3E2LA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
b'AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 260
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2lA00
3WS4A 2WADA 3EQVA 5A93A 2UWXA 5DF9A 3DTMA 2DRWA 4EWFA 3ITBA 4GZBA 2WZXA 3IH8A 5D3OA 4KZAA 4JXVA 2WGWA 1CK3A 2ZC7A 3HUNA 1K4EA 3WWXA 3VSKA 2IWCA 4Y0UA 5FAQA 4N92A 1IELA 1PZOA 5DTSA 5F82A 1MWTA 4OLGA 4Y7PA 2V2FF 2E8IA 4B4XA 3N8SA 4OOMA 2XFTA 1KDSA 3PBSA 4Y0OA 5EECA 2IWBA 1K55C 1XGJA 5CTMA 4BJPA 3IT9A 1XP4A 5FQIA 2Y59A 2QMIA 3TG9A 5U47A 3RXXA 5A92A 1KGEA 1FSWA 4GD8A 1EWZA 4U0TA 1CEGA 2WKHA 1YMSA 2P9VA 1BT5A 4JXGA 4KZ4A 4YFMA 5IHVA 2HP6A 1MPLA 3Q82A 5CGWA 1IKIA 2Y2PA 5JYPA 1CEFA 1K55A 1K4FA 2ZQAA 4KZ3A 4O7DA 5KSCA 2Y55A 1PWGA 1E3UA 1MWRA 4OQIA 4WBGA 4BL2A 1MKIA 4KQQA 1N9BA 1YLJA 1FQGA 2XQZA 3WRTA 4DE0A 4MBHA 4R3BA 2J7VA 3Q7VA 1YLZA 1ZG4A 1YM1A 4BQMA 2B5RA 4K0WA 3ZVWA 1XKZA 5F83A 4EQIA 4JXWA 2Z2LB 1O07A 2OSUA 3GMWA 5AQ7A 4E3OA 3FZCA 1GHIA 1ALQA 2WGWB 3OCLA 5EE8A 1Q2QA 4S2PA 5CEDA 1K57C 1N4OA 2EXAA 4C6YA 4EV4A 1LI0A 1FCOA 1RP5A 4BLMA 4GKUA 2V20A 1H8YA 2Y2QA 1RGYA 3GTCA 5FATA 2ZM0A 2ZJ9A 2XLNA 2GDNA 1ZG6A 1K56D 1K57A 5GLBA 3UO9A 5TFQA 4CPKA 3A3JA 3GVBA 3N8LA 2ZLYA 3A3IA 5DTKA 3VP0A 4E6WA 4DKIA 1HVBA 1W8YA 2XEPA 1TDGA 2QPNA 1IYOA 4GB7A 1MWUA 2P9VB 4KZ7A 3V3SA 4BENA 3ZGAB 3UDFA 5AQBA 1SCWA 5HARA 1E25A 4S2JA 4X68A 4ZJ2A 4WEKA 1BULA 4NETA 1K25A 3UDIA 1PYYA 3OPRA 3GQZA 3IXDA 3ZG5A 3UPOA 3G4PA 5EOEA 1KGGA 1RGZA 2FFFB 3Q7VB 2I72A 4U0XA 4WZ5C 3SS5A 3ZVTA 4GDBA 5HAIA 3N6IA 3LCEA 3GRJA 4KQRA 5HX9A 3A3EA 3MBZA 4DE1A 1RCJA 2XF3A 4PM5A 2ZQ8A 4KG6A 3IXHA 3C4PA 3UNWA 1HTZA 3CJMA 4FSFA 5CXWA 4B4ZA 3IHBA 4E3IA 1PI4A 4DDYA 2JE5A 3DWZA 4ZJ1A 4WZ5A 3O88A 3HLEA 3Q1FA 4PM6A 2V1ZA 4R23A 4XUZA 5FA7A 4X55A 2HDQA 1IEMA 4BD1A 4DF6A 4BD0A 3V50A 2R9WA 3RJUA 1TEMA 1EROA 4JF4A 2A49A 5GLCA 3N4IA 4ID4A 3WS2A 2Y2JA 1SDEA 5FQJA 1ONHA 4JF6A 3HLGA 5FI6A 3HUMA 5CHUA 5JYOA 5EVLA 3WRZA 1DY6A 1FR6A 1XA1A 2XGNA 1XPBA 4WEJA 5E2HA 1BZAA 2OV5A 4CJNA 4JPMA 1L0FA 2Y2GA 1K56A 3HLDA 4QU3A 3Q07A 4WELA 5BOHA 3BLMA 5KMWA 3ZCZA 1MY8A 5FQ9A 3HLCA 4S2NC 4WMCD 3ZDJA 5FASA 5GHYA 1BUEA 1I2WA 1K6SA 1FCNA 1PZPA 1ES5A 1IYPA 1SDNA 1I2SA 3I7JA 4S2MA 2WZZA 4S2NA 1DJAA 3M6BA 5EVIB 1WYCA 3MZEA 2VGKA 3O87A 1YMXA 3CZDA 1BSGA 5M19A 4MLLA 5FAOA 3C5AA 3D4FA 3IQAA 5CHJA 3V39A 2EFXA 4S2IA 3ZHHA 1K6RA 1NXYA 4LV0A 4OPRA 1BTLA 3PBQA 2JC7A 4UHUA 4QY6A 3BLSA 2XR0A 3V3RA 3V5MA 4F94A 5GHZA 3SS4A 4QHCA 1KE3A 4IVIA 4B88A 2Y4AA 2OLVA 2ZQ7A 2Q9MA 3G35A 3NDEA 5HW3A 1L0GA 5CTNA 4GOGA 2PBYA 1IKGA 3GR2A 4LV1A 4OPZA 3FKVA 2VGJA 4Y0TA 2ZC4B 3IH9A 1KDWA 3NDGA 1FSYA 3GV9A 4JLFA 3WS0A 1Z6FA 4OQGA 5AQ9A 2C5WB 5A91A 1CI8A 4H8RA 2XDMA 1ONGA 3UPNA 3DWKA 1ES2A 5TR7A 3N7WA 5EOOA 3NIAA 2HDSA 5TGFA 5E2FA 3BRMA 4OVDA 3HLBA 5G18A 5CECA 4JBFA 3BECA 2J8YA 4ZBEA 3G2YA 1YLWA 4QD4A 2EX9A 4Q8IA 1KE4A 1ES3A 3HL9A 4N9LA 3HREA 1DJCA 4C3QA 3ZG8B 1W7FA 3W4OA 4E6XA 4GN2A 4S2OA 5M18A 1KE0A 4WMCA 4YINA 2ZQCA 1FCMA 3WS1A 3OZHA 4E3LA 4D2OA 4L0LA 2G2WA 2OLUA 2J9PA 4OQ0A 2HPBA 3HBRA 3SH9A 3GSGA 1W8QA 2WGVA 2RL3A 1TVFA 5CGXA 4ZTKA 2XFSA 3W4PA 3IWIA 4N1XA 5HAPA 3PBTA 4K91A 3IWOA 3IHAA 2WKIA 3LY4A 4QB8A 5CGSA 4P0MA 4UA6A 4S2KA 2PU4A 2XD1A 1XGIA 1NRFA 1ZKJA 3SOIA 2H5SA 1PIOA 1GHMA 1LHYA 3SS3A 4FD8A 3NCKA 3FWLA 3S1YA 1BLPA 4P6BA 3VP2A 2RCXA 3LEZA 1GCEA 5E2EA 1I5QA 2DCFA 2PU2A 3HVFA 3M6HA 3S22A 3UE0A 3ZNYA 3MXSA 3OPHA 4DE3A 4OP5A 2ZC6B 5FQMA 4RX2A 4R1GA 4JKTA 5HFOA 1JTGA 1VQQA 3NI9A 4PPRA 1LLBA 1G6AA 4E3KA 3LO7A 4EBNA 3IF5A 3OCNA 4KZ9A 3TOIA 3VSLA 1NYMA 3MZDA 4UA9A 3HLFA 3HUOA 3W8KA 1ESIA 2ZC5B 1LL5A 1C3BA 5FDHA 2HDUA 3Q81A 2WK0A 1Q2PA 4DRTA 1AXBA 3MZFA 4FCFA 4KENB 4OQHA 4LENA 4RX3A 2X02A 2CC1A 5HAQA 5FI2A 1WYBA 1K54C 1BLHA 3VMAA 5KSHA 4HBUA 2C6WB 4E3JA 4JXSA 2IWDA 4PM9A 1J9MA 4E3NA 3B3XA 1HZOA 1JWVA 1K54A 3NC8A 3UE3A 5FQQA 3VFFA 2HP9A 1LL9A 4RVAA 2WKEA 2DNSA 3BYDA 4ZDXA 1MXOA 4KZBA 4PM8A 2Y2KA 4KG2A 4S2LA 4LV2A 3PBNA 3O3VA 3MKEA 3JYIA 4X53A 5CHMA 4ZAMA 1FOFA 1PWCA 3G34A 4HBTA 4XXRA 3Q7ZA 3VP4A 5FQKA 5I94A 4X6TA 2Y2HA 1MWSA 2XH9A 4JF5A 2ZD8A 4OONA 1H5XA 2Y2IA 4HESA 3IF6C 2WGIA 3CG5A 1SHVA 3NY4A 2H0YA 3ZG9B 5DVAA 4WZ4A 4DE2A 3QNBA 4EBLA 1MBLA 3A3FA 2EX8A 3SH8A 1L0EA 5AQAA 1YLTA 3IF6A 2ZM2A 2ZM8A 1M6KA 3AGDA 3TSGA 5GLDA 4X56A 1NY0A 3FYZA 4P85A 4DXBA 2BLSA 3A3DA 3G31A 4GD6A 1E4DA 1NZUA 5DTTA 1FR1A 1O7EA 1KVMA 4GDNA 5EUAA 3SH7A 3UDXA 3VFHA 3C4OA 4OPQA 2Z2MB 4R3JA 2H10A 1XX2A 1EI5A 4IVKA 4OLDA 1CI9A 5M1AA 3HLWA 4ZJ3A 1L2SA 3CMZA 5HL1A 1LI9A 4OKPA 3UY6A 4KZ6A 4FH2A 3BM6A 1H8ZA 3PAEA 3MXRA 2J9OA 2ZQDA 3G32A 2JBFA 3QHYA 5J8XA 1ESUA 3WS5A 1GA0A 4UAAA 1VM1A 1ERMA 1SKFA 5DF7A 4OH0A 4EUZA 2H0TA 4K0XA 4R0QA 2JCHA 3AGFA 4RYEA 4KZ5A 4DDSA 5EVID 1W79A 3PAGA 2Y91A 1K38A 3ZG0A 3IXGA 4KQOA 4MNRA 3OPPA 2QZ6A 4QY5A 1W5DA 1YQSA 2WAFA 3IWQA 3C7VA 4E3MA 1BLSA 1KVLA 3IF6B 1IYQA 4OOLA 2XD5A 3EQUA 3OC2A 3VP1A 4PM7A 1HD8A 4U3TA 2ZMAA 3W4QA 4NK3A 4FH4A 3BFGA 3RXWA 4MEZA 1PWDA 2G2UA 3ZFZA 4QJGA 4GNUA 5GL9A 3MFDA 5FAPA 5FSRA 5E43A 3BFDA 4LCLA 2Y2MA 4P87A 2EX2A 3PBOA 4M3KA 4OP8A 1U60A 2XK1A 3NBLA 2WUQA 3UE1A 3VOZA 3VOYA 2EX6A 3E2KA 1PW1A 5DF8A 2X01A 4LV3A 4IBRA 1NZOA 3MKFA 4N9KA 4Z9QA 4LCMA 3N8RA 3G30A 1M40A 1WE4A 4C75A 4KZ8A 1JWZA 3S4XA 1NYYA 4WYYA 3O86A 4XUXA 1ES4A 2P74A 2EXBA 3QNCA 1L0DA 3E2LA 3PTEA 1JWPA 1S0WA 4IEDA 3VP3A 1JVJA 1QMFA 3M2JA 4A5RA 3PBRA 1OMEA 1DJBA 2BG1A 5CEBA 1TDLA 5L2FA 2Q9NA 1QMEA 1YLYA 1S6RA 3G2ZA 1ERQA 1BLCA 5GHXA 5EVIC 2R9XA 3LY3A 1GHPA 2HP5A 1PI5A 2Y2NA 1GA9A 3IXBA 4N1HA 3ISGA 4PMAA 5A90A 4R4RA 3ITAA 4OOYA 5EVIA 2A3UA 2EFUA 4RA7A 4OPYA 3FKWA 3ZNTA 5CRFA 1Y54A 5F1FA 4HEFA 2ZQ9A 3AGEA 1KGFA 1ZC2A 3C7UA 1E3UD 4UA7A 2HDRA 2X71A 5EPHA 2WYXA 5E2GA 2FFYA 4WM9A 1NJ4A 1PW8A 2Y2LA 3FV7A 5F1GA 3BFCA 4X69A 3BEBA 3BFEA 3M2KA 4DXCA 4BL3A 1YLPA 1JTDA 4MBFA 4R4SA 5FI7A 3ZG7B 5CERA 1XA7A 3BFFA 1YT4A 2WAEA 4IBXA 1XXMA 5KZHA 2ZC3B 1IYSA 3OPLA 4EBPA 1G68A 4MBKA 3UN7A 3DW0A 2Y2OA 5GLAA 3P98A 3P09A 4KG5A 3UPPA
chains in the Genus database with same CATH superfamily
