKPA 4I3AA 5FQKA 5DFXA 1YAXA 4JF6A 1VETB 3QNCA 2ZQ8A 2E8JA 5HAIA 1MBLA 3UB5P 1S4SA 2BASA 5FI7A 3ULFA 5CX7A 4KUOA 3QP1A 3HJKA 2FFYA 2HDUA 5TGFA 1G6OA 4ETZA 4OPRA 2KX6A 4HOIA 5AJGA 4YINA 3IT9A 5GHYA 1IEMA 4ID4A 3BY8A 3SS4A 3UO9A 1HLUP 3ISGA 1XA7A 2ZQCA 3UN7A 1JTDA 3UDFA 4GB7A 4N1HA 3LI9A 1WYBA 4CLCB 3A3FA 3KSHA 2Y2MA 4WM9A 2QPNA 4HBUA 5F68A 2QMIA 2OOLA 4PKYG 1YM1A 3PHYA 4Y0OA 3NOUC 3LO7A 4RX3A 3H7WB 4CPKA 2PR6A 4S2MA 1MKIA 4PM7A 2VX8A 1OJGA 4LENA 3K3CA 5E2HA 2J7VA 2VV8A 3N8SA 2WKIA 3UDIA 1DJAA 2KDKA 2WYXA 3SZTA 4R3AA 5HZHA 3MQ0A 5DKLA 2Y2KA 3E4OA 2V8CA 4HP9A 3IF6C 3T4OA 5CXWA 1OT9A 2ZQDA 4FOFA 2P9VB 4KZ6A 4FUWA 2FZ0A 3MQOA 5DFYA 4DDSA 1PW1A 5AVFA 2XRNA 2XROA 4GN2A 4JF4A 5CTNA 3GMWA 3QP8A 4WEKA 1J3WA 1K4FA 3T4KA 1N9LA 3V3RA 4JXVA 5CHJA 4XUXA 1PYYA 4Y2FA 3EOIA 1PZOA 3BLSA 1BLSA 4FCFA 5A90A 3F1NB 1MC0A 1T18A 1PFLA 1K56A 2K2NA 4Q8IA 4BJPA 1H8ZA 1K4EA 2OLUA 5EFWA 2WZZA 4FH2A 4MBHA 2PDRA 2Y79A 1E4DA 4QY5A 4EXOA 1L0FA 3B33A 1DP9A 4QWOA 3VFFA 5A92A 4WZ4A 1PW8A 4B9OA 2O9AA 4R6LA 5BOHA 2HDQA 5HWVA 2K31A 2EXBA 3IBJA 4OQHA 1WE4A 1KOUA 1VEUB 3IXBA 5AQ7A 4JLFA 4N92A 1XJ4A 2W1TB 4KG2A 3BFFA 2ZMFA 4WLAA 3B3XA 3HREA 3ITAA 3MZDA 4EETB 4OPYA 2ZBBA 3ZDJA 3IF6B 3N7WA 5FAQA 2XGNA 3E2LA 3T1RA 2W0NA 5EE8A 3LR3A 3BFGA 1W8QA 2YKHA 4EUVA 4OOYA 4G3VA 2PRFA 1FOFA 2JE5A 1CEGA 3MXSA 3P09A 1LSVA 2W1RA 2P74A 4S2JA 4I3JA 3TJZC 2ZL1A 4NXBA 2I72A 4QU3A 2OWJA 3SS3A 3UB9A 4DRTA 2B02A 1KDSA 3QHYA 2A24A 3HVFA 2QZ6A 4EUZA 5DF9A 1JTGA 1RGZA 4WUJA 5EM1A 1AXBA 4WMCA 5IU1A 3OBFA 1CQAA 4BMWA 4JGQA 3T4QA 3BM6A 5EVLA 4S2NC 4JGRA 2ZC4B 4LV3A 1S0WA 4DDYA 3DTKA 2J3TD 3D72A 4HBTA 2D01A 1L3LA 1CI8A 4IHQA 3RH8B 4KQRA 4JGPA 4E3KA 4N9LA 2PBYA 3G35A 5A8BA 1IYPA 1FCNA 3G30A 1V9ZA 3TG9A 1NXYA 2EX6A 3FV7A 2VGLS 5EV0A 1KDWA 4DE3A 3FWLA 3PBNA 5A91A 2OWHA 3G31A 3SH9A 4P6BA 4BBUA 5HWWA 1L2SA 1YSQA 4GZBA 3G2YA 1ZKJA 3GDIA 4EV4A 5FSRA 3QP4A 4II7A 3KSIA 1Y28A 3IXGA 3IXHA 3NBLA 1VHMA 5CTMA 1TF1A 3FZCA 2EWWA 3SOIA 1MY8A 3QP6A 3MBZA 4F3LB 3V5MA 4OKPA 1KVMA 1FSWA 1NJ4A 1T1AA 3UPNA 5A93A 3IHAA 1TDLA 5EM0A 4HQAA 4EEPA 3NOPC 3LICA 4PHTA 1XXMA 4QJGA 1E3UA 4R23A 2OAQ1 3FKVA 2PYRA 1Y4OA 5IHVA 3NDEA 2JKTM 3G32A 2GJ3A 1YPRA 2Y2IA 2VGJA 2C6WB 1MZUA 4EBPA 2JHEA 4OPZA 4X1MA 3VP0A 2NUPC 4JBFA 3C2WA 5FQ9A 5FDSA 3ZNTA 4R0QA 4JXGA 1O07A 5L10A 1ERQA 5FQQA 2Y2OA 1GA0A 2L0WA 4B93A 1UWNX 1K54A 2O9CA 5I5LA 3R7WB 2ZC7A 4I39A 5TFQA 3C7UA 3D3OA 5FI6A 3TRCA 1YSPA 3WS0A 1S66L 4Y5FA 1VM1A 5L2FA 5K5BA 1SCWA 3T1SA 5TR7A 5GHXA 1MWTA 3VE3A 3GQZA 3NCKA 5EVIA 3HUNA 4IVKA 1LI0A 2Y59A 4KZ8A 1KE0A 4GKUA 2HJ9C 1QMFA 1S6RA 3BEBA 1JNUA 5CHUA 3LIAA 5IT5A 3NDGA 2QJ7A 3WRZA 4FSFA 3FYZA 2EA9A 1NLZA 2DRWA 3ZNYA 1Y54A 1P0ZA 3LY4A 4EBNA 4LRZE 1FR6A 2Q9NA 1H3QA 1YKDA 2EX9A 2Y2JA 1PWDA 3SW1A 1DY6A 5F82A 1GSVA 3W2ZA 1VETA 1IFQA 1PIOA 3ZG9B 4IUKA 2R9WA 3HLDA 2XFSA 3HUOA 2VV7A 1H8MA 4YNRA 4EWFA 5FL3A 2ZM2A 3N6IA 4IVIA 1STZA 2WGWB 3LEZA 3SH7A 4DE0A 2GX5A 1YLZA 2XA7S 3WS2A 3R4KA 5DTSA 4IUHA 2Y91A 3B47A 4BL3A 4HNBA 1EI5A 1X0OA 4CLCA 1KGEA 5G4ZA 4LV0A 1MKMA 4K91A 3IWIA 5EVIB 3DWKA 1K56D 1MWUA 3GV9A 5FAOA 2W3FA 2XQZA 1OTBA 4ZBEA 3Q7ZA 5M1AA 4QD4A 1E25A 3H7WA 3IH9A 3CITA 3HCYA 5DJTA 4B4XA 3P01A 2EX2A 3WS5A 3NULA 2OSUA 2B95A 5KSCA 4JF5A 1LT0A 1FILA 4UA6A 3KYZA 2EFUA 5FATA 1IKGA 5E2EA 1HZOA 3FPVA 1GSWA 1G5UA 1ODVA 3HBRA 1LL8A 4KUKA 4X68A 1XKZA 3HLEA 3RXXA 2QYBA 1K55C 2VJWA 2G2UA 2V8FA 5J4EA 4OQGA 4UQIS 2O0YA 3EGXC 3HLCA 4C6YA 2HV1A 1KGFA 2B18A 5CEDA 1MPLA 2HGVA 2QWSA 4H6JB 1Q2QA 2P04A 2XF3A 3F1NA 3DTEA 3HUMA 4LCLA 4LV1A 4X56A 3H82B 1SKOB 3V3SA 2IA2A 4Q0IA 3GRJA 1DJCA 4S2KA 4L9FA 1BUEA 4HJ6A 2H5SA 1FSYA 4OOLA 3DTIA 3CPTB 3HLFA 1IYOA 1PRQA 5TBMB 3IX3A 5JYPA 1ONHA 4ZJ3A 5AQ9A 1BT5A 1S1YA 1VEUA 1FCOA 4Y0UA 2W1TA 4YOFA 2P7JA 1ESIA 1KGGA 3IWOA 2R78A 2Y2GA 3IF6A 4PM9A 3BFDA 3T12B 5M18A 2LB5A 3O88A 2VV6A 4C75A 2K7SA 2HP6A 4K08A 4ARZA 3T4JA 1K0KA 1SHVA 1YLJA 3NC8A 1ACFA 4OP8A 2GDNA 3PBRA 5CECA 5HPIA 3VV4A 4DJ3A 2X01A 4OVDA 3A3JA 3NOTC 4MN6A 3IH8A 4X69A 3VSLA 1ES2A 3QP2A 3JVUA 4R3JA 4P85A 1JVJA 3LR4A 4O7DA 1L0DA 4DE1A 1NRJA 4LRXC 1OMEA 3C7VA 5IS1A 3MKEA 1OTDA 2ZOIA 4HESA 3OZHA 4KG5A 4HJ3A 3FKWA 3HJIA 1TD5A 4DMZA 1H5XA 4HH3A 5J7EA 2BLSA 3FPWA 1HVBA 3BRMA 4KZ3A 5FASA 1XJ6A 2XFTA 2A49A 2ZC6B 1RGYA 1E3UD 4Y17A 3VOZA 1ES3A 2ZQ7A 1OTIA 3KYEA 4LPZA 2PU2A 3W4OA 1W7FA 5MC7A 5F5YA 1I2WA 3LIEA 3S4XA 3ZG7B 4F94A 4N1XA 3UNWA 3PBTA 3ZVTA 4RA7A 3V39A 2XH9A 4GNUA 2Z2LB 3UE3A 4WN5A 5KIZA 4ARZB 4HY8A 2PR5A 2OLVA 2M7UA 3A0VA 5M19A 5AQBA 3RFBA 2X02A 1IYSA 4YFMA 2M1CA 5L8MA 3BFEA 4N9KA 2V1BA 4F3LA 3GR2A 1DP6A 1SDNA 3CI6A 4QPRA 4ZDXA 4P87A 4LGWA 4S2NA 4ZAMA 1I2SA 4X6TA 5EVEA 3NECA 2WKPA 1T19A 3ITBA 1NLYA 4E3NA 4E3MA 3N8LA 5E43A 