3E2LA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 260
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2lA00
1ERMA 2RL3A 4BQMA 4UA9A 5A91A 3NDGA 3GTCA 1L0GA 2V1ZA 3UNWA 3E2LA 5FQ9A 4WYYA 5DTSA 2IWDA 5FAQA 5KSCA 2J9OA 4JXSA 2EX9A 4NK3A 4S2NA 3WRTA 2V20A 2Y2GA 3SS5A 1PI4A 1YMSA 4HBTA 4PM8A 1DJBA 1NZUA 4A5RA 1BLSA 4OQ0A 2WADA 5FQJA 4DE3A 4FCFA 4BL3A 1LI9A 1K57C 2H0YA 4KG5A 4C6YA 1KGGA 2XD5A 4KZ3A 1NZOA 1M6KA 3P98A 3RJUA 1SDNA 4QD4A 5CTNA 3DW0A 2PBYA 2G2WA 4KG2A 3VSKA 3HLWA 4UA7A 4KZ4A 3HLCA 2JCHA 3NCKA 1ZG4A 4CJNA 2EXAA 1FOFA 3M6BA 1BULA 4GOGA 4LV2A 5CRFA 3RXXA 4E3NA 3SOIA 3C5AA 4NETA 4WEKA 1NY0A 4PM7A 3Q07A 3VFHA 5AQBA 2XFTA 2ZQCA 5E2HA 4R3JA 1G68A 1N9BA 2Y2NA 1CEGA 2Y59A 1SCWA 2H5SA 3QHYA 2XEPA 2ZQ8A 3BFDA 3NDEA 4IVIA 3IT9A 4UA6A 4Q8IA 1K25A 3WRZA 1XGJA 4QHCA 4R23A 3N8LA 4GZBA 3G34A 2XQZA 1L0EA 2ZC6B 3IF6C 5EPHA 3A3IA 5EVIA 4DE1A 1GHPA 3GQZA 3SS4A 1OMEA 4DE0A 4LCMA 4OPYA 2XDMA 5CEDA 1ZG6A 1XGIA 2HDUA 5EUAA 1K6RA 3W4PA 3MKFA 4WELA 5F83A 1Y54A 2HP6A 4IBRA 1KDWA 1HTZA 3OCNA 4FD8A 3BFFA 1ONGA 1K54C 4DF6A 4Y0TA 3SH8A 5EVLA 4EUZA 4EWFA 2Y2PA 1CI9A 3O3VA 5A93A 3ZNYA 5FI2A 2Y4AA 1MWSA 1DJAA 1S6RA 2Y91A 1JWZA 5I94A 3G32A 5U47A 3N8RA 4RX2A 3C7VA 5HFOA 2WGWB 3UE0A 4OOYA 1DY6A 3LCEA 2EFUA 2GDNA 4L0LA 3HREA 2WZZA 4RVAA 3ZG5A 4K0WA 4WM9A 3O88A 4GB7A 5F1FA 2ZJ9A 4MEZA 2ZC3B 5E2FA 4E6XA 1E3UA 1ZKJA 4P87A 3TOIA 1ERQA 4DDYA 5TR7A 1N4OA 2ZLYA 4HESA 4BJPA 4X53A 1JWVA 4WZ5C 3CJMA 3N6IA 5FQQA 1NYMA 1PW8A 4PM9A 2ZQAA 3TG9A 5FQIA 5TFQA 3BLMA 3FKWA 1JWPA 3MXRA 1XXMA 5IHVA 3VP1A 3A3DA 5HW3A 4S2JA 4JF5A 2ZC4B 2Q9MA 4JXWA 4YINA 4OH0A 3A3JA 1JVJA 1Z6FA 2VGKA 4S2KA 2QMIA 4E3KA 3ITBA 3BLSA 3BM6A 5DF7A 4GD6A 3HUOA 2BLSA 4IVKA 3D4FA 1KE3A 1BSGA 3UO9A 3WS4A 1BT5A 4PM5A 4EBPA 4GNUA 4OPRA 4S2NC 3JYIA 4JLFA 1MXOA 5CGSA 3HLDA 4ZDXA 3W4QA 5EE8A 3C4OA 1IYOA 4HEFA 2A49A 5F82A 1RP5A 4OPZA 3DWZA 3GSGA 4B4XA 1PYYA 2JBFA 2PU4A 3ISGA 4IEDA 1J9MA 1I2SA 1YLWA 4EBLA 2HP9A 4KZBA 1WYCA 3UPNA 2OV5A 1H8ZA 4WMCA 1JTDA 1DJCA 1K4FA 2Y2LA 1RGZA 5GHYA 3WS1A 4X68A 3SH9A 5AQ7A 5HAQA 3UE3A 1KGEA 3FWLA 2WYXA 5CXWA 5GL9A 3LY4A 2XFSA 3A3FA 3OPHA 5EVID 4CPKA 1K38A 2Y2MA 2WKIA 5CGXA 3MZFA 3HLGA 4JPMA 1IYPA 1YLYA 3UDIA 1W79A 1U60A 4LCLA 1W5DA 3V3SA 3IXDA 3FYZA 1K4EA 4R4SA 5M1AA 1BLHA 4S2OA 2Y2KA 1CK3A 1L2SA 1AXBA 3ZVWA 3HUMA 5FA7A 2FFYA 3E2KA 1NYYA 1RCJA 4OOLA 1Q2QA 2VGJA 5EOOA 3ZG0A 1H8YA 5HAIA 2WGIA 3G2YA 5AQAA 3SH7A 5FDHA 4Y0OA 5D3OA 4JKTA 2V2FF 4OOMA 2BG1A 4Z9QA 3CZDA 1GHIA 1YLTA 4C75A 4N1XA 1I5QA 1ONHA 4JXVA 1VM1A 1KE0A 4RA7A 3IXHA 3PBTA 4E3LA 1E3UD 2HP5A 3GV9A 3IHAA 4QU3A 5FATA 5M18A 3NI9A 3BFCA 4WZ4A 1XA7A 3NBLA 4LV0A 3VOZA 5KSHA 4DKIA 1KGFA 2ZQDA 1FCOA 4X6TA 1BUEA 1EWZA 1PI5A 2OLVA 2DRWA 2WGWA 2XF3A 4UAAA 3N4IA 2QPNA 4X55A 1IYSA 4GD8A 5JYOA 3ZG9B 3CG5A 4DXBA 2ZQ7A 1K57A 5FASA 3PBSA 1W8YA 3WS2A 3EQUA 1CI8A 4BENA 4DE2A 3QNBA 1EI5A 5CEBA 4FH4A 4RYEA 3BFEA 3O87A 3ZDJA 4E3IA 5KZHA 3V50A 4OP5A 4BL2A 4LV1A 3BFGA 3UPPA 4QB8A 2XR0A 2Q9NA 2Y2OA 3GVBA 4BLMA 3IF5A 4S2IA 5DTKA 1TDLA 3PBRA 4U3TA 3VP4A 3WS5A 3MFDA 3FZCA 1QMEA 5E2GA 1BLCA 5GLAA 1GHMA 3BECA 3QNCA 4FSFA 5HARA 4K91A 3C7UA 4OQIA 1FCNA 3G2ZA 4WMCD 4GKUA 4RX3A 3W4OA 5FQKA 1MY8A 4B88A 1PWCA 2DNSA 4OLGA 1Q2PA 4N9LA 2EFXA 1NRFA 4PPRA 5EECA 3GR2A 3Q7ZA 4OONA 5FI6A 1K56A 2XD1A 4JXGA 5FSRA 4GDBA 5E2EA 3IWIA 1BZAA 5TGFA 2G2UA 4QJGA 2FFFB 3NIAA 3B3XA 3VP3A 2Z2MB 3AGFA 4XXRA 2EX2A 4K0XA 1HD8A 2JE5A 1IELA 3IQAA 4ZBEA 2XH9A 3UN7A 4ZJ1A 4OKPA 4DXCA 3BRMA 1FSYA 1YLZA 1GA9A 4P6BA 2WAFA 3IHBA 4R3BA 5CECA 3GMWA 5CGWA 5CTMA 1QMFA 1K55C 1HZOA 3SS3A 5A92A 4KG6A 1K54A 3ZHHA 1EROA 3Q82A 1C3BA 3HL9A 1GA0A 1YQSA 4OQHA 2HDRA 2WAEA 3LEZA 3HUNA 3ZNTA 3IXGA 3Q7VA 5CHUA 1RGYA 3HLEA 4OVDA 2XGNA 2CC1A 3ZG8B 2HPBA 1E4DA 4KZ8A 2Z2LB 1ES5A 3DTMA 3VP0A 2PU2A 3UE1A 3M2KA 1JTGA 3IF6B 3PBOA 3Q1FA 4KZAA 3IXBA 2XLNA 4GN2A 4P0MA 1ES3A 3VOYA 4PM6A 5DTTA 4O7DA 5E43A 1NJ4A 3UY6A 3V3RA 2H10A 4LV3A 1CEFA 3PAGA 2ZMAA 5DF9A 3M6HA 4WZ5A 3VMAA 2QZ6A 2WZXA 3MBZA 2E8IA 5CERA 3IH9A 2ZM2A 4R1GA 4EBNA 2X01A 3CMZA 1KVLA 1MKIA 5DF8A 3EQVA 4KZ7A 4MLLA 5AQ9A 4M3KA 3VSLA 1XA1A 2WK0A 3Q7VB 3LY3A 1MPLA 1MWUA 1O7EA 1SDEA 4N9KA 2EXBA 4ZJ2A 3OPLA 4N1HA 4S2PA 1S0WA 1TEMA 3G31A 3PBNA 2UWXA 2DCFA 4U0XA 1LI0A 2WUQA 2ZC5B 4ZTKA 4MBFA 5CHJA 3ZVTA 4BD1A 2Y2JA 4FH2A 5M19A 3MXSA 4KZ5A 4MBKA 1L0FA 3MZDA 1ES4A 1W7FA 5EVIC 1PZOA 1XPBA 3BYDA 4JBFA 1LL9A 1YT4A 2Y2QA 5GLCA 3OPPA 5BOHA 3P09A 4R4RA 2P9VB 1MWRA 1IKIA 4GDNA 2Y2IA 3HBRA 1KE4A 1L0DA 3VFFA 1K6SA 4E6WA 1PW1A 1PZPA 3NC8A 3OC2A 3OZHA 3IWOA 5EOEA 3HLBA 5FAPA 3WWXA 4OP8A 4KQRA 5F1GA 1K56D 3HLFA 4EQIA 2ZM0A 2H0TA 2IWCA 2ZC7A 5FQMA 3W8KA 3Q81A 3OPRA 5FI7A 1I2WA 3MZEA 1G6AA 5GLBA 1NXYA 4KQQA 3BEBA 2J8YA 1FR6A 2C5WB 3N8SA 2WKHA 1LL5A 2X71A 4OLDA 2RCXA 4KENB 4ID4A 1YLPA 4WEJA 1XP4A 1PWDA 4XUXA 5HAPA 1IEMA 2J9PA 4HBUA 3ZGAB 4ZAMA 1WE4A 1XX2A 3A3EA 3AGDA 2Y55A 3TSGA 2X02A 1IYQA 2EX6A 4P85A 4Y7PA 5FAOA 1ESIA 3M2JA 2XK1A 3UDXA 2EX8A 1IKGA 1KVMA 3UPOA 4E3MA 3MKEA 3FV7A 3S4XA 1FCMA 4X56A 5G18A 4B4ZA 1H5XA 2HDQA 3C4PA 5CHMA 3UDFA 2C6WB 2IWBA 5GHXA 2Y2HA 4Y0UA 3OCLA 1FSWA 3G4PA 3N7WA 1MWTA 4DRTA 2I72A 3DWKA 1BTLA 3IWQA 3ZCZA 1PWGA 3S1YA 3IF6A 3RXWA 4YFMA 3PAEA 5L2FA 1VQQA 3V39A 5KMWA 3IH8A 4D2OA 4KZ9A 1ALQA 4IBXA 5EVIB 4EV4A 4C3QA 1SHVA 4KZ6A 5HL1A 1LLBA 2WKEA 2A3UA 3WS0A 1FQGA 2OLUA 2JC7A 5A90A 1O07A 1ES2A 4X69A 5HX9A 4JF6A 1M40A 3HVFA 4H8RA 3GRJA 1FR1A 4U0TA 2HDSA 4WBGA 1YM1A 4LENA 3ZG7B 4F94A 4KQOA 2B5RA 4S2MA 1TVFA 3G35A 3ITAA 1TDGA 3O86A 4OQGA 4OPQA 2J7VA 4JF4A 1ZC2A 4XUZA 1W8QA 4MBHA 1BLPA 1LHYA 3PBQA 1PIOA 1YLJA 1SKFA 1KDSA 5GHZA 2WGVA 4QY5A 2ZD8A 2R9WA 3PTEA 3VP2A 2ZM8A 2R9XA 4R0QA 4S2LA 4BD0A 4E3OA 5GLDA 3LO7A 4PMAA 1E25A 1XKZA 2OSUA 3S22A 4E3JA 4QY6A 3ZFZA 3G30A 1MBLA 4DDSA 5J8XA 2P9VA 3NY4A 1GCEA 3I7JA 4N92A 1WYBA 2ZQ9A 4ZJ3A 1ESUA 5JYPA 3FKVA 3V5MA 1YMXA 5DVAA 3AGEA 2P74A 4UHUA 4MNRA 1HVBA 1K55A
chains in the Genus database with same CATH superfamily