4CLCD 3EQVA 1P97A 5FL3A 4D60A 2WGWA 3VSKA 4WLAA 1MWTA 4Y7PA 2V2FF 2VLGA 2OAP1 4B4XA 1KDSA 4DN0A 1XGJA 1D7EA 2QHKA 5FQIA 1YMSA 1BT5A 2HP6A 1MPLA 4IUHA 1K4FA 5KSCA 2J3WA 4BL2A 4E3LA 4OQIA 3QP1A 1T19A 2J7VA 4BQMA 2PD8A 1OT6A 1XKZA 2L4RA 5AQ7A 3FZCA 2WGWB 4BBTA 1OT9A 2PAVP 1CF0A 4EXOA 4EV4A 5IU1A 4BLMA 2V20A 4UQIS 4Y15A 3GTCA 2ZJ9A 5GLBA 4MN5A 5TFQA 1GSVA 3CLOA 3N8LA 3U2AA 3R7WA 4DKIA 2QPNA 3V3SA 3UDFA 4S2JA 5J3WA 1BULA 4MCWA 4NETA 3OPRA 3GQZA 3ZG5A 3UPOA 5EOEA 4LPZA 4MN7A 4U0XA 4GDBA 5J7EA 5HX9A 3MBZA 2ZOHA 3C4PA 1HTZA 5CXWA 2W27A 4B4ZA 4F3LA 1NRJA 2HDQA 3UB8A 4DF6A 3V50A 5HDSA 1SDEA 4EW7A 4HIAA 5EVLA 1DY6A 3E4OA 1L3LA 2XGNA 1BZAA 2OV5A 4CJNA 4Y2FA 3ZCZA 1MY8A 2PT7A 5FASA 5DJTA 4CQHA 3LFVA 2K7SA 1ES5A 2XRNA 3IX8A 1DJAA 5EVIB 1VB6A 4F3LB 2UV0E 3MZEA 2XA7S 1YMXA 3H9WA 1BSGA 3ZHHA 1N9LA 5DKLA 1K6RA 4II7A 3BLSA 4F94A 5GHZA 2PD7A 4O0PA 4B88A 4IVIA 2Y4AA 2Q0OA 2VZWA 2Q9MA 1T1BA 2O99A 4Y0TA 2ZC4B 3IH9A 3IX3A 1CI8A 4H8RA 1ONGA 3NIAA 5TGFA 3BRMA 4OVDA 3HLBA 4QD4A 3S7PA 1DJCA 3ZG8B 1W7FA 1KE0A 1FCMA 2V8CA 2PR5A 4OQ0A 1TS0A 2J9PA 2VX8A 3SH9A 4K08A 1TVFA 4ZTKA 2XFSA 3PXPA 3W4PA 3DAVA 4PKYG 3T12B 3IWOA 3IHAA 4NKPA 2Z6DA 3SOIA 1GHMA 1LHYA 3CITA 4FD8A 3FWLA 4P6BA 3VP2A 3LEZA 3BW6A 2PU2A 3HVFA 3M6HA 3OPHA 3LIBA 2ZC6B 4KQDA 5FQMA 4JKTA 4IUKA 3T4JA 3NI9A 1Z09A 1SKOB 3MZDA 3IS2B 2ZC5B 3D72A 1C3BA 2W3FA 1Q2PA 4HY8A 4XT2B 4H6JA 2VV7A 1WYBA 1K54C 2QJ5A 5KSHA 4JXSA 4JGOA 4PM9A 1JWVA 1K54A 3UE3A 4CLCE 3BYDA 1MXOA 4LRYC 3EEHA 3SZTA 3MKEA 4ZAMA 4EEUA 2HGVA 5I94A 2Y2HA 2ZD8A 4L9EA 3VOLA 3CG5A 2B95A 3RH8B 5DVAA 3ZG9B 4WZ4A 1MBLA 1S1YA 4HJ6A 5AQAA 4ARZB 1YLTA 2ZM2A 1G6OA 3L9KA 2W1TA 4ZRRA 2BLSA 1NZUA 5EUAA 3MS6A 4GDNA 3C4OA 2M7VA 2HZ5A 1T1AA 1HLUP 4OLDA 1A0KA 5M1AA 1S4RA 1L2SA 3CMZA 4NXFA 5IS1A 4FH2A 4GS9A 1OTIA 1VEUA 2J9OA 3G32A 1V9YA 1ESUA 3WS5A 1GA0A 3F1OA 4UAAA 4LGWA 4K0XA 3KSIA 4DDSA 5EVID 3A0RA 3LGOA 2GJ3A 1BLSA 1KVLA 3EQUA 4U3TA 1D06A 2W1TB 1W63M 3K3DA 3W4QA 4NK3A 3MSHA 1DP9A 1J3WA 2LB5A 4MEZA 2G2UA 4WUJA 4BBUA 4GNUA 3EWKA 5FSRA 5E43A 2OOLA 3PBOA 2AVXA 5AJGA 2VJWA 1H3QA 4M3KA 2XK1A 1XJ3A 2WUQA 3T4OA 2P08A 4GS9B 3N8RA 1VEUB 2V8FA 4FTXA 3ULFA 1F98A 4Q0JA 1NYYA 1ES4A 2EXBA 1L0DA 4JGQA 1JVJA 2JHEA 1OMEA 2BG1A 5CEBA 5EV0A 2Q9NA 3PR6A 5F6AA 3K3CA 5GHXA 1GHPA 2Y2NA 4N1HA 4OOYA 5HD3A 2JN7A 3CPTB 2JKRM 1IOUA 3C7UA 2HDRA 5EPHA 1F9IA 1NJ4A 2Y2LA 3FV7A 4QWOA 5F1GA 2HJ9C 3BFEA 1KOUA 1MKMA 4MBFA 5FI7A 3B42A 3MQQA 1IYSA 4MBKA 1Y28A 4KG5A 3WS4A 2WADA 5K5BA 2UWXA 3S7OA 5HWTA 4EWFA 4GZBA 2CMNA 1K4EA 3CAXA 1PZOA 5F82A 4OLGA 3DTEA 2M7UA 3E0YA 3PBSA 5DFYA 5EECA 2JKTI 2IWBA 5CTMA 5HPIA 1XP4A 5DFXA 3KYZA 4HJ3A 2QMIA 2INWA 3RFBA 5A92A 1KGEA 4GD8A 1EWZA 2P9VA 5IHVA 3Q82A 5F69A 1IKIA 2Y2PA 1CEFA 1PWGA 1E3UA 1MKIA 4KQQA 1N9BA 1FQGA 4R3BA 3Q7VA 2DMWA 1YM1A 2W3EA 2ACGA 4K0WA 3ZVWA 4EQIA 2J80A 1V9ZA 3LIAA 1GHIA 5EE8A 4S2PA 3TRCA 1LI0A 1FCOA 4GKUA 1LT0A 1RGYA 5FATA 2ZM0A 2VV8A 4X25A 3C2WA 2FZ0A 2XLNA 1ZG6A 3GVBA 4E6WA 4HHDA 1W8YA 2XEPA 2W0NA 4GB7A 1MWUA 2P9VB 4BENA 2KOIA 5AQBA 4L9FA 1E25A 4ZJ2A 4X68A 4WEKA 2V1AA 2PHYA 1KGGA 3Q7VB 2QKPA 2I72A 4WZ5C 3SS5A 4I3AA 2D02A 1LL8A 3LCEA 3GRJA 3VE4A 3A3EA 2ZQ8A 4KG6A 3IXHA 2W3HA 4ZJ1A 4WZ5A 3O88A 3Q1FA 1YPRA 2V1ZA 2V9AA 4XUZA 5FA7A 1DP6A 4X55A 4PAUA 1TEMA 3HJIA 5EM1A 4JF4A 3N4IA 4ID4A 3WS2A 5FQJA 1ONHA 3HUMA 4HI4A 5CHUA 2JKTM 1H8MA 1XA1A 1LSVA 4JGRA 2K31A 5HDCA 3UE6A 1L0FA 3HLDA 1K56A 2A24B 3C30A 3Q07A 5BOHA 3BLMA 5FQ9A 4S2NC 3F1NB 4WMCD 3ZDJA 3TW8A 4G3WA 1I2WA 2QJ7A 1PZPA 1YSPA 3I7JA 4NXEA 2WZZA 4R3AA 4S2NA 3M6BA 3D4FA 4S2IA 4LV0A 1BTLA 1S67L 2JC7A 3LUQA 1KE3A 2OLVA 2ZQ7A 3D3OA 4NXGA 3NDEA 3SW1A 2PBYA 3LIEA 3FKVA 1KDWA 4MMNA 3T4TA 3MXQA 2C5WB 2XDMA 3DWKA 3E4PA 5E2FA 3BECA 4ZBEA 5HL6A 1ES3A 3KO6A 3HREA 4Y17A 3U4LP 5M18A 3WS1A 4O01A 1VHMA 3DTKA 3C38A 4L0LA 3TE8A 2WGVA 2RL3A 3IWIA 2FH5A 4K91A 3BQ8A 4QB8A 4S2KA 3VV4A 2PU4A 2XD1A 2PBDP 3NECA 4YWZA 2XROA 2H5SA 1PIOA 3SS3A 1BLPA 4EU0A 5TJJA 1ZTUA 2DCFA 4DE3A 4RX2A 4EEPA 3NOTC 1JTGA 3EGDC 4E3KA 1G6AA 3QP6A 3TOIA 3Q81A 4G3VA 4DRTA 3MZFA 2X02A 3R7WB 5FI2A 1BLHA 4EERA 5DKKA 4KUOA 3MQ0A 1IFQA 4E3NA 4Y5FA 1HZOA 3NC8A 4UEYA 5FQQA 2J3TC 4RVAA 2DNSA 4KG2A 1N9OA 3JYIA 1PWCA 4HBTA 5FQKA 1MWSA 4P6ZS 1H5XA 1H0MA 2Y2IA 3FPVA 4EBLA 4ME4A 2EX8A 2KLIA 1XFNA 3ZQ5A 1M6KA 3TSGA 1NY0A 3G31A 1E4DA 5DTTA 1FR1A 3LEQA 3SH7A 1NWZA 4R3JA 3MJQA 4EQ1A 3B47A 4LLOB 5HWVA 3BM6A 3PAEA 4R38A 5J8XA 3TJZC 3LYXA 5FEFA 4OH0A 3G6OA 4HOIA 2VK3A 4R0QA 3AGFA 5HDDA 3LR0A 4R6LA 4MNRA 2M1CA 3OPPA 2QZ6A 1UGUA 3IWQA 3C7VA 4E3MA 1IYQA 2XD5A 3VP1A 4HH2A 1HD8A 2ZMAA 1XJ4A 4IHQA 1PWDA 4QJGA 3MFDA 5FAPA 3BFDA 4LCLA 1U60A 3UE1A 3P7NA 2EX6A 3E2KA 1PW1A 5DF8A 3T1QB 1DP8A 2X01A 4LV3A 4IBRA 3MKFA 4N9KA 4Z9QA 3EEAA 1WE4A 3S4XA 4WYYA 3O86A 1JWPA 3DTIA 4A5RA 3NOUC 1QMEA 3G2ZA 4I3IA 2R9XA 3LY3A 3QP4A 4ETXA 1GA9A 5HZHA 5A90A 4R4RA 3IBJA 4Q0IA 4RA7A 1DRMA 2VKSA 3FKWA 1Y54A 5F1FA 5L10A 4Y3IA 5E2GA 4WM9A 1EW0A 3M2KA 1YLPA 4R4SA 1PFLA 1XA7A 4R70A 4IBXA 2ZC3B 1SZVA 3UN7A 3UPPA 5DF9A 4H6JB 3ITBA 1G28A 4QPRA 5D3OA 2LB9A 4KZAA 4JXVA 2ZC7A 3HUNA 4Y0UA 5FAQA 1STZA 3NHQA 2E8IA 4OOMA 2XFTA 4Y0OA 1K55C 2NUTC 4BJPA 3TG9A 1FSWA 4U0TA 1P0ZA 4HQAA 1K55A 4O7DA 2ZQAA 4KZ3A 4DJ2A 2Y55A 4LRXC 1FILA 1PRQA 1MWRA 4WBGA 1YLJA 4DE0A 2XQZA 3CWFA 1YLZA 1ZG4A 2B5RA 5F83A 4JXWA 4EESA 2OSUA 3GMWA 4E3OA 3OCLA 1ALQA 4CLCC 1Q2QA 4UQIM 5CEDA 3C8CA 1K57C 2EXAA 4C6YA 5LBRA 3UB5P 2KX6A 4CLCA 1OJ5A 4HP9A 2GDNA 1K57A 1LSWA 3UO9A 4CPKA 3A3JA 4Y13A 3EGXC 2VA0A 3F1OB 2W3DA 2EWVA 1IYOA 3ZGAB 1TD5A 3UDIA 1PYYA 3IXDA 4IJGA 5EFWA 3ZVTA 5HAIA 3H82A 3N6IA 4PM5A 1RCJA 5F5YA 2WKQA 3F1PA 3T1SA 4E3IA 2JE5A 3DWZA 1F5MA 3HLEA 1TF1A 4R23A 1IEMA 3PHYA 4BD1A 5HSQA 4CLCB 2R9WA 2Z6CA 1EROA 2A49A 5GLCA 4GCZA 4GHIA 4JF6A 1FR6A 5E2HA 4JPMA 2Y2GA 4BMWA 3H7WA 5KMWA 3HLCA 5GHYA 3H82B 1K6SA 1FCNA 4P6ZM 1IYPA 1SDNA 1I2SA 2HJEA 1XFQA 4MN6A 2XA7M 3FC7A 3UB6A 2O9AA 1WYCA 2VGKA 5M19A 4MLLA 1OJGA 2PR6A 5FAOA 5CHJA 3V39A 3E4QA 1NXYA 4OPRA 4WN5A 3V3RA 3SS4A 3G35A 5HW3A 3ZYTA 1L0GA 3JVUA 3LR4A 4GOGA 4HH3A 3GR2A 4OPZA 3NDGA 3H7WB 1FSYA 3WS0A 2XSSA 3D9YA 2HDSA 2L0WA 3DBAA 4JBFA 2J8YA 1YLWA 1KE4A 3HL9A 4N9LA 3S7NA 4C3QA 4E6XA 4S2OA 5TBMA 2ZQCA 2ZBBA 3OZHA 4B9OA 4FOFA 4D2OA 2G2WA 2PYRA 3GSGA 1W8QA 3KX0X 5EVEA 2WKIA 4P0MA 1X0OA 5DJUA 3T4LA 3KSGA 1XGIA 1ZKJA 3S7QA 1GSXA 1MZUA 4DMZA 2JKGA 1NLYA 1I5QA 3S22A 3ZNYA 3LI9A 3MXSA 4OP5A 4R1GA 5HFOA 4PPRA 1LLBA 1N9NA 3LO7A 2VGLS 4EBNA 4I5SA 3IF5A 1FIKA 2ZL1A 4UA9A 5TBMB 5KIZA 1ESIA 5FDHA 3BY8A 2HDUA 2WK0A 2YKFA 1AXBA 4ETZA 4OQHA 4KENB 4LENA 1UWNX 4HBUA 2W3GA 2C6WB 3T1XA 2IWDA 1J9MA 3B3XA 3VFFA 2HP9A 4BBVA 2D01A 2WKEA 4KZBA 3T1RA 1S1ZA 2G7UA 2Y2KA 3JVVA 3QP5A 2H28A 4X53A 3LR3A 2ZMVA 3Q7ZA 4XXRA 2XH9A 4JF5A 4HESA 1TS7A 5G4YA 1SHVA 2H0YA 2R78A 3A3FA 3SH8A 3HJKA 2BTFP 1OTDA 2ZM8A 4X56A 3OBFA 4DXBA 3A3DA 4GD6A 1PNEA 1O7EA 2Z2MB 3K2NA 2H10A 4NEED 1S4SA 1W63Q 4HNBA 1EI5A 2B02A 1CI9A 3HLWA 3UY6A 4KZ6A 5J4EA 2ZOIA 1H8ZA 3MXRA 2ZQDA 3QHYA 2JBFA 1LSXA 1SKFA 5DF7A 2H0TA 2JCHA 4FUWA 1W79A 3VE3A 3PAGA 3IXGA 1W5DA 1YQSA 2WAFA 2KDKA 3OC2A 3P01A 4HP4A 3RXWA 3UMEA 3CUEC 3IX4A 2Y2MA 1XJ2A 3VOYA 3LIDA 4WF0A 3CUEA 3G30A 1M40A 4C75A 1JWZA 4XUXA 3QNCA 3PTEA 3E2LA 1S0WA 3KYQA 3VP3A 1JNUA 1OTEA 3BJNA 3PBRA 1DJBA 1TDLA 4E04A 5L2FA 1YLYA 1BLCA 5EVIC 4NG2A 2HP5A 4NXBA 1PI5A 3ITAA 5EVIA 2A3UA 1P9RA 3B33A 4OPYA 3ZNTA 2ZQ9A 1KGFA 1E3UD 4UA7A 3T4KA 2X71A 2WYXA 2FFYA 1OTAA 3ICYA 3BFCA 3BEBA 4O8GA 4DXCA 5HD5A 3ZG7B 3BFFA 1YT4A 2WAEA 5KZHA 3FPWA 3OPLA 3RTYA 5GLAA 2Y2OA 3P98A 2WKPA 4GW9A 5A93A 1T18A 3DTMA 4LRZE 2DRWA 2WZXA 3IH8A 1CK3A 3WWXA 2IWCA 4N92A 1IELA 3LI8A 