3E2LA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carbapenemase
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 93
structure length 260
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2lA00
3HUOA 4UAAA 4X6TA 3BECA 5AQ9A 3GR2A 1ALQA 4JF6A 4F94A 1BSGA 2XD5A 2ZQDA 4KG6A 5EVIC 2H0YA 3V3RA 3VFHA 3DW0A 3IH9A 4GD6A 4JXVA 4PM6A 3NBLA 3GVBA 1S6RA 4KQRA 1Z6FA 4OONA 2IWDA 1QMEA 3UDFA 3GSGA 4WEJA 4E6WA 4K0WA 1FCMA 5EOOA 4R0QA 4UA6A 1ES3A 4KZ3A 4WMCD 4S2KA 2Y2MA 4PMAA 3A3JA 3I7JA 4S2NC 1KE0A 5AQAA 5CHJA 2VGJA 1IEMA 1FR1A 2ZLYA 1BT5A 4S2OA 1WYBA 2Y2NA 1ZC2A 2EX6A 4KZ6A 3O3VA 3W4QA 3HBRA 4DXBA 3G32A 1WE4A 3G34A 1CI9A 1N9BA 4LV0A 1KE4A 2CC1A 1KE3A 4QY6A 1LI9A 1YMXA 2EX8A 2ZC5B 1RGZA 4R23A 3NIAA 3IF6C 3Q7VA 4L0LA 3ZVTA 3AGEA 3IWQA 3M2KA 4JF5A 4KZ8A 4BQMA 4R1GA 3DWZA 1MBLA 4NK3A 4X68A 2EFXA 3RXWA 1CK3A 1XP4A 3MXRA 3N8SA 1IYQA 4OOLA 2V20A 1I2WA 2UWXA 4ID4A 3HLGA 1GCEA 1E3UA 1ZG4A 3G31A 3E2KA 4OP8A 1PYYA 1ESUA 4IEDA 4EUZA 4FCFA 1M40A 1E4DA 3P09A 1K57C 4MLLA 2PU4A 3M6HA 5FI6A 4GD8A 3LEZA 4GB7A 5CXWA 2HP9A 4GKUA 3IHAA 3EQVA 2Y2LA 4S2LA 5DTKA 3MZDA 4M3KA 3NDGA 3S22A 1NYYA 1TDGA 3NDEA 3HLBA 3AGDA 2WKEA 1MPLA 5KSHA 1JTGA 2GDNA 3D4FA 3OPHA 4DF6A 2XR0A 1IYSA 2A3UA 4YFMA 4LV3A 3ZGAB 4HESA 1YLJA 1I5QA 4ZJ3A 2P74A 5F1FA 4OPZA 3S1YA 5FA7A 5A91A 2JC7A 3HLDA 2V1ZA 3PAGA 3Q07A 3IQAA 2WAFA 3IXGA 1PW1A 1EWZA 3N4IA 1KVLA 3UE0A 1CEGA 4HBTA 4EBLA 1W7FA 2XQZA 4XXRA 5E2GA 4DKIA 4E3OA 3GMWA 1ES2A 3UPNA 4OLGA 4OVDA 1RGYA 2ZMAA 1L0GA 1JWPA 2ZC6B 4FSFA 2C5WB 1PI5A 1XA1A 1BZAA 3LCEA 4RYEA 5FAQA 3ZNYA 5HW3A 2Y2HA 3N7WA 4OPRA 2H10A 5DF8A 5CRFA 1K54C 3A3EA 1PWCA 4QY5A 3Q82A 1DJCA 3G4PA 3BFDA 3C7UA 2WK0A 5JYOA 2Y2OA 3HL9A 1ERMA 1YQSA 2VGKA 3UN7A 1L0EA 5FATA 1YLZA 3QNBA 4EQIA 1H8ZA 3BFFA 4YINA 1YMSA 4QJGA 3M2JA 2JE5A 