2CMNA 3E2LA 2J3TD 5KSCA 2EX9A 4HJ4A 5HDCA 4BBUA 2Y2GA 3IBRA 1BLSA 1NWZA 4DE3A 4BL3A 1VETB 3VV4A 4DJ3A 1SDNA 4UA7A 1AWIA 3HLCA 4KZ4A 1G28A 3NCKA 4E3NA 1BULA 2KOIA 4WEKA 4PM7A 3T1XA 5AQBA 4BBTA 2Y59A 1W63Q 2PYRA 4R23A 1L0EA 3H9WA 4DE0A 1OMEA 2JN7A 1K6RA 3MKFA 1Y54A 3T4KA 4IBRA 1OJ5A 4Y0TA 5EVLA 1CI9A 2Y91A 5U47A 4K08A 3C7VA 5J3WA 1DY6A 2WZZA 4WM9A 3O88A 5F1FA 5F6AA 4MEZA 4LPZA 4EU0A 1ZKJA 4P87A 2JKTM 3MR0A 4HESA 3NOTC 1XFQA 4KUKA 1JWVA 4WLAA 3N6IA 2ZQAA 4HI4A 1XJ2A 3TG9A 1MKMA 1Y28A 4S2JA 1S4SA 1OPXA 1JVJA 1Z6FA 2KX6A 3LIDA 3BM6A 2M7VA 4IVKA 1KE3A 1CQAA 3KO6A 3R7WA 3EOIA 3TW8A 3E98A 2I9VA 5CGSA 3EGDC 1RP5A 3DWZA 2UV0E 3GSGA 3ISGA 3LR4A 1J9MA 3UPNA 5HSQA 2OV5A 1K4FA 4H6JB 5HAQA 4X68A 3SH9A 1KGEA 3FWLA 2XFSA 5EVID 4CPKA 5F69A 1K38A 2WKIA 3ULFA 3MZFA 4JPMA 1W79A 1KOUA 1W5DA 3V3SA 1K4EA 2Y2KA 1CK3A 3KSHA 4HJ6A 5L8MA 1NYYA 1RCJA 5EOOA 4IUHA 1H8YA 2HZ5A 5AQAA 3SH7A 1F98A 4Y0OA 4O01A 2BG1A 2O9AA 2Q0OA 4JXVA 4BWIA 3IXHA 3IHAA 3QP4A 4WZ4A 1XA7A 2HJ9C 1KGFA 1PI5A 5HPFA 2XF3A 3A0VA 1IYSA 4GD8A 5JYOA 3ZG9B 1K57A 1W8YA 3WS2A 3EQUA 3VOLA 1YSQA 3RTYA 4FH4A 1F2KA 3O87A 2JKRM 4BL2A 4LV1A 2P7JA 3CPTB 3GVBA 2A2LA 2QWSA 3BQAA 3WS5A 3FZCA 1GHMA 4UQIM 2VV6A 5FDSA 3C7UA 1FCNA 3W4OA 2DNSA 5FSRA 4OONA 5E2EA 1BZAA 5TGFA 3H82B 4QJGA 3AGFA 1IELA 1H8MA 3BRMA 1YLZA 4WN5A 4P6BA 3IHBA 4R3BA 5CECA 5CTMA 1TS0A 5CGWA 3SS3A 4KG6A 3ZHHA 1EROA 3Q82A 1C3BA 3LR5A 2HDRA 3HUNA 4R6LA 1RGYA 4OVDA 3ZG8B 3R4KA 1ES5A 3UE1A 4X1LA 1JTGA 3IF6B 3PBOA 3Q1FA 5E43A 2H10A 2NUTC 3DTEA 4WZ5A 2QZ6A 3MBZA 2JHEA 5CERA 1ODVA 3IH9A 5TBMB 2X01A 1KVLA 3HCYA 3UMEA 2ZMVA 3EQVA 4KZ7A 5AQ9A 3VSLA 3HJKA 1MPLA 1MWUA 1T1BA 3SZTA 5DKLA 2Y79A 1TEMA 3G31A 2DCFA 5J4EA 3A0SA 3UE6A 2W3GA 5CHJA 4BD1A 1NLZA 1L0FA 5EVIC 1LL9A 1YT4A 2J3WA 3OPPA 2QHKA 1MWRA 2Y2IA 3HBRA 4RQ9A 3LI8A 3NC8A 4EW7A 5EOEA 3HLBA 4L9GA 4CLCA 3OPRA 1OTIA 1K0KA 3N8SA 2WKHA 2X71A 5HAPA 1IEMA 4R70A 3ZGAB 3KYQA 4DMZA 2INWA 3MQOA 4P85A 2XK1A 5HWVA 3VE4A 3MKEA 2HDQA 5CHMA 2Z6DA 4Y0UA 2PR5A 3G4PA 3K3DA 1MWTA 4DRTA 2I72A 3DWKA 1BTLA 5DKKA 1PWGA 5L2FA 1VQQA 3IH8A 4D2OA 4KZ9A 5EVIB 4EV4A 4C3QA 2VA0A 4KZ6A 4NKPA 3U4LP 3LEQA 4IUKA 4X69A 4JF6A 5HWWA 3CITA 1SZVA 3GRJA 2G7UA 1P0ZA 3LR3A 1YM1A 3ITAA 3T4OA 4I3IA 3IBJA 3OLOA 1ZC2A 4XUZA 4MBHA 4EETB 1KDSA 2ZL1B 2R9WA 4R0QA 1J3WA 5GLDA 2GNXA 4PMAA 1E25A 1XKZA 3S22A 2P9VA 3I7JA 1WYBA 1BYWA 1YMXA 1HVBA 5HPIA 4M4XA 1ERMA 2RL3A 5K5BA 4UA9A 5A91A 2L4RA 1VEUB 3ZYTA 2J9OA 4JXSA 4NK3A 3WRTA 2V20A 1PI4A 4A5RA 4OQ0A 2WADA 4FCFA 1UGUA 4KG5A 1KGGA 2XD5A 4KZ3A 1NZOA 2W3EA 1PFLA 5CTNA 3DW0A 4KG2A 1P9RA 2JCHA 4G3WA 2EXAA 4LV2A 2KDKA 3KSGA 4NETA 3F1NA 3VFHA 2XFTA 2ZQCA 4R3JA 3RH8B 1YAXA 3BJNA 2ZQ8A 3NDEA 2QJ7A 4WF0A 4Q8IA 1K25A 2FZ0A 4QHCA 4B93A 3G34A 5EPHA 2W3HA 1GHPA 4LCMA 2PBDP 2XDMA 1XGIA 2HDUA 5HD3A 5L10A 4WELA 2HF6A 3OCNA 5DJUA 3H7WA 1K54C 4LFUA 3SH8A 2Y2PA 3O3VA 2OAQ1 4EEUA 2PAVP 2HV1A 3E4OA 1JWZA 4L9FA 5I94A 4RX2A 4O8GA 4OOYA 3ZG5A 2EFUA 2GDNA 3HREA 4RVAA 4GB7A 2VKSA 4Q0HA 2ZJ9A 1TF1A 2ZC3B 1E3UA 1ERQA 4DDYA 1UWNX 3SW1A 1OT9A 5FQQA 3LIEA 1NYMA 4QPRA 1DP8A 3HJIA 5TFQA 1DP6A 1JWPA 3QP1A 2Q9MA 4EERA 4YINA 4S2KA 3T50A 2QMIA 3QP6A 4GD6A 3HUOA 3UO9A 3WS4A 4GNUA 4D60A 4OPRA 4FUWA 1MXOA 5FL3A 2JBFA 4IEDA 3G6OA 5AJGA 4MCWA 1JTDA 1DJCA 2HJEA 2Y2LA 1RGZA 5AQ7A 2WKQA 2ACGA 4LRZE 2VGLS 2Y2MA 2O9BA 1IYPA 1YLYA 2PHYA 4LCLA 1Z09A 3FYZA 4LLOB 4O0PA 4OOLA 5DFXA 1Q2QA 2VGJA 1V9YA 2WGIA 3G2YA 1ZHHB 4JKTA 2V2FF 4OOMA 1GHIA 4GHIB 1P97A 1D06A 1VM1A 1W63M 3FPWA 3UB7A 4LV0A 5KSHA 2ZQDA 2PR6A 4YWZA 2OLVA 2WGWA 3N4IA 1CJFA 4WL9A 2GZAA 1VHMA 3F1OA 3LFVA 2EA9A 1CI8A 4BENA 3QNBA 5CEBA 4RYEA 3BFEA 3IX3A 5KZHA 2Y2OA 1MZUA 4S2IA 1TDLA 1SKOB 1PNEA 1QMEA 5E2GA 1BLCA 4WUJA 3QNCA 5HARA 4OQIA 1WA9A 4B88A 1PWCA 4OLGA 2EFXA 1NRFA 4PPRA 3CUEC 3Q7ZA 3CWFA 1K56A 2XD1A 2G2UA 4MMNA 4HHDA 3B3XA 2ZMFA 2EX2A 4K0XA 3IQAA 4DXCA 1FSYA 2P08A 5A92A 3EEAA 4GS9B 1OTAA 1JNUA 4ARZB 2WAEA 3LEZA 2VEAA 2WKRA 3HLEA 2V9AA 3F1PA 4YOFA 3DTMA 4I5SA 2PU2A 2A24A 3M2KA 4KZAA 2QJ5A 3ICYA 2XLNA 3IXBA 4GN2A 4HNBA 3VOYA 5DTTA 3VE3A 3V3RA 4LV3A 1CEFA 5DF9A 3VMAA 4BBVA 2E8IA 4PAUA 4EBNA 2BTFP 3U2AA 2XA7M 2OAP1 3EGXC 4HH2A 2MJ6A 2WK0A 1O7EA 1SDEA 4N9KA 2EXBA 1OTBA 3C38A 3OPLA 2V0WA 4S2PA 1S0WA 3PBNA 1LI0A 4MBFA 3TE8A 2J3TC 3MZDA 1W7FA 1PZOA 1XPBA 4IHQA 4R4RA 3OBFA 5HWTA 1K6SA 4E6WA 1PZPA 1S1YA 5F1GA 2W3DA 2ZM0A 5FQMA 3Q81A 2IA2A 2K7SA 5FI7A 1FIKA 2QYBA 3K2NA 3MZEA 3LI9A 4ZRRA 1FR6A 4KENB 4ID4A 1YLPA 4WEJA 1XP4A 4XUXA 3QP8A 2J9PA 4HBUA 3AGDA 2D01A 4HQAA 3TSGA 2X02A 3CHWP 1IYQA 2E8JA 5FAOA 3NHQA 1XJ3A 2EX8A 2B02A 4E3MA 3S4XA 1FCMA 3C4PA 1IOUA 2C6WB 3IS2A 3T1SA 1FSWA 3N7WA 2W1TB 3IWQA 3RXWA 3PAEA 4EESA 1TS8A 3V39A 5KMWA 3KYEA 4Q0JA 2K2NA 4P6ZM 2WKEA 3WS0A 1LL8A 2YKHA 1M40A 5FEGA 1FR1A 4WBGA 3ZG7B 3E4QA 2B5RA 3O86A 3MSHA 1TDGA 4OQGA 5CX7A 4OPQA 3P01A 3PBQA 1YLJA 4QY5A 3PTEA 2JKTI 2ZM8A 4CLCD 4L9EA 2W0NA 4R38A 4S2LA 4BD0A 4E3OA 3LO7A 4X25A 3K3CA 4E3JA 2VK3A 3ZFZA 3G30A 5J8XA 3S7OA 1T1CA 4DJ2A 4ZJ3A 1ESUA 5EFWA 5DVAA 4Z1WA 3JPUA 2P74A 4UHUA 4MNRA 4B4XA 1K55A 3NDGA 3GTCA 2V1ZA 5FQ9A 5DTSA 5FAQA 5G4YA 3R7WB 1YMSA 2PDRA 4HBTA 1Y4OA 2P04A 1K57C 3IX8A 4NG2A 4UQIS 2EWWA 4GJ4A 1S1ZA 3RJUA 3VSKA 2PBYA 2G2WA 3T4SA 3HLWA 4ETXA 4CJNA 3M6BA 3SOIA 3C5AA 1NY0A 1G68A 1N9BA 3EEHA 1CEGA 1SCWA 2XEPA 1D1JA 4YNRA 4IVIA 3IT9A 1NLYA 3UB6A 3N8LA 4JGQA 2XQZA 2ZC6B 2PRFA 3A3IA 3MXQA 3SS4A 1NRJA 4OPYA 5CEDA 5EUAA 4FOFA 4CLCE 3BFFA 4DF6A 4EWFA 2W27A 3NOUC 2Y4AA 1MWSA 1DJAA 1S6RA 3G32A 3N8RA 2EWVA 3LCEA 4K0WA 3D3OA 4E6XA 3TOIA 3S7NA 4XT2B 5TR7A 1N4OA 2ZLYA 4X53A 4F3LA 4WZ5C 4PM9A 1HLUP 3FKWA 2JKRI 2L1MA 1XXMA 3VP1A 5FEFA 2ZC4B 3KSFA 4OH0A 4ME4A 2VGKA 4E3KA 1P9WA 3ITBA 3BLSA 1UWPX 2BLSA 3D4FA 4PM5A 1BSGA 1BT5A 4EBPA 3JYIA 3HLDA 4ZDXA 5EE8A 4GCZA 1IYOA 1VETA 2A49A 5F82A 2VX8A 2D02A 3C30A 4NXGA 2HP9A 4KZBA 1WYCA 1H8ZA 4WMCA 2V8CA 5GHYA 3UB5P 3UE3A 2WYXA 4CLCC 3LY4A 3OPHA 2ZOHA 5DJTA 3BWLA 4MN7A 3UDIA 3IXDA 3GECA 4R4SA 5M1AA 5G4ZA 1L2SA 4PKYA 3HUMA 5FA7A 2FFYA 3E2KA 3ZG0A 3FG8A 5HAIA 4B9OA 3DTKA 1YPRA 3S7QA 3C8CA 1S66L 4G3VA 5D3OA 4Z9QA 3CZDA 4C75A 4N1XA 1ONHA 1KE0A 4E3LA 4Y15A 1E3UD 2KLIA 5FATA 4QU3A 3PYPA 3BFCA 3NBLA 2OOLA 5F68A 1FCOA 4X6TA 3T4JA 4FTXA 1FILA 4NEED 3CG5A 4DXBA 3PBSA 3NECA 3OOVA 4HP4A 3MF0A 3BFGA 3UB9A 1XFNA 2OWJA 4GW9A 4QB8A 4BLMA 2Q9NA 5A8BA 3IF5A 2B95A 3MFDA 4CLCB 5GLAA 3BECA 4FSFA 4UEYA 4GKUA 5FQKA 3T1RA 1Q2PA 4N9LA 3GR2A 4JXGA 3IWIA 5I5LA 2FFFB 4IJGA 1HD8A 3KYZA 3IX4A 3UN7A 4ZJ1A 1ACFA 3D72A 4H6JA 1GA9A 2WAFA 3LICA 1HZOA 3HL9A 1YQSA 4OQHA 3TJZC 1E4DA 2Z2LB 3VP0A 3NULA 4PM6A 1X0OA 1NJ4A 3UY6A 3M6HA 3W2ZA 2WZXA 3T1QB 1MKIA 5DF8A 2B18A 2O9CA 4M3KA 1N9OA 3BY9A 3Q7VB 3LY3A 3T4QA 4N1HA 3BW6A 2WUQA 2ZC5B 4ZTKA 3ZVTA 5DFYA 3MXSA 4KZ5A 3CI6A 3MFXA 4JBFA 2Y2QA 5GLCA 3E4PA 5BOHA 3B42A 3P09A 2VV8A 2P9VB 1IKIA 3L9KA 4GDNA 1KE4A 3VFFA 3C2WA 3OC2A 3CPTA 3D9YA 5FAPA 3WWXA 3BY8A 1K56D 1OTEA 4EQIA 2ZC7A 3KSIA 1G6AA 4KQQA 2J8YA 2C5WB 2J80A 4OLDA 1STZA 2H28A 4PHTA 2W1TA 3LYXA 3NOPC 4ZAMA 1XX2A 3A3EA 3DTIA 3H82A 2EX6A 3B47A 4Y7PA 1ESIA 3UDXA 1KVMA 4DN0A 3UPOA 1OTDA 4Y13A 3FV7A 4B4ZA 4X56A 1H5XA 3UDFA 3CAXA 2IWBA 3OCLA 1TS6A 3F1NB 2XROA 5HZHA 3ZCZA 3IF6A 2W3FA 1GSVA 3E0YA 2LB5A 5C5KA 3MQQA 1XJ6A 4IBXA 3FC7A 5HL1A 3S7PA 2A3UA 5TBMA 3LR0A 1EW0A 2JC7A 1ES2A 4QWOA 4R3AA 4H8RA 4U0TA 3MJQA 3H7WB 2QKPA 1LSVA 4KQOA 4S2MA 1TVFA 4KUOA 1D7EA 1W8QA 1BLPA 4G3KA 5EM1A 1SKFA 5GHZA 2WGVA 2ZD8A 4CQHA 2R9XA 1MBLA 4JGOA 1GCEA 2AVXA 4HP9A 4N92A 5JYPA 3FKVA 4BQMA 4LGWA 2V8FA 3L7HA 1XJ4A 1L0GA 3UNWA 4WYYA 2IWDA 4S2NA 5AVFA 2WKPA 3SS5A 4PM8A 1DJBA 1NZUA 5FQJA 1LI9A 2H0YA 4C6YA 2JKFA 5HL6A 1M6KA 3P98A 4QD4A 5AVEA 1ZG4A 3RXXA 