2OAQ1 5DTSA 3N8SA 5AVFA 3IT9A 2Y59A 3UMDA 5U47A 3RXXA 5L07A 1MC0A 1CEGA 2WKHA 4KZ4A 4JXGA 4YFMA 5CGWA 5JYPA 2O9BA 3MMHA 1S66L 4Q8IA 3WRTA 3NOPC 4MBHA 3BQAA 1ODVA 2Z2LB 1O07A 4EETB 2V1BA 1N4OA 1SKOA 2IA2A 1RP5A 3FG8A 4KUKA 1H8YA 2Y2QA 3IS2A 1K56D 2HV1A 5IT5A 2ZLYA 1F2KA 3V67A 1OPXA 3A3IA 5DTKA 4XT2A 3VP0A 1HVBA 1TDGA 1WA9A 4AFIA 4KZ7A 1YKDA 2E8JA 1SCWA 5HARA 1K25A 3KSHA 5FDSA 3G4PA 1RGZA 2FFFB 1YSQA 2O9CA 5HPFA 4KQRA 2VGLM 4DE1A 2XF3A 3UNWA 3CJMA 4FSFA 4HJ4A 3IHBA 1PI4A 4DDYA 4PM6A 3QP8A 4BD0A 3RJUA 4B93A 4ARZA 2Y2JA 3HLGA 5FI6A 3KYEA 5JYOA 3WRZA 4GJ4A 1XPBA 4WEJA 4QU3A 4ESPA 4WELA 1G5UA 2GNXA 1BUEA 4S2MA 4Q0HA 3O87A 3CZDA 3C5AA 3IQAA 5EM0A 2EFXA 4BWIA 3PBQA 4UHUA 4QY6A 2JKRI 2XR0A 3V5MA 4QHCA 2NUPC 5CTNA 1IKGA 1YAXA 4LV1A 2OWJA 2VGJA 3GV9A 4JLFA 2GX5A 2BASA 1Z6FA 4OQGA 5AQ9A 5L8MA 5A91A 3UPNA 1ES2A 3HCYA 5TR7A 3N7WA 4L9GA 5EOOA 5CECA 5G18A 3T4QA 2V0WA 3G2YA 2EX9A 1CJFA 4PKYA 1GSWA 3W4OA 4GN2A 4WMCA 4YINA 3T50A 3E98A 2OLUA 2HPBA 3HBRA 5CGXA 4N1XA 3O5YA 5HAPA 5FEGA 3PBTA 4LFUA 3LY4A 3LR5A 5CGSA 2J3TD 4UA6A 3CPTA 3OLOA 4RQ9A 1NRFA 3PYPA 3NCKA 3S1YA 2RCXA 1GCEA 5E2EA 3UE0A 4I39A 1VETA 3UB7A 2HF6A 5C5KA 1VQQA 3T4SA 1AWIA 2V0UA 3OCNA 4KZ9A 2O0YA 5AVEA 3VSLA 1NYMA 3HLFA 3HUOA 3W8KA 1LL5A 2JKFA 3L7HA 2GZAA 4WL9A 2EWWA 2B18A 4FCFA 4RX3A 3MR0A 2CC1A 5HAQA 5HWWA 3VMAA 5I5LA 5CX7A 4Z1WA 2ZMFA 4E3JA 4G3KA 2PDRA 2QYBA 3LICA 3CHWP 1LL9A 4ZDXA 4PM8A 2I9VA 4S2LA 4LV2A 3PBNA 3O3VA 4PHTA 4X1MA 1VETB 5CHMA 1FOFA 3G34A 3F1PB 1P9WA 2PRFA 3VP4A 4X6TA 3MF0A 4OONA 1D1JA 1Y4OA 3IF6C 2WGIA 3BY9A 3NY4A 3W2ZA 4DE2A 3QNBA 1L0EA 1TS6A 3LIFA 5A8BA 3IF6A 3MQOA 4GHIB 3AGDA 5GLDA 3FYZA 4P85A 5MC7A 3EOIA 3UDXA 3VFHA 1KVMA 4OPQA 4X1LA 3UB9A 2OWHA 4GLQA 1XX2A 4IVKA 3NULA 4YOFA 5HL1A 4ZJ3A 1LI9A 4OKPA 1K0KA 3OOVA 3R4KA 1VM1A 1ERMA 3GDIA 4EUZA 3KSFA 4EUVA 3A0SA 4RYEA 2PYPA 4KZ5A 2Y91A 1K38A 3ZG0A 4KQOA 2Y8HA 3GECA 4QY5A 2VEAA 3IF6B 1BYWA 4OOLA 2EA9A 4PM7A 4FH4A 3BFGA 3ZFZA 2L1MA 5GL9A 4P87A 2EX2A 4M4XA 4OP8A 2P04A 3NBLA 3VOZA 1UWPX 1NZOA 2K2NA 2MJ6A 2QWSA 4LCMA 3CI6A 4JGPA 4KZ8A 2P74A 4IEDA 3BWLA 3IBRA 2WKRA 1QMFA 3M2JA 2A24A 1S6RA 3JPUA 1CQAA 1ERQA 3F1NA 4DJ3A 2A2LA 3IXBA 4MDZA 3ISGA 4PMAA 2P7JA 5G4ZA 2EFUA 3QP2A 3MFXA 5F68A 3NJAA 5CRFA 4HEFA 1OTBA 3AGEA 1ZC2A 5L09A 2Y79A 2VV6A 1ACFA 1TS8A 1NLZA 1PW8A 3A0VA 4I38A 4X69A 1ZHHB 4BL3A 1JTDA 2YKHA 4YNRA 5CERA 4I3JA 1XXMA 2ZL1B 2W1RA 4EBPA 1G68A 1T1CA 1XJ6A 3DW0A 3P09A
chains in the Genus database with same CATH topology
3WS4A 2WADA 3EQVA 5A93A 2UWXA 5DF9A 3DTMA 2DRWA 4EWFA 3ITBA 4GZBA 2WZXA 3IH8A 5D3OA 4KZAA 4JXVA 2WGWA 1CK3A 2ZC7A 3HUNA 1K4EA 3WWXA 3VSKA 2IWCA 4Y0UA 5FAQA 4N92A 1IELA 1PZOA 5DTSA 5F82A 1MWTA 4OLGA 4Y7PA 2V2FF 2E8IA 4B4XA 3N8SA 4OOMA 2XFTA 1KDSA 3PBSA 4Y0OA 5EECA 2IWBA 1K55C 1XGJA 5CTMA 4BJPA 3IT9A 1XP4A 5FQIA 2Y59A 2QMIA 3TG9A 5U47A 3RXXA 5A92A 1KGEA 1FSWA 4GD8A 1EWZA 4U0TA 1CEGA 2WKHA 1YMSA 2P9VA 1BT5A 4JXGA 4KZ4A 4YFMA 5IHVA 2HP6A 1MPLA 3Q82A 5CGWA 1IKIA 2Y2PA 5JYPA 1CEFA 1K55A 1K4FA 2ZQAA 4KZ3A 4O7DA 5KSCA 2Y55A 1PWGA 1E3UA 1MWRA 4OQIA 4WBGA 4BL2A 1MKIA 4KQQA 1N9BA 1YLJA 1FQGA 2XQZA 3WRTA 4DE0A 4MBHA 4R3BA 2J7VA 3Q7VA 1YLZA 1ZG4A 1YM1A 4BQMA 2B5RA 4K0WA 3ZVWA 1XKZA 5F83A 4EQIA 4JXWA 2Z2LB 1O07A 2OSUA 3GMWA 5AQ7A 4E3OA 3FZCA 1GHIA 1ALQA 2WGWB 3OCLA 5EE8A 1Q2QA 4S2PA 5CEDA 1K57C 1N4OA 2EXAA 4C6YA 4EV4A 1LI0A 1FCOA 1RP5A 4BLMA 4GKUA 2V20A 1H8YA 2Y2QA 1RGYA 3GTCA 5FATA 2ZM0A 2ZJ9A 2XLNA 2GDNA 1ZG6A 1K56D 1K57A 5GLBA 3UO9A 5TFQA 4CPKA 3A3JA 3GVBA 3N8LA 2ZLYA 3A3IA 5DTKA 3VP0A 4E6WA 4DKIA 1HVBA 1W8YA 2XEPA 1TDGA 2QPNA 1IYOA 4GB7A 1MWUA 2P9VB 4KZ7A 3V3SA 4BENA 3ZGAB 3UDFA 5AQBA 1SCWA 5HARA 1E25A 4S2JA 4X68A 4ZJ2A 4WEKA 1BULA 4NETA 1K25A 3UDIA 1PYYA 3OPRA 3GQZA 3IXDA 3ZG5A 3UPOA 3G4PA 5EOEA 1KGGA 1RGZA 2FFFB 3Q7VB 2I72A 4U0XA 4WZ5C 3SS5A 3ZVTA 4GDBA 5HAIA 3N6IA 3LCEA 3GRJA 4KQRA 5HX9A 3A3EA 3MBZA 4DE1A 1RCJA 2XF3A 4PM5A 2ZQ8A 4KG6A 3IXHA 3C4PA 3UNWA 1HTZA 3CJMA 4FSFA 5CXWA 4B4ZA 3IHBA 4E3IA 1PI4A 4DDYA 2JE5A 3DWZA 4ZJ1A 4WZ5A 3O88A 3HLEA 3Q1FA 4PM6A 2V1ZA 4R23A 4XUZA 5FA7A 4X55A 2HDQA 1IEMA 4BD1A 4DF6A 4BD0A 3V50A 2R9WA 3RJUA 1TEMA 1EROA 4JF4A 2A49A 5GLCA 3N4IA 4ID4A 3WS2A 2Y2JA 1SDEA 5FQJA 1ONHA 4JF6A 3HLGA 5FI6A 3HUMA 5CHUA 5JYOA 5EVLA 3WRZA 1DY6A 1FR6A 1XA1A 2XGNA 1XPBA 4WEJA 5E2HA 1BZAA 2OV5A 4CJNA 4JPMA 1L0FA 2Y2GA 1K56A 3HLDA 4QU3A 3Q07A 4WELA 5BOHA 3BLMA 5KMWA 3ZCZA 1MY8A 5FQ9A 3HLCA 4S2NC 4WMCD 3ZDJA 5FASA 5GHYA 1BUEA 1I2WA 1K6SA 1FCNA 1PZPA 1ES5A 1IYPA 1SDNA 1I2SA 3I7JA 4S2MA 2WZZA 4S2NA 1DJAA 3M6BA 5EVIB 1WYCA 3MZEA 2VGKA 3O87A 1YMXA 3CZDA 1BSGA 5M19A 4MLLA 5FAOA 3C5AA 3D4FA 3IQAA 5CHJA 3V39A 2EFXA 4S2IA 3ZHHA 1K6RA 1NXYA 4LV0A 4OPRA 1BTLA 3PBQA 2JC7A 4UHUA 4QY6A 3BLSA 2XR0A 3V3RA 3V5MA 4F94A 5GHZA 3SS4A 4QHCA 1KE3A 4IVIA 4B88A 2Y4AA 2OLVA 2ZQ7A 2Q9MA 3G35A 3NDEA 5HW3A 1L0GA 5CTNA 4GOGA 2PBYA 1IKGA 3GR2A 4LV1A 4OPZA 3FKVA 2VGJA 4Y0TA 2ZC4B 3IH9A 1KDWA 3NDGA 1FSYA 3GV9A 4JLFA 3WS0A 1Z6FA 4OQGA 5AQ9A 2C5WB 5A91A 1CI8A 4H8RA 2XDMA 1ONGA 3UPNA 3DWKA 1ES2A 5TR7A 3N7WA 5EOOA 3NIAA 2HDSA 5TGFA 5E2FA 3BRMA 4OVDA 3HLBA 5G18A 5CECA 4JBFA 3BECA 2J8YA 4ZBEA 3G2YA 1YLWA 4QD4A 2EX9A 4Q8IA 1KE4A 1ES3A 3HL9A 4N9LA 3HREA 1DJCA 4C3QA 3ZG8B 1W7FA 3W4OA 4E6XA 4GN2A 4S2OA 5M18A 1KE0A 4WMCA 4YINA 2ZQCA 1FCMA 3WS1A 3OZHA 4E3LA 4D2OA 4L0LA 2G2WA 2OLUA 2J9PA 4OQ0A 2HPBA 3HBRA 3SH9A 3GSGA 1W8QA 2WGVA 2RL3A 1TVFA 5CGXA 4ZTKA 2XFSA 3W4PA 3IWIA 4N1XA 5HAPA 3PBTA 4K91A 3IWOA 3IHAA 2WKIA 3LY4A 4QB8A 5CGSA 4P0MA 4UA6A 4S2KA 2PU4A 2XD1A 1XGIA 1NRFA 1ZKJA 3SOIA 2H5SA 1PIOA 1GHMA 1LHYA 3SS3A 4FD8A 3NCKA 3FWLA 3S1YA 1BLPA 4P6BA 3VP2A 2RCXA 3LEZA 1GCEA 5E2EA 1I5QA 2DCFA 2PU2A 3HVFA 3M6HA 3S22A 3UE0A 3ZNYA 3MXSA 3OPHA 4DE3A 4OP5A 2ZC6B 5FQMA 4RX2A 4R1GA 4JKTA 5HFOA 1JTGA 1VQQA 3NI9A 4PPRA 1LLBA 1G6AA 4E3KA 3LO7A 4EBNA 3IF5A 3OCNA 4KZ9A 3TOIA 3VSLA 1NYMA 3MZDA 4UA9A 3HLFA 3HUOA 3W8KA 1ESIA 2ZC5B 1LL5A 1C3BA 5FDHA 2HDUA 3Q81A 2WK0A 1Q2PA 4DRTA 1AXBA 3MZFA 4FCFA 4KENB 4OQHA 4LENA 4RX3A 2X02A 2CC1A 5HAQA 5FI2A 1WYBA 1K54C 1BLHA 3VMAA 5KSHA 4HBUA 2C6WB 4E3JA 4JXSA 2IWDA 4PM9A 1J9MA 4E3NA 3B3XA 1HZOA 1JWVA 1K54A 3NC8A 3UE3A 5FQQA 3VFFA 2HP9A 1LL9A 4RVAA 2WKEA 2DNSA 3BYDA 4ZDXA 1MXOA 4KZBA 4PM8A 2Y2KA 4KG2A 4S2LA 4LV2A 3PBNA 3O3VA 3MKEA 3JYIA 4X53A 5CHMA 4ZAMA 1FOFA 1PWCA 3G34A 4HBTA 4XXRA 3Q7ZA 3VP4A 5FQKA 5I94A 4X6TA 2Y2HA 1MWSA 2XH9A 4JF5A 2ZD8A 4OONA 1H5XA 2Y2IA 4HESA 3IF6C 2WGIA 3CG5A 1SHVA 3NY4A 2H0YA 3ZG9B 5DVAA 4WZ4A 4DE2A 3QNBA 4EBLA 1MBLA 3A3FA 2EX8A 3SH8A 1L0EA 5AQAA 1YLTA 3IF6A 2ZM2A 2ZM8A 1M6KA 3AGDA 3TSGA 5GLDA 4X56A 1NY0A 3FYZA 4P85A 4DXBA 2BLSA 3A3DA 3G31A 4GD6A 1E4DA 1NZUA 5DTTA 1FR1A 1O7EA 1KVMA 4GDNA 5EUAA 3SH7A 3UDXA 3VFHA 3C4OA 4OPQA 2Z2MB 4R3JA 2H10A 1XX2A 1EI5A 4IVKA 4OLDA 1CI9A 5M1AA 3HLWA 4ZJ3A 1L2SA 3CMZA 5HL1A 