3OPRA 1K25A 1YM1A 1YLTA 4S2PA 1NY0A 4OQ0A 3M6BA 5U47A 5A90A 3TG9A 4BL2A 5AQ7A 4OQHA 5CGXA 5F83A 3HVFA 4OH0A 5IHVA 2PU2A 1MWRA 4WYYA 3ZG9B 5GHXA 4KZBA 2RL3A 3MXSA 1LL5A 3IF5A 4Y0TA 2J8YA 5M19A 1ES4A 4P6BA 3G2YA 4WELA 4O7DA 4JKTA 5FAOA 4C75A 3RXXA 4LV1A 1WYCA 2ZQCA 3VSKA 4Y0UA 5EVIA 1AXBA 3ZG5A 3DTMA 5D3OA 1HVBA 4MBHA 2P9VA 1OMEA 1PWGA 4N1HA 3O88A 1PWDA 1TDLA 3N6IA 4KZ7A 3UE3A 4E3NA 3BEBA 4ZDXA 2XEPA 3CMZA 3HLWA 1YLPA 3UNWA 1CI8A 4BD0A 1S0WA 1ZKJA 2XF3A 2ZQ9A 3ZG7B 2J9OA 1FCOA 5GL9A 1DY6A 3WS4A 5EECA 5FI2A 1XXMA 2DNSA 4KZ4A 2XH9A 4FD8A 1GA9A 4QB8A 5FQIA 5GLAA 4LCLA 1GA0A 4DE1A 2OLVA 3QNCA 4KZ9A 3V5MA 3WS0A 5F1GA 4N1XA 4N92A 4GZBA 3ZDJA 3QHYA 1DJBA 5I94A 2OLUA 5DF9A 1HD8A 3ZVWA 2FFFB 2JBFA 1BLHA 4WEKA 2Y2IA 1ESIA 4JLFA 4WZ5C 2BG1A 2XLNA 4ZAMA 3WRTA 3Q81A 1NXYA 4DE2A 4MEZA 1M6KA 4P0MA 3IWOA 4HEFA 1FSYA 3NCKA 1K6SA 3G2ZA 3B3XA 3BM6A 3P98A 2J7VA 4DDYA 4OOYA 4U0XA 4RX2A 4DRTA 1PI4A 2WGWA 4R3BA 1G6AA 4X69A 3CJMA 5EUAA 2HDSA 4GDNA 2X71A 4UA9A 1K57A 3IXDA 3LO7A 2ZJ9A 3MZEA 1K38A 4D2OA 1LI0A 2P9VB 5CHMA 1NRFA 2Y2GA 4PM8A 4Z9QA 4DXCA 3ITBA 2H5SA 1VQQA 2Y59A 1BLSA 1LL9A 2WYXA 3FWLA 5FQKA 5F82A 5HAQA 1SDNA 3OCLA 3W8KA 4EWFA 3VP3A 3FZCA 2B5RA 3C7VA 4N9KA 2QPNA 3MBZA 1K56A 3VP1A 5CTMA 5DTSA 4RVAA 1K55A 5GLBA 3ZCZA 4E3MA 4Q8IA 4A5RA 4KENB 1JTDA 5CGSA 1FR6A 3CG5A 4EBPA 5BOHA 4IBXA 5DF7A 4K0XA 4B4ZA 4EV4A 5JYPA 4JXSA 3AGFA 1LHYA 2ZQ7A 4MBFA 1TEMA 3UDXA 1IYPA 2RCXA 5GLCA 4B4XA 2R9XA 1RP5A 3SS5A 1FCNA 3Q1FA 4KQOA 2Z2MB 1XA7A 3BFGA 3NY4A 1JWVA 1U60A 4JXWA 3Q7VB 3GQZA 3WS5A 1NZUA 5CHUA 3MKFA 1XPBA 3PBTA 4N9LA 4OP5A 4U0TA 3SS3A 2Y2KA 4OQGA 2HDQA 2WGWB 3HREA 3TSGA 3VSLA 4UA7A 4R3JA 5EE8A 2A49A 3UE1A 4MBKA 1IELA 4BLMA 4E3KA 1ONHA 2JCHA 3OPPA 4S2IA 5DTTA 5EOEA 3WRZA 1NJ4A 1BUEA 1YLWA 2ZQ8A 1SHVA 1FOFA 3NC8A 