2VGLM 3UPOA 1LSWA 1EWZA 4P6ZM 3C38A 5HSQA 3MZFA 2Z2MB 3L9KA 3IX8A 5HFOA 2GZAA 3UE1A 3I7JA 3PR6A 5FAPA 3Q1FA 2PBDP 1K6SA 3VFHA 4EESA 3G4PA 3PAGA 3QP5A 2ACGA 4IBRA 4Z1WA 3TE8A 3V67A 1W8YA 2JCHA 1UWPX 4ZRRA 4K0XA 4OH0A 5HD5A 5D3OA 3S22A 3PAEA 1PWGA 1J9MA 3A0RA 1TS0A 1M6KA 1CJFA 3DW0A 3A0SA 2HPBA 1QMEA 4PPRA 4EW7A 3R7WA 2A3UA 3S1YA 4GHIA 3DTMA 3VE4A 3SS5A 4NETA 2EFXA 3P98A 5CGWA 3DWZA 5G4YA 4R3BA 2FFFB 3WS1A 2V0UA 2B5RA 1MXOA 4WZ5C 3O5YA 1ONGA 5HARA 2PAVP 3KO6A 2JKRM 4KQOA 1F9IA 3WWXA 1GHIA 2M7VA 3OPRA 3UPPA 3UMDA 1IOUA 2VLGA 3T4SA 1DJBA 4U0TA 4X25A 4FH4A 3M2KA 2HZ5A 4GDNA 1LI9A 4GLQA 4CLCD 4LV2A 1Q2PA 3OC2A 2DCFA 3BJNA 3VP1A 1GCEA 2Z6CA 3GSGA 4NKPA 3NY4A 1S67L 3T1QB 5CERA 3OPLA 4M3KA 2Q9MA 3MMHA 3OPPA 2JBFA 3LFVA 5HAQA 2E8IA 5CGSA 5EOEA 1SDEA 1PNEA 5F69A 1ES5A 5GLAA 1WYCA 2WUQA 1NZUA 3WRTA 3G6OA 1FQGA 1W63Q 2L1MA 3GECA 2QHKA 1FCMA 3UB8A 3OCLA 4FTXA 5I94A 4MCWA 4DE2A 1YLPA 2WGWA 2HDSA 3IWQA 3MQQA 4GHIB 3FC7A 4X55A 1S4RA 3UMEA 4KQQA 3T4TA 5L07A 4BENA 2H0TA 3TW8A 2WGVA 1KE4A 4C3QA 2OV5A 1CK3A 3CWFA 3WS4A 4Y15A 3O87A 2MJ6A 3Q7VB 4MBFA 2QJ5A 3CUEA 4PM5A 5JYOA 3ZG8B 4S2OA 3OCNA 1GHMA 4ZJ2A 5KZHA 1YMSA 3A3EA 3S7NA 2HP9A 3JPUA 4GW9A 4ZJ1A 2J3TC 4E6WA 4MMNA 1K57A 1PI5A 2YKFA 3IQAA 4WEJA 2IWDA 1ESUA 1XJ3A 3T1XA 1PI4A 1F5MA 3VP3A 4MN7A 3LEQA 3CJMA 2UWXA 2X71A 3OPHA 2HDRA 4PAUA 1BULA 1CI9A 1LSXA 3FG8A 1CEFA 2VEAA 4MNRA 3T50A 2OAP1 4BD1A 4DXCA 2XK1A 4MBKA 3IF5A 3A3DA 3MXRA 3BQ8A 2V0WA 3C4OA 3BW6A 1AWIA 5KMWA 5DTKA 1G6AA 1WA9A 4ME4A 3VSKA 2XEPA 4DN0A 3RJUA 4H6JA 4O8GA 4BLMA 2WK0A 3H82A 1SKOA 2INWA 1ZHHB 5EPHA 2WKHA 5KSHA 1G68A 3LCEA 4KZ9A 5G18A 4LCMA 3PXPA 4B88A 4LRYC 5HDDA 1YQSA 1IKIA 3KYQA 3CPTA 3GVBA 4LFUA 5CEBA 5TBMA 3F1OB 5HDSA 2JN7A 3JVVA 4NXFA 2UV0E 3LI8A 4RYEA 3HLBA 2VA0A 4UA9A 4H8RA 5E2GA 3PBQA 2WADA 2Y2QA 3ZCZA 2BTFP 4KZ5A 4UQIM 2Y2HA 1NYYA 4GJ4A 3BY9A 1XX2A 4LLOB 2G7UA 4UEYA 3ZHHA 3DAVA 4HEFA 2Q0OA 1ES4A 5EUAA 1ZG6A 1GSXA 1K55A 2O99A 5J3WA 3AGEA 3BWLA 3ICYA 2V20A 3F1PB 3HLWA 4GOGA 2CMNA 3E98A 4O0PA 2WGIA 4E3OA 4WL9A 4GDBA 3S7OA 3O86A 2W27A 1I5QA 5FQMA 5GLBA 4D2OA 3UB6A 1M40A 3OLOA 2VGKA 4ETXA 2JKTI 2R9XA 3E2KA 2WKEA 1A0KA 3RTYA 5HDCA 4DKIA 2H10A 3KX0X 4JPMA 3EQUA 4DJ2A 3MS6A 2H0YA 4GS9A 2XDMA 4JGOA 3MZEA 2W3HA 2W3GA 1BLCA 3B42A 3EWKA 4WMCD 4MN5A 1PWCA 2W3EA 4EEUA 1JWPA 4NG2A 3LYXA 3PBSA 1W5DA 5AQAA 1Z09A 5FEGA 2PD8A 4PMAA 5TJJA 3MF0A 5GHZA 4A5RA 3AGFA 5F6AA 3BYDA 4JKTA 2KOIA 4RQ9A 2J9OA 4RX2A 1YLTA 1XGJA 2Y2NA 4KQDA 4S2IA 1ALQA 4Y7PA 1BSGA 2JKGA 1GA9A 4E3JA 2J80A 3BLMA 2J9PA 1HTZA 2EXAA 1N4OA 1BLHA 1MWRA 2NUTC 1S1ZA 3DBAA 1N9NA 4XT2B 3G2ZA 4OONA 4BQMA 2RL3A 1L0GA 2VKSA 3E0YA 2V9AA 4S2LA 3IHBA 3ZG0A 1SZVA 1L0EA 2Y2PA 5HL6A 4EBLA 1V9YA 2IWCA 4HIAA 4M4XA 4GS9B 4IEDA 3U2AA 5J8XA 4CQHA 1O7EA 1DP8A 2W3DA 3IBRA 4HHDA 4O01A 5HAPA 1LLBA 2XD1A 3ZVWA 1W63M 4KZ4A 4HP4A 5FQIA 1EROA 1U60A 5CRFA 2HF6A 4YWZA 3UB7A 2ZMVA 3NJAA 4IJGA 4PM6A 4EQ1A 4R70A 3LR0A 3EEAA 2CC1A 4DXBA 1KVLA 4WF0A 1XJ2A 1XGIA 4R4SA 1PZPA 3EGDC 1F2KA 3CZDA 2IWBA 3CLOA 1G28A 2V1ZA 3IXDA 3Q07A 4HH2A 1SKFA 1F98A 3MSHA 2O9BA 3CAXA 4EERA 2P08A 1ZG4A 1TS8A 5FEFA 1H8YA 3JYIA 2KLIA 4BBTA 4L0LA 4NEED 2V1AA 3BQAA 3ZGAB 4I38A 4OQIA 4Y0TA 4BL2A 3ZG5A 5EVID 3EEHA 3C5AA 3P7NA 4L9GA 1BLPA 4NK3A 5GLDA 3VOYA 4OPQA 3QNBA 5GLCA 1KE3A 1Z6FA 3C30A 1NZOA 2PT7A 4GD8A 1ZTUA 2A2LA 1D1JA 1LL9A 5EECA 3VOLA 4CJNA 4PKYA 2ZM8A 4QHCA 1IELA 5HL1A 3CHWP 3MXQA 4KZ7A 4UAAA 5DKKA 2ZM0A 1XP4A 3KSFA 4WBGA 4OQ0A 3W4QA 4ZTKA 4G3KA 4P6ZS 4OP5A 3ZYTA 3VP2A 1P9WA 3MJQA 4X53A 3CMZA 3BFCA 3PYPA 3IS2A 5HPFA 2HJEA 4WZ5A 4MEZA 1NYMA 1RCJA 1OT6A 1T1BA 3HL9A 3L7HA 3C4PA 3LGOA 2PD7A 4I3IA 3Q7VA 5F1FA 5U47A 1N9BA 2ZJ9A 5DVAA 4Y3IA 2ZL1B 5DJUA 4E3IA 1XA1A 4U3TA 3LY3A 4S2PA 1NWZA 2A24B 2DNSA 4RVAA 1N9OA 4MDZA 3N4IA 4BBVA 1P97A 3NHQA 3T4LA 1D7EA 3ZQ5A 4AFIA 4EQIA 1HD8A 4L9EA 2H28A 4UA7A 5C5KA 3A3IA 1W79A 4OLDA 2ZC3B 2EWVA 5LBRA 3C8CA 2GNXA 3Q81A 3AGDA 4Q0HA 3IX4A 3MKFA 4KZAA 1H0MA 4NXGA 4IBXA 3EQVA 4KZBA 2Y8HA 3S7PA 1T1CA 3S7QA 2XD5A 3CG5A 4PM8A 2D02A 2I9VA 3LIBA 1EW0A 1JWZA 1TEMA 3RXWA 4X1LA 3D9YA 1OTAA 1TDGA 2BG1A 4KG6A 1IYQA 4OOMA 4FD8A 4DF6A 3IS2B 2RCXA 3VMAA 1K54C 4XXRA 3U4LP 2ZMAA 1D06A 3O3VA 1DRMA 2HP5A 1LL5A 3UDXA 3OOVA 2JKFA 3LUQA 4JXSA 4WYYA 1NRFA 3K3DA 1FR1A 1GHPA 5FDHA 1TVFA 4WELA 4BD0A 4GD6A 5HW3A 3GTCA 5DTTA 1OTEA 1OJ5A 3PTEA 2ZC5B 5FI2A 2C5WB 3F1OA 2WAFA 3MFXA 1RP5A 4D60A 1XFQA 4GCZA 2ZQAA 1UGUA 3CUEC 1YLYA 4UHUA 5F83A 4G3WA 2G2WA 5EVIC 4P0MA 3LIDA 4R4RA 4R38A 5F1GA 1YT4A 3D4FA 3NIAA 4K0WA 5HWTA 4KENB 5EOOA 2VK3A 1XFNA 5GL9A 3TSGA 3MFDA 4Q0JA 3Q82A 2EX8A 4BWIA 3ZFZA 1K57C 1LHYA 2WKRA 3TOIA 4E04A 4Y13A 3UE0A 2L4RA 3F1PA 2Y4AA 5DF8A 1YMXA 2XA7M 1NY0A 1P9RA 2J3WA 3UE6A 3NI9A 2VZWA 3PBOA 1JWVA 2Y2LA 1TS6A 1FIKA 2FH5A 5HD3A 5E2FA 2ZLYA 5FQJA 4OLGA 4E3LA 2V2FF 4HJ4A 4Z9QA 3W4PA 2PYPA 4I5SA 2AVXA 2J8YA 3VP4A 3KSGA 1VB6A 3UY6A 3HLGA 1BYWA 2DMWA 3BECA 5L09A 1BZAA 4E6XA 2PHYA 3H9WA 3N8RA 3LIFA 3G34A 4QY6A 2WAEA 1MWSA 1K25A 3M6HA 1YLWA 4CLCC