1LI9A 4OKPA 3UY6A 4KZ6A 4FH2A 3BM6A 1H8ZA 3PAEA 3MXRA 2J9OA 2ZQDA 3G32A 2JBFA 3QHYA 5J8XA 1ESUA 3WS5A 1GA0A 4UAAA 1VM1A 1ERMA 1SKFA 5DF7A 4OH0A 4EUZA 2H0TA 4K0XA 4R0QA 2JCHA 3AGFA 4RYEA 4KZ5A 4DDSA 5EVID 1W79A 3PAGA 2Y91A 1K38A 3ZG0A 3IXGA 4KQOA 4MNRA 3OPPA 2QZ6A 4QY5A 1W5DA 1YQSA 2WAFA 3IWQA 3C7VA 4E3MA 1BLSA 1KVLA 3IF6B 1IYQA 4OOLA 2XD5A 3EQUA 3OC2A 3VP1A 4PM7A 1HD8A 4U3TA 2ZMAA 3W4QA 4NK3A 4FH4A 3BFGA 3RXWA 4MEZA 1PWDA 2G2UA 3ZFZA 4QJGA 4GNUA 5GL9A 3MFDA 5FAPA 5FSRA 5E43A 3BFDA 4LCLA 2Y2MA 4P87A 2EX2A 3PBOA 4M3KA 4OP8A 1U60A 2XK1A 3NBLA 2WUQA 3UE1A 3VOZA 3VOYA 2EX6A 3E2KA 1PW1A 5DF8A 2X01A 4LV3A 4IBRA 1NZOA 3MKFA 4N9KA 4Z9QA 4LCMA 3N8RA 3G30A 1M40A 1WE4A 4C75A 4KZ8A 1JWZA 3S4XA 1NYYA 4WYYA 3O86A 4XUXA 1ES4A 2P74A 2EXBA 3QNCA 1L0DA 3E2LA 3PTEA 1JWPA 1S0WA 4IEDA 3VP3A 1JVJA 1QMFA 3M2JA 4A5RA 3PBRA 1OMEA 1DJBA 2BG1A 5CEBA 1TDLA 5L2FA 2Q9NA 1QMEA 1YLYA 1S6RA 3G2ZA 1ERQA 1BLCA 5GHXA 5EVIC 2R9XA 3LY3A 1GHPA 2HP5A 1PI5A 2Y2NA 1GA9A 3IXBA 4N1HA 3ISGA 4PMAA 5A90A 4R4RA 3ITAA 4OOYA 5EVIA 2A3UA 2EFUA 4RA7A 4OPYA 3FKWA 3ZNTA 5CRFA 1Y54A 5F1FA 4HEFA 2ZQ9A 3AGEA 1KGFA 1ZC2A 3C7UA 1E3UD 4UA7A 2HDRA 2X71A 5EPHA 2WYXA 5E2GA 2FFYA 4WM9A 1NJ4A 1PW8A 2Y2LA 3FV7A 5F1GA 3BFCA 4X69A 3BEBA 3BFEA 3M2KA 4DXCA 4BL3A 1YLPA 1JTDA 4MBFA 4R4SA 5FI7A 3ZG7B 5CERA 1XA7A 3BFFA 1YT4A 2WAEA 4IBXA 1XXMA 5KZHA 2ZC3B 1IYSA 3OPLA 4EBPA 1G68A 4MBKA 3UN7A 3DW0A 2Y2OA 5GLAA 3P98A 3P09A 4KG5A 3UPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS4 A;  2WAD A;  3EQV A;  5A93 A;  2UWX A;  5DF9 A;  3DTM A;  2DRW A;  4EWF A;  3ITB A;  4GZB A;  2WZX A;  3IH8 A;  5D3O A;  4KZA A;  4JXV A;  2WGW A;  1CK3 A;  2ZC7 A;  3HUN A;  1K4E A;  3WWX A;  3VSK A;  2IWC A;  4Y0U A;  5FAQ A;  4N92 A;  1IEL A;  1PZO A;  5DTS A;  5F82 A;  1MWT A;  4OLG A;  4Y7P A;  2V2F F;  2E8I A;  4B4X A;  3N8S A;  4OOM A;  2XFT A;  1KDS A;  3PBS A;  4Y0O A;  5EEC A;  2IWB A;  1K55 C;  1XGJ A;  5CTM A;  4BJP A;  3IT9 A;  1XP4 A;  5FQI A;  2Y59 A;  2QMI A;  3TG9 A;  5U47 A;  3RXX A;  5A92 A;  1KGE A;  1FSW A;  4GD8 A;  1EWZ A;  4U0T A;  1CEG A;  2WKH A;  1YMS A;  2P9V A;  1BT5 A;  4JXG A;  4KZ4 A;  4YFM A;  5IHV A;  2HP6 A;  1MPL A;  3Q82 A;  5CGW A;  1IKI A;  2Y2P A;  5JYP A;  1CEF A;  1K55 A;  1K4F A;  2ZQA A;  4KZ3 A;  4O7D A;  5KSC A;  2Y55 A;  1PWG A;  1E3U A;  1MWR A;  4OQI A;  4WBG A;  4BL2 A;  1MKI A;  4KQQ A;  1N9B A;  1YLJ A;  1FQG A;  2XQZ A;  3WRT A;  4DE0 A;  4MBH A;  4R3B A;  2J7V A;  3Q7V A;  1YLZ A;  1ZG4 A;  1YM1 A;  4BQM A;  2B5R A;  4K0W A;  3ZVW A;  1XKZ A;  5F83 A;  4EQI A;  4JXW A;  2Z2L B;  1O07 A;  2OSU A;  3GMW A;  5AQ7 A;  4E3O A;  3FZC A;  1GHI A;  1ALQ A;  2WGW B;  3OCL A;  5EE8 A;  1Q2Q A;  4S2P A;  5CED A;  1K57 C;  1N4O A;  2EXA A;  4C6Y A;  4EV4 A;  1LI0 A;  1FCO A;  1RP5 A;  4BLM A;  4GKU A;  2V20 A;  1H8Y A;  2Y2Q A;  1RGY A;  3GTC A;  5FAT A;  2ZM0 A;  2ZJ9 A;  2XLN A;  2GDN A;  1ZG6 A;  1K56 D;  1K57 A;  5GLB A;  3UO9 A;  5TFQ A;  4CPK A;  3A3J A;  3GVB A;  3N8L A;  2ZLY A;  3A3I A;  5DTK A;  3VP0 A;  4E6W A;  4DKI A;  1HVB A;  1W8Y A;  2XEP A;  1TDG A;  2QPN A;  1IYO A;  4GB7 A;  1MWU A;  2P9V B;  4KZ7 A;  3V3S A;  4BEN A;  3ZGA B;  3UDF A;  5AQB A;  1SCW A;  5HAR A;  1E25 A;  4S2J A;  4X68 A;  4ZJ2 A;  4WEK A;  1BUL A;  4NET A;  1K25 A;  3UDI A;  1PYY A;  3OPR A;  3GQZ A;  3IXD A;  3ZG5 A;  3UPO A;  3G4P A;  5EOE A;  1KGG A;  1RGZ A;  2FFF B;  3Q7V B;  2I72 A;  4U0X A;  4WZ5 C;  3SS5 A;  3ZVT A;  4GDB A;  5HAI A;  3N6I A;  3LCE A;  3GRJ A;  4KQR A;  5HX9 A;  3A3E A;  3MBZ A;  4DE1 A;  1RCJ A;  2XF3 A;  4PM5 A;  2ZQ8 A;  4KG6 A;  3IXH A;  3C4P A;  3UNW A;  1HTZ A;  3CJM A;  4FSF A;  5CXW A;  4B4Z A;  3IHB A;  4E3I A;  1PI4 A;  4DDY A;  2JE5 A;  3DWZ A;  4ZJ1 A;  4WZ5 A;  3O88 A;  3HLE A;  3Q1F A;  4PM6 A;  2V1Z A;  4R23 A;  4XUZ A;  5FA7 A;  4X55 A;  2HDQ A;  1IEM A;  4BD1 A;  4DF6 A;  4BD0 A;  3V50 A;  2R9W A;  3RJU A;  1TEM A;  1ERO A;  4JF4 A;  2A49 A;  5GLC A;  3N4I A;  4ID4 A;  3WS2 A;  2Y2J A;  1SDE A;  5FQJ A;  1ONH A;  4JF6 A;  3HLG A;  5FI6 A;  3HUM A;  5CHU A;  5JYO A;  5EVL A;  3WRZ A;  1DY6 A;  1FR6 A;  1XA1 A;  2XGN A;  1XPB A;  4WEJ A;  5E2H A;  1BZA A;  2OV5 A;  4CJN A;  4JPM A;  1L0F A;  2Y2G A;  1K56 A;  3HLD A;  4QU3 A;  3Q07 A;  4WEL A;  5BOH A;  3BLM A;  5KMW A;  3ZCZ A;  1MY8 A;  5FQ9 A;  3HLC A;  4S2N C;  4WMC D;  3ZDJ A;  5FAS A;  5GHY A;  1BUE A;  1I2W A;  1K6S A;  1FCN A;  1PZP A;  1ES5 A;  1IYP A;  1SDN A;  1I2S A;  3I7J A;  4S2M A;  2WZZ A;  4S2N A;  1DJA A;  3M6B A;  5EVI B;  1WYC A;  3MZE A;  2VGK A;  3O87 A;  1YMX A;  3CZD A;  1BSG A;  5M19 A;  4MLL A;  5FAO A;  3C5A A;  3D4F A;  3IQA A;  5CHJ A;  3V39 A;  2EFX A;  4S2I A;  3ZHH A;  1K6R A;  1NXY A;  4LV0 A;  4OPR A;  1BTL A;  3PBQ A;  2JC7 A;  4UHU A;  4QY6 A;  3BLS A;  2XR0 A;  3V3R A;  3V5M A;  4F94 A;  5GHZ A;  3SS4 A;  4QHC A;  1KE3 A;  4IVI A;  4B88 A;  2Y4A A;  2OLV A;  2ZQ7 A;  2Q9M A;  3G35 A;  3NDE A;  5HW3 A;  1L0G A;  5CTN A;  4GOG A;  2PBY A;  1IKG A;  3GR2 A;  4LV1 A;  4OPZ A;  3FKV A;  2VGJ A;  4Y0T A;  2ZC4 B;  3IH9 A;  1KDW A;  3NDG A;  1FSY A;  3GV9 A;  4JLF A;  3WS0 A;  1Z6F A;  4OQG A;  5AQ9 A;  2C5W B;  5A91 A;  1CI8 A;  4H8R A;  2XDM A;  1ONG A;  3UPN A;  3DWK A;  1ES2 A;  5TR7 A;  3N7W A;  5EOO A;  3NIA A;  2HDS A;  5TGF A;  5E2F A;  3BRM A;  4OVD A;  3HLB A;  5G18 A;  5CEC A;  4JBF A;  3BEC A;  2J8Y A;  4ZBE A;  3G2Y A;  1YLW A;  4QD4 A;  2EX9 A;  4Q8I A;  1KE4 A;  1ES3 A;  3HL9 A;  4N9L A;  3HRE A;  1DJC A;  4C3Q A;  3ZG8 B;  1W7F A;  3W4O A;  4E6X A;  4GN2 A;  4S2O A;  5M18 A;  1KE0 A;  4WMC A;  4YIN A;  2ZQC A;  1FCM A;  3WS1 A;  3OZH A;  4E3L A;  4D2O A;  4L0L A;  2G2W A;  2OLU A;  2J9P A;  4OQ0 A;  2HPB A;  3HBR A;  3SH9 A;  3GSG A;  1W8Q A;  2WGV A;  2RL3 A;  1TVF A;  5CGX A;  4ZTK A;  2XFS A;  3W4P A;  3IWI A;  4N1X A;  5HAP A;  3PBT A;  4K91 A;  3IWO A;  3IHA A;  2WKI A;  3LY4 A;  4QB8 A;  5CGS A;  4P0M A;  4UA6 A;  4S2K A;  2PU4 A;  2XD1 A;  1XGI A;  1NRF A;  1ZKJ A;  3SOI A;  2H5S A;  1PIO A;  1GHM A;  1LHY A;  3SS3 A;  4FD8 A;  3NCK A;  3FWL A;  3S1Y A;  1BLP A;  4P6B A;  3VP2 A;  2RCX A;  3LEZ A;  1GCE A;  5E2E A;  1I5Q A;  2DCF A;  2PU2 A;  3HVF A;  3M6H A;  3S22 A;  3UE0 A;  3ZNY A;  3MXS A;  3OPH A;  4DE3 A;  4OP5 A;  2ZC6 B;  5FQM A;  4RX2 A;  4R1G A;  4JKT A;  5HFO A;  1JTG A;  1VQQ A;  3NI9 A;  4PPR A;  1LLB A;  1G6A A;  4E3K A;  3LO7 A;  4EBN A;  3IF5 A;  3OCN A;  4KZ9 A;  3TOI A;  3VSL A;  1NYM A;  3MZD A;  4UA9 A;  3HLF A;  3HUO A;  3W8K A;  1ESI A;  2ZC5 B;  1LL5 A;  1C3B A;  5FDH A;  2HDU A;  3Q81 A;  2WK0 A;  1Q2P A;  4DRT A;  1AXB A;  3MZF A;  4FCF A;  4KEN B;  4OQH A;  4LEN A;  4RX3 A;  2X02 A;  2CC1 A;  5HAQ A;  5FI2 A;  1WYB A;  1K54 