3PBNA 1K4FA 3MZFA 3SH9A 2QZ6A 4ZBEA 4PM5A 3ITAA 4OLDA 3Q7ZA 1W79A 4JPMA 5TR7A 4OKPA 1SDEA 5FQMA 4R4SA 4B88A 4BJPA 4KQQA 3W4PA 4ZJ1A 3OC2A 1GHMA 3E2LA 5HAIA 1XGIA 3BFEA 5CECA 4IVIA 1FQGA 5HL1A 1MXOA 3FKVA 1GHIA 4OOMA 5E2EA 4E3IA 2ZC4B 3UY6A 2EXBA 1IKGA 3BLMA 2XGNA 1HZOA 3C4PA 1EI5A 1H8YA 1TVFA 3CZDA 3UPPA 1I2SA 1W8QA 2HDUA 1XX2A 3MKEA 5EVLA 3WS1A 1PZOA 2PBYA 3PBSA 3ZG0A 4QD4A 4WMCA 3W4OA 4XUZA 4KG5A 4S2NA 2ZQAA 5CTNA 4RA7A 1IYOA 4NETA 2WKHA 3JYIA 1Q2PA 2BLSA 4PM9A 4Y0OA 2V2FF 3FKWA 4WZ5A 2J9PA 2DCFA 4KG2A 5EVID 3GRJA 5AQBA 3VOZA 2WZXA 2Y91A 1ERQA 1H5XA 2HP5A 5FSRA 3IF6A 2EX9A 2QMIA 3HLFA 4K91A 5G18A 3HLCA 1E25A 3HUNA 2XK1A 2ZC7A 1JVJA 5KSCA 1KDSA 2Q9NA 1CEFA 3IT9A 4KZAA 4JF4A 4BL3A 1BLPA 2E8IA 2WGIA 3IWIA 3WS2A 5FASA 3FYZA 3PBQA 1ZG6A 5J8XA 3V39A 2C6WB 1EROA 5FQQA 3V50A 4PM7A 1YLYA 2WUQA 3O86A 4EBNA 1LLBA 5EVIB 1QMFA 2EX2A 4BD1A 1N4OA 3IXBA 1O07A 4OQIA 1RCJA 4CPKA 2HP6A 3S4XA 3G35A 4XUXA 5FAPA 2WADA 1XKZA 4U3TA 4DE3A 2WGVA 4R4RA 4OPYA 3PBRA 4CJNA 2HPBA 3IXHA 3ISGA 4LENA 5GHYA 4DE0A 2ZM0A 4WM9A 3A3IA 3BFCA 5TFQA 3A3DA 2Y2JA 5A92A 4QHCA 3SS4A 1MY8A 2XD1A 1W8YA 2IWBA 3C5AA 4FH4A 4WZ4A 1BULA 1E3UD 2WKIA 2DRWA 4GN2A 1ONGA 2EFUA 4JBFA 4FH2A 5HX9A 2Y4AA 1G68A 4OPQA 3GV9A 1ES5A 2G2WA 3N8LA 5CERA 1YT4A 1J9MA 1PZPA 1PIOA 2OSUA 4RX3A 1O7EA 5CEDA 4X53A 3IF6B 5HFOA 2OV5A 1Q2QA 1KDWA 3V3SA 3ZHHA 3ZFZA 4WBGA 3SH7A 4P87A 2XDMA 3IH8A 3UO9A 4C3QA 1K4EA 1K54A 1XGJA 2Y2QA 2ZC3B 3C4OA 5GHZA 4DDSA 3UDIA 4LCMA 4PPRA 3UPOA 4GDBA 3A3FA 3VP0A 4E6XA 5KZHA 4QU3A 1K56D 2XFTA 4S2MA 1MWSA 3SH8A 3TOIA 5HAPA 2ZM2A 3OCNA 1PW8A 2XFSA 1GHPA 3MFDA 3ZNTA 3EQUA 1K55C 4ZTKA 3VP2A 5DVAA 2Q9MA 3RJUA 4E3JA 4MNRA 4ZJ2A 1NZOA 3PBOA 3NI9A 1IKIA 1MWTA 4HBUA 4X56A 1KVMA 5E2HA 2Z2LB 2EXAA 1NYMA 1Y54A 5M18A 4P85A 2H0TA 2G2UA 5E43A 