chains in the Genus database with same CATH topology
1NLYA 3MR0A 2L0WA 4B93A 1UWNX 2VGLM 2NUTC 2O9CA 1S1ZA 1LSWA 1N9NA 3DBAA 4P6ZM 3C38A 4XT2B 5I5LA 5HSQA 3E4QA 2ZOHA 3LR5A 2GZAA 3R7WB 4CLCE 3PR6A 4I39A 2VKSA 3E0YA 2V9AA 3D3OA 4EESA 2XSSA 3TRCA 1YSPA 1S66L 2LB9A 4Y5FA 2WKQA 4Z1WA 2JKRI 5HL6A 3TE8A 5K5BA 1OPXA 3V67A 1V9YA 1UWPX 2Z6DA 3E4PA 4HIAA 4ZRRA 4M4XA 3K2NA 4GS9B 3U2AA 5HD5A 4NXEA 4CQHA 5AVEA 3A0RA 1DP8A 3VE3A 1TS0A 1TS7A 2W3DA 4EU0A 3IBRA 4XT2A 4HHDA 4O01A 3A0SA 4HI4A 4EW7A 1W63M 2QKPA 4I3AA 3R7WA 4HP4A 2HJ9C 5DFXA 4GHIA 1YAXA 3VE4A 1JNUA 3LIAA 2HF6A 5IT5A 5G4YA 2QJ7A 4YWZA 2V0UA 4FSFA 3UB7A 2EA9A 2ZMVA 1S4SA 3NJAA 3O5YA 2BASA 4IJGA 1NLZA 3KO6A 3ULFA 5CX7A 2JKRM 4EQ1A 4KUOA 4KQOA 1F9IA 4R70A 1P0ZA 3HJKA 2M7VA 3LR0A 3EEAA 1G6OA 4LRZE 4ETZA 4WF0A 2KX6A 4HOIA 3UMDA 1IOUA 1H3QA 5AJGA 1YKDA 2VLGA 1XJ2A 3T4SA 3BY8A 3SW1A 1GSVA 3W2ZA 3EGDC 1IFQA 3LI9A 4CLCB 3KSHA 4IUKA 3CLOA 4GLQA 1G28A 4CLCD 4CLCC 2VV7A 3OC2A 3BJNA 1H8MA 4YNRA 4HH2A 5FL3A 2Z6CA 5F68A 1F98A 2OOLA 4NKPA 4PKYG 3PHYA 1S67L 1STZA 3NOUC 2O9BA 3CAXA 3MMHA 3H7WB 2PR6A 3LFVA 4EERA 2VX8A 2GX5A 1OJGA 2XA7S 2P08A 3K3CA 2VV8A 5F69A 2KDKA 3R4KA 4IUHA 3B47A 1TS8A 4HNBA 2KLIA 4BBTA 4L0LA 1X0OA 4NEED 4CLCA 3G6OA 4R3AA 5HZHA 3MQ0A 5DKLA 1W63Q 2V1AA 3BQAA 3E4OA 2L1MA 4HP9A 3GECA 5G4ZA 3T4OA 1MKMA 1OT9A 2QHKA 4I38A 4FOFA 3UB8A 3OCLA 4MCWA 2FZ0A 3MQOA 5DFYA 3EEHA 4L9GA 3P7NA 2W3FA 1OTBA 3MQQA 5AVFA 3H7WA 4GHIB 3FC7A 2XRNA 1S4RA 3CITA 3UMEA 2XROA 3HCYA 3T4TA 5DJTA 3C30A 3P01A 2PT7A 1ZTUA 4WEKA 3TW8A 2A2LA 3T4KA 1N9LA 1LT0A 3VOLA 3CWFA 4PKYA 3KYZA 3EOIA 4Y2FA 3MXQA 2MJ6A 3FPVA 5DKKA 1GSWA 2QJ5A 3F1NB 3CUEA 1MC0A 1T18A 1ODVA 1LL8A 4KUKA 3KSFA 2K2NA 3OCNA 4BJPA 5EFWA 3S7NA 2QYBA 4G3KA 4P6ZS 3ZYTA 2VJWA 2PDRA 2Y79A 5J4EA 1P9WA 3MJQA 4GW9A 3PYPA 3IS2A 4UQIS 2J3TC 5HPFA 4MMNA 2HJEA 2O0YA 2YKFA 4EXOA 3EGXC 4WEJA 1XJ3A 2HV1A 1OT6A 3B33A 1DP9A 1T1BA 2B18A 1F5MA 2PD7A 2HGVA 4I3IA 4MN7A 2QWSA 4B9OA 4H6JB 3F1NA 2P04A 2O9AA 4R6LA 5HWVA 4PAUA 2K31A 3IBJA 3H82B 1LSXA 3FG8A 2VEAA 4Y3IA 1KOUA 3T50A 2IA2A 2OAP1 5DJUA 4Q0IA 1XJ4A 2W1TB 2ZMFA 1NWZA 2A24B 3BQ8A 4WLAA 1N9OA 4L9FA 2V0WA 4MDZA 4BBVA 3BW6A 1P97A 4EETB 2ZBBA 3NHQA 3T4LA 4HJ6A 2W0NA 3LR3A 1WA9A 4ME4A 4OOLA 4DN0A 1D7EA 2YKHA 3ZQ5A 4AFIA 4EUVA 4L9EA 4G3VA 2H28A 4H6JA 5TBMB 4O8GA 5C5KA 2EWVA 3H82A 1LSVA 2W1RA 5LBRA 1S1YA 4I3JA 3TJZC 3C8CA 2GNXA 4NXBA 2INWA 4Q0HA 3UB9A 2OWJA 1ZHHB 2W1TA 4YOFA 2B02A 4NXGA 2P7JA 5KSHA 2A24A 3EQVA 2Y8HA 3S7PA 1T1CA 2R78A 5DF9A 3PXPA 3S7QA 4WUJA 4LRYC 2D02A 5IU1A 3OBFA 2I9VA 3LIBA 1EW0A 4BMWA 5HDDA 4JGQA 2LB5A 3T4QA 2VV6A 3KYQA 2K7SA 4JGRA 4K08A 4ARZA 1OTAA 3F1OB 5TBMA 3T4JA 5HDSA 2JN7A 3JVVA 4NXFA 4OOMA 3LI8A 3IS2B 2VA0A 2J3TD 3D72A 2D01A 1D06A 1DRMA 3PBRA 3PBQA 5HPIA 4IHQA 3VV4A 3RH8B 4DJ3A 3OOVA 4JGPA 3LUQA 4UQIM 3NOTC 4MN6A 4GJ4A 5A8BA 3BY9A 3K3DA 3JVUA 4LLOB 1V9ZA 2G7UA 4UEYA 3LR4A 4WELA 2VGLS 1OTEA 1NRJA 1OJ5A 1GSXA 3PBNA 2O99A 4LRXC 5J3WA 3BWLA 3F1OA 2OWHA 5IS1A 3MFXA 3ICYA 1OTDA 2ZOIA 1XFQA 3F1PB 4GCZA 2CMNA 4HJ3A 1UGUA 3HJIA 3E98A 1TD5A 3CUEC 4O0PA 4BBUA 4DMZA 5HWWA 4HH3A 4WL9A 5J7EA 3S7OA 4G3WA 2W27A 1YSQA 3FPWA 3LIDA 4R38A 3GDIA 3UB6A 5HWTA 1XJ6A 3OLOA 4ETXA 1XFNA 2JKTI 4II7A 3KSIA 1Y28A 3RTYA 5HDCA 4Q0JA 1VHMA 4BWIA 1TF1A 1OTIA 3KX0X 2EWWA 4LPZA 3EQUA 4DJ2A 2WKRA 4E04A 5MC7A 4GS9A 4F3LB 4JGOA 5F5YA 3LIEA 2L4RA 3F1PA 2W3HA 2W3GA 2XA7M 1P9RA 1T1AA 3PBTA 2J3WA 3UE6A 3B42A 3EWKA 2VZWA 3PBOA 4MN5A 2W3EA 4EEUA 3UE3A 4WN5A 3LYXA 4HQAA 3PBSA 4EEPA 5KIZA 3NOPC 3LICA 4ARZB 2PD8A 4PHTA 5TJJA 1TS6A 4HY8A 2OAQ1 2PR5A 2M7UA 3A0VA 3MF0A 2FH5A 2PYRA 5HD3A 3RFBA 2M1CA 2JKTM 5L8MA 5F6AA 2GJ3A 2V1BA 2KOIA 4HJ4A 4F3LA 2PYPA 1DP6A 4I5SA 1MZUA 3KSGA 1VB6A 2JHEA 4RQ9A 3CI6A 4QPRA 1BYWA 2DMWA 2NUPC 3C2WA 2PHYA 3H9WA 3LIFA 4KQDA 2WKPA 2J80A 1T19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR0 A;  2L0W A;  1UWN X;  1S1Z A;  1LSW A;  1N9N A;  4XT2 B;  5I5L A;  5HSQ A;  3E4Q A;  2ZOH A;  4I39 A;  2V9A A;  4EES A;  1S66 L;  2WKQ A;  1V9Y A;  1UWP X;  2Z6D A;  3E4P A;  4HIA A;  4M4X A;  4GS9 B;  5HD5 A;  4NXE A;  5AVE A;  3A0R A;  1DP8 A;  3VE3 A;  1TS0 A;  1TS7 A;  3IBR A;  4XT2 A;  4HHD A;  3A0S A;  4HI4 A;  4EW7 A;  2QKP A;  4I3A A;  4HP4 A;  4GHI A;  3VE4 A;  1JNU A;  3LIA A;  5G4Y A;  2QJ7 A;  4YWZ A;  2V0U A;  3UB7 A;  2EA9 A;  1S4S A;  3NJA A;  2BAS A;  3ULF A;  4EQ1 A;  4KUO A;  