C;  1BLH A;  3VMA A;  5KSH A;  4HBU A;  2C6W B;  4E3J A;  4JXS A;  2IWD A;  4PM9 A;  1J9M A;  4E3N A;  3B3X A;  1HZO A;  1JWV A;  1K54 A;  3NC8 A;  3UE3 A;  5FQQ A;  3VFF A;  2HP9 A;  1LL9 A;  4RVA A;  2WKE A;  2DNS A;  3BYD A;  4ZDX A;  1MXO A;  4KZB A;  4PM8 A;  2Y2K A;  4KG2 A;  4S2L A;  4LV2 A;  3PBN A;  3O3V A;  3MKE A;  3JYI A;  4X53 A;  5CHM A;  4ZAM A;  1FOF A;  1PWC A;  3G34 A;  4HBT A;  4XXR A;  3Q7Z A;  3VP4 A;  5FQK A;  5I94 A;  4X6T A;  2Y2H A;  1MWS A;  2XH9 A;  4JF5 A;  2ZD8 A;  4OON A;  1H5X A;  2Y2I A;  4HES A;  3IF6 C;  2WGI A;  3CG5 A;  1SHV A;  3NY4 A;  2H0Y A;  3ZG9 B;  5DVA A;  4WZ4 A;  4DE2 A;  3QNB A;  4EBL A;  1MBL A;  3A3F A;  2EX8 A;  3SH8 A;  1L0E A;  5AQA A;  1YLT A;  3IF6 A;  2ZM2 A;  2ZM8 A;  1M6K A;  3AGD A;  3TSG A;  5GLD A;  4X56 A;  1NY0 A;  3FYZ A;  4P85 A;  4DXB A;  2BLS A;  3A3D A;  3G31 A;  4GD6 A;  1E4D A;  1NZU A;  5DTT A;  1FR1 A;  1O7E A;  1KVM A;  4GDN A;  5EUA A;  3SH7 A;  3UDX A;  3VFH A;  3C4O A;  4OPQ A;  2Z2M B;  4R3J A;  2H10 A;  1XX2 A;  1EI5 A;  4IVK A;  4OLD A;  1CI9 A;  5M1A A;  3HLW A;  4ZJ3 A;  1L2S A;  3CMZ A;  5HL1 A;  1LI9 A;  4OKP A;  3UY6 A;  4KZ6 A;  4FH2 A;  3BM6 A;  1H8Z A;  3PAE A;  3MXR A;  2J9O A;  2ZQD A;  3G32 A;  2JBF A;  3QHY A;  5J8X A;  1ESU A;  3WS5 A;  1GA0 A;  4UAA A;  1VM1 A;  1ERM A;  1SKF A;  5DF7 A;  4OH0 A;  4EUZ A;  2H0T A;  4K0X A;  4R0Q A;  2JCH A;  3AGF A;  4RYE A;  4KZ5 A;  4DDS A;  5EVI D;  1W79 A;  3PAG A;  2Y91 A;  1K38 A;  3ZG0 A;  3IXG A;  4KQO A;  4MNR A;  3OPP A;  2QZ6 A;  4QY5 A;  1W5D A;  1YQS A;  2WAF A;  3IWQ A;  3C7V A;  4E3M A;  1BLS A;  1KVL A;  3IF6 B;  1IYQ A;  4OOL A;  2XD5 A;  3EQU A;  3OC2 A;  3VP1 A;  4PM7 A;  1HD8 A;  4U3T A;  2ZMA A;  3W4Q A;  4NK3 A;  4FH4 A;  3BFG A;  3RXW A;  4MEZ A;  1PWD A;  2G2U A;  3ZFZ A;  4QJG A;  4GNU A;  5GL9 A;  3MFD A;  5FAP A;  5FSR A;  5E43 A;  3BFD A;  4LCL A;  2Y2M A;  4P87 A;  2EX2 A;  3PBO A;  4M3K A;  4OP8 A;  1U60 A;  2XK1 A;  3NBL A;  2WUQ A;  3UE1 A;  3VOZ A;  3VOY A;  2EX6 A;  3E2K A;  1PW1 A;  5DF8 A;  2X01 A;  4LV3 A;  4IBR A;  1NZO A;  3MKF A;  4N9K A;  4Z9Q A;  4LCM A;  3N8R A;  3G30 A;  1M40 A;  1WE4 A;  4C75 A;  4KZ8 A;  1JWZ A;  3S4X A;  1NYY A;  4WYY A;  3O86 A;  4XUX A;  1ES4 A;  2P74 A;  2EXB A;  3QNC A;  1L0D A;  3E2L A;  3PTE A;  1JWP A;  1S0W A;  4IED A;  3VP3 A;  1JVJ A;  1QMF A;  3M2J A;  4A5R A;  3PBR A;  1OME A;  1DJB A;  2BG1 A;  5CEB A;  1TDL A;  5L2F A;  2Q9N A;  1QME A;  1YLY A;  1S6R A;  3G2Z A;  1ERQ A;  1BLC A;  5GHX A;  5EVI C;  2R9X A;  3LY3 A;  1GHP A;  2HP5 A;  1PI5 A;  2Y2N A;  1GA9 A;  3IXB A;  4N1H A;  3ISG A;  4PMA A;  5A90 A;  4R4R A;  3ITA A;  4OOY A;  5EVI A;  2A3U A;  2EFU A;  4RA7 A;  4OPY A;  3FKW A;  3ZNT A;  5CRF A;  1Y54 A;  5F1F A;  4HEF A;  2ZQ9 A;  3AGE A;  1KGF A;  1ZC2 A;  3C7U A;  1E3U D;  4UA7 A;  2HDR A;  2X71 A;  5EPH A;  2WYX A;  5E2G A;  2FFY A;  4WM9 A;  1NJ4 A;  1PW8 A;  2Y2L A;  3FV7 A;  5F1G A;  3BFC A;  4X69 A;  3BEB A;  3BFE A;  3M2K A;  4DXC A;  4BL3 A;  1YLP A;  1JTD A;  4MBF A;  4R4S A;  5FI7 A;  3ZG7 B;  5CER A;  1XA7 A;  3BFF A;  1YT4 A;  2WAE A;  4IBX A;  1XXM A;  5KZH A;  2ZC3 B;  1IYS A;  3OPL A;  4EBP A;  1G68 A;  4MBK A;  3UN7 A;  3DW0 A;  2Y2O A;  5GLA A;  3P98 A;  3P09 A;  4KG5 A;  3UPP A; 
#chains in the Genus database with same CATH topology
 4CLC D;  3EQV A;  1P97 A;  5FL3 A;  4D60 A;  2WGW A;  3VSK A;  4WLA A;  1MWT A;  4Y7P A;  2V2F F;  2VLG A;  2OAP 1;  4B4X A;  1KDS A;  4DN0 A;  1XGJ A;  1D7E A;  2QHK A;  5FQI A;  1YMS A;  1BT5 A;  2HP6 A;  1MPL A;  4IUH A;  1K4F A;  5KSC A;  2J3W A;  4BL2 A;  4E3L A;  4OQI A;  3QP1 A;  1T19 A;  2J7V A;  4BQM A;  2PD8 A;  1OT6 A;  1XKZ A;  2L4R A;  5AQ7 A;  3FZC A;  2WGW B;  4BBT A;  1OT9 A;  2PAV P;  1CF0 A;  4EXO A;  4EV4 A;  5IU1 A;  4BLM A;  2V20 A;  4UQI S;  4Y15 A;  3GTC A;  2ZJ9 A;  5GLB A;  4MN5 A;  5TFQ A;  1GSV A;  3CLO A;  3N8L A;  3U2A A;  3R7W A;  4DKI A;  2QPN A;  3V3S A;  3UDF A;  4S2J A;  5J3W A;  1BUL A;  4MCW A;  4NET A;  3OPR A;  3GQZ A;  3ZG5 A;  3UPO A;  5EOE A;  4LPZ A;  4MN7 A;  4U0X A;  4GDB A;  5J7E A;  5HX9 A;  3MBZ A;  2ZOH A;  3C4P A;  1HTZ A;  5CXW A;  2W27 A;  4B4Z A;  4F3L A;  1NRJ A;  2HDQ A;  3UB8 A;  4DF6 A;  3V50 A;  5HDS A;  1SDE A;  4EW7 A;  4HIA A;  5EVL A;  1DY6 A;  3E4O A;  1L3L A;  2XGN A;  1BZA A;  2OV5 A;  4CJN A;  4Y2F A;  3ZCZ A;  1MY8 A;  2PT7 A;  5FAS A;  5DJT A;  4CQH A;  3LFV A;  2K7S A;  1ES5 A;  2XRN A;  3IX8 A;  1DJA A;  5EVI B;  1VB6 A;  4F3L B;  2UV0 E;  3MZE A;  2XA7 S;  1YMX A;  3H9W A;  1BSG A;  3ZHH A;  1N9L A;  5DKL A;  1K6R A;  4II7 A;  3BLS A;  4F94 A;  5GHZ A;  2PD7 A;  4O0P A;  4B88 A;  4IVI A;  2Y4A A;  2Q0O A;  2VZW A;  2Q9M A;  1T1B A;  2O99 A;  4Y0T A;  2ZC4 B;  3IH9 A;  3IX3 A;  1CI8 A;  4H8R A;  1ONG A;  3NIA A;  5TGF A;  3BRM A;  4OVD A;  3HLB A;  4QD4 A;  3S7P A;  1DJC A;  3ZG8 B;  1W7F A;  1KE0 A;  1FCM A;  2V8C A;  2PR5 A;  4OQ0 A;  1TS0 A;  2J9P A;  2VX8 A;  3SH9 A;  4K08 A;  1TVF A;  4ZTK A;  2XFS A;  3PXP A;  3W4P A;  3DAV A;  4PKY G;  3T12 B;  3IWO A;  3IHA A;  4NKP A;  2Z6D A;  3SOI A;  1GHM A;  1LHY A;  3CIT A;  4FD8 A;  3FWL A;  4P6B A;  3VP2 A;  3LEZ A;  3BW6 A;  2PU2 A;  3HVF A;  3M6H A;  3OPH A;  3LIB A;  2ZC6 B;  4KQD A;  5FQM A;  4JKT A;  4IUK A;  3T4J A;  3NI9 A;  1Z09 A;  1SKO B;  3MZD A;  3IS2 B;  2ZC5 B;  3D72 A;  1C3B A;  2W3F A;  1Q2P A;  4HY8 A;  4XT2 B;  4H6J A;  2VV7 A;  1WYB A;  1K54 C;  2QJ5 A;  5KSH A;  4JXS A;  4JGO A;  4PM9 A;  1JWV A;  1K54 A;  3UE3 A;  4CLC E;  3BYD A;  1MXO A;  4LRY C;  3EEH A;  3SZT A;  3MKE A;  4ZAM A;  4EEU A;  2HGV A;  5I94 A;  2Y2H A;  2ZD8 A;  4L9E A;  3VOL A;  3CG5 A;  2B95 A;  3RH8 B;  5DVA A;  3ZG9 B;  4WZ4 A;  1MBL A;  1S1Y A;  4HJ6 A;  5AQA A;  4ARZ B;  1YLT A;  2ZM2 A;  1G6O A;  3L9K A;  2W1T A;  4ZRR A;  2BLS A;  1NZU A;  5EUA A;  3MS6 A;  4GDN A;  3C4O A;  2M7V A;  2HZ5 A;  1T1A A;  1HLU P;  4OLD A;  1A0K A;  5M1A A;  1S4R A;  1L2S A;  3CMZ A;  4NXF A;  5IS1 A;  4FH2 A;  4GS9 A;  1OTI A;  1VEU A;  2J9O A;  3G32 A;  1V9Y A;  1ESU A;  3WS5 A;  1GA0 A;  3F1O A;  4UAA A;  4LGW A;  4K0X A;  3KSI A;  4DDS A;  5EVI D;  3A0R A;  3LGO A;  2GJ3 A;  1BLS A;  1KVL A;  3EQU A;  4U3T A;  1D06 A;  2W1T B;  1W63 M;  3K3D A;  3W4Q A;  4NK3 A;  3MSH A;  1DP9 A;  1J3W A;  2LB5 A;  4MEZ A;  2G2U A;  4WUJ A;  4BBU A;  4GNU A;  3EWK A;  5FSR A;  5E43 A;  2OOL A;  3PBO A;  2AVX A;  5AJG A;  2VJW A;  1H3Q A;  4M3K A;  2XK1 A;  1XJ3 A;  2WUQ A;  3T4O A;  2P08 A;  4GS9 B;  3N8R A;  1VEU B;  2V8F A;  4FTX A;  3ULF A;  1F98 A;  4Q0J A;  1NYY A;  1ES4 A;  2EXB A;  1L0D A;  4JGQ A;  1JVJ A;  2JHE A;  1OME A;  2BG1 A;  5CEB A;  5EV0 A;  2Q9N A;  3PR6 A;  5F6A A;  