1FOFA 4GOGA 5CRFA 3MMHA 3ZQ5A 1ZTUA 3Q07A 5F5YA 5E2HA 2Y2NA 3LIFA 4HH3A 2H5SA 3QHYA 2GJ3A 3BFDA 4EXOA 4UA6A 3WRZA 3BQ8A 1XGJA 4GZBA 3IF6C 4DE1A 5EVIA 3GQZA 1H3QA 3PR6A 1V9ZA 1ZG6A 4XT2A 3LGOA 3W4PA 3JVUA 5F83A 2HP6A 3CLOA 1KDWA 1HTZA 4FD8A 1ONGA 4EUZA 5A93A 3ZNYA 5FI2A 3PHYA 5HFOA 2K31A 2WGWB 4Y5FA 3UE0A 3V67A 2XA7S 4L0LA 2ZL1A 5L09A 4EQ1A 5E2FA 2ZOIA 4BJPA 3F1OB 3O5YA 5HDSA 3CJMA 1OT6A 1PW8A 3MQ0A 2GX5A 5FQIA 3BLMA 2VV7A 3MXRA 2R78A 4Y17A 5IHVA 2XSSA 3A3DA 5HW3A 4JF5A 4JXWA 3A3JA 1VEUA 4MN5A 5DF7A 3B33A 4LRXC 4HOIA 4NXBA 4S2NC 4JLFA 3W4QA 3C4OA 4HEFA 4OPZA 1PYYA 1DP9A 2PU4A 4EBLA 1I2SA 1YLWA 1GSWA 5LBRA 1LSWA 3WS1A 1LSXA 5CXWA 5GL9A 1F9IA 3A3FA 4NXFA 5EVEA 5CGXA 3HLGA 3GDIA 1U60A 2LB9A 3F1PB 1BLHA 2A24B 4S2OA 3DAVA 1AXBA 4JGPA 3ZVWA 1MC0A 5FDHA 4MN6A 1YLTA 1I5QA 4RA7A 5HDDA 3PBTA 5EM0A 2HP5A 3GV9A 5M18A 4LRYC 3NI9A 3MS6A 3VOZA 4EEPA 4DKIA 1G5UA 4P6ZS 1T19A 1BUEA 1EWZA 1OJGA 2DRWA 3LIAA 4UAAA 5TJJA 2QPNA 4X55A 2HGVA 4E04A 1N9NA 2ZQ7A 2ZBBA 5FASA 4DE2A 1EI5A 5L07A 3ZDJA 4E3IA 3V50A 4OP5A 3UPPA 2XR0A 5DTKA 3PBRA 3T4LA 4U3TA 3VP4A 3LUQA 2XRNA 2M1CA 4K91A 3G2ZA 4HJ3A 4WMCD 2O0YA 4RX3A 1GSXA 1MY8A 2L0WA 1CF0A 5J7EA 5EECA 5FI6A 4GDBA 2V1AA 5HD5A 3NIAA 3VP3A 2Z2MB 4XXRA 4MDZA 5MC7A 2JE5A 4ZBEA 2XH9A 4OKPA 1G6OA 3GMWA 3DBAA 1QMFA 1K55C 1K54A 1GA0A 3IS2B 3ZNTA 1T1AA 3IXGA 3Q7VA 1N9LA 5CHUA 2XGNA 2CC1A 3JVVA 3T12B 2HPBA 4KZ8A 4BMWA 1L3LA 4P0MA 5IU1A 1ES3A 4O7DA 3PAGA 2ZMAA 2PD8A 2ZM2A 4R1GA 3CMZA 4GHIA 2OWHA 3T4TA 1DRMA 4MLLA 1XA1A 4HY8A 4AFIA 4ZJ2A 4ETZA 2UWXA 4U0XA 4JGRA 1LT0A 4Y3IA 2Y2JA 4FH2A 5M19A 4Q0IA 4MBKA 4HIAA 1ES4A 1PRQA 2YKFA 3LIBA 3BYDA 2PYPA 4I39A 3UB8A 1L0DA 1PW1A 3OZHA 3RFBA 3IWOA 4OP8A 4KQRA 2V0UA 3HLFA 1SKOA 2H0TA 2IWCA 2Z6CA 3W8KA 4Y2FA 1I2WA 2VLGA 2VZWA 5GLBA 1NXYA 3BEBA 1H0MA 1LL5A 5IS1A 2RCXA 1PWDA 1WE4A 2O99A 2VGLM 2Y55A 1TD5A 3QP2A 3M2JA 1A0KA 1IKGA 3KX0X 1IFQA 4KQDA 5G18A 4GS9A 4I38A 5KIZA 4EUVA 5GHXA 2Y2HA 3QP5A 4PKYG 4ARZA 1YSPA 3TRCA 3S1YA 3NJAA 1TS7A 1T18A 4I3AA 4YFMA 1ALQA 4GLQA 3FPVA 1SHVA 1YKDA 4I3JA 1LLBA 1FQGA 2OLUA 5A90A 1F5MA 1O07A 4II7A 5HX9A 3HVFA 2HDSA 2NUPC 4LENA 4F94A 4X1MA 2JKGA 3G35A 1VB6A 4NXEA 3A0RA 3UMDA 1S67L 2DMWA 2J7VA 2PD7A 4JF4A 4ESPA 3P7NA 2PT7A 1LHYA 1PIOA 5EV0A 3VP2A 3CUEA 2VJWA 2OSUA 4QY6A 4F3LB 3EWKA 4DDSA 3NY4A 2W1RA 3PXPA 5IT5A 2BASA 2FH5A 2ZQ9A 3V5MA 2V1BA 2M7UA 3AGEA 1S4RA 2Y8HA
chains in the Genus database with same CATH topology
1ERMA 2RL3A 4BQMA 4UA9A 5A91A 3NDGA 3GTCA 1L0GA 2V1ZA 3UNWA 3E2LA 5FQ9A 4WYYA 5DTSA 2IWDA 5FAQA 5KSCA 2J9OA 4JXSA 2EX9A 4NK3A 4S2NA 3WRTA 2V20A 2Y2GA 3SS5A 1PI4A 1YMSA 4HBTA 4PM8A 1DJBA 1NZUA 4A5RA 1BLSA 4OQ0A 2WADA 5FQJA 4DE3A 4FCFA 4BL3A 1LI9A 1K57C 2H0YA 4KG5A 4C6YA 1KGGA 2XD5A 4KZ3A 1NZOA 1M6KA 3P98A 3RJUA 1SDNA 4QD4A 5CTNA 3DW0A 2PBYA 2G2WA 4KG2A 3VSKA 3HLWA 4UA7A 4KZ4A 3HLCA 2JCHA 3NCKA 1ZG4A 4CJNA 2EXAA 1FOFA 3M6BA 1BULA 4GOGA 4LV2A 5CRFA 3RXXA 4E3NA 3SOIA 3C5AA 4NETA 4WEKA 1NY0A 4PM7A 3Q07A 3VFHA 5AQBA 2XFTA 2ZQCA 5E2HA 4R3JA 1G68A 1N9BA 2Y2NA 1CEGA 2Y59A 1SCWA 2H5SA 3QHYA 2XEPA 2ZQ8A 3BFDA 3NDEA 4IVIA 3IT9A 4UA6A 4Q8IA 1K25A 3WRZA 1XGJA 4QHCA 4R23A 3N8LA 4GZBA 3G34A 2XQZA 1L0EA 2ZC6B 3IF6C 5EPHA 3A3IA 5EVIA 4DE1A 1GHPA 3GQZA 3SS4A 1OMEA 4DE0A 4LCMA 4OPYA 2XDMA 5CEDA 1ZG6A 1XGIA 2HDUA 5EUAA 1K6RA 3W4PA 3MKFA 4WELA 5F83A 1Y54A 2HP6A 4IBRA 1KDWA 1HTZA 3OCNA 4FD8A 3BFFA 1ONGA 1K54C 4DF6A 4Y0TA 3SH8A 5EVLA 4EUZA 4EWFA 2Y2PA 1CI9A 3O3VA 5A93A 3ZNYA 5FI2A 2Y4AA 1MWSA 1DJAA 1S6RA 2Y91A 1JWZA 5I94A 3G32A 5U47A 3N8RA 4RX2A 3C7VA 5HFOA 2WGWB 3UE0A 4OOYA 1DY6A 3LCEA 2EFUA 2GDNA 4L0LA 3HREA 2WZZA 4RVAA 3ZG5A 4K0WA 4WM9A 3O88A 4GB7A 5F1FA 2ZJ9A 4MEZA 2ZC3B 5E2FA 4E6XA 1E3UA 1ZKJA 4P87A 3TOIA 1ERQA 4DDYA 5TR7A 1N4OA 2ZLYA 4HESA 4BJPA 4X53A 1JWVA 4WZ5C 3CJMA 3N6IA 5FQQA 1NYMA 1PW8A 4PM9A 2ZQAA 3TG9A 5FQIA 5TFQA 3BLMA 3FKWA 1JWPA 3MXRA 1XXMA 5IHVA 3VP1A 3A3DA 5HW3A 4S2JA 4JF5A 2ZC4B 2Q9MA 4JXWA 4YINA 4OH0A 3A3JA 1JVJA 1Z6FA 2VGKA 4S2KA 2QMIA 4E3KA 3ITBA 3BLSA 3BM6A 5DF7A 4GD6A 3HUOA 2BLSA 4IVKA 3D4FA 1KE3A 1BSGA 3UO9A 3WS4A 1BT5A 4PM5A 4EBPA 4GNUA 4OPRA 4S2NC 3JYIA 4JLFA 1MXOA 5CGSA 3HLDA 4ZDXA 3W4QA 5EE8A 3C4OA 1IYOA 4HEFA 2A49A 5F82A 1RP5A 4OPZA 3DWZA 3GSGA 4B4XA 1PYYA 2JBFA 2PU4A 3ISGA 4IEDA 1J9MA 1I2SA 1YLWA 4EBLA 2HP9A 4KZBA 1WYCA 3UPNA 2OV5A 1H8ZA 4WMCA 1JTDA 1DJCA 1K4FA 2Y2LA 1RGZA 5GHYA 3WS1A 4X68A 3SH9A 5AQ7A 5HAQA 3UE3A 1KGEA 3FWLA 2WYXA 5CXWA 5GL9A 3LY4A 2XFSA 3A3FA 3OPHA 5EVID 4CPKA 1K38A 2Y2MA 2WKIA 5CGXA 3MZFA 3HLGA 4JPMA 1IYPA 1YLYA 3UDIA 1W79A 1U60A 4LCLA 1W5DA 3V3SA 3IXDA 3FYZA 1K4EA 4R4SA 5M1AA 1BLHA 4S2OA 2Y2KA 1CK3A 1L2SA 1AXBA 3ZVWA 3HUMA 5FA7A 2FFYA 3E2KA 1NYYA 1RCJA 4OOLA 1Q2QA 2VGJA 5EOOA 3ZG0A 1H8YA 5HAIA 2WGIA 3G2YA 5AQAA 3SH7A 5FDHA 4Y0OA 5D3OA 4JKTA 2V2FF 4OOMA 2BG1A 4Z9QA 3CZDA 1GHIA 1YLTA 4C75A 4N1XA 1I5QA 1ONHA 4JXVA 1VM1A 1KE0A 4RA7A 3IXHA 3PBTA 4E3LA 1E3UD 2HP5A 3GV9A 3IHAA 4QU3A 5FATA 5M18A 3NI9A 3BFCA 4WZ4A 1XA7A 3NBLA 4LV0A 3VOZA 5KSHA 4DKIA 1KGFA 2ZQDA 1FCOA 4X6TA 1BUEA 1EWZA 1PI5A 2OLVA 2DRWA 2WGWA 2XF3A 4UAAA 3N4IA 2QPNA 4X55A 1IYSA 4GD8A 5JYOA 3ZG9B 3CG5A 4DXBA 2ZQ7A 1K57A 5FASA 3PBSA 1W8YA 3WS2A 3EQUA 1CI8A 4BENA 4DE2A 3QNBA 1EI5A 5CEBA 4FH4A 4RYEA 3BFEA 3O87A 3ZDJA 4E3IA 5KZHA 3V50A 4OP5A 4BL2A 4LV1A 3BFGA 3UPPA 4QB8A 2XR0A 2Q9NA 2Y2OA 3GVBA 4BLMA 3IF5A 4S2IA 5DTKA 1TDLA 3PBRA 4U3TA 3VP4A 3WS5A 3MFDA 3FZCA 1QMEA 5E2GA 1BLCA 5GLAA 1GHMA 3BECA 3QNCA 4FSFA 5HARA 4K91A 3C7UA 4OQIA 1FCNA 3G2ZA 4WMCD 4GKUA 4RX3A 3W4OA 5FQKA 1MY8A 4B88A 1PWCA 2DNSA 4OLGA 1Q2PA 4N9LA 2EFXA 1NRFA 4PPRA 5EECA 3GR2A 3Q7ZA 4OONA 5FI6A 1K56A 2XD1A 4JXGA 5FSRA 4GDBA 5E2EA 3IWIA 1BZAA 5TGFA 2G2UA 4QJGA 2FFFB 3NIAA 3B3XA 3VP3A 2Z2MB 3AGFA 4XXRA 2EX2A 4K0XA 1HD8A 2JE5A 1IELA 3IQAA 4ZBEA 2XH9A 3UN7A 4ZJ1A 4OKPA 4DXCA 3BRMA 1FSYA 1YLZA 1GA9A 4P6BA 2WAFA 3IHBA 4R3BA 5CECA 3GMWA 5CGWA 5CTMA 1QMFA 1K55C 1HZOA 3SS3A 5A92A 4KG6A 1K54A 3ZHHA 1EROA 3Q82A 1C3BA 3HL9A 1GA0A 1YQSA 4OQHA 2HDRA 2WAEA 3LEZA 3HUNA 3ZNTA 3IXGA 3Q7VA 5CHUA 1RGYA 3HLEA 4OVDA 2XGNA 2CC1A 3ZG8B 2HPBA 1E4DA 4KZ8A 2Z2LB 1ES5A 3DTMA 3VP0A 2PU2A 3UE1A 3M2KA 1JTGA 3IF6B 3PBOA 3Q1FA 4KZAA 3IXBA 2XLNA 4GN2A 4P0MA 1ES3A 3VOYA 4PM6A 5DTTA 4O7DA 5E43A 1NJ4A 3UY6A 3V3RA 2H10A 4LV3A 1CEFA 3PAGA 2ZMAA 5DF9A 3M6HA 4WZ5A 3VMAA 2QZ6A 2WZXA 3MBZA 2E8IA 5CERA 3IH9A 2ZM2A 4R1GA 4EBNA 2X01A 3CMZA 1KVLA 1MKIA 5DF8A 3EQVA 4KZ7A 4MLLA 5AQ9A 4M3KA 3VSLA 1XA1A 2WK0A 3Q7VB 3LY3A 1MPLA 1MWUA 1O7EA 1SDEA 4N9KA 2EXBA 4ZJ2A 3OPLA 4N1HA 4S2PA 1S0WA 1TEMA 3G31A 3PBNA 2UWXA 2DCFA 4U0XA 1LI0A 2WUQA 2ZC5B 4ZTKA 4MBFA 5CHJA 3ZVTA 4BD1A 2Y2JA 4FH2A 5M19A 3MXSA 4KZ5A 4MBKA 1L0FA 3MZDA 1ES4A 1W7FA 5EVIC 1PZOA 1XPBA 3BYDA 4JBFA 1LL9A 1YT4A 2Y2QA 5GLCA 3OPPA 5BOHA 3P09A 4R4RA 2P9VB 1MWRA 1IKIA 4GDNA 2Y2IA 3HBRA 