1F9I A;  4R70 A;  1P0Z A;  3HJK A;  4LRZ E;  4WF0 A;  2KX6 A;  4HOI A;  3UMD A;  2VLG A;  1XJ2 A;  3BY8 A;  3SW1 A;  1GSV A;  3LI9 A;  3CLO A;  1G28 A;  2VV7 A;  4HH2 A;  2Z6C A;  5F68 A;  1F98 A;  2OOL A;  4PKY G;  3PHY A;  1S67 L;  3NOU C;  3CAX A;  3H7W B;  2PR6 A;  4EER A;  1OJG A;  3K3C A;  2VV8 A;  5F69 A;  2KDK A;  1TS8 A;  4HNB A;  4BBT A;  1X0O A;  3G6O A;  4R3A A;  5HZH A;  5DKL A;  2V1A A;  3E4O A;  2L1M A;  4HP9 A;  3GEC A;  5G4Z A;  1OT9 A;  2QHK A;  4I38 A;  3UB8 A;  3MQO A;  3EEH A;  4L9G A;  3P7N A;  1OTB A;  3MQQ A;  5AVF A;  3H7W A;  4GHI B;  3FC7 A;  1S4R A;  3UME A;  5DJT A;  1N9L A;  1LT0 A;  3VOL A;  3CWF A;  4PKY A;  3MXQ A;  5DKK A;  1GSW A;  2QJ5 A;  3F1N B;  1T18 A;  1ODV A;  1LL8 A;  4KUK A;  5EFW A;  2PDR A;  5J4E A;  3MJQ A;  4GW9 A;  3PYP A;  3IS2 A;  2YKF A;  4EXO A;  1XJ3 A;  2HV1 A;  1OT6 A;  3B33 A;  1DP9 A;  1T1B A;  2PD7 A;  4I3I A;  2QWS A;  4B9O A;  4H6J B;  3F1N A;  4R6L A;  5HWV A;  3H82 B;  1LSX A;  3FG8 A;  2VEA A;  1KOU A;  3T50 A;  5DJU A;  1XJ4 A;  1NWZ A;  2A24 B;  4WLA A;  1N9O A;  4L9F A;  2V0W A;  4BBV A;  1P97 A;  4EET B;  2ZBB A;  3NHQ A;  4HJ6 A;  2W0N A;  1WA9 A;  1D7E A;  2YKH A;  3ZQ5 A;  4L9E A;  2H28 A;  4H6J A;  5TBM B;  3H82 A;  1LSV A;  1S1Y A;  4I3J A;  3C8C A;  4NXB A;  2INW A;  3UB9 A;  2OWJ A;  2B02 A;  4NXG A;  2P7J A;  2A24 A;  1T1C A;  2R78 A;  4WUJ A;  4LRY C;  2D02 A;  5IU1 A;  2I9V A;  3LIB A;  1EW0 A;  5HDD A;  4JGQ A;  2VV6 A;  2K7S A;  4JGR A;  4K08 A;  1OTA A;  3F1O B;  5TBM A;  5HDS A;  2JN7 A;  4NXF A;  3LI8 A;  3IS2 B;  3D72 A;  2D01 A;  1D06 A;  1DRM A;  4DJ3 A;  3RH8 B;  4JGP A;  3LUQ A;  3NOT C;  4MN6 A;  5A8B A;  3BY9 A;  3K3D A;  4LLO B;  1V9Z A;  1OTE A;  1OJ5 A;  4LRX C;  1GSX A;  5J3W A;  3BWL A;  3F1O A;  2OWH A;  5IS1 A;  3MFX A;  3ICY A;  1OTD A;  2ZOI A;  1XFQ A;  3F1P B;  4GCZ A;  2CMN A;  4HJ3 A;  1UGU A;  3HJI A;  4BBU A;  5HWW A;  4HH3 A;  4WL9 A;  5J7E A;  2W27 A;  3LID A;  4R38 A;  3GDI A;  3UB6 A;  5HWT A;  1XJ6 A;  3OLO A;  1XFN A;  1Y28 A;  3RTY A;  5HDC A;  1OTI A;  3KX0 X;  4LPZ A;  4DJ2 A;  2WKR A;  4E04 A;  4GS9 A;  4F3L B;  4JGO A;  5F5Y A;  3LIE A;  2L4R A;  3F1P A;  1T1A A;  3UE6 A;  3EWK A;  4MN5 A;  4EEU A;  4WN5 A;  3LYX A;  4HQA A;  4EEP A;  5KIZ A;  3NOP C;  3LIC A;  2PD8 A;  1TS6 A;  4HY8 A;  2PR5 A;  3A0V A;  2PYR A;  5HD3 A;  2M1C A;  5F6A A;  2GJ3 A;  2V1B A;  4HJ4 A;  4F3L A;  2PYP A;  1DP6 A;  4I5S A;  1MZU A;  1VB6 A;  2JHE A;  4RQ9 A;  1BYW A;  3C2W A;  2PHY A;  3H9W A;  3LIF A;  4KQD A;  2WKP A;  2J80 A;  1T19 A; 
#chains in the Genus database with same CATH topology
 1ZC2 A;  4JXW A;  3MR0 A;  2ZQ9 A;  2ZD8 A;  3V50 A;  3E4Q A;  4B4Z A;  1ERM A;  2ZOH A;  3LR5 A;  1K38 A;  1VQQ A;  4CLC E;  1XPB A;  5CGX A;  3SH8 A;  3M6B A;  2XSS A;  4ESP A;  2LB9 A;  2WKQ A;  2JKR I;  2Y55 A;  3W8K A;  1OPX A;  2JC7 A;  2Z6D A;  3E4P A;  1BTL A;  4MLL A;  3K2N A;  4QB8 A;  2PU4 A;  2XR0 A;  5FA7 A;  1K6R A;  3M2J A;  2WZX A;  1C3B A;  1CF0 A;  4NXE A;  4XUZ A;  5AVE A;  5HX9 A;  1TS7 A;  4EU0 A;  5DF7 A;  4U0X A;  4R1G A;  2P9V A;  2XLN A;  4XT2 A;  5CHM A;  4HI4 A;  2QKP A;  4I3A A;  5FQK A;  5DFX A;  1YAX A;  4JF6 A;  1VET B;  3QNC A;  2ZQ8 A;  2E8J A;  5HAI A;  1MBL A;  3UB5 P;  1S4S A;  2BAS A;  5FI7 A;  3ULF A;  5CX7 A;  4KUO A;  3QP1 A;  3HJK A;  2FFY A;  2HDU A;  5TGF A;  1G6O A;  4ETZ A;  4OPR A;  2KX6 A;  4HOI A;  5AJG A;  4YIN A;  3IT9 A;  5GHY A;  1IEM A;  4ID4 A;  3BY8 A;  3SS4 A;  3UO9 A;  1HLU P;  3ISG A;  1XA7 A;  2ZQC A;  3UN7 A;  1JTD A;  3UDF A;  4GB7 A;  4N1H A;  3LI9 A;  1WYB A;  4CLC B;  3A3F A;  3KSH A;  2Y2M A;  4WM9 A;  2QPN A;  4HBU A;  5F68 A;  2QMI A;  2OOL A;  4PKY G;  1YM1 A;  3PHY A;  4Y0O A;  3NOU C;  3LO7 A;  4RX3 A;  3H7W B;  4CPK A;  2PR6 A;  4S2M A;  1MKI A;  4PM7 A;  2VX8 A;  1OJG A;  4LEN A;  3K3C A;  5E2H A;  2J7V A;  2VV8 A;  3N8S A;  2WKI A;  3UDI A;  1DJA A;  2KDK A;  2WYX A;  3SZT A;  4R3A A;  5HZH A;  3MQ0 A;  5DKL A;  2Y2K A;  3E4O A;  2V8C A;  4HP9 A;  3IF6 C;  3T4O A;  5CXW A;  1OT9 A;  2ZQD A;  4FOF A;  2P9V B;  4KZ6 A;  4FUW A;  2FZ0 A;  3MQO A;  5DFY A;  4DDS A;  1PW1 A;  5AVF A;  2XRN A;  2XRO A;  4GN2 A;  4JF4 A;  5CTN A;  3GMW A;  3QP8 A;  4WEK A;  1J3W A;  1K4F A;  3T4K A;  1N9L A;  3V3R A;  4JXV A;  5CHJ A;  4XUX A;  1PYY A;  4Y2F A;  3EOI A;  1PZO A;  3BLS A;  1BLS A;  4FCF A;  5A90 A;  3F1N B;  1MC0 A;  1T18 A;  1PFL A;  1K56 A;  2K2N A;  4Q8I A;  4BJP A;  1H8Z A;  1K4E A;  2OLU A;  5EFW A;  2WZZ A;  4FH2 A;  4MBH A;  2PDR A;  2Y79 A;  1E4D A;  4QY5 A;  4EXO A;  1L0F A;  3B33 A;  1DP9 A;  4QWO A;  3VFF A;  