1K6RA 4X55A 3IHBA 5E2FA 2ZM8A 4E3LA 5FI7A 3HLEA 4C6YA 2X02A 3ZG8B 1MKIA 3BYDA 4LV2A 1MWUA 2WAEA 4GNUA 4Y7PA 2Y55A 3VOYA 2FFYA 1KGFA 1L2SA 4KZ5A 5HARA 3SOIA 3VMAA 3DWKA 5EPHA 2X01A 5GLDA 1SKFA 3HUMA 5CEBA 3G30A 1BLCA 1HTZA 3OPLA 5KMWA 4UHUA 3N8RA 3WWXA 1L0FA 4IVKA 1KGGA 3GTCA 1L0DA 1DJAA 1KGEA 5FQJA 2ZD8A 3PTEA 2WZZA 4IBRA 5M1AA 1SCWA 3PAEA 4JXGA 2IWCA 3VP4A 2I72A 5TGFA 3OZHA 1W5DA 5CGWA 1BTLA 3LY3A 2Y2PA 5A93A 3LY4A 2HDRA 1FSWA 3FV7A 4BENA 1VM1A 4S2JA 5L2FA 3O87A 1JWZA 2R9WA 3BLSA 1C3BA 4GOGA 5FDHA 5FQ9A 3BRMA 4H8RA 3VFFA
chains in the Genus database with same CATH superfamily
3BECA 3GR2A 5CX7A 2NUTC 2ZQDA 4KG6A 5EVIC 4KQRA 4Q0IA 4WEJA 4K0WA 1FCMA 3C38A 4PMAA 3A3JA 2PT7A 3UE6A 2W3EA 2L1MA 2ZLYA 1BT5A 4S2OA 1G6OA 5L07A 3W4QA 3HBRA 3U4LP 4I39A 5L10A 2JN7A 2WKPA 4DJ2A 1KE3A 1LI9A 1YMXA 3IF6C 3Q7VA 3ZVTA 4ME4A 3IWQA 3M2KA 4LPZA 5DJUA 3E98A 5TBMB 1I2WA 2UWXA 1E3UA 5AVEA 1ESUA 2JHEA 4CLCE 1M40A 2HZ5A 4GCZA 5CXWA 2UV0E 3NDEA 1T1AA 3F1NB 1H0MA 5HDSA 2GDNA 3OPHA 1IYSA 3E4OA 1PNEA 3CPTA 1BYWA 4OPZA 1DP8A 5FA7A 1YAXA 3Q07A 4XXRA 3UPNA 4GJ4A 1L0GA 1BZAA 4RYEA 4ESPA 4OPRA 2H10A 5DF8A 1DJCA 3BFDA 4EXOA 3R7WA 1YLZA 2XA7S 4QJGA 2KOIA 1W63M 4S2PA 5IU1A 2PRFA 3TG9A 4BL2A 1H8MA 5F83A 5IHVA 2J80A 1D06A 4KZBA 3IF5A 2VX8A 5M19A 3BQAA 4P6BA 5HPFA 4JKTA 4C75A 2ZMVA 2ZQCA 2V0WA 1HVBA 5DJTA 3K2NA 2QYBA 3DTEA 3BEBA 3CMZA 3HLWA 3IX4A 1Z09A 1FCOA 3WS4A 5EECA 1XXMA 5GLAA 4LCLA 1GA0A 3WS0A 3QP1A 5F1GA 4R6LA 5I94A 4PAUA 1BLHA 4JLFA 3EOIA 4DE2A 2ZOHA 3NULA 2D02A 4LRXC 3IWOA 3NCKA 4U0XA 4RX2A 1W63Q 2PYPA 4GLQA 3CJMA 1F5MA 4O0PA 1CJFA 4L9EA 4D2OA 1LI0A 5CHMA 4Z9QA 4DXCA 2Y59A 1LL9A 4BMWA 2B02A 2K2NA 3IX3A 5F82A 1SDNA 3W8KA 1XJ2A 3FZCA 2B5RA 4LFUA 5FL3A 4EERA 4X1LA 2QPNA 3VP1A 1N9LA 5DTSA 3ZCZA 4H6JB 1JTDA 4NKPA 5JYPA 2B95A 