1KE4A 1L0DA 3VFFA 1K6SA 4E6WA 1PW1A 1PZPA 3NC8A 3OC2A 3OZHA 3IWOA 5EOEA 3HLBA 5FAPA 3WWXA 4OP8A 4KQRA 5F1GA 1K56D 3HLFA 4EQIA 2ZM0A 2H0TA 2IWCA 2ZC7A 5FQMA 3W8KA 3Q81A 3OPRA 5FI7A 1I2WA 3MZEA 1G6AA 5GLBA 1NXYA 4KQQA 3BEBA 2J8YA 1FR6A 2C5WB 3N8SA 2WKHA 1LL5A 2X71A 4OLDA 2RCXA 4KENB 4ID4A 1YLPA 4WEJA 1XP4A 1PWDA 4XUXA 5HAPA 1IEMA 2J9PA 4HBUA 3ZGAB 4ZAMA 1WE4A 1XX2A 3A3EA 3AGDA 2Y55A 3TSGA 2X02A 1IYQA 2EX6A 4P85A 4Y7PA 5FAOA 1ESIA 3M2JA 2XK1A 3UDXA 2EX8A 1IKGA 1KVMA 3UPOA 4E3MA 3MKEA 3FV7A 3S4XA 1FCMA 4X56A 5G18A 4B4ZA 1H5XA 2HDQA 3C4PA 5CHMA 3UDFA 2C6WB 2IWBA 5GHXA 2Y2HA 4Y0UA 3OCLA 1FSWA 3G4PA 3N7WA 1MWTA 4DRTA 2I72A 3DWKA 1BTLA 3IWQA 3ZCZA 1PWGA 3S1YA 3IF6A 3RXWA 4YFMA 3PAEA 5L2FA 1VQQA 3V39A 5KMWA 3IH8A 4D2OA 4KZ9A 1ALQA 4IBXA 5EVIB 4EV4A 4C3QA 1SHVA 4KZ6A 5HL1A 1LLBA 2WKEA 2A3UA 3WS0A 1FQGA 2OLUA 2JC7A 5A90A 1O07A 1ES2A 4X69A 5HX9A 4JF6A 1M40A 3HVFA 4H8RA 3GRJA 1FR1A 4U0TA 2HDSA 4WBGA 1YM1A 4LENA 3ZG7B 4F94A 4KQOA 2B5RA 4S2MA 1TVFA 3G35A 3ITAA 1TDGA 3O86A 4OQGA 4OPQA 2J7VA 4JF4A 1ZC2A 4XUZA 1W8QA 4MBHA 1BLPA 1LHYA 3PBQA 1PIOA 1YLJA 1SKFA 1KDSA 5GHZA 2WGVA 4QY5A 2ZD8A 2R9WA 3PTEA 3VP2A 2ZM8A 2R9XA 4R0QA 4S2LA 4BD0A 4E3OA 5GLDA 3LO7A 4PMAA 1E25A 1XKZA 2OSUA 3S22A 4E3JA 4QY6A 3ZFZA 3G30A 1MBLA 4DDSA 5J8XA 2P9VA 3NY4A 1GCEA 3I7JA 4N92A 1WYBA 2ZQ9A 4ZJ3A 1ESUA 5JYPA 3FKVA 3V5MA 1YMXA 5DVAA 3AGEA 2P74A 4UHUA 4MNRA 1HVBA 1K55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERM A;  2RL3 A;  4BQM A;  4UA9 A;  5A91 A;  3NDG A;  3GTC A;  1L0G A;  2V1Z A;  3UNW A;  3E2L A;  5FQ9 A;  4WYY A;  5DTS A;  2IWD A;  5FAQ A;  5KSC A;  2J9O A;  4JXS A;  2EX9 A;  4NK3 A;  4S2N A;  3WRT A;  2V20 A;  2Y2G A;  3SS5 A;  1PI4 A;  1YMS A;  4HBT A;  4PM8 A;  1DJB A;  1NZU A;  4A5R A;  1BLS A;  4OQ0 A;  2WAD A;  5FQJ A;  4DE3 A;  4FCF A;  4BL3 A;  1LI9 A;  1K57 C;  2H0Y A;  4KG5 A;  4C6Y A;  1KGG A;  2XD5 A;  4KZ3 A;  1NZO A;  1M6K A;  3P98 A;  3RJU A;  1SDN A;  4QD4 A;  5CTN A;  3DW0 A;  2PBY A;  2G2W A;  4KG2 A;  3VSK A;  3HLW A;  4UA7 A;  4KZ4 A;  3HLC A;  2JCH A;  3NCK A;  1ZG4 A;  4CJN A;  2EXA A;  1FOF A;  3M6B A;  1BUL A;  4GOG A;  4LV2 A;  5CRF A;  3RXX A;  4E3N A;  3SOI A;  3C5A A;  4NET A;  4WEK A;  1NY0 A;  4PM7 A;  3Q07 A;  3VFH A;  5AQB A;  2XFT A;  2ZQC A;  5E2H A;  4R3J A;  1G68 A;  1N9B A;  2Y2N A;  1CEG A;  2Y59 A;  1SCW A;  2H5S A;  3QHY A;  2XEP A;  2ZQ8 A;  3BFD A;  3NDE A;  4IVI A;  3IT9 A;  4UA6 A;  4Q8I A;  1K25 A;  3WRZ A;  1XGJ A;  4QHC A;  4R23 A;  3N8L A;  4GZB A;  3G34 A;  2XQZ A;  1L0E A;  2ZC6 B;  3IF6 C;  5EPH A;  3A3I A;  5EVI A;  4DE1 A;  1GHP A;  3GQZ A;  3SS4 A;  1OME A;  4DE0 A;  4LCM A;  4OPY A;  2XDM A;  5CED A;  1ZG6 A;  1XGI A;  2HDU A;  5EUA A;  1K6R A;  3W4P A;  3MKF A;  4WEL A;  5F83 A;  1Y54 A;  2HP6 A;  4IBR A;  1KDW A;  1HTZ A;  3OCN A;  4FD8 A;  3BFF A;  1ONG A;  1K54 C;  4DF6 A;  4Y0T A;  3SH8 A;  5EVL A;  4EUZ A;  4EWF A;  2Y2P A;  1CI9 A;  3O3V A;  5A93 A;  3ZNY A;  5FI2 A;  2Y4A A;  1MWS A;  1DJA A;  1S6R A;  2Y91 A;  1JWZ A;  5I94 A;  3G32 A;  5U47 A;  3N8R A;  4RX2 A;  3C7V A;  5HFO A;  2WGW B;  3UE0 A;  4OOY A;  1DY6 A;  3LCE A;  2EFU A;  2GDN A;  4L0L A;  3HRE A;  2WZZ A;  4RVA A;  3ZG5 A;  4K0W A;  4WM9 A;  3O88 A;  4GB7 A;  5F1F A;  2ZJ9 A;  4MEZ A;  2ZC3 B;  5E2F A;  4E6X A;  1E3U A;  1ZKJ A;  4P87 A;  3TOI A;  1ERQ A;  4DDY A;  5TR7 A;  1N4O A;  2ZLY A;  4HES A;  4BJP A;  4X53 A;  1JWV A;  4WZ5 C;  3CJM A;  3N6I A;  5FQQ A;  1NYM A;  1PW8 A;  4PM9 A;  2ZQA A;  3TG9 A;  5FQI A;  5TFQ A;  3BLM A;  3FKW A;  1JWP A;  3MXR A;  1XXM A;  5IHV A;  3VP1 A;  3A3D A;  5HW3 A;  4S2J A;  4JF5 A;  2ZC4 B;  2Q9M A;  4JXW A;  4YIN A;  4OH0 A;  3A3J A;  1JVJ A;  1Z6F A;  2VGK A;  4S2K A;  2QMI A;  4E3K A;  3ITB A;  3BLS A;  3BM6 A;  5DF7 A;  4GD6 A;  3HUO A;  2BLS A;  4IVK A;  3D4F A;  1KE3 A;  1BSG A;  3UO9 A;  3WS4 A;  1BT5 A;  4PM5 A;  4EBP A;  4GNU A;  4OPR A;  4S2N C;  3JYI A;  4JLF A;  1MXO A;  5CGS A;  3HLD A;  4ZDX A;  3W4Q A;  5EE8 A;  3C4O A;  1IYO A;  4HEF A;  2A49 A;  5F82 A;  1RP5 A;  4OPZ A;  3DWZ A;  3GSG A;  4B4X A;  1PYY A;  2JBF A;  2PU4 A;  3ISG A;  4IED A;  1J9M A;  1I2S A;  1YLW A;  4EBL A;  2HP9 A;  4KZB A;  1WYC A;  3UPN A;  2OV5 A;  1H8Z A;  4WMC A;  1JTD A;  1DJC A;  1K4F A;  2Y2L A;  1RGZ A;  5GHY A;  3WS1 A;  4X68 A;  3SH9 A;  5AQ7 A;  5HAQ A;  3UE3 A;  1KGE A;  3FWL A;  2WYX A;  5CXW A;  5GL9 A;  3LY4 A;  2XFS A;  3A3F A;  3OPH A;  5EVI D;  4CPK A;  1K38 A;  2Y2M A;  2WKI A;  5CGX A;  3MZF A;  3HLG A;  4JPM A;  1IYP A;  1YLY A;  3UDI A;  1W79 A;  1U60 A;  4LCL A;  1W5D A;  3V3S A;  3IXD A;  3FYZ A;  1K4E A;  4R4S A;  5M1A A;  1BLH A;  4S2O A;  2Y2K A;  1CK3 A;  1L2S A;  1AXB A;  3ZVW A;  3HUM A;  5FA7 A;  2FFY A;  3E2K A;  1NYY A;  1RCJ A;  4OOL A;  1Q2Q A;  2VGJ A;  5EOO A;  3ZG0 A;  1H8Y A;  5HAI A;  2WGI A;  3G2Y A;  5AQA A;  3SH7 A;  5FDH A;  4Y0O A;  5D3O A;  4JKT A;  2V2F F;  4OOM A;  2BG1 A;  4Z9Q A;  3CZD A;  1GHI A;  1YLT A;  4C75 A;  4N1X A;  1I5Q A;  1ONH A;  4JXV A;  1VM1 A;  1KE0 A;  4RA7 A;  3IXH A;  3PBT A;  4E3L A;  1E3U D;  2HP5 A;  3GV9 A;  3IHA A;  4QU3 A;  5FAT A;  5M18 A;  3NI9 A;  3BFC A;  4WZ4 A;  1XA7 A;  3NBL A;  4LV0 A;  3VOZ A;  5KSH A;  4DKI A;  1KGF A;  2ZQD A;  1FCO A;  4X6T A;  1BUE A;  1EWZ A;  1PI5 A;  2OLV A;  2DRW A;  2WGW A;  2XF3 A;  4UAA A;  3N4I A;  2QPN A;  4X55 A;  1IYS A;  4GD8 A;  5JYO A;  3ZG9 B;  3CG5 A;  4DXB A;  2ZQ7 A;  1K57 A;  5FAS A;  3PBS A;  1W8Y A;  3WS2 A;  3EQU A;  1CI8 A;  4BEN A;  4DE2 A;  3QNB A;  1EI5 A;  5CEB A;  4FH4 A;  4RYE A;  3BFE A;  3O87 A;  3ZDJ A;  4E3I A;  5KZH A;  3V50 A;  4OP5 A;  4BL2 A;  4LV1 A;  3BFG A;  3UPP A;  4QB8 A;  2XR0 A;  2Q9N A;  2Y2O A;  3GVB A;  4BLM A;  3IF5 A;  4S2I A;  5DTK A;  1TDL A;  3PBR A;  4U3T A;  3VP4 A;  3WS5 A;  3MFD A;  3FZC A;  1QME A;  5E2G A;  1BLC A;  5GLA A;  1GHM A;  3BEC A;  3QNC A;  4FSF A;  5HAR A;  4K91 A;  3C7U A;  4OQI A;  1FCN A;  3G2Z A;  4WMC D;  4GKU A;  4RX3 A;  3W4O A;  5FQK A;  1MY8 A;  4B88 A;  1PWC A;  2DNS A;  4OLG A;  1Q2P A;  4N9L A;  2EFX A;  1NRF A;  4PPR A;  5EEC A;  3GR2 A;  3Q7Z A;  4OON A;  5FI6 A;  1K56 A;  2XD1 A;  4JXG A;  5FSR A;  4GDB A;  5E2E A;  3IWI A;  1BZA A;  5TGF A;  2G2U A;  4QJG A;  2FFF B;  3NIA A;  3B3X A;  3VP3 A;  2Z2M B;  3AGF A;  4XXR A;  2EX2 A;  4K0X A;  1HD8 A;  2JE5 A;  1IEL A;  3IQA A;  4ZBE A;  2XH9 A;  3UN7 A;  4ZJ1 A;  4OKP A;  4DXC A;  3BRM A;  1FSY A;  1YLZ A;  1GA9 A;  4P6B A;  2WAF A;  3IHB A;  4R3B A;  5CEC A;  3GMW A;  5CGW A;  5CTM A;  1QMF A;  1K55 C;  1HZO A;  3SS3 A;  5A92 A;  4KG6 A;  1K54 A;  3ZHH A;  1ERO A;  3Q82 A;  1C3B A;  3HL9 A;  1GA0 A;  1YQS A;  4OQH A;  2HDR A;  2WAE A;  3LEZ A;  3HUN A;  3ZNT