5A92 A;  4WZ4 A;  1PW8 A;  4B9O A;  2O9A A;  4R6L A;  5BOH A;  2HDQ A;  5HWV A;  2K31 A;  2EXB A;  3IBJ A;  4OQH A;  1WE4 A;  1KOU A;  1VEU B;  3IXB A;  5AQ7 A;  4JLF A;  4N92 A;  1XJ4 A;  2W1T B;  4KG2 A;  3BFF A;  2ZMF A;  4WLA A;  3B3X A;  3HRE A;  3ITA A;  3MZD A;  4EET B;  4OPY A;  2ZBB A;  3ZDJ A;  3IF6 B;  3N7W A;  5FAQ A;  2XGN A;  3E2L A;  3T1R A;  2W0N A;  5EE8 A;  3LR3 A;  3BFG A;  1W8Q A;  2YKH A;  4EUV A;  4OOY A;  4G3V A;  2PRF A;  1FOF A;  2JE5 A;  1CEG A;  3MXS A;  3P09 A;  1LSV A;  2W1R A;  2P74 A;  4S2J A;  4I3J A;  3TJZ C;  2ZL1 A;  4NXB A;  2I72 A;  4QU3 A;  2OWJ A;  3SS3 A;  3UB9 A;  4DRT A;  2B02 A;  1KDS A;  3QHY A;  2A24 A;  3HVF A;  2QZ6 A;  4EUZ A;  5DF9 A;  1JTG A;  1RGZ A;  4WUJ A;  5EM1 A;  1AXB A;  4WMC A;  5IU1 A;  3OBF A;  1CQA A;  4BMW A;  4JGQ A;  3T4Q A;  3BM6 A;  5EVL A;  4S2N C;  4JGR A;  2ZC4 B;  4LV3 A;  1S0W A;  4DDY A;  3DTK A;  2J3T D;  3D72 A;  4HBT A;  2D01 A;  1L3L A;  1CI8 A;  4IHQ A;  3RH8 B;  4KQR A;  4JGP A;  4E3K A;  4N9L A;  2PBY A;  3G35 A;  5A8B A;  1IYP A;  1FCN A;  3G30 A;  1V9Z A;  3TG9 A;  1NXY A;  2EX6 A;  3FV7 A;  2VGL S;  5EV0 A;  1KDW A;  4DE3 A;  3FWL A;  3PBN A;  5A91 A;  2OWH A;  3G31 A;  3SH9 A;  4P6B A;  4BBU A;  5HWW A;  1L2S A;  1YSQ A;  4GZB A;  3G2Y A;  1ZKJ A;  3GDI A;  4EV4 A;  5FSR A;  3QP4 A;  4II7 A;  3KSI A;  1Y28 A;  3IXG A;  3IXH A;  3NBL A;  1VHM A;  5CTM A;  1TF1 A;  3FZC A;  2EWW A;  3SOI A;  1MY8 A;  3QP6 A;  3MBZ A;  4F3L B;  3V5M A;  4OKP A;  1KVM A;  1FSW A;  1NJ4 A;  1T1A A;  3UPN A;  5A93 A;  3IHA A;  1TDL A;  5EM0 A;  4HQA A;  4EEP A;  3NOP C;  3LIC A;  4PHT A;  1XXM A;  4QJG A;  1E3U A;  4R23 A;  2OAQ 1;  3FKV A;  2PYR A;  1Y4O A;  5IHV A;  3NDE A;  2JKT M;  3G32 A;  2GJ3 A;  1YPR A;  2Y2I A;  2VGJ A;  2C6W B;  1MZU A;  4EBP A;  2JHE A;  4OPZ A;  4X1M A;  3VP0 A;  2NUP C;  4JBF A;  3C2W A;  5FQ9 A;  5FDS A;  3ZNT A;  4R0Q A;  4JXG A;  1O07 A;  5L10 A;  1ERQ A;  5FQQ A;  2Y2O A;  1GA0 A;  2L0W A;  4B93 A;  1UWN X;  1K54 A;  2O9C A;  5I5L A;  3R7W B;  2ZC7 A;  4I39 A;  5TFQ A;  3C7U A;  3D3O A;  5FI6 A;  3TRC A;  1YSP A;  3WS0 A;  1S66 L;  4Y5F A;  1VM1 A;  5L2F A;  5K5B A;  1SCW A;  3T1S A;  5TR7 A;  5GHX A;  1MWT A;  3VE3 A;  3GQZ A;  3NCK A;  5EVI A;  3HUN A;  4IVK A;  1LI0 A;  2Y59 A;  4KZ8 A;  1KE0 A;  4GKU A;  2HJ9 C;  1QMF A;  1S6R A;  3BEB A;  1JNU A;  5CHU A;  3LIA A;  5IT5 A;  3NDG A;  2QJ7 A;  3WRZ A;  4FSF A;  3FYZ A;  2EA9 A;  1NLZ A;  2DRW A;  3ZNY A;  1Y54 A;  1P0Z A;  3LY4 A;  4EBN A;  4LRZ E;  1FR6 A;  2Q9N A;  1H3Q A;  1YKD A;  2EX9 A;  2Y2J A;  1PWD A;  3SW1 A;  1DY6 A;  5F82 A;  1GSV A;  3W2Z A;  1VET A;  1IFQ A;  1PIO A;  3ZG9 B;  4IUK A;  2R9W A;  3HLD A;  2XFS A;  3HUO A;  2VV7 A;  1H8M A;  4YNR A;  4EWF A;  5FL3 A;  2ZM2 A;  3N6I A;  4IVI A;  1STZ A;  2WGW B;  3LEZ A;  3SH7 A;  4DE0 A;  2GX5 A;  1YLZ A;  2XA7 S;  3WS2 A;  3R4K A;  5DTS A;  4IUH A;  2Y91 A;  3B47 A;  4BL3 A;  4HNB A;  1EI5 A;  1X0O A;  4CLC A;  1KGE A;  5G4Z A;  4LV0 A;  1MKM A;  4K91 A;  3IWI A;  5EVI B;  3DWK A;  1K56 D;  1MWU A;  3GV9 A;  5FAO A;  2W3F A;  2XQZ A;  1OTB A;  4ZBE A;  3Q7Z A;  5M1A A;  4QD4 A;  1E25 A;  3H7W A;  3IH9 A;  3CIT A;  3HCY A;  5DJT A;  4B4X A;  3P01 A;  2EX2 A;  3WS5 A;  3NUL A;  2OSU A;  2B95 A;  5KSC A;  4JF5 A;  1LT0 A;  1FIL A;  4UA6 A;  3KYZ A;  2EFU A;  5FAT A;  1IKG A;  5E2E A;  1HZO A;  3FPV A;  1GSW A;  1G5U A;  1ODV A;  3HBR A;  1LL8 A;  4KUK A;  4X68 A;  1XKZ A;  3HLE A;  3RXX A;  2QYB A;  1K55 C;  2VJW A;  2G2U A;  2V8F A;  5J4E A;  4OQG A;  4UQI S;  2O0Y A;  3EGX C;  3HLC A;  4C6Y A;  2HV1 A;  1KGF A;  2B18 A;  5CED A;  1MPL A;  2HGV A;  2QWS A;  4H6J B;  1Q2Q A;  2P04 A;  2XF3 A;  3F1N A;  3DTE A;  3HUM A;  4LCL A;  4LV1 A;  4X56 A;  3H82 B;  1SKO B;  3V3S A;  2IA2 A;  4Q0I A;  3GRJ A;  1DJC A;  4S2K A;  4L9F A;  1BUE A;  4HJ6 A;  2H5S A;  1FSY A;  4OOL A;  3DTI A;  3CPT B;  3HLF A;  1IYO A;  1PRQ A;  5TBM B;  3IX3 A;  5JYP A;  1ONH A;  4ZJ3 A;  5AQ9 A;  1BT5 A;  1S1Y A;  1VEU A;  1FCO A;  4Y0U A;  2W1T A;  4YOF A;  2P7J A;  1ESI A;  1KGG A;  3IWO A;  2R78 A;  2Y2G A;  3IF6 A;  4PM9 A;  3BFD A;  3T12 B;  5M18 A;  2LB5 A;  3O88 A;  2VV6 A;  4C75 A;  2K7S A;  2HP6 A;  4K08 A;  4ARZ A;  3T4J A;  1K0K A;  1SHV A;  1YLJ A;  3NC8 A;  1ACF A;  4OP8 A;  2GDN A;  3PBR A;  5CEC A;  5HPI A;  3VV4 A;  4DJ3 A;  2X01 A;  4OVD A;  3A3J A;  3NOT C;  4MN6 A;  3IH8 A;  4X69 A;  3VSL A;  1ES2 A;  3QP2 A;  3JVU A;  4R3J A;  4P85 A;  1JVJ A;  3LR4 A;  4O7D A;  1L0D A;  4DE1 A;  1NRJ A;  4LRX C;  1OME A;  3C7V A;  5IS1 A;  3MKE A;  1OTD A;  2ZOI A;  4HES A;  3OZH A;  