3K3C A;  5GHX A;  1GHP A;  2Y2N A;  4N1H A;  4OOY A;  5HD3 A;  2JN7 A;  3CPT B;  2JKR M;  1IOU A;  3C7U A;  2HDR A;  5EPH A;  1F9I A;  1NJ4 A;  2Y2L A;  3FV7 A;  4QWO A;  5F1G A;  2HJ9 C;  3BFE A;  1KOU A;  1MKM A;  4MBF A;  5FI7 A;  3B42 A;  3MQQ A;  1IYS A;  4MBK A;  1Y28 A;  4KG5 A;  3WS4 A;  2WAD A;  5K5B A;  2UWX A;  3S7O A;  5HWT A;  4EWF A;  4GZB A;  2CMN A;  1K4E A;  3CAX A;  1PZO A;  5F82 A;  4OLG A;  3DTE A;  2M7U A;  3E0Y A;  3PBS A;  5DFY A;  5EEC A;  2JKT I;  2IWB A;  5CTM A;  5HPI A;  1XP4 A;  5DFX A;  3KYZ A;  4HJ3 A;  2QMI A;  2INW A;  3RFB A;  5A92 A;  1KGE A;  4GD8 A;  1EWZ A;  2P9V A;  5IHV A;  3Q82 A;  5F69 A;  1IKI A;  2Y2P A;  1CEF A;  1PWG A;  1E3U A;  1MKI A;  4KQQ A;  1N9B A;  1FQG A;  4R3B A;  3Q7V A;  2DMW A;  1YM1 A;  2W3E A;  2ACG A;  4K0W A;  3ZVW A;  4EQI A;  2J80 A;  1V9Z A;  3LIA A;  1GHI A;  5EE8 A;  4S2P A;  3TRC A;  1LI0 A;  1FCO A;  4GKU A;  1LT0 A;  1RGY A;  5FAT A;  2ZM0 A;  2VV8 A;  4X25 A;  3C2W A;  2FZ0 A;  2XLN A;  1ZG6 A;  3GVB A;  4E6W A;  4HHD A;  1W8Y A;  2XEP A;  2W0N A;  4GB7 A;  1MWU A;  2P9V B;  4BEN A;  2KOI A;  5AQB A;  4L9F A;  1E25 A;  4ZJ2 A;  4X68 A;  4WEK A;  2V1A A;  2PHY A;  1KGG A;  3Q7V B;  2QKP A;  2I72 A;  4WZ5 C;  3SS5 A;  4I3A A;  2D02 A;  1LL8 A;  3LCE A;  3GRJ A;  3VE4 A;  3A3E A;  2ZQ8 A;  4KG6 A;  3IXH A;  2W3H A;  4ZJ1 A;  4WZ5 A;  3O88 A;  3Q1F A;  1YPR A;  2V1Z A;  2V9A A;  4XUZ A;  5FA7 A;  1DP6 A;  4X55 A;  4PAU A;  1TEM A;  3HJI A;  5EM1 A;  4JF4 A;  3N4I A;  4ID4 A;  3WS2 A;  5FQJ A;  1ONH A;  3HUM A;  4HI4 A;  5CHU A;  2JKT M;  1H8M A;  1XA1 A;  1LSV A;  4JGR A;  2K31 A;  5HDC A;  3UE6 A;  1L0F A;  3HLD A;  1K56 A;  2A24 B;  3C30 A;  3Q07 A;  5BOH A;  3BLM A;  5FQ9 A;  4S2N C;  3F1N B;  4WMC D;  3ZDJ A;  3TW8 A;  4G3W A;  1I2W A;  2QJ7 A;  1PZP A;  1YSP A;  3I7J A;  4NXE A;  2WZZ A;  4R3A A;  4S2N A;  3M6B A;  3D4F A;  4S2I A;  4LV0 A;  1BTL A;  1S67 L;  2JC7 A;  3LUQ A;  1KE3 A;  2OLV A;  2ZQ7 A;  3D3O A;  4NXG A;  3NDE A;  3SW1 A;  2PBY A;  3LIE A;  3FKV A;  1KDW A;  4MMN A;  3T4T A;  3MXQ A;  2C5W B;  2XDM A;  3DWK A;  3E4P A;  5E2F A;  3BEC A;  4ZBE A;  5HL6 A;  1ES3 A;  3KO6 A;  3HRE A;  4Y17 A;  3U4L P;  5M18 A;  3WS1 A;  4O01 A;  1VHM A;  3DTK A;  3C38 A;  4L0L A;  3TE8 A;  2WGV A;  2RL3 A;  3IWI A;  2FH5 A;  4K91 A;  3BQ8 A;  4QB8 A;  4S2K A;  3VV4 A;  2PU4 A;  2XD1 A;  2PBD P;  3NEC A;  4YWZ A;  2XRO A;  2H5S A;  1PIO A;  3SS3 A;  1BLP A;  4EU0 A;  5TJJ A;  1ZTU A;  2DCF A;  4DE3 A;  4RX2 A;  4EEP A;  3NOT C;  1JTG A;  3EGD C;  4E3K A;  1G6A A;  3QP6 A;  3TOI A;  3Q81 A;  4G3V A;  4DRT A;  3MZF A;  2X02 A;  3R7W B;  5FI2 A;  1BLH A;  4EER A;  5DKK A;  4KUO A;  3MQ0 A;  1IFQ A;  4E3N A;  4Y5F A;  1HZO A;  3NC8 A;  4UEY A;  5FQQ A;  2J3T C;  4RVA A;  2DNS A;  4KG2 A;  1N9O A;  3JYI A;  1PWC A;  4HBT A;  5FQK A;  1MWS A;  4P6Z S;  1H5X A;  1H0M A;  2Y2I A;  3FPV A;  4EBL A;  4ME4 A;  2EX8 A;  2KLI A;  1XFN A;  3ZQ5 A;  1M6K A;  3TSG A;  1NY0 A;  3G31 A;  1E4D A;  5DTT A;  1FR1 A;  3LEQ A;  3SH7 A;  1NWZ A;  4R3J A;  3MJQ A;  4EQ1 A;  3B47 A;  4LLO B;  5HWV A;  3BM6 A;  3PAE A;  4R38 A;  5J8X A;  3TJZ C;  3LYX A;  5FEF A;  4OH0 A;  3G6O A;  4HOI A;  2VK3 A;  4R0Q A;  3AGF A;  5HDD A;  3LR0 A;  4R6L A;  4MNR A;  2M1C A;  3OPP A;  2QZ6 A;  1UGU A;  3IWQ A;  3C7V A;  4E3M A;  1IYQ A;  2XD5 A;  3VP1 A;  4HH2 A;  1HD8 A;  2ZMA A;  1XJ4 A;  4IHQ A;  1PWD A;  4QJG A;  3MFD A;  5FAP A;  3BFD A;  4LCL A;  1U60 A;  3UE1 A;  3P7N A;  2EX6 A;  3E2K A;  1PW1 A;  5DF8 A;  3T1Q B;  1DP8 A;  2X01 A;  4LV3 A;  4IBR A;  3MKF A;  4N9K A;  4Z9Q A;  3EEA A;  1WE4 A;  3S4X A;  4WYY A;  3O86 A;  1JWP A;  3DTI A;  4A5R A;  3NOU C;  1QME A;  3G2Z A;  4I3I A;  2R9X A;  3LY3 A;  3QP4 A;  4ETX A;  1GA9 A;  5HZH A;  5A90 A;  4R4R A;  3IBJ A;  4Q0I A;  4RA7 A;  1DRM A;  2VKS A;  3FKW A;  1Y54 A;  5F1F A;  5L10 A;  4Y3I A;  5E2G A;  4WM9 A;  1EW0 A;  3M2K A;  1YLP A;  4R4S A;  1PFL A;  1XA7 A;  4R70 A;  4IBX A;  2ZC3 B;  1SZV A;  3UN7 A;  3UPP A;  5DF9 A;  4H6J B;  3ITB A;  1G28 A;  4QPR A;  5D3O A;  2LB9 A;  4KZA A;  4JXV A;  2ZC7 A;  3HUN A;  4Y0U A;  5FAQ A;  1STZ A;  3NHQ A;  2E8I A;  4OOM A;  2XFT A;  4Y0O A;  1K55 C;  2NUT C;  4BJP A;  3TG9 A;  1FSW A;  4U0T A;  1P0Z A;  4HQA A;  1K55 A;  4O7D A;  2ZQA A;  4KZ3 A;  4DJ2 A;  2Y55 A;  4LRX C;  1FIL A;  1PRQ A;  1MWR A;  4WBG A;  1YLJ A;  4DE0 A;  2XQZ A;  3CWF A;  1YLZ A;  1ZG4 A;  2B5R A;  5F83 A;  4JXW A;  4EES A;  2OSU A;  3GMW A;  4E3O A;  3OCL A;  1ALQ A;  4CLC C;  1Q2Q A;  4UQI M;  5CED A;  3C8C A;  1K57 C;  2EXA A;  4C6Y A;  5LBR A;  3UB5 P;  2KX6 A;  4CLC A;  1OJ5 A;  4HP9 A;  2GDN A;  1K57 A;  1LSW A;  3UO9 A;  4CPK A;  3A3J A;  4Y13 A;  3EGX C;  2VA0 A;  3F1O B;  2W3D A;  2EWV A;  1IYO A;  3ZGA B;  1TD5 A;  3UDI A;  1PYY A;  3IXD A;  4IJG A;  5EFW A;  3ZVT A;  5HAI A;  3H82 A;  3N6I A;  4PM5 A;  1RCJ A;  5F5Y A;  2WKQ A;  3F1P A;  3T1S A;  4E3I A;  2JE5 A;  3DWZ A;  1F5M A;  3HLE A;  1TF1 A;  4R23 A;  1IEM A;  3PHY A;  4BD1 A;  5HSQ A;  4CLC B;  2R9W A;  2Z6C A;  1ERO A;  2A49 A;  5GLC A;  4GCZ A;  4GHI A;  4JF6 A;  1FR6 A;  5E2H A;  4JPM A;  2Y2G A;  4BMW A;  3H7W A;  5KMW A;  3HLC A;  5GHY A;  3H82 B;  1K6S A;  1FCN A;  4P6Z M;  1IYP A;  1SDN A;  1I2S A;  2HJE A;  1XFQ A;  4MN6 A;  2XA7 M;  3FC7 A;  3UB6 A;  2O9A A;  1WYC A;  2VGK A;  5M19 A;  4MLL A;  1OJG A;  2PR6 A;  5FAO A;  5CHJ A;  3V39 A;  3E4Q A;  1NXY A;  4OPR A;  4WN5 A;  3V3R A;  3SS4 A;  3G35 A;  5HW3 A;  3ZYT A;  1L0G A;  3JVU A;  3LR4 A;  4GOG A;  4HH3 A;  3GR2 A;  4OPZ A;  3NDG A;  3H7W B;  1FSY A;  3WS0 A;  2XSS A;  3D9Y A;  2HDS A;  2L0W A;  3DBA A;  4JBF A;  2J8Y A;  1YLW A;  1KE4 A;  3HL9 A;  4N9L A;  3S7N A;  4C3Q A;  4E6X A;  4S2O A;  5TBM A;  2ZQC A;  2ZBB A;  3OZH A;  4B9O A;  4FOF A;  4D2O A;  2G2W A;  2PYR A;  3GSG A;  1W8Q A;  3KX0 X;  5EVE A;  2WKI A;  4P0M A;  1X0O A;  5DJU A;  3T4L A;  3KSG A;  1XGI A;  1ZKJ A;  3S7Q A;  1GSX A;  1MZU A;  4DMZ A;  2JKG A;  1NLY A;  1I5Q A;  3S22 A;  3ZNY A;  3LI9 A;  3MXS A;  4OP5 A;  4R1G A;  5HFO A;  4PPR A;  1LLB A;  1N9N A;  3LO7 A;  2VGL S;  4EBN A;  4I5S A;  3IF5 A;  1FIK A;  2ZL1 A;  4UA9 A;  5TBM B;  5KIZ A;  1ESI A;  5FDH A;  3BY8 A;  2HDU A;  2WK0 A;  2YKF A;  1AXB A;  4ETZ A;  4OQH A;  4KEN B;  4LEN A;  1UWN X;  4HBU A;  2W3G A;  2C6W B;  3T1X A;  2IWD A;  1J9M A;  3B3X A;  3VFF A;  2HP9 A;  4BBV A;  2D01 A;  2WKE A;  4KZB A;  3T1R A;  1S1Z A;  2G7U A;  2Y2K A;  3JVV A;  3QP5 A;  2H28 A;  4X53 A;  3LR3 A;  2ZMV A;  3Q7Z A;  4XXR A;  2XH9 A;  4JF5 A;  4HES A;  1TS7 A;  5G4Y A;  1SHV A;  2H0Y A;  2R78 A;  3A3F A;  3SH8 A;  3HJK A;  2BTF P;  1OTD A;  2ZM8 A;  4X56 A;  3OBF A;  4DXB A;  