A;  3IXG A;  3Q7V A;  5CHU A;  1RGY A;  3HLE A;  4OVD A;  2XGN A;  2CC1 A;  3ZG8 B;  2HPB A;  1E4D A;  4KZ8 A;  2Z2L B;  1ES5 A;  3DTM A;  3VP0 A;  2PU2 A;  3UE1 A;  3M2K A;  1JTG A;  3IF6 B;  3PBO A;  3Q1F A;  4KZA A;  3IXB A;  2XLN A;  4GN2 A;  4P0M A;  1ES3 A;  3VOY A;  4PM6 A;  5DTT A;  4O7D A;  5E43 A;  1NJ4 A;  3UY6 A;  3V3R A;  2H10 A;  4LV3 A;  1CEF A;  3PAG A;  2ZMA A;  5DF9 A;  3M6H A;  4WZ5 A;  3VMA A;  2QZ6 A;  2WZX A;  3MBZ A;  2E8I A;  5CER A;  3IH9 A;  2ZM2 A;  4R1G A;  4EBN A;  2X01 A;  3CMZ A;  1KVL A;  1MKI A;  5DF8 A;  3EQV A;  4KZ7 A;  4MLL A;  5AQ9 A;  4M3K A;  3VSL A;  1XA1 A;  2WK0 A;  3Q7V B;  3LY3 A;  1MPL A;  1MWU A;  1O7E A;  1SDE A;  4N9K A;  2EXB A;  4ZJ2 A;  3OPL A;  4N1H A;  4S2P A;  1S0W A;  1TEM A;  3G31 A;  3PBN A;  2UWX A;  2DCF A;  4U0X A;  1LI0 A;  2WUQ A;  2ZC5 B;  4ZTK A;  4MBF A;  5CHJ A;  3ZVT A;  4BD1 A;  2Y2J A;  4FH2 A;  5M19 A;  3MXS A;  4KZ5 A;  4MBK A;  1L0F A;  3MZD A;  1ES4 A;  1W7F A;  5EVI C;  1PZO A;  1XPB A;  3BYD A;  4JBF A;  1LL9 A;  1YT4 A;  2Y2Q A;  5GLC A;  3OPP A;  5BOH A;  3P09 A;  4R4R A;  2P9V B;  1MWR A;  1IKI A;  4GDN A;  2Y2I A;  3HBR A;  1KE4 A;  1L0D A;  3VFF A;  1K6S A;  4E6W A;  1PW1 A;  1PZP A;  3NC8 A;  3OC2 A;  3OZH A;  3IWO A;  5EOE A;  3HLB A;  5FAP A;  3WWX A;  4OP8 A;  4KQR A;  5F1G A;  1K56 D;  3HLF A;  4EQI A;  2ZM0 A;  2H0T A;  2IWC A;  2ZC7 A;  5FQM A;  3W8K A;  3Q81 A;  3OPR A;  5FI7 A;  1I2W A;  3MZE A;  1G6A A;  5GLB A;  1NXY A;  4KQQ A;  3BEB A;  2J8Y A;  1FR6 A;  2C5W B;  3N8S A;  2WKH A;  1LL5 A;  2X71 A;  4OLD A;  2RCX A;  4KEN B;  4ID4 A;  1YLP A;  4WEJ A;  1XP4 A;  1PWD A;  4XUX A;  5HAP A;  1IEM A;  2J9P A;  4HBU A;  3ZGA B;  4ZAM A;  1WE4 A;  1XX2 A;  3A3E A;  3AGD A;  2Y55 A;  3TSG A;  2X02 A;  1IYQ A;  2EX6 A;  4P85 A;  4Y7P A;  5FAO A;  1ESI A;  3M2J A;  2XK1 A;  3UDX A;  2EX8 A;  1IKG A;  1KVM A;  3UPO A;  4E3M A;  3MKE A;  3FV7 A;  3S4X A;  1FCM A;  4X56 A;  5G18 A;  4B4Z A;  1H5X A;  2HDQ A;  3C4P A;  5CHM A;  3UDF A;  2C6W B;  2IWB A;  5GHX A;  2Y2H A;  4Y0U A;  3OCL A;  1FSW A;  3G4P A;  3N7W A;  1MWT A;  4DRT A;  2I72 A;  3DWK A;  1BTL A;  3IWQ A;  3ZCZ A;  1PWG A;  3S1Y A;  3IF6 A;  3RXW A;  4YFM A;  3PAE A;  5L2F A;  1VQQ A;  3V39 A;  5KMW A;  3IH8 A;  4D2O A;  4KZ9 A;  1ALQ A;  4IBX A;  5EVI B;  4EV4 A;  4C3Q A;  1SHV A;  4KZ6 A;  5HL1 A;  1LLB A;  2WKE A;  2A3U A;  3WS0 A;  1FQG A;  2OLU A;  2JC7 A;  5A90 A;  1O07 A;  1ES2 A;  4X69 A;  5HX9 A;  4JF6 A;  1M40 A;  3HVF A;  4H8R A;  3GRJ A;  1FR1 A;  4U0T A;  2HDS A;  4WBG A;  1YM1 A;  4LEN A;  3ZG7 B;  4F94 A;  4KQO A;  2B5R A;  4S2M A;  1TVF A;  3G35 A;  3ITA A;  1TDG A;  3O86 A;  4OQG A;  4OPQ A;  2J7V A;  4JF4 A;  1ZC2 A;  4XUZ A;  1W8Q A;  4MBH A;  1BLP A;  1LHY A;  3PBQ A;  1PIO A;  1YLJ A;  1SKF A;  1KDS A;  5GHZ A;  2WGV A;  4QY5 A;  2ZD8 A;  2R9W A;  3PTE A;  3VP2 A;  2ZM8 A;  2R9X A;  4R0Q A;  4S2L A;  4BD0 A;  4E3O A;  5GLD A;  3LO7 A;  4PMA A;  1E25 A;  1XKZ A;  2OSU A;  3S22 A;  4E3J A;  4QY6 A;  3ZFZ A;  3G30 A;  1MBL A;  4DDS A;  5J8X A;  2P9V A;  3NY4 A;  1GCE A;  3I7J A;  4N92 A;  1WYB A;  2ZQ9 A;  4ZJ3 A;  1ESU A;  5JYP A;  3FKV A;  3V5M A;  1YMX A;  5DVA A;  3AGE A;  2P74 A;  4UHU A;  4MNR A;  1HVB A;  1K55 A; 
#chains in the Genus database with same CATH topology
 2CMN A;  3E2L A;  2J3T D;  5KSC A;  2EX9 A;  4HJ4 A;  5HDC A;  4BBU A;  2Y2G A;  3IBR A;  1BLS A;  1NWZ A;  4DE3 A;  4BL3 A;  1VET B;  3VV4 A;  4DJ3 A;  1SDN A;  4UA7 A;  1AWI A;  3HLC A;  4KZ4 A;  1G28 A;  3NCK A;  4E3N A;  1BUL A;  2KOI A;  4WEK A;  4PM7 A;  3T1X A;  5AQB A;  4BBT A;  2Y59 A;  1W63 Q;  2PYR A;  4R23 A;  1L0E A;  3H9W A;  4DE0 A;  1OME A;  2JN7 A;  1K6R A;  3MKF A;  1Y54 A;  3T4K A;  4IBR A;  1OJ5 A;  4Y0T A;  5EVL A;  1CI9 A;  2Y91 A;  5U47 A;  4K08 A;  3C7V A;  5J3W A;  1DY6 A;  2WZZ A;  4WM9 A;  3O88 A;  5F1F A;  5F6A A;  4MEZ A;  4LPZ A;  4EU0 A;  1ZKJ A;  4P87 A;  2JKT M;  3MR0 A;  4HES A;  3NOT C;  1XFQ A;  4KUK A;  1JWV A;  4WLA A;  3N6I A;  2ZQA A;  4HI4 A;  1XJ2 A;  3TG9 A;  1MKM A;  1Y28 A;  4S2J A;  1S4S A;  1OPX A;  1JVJ A;  1Z6F A;  2KX6 A;  3LID A;  3BM6 A;  2M7V A;  4IVK A;  1KE3 A;  1CQA A;  3KO6 A;  3R7W A;  3EOI A;  3TW8 A;  3E98 A;  2I9V A;  5CGS A;  3EGD C;  1RP5 A;  3DWZ A;  2UV0 E;  3GSG A;  3ISG A;  3LR4 A;  1J9M A;  3UPN A;  5HSQ A;  2OV5 A;  1K4F A;  4H6J B;  5HAQ A;  4X68 A;  3SH9 A;  1KGE A;  3FWL A;  2XFS A;  5EVI D;  4CPK A;  5F69 A;  1K38 A;  2WKI A;  3ULF A;  3MZF A;  4JPM A;  1W79 A;  1KOU A;  1W5D A;  3V3S A;  1K4E A;  2Y2K A;  1CK3 A;  3KSH A;  4HJ6 A;  5L8M A;  1NYY A;  1RCJ A;  5EOO A;  4IUH A;  1H8Y A;  2HZ5 A;  5AQA A;  3SH7 A;  1F98 A;  4Y0O A;  4O01 A;  2BG1 A;  2O9A A;  2Q0O A;  4JXV A;  4BWI A;  3IXH A;  3IHA A;  3QP4 A;  4WZ4 A;  1XA7 A;  2HJ9 C;  1KGF A;  1PI5 A;  5HPF A;  2XF3 A;  3A0V A;  1IYS A;  4GD8 A;  5JYO A;  3ZG9 B;  1K57 A;  1W8Y A;  3WS2 A;  3EQU A;  3VOL A;  1YSQ A;  3RTY A;  4FH4 A;  1F2K A;  3O87 A;  2JKR M;  4BL2 A;  4LV1 A;  2P7J A;  3CPT B;  3GVB A;  2A2L A;  2QWS A;  3BQA A;  3WS5 A;  3FZC A;  1GHM A;  4UQI M;  2VV6 A;  5FDS A;  3C7U A;  1FCN A;  3W4O A;  2DNS A;  5FSR A;  4OON A;  5E2E A;  1BZA A;  5TGF A;  3H82 B;  4QJG A;  3AGF A;  1IEL A;  1H8M A;  3BRM A;  1YLZ A;  4WN5 A;  4P6B A;  3IHB A;  4R3B A;  5CEC A;  5CTM A;  1TS0 A;  5CGW A;  3SS3 A;  4KG6 A;  3ZHH A;  1ERO A;  3Q82 A;  1C3B A;  3LR5 A;  2HDR A;  3HUN A;  4R6L A;  1RGY A;  4OVD A;  3ZG8 B;  3R4K A;  1ES5 A;  3UE1 A;  4X1L A;  1JTG A;  3IF6 B;  3PBO A;  3Q1F A;  5E43 A;  2H10 A;  2NUT C;  3DTE A;  4WZ5 A;  2QZ6 A;  3MBZ A;  2JHE A;  5CER A;  1ODV A;  3IH9 A;  5TBM B;  2X01 A;  1KVL A;  3HCY A;  3UME A;  2ZMV A;  3EQV A;  4KZ7 A;  5AQ9 A;  3VSL A;  3HJK A;  1MPL A;  1MWU A;  1T1B A;  3SZT A;  5DKL A;  2Y79 A;  1TEM A;  3G31 A;  2DCF A;  5J4E A;  3A0S A;  3UE6 A;  2W3G A;  5CHJ A;  4BD1 A;  1NLZ A;  1L0F A;  5EVI C;  1LL9 A;  1YT4 A;  2J3W A;  3OPP A;  2QHK A;  1MWR A;  2Y2I A;  3HBR A;  4RQ9 A;  3LI8 A;  3NC8 A;  4EW7 A;  5EOE A;  3HLB A;  4L9G A;  4CLC A;  3OPR A;  1OTI A;  1K0K A;  3N8S A;  2WKH A;  2X71 A;  5HAP A;  1IEM A;  4R70 A;  3ZGA B;  3KYQ A;  4DMZ A;  2INW A;  3MQO A;  4P85 A;  2XK1 A;  5HWV A;  3VE4 A;  3MKE A;  2HDQ A;  5CHM A;  2Z6D A;  4Y0U A;  2PR5 A;  3G4P A;  3K3D A;  1MWT A;  4DRT A;  2I72 A;  3DWK A;  1BTL A;  5DKK A;  1PWG A;  5L2F A;  1VQQ A;  3IH8 A;  4D2O A;  4KZ9 A;  5EVI B;  4EV4 A;  4C3Q A;  2VA0 A;  4KZ6 A;  4NKP A;  3U4L P;  3LEQ A;  4IUK A;  4X69 A;  4JF6 A;  5HWW A;  3CIT A;  1SZV A;  3GRJ A;  2G7U A;  1P0Z A;  3LR3 A;  1YM1 A;  3ITA A;  3T4O A;  4I3I A;  3IBJ A;  3OLO A;  1ZC2 A;  4XUZ A;  4MBH A;  4EET B;  1KDS