4KG5 A;  4HJ3 A;  3FKW A;  3HJI A;  1TD5 A;  4DMZ A;  1H5X A;  4HH3 A;  5J7E A;  2BLS A;  3FPW A;  1HVB A;  3BRM A;  4KZ3 A;  5FAS A;  1XJ6 A;  2XFT A;  2A49 A;  2ZC6 B;  1RGY A;  1E3U D;  4Y17 A;  3VOZ A;  1ES3 A;  2ZQ7 A;  1OTI A;  3KYE A;  4LPZ A;  2PU2 A;  3W4O A;  1W7F A;  5MC7 A;  5F5Y A;  1I2W A;  3LIE A;  3S4X A;  3ZG7 B;  4F94 A;  4N1X A;  3UNW A;  3PBT A;  3ZVT A;  4RA7 A;  3V39 A;  2XH9 A;  4GNU A;  2Z2L B;  3UE3 A;  4WN5 A;  5KIZ A;  4ARZ B;  4HY8 A;  2PR5 A;  2OLV A;  2M7U A;  3A0V A;  5M19 A;  5AQB A;  3RFB A;  2X02 A;  1IYS A;  4YFM A;  2M1C A;  5L8M A;  3BFE A;  4N9K A;  2V1B A;  4F3L A;  3GR2 A;  1DP6 A;  1SDN A;  3CI6 A;  4QPR A;  4ZDX A;  4P87 A;  4LGW A;  4S2N A;  4ZAM A;  1I2S A;  4X6T A;  5EVE A;  3NEC A;  2WKP A;  1T19 A;  3ITB A;  1NLY A;  4E3N A;  4E3M A;  3N8L A;  5E43 A;  2VGL M;  3UPO A;  1LSW A;  1EWZ A;  4P6Z M;  3C38 A;  5HSQ A;  3MZF A;  2Z2M B;  3L9K A;  3IX8 A;  5HFO A;  2GZA A;  3UE1 A;  3I7J A;  3PR6 A;  5FAP A;  3Q1F A;  2PBD P;  1K6S A;  3VFH A;  4EES A;  3G4P A;  3PAG A;  3QP5 A;  2ACG A;  4IBR A;  4Z1W A;  3TE8 A;  3V67 A;  1W8Y A;  2JCH A;  1UWP X;  4ZRR A;  4K0X A;  4OH0 A;  5HD5 A;  5D3O A;  3S22 A;  3PAE A;  1PWG A;  1J9M A;  3A0R A;  1TS0 A;  1M6K A;  1CJF A;  3DW0 A;  3A0S A;  2HPB A;  1QME A;  4PPR A;  4EW7 A;  3R7W A;  2A3U A;  3S1Y A;  4GHI A;  3DTM A;  3VE4 A;  3SS5 A;  4NET A;  2EFX A;  3P98 A;  5CGW A;  3DWZ A;  5G4Y A;  4R3B A;  2FFF B;  3WS1 A;  2V0U A;  2B5R A;  1MXO A;  4WZ5 C;  3O5Y A;  1ONG A;  5HAR A;  2PAV P;  3KO6 A;  2JKR M;  4KQO A;  1F9I A;  3WWX A;  1GHI A;  2M7V A;  3OPR A;  3UPP A;  3UMD A;  1IOU A;  2VLG A;  3T4S A;  1DJB A;  4U0T A;  4X25 A;  4FH4 A;  3M2K A;  2HZ5 A;  4GDN A;  1LI9 A;  4GLQ A;  4CLC D;  4LV2 A;  1Q2P A;  3OC2 A;  2DCF A;  3BJN A;  3VP1 A;  1GCE A;  2Z6C A;  3GSG A;  4NKP A;  3NY4 A;  1S67 L;  3T1Q B;  5CER A;  3OPL A;  4M3K A;  2Q9M A;  3MMH A;  3OPP A;  2JBF A;  3LFV A;  5HAQ A;  2E8I A;  5CGS A;  5EOE A;  1SDE A;  1PNE A;  5F69 A;  1ES5 A;  5GLA A;  1WYC A;  2WUQ A;  1NZU A;  3WRT A;  3G6O A;  1FQG A;  1W63 Q;  2L1M A;  3GEC A;  2QHK A;  1FCM A;  3UB8 A;  3OCL A;  4FTX A;  5I94 A;  4MCW A;  4DE2 A;  1YLP A;  2WGW A;  2HDS A;  3IWQ A;  3MQQ A;  4GHI B;  3FC7 A;  4X55 A;  1S4R A;  3UME A;  4KQQ A;  3T4T A;  5L07 A;  4BEN A;  2H0T A;  3TW8 A;  2WGV A;  1KE4 A;  4C3Q A;  2OV5 A;  1CK3 A;  3CWF A;  3WS4 A;  4Y15 A;  3O87 A;  2MJ6 A;  3Q7V B;  4MBF A;  2QJ5 A;  3CUE A;  4PM5 A;  5JYO A;  3ZG8 B;  4S2O A;  3OCN A;  1GHM A;  4ZJ2 A;  5KZH A;  1YMS A;  3A3E A;  3S7N A;  2HP9 A;  3JPU A;  4GW9 A;  4ZJ1 A;  2J3T C;  4E6W A;  4MMN A;  1K57 A;  1PI5 A;  2YKF A;  3IQA A;  4WEJ A;  2IWD A;  1ESU A;  1XJ3 A;  3T1X A;  1PI4 A;  1F5M A;  3VP3 A;  4MN7 A;  3LEQ A;  3CJM A;  2UWX A;  2X71 A;  3OPH A;  2HDR A;  4PAU A;  1BUL A;  1CI9 A;  1LSX A;  3FG8 A;  1CEF A;  2VEA A;  4MNR A;  3T50 A;  2OAP 1;  4BD1 A;  4DXC A;  2XK1 A;  4MBK A;  3IF5 A;  3A3D A;  3MXR A;  3BQ8 A;  2V0W A;  3C4O A;  3BW6 A;  1AWI A;  5KMW A;  5DTK A;  1G6A A;  1WA9 A;  4ME4 A;  3VSK A;  2XEP A;  4DN0 A;  3RJU A;  4H6J A;  4O8G A;  4BLM A;  2WK0 A;  3H82 A;  1SKO A;  2INW A;  1ZHH B;  5EPH A;  2WKH A;  5KSH A;  1G68 A;  3LCE A;  4KZ9 A;  5G18 A;  4LCM A;  3PXP A;  4B88 A;  4LRY C;  5HDD A;  1YQS A;  1IKI A;  3KYQ A;  3CPT A;  3GVB A;  4LFU A;  5CEB A;  5TBM A;  3F1O B;  5HDS A;  2JN7 A;  3JVV A;  4NXF A;  2UV0 E;  3LI8 A;  4RYE A;  3HLB A;  2VA0 A;  4UA9 A;  4H8R A;  5E2G A;  3PBQ A;  2WAD A;  2Y2Q A;  3ZCZ A;  2BTF P;  4KZ5 A;  4UQI M;  2Y2H A;  1NYY A;  4GJ4 A;  3BY9 A;  1XX2 A;  4LLO B;  2G7U A;  4UEY A;  3ZHH A;  3DAV A;  4HEF A;  2Q0O A;  1ES4 A;  5EUA A;  1ZG6 A;  1GSX A;  1K55 A;  2O99 A;  5J3W A;  3AGE A;  3BWL A;  3ICY A;  2V20 A;  3F1P B;  3HLW A;  4GOG A;  2CMN A;  3E98 A;  4O0P A;  2WGI A;  4E3O A;  4WL9 A;  4GDB A;  3S7O A;  3O86 A;  2W27 A;  1I5Q A;  5FQM A;  5GLB A;  4D2O A;  3UB6 A;  1M40 A;  3OLO A;  2VGK A;  4ETX A;  2JKT I;  2R9X A;  3E2K A;  2WKE A;  1A0K A;  3RTY A;  5HDC A;  4DKI A;  2H10 A;  3KX0 X;  4JPM A;  3EQU A;  4DJ2 A;  3MS6 A;  2H0Y A;  4GS9 A;  2XDM A;  4JGO A;  3MZE A;  2W3H A;  2W3G A;  1BLC A;  3B42 A;  3EWK A;  4WMC D;  4MN5 A;  1PWC A;  2W3E A;  4EEU A;  1JWP A;  4NG2 A;  3LYX A;  3PBS A;  1W5D A;  5AQA A;  1Z09 A;  5FEG A;  2PD8 A;  4PMA A;  5TJJ A;  3MF0 A;  5GHZ A;  4A5R A;  3AGF A;  5F6A A;  3BYD A;  4JKT A;  2KOI A;  4RQ9 A;  2J9O A;  4RX2 A;  1YLT A;  1XGJ A;  2Y2N A;  4KQD A;  4S2I A;  1ALQ A;  4Y7P A;  1BSG A;  2JKG A;  1GA9 A;  4E3J A;  2J80 A;  3BLM A;  2J9P A;  1HTZ A;  2EXA A;  1N4O