3A3D A;  4GD6 A;  1PNE A;  1O7E A;  2Z2M B;  3K2N A;  2H10 A;  4NEE D;  1S4S A;  1W63 Q;  4HNB A;  1EI5 A;  2B02 A;  1CI9 A;  3HLW A;  3UY6 A;  4KZ6 A;  5J4E A;  2ZOI A;  1H8Z A;  3MXR A;  2ZQD A;  3QHY A;  2JBF A;  1LSX A;  1SKF A;  5DF7 A;  2H0T A;  2JCH A;  4FUW A;  1W79 A;  3VE3 A;  3PAG A;  3IXG A;  1W5D A;  1YQS A;  2WAF A;  2KDK A;  3OC2 A;  3P01 A;  4HP4 A;  3RXW A;  3UME A;  3CUE C;  3IX4 A;  2Y2M A;  1XJ2 A;  3VOY A;  3LID A;  4WF0 A;  3CUE A;  3G30 A;  1M40 A;  4C75 A;  1JWZ A;  4XUX A;  3QNC A;  3PTE A;  3E2L A;  1S0W A;  3KYQ A;  3VP3 A;  1JNU A;  1OTE A;  3BJN A;  3PBR A;  1DJB A;  1TDL A;  4E04 A;  5L2F A;  1YLY A;  1BLC A;  5EVI C;  4NG2 A;  2HP5 A;  4NXB A;  1PI5 A;  3ITA A;  5EVI A;  2A3U A;  1P9R A;  3B33 A;  4OPY A;  3ZNT A;  2ZQ9 A;  1KGF A;  1E3U D;  4UA7 A;  3T4K A;  2X71 A;  2WYX A;  2FFY A;  1OTA A;  3ICY A;  3BFC A;  3BEB A;  4O8G A;  4DXC A;  5HD5 A;  3ZG7 B;  3BFF A;  1YT4 A;  2WAE A;  5KZH A;  3FPW A;  3OPL A;  3RTY A;  5GLA A;  2Y2O A;  3P98 A;  2WKP A;  4GW9 A;  5A93 A;  1T18 A;  3DTM A;  4LRZ E;  2DRW A;  2WZX A;  3IH8 A;  1CK3 A;  3WWX A;  2IWC A;  4N92 A;  1IEL A;  3LI8 A;  2OAQ 1;  5DTS A;  3N8S A;  5AVF A;  3IT9 A;  2Y59 A;  3UMD A;  5U47 A;  3RXX A;  5L07 A;  1MC0 A;  1CEG A;  2WKH A;  4KZ4 A;  4JXG A;  4YFM A;  5CGW A;  5JYP A;  2O9B A;  3MMH A;  1S66 L;  4Q8I A;  3WRT A;  3NOP C;  4MBH A;  3BQA A;  1ODV A;  2Z2L B;  1O07 A;  4EET B;  2V1B A;  1N4O A;  1SKO A;  2IA2 A;  1RP5 A;  3FG8 A;  4KUK A;  1H8Y A;  2Y2Q A;  3IS2 A;  1K56 D;  2HV1 A;  5IT5 A;  2ZLY A;  1F2K A;  3V67 A;  1OPX A;  3A3I A;  5DTK A;  4XT2 A;  3VP0 A;  1HVB A;  1TDG A;  1WA9 A;  4AFI A;  4KZ7 A;  1YKD A;  2E8J A;  1SCW A;  5HAR A;  1K25 A;  3KSH A;  5FDS A;  3G4P A;  1RGZ A;  2FFF B;  1YSQ A;  2O9C A;  5HPF A;  4KQR A;  2VGL M;  4DE1 A;  2XF3 A;  3UNW A;  3CJM A;  4FSF A;  4HJ4 A;  3IHB A;  1PI4 A;  4DDY A;  4PM6 A;  3QP8 A;  4BD0 A;  3RJU A;  4B93 A;  4ARZ A;  2Y2J A;  3HLG A;  5FI6 A;  3KYE A;  5JYO A;  3WRZ A;  4GJ4 A;  1XPB A;  4WEJ A;  4QU3 A;  4ESP A;  4WEL A;  1G5U A;  2GNX A;  1BUE A;  4S2M A;  4Q0H A;  3O87 A;  3CZD A;  3C5A A;  3IQA A;  5EM0 A;  2EFX A;  4BWI A;  3PBQ A;  4UHU A;  4QY6 A;  2JKR I;  2XR0 A;  3V5M A;  4QHC A;  2NUP C;  5CTN A;  1IKG A;  1YAX A;  4LV1 A;  2OWJ A;  2VGJ A;  3GV9 A;  4JLF A;  2GX5 A;  2BAS A;  1Z6F A;  4OQG A;  5AQ9 A;  5L8M A;  5A91 A;  3UPN A;  1ES2 A;  3HCY A;  5TR7 A;  3N7W A;  4L9G A;  5EOO A;  5CEC A;  5G18 A;  3T4Q A;  2V0W A;  3G2Y A;  2EX9 A;  1CJF A;  4PKY A;  1GSW A;  3W4O A;  4GN2 A;  4WMC A;  4YIN A;  3T50 A;  3E98 A;  2OLU A;  2HPB A;  3HBR A;  5CGX A;  4N1X A;  3O5Y A;  5HAP A;  5FEG A;  3PBT A;  4LFU A;  3LY4 A;  3LR5 A;  5CGS A;  2J3T D;  4UA6 A;  3CPT A;  3OLO A;  4RQ9 A;  1NRF A;  3PYP A;  3NCK A;  3S1Y A;  2RCX A;  1GCE A;  5E2E A;  3UE0 A;  4I39 A;  1VET A;  3UB7 A;  2HF6 A;  5C5K A;  1VQQ A;  3T4S A;  1AWI A;  2V0U A;  3OCN A;  4KZ9 A;  2O0Y A;  5AVE A;  3VSL A;  1NYM A;  3HLF A;  3HUO A;  3W8K A;  1LL5 A;  2JKF A;  3L7H A;  2GZA A;  4WL9 A;  2EWW A;  2B18 A;  4FCF A;  4RX3 A;  3MR0 A;  2CC1 A;  5HAQ A;  5HWW A;  3VMA A;  5I5L A;  5CX7 A;  4Z1W A;  2ZMF A;  4E3J A;  4G3K A;  2PDR A;  2QYB A;  3LIC A;  3CHW P;  1LL9 A;  4ZDX A;  4PM8 A;  2I9V A;  4S2L A;  4LV2 A;  3PBN A;  3O3V A;  4PHT A;  4X1M A;  1VET B;  5CHM A;  1FOF A;  3G34 A;  3F1P B;  1P9W A;  2PRF A;  3VP4 A;  4X6T A;  3MF0 A;  4OON A;  1D1J A;  1Y4O A;  3IF6 C;  2WGI A;  3BY9 A;  3NY4 A;  3W2Z A;  4DE2 A;  3QNB A;  1L0E A;  1TS6 A;  3LIF A;  5A8B A;  3IF6 A;  3MQO A;  4GHI B;  3AGD A;  5GLD A;  3FYZ A;  4P85 A;  5MC7 A;  3EOI A;  3UDX A;  3VFH A;  1KVM A;  4OPQ A;  4X1L A;  3UB9 A;  2OWH A;  4GLQ A;  1XX2 A;  4IVK A;  3NUL A;  4YOF A;  5HL1 A;  4ZJ3 A;  1LI9 A;  4OKP A;  1K0K A;  3OOV A;  3R4K A;  1VM1 A;  1ERM A;  3GDI A;  4EUZ A;  3KSF A;  4EUV A;  3A0S A;  4RYE A;  2PYP A;  4KZ5 A;  2Y91 A;  1K38 A;  3ZG0 A;  4KQO A;  2Y8H A;  3GEC A;  4QY5 A;  2VEA A;  3IF6 B;  1BYW A;  4OOL A;  2EA9 A;  4PM7 A;  4FH4 A;  3BFG A;  3ZFZ A;  2L1M A;  5GL9 A;  4P87 A;  2EX2 A;  4M4X A;  4OP8 A;  2P04 A;  3NBL A;  3VOZ A;  1UWP X;  1NZO A;  2K2N A;  2MJ6 A;  2QWS A;  4LCM A;  3CI6 A;  4JGP A;  4KZ8 A;  2P74 A;  4IED A;  3BWL A;  3IBR A;  2WKR A;  1QMF A;  3M2J A;  2A24 A;  1S6R A;  3JPU A;  1CQA A;  1ERQ A;  3F1N A;  4DJ3 A;  2A2L A;  3IXB A;  4MDZ A;  3ISG A;  4PMA A;  2P7J A;  5G4Z A;  2EFU A;  3QP2 A;  3MFX A;  5F68 A;  3NJA A;  5CRF A;  4HEF A;  1OTB A;  3AGE A;  1ZC2 A;  5L09 A;  2Y79 A;  2VV6 A;  1ACF A;  1TS8 A;  1NLZ A;  1PW8 A;  3A0V A;  4I38 A;  4X69 A;  1ZHH B;  4BL3 A;  1JTD A;  2YKH A;  4YNR A;  5CER A;  4I3J A;  1XXM A;  2ZL1 B;  2W1R A;  4EBP A;  1G68 A;  1T1C A;  1XJ6 A;  3DW0 A;  3P09 A; 
#chains in the Genus database with same CATH homology
 3WS4 A;  2WAD A;  3EQV A;  5A93 A;  2UWX A;  5DF9 A;  3DTM A;  2DRW A;  4EWF A;  3ITB A;  4GZB A;  2WZX A;  3IH8 A;  5D3O A;  4KZA A;  4JXV A;  2WGW A;  1CK3 A;  2ZC7 A;  3HUN A;  1K4E A;  3WWX A;  3VSK A;  2IWC A;  4Y0U A;  5FAQ A;  4N92 A;  1IEL A;  1PZO A;  5DTS A;  5F82 A;  1MWT A;  4OLG A;  4Y7P A;  2V2F F;  2E8I A;  4B4X A;  3N8S A;  4OOM A;  2XFT A;  1KDS A;  3PBS A;  4Y0O A;  5EEC A;  2IWB A;  1K55 C;  1XGJ A;  5CTM A;  4BJP A;  3IT9 A;  1XP4 A;  5FQI A;  2Y59 A;  2QMI A;  3TG9 A;  5U47 A;  3RXX A;  5A92 A;  1KGE A;  1FSW A;  4GD8 A;  1EWZ A;  4U0T A;  1CEG A;  2WKH A;  1YMS A;  2P9V A;  1BT5 A;  4JXG A;  4KZ4 A;  4YFM A;  5IHV A;  2HP6 A;  1MPL A;  3Q82 A;  5CGW A;  1IKI A;  2Y2P A;  5JYP A;  1CEF A;  1K55 A;  1K4F A;  2ZQA A;  4KZ3 A;  4O7D A;  5KSC A;  2Y55 A;  1PWG A;  1E3U A;  1MWR A;  4OQI A;  4WBG A;  4BL2 A;  1MKI A;  4KQQ A;  1N9B A;  1YLJ A;  1FQG A;  2XQZ A;  3WRT A;  4DE0 A;  4MBH A;  4R3B A;  2J7V A;  3Q7V A;  1YLZ A;  1ZG4 A;  1YM1 A;  4BQM A;  2B5R A;  4K0W A;  3ZVW A;  1XKZ A;  5F83 A;  4EQI A;  4JXW A;  2Z2L B;  1O07 A;  2OSU A;  3GMW A;  5AQ7 A;  4E3O A;  3FZC A;  1GHI A;  1ALQ A;  2WGW B;  3OCL A;  5EE8 A;  1Q2Q A;  4S2P A;  5CED A;  1K57 C;  1N4O A;  2EXA A;  4C6Y A;  4EV4 A;  1LI0 A;  1FCO A;  1RP5 A;  4BLM A;  4GKU A;  2V20 A;  1H8Y A;  2Y2Q A;  1RGY A;  3GTC A;  5FAT A;  2ZM0 A;  2ZJ9 A;  2XLN A;  2GDN A;  1ZG6 A;  1K56 D;  1K57 A;  5GLB A;  3UO9 A;  5TFQ A;  4CPK A;  3A3J A;  3GVB A;  3N8L A;  2ZLY A;  3A3I A;  5DTK A;  3VP0 A;  4E6W A;  4DKI A;  1HVB A;  1W8Y A;  2XEP A;  1TDG A;  2QPN A;  1IYO A;  4GB7 A;  1MWU A;  2P9V B;  4KZ7 A;  3V3S A;  4BEN A;  3ZGA B;  3UDF A;  5AQB A;  1SCW A;  5HAR A;  1E25 A;  4S2J A;  4X68 A;  4ZJ2 A;  4WEK A;  1BUL A;  4NET A;  1K25 A;  3UDI A;  1PYY A;  3OPR A;  3GQZ A;  3IXD A;  3ZG5 A;  3UPO