A;  2ZL1 B;  2R9W A;  4R0Q A;  1J3W A;  5GLD A;  2GNX A;  4PMA A;  1E25 A;  1XKZ A;  3S22 A;  2P9V A;  3I7J A;  1WYB A;  1BYW A;  1YMX A;  1HVB A;  5HPI A;  4M4X A;  1ERM A;  2RL3 A;  5K5B A;  4UA9 A;  5A91 A;  2L4R A;  1VEU B;  3ZYT A;  2J9O A;  4JXS A;  4NK3 A;  3WRT A;  2V20 A;  1PI4 A;  4A5R A;  4OQ0 A;  2WAD A;  4FCF A;  1UGU A;  4KG5 A;  1KGG A;  2XD5 A;  4KZ3 A;  1NZO A;  2W3E A;  1PFL A;  5CTN A;  3DW0 A;  4KG2 A;  1P9R A;  2JCH A;  4G3W A;  2EXA A;  4LV2 A;  2KDK A;  3KSG A;  4NET A;  3F1N A;  3VFH A;  2XFT A;  2ZQC A;  4R3J A;  3RH8 B;  1YAX A;  3BJN A;  2ZQ8 A;  3NDE A;  2QJ7 A;  4WF0 A;  4Q8I A;  1K25 A;  2FZ0 A;  4QHC A;  4B93 A;  3G34 A;  5EPH A;  2W3H A;  1GHP A;  4LCM A;  2PBD P;  2XDM A;  1XGI A;  2HDU A;  5HD3 A;  5L10 A;  4WEL A;  2HF6 A;  3OCN A;  5DJU A;  3H7W A;  1K54 C;  4LFU A;  3SH8 A;  2Y2P A;  3O3V A;  2OAQ 1;  4EEU A;  2PAV P;  2HV1 A;  3E4O A;  1JWZ A;  4L9F A;  5I94 A;  4RX2 A;  4O8G A;  4OOY A;  3ZG5 A;  2EFU A;  2GDN A;  3HRE A;  4RVA A;  4GB7 A;  2VKS A;  4Q0H A;  2ZJ9 A;  1TF1 A;  2ZC3 B;  1E3U A;  1ERQ A;  4DDY A;  1UWN X;  3SW1 A;  1OT9 A;  5FQQ A;  3LIE A;  1NYM A;  4QPR A;  1DP8 A;  3HJI A;  5TFQ A;  1DP6 A;  1JWP A;  3QP1 A;  2Q9M A;  4EER A;  4YIN A;  4S2K A;  3T50 A;  2QMI A;  3QP6 A;  4GD6 A;  3HUO A;  3UO9 A;  3WS4 A;  4GNU A;  4D60 A;  4OPR A;  4FUW A;  1MXO A;  5FL3 A;  2JBF A;  4IED A;  3G6O A;  5AJG A;  4MCW A;  1JTD A;  1DJC A;  2HJE A;  2Y2L A;  1RGZ A;  5AQ7 A;  2WKQ A;  2ACG A;  4LRZ E;  2VGL S;  2Y2M A;  2O9B A;  1IYP A;  1YLY A;  2PHY A;  4LCL A;  1Z09 A;  3FYZ A;  4LLO B;  4O0P A;  4OOL A;  5DFX A;  1Q2Q A;  2VGJ A;  1V9Y A;  2WGI A;  3G2Y A;  1ZHH B;  4JKT A;  2V2F F;  4OOM A;  1GHI A;  4GHI B;  1P97 A;  1D06 A;  1VM1 A;  1W63 M;  3FPW A;  3UB7 A;  4LV0 A;  5KSH A;  2ZQD A;  2PR6 A;  4YWZ A;  2OLV A;  2WGW A;  3N4I A;  1CJF A;  4WL9 A;  2GZA A;  1VHM A;  3F1O A;  3LFV A;  2EA9 A;  1CI8 A;  4BEN A;  3QNB A;  5CEB A;  4RYE A;  3BFE A;  3IX3 A;  5KZH A;  2Y2O A;  1MZU A;  4S2I A;  1TDL A;  1SKO B;  1PNE A;  1QME A;  5E2G A;  1BLC A;  4WUJ A;  3QNC A;  5HAR A;  4OQI A;  1WA9 A;  4B88 A;  1PWC A;  4OLG A;  2EFX A;  1NRF A;  4PPR A;  3CUE C;  3Q7Z A;  3CWF A;  1K56 A;  2XD1 A;  2G2U A;  4MMN A;  4HHD A;  3B3X A;  2ZMF A;  2EX2 A;  4K0X A;  3IQA A;  4DXC A;  1FSY A;  2P08 A;  5A92 A;  3EEA A;  4GS9 B;  1OTA A;  1JNU A;  4ARZ B;  2WAE A;  3LEZ A;  2VEA A;  2WKR A;  3HLE A;  2V9A A;  3F1P A;  4YOF A;  3DTM A;  4I5S A;  2PU2 A;  2A24 A;  3M2K A;  4KZA A;  2QJ5 A;  3ICY A;  2XLN A;  3IXB A;  4GN2 A;  4HNB A;  3VOY A;  5DTT A;  3VE3 A;  3V3R A;  4LV3 A;  1CEF A;  5DF9 A;  3VMA A;  4BBV A;  2E8I A;  4PAU A;  4EBN A;  2BTF P;  3U2A A;  2XA7 M;  2OAP 1;  3EGX C;  4HH2 A;  2MJ6 A;  2WK0 A;  1O7E A;  1SDE A;  4N9K A;  2EXB A;  1OTB A;  3C38 A;  3OPL A;  2V0W A;  4S2P A;  1S0W A;  3PBN A;  1LI0 A;  4MBF A;  3TE8 A;  2J3T C;  3MZD A;  1W7F A;  1PZO A;  1XPB A;  4IHQ A;  4R4R A;  3OBF A;  5HWT A;  1K6S A;  4E6W A;  1PZP A;  1S1Y A;  5F1G A;  2W3D A;  2ZM0 A;  5FQM A;  3Q81 A;  2IA2 A;  2K7S A;  5FI7 A;  1FIK A;  2QYB A;  3K2N A;  3MZE A;  3LI9 A;  4ZRR A;  1FR6 A;  4KEN B;  4ID4 A;  1YLP A;  4WEJ A;  1XP4 A;  4XUX A;  3QP8 A;  2J9P A;  4HBU A;  3AGD A;  2D01 A;  4HQA A;  3TSG A;  2X02 A;  3CHW P;  1IYQ A;  2E8J A;  5FAO A;  3NHQ A;  1XJ3 A;  2EX8 A;  2B02 A;  4E3M A;  3S4X A;  1FCM A;  3C4P A;  1IOU A;  2C6W B;  3IS2 A;  3T1S A;  1FSW A;  3N7W A;  2W1T B;  3IWQ A;  3RXW A;  3PAE A;  4EES A;  1TS8 A;  3V39 A;  5KMW A;  3KYE A;  4Q0J A;  2K2N A;  4P6Z M;  2WKE A;  3WS0 A;  1LL8 A;  2YKH A;  1M40 A;  5FEG A;  1FR1 A;  4WBG A;  3ZG7 B;  3E4Q A;  2B5R A;  3O86 A;  3MSH A;  1TDG A;  4OQG A;  5CX7 A;  4OPQ A;  3P01 A;  3PBQ A;  1YLJ A;  4QY5 A;  3PTE A;  2JKT I;  2ZM8 A;  4CLC D;  4L9E A;  2W0N A;  4R38 A;  4S2L A;  4BD0 A;  4E3O A;  3LO7 A;  4X25 A;  3K3C A;  4E3J A;  2VK3 A;  3ZFZ A;  3G30 A;  5J8X A;  3S7O A;  1T1C A;  4DJ2 A;  4ZJ3 A;  1ESU A;  5EFW A;  5DVA A;  4Z1W A;  3JPU A;  2P74 A;  4UHU A;  4MNR A;  4B4X A;  1K55 A;  3NDG A;  3GTC A;  2V1Z A;  5FQ9 A;  5DTS A;  5FAQ A;  5G4Y A;  3R7W B;  1YMS A;  2PDR A;  4HBT A;  1Y4O A;  2P04 A;  1K57 C;  3IX8 A;  4NG2 A;  4UQI S;  2EWW A;  4GJ4 A;  1S1Z A;  3RJU A;  3VSK A;  2PBY A;  2G2W A;  3T4S A;  3HLW A;  4ETX A;  4CJN A;  3M6B A;  3SOI A;  3C5A A;  1NY0 A;  1G68 A;  1N9B A;  3EEH A;  1CEG A;  1SCW A;  2XEP A;  1D1J A;  4YNR A;  4IVI A;  3IT9 A;  1NLY A;  3UB6 A;  3N8L A;  4JGQ A;  2XQZ A;  2ZC6 B;  2PRF A;  3A3I A;  3MXQ A;  3SS4 A;  1NRJ A;  4OPY A;  5CED A;  5EUA A;  4FOF A;  4CLC E;  3BFF A;  4DF6 A;  4EWF A;  2W27 A;  3NOU C;  2Y4A A;  1MWS A;  1DJA A;  1S6R A;  3G32 A;  3N8R A;  2EWV A;  3LCE A;  4K0W A;  3D3O A;  4E6X A;  3TOI A;  3S7N A;  4XT2 B;  5TR7 A;  1N4O A;  2ZLY A;  4X53 A;  4F3L A;  4WZ5 C;  4PM9 A;  1HLU P;  3FKW A;  2JKR I;  2L1M A;  1XXM A;  3VP1 A;  5FEF A;  2ZC4 B;  3KSF A;  4OH0 A;  4ME4 A;  2VGK A;  4E3K A;  1P9W A;  3ITB A;  3BLS A;  1UWP X;  2BLS A;  3D4F A;  4PM5 A;  1BSG A;  1BT5 A;  4EBP A;  3JYI A;  3HLD A;  4ZDX A;  5EE8 A;  4GCZ A;  1IYO A;  1VET A;  2A49 A;  5F82 A;  2VX8 A;  2D02 A;  3C30 A;  4NXG A;  2HP9 A;  4KZB A;  1WYC A;  1H8Z A;  4WMC A;  2V8C A;  5GHY A;  3UB5 P;  3UE3 A;  2WYX A;  4CLC C;  3LY4 A;  3OPH A;  2ZOH A;  5DJT A;  3BWL A;  4MN7 A;  3UDI A;  3IXD A;  3GEC A;  4R4S A;  5M1A A;  5G4Z A;  1L2S A;  4PKY A;  3HUM A;  5FA7 A;  2FFY A;  3E2K A;  3ZG0 A;  3FG8 A;  5HAI A;  4B9O A;  3DTK A;  1YPR A;  3S7Q A;  3C8C A;  1S66 L;  4G3V A;  5D3O A;  4Z9Q A;  3CZD A;  4C75 A;  4N1X A;  1ONH A;  1KE0 A;  4E3L A;  4Y15 A;  1E3U D;  2KLI A;  5FAT A;  4QU3 A;  3PYP A;  3BFC A;  3NBL A;  2OOL A;  5F68 A;  1FCO A;  4X6T A;  3T4J A;  4FTX A;  1FIL A;  4NEE D;  3CG5 A;  4DXB A;  3PBS A;  3NEC A;  3OOV A;  4HP4 A;  3MF0 A;  3BFG A;  3UB9 A;  1XFN A;  2OWJ A;  4GW9 A;  4QB8 A;  4BLM A;  2Q9N A;  5A8B A;  3IF5 A;  2B95 A;  3MFD A;  4CLC B;  5GLA A;  3BEC A;  4FSF A;  4UEY A;  4GKU A;  5FQK A;  3T1R A;  1Q2P A;  4N9L A;  3GR2 A;  4JXG A;  3IWI A;  5I5L A;  2FFF B;  4IJG A;  1HD8 A;  3KYZ A;  3IX4 A;  3UN7 A;  4ZJ1 A;  1ACF A;  3D72 A;  4H6J A;  1GA9 A;  2WAF A;  3LIC A;  1HZO A;  3HL9 A;  1YQS A;  4OQH A;  3TJZ C;  1E4D A;  2Z2L B;  3VP0 A;  3NUL A;  4PM6 A;  1X0O A;  1NJ4 A;  3UY6 A;  3M6H A;  3W2Z A;  2WZX A;  3T1Q B;  1MKI A;  5DF8 A;  2B18 A;  2O9C A;  4M3K A;  1N9O A;  3BY9 A;  3Q7V B;  3LY3 A;  3T4Q A;  4N1H A;  3BW6 A;  2WUQ A;  2ZC5 B;  4ZTK A;  3ZVT A;  5DFY A;  3MXS A;  4KZ5 A;  3CI6 A;  3MFX A;  4JBF A;  2Y2Q A;  5GLC A;  3E4P A;  5BOH A;  3B42 A;  3P09 A;  2VV8 A;  2P9V B;  1IKI A;  3L9K A;  4GDN