A;  1BLH A;  1MWR A;  2NUT C;  1S1Z A;  3DBA A;  1N9N A;  4XT2 B;  3G2Z A;  4OON A;  4BQM A;  2RL3 A;  1L0G A;  2VKS A;  3E0Y A;  2V9A A;  4S2L A;  3IHB A;  3ZG0 A;  1SZV A;  1L0E A;  2Y2P A;  5HL6 A;  4EBL A;  1V9Y A;  2IWC A;  4HIA A;  4M4X A;  4GS9 B;  4IED A;  3U2A A;  5J8X A;  4CQH A;  1O7E A;  1DP8 A;  2W3D A;  3IBR A;  4HHD A;  4O01 A;  5HAP A;  1LLB A;  2XD1 A;  3ZVW A;  1W63 M;  4KZ4 A;  4HP4 A;  5FQI A;  1ERO A;  1U60 A;  5CRF A;  2HF6 A;  4YWZ A;  3UB7 A;  2ZMV A;  3NJA A;  4IJG A;  4PM6 A;  4EQ1 A;  4R70 A;  3LR0 A;  3EEA A;  2CC1 A;  4DXB A;  1KVL A;  4WF0 A;  1XJ2 A;  1XGI A;  4R4S A;  1PZP A;  3EGD C;  1F2K A;  3CZD A;  2IWB A;  3CLO A;  1G28 A;  2V1Z A;  3IXD A;  3Q07 A;  4HH2 A;  1SKF A;  1F98 A;  3MSH A;  2O9B A;  3CAX A;  4EER A;  2P08 A;  1ZG4 A;  1TS8 A;  5FEF A;  1H8Y A;  3JYI A;  2KLI A;  4BBT A;  4L0L A;  4NEE D;  2V1A A;  3BQA A;  3ZGA B;  4I38 A;  4OQI A;  4Y0T A;  4BL2 A;  3ZG5 A;  5EVI D;  3EEH A;  3C5A A;  3P7N A;  4L9G A;  1BLP A;  4NK3 A;  5GLD A;  3VOY A;  4OPQ A;  3QNB A;  5GLC A;  1KE3 A;  1Z6F A;  3C30 A;  1NZO A;  2PT7 A;  4GD8 A;  1ZTU A;  2A2L A;  1D1J A;  1LL9 A;  5EEC A;  3VOL A;  4CJN A;  4PKY A;  2ZM8 A;  4QHC A;  1IEL A;  5HL1 A;  3CHW P;  3MXQ A;  4KZ7 A;  4UAA A;  5DKK A;  2ZM0 A;  1XP4 A;  3KSF A;  4WBG A;  4OQ0 A;  3W4Q A;  4ZTK A;  4G3K A;  4P6Z S;  4OP5 A;  3ZYT A;  3VP2 A;  1P9W A;  3MJQ A;  4X53 A;  3CMZ A;  3BFC A;  3PYP A;  3IS2 A;  5HPF A;  2HJE A;  4WZ5 A;  4MEZ A;  1NYM A;  1RCJ A;  1OT6 A;  1T1B A;  3HL9 A;  3L7H A;  3C4P A;  3LGO A;  2PD7 A;  4I3I A;  3Q7V A;  5F1F A;  5U47 A;  1N9B A;  2ZJ9 A;  5DVA A;  4Y3I A;  2ZL1 B;  5DJU A;  4E3I A;  1XA1 A;  4U3T A;  3LY3 A;  4S2P A;  1NWZ A;  2A24 B;  2DNS A;  4RVA A;  1N9O A;  4MDZ A;  3N4I A;  4BBV A;  1P97 A;  3NHQ A;  3T4L A;  1D7E A;  3ZQ5 A;  4AFI A;  4EQI A;  1HD8 A;  4L9E A;  2H28 A;  4UA7 A;  5C5K A;  3A3I A;  1W79 A;  4OLD A;  2ZC3 B;  2EWV A;  5LBR A;  3C8C A;  2GNX A;  3Q81 A;  3AGD A;  4Q0H A;  3IX4 A;  3MKF A;  4KZA A;  1H0M A;  4NXG A;  4IBX A;  3EQV A;  4KZB A;  2Y8H A;  3S7P A;  1T1C A;  3S7Q A;  2XD5 A;  3CG5 A;  4PM8 A;  2D02 A;  2I9V A;  3LIB A;  1EW0 A;  1JWZ A;  1TEM A;  3RXW A;  4X1L A;  3D9Y A;  1OTA A;  1TDG A;  2BG1 A;  4KG6 A;  1IYQ A;  4OOM A;  4FD8 A;  4DF6 A;  3IS2 B;  2RCX A;  3VMA A;  1K54 C;  4XXR A;  3U4L P;  2ZMA A;  1D06 A;  3O3V A;  1DRM A;  2HP5 A;  1LL5 A;  3UDX A;  3OOV A;  2JKF A;  3LUQ A;  4JXS A;  4WYY A;  1NRF A;  3K3D A;  1FR1 A;  1GHP A;  5FDH A;  1TVF A;  4WEL A;  4BD0 A;  4GD6 A;  5HW3 A;  3GTC A;  5DTT A;  1OTE A;  1OJ5 A;  3PTE A;  2ZC5 B;  5FI2 A;  2C5W B;  3F1O A;  2WAF A;  3MFX A;  1RP5 A;  4D60 A;  1XFQ A;  4GCZ A;  2ZQA A;  1UGU A;  3CUE C;  1YLY A;  4UHU A;  5F83 A;  4G3W A;  2G2W A;  5EVI C;  4P0M A;  3LID A;  4R4R A;  4R38 A;  5F1G A;  1YT4 A;  3D4F A;  3NIA A;  4K0W A;  5HWT A;  4KEN B;  5EOO A;  2VK3 A;  1XFN A;  5GL9 A;  3TSG A;  3MFD A;  4Q0J A;  3Q82 A;  2EX8 A;  4BWI A;  3ZFZ A;  1K57 C;  1LHY A;  2WKR A;  3TOI A;  4E04 A;  4Y13 A;  3UE0 A;  2L4R A;  3F1P A;  2Y4A A;  5DF8 A;  1YMX A;  2XA7 M;  1NY0 A;  1P9R A;  2J3W A;  3UE6 A;  3NI9 A;  2VZW A;  3PBO A;  1JWV A;  2Y2L A;  1TS6 A;  1FIK A;  2FH5 A;  5HD3 A;  5E2F A;  2ZLY A;  5FQJ A;  4OLG A;  4E3L A;  2V2F F;  4HJ4 A;  4Z9Q A;  3W4P A;  2PYP A;  4I5S A;  2AVX A;  2J8Y A;  3VP4 A;  3KSG A;  1VB6 A;  3UY6 A;  3HLG A;  1BYW A;  2DMW A;  3BEC A;  5L09 A;  1BZA A;  4E6X A;  2PHY A;  3H9W A;  3N8R A;  3LIF A;  3G34 A;  4QY6 A;  2WAE A;  1MWS A;  1K25 A;  3M6H A;  1YLW A;  4CLC C; 
#chains in the Genus database with same CATH homology
 1NLY A;  3MR0 A;  2L0W A;  4B93 A;  1UWN X;  2VGL M;  2NUT C;  2O9C A;  1S1Z A;  1LSW A;  1N9N A;  3DBA A;  4P6Z M;  3C38 A;  4XT2 B;  5I5L A;  5HSQ A;  3E4Q A;  2ZOH A;  3LR5 A;  2GZA A;  3R7W B;  4CLC E;  3PR6 A;  4I39 A;  2VKS A;  3E0Y A;  2V9A A;  3D3O A;  4EES A;  2XSS A;  3TRC A;  1YSP A;  1S66 L;  2LB9 A;  4Y5F A;  2WKQ A;  4Z1W A;  2JKR I;  5HL6 A;  3TE8 A;  5K5B A;  1OPX A;  3V67 A;  1V9Y A;  1UWP X;  2Z6D A;  3E4P A;  4HIA A;  4ZRR A;  4M4X A;  3K2N A;  4GS9 B;  3U2A A;  5HD5 A;  4NXE A;  4CQH A;  5AVE A;  3A0R A;  1DP8 A;  3VE3 A;  1TS0 A;  1TS7 A;  2W3D A;  4EU0 A;  3IBR A;  4XT2 A;  4HHD A;  4O01 A;  3A0S A;  4HI4 A;  4EW7 A;  1W63 M;  2QKP A;  4I3A A;  3R7W A;  4HP4 A;  2HJ9 C;  5DFX A;  4GHI A;  1YAX A;  3VE4 A;  1JNU A;  3LIA A;  2HF6 A;  5IT5 A;  5G4Y A;  2QJ7 A;  4YWZ A;  2V0U A;  4FSF A;  3UB7 A;  2EA9 A;  2ZMV A;  1S4S A;  3NJA A;  3O5Y A;  2BAS A;  4IJG A;  1NLZ A;  3KO6 A;  3ULF A;  5CX7 A;  2JKR M;  4EQ1 