A;  3G4P A;  5EOE A;  1KGG A;  1RGZ A;  2FFF B;  3Q7V B;  2I72 A;  4U0X A;  4WZ5 C;  3SS5 A;  3ZVT A;  4GDB A;  5HAI A;  3N6I A;  3LCE A;  3GRJ A;  4KQR A;  5HX9 A;  3A3E A;  3MBZ A;  4DE1 A;  1RCJ A;  2XF3 A;  4PM5 A;  2ZQ8 A;  4KG6 A;  3IXH A;  3C4P A;  3UNW A;  1HTZ A;  3CJM A;  4FSF A;  5CXW A;  4B4Z A;  3IHB A;  4E3I A;  1PI4 A;  4DDY A;  2JE5 A;  3DWZ A;  4ZJ1 A;  4WZ5 A;  3O88 A;  3HLE A;  3Q1F A;  4PM6 A;  2V1Z A;  4R23 A;  4XUZ A;  5FA7 A;  4X55 A;  2HDQ A;  1IEM A;  4BD1 A;  4DF6 A;  4BD0 A;  3V50 A;  2R9W A;  3RJU A;  1TEM A;  1ERO A;  4JF4 A;  2A49 A;  5GLC A;  3N4I A;  4ID4 A;  3WS2 A;  2Y2J A;  1SDE A;  5FQJ A;  1ONH A;  4JF6 A;  3HLG A;  5FI6 A;  3HUM A;  5CHU A;  5JYO A;  5EVL A;  3WRZ A;  1DY6 A;  1FR6 A;  1XA1 A;  2XGN A;  1XPB A;  4WEJ A;  5E2H A;  1BZA A;  2OV5 A;  4CJN A;  4JPM A;  1L0F A;  2Y2G A;  1K56 A;  3HLD A;  4QU3 A;  3Q07 A;  4WEL A;  5BOH A;  3BLM A;  5KMW A;  3ZCZ A;  1MY8 A;  5FQ9 A;  3HLC A;  4S2N C;  4WMC D;  3ZDJ A;  5FAS A;  5GHY A;  1BUE A;  1I2W A;  1K6S A;  1FCN A;  1PZP A;  1ES5 A;  1IYP A;  1SDN A;  1I2S A;  3I7J A;  4S2M A;  2WZZ A;  4S2N A;  1DJA A;  3M6B A;  5EVI B;  1WYC A;  3MZE A;  2VGK A;  3O87 A;  1YMX A;  3CZD A;  1BSG A;  5M19 A;  4MLL A;  5FAO A;  3C5A A;  3D4F A;  3IQA A;  5CHJ A;  3V39 A;  2EFX A;  4S2I A;  3ZHH A;  1K6R A;  1NXY A;  4LV0 A;  4OPR A;  1BTL A;  3PBQ A;  2JC7 A;  4UHU A;  4QY6 A;  3BLS A;  2XR0 A;  3V3R A;  3V5M A;  4F94 A;  5GHZ A;  3SS4 A;  4QHC A;  1KE3 A;  4IVI A;  4B88 A;  2Y4A A;  2OLV A;  2ZQ7 A;  2Q9M A;  3G35 A;  3NDE A;  5HW3 A;  1L0G A;  5CTN A;  4GOG A;  2PBY A;  1IKG A;  3GR2 A;  4LV1 A;  4OPZ A;  3FKV A;  2VGJ A;  4Y0T A;  2ZC4 B;  3IH9 A;  1KDW A;  3NDG A;  1FSY A;  3GV9 A;  4JLF A;  3WS0 A;  1Z6F A;  4OQG A;  5AQ9 A;  2C5W B;  5A91 A;  1CI8 A;  4H8R A;  2XDM A;  1ONG A;  3UPN A;  3DWK A;  1ES2 A;  5TR7 A;  3N7W A;  5EOO A;  3NIA A;  2HDS A;  5TGF A;  5E2F A;  3BRM A;  4OVD A;  3HLB A;  5G18 A;  5CEC A;  4JBF A;  3BEC A;  2J8Y A;  4ZBE A;  3G2Y A;  1YLW A;  4QD4 A;  2EX9 A;  4Q8I A;  1KE4 A;  1ES3 A;  3HL9 A;  4N9L A;  3HRE A;  1DJC A;  4C3Q A;  3ZG8 B;  1W7F A;  3W4O A;  4E6X A;  4GN2 A;  4S2O A;  5M18 A;  1KE0 A;  4WMC A;  4YIN A;  2ZQC A;  1FCM A;  3WS1 A;  3OZH A;  4E3L A;  4D2O A;  4L0L A;  2G2W A;  2OLU A;  2J9P A;  4OQ0 A;  2HPB A;  3HBR A;  3SH9 A;  3GSG A;  1W8Q A;  2WGV A;  2RL3 A;  1TVF A;  5CGX A;  4ZTK A;  2XFS A;  3W4P A;  3IWI A;  4N1X A;  5HAP A;  3PBT A;  4K91 A;  3IWO A;  3IHA A;  2WKI A;  3LY4 A;  4QB8 A;  5CGS A;  4P0M A;  4UA6 A;  4S2K A;  2PU4 A;  2XD1 A;  1XGI A;  1NRF A;  1ZKJ A;  3SOI A;  2H5S A;  1PIO A;  1GHM A;  1LHY A;  3SS3 A;  4FD8 A;  3NCK A;  3FWL A;  3S1Y A;  1BLP A;  4P6B A;  3VP2 A;  2RCX A;  3LEZ A;  1GCE A;  5E2E A;  1I5Q A;  2DCF A;  2PU2 A;  3HVF A;  3M6H A;  3S22 A;  3UE0 A;  3ZNY A;  3MXS A;  3OPH A;  4DE3 A;  4OP5 A;  2ZC6 B;  5FQM A;  4RX2 A;  4R1G A;  4JKT A;  5HFO A;  1JTG A;  1VQQ A;  3NI9 A;  4PPR A;  1LLB A;  1G6A A;  4E3K A;  3LO7 A;  4EBN A;  3IF5 A;  3OCN A;  4KZ9 A;  3TOI A;  3VSL A;  1NYM A;  3MZD A;  4UA9 A;  3HLF A;  3HUO A;  3W8K A;  1ESI A;  2ZC5 B;  1LL5 A;  1C3B A;  5FDH A;  2HDU A;  3Q81 A;  2WK0 A;  1Q2P A;  4DRT A;  1AXB A;  3MZF A;  4FCF A;  4KEN B;  4OQH A;  4LEN A;  4RX3 A;  2X02 A;  2CC1 A;  5HAQ A;  5FI2 A;  1WYB A;  1K54 C;  1BLH A;  3VMA A;  5KSH A;  4HBU A;  2C6W B;  4E3J A;  4JXS A;  2IWD A;  4PM9 A;  1J9M A;  4E3N A;  3B3X A;  1HZO A;  1JWV A;  1K54 A;  3NC8 A;  3UE3 A;  5FQQ A;  3VFF A;  2HP9 A;  1LL9 A;  4RVA A;  2WKE A;  2DNS A;  3BYD A;  4ZDX A;  1MXO A;  4KZB A;  4PM8 A;  2Y2K A;  4KG2 A;  4S2L A;  4LV2 A;  3PBN A;  3O3V A;  3MKE A;  3JYI A;  4X53 A;  5CHM A;  4ZAM A;  1FOF A;  1PWC A;  3G34 A;  4HBT A;  4XXR A;  3Q7Z A;  3VP4 A;  5FQK A;  5I94 A;  4X6T A;  2Y2H A;  1MWS A;  2XH9 A;  4JF5 A;  2ZD8 A;  4OON A;  1H5X A;  2Y2I A;  4HES A;  3IF6 C;  2WGI A;  3CG5 A;  1SHV A;  3NY4 A;  2H0Y A;  3ZG9 B;  5DVA A;  4WZ4 A;  4DE2 A;  3QNB A;  4EBL A;  1MBL A;  3A3F A;  2EX8 A;  3SH8 A;  1L0E A;  5AQA A;  1YLT A;  3IF6 A;  2ZM2 A;  2ZM8 A;  1M6K A;  3AGD A;  3TSG A;  5GLD A;  4X56 A;  1NY0 A;  3FYZ A;  4P85 A;  4DXB A;  2BLS A;  3A3D A;  3G31 A;  4GD6 A;  1E4D A;  1NZU A;  5DTT A;  1FR1 A;  1O7E A;  1KVM A;  4GDN A;  5EUA A;  3SH7 A;  3UDX A;  3VFH A;  3C4O A;  4OPQ A;  2Z2M B;  4R3J A;  2H10 A;  1XX2 A;  1EI5 A;  4IVK A;  4OLD A;  1CI9 A;  5M1A A;  3HLW A;  4ZJ3 A;  1L2S A;  3CMZ A;  5HL1 A;  1LI9 A;  4OKP A;  3UY6 A;  4KZ6 A;  4FH2 A;  3BM6 A;  1H8Z A;  3PAE A;  3MXR A;  2J9O A;  2ZQD A;  3G32 A;  2JBF A;  3QHY A;  5J8X A;  1ESU A;  3WS5 A;  1GA0 A;  4UAA A;  1VM1 A;  1ERM A;  1SKF A;  5DF7 A;  4OH0 A;  4EUZ A;  2H0T A;  4K0X A;  4R0Q A;  2JCH A;  3AGF A;  4RYE A;  4KZ5 A;  4DDS A;  5EVI D;  1W79 A;  3PAG A;  2Y91 A;  1K38 A;  3ZG0 A;  3IXG A;  4KQO A;  4MNR A;  3OPP A;  2QZ6 A;  4QY5 A;  1W5D A;  1YQS A;  2WAF A;  3IWQ A;  3C7V A;  4E3M A;  1BLS A;  1KVL A;  3IF6 B;  1IYQ A;  4OOL A;  2XD5 A;  3EQU A;  3OC2 A;  3VP1 A;  4PM7 A;  1HD8 A;  4U3T A;  2ZMA A;  3W4Q A;  4NK3 A;  4FH4 A;  3BFG A;  3RXW A;  4MEZ A;  1PWD A;  2G2U A;  3ZFZ A;  4QJG A;  4GNU A;  5GL9 A;  3MFD A;  5FAP A;  5FSR A;  5E43 A;  3BFD A;  4LCL A;  2Y2M A;  4P87 A;  2EX2 A;  3PBO A;  4M3K A;  4OP8 A;  1U60 A;  2XK1 A;  3NBL A;  2WUQ A;  3UE1 A;  3VOZ A;  3VOY A;  2EX6 A;  3E2K A;  1PW1 A;  5DF8 A;  2X01 A;  4LV3 A;  4IBR A;  1NZO A;  3MKF A;  4N9K A;  4Z9Q A;  4LCM A;  3N8R A;  3G30 A;  1M40 A;  1WE4 A;  4C75 A;  4KZ8 A;  1JWZ A;  3S4X A;  1NYY A;  4WYY A;  3O86 A;  4XUX A;  1ES4 A;  2P74 A;  2EXB A;  3QNC A;  1L0D A;  3E2L A;  3PTE A;  1JWP A;  1S0W A;  4IED A;  3VP3 A;  1JVJ A;  1QMF A;  3M2J A;  4A5R A;  3PBR A;  1OME A;  1DJB A;  2BG1 A;  5CEB A;  1TDL A;  5L2F A;  2Q9N A;  1QME A;  1YLY A;  1S6R A;  3G2Z A;  1ERQ A;  1BLC A;  5GHX A;  5EVI C;  2R9X A;  3LY3 A;  1GHP A;  2HP5 A;  1PI5 A;  2Y2N A;  1GA9 A;  3IXB A;  4N1H A;  3ISG A;  4PMA A;  5A90 A;  4R4R A;  3ITA A;  4OOY A;  5EVI A;  2A3U A;  2EFU A;  4RA7 A;  4OPY A;  3FKW A;  3ZNT A;  5CRF A;  1Y54 A;  5F1F A;  4HEF A;  2ZQ9 A;  3AGE A;  1KGF A;  1ZC2 A;  3C7U A;  1E3U D;  4UA7 A;  2HDR A;  2X71 A;  5EPH A;  2WYX A;  5E2G A;  2FFY A;  4WM9 A;  1NJ4 A;  1PW8 A;  2Y2L A;  3FV7 A;  5F1G A;  3BFC A;  4X69 A;  3BEB A;  3BFE A;  3M2K A;  4DXC A;  4BL3 A;  1YLP A;  1JTD A;  4MBF A;  4R4S A;  5FI7 A;  3ZG7 B;  5CER A;  1XA7 A;  3BFF A;  1YT4 A;  2WAE A;  4IBX A;  1XXM A;  5KZH A;  2ZC3 B;  1IYS A;  3OPL A;  4EBP A;  1G68 A;  4MBK A;  3UN7 A;  3DW0 A;  2Y2O A;  5GLA A;  3P98 A;  3P09 A;  4KG5 A;  3UPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...