A;  1KE4 A;  3VFF A;  3C2W A;  3OC2 A;  3CPT A;  3D9Y A;  5FAP A;  3WWX A;  3BY8 A;  1K56 D;  1OTE A;  4EQI A;  2ZC7 A;  3KSI A;  1G6A A;  4KQQ A;  2J8Y A;  2C5W B;  2J80 A;  4OLD A;  1STZ A;  2H28 A;  4PHT A;  2W1T A;  3LYX A;  3NOP C;  4ZAM A;  1XX2 A;  3A3E A;  3DTI A;  3H82 A;  2EX6 A;  3B47 A;  4Y7P A;  1ESI A;  3UDX A;  1KVM A;  4DN0 A;  3UPO A;  1OTD A;  4Y13 A;  3FV7 A;  4B4Z A;  4X56 A;  1H5X A;  3UDF A;  3CAX A;  2IWB A;  3OCL A;  1TS6 A;  3F1N B;  2XRO A;  5HZH A;  3ZCZ A;  3IF6 A;  2W3F A;  1GSV A;  3E0Y A;  2LB5 A;  5C5K A;  3MQQ A;  1XJ6 A;  4IBX A;  3FC7 A;  5HL1 A;  3S7P A;  2A3U A;  5TBM A;  3LR0 A;  1EW0 A;  2JC7 A;  1ES2 A;  4QWO A;  4R3A A;  4H8R A;  4U0T A;  3MJQ A;  3H7W B;  2QKP A;  1LSV A;  4KQO A;  4S2M A;  1TVF A;  4KUO A;  1D7E A;  1W8Q A;  1BLP A;  4G3K A;  5EM1 A;  1SKF A;  5GHZ A;  2WGV A;  2ZD8 A;  4CQH A;  2R9X A;  1MBL A;  4JGO A;  1GCE A;  2AVX A;  4HP9 A;  4N92 A;  5JYP A;  3FKV A;  4BQM A;  4LGW A;  2V8F A;  3L7H A;  1XJ4 A;  1L0G A;  3UNW A;  4WYY A;  2IWD A;  4S2N A;  5AVF A;  2WKP A;  3SS5 A;  4PM8 A;  1DJB A;  1NZU A;  5FQJ A;  1LI9 A;  2H0Y A;  4C6Y A;  2JKF A;  5HL6 A;  1M6K A;  3P98 A;  4QD4 A;  5AVE A;  1ZG4 A;  3RXX A;  1FOF A;  4GOG A;  5CRF A;  3MMH A;  3ZQ5 A;  1ZTU A;  3Q07 A;  5F5Y A;  5E2H A;  2Y2N A;  3LIF A;  4HH3 A;  2H5S A;  3QHY A;  2GJ3 A;  3BFD A;  4EXO A;  4UA6 A;  3WRZ A;  3BQ8 A;  1XGJ A;  4GZB A;  3IF6 C;  4DE1 A;  5EVI A;  3GQZ A;  1H3Q A;  3PR6 A;  1V9Z A;  1ZG6 A;  4XT2 A;  3LGO A;  3W4P A;  3JVU A;  5F83 A;  2HP6 A;  3CLO A;  1KDW A;  1HTZ A;  4FD8 A;  1ONG A;  4EUZ A;  5A93 A;  3ZNY A;  5FI2 A;  3PHY A;  5HFO A;  2K31 A;  2WGW B;  4Y5F A;  3UE0 A;  3V67 A;  2XA7 S;  4L0L A;  2ZL1 A;  5L09 A;  4EQ1 A;  5E2F A;  2ZOI A;  4BJP A;  3F1O B;  3O5Y A;  5HDS A;  3CJM A;  1OT6 A;  1PW8 A;  3MQ0 A;  2GX5 A;  5FQI A;  3BLM A;  2VV7 A;  3MXR A;  2R78 A;  4Y17 A;  5IHV A;  2XSS A;  3A3D A;  5HW3 A;  4JF5 A;  4JXW A;  3A3J A;  1VEU A;  4MN5 A;  5DF7 A;  3B33 A;  4LRX C;  4HOI A;  4NXB A;  4S2N C;  4JLF A;  3W4Q A;  3C4O A;  4HEF A;  4OPZ A;  1PYY A;  1DP9 A;  2PU4 A;  4EBL A;  1I2S A;  1YLW A;  1GSW A;  5LBR A;  1LSW A;  3WS1 A;  1LSX A;  5CXW A;  5GL9 A;  1F9I A;  3A3F A;  4NXF A;  5EVE A;  5CGX A;  3HLG A;  3GDI A;  1U60 A;  2LB9 A;  3F1P B;  1BLH A;  2A24 B;  4S2O A;  3DAV A;  1AXB A;  4JGP A;  3ZVW A;  1MC0 A;  5FDH A;  4MN6 A;  1YLT A;  1I5Q A;  4RA7 A;  5HDD A;  3PBT A;  5EM0 A;  2HP5 A;  3GV9 A;  5M18 A;  4LRY C;  3NI9 A;  3MS6 A;  3VOZ A;  4EEP A;  4DKI A;  1G5U A;  4P6Z S;  1T19 A;  1BUE A;  1EWZ A;  1OJG A;  2DRW A;  3LIA A;  4UAA A;  5TJJ A;  2QPN A;  4X55 A;  2HGV A;  4E04 A;  1N9N A;  2ZQ7 A;  2ZBB A;  5FAS A;  4DE2 A;  1EI5 A;  5L07 A;  3ZDJ A;  4E3I A;  3V50 A;  4OP5 A;  3UPP A;  2XR0 A;  5DTK A;  3PBR A;  3T4L A;  4U3T A;  3VP4 A;  3LUQ A;  2XRN A;  2M1C A;  4K91 A;  3G2Z A;  4HJ3 A;  4WMC D;  2O0Y A;  4RX3 A;  1GSX A;  1MY8 A;  2L0W A;  1CF0 A;  5J7E A;  5EEC A;  5FI6 A;  4GDB A;  2V1A A;  5HD5 A;  3NIA A;  3VP3 A;  2Z2M B;  4XXR A;  4MDZ A;  5MC7 A;  2JE5 A;  4ZBE A;  2XH9 A;  4OKP A;  1G6O A;  3GMW A;  3DBA A;  1QMF A;  1K55 C;  1K54 A;  1GA0 A;  3IS2 B;  3ZNT A;  1T1A A;  3IXG A;  3Q7V A;  1N9L A;  5CHU A;  2XGN A;  2CC1 A;  3JVV A;  3T12 B;  2HPB A;  4KZ8 A;  4BMW A;  1L3L A;  4P0M A;  5IU1 A;  1ES3 A;  4O7D A;  3PAG A;  2ZMA A;  2PD8 A;  2ZM2 A;  4R1G A;  3CMZ A;  4GHI A;  2OWH A;  3T4T A;  1DRM A;  4MLL A;  1XA1 A;  4HY8 A;  4AFI A;  4ZJ2 A;  4ETZ A;  2UWX A;  4U0X A;  4JGR A;  1LT0 A;  4Y3I A;  2Y2J A;  4FH2 A;  5M19 A;  4Q0I A;  4MBK A;  4HIA A;  1ES4 A;  1PRQ A;  2YKF A;  3LIB A;  3BYD A;  2PYP A;  4I39 A;  3UB8 A;  1L0D A;  1PW1 A;  3OZH A;  3RFB A;  3IWO A;  4OP8 A;  4KQR A;  2V0U A;  3HLF A;  1SKO A;  2H0T A;  2IWC A;  2Z6C A;  3W8K A;  4Y2F A;  1I2W A;  2VLG A;  2VZW A;  5GLB A;  1NXY A;  3BEB A;  1H0M A;  1LL5 A;  5IS1 A;  2RCX A;  1PWD A;  1WE4 A;  2O99 A;  2VGL M;  2Y55 A;  1TD5 A;  3QP2 A;  3M2J A;  1A0K A;  1IKG A;  3KX0 X;  1IFQ A;  4KQD A;  5G18 A;  4GS9 A;  4I38 A;  5KIZ A;  4EUV A;  5GHX A;  2Y2H A;  3QP5 A;  4PKY G;  4ARZ A;  1YSP A;  3TRC A;  3S1Y A;  3NJA A;  1TS7 A;  1T18 A;  4I3A A;  4YFM A;  1ALQ A;  4GLQ A;  3FPV A;  1SHV A;  1YKD A;  4I3J A;  1LLB A;  1FQG A;  2OLU A;  5A90 A;  1F5M A;  1O07 A;  4II7 A;  5HX9 A;  3HVF A;  2HDS A;  2NUP C;  4LEN A;  4F94 A;  4X1M A;  2JKG A;  3G35 A;  1VB6 A;  4NXE A;  3A0R A;  3UMD A;  1S67 L;  2DMW A;  2J7V A;  2PD7 A;  4JF4 A;  4ESP A;  3P7N A;  2PT7 A;  1LHY A;  1PIO A;  5EV0 A;  3VP2 A;  3CUE A;  2VJW A;  2OSU A;  4QY6 A;  4F3L B;  3EWK A;  4DDS A;  3NY4 A;  2W1R A;  3PXP A;  5IT5 A;  2BAS A;  2FH5 A;  2ZQ9 A;  3V5M A;  2V1B A;  2M7U A;  3AGE A;  1S4R A;  2Y8H A; 
#chains in the Genus database with same CATH homology
 1ERM A;  2RL3 A;  4BQM A;  4UA9 A;  5A91 A;  3NDG A;  3GTC A;  1L0G A;  2V1Z A;  3UNW A;  3E2L A;  5FQ9 A;  4WYY A;  5DTS A;  2IWD A;  5FAQ A;  5KSC A;  2J9O A;  4JXS A;  2EX9 A;  4NK3 A;  4S2N A;  3WRT A;  2V20 A;  2Y2G A;  3SS5 A;  1PI4 A;  1YMS A;  4HBT A;  4PM8 A;  1DJB A;  1NZU A;  4A5R A;  1BLS A;  4OQ0 A;  2WAD A;  5FQJ A;  4DE3 A;  4FCF A;  4BL3 A;  1LI9 A;  1K57 C;  2H0Y A;  4KG5 A;  4C6Y A;  1KGG A;  2XD5 A;  4KZ3 A;  1NZO A;  1M6K A;  3P98 A;  3RJU A;  1SDN A;  4QD4 A;  5CTN A;  3DW0 A;  2PBY A;  2G2W A;  4KG2 A;  3VSK A;  3HLW A;  4UA7 A;  4KZ4 A;  3HLC A;  2JCH A;  3NCK A;  1ZG4 A;  4CJN A;  2EXA A;  1FOF A;  3M6B A;  1BUL A;  4GOG A;  4LV2 A;  5CRF A;  3RXX A;  4E3N A;  3SOI A;  3C5A A;  4NET A;  4WEK A;  1NY0 A;  4PM7 A;  3Q07 A;  3VFH A;  5AQB A;  2XFT A;  2ZQC A;  5E2H A;  4R3J A;  1G68 A;  1N9B A;  2Y2N A;  1CEG A;  2Y59 A;  1SCW A;  2H5S A;  3QHY A;  2XEP A;  2ZQ8 A;  3BFD A;  3NDE A;  4IVI A;  3IT9 A;  4UA6 A;  4Q8I A;  1K25 A;  3WRZ A;  1XGJ A;  4QHC A;  4R23 A;  3N8L A;  4GZB A;  3G34 A;  2XQZ A;  1L0E A;  2ZC6 B;  3IF6 C;  5EPH A;  3A3I A;  5EVI A;  4DE1 A;  1GHP A;  3GQZ A;  3SS4 A;  1OME A;  4DE0 A;  4LCM A;  4OPY A;  2XDM A;  5CED A;  1ZG6 A;  1XGI A;  2HDU A;  5EUA A;  1K6R A;  3W4P A;  3MKF A;  4WEL A;  5F83 A;  1Y54 A;  2HP6 A;  4IBR A;  1KDW A;  1HTZ A;  3OCN A;  4FD8 A;  3BFF A;  1ONG A;  1K54 C;  4DF6 A;  4Y0T A;  3SH8 A;  5EVL A;  4EUZ A;  4EWF A;  2Y2P A;  1CI9 A;  3O3V A;  5A93 A;  3ZNY A;  5FI2 A;  2Y4A A;  1MWS A;  1DJA A;  1S6R A;  2Y91 A;  1JWZ A;  5I94 A;  3G32 A;  5U47 A;  3N8R A;  4RX2 A;  3C7V A;  5HFO A;  2WGW B;  3UE0 A;  4OOY A;  1DY6 A;  3LCE A;  2EFU A;  2GDN A;  4L0L A;  3HRE A;  2WZZ A;  4RVA A;  3ZG5 A;  4K0W A;  4WM9 A;  3O88 A;  4GB7 A;  5F1F A;  2ZJ9 A;  4MEZ A;  2ZC3 B;  5E2F A;  4E6X A;  1E3U A;  1ZKJ A;  4P87 