A;  4KUO A;  4KQO A;  1F9I A;  4R70 A;  1P0Z A;  3HJK A;  2M7V A;  3LR0 A;  3EEA A;  1G6O A;  4LRZ E;  4ETZ A;  4WF0 A;  2KX6 A;  4HOI A;  3UMD A;  1IOU A;  1H3Q A;  5AJG A;  1YKD A;  2VLG A;  1XJ2 A;  3T4S A;  3BY8 A;  3SW1 A;  1GSV A;  3W2Z A;  3EGD C;  1IFQ A;  3LI9 A;  4CLC B;  3KSH A;  4IUK A;  3CLO A;  4GLQ A;  1G28 A;  4CLC D;  4CLC C;  2VV7 A;  3OC2 A;  3BJN A;  1H8M A;  4YNR A;  4HH2 A;  5FL3 A;  2Z6C A;  5F68 A;  1F98 A;  2OOL A;  4NKP A;  4PKY G;  3PHY A;  1S67 L;  1STZ A;  3NOU C;  2O9B A;  3CAX A;  3MMH A;  3H7W B;  2PR6 A;  3LFV A;  4EER A;  2VX8 A;  2GX5 A;  1OJG A;  2XA7 S;  2P08 A;  3K3C A;  2VV8 A;  5F69 A;  2KDK A;  3R4K A;  4IUH A;  3B47 A;  1TS8 A;  4HNB A;  2KLI A;  4BBT A;  4L0L A;  1X0O A;  4NEE D;  4CLC A;  3G6O A;  4R3A A;  5HZH A;  3MQ0 A;  5DKL A;  1W63 Q;  2V1A A;  3BQA A;  3E4O A;  2L1M A;  4HP9 A;  3GEC A;  5G4Z A;  3T4O A;  1MKM A;  1OT9 A;  2QHK A;  4I38 A;  4FOF A;  3UB8 A;  3OCL A;  4MCW A;  2FZ0 A;  3MQO A;  5DFY A;  3EEH A;  4L9G A;  3P7N A;  2W3F A;  1OTB A;  3MQQ A;  5AVF A;  3H7W A;  4GHI B;  3FC7 A;  2XRN A;  1S4R A;  3CIT A;  3UME A;  2XRO A;  3HCY A;  3T4T A;  5DJT A;  3C30 A;  3P01 A;  2PT7 A;  1ZTU A;  4WEK A;  3TW8 A;  2A2L A;  3T4K A;  1N9L A;  1LT0 A;  3VOL A;  3CWF A;  4PKY A;  3KYZ A;  3EOI A;  4Y2F A;  3MXQ A;  2MJ6 A;  3FPV A;  5DKK A;  1GSW A;  2QJ5 A;  3F1N B;  3CUE A;  1MC0 A;  1T18 A;  1ODV A;  1LL8 A;  4KUK A;  3KSF A;  2K2N A;  3OCN A;  4BJP A;  5EFW A;  3S7N A;  2QYB A;  4G3K A;  4P6Z S;  3ZYT A;  2VJW A;  2PDR A;  2Y79 A;  5J4E A;  1P9W A;  3MJQ A;  4GW9 A;  3PYP A;  3IS2 A;  4UQI S;  2J3T C;  5HPF A;  4MMN A;  2HJE A;  2O0Y A;  2YKF A;  4EXO A;  3EGX C;  4WEJ A;  1XJ3 A;  2HV1 A;  1OT6 A;  3B33 A;  1DP9 A;  1T1B A;  2B18 A;  1F5M A;  2PD7 A;  2HGV A;  4I3I A;  4MN7 A;  2QWS A;  4B9O A;  4H6J B;  3F1N A;  2P04 A;  2O9A A;  4R6L A;  5HWV A;  4PAU A;  2K31 A;  3IBJ A;  3H82 B;  1LSX A;  3FG8 A;  2VEA A;  4Y3I A;  1KOU A;  3T50 A;  2IA2 A;  2OAP 1;  5DJU A;  4Q0I A;  1XJ4 A;  2W1T B;  2ZMF A;  1NWZ A;  2A24 B;  3BQ8 A;  4WLA A;  1N9O A;  4L9F A;  2V0W A;  4MDZ A;  4BBV A;  3BW6 A;  1P97 A;  4EET B;  2ZBB A;  3NHQ A;  3T4L A;  4HJ6 A;  2W0N A;  3LR3 A;  1WA9 A;  4ME4 A;  4OOL A;  4DN0 A;  1D7E A;  2YKH A;  3ZQ5 A;  4AFI A;  4EUV A;  4L9E A;  4G3V A;  2H28 A;  4H6J A;  5TBM B;  4O8G A;  5C5K A;  2EWV A;  3H82 A;  1LSV A;  2W1R A;  5LBR A;  1S1Y A;  4I3J A;  3TJZ C;  3C8C A;  2GNX A;  4NXB A;  2INW A;  4Q0H A;  3UB9 A;  2OWJ A;  1ZHH B;  2W1T A;  4YOF A;  2B02 A;  4NXG A;  2P7J A;  5KSH A;  2A24 A;  3EQV A;  2Y8H A;  3S7P A;  1T1C A;  2R78 A;  5DF9 A;  3PXP A;  3S7Q A;  4WUJ A;  4LRY C;  2D02 A;  5IU1 A;  3OBF A;  2I9V A;  3LIB A;  1EW0 A;  4BMW A;  5HDD A;  4JGQ A;  2LB5 A;  3T4Q A;  2VV6 A;  3KYQ A;  2K7S A;  4JGR A;  4K08 A;  4ARZ A;  1OTA A;  3F1O B;  5TBM A;  3T4J A;  5HDS A;  2JN7 A;  3JVV A;  4NXF A;  4OOM A;  3LI8 A;  3IS2 B;  2VA0 A;  2J3T D;  3D72 A;  2D01 A;  1D06 A;  1DRM A;  3PBR A;  3PBQ A;  5HPI A;  4IHQ A;  3VV4 A;  3RH8 B;  4DJ3 A;  3OOV A;  4JGP A;  3LUQ A;  4UQI M;  3NOT C;  4MN6 A;  4GJ4 A;  5A8B A;  3BY9 A;  3K3D A;  3JVU A;  4LLO B;  1V9Z A;  2G7U A;  4UEY A;  3LR4 A;  4WEL A;  2VGL S;  1OTE A;  1NRJ A;  1OJ5 A;  1GSX A;  3PBN A;  2O99 A;  4LRX C;  5J3W A;  3BWL A;  3F1O A;  2OWH A;  5IS1 A;  3MFX A;  3ICY A;  1OTD A;  2ZOI A;  1XFQ A;  3F1P B;  4GCZ A;  2CMN A;  4HJ3 A;  1UGU A;  3HJI A;  3E98 A;  1TD5 A;  3CUE C;  4O0P A;  4BBU A;  4DMZ A;  5HWW A;  4HH3 A;  4WL9 A;  5J7E A;  3S7O A;  4G3W A;  2W27 A;  1YSQ A;  3FPW A;  3LID A;  4R38 A;  3GDI A;  3UB6 A;  5HWT A;  1XJ6 A;  3OLO A;  4ETX A;  1XFN A;  2JKT I;  4II7 A;  3KSI A;  1Y28 A;  3RTY A;  5HDC A;  4Q0J A;  1VHM A;  4BWI A;  1TF1 A;  1OTI A;  3KX0 X;  2EWW A;  4LPZ A;  3EQU A;  4DJ2 A;  2WKR A;  4E04 A;  5MC7 A;  4GS9 A;  4F3L B;  4JGO A;  5F5Y A;  3LIE A;  2L4R A;  3F1P A;  2W3H A;  2W3G A;  2XA7 M;  1P9R A;  1T1A A;  3PBT A;  2J3W A;  3UE6 A;  3B42 A;  3EWK A;  2VZW A;  3PBO A;  4MN5 A;  2W3E A;  4EEU A;  3UE3 A;  4WN5 A;  3LYX A;  4HQA A;  3PBS A;  4EEP A;  5KIZ A;  3NOP C;  3LIC A;  4ARZ B;  2PD8 A;  4PHT A;  5TJJ A;  1TS6 A;  4HY8 A;  2OAQ 1;  2PR5 A;  2M7U A;  3A0V A;  3MF0 A;  2FH5 A;  2PYR A;  5HD3 A;  3RFB A;  2M1C A;  2JKT M;  5L8M A;  5F6A A;  2GJ3 A;  2V1B A;  2KOI A;  4HJ4 A;  4F3L A;  2PYP A;  1DP6 A;  4I5S A;  1MZU A;  3KSG A;  1VB6 A;  2JHE A;  4RQ9 A;  3CI6 A;  4QPR A;  1BYW A;  2DMW A;  2NUP C;  3C2W A;  2PHY A;  3H9W A;  3LIF A;  4KQD A;  2WKP A;  2J80 A;  1T19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...