A;  3TOI A;  1ERQ A;  4DDY A;  5TR7 A;  1N4O A;  2ZLY A;  4HES A;  4BJP A;  4X53 A;  1JWV A;  4WZ5 C;  3CJM A;  3N6I A;  5FQQ A;  1NYM A;  1PW8 A;  4PM9 A;  2ZQA A;  3TG9 A;  5FQI A;  5TFQ A;  3BLM A;  3FKW A;  1JWP A;  3MXR A;  1XXM A;  5IHV A;  3VP1 A;  3A3D A;  5HW3 A;  4S2J A;  4JF5 A;  2ZC4 B;  2Q9M A;  4JXW A;  4YIN A;  4OH0 A;  3A3J A;  1JVJ A;  1Z6F A;  2VGK A;  4S2K A;  2QMI A;  4E3K A;  3ITB A;  3BLS A;  3BM6 A;  5DF7 A;  4GD6 A;  3HUO A;  2BLS A;  4IVK A;  3D4F A;  1KE3 A;  1BSG A;  3UO9 A;  3WS4 A;  1BT5 A;  4PM5 A;  4EBP A;  4GNU A;  4OPR A;  4S2N C;  3JYI A;  4JLF A;  1MXO A;  5CGS A;  3HLD A;  4ZDX A;  3W4Q A;  5EE8 A;  3C4O A;  1IYO A;  4HEF A;  2A49 A;  5F82 A;  1RP5 A;  4OPZ A;  3DWZ A;  3GSG A;  4B4X A;  1PYY A;  2JBF A;  2PU4 A;  3ISG A;  4IED A;  1J9M A;  1I2S A;  1YLW A;  4EBL A;  2HP9 A;  4KZB A;  1WYC A;  3UPN A;  2OV5 A;  1H8Z A;  4WMC A;  1JTD A;  1DJC A;  1K4F A;  2Y2L A;  1RGZ A;  5GHY A;  3WS1 A;  4X68 A;  3SH9 A;  5AQ7 A;  5HAQ A;  3UE3 A;  1KGE A;  3FWL A;  2WYX A;  5CXW A;  5GL9 A;  3LY4 A;  2XFS A;  3A3F A;  3OPH A;  5EVI D;  4CPK A;  1K38 A;  2Y2M A;  2WKI A;  5CGX A;  3MZF A;  3HLG A;  4JPM A;  1IYP A;  1YLY A;  3UDI A;  1W79 A;  1U60 A;  4LCL A;  1W5D A;  3V3S A;  3IXD A;  3FYZ A;  1K4E A;  4R4S A;  5M1A A;  1BLH A;  4S2O A;  2Y2K A;  1CK3 A;  1L2S A;  1AXB A;  3ZVW A;  3HUM A;  5FA7 A;  2FFY A;  3E2K A;  1NYY A;  1RCJ A;  4OOL A;  1Q2Q A;  2VGJ A;  5EOO A;  3ZG0 A;  1H8Y A;  5HAI A;  2WGI A;  3G2Y A;  5AQA A;  3SH7 A;  5FDH A;  4Y0O A;  5D3O A;  4JKT A;  2V2F F;  4OOM A;  2BG1 A;  4Z9Q A;  3CZD A;  1GHI A;  1YLT A;  4C75 A;  4N1X A;  1I5Q A;  1ONH A;  4JXV A;  1VM1 A;  1KE0 A;  4RA7 A;  3IXH A;  3PBT A;  4E3L A;  1E3U D;  2HP5 A;  3GV9 A;  3IHA A;  4QU3 A;  5FAT A;  5M18 A;  3NI9 A;  3BFC A;  4WZ4 A;  1XA7 A;  3NBL A;  4LV0 A;  3VOZ A;  5KSH A;  4DKI A;  1KGF A;  2ZQD A;  1FCO A;  4X6T A;  1BUE A;  1EWZ A;  1PI5 A;  2OLV A;  2DRW A;  2WGW A;  2XF3 A;  4UAA A;  3N4I A;  2QPN A;  4X55 A;  1IYS A;  4GD8 A;  5JYO A;  3ZG9 B;  3CG5 A;  4DXB A;  2ZQ7 A;  1K57 A;  5FAS A;  3PBS A;  1W8Y A;  3WS2 A;  3EQU A;  1CI8 A;  4BEN A;  4DE2 A;  3QNB A;  1EI5 A;  5CEB A;  4FH4 A;  4RYE A;  3BFE A;  3O87 A;  3ZDJ A;  4E3I A;  5KZH A;  3V50 A;  4OP5 A;  4BL2 A;  4LV1 A;  3BFG A;  3UPP A;  4QB8 A;  2XR0 A;  2Q9N A;  2Y2O A;  3GVB A;  4BLM A;  3IF5 A;  4S2I A;  5DTK A;  1TDL A;  3PBR A;  4U3T A;  3VP4 A;  3WS5 A;  3MFD A;  3FZC A;  1QME A;  5E2G A;  1BLC A;  5GLA A;  1GHM A;  3BEC A;  3QNC A;  4FSF A;  5HAR A;  4K91 A;  3C7U A;  4OQI A;  1FCN A;  3G2Z A;  4WMC D;  4GKU A;  4RX3 A;  3W4O A;  5FQK A;  1MY8 A;  4B88 A;  1PWC A;  2DNS A;  4OLG A;  1Q2P A;  4N9L A;  2EFX A;  1NRF A;  4PPR A;  5EEC A;  3GR2 A;  3Q7Z A;  4OON A;  5FI6 A;  1K56 A;  2XD1 A;  4JXG A;  5FSR A;  4GDB A;  5E2E A;  3IWI A;  1BZA A;  5TGF A;  2G2U A;  4QJG A;  2FFF B;  3NIA A;  3B3X A;  3VP3 A;  2Z2M B;  3AGF A;  4XXR A;  2EX2 A;  4K0X A;  1HD8 A;  2JE5 A;  1IEL A;  3IQA A;  4ZBE A;  2XH9 A;  3UN7 A;  4ZJ1 A;  4OKP A;  4DXC A;  3BRM A;  1FSY A;  1YLZ A;  1GA9 A;  4P6B A;  2WAF A;  3IHB A;  4R3B A;  5CEC A;  3GMW A;  5CGW A;  5CTM A;  1QMF A;  1K55 C;  1HZO A;  3SS3 A;  5A92 A;  4KG6 A;  1K54 A;  3ZHH A;  1ERO A;  3Q82 A;  1C3B A;  3HL9 A;  1GA0 A;  1YQS A;  4OQH A;  2HDR A;  2WAE A;  3LEZ A;  3HUN A;  3ZNT A;  3IXG A;  3Q7V A;  5CHU A;  1RGY A;  3HLE A;  4OVD A;  2XGN A;  2CC1 A;  3ZG8 B;  2HPB A;  1E4D A;  4KZ8 A;  2Z2L B;  1ES5 A;  3DTM A;  3VP0 A;  2PU2 A;  3UE1 A;  3M2K A;  1JTG A;  3IF6 B;  3PBO A;  3Q1F A;  4KZA A;  3IXB A;  2XLN A;  4GN2 A;  4P0M A;  1ES3 A;  3VOY A;  4PM6 A;  5DTT A;  4O7D A;  5E43 A;  1NJ4 A;  3UY6 A;  3V3R A;  2H10 A;  4LV3 A;  1CEF A;  3PAG A;  2ZMA A;  5DF9 A;  3M6H A;  4WZ5 A;  3VMA A;  2QZ6 A;  2WZX A;  3MBZ A;  2E8I A;  5CER A;  3IH9 A;  2ZM2 A;  4R1G A;  4EBN A;  2X01 A;  3CMZ A;  1KVL A;  1MKI A;  5DF8 A;  3EQV A;  4KZ7 A;  4MLL A;  5AQ9 A;  4M3K A;  3VSL A;  1XA1 A;  2WK0 A;  3Q7V B;  3LY3 A;  1MPL A;  1MWU A;  1O7E A;  1SDE A;  4N9K A;  2EXB A;  4ZJ2 A;  3OPL A;  4N1H A;  4S2P A;  1S0W A;  1TEM A;  3G31 A;  3PBN A;  2UWX A;  2DCF A;  4U0X A;  1LI0 A;  2WUQ A;  2ZC5 B;  4ZTK A;  4MBF A;  5CHJ A;  3ZVT A;  4BD1 A;  2Y2J A;  4FH2 A;  5M19 A;  3MXS A;  4KZ5 A;  4MBK A;  1L0F A;  3MZD A;  1ES4 A;  1W7F A;  5EVI C;  1PZO A;  1XPB A;  3BYD A;  4JBF A;  1LL9 A;  1YT4 A;  2Y2Q A;  5GLC A;  3OPP A;  5BOH A;  3P09 A;  4R4R A;  2P9V B;  1MWR A;  1IKI A;  4GDN A;  2Y2I A;  3HBR A;  1KE4 A;  1L0D A;  3VFF A;  1K6S A;  4E6W A;  1PW1 A;  1PZP A;  3NC8 A;  3OC2 A;  3OZH A;  3IWO A;  5EOE A;  3HLB A;  5FAP A;  3WWX A;  4OP8 A;  4KQR A;  5F1G A;  1K56 D;  3HLF A;  4EQI A;  2ZM0 A;  2H0T A;  2IWC A;  2ZC7 A;  5FQM A;  3W8K A;  3Q81 A;  3OPR A;  5FI7 A;  1I2W A;  3MZE A;  1G6A A;  5GLB A;  1NXY A;  4KQQ A;  3BEB A;  2J8Y A;  1FR6 A;  2C5W B;  3N8S A;  2WKH A;  1LL5 A;  2X71 A;  4OLD A;  2RCX A;  4KEN B;  4ID4 A;  1YLP A;  4WEJ A;  1XP4 A;  1PWD A;  4XUX A;  5HAP A;  1IEM A;  2J9P A;  4HBU A;  3ZGA B;  4ZAM A;  1WE4 A;  1XX2 A;  3A3E A;  3AGD A;  2Y55 A;  3TSG A;  2X02 A;  1IYQ A;  2EX6 A;  4P85 A;  4Y7P A;  5FAO A;  1ESI A;  3M2J A;  2XK1 A;  3UDX A;  2EX8 A;  1IKG A;  1KVM A;  3UPO A;  4E3M A;  3MKE A;  3FV7 A;  3S4X A;  1FCM A;  4X56 A;  5G18 A;  4B4Z A;  1H5X A;  2HDQ A;  3C4P A;  5CHM A;  3UDF A;  2C6W B;  2IWB A;  5GHX A;  2Y2H A;  4Y0U A;  3OCL A;  1FSW A;  3G4P A;  3N7W A;  1MWT A;  4DRT A;  2I72 A;  3DWK A;  1BTL A;  3IWQ A;  3ZCZ A;  1PWG A;  3S1Y A;  3IF6 A;  3RXW A;  4YFM A;  3PAE A;  5L2F A;  1VQQ A;  3V39 A;  5KMW A;  3IH8 A;  4D2O A;  4KZ9 A;  1ALQ A;  4IBX A;  5EVI B;  4EV4 A;  4C3Q A;  1SHV A;  4KZ6 A;  5HL1 A;  1LLB A;  2WKE A;  2A3U A;  3WS0 A;  1FQG A;  2OLU A;  2JC7 A;  5A90 A;  1O07 A;  1ES2 A;  4X69 A;  5HX9 A;  4JF6 A;  1M40 A;  3HVF A;  4H8R A;  3GRJ A;  1FR1 A;  4U0T A;  2HDS A;  4WBG A;  1YM1 A;  4LEN A;  3ZG7 B;  4F94 A;  4KQO A;  2B5R A;  4S2M A;  1TVF A;  3G35 A;  3ITA A;  1TDG A;  3O86 A;  4OQG A;  4OPQ A;  2J7V A;  4JF4 A;  1ZC2 A;  4XUZ A;  1W8Q A;  4MBH A;  1BLP A;  1LHY A;  3PBQ A;  1PIO A;  1YLJ A;  1SKF A;  1KDS A;  5GHZ A;  2WGV A;  4QY5 A;  2ZD8 A;  2R9W A;  3PTE A;  3VP2 A;  2ZM8 A;  2R9X A;  4R0Q A;  4S2L A;  4BD0 A;  4E3O A;  5GLD A;  3LO7 A;  4PMA A;  1E25 A;  1XKZ A;  2OSU A;  3S22 A;  4E3J A;  4QY6 A;  3ZFZ A;  3G30 A;  1MBL A;  4DDS A;  5J8X A;  2P9V A;  3NY4 A;  1GCE A;  3I7J A;  4N92 A;  1WYB A;  2ZQ9 A;  4ZJ3 A;  1ESU A;  5JYP A;  3FKV A;  3V5M A;  1YMX A;  5DVA A;  3AGE A;  2P74 A;  4UHU A;  4MNR A;  1HVB A;  1K55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...