1G5UA 1S4SA 4MBFA 4UQIS 5HPIA 1F9IA 4Y5FA 2R9XA 4ARZB 1STZA 3Q1FA 4KQOA 2Z2MB 1XA7A 3Q7VB 1NZUA 3SS3A 1S4RA 4UA7A 2A49A 4MBKA 4E3KA 1YLWA 2ZQ8A 3LR4A 3NC8A 2VEAA 3E4QA 3MZFA 3ITAA 3LIEA 5TR7A 1W79A 3QP6A 2WKQA 1SDEA 4KQQA 3JVVA 4ZJ1A 3OC2A 4KUKA 4DMZA 1GHMA 3FKVA 3UMEA 4OOMA 3O5YA 3UY6A 2EXBA 4EEPA 2XGNA 1HZOA 3QP2A 5L09A 1VB6A 3CZDA 1CF0A 4YWZA 1PZOA 4PKYG 4QD4A 4WMCA 3SW1A 3CHWP 3VE4A 1IYOA 1LSXA 3KSIA 2WKHA 3JYIA 1Q2PA 4PM9A 3FKWA 2J9PA 5EVID 4KG2A 3R7WB 1DRMA 4G3KA 1SKOA 3KYZA 4JGOA 2WZXA 3VOZA 2Y91A 4Y13A 3IF6A 3LIFA 3HLFA 1E25A 3ZQ5A 1NLYA 4KZAA 1P9WA 3FYZA 3PBQA 5J8XA 4HH2A 2MJ6A 2NUPC 1YLYA 4X1MA 2EX2A 1N4OA 3B42A 1O07A 4OQIA 1T1BA 4CPKA 3S4XA 2PR5A 4DE3A 2WGVA 5GHYA 2A24B 4B93A 1MY8A 1W8YA 2IWBA 4WZ4A 2WKIA 1ONGA 1EW0A 5HX9A 4NG2A 3N8LA 5K5BA 4RX3A 5HFOA 1KDWA 3ZHHA 3MQ0A 1K4EA 2Y2QA 3C4OA 4DDSA 4WN5A 4PPRA 3UPOA 2XFTA 4Y3IA 1A0KA 1PW8A 1GHPA 3MFDA 3ZNTA 3EQUA 4MNRA 4ZJ2A 1NZOA 5E2HA 1NYMA 5M18A 3MSHA 5E43A 1K6RA 5E2FA 1S67L 5FI7A 2VKSA 4LV2A 4QPRA 2WAEA 4Y7PA 2Y55A 3VOYA 1KGFA 4KZ5A 3SOIA 3DWKA 3HUMA 4WUJA 1BLCA 1HTZA 3N8RA 3WWXA 1Y4OA 4CLCA 1KGEA 4IBRA 3PAEA 4JXGA 1X0OA 2VV7A 1FSWA 1VM1A 4HIAA 3O87A 1C3BA 4GOGA 3BRMA 3VFFA 2EA9A 5EM0A 5AQ9A 1VETB 1ALQA 4F94A 1BSGA 4ZRRA 3VFHA 3DW0A 4GD6A 1S6RA 4OONA 3W2ZA 1QMEA 3GSGA 4E6WA 3F1NA 4R0QA 4HJ4A 3T1SA 2M1CA 5A8BA 1KE0A 2GX5A 5CHJA 2W3GA 1FR1A 5L8MA 3OLOA 2EX6A 4KZ6A 3G32A 1WE4A 5FEFA 1CI9A 2EWVA 1N9BA 4LV0A 4Y15A 2JKTI 4IJGA 3NIAA 3E4PA 4EESA 2O99A 3H9WA 4JF5A 4Z1WA 1MBLA 2EFXA 3RXWA 3CLOA 1XP4A 3N8SA 1ZG4A 3NOUC 2VK3A 3G31A 4OP8A 4IHQA 4M4XA 4I3AA 4HHDA 3QP4A 4EUZA 1T1CA 2W1RA 2PAVP 5FI6A 1OTAA 4ETZA 4FTXA 5HDCA 4GD8A 3LEZA 4GB7A 3ICYA 2Y2LA 5DTKA 3MZDA 1OTBA 4M3KA 3S22A 1DP9A 2XR0A 4DF6A 2A3UA 3ZGAB 4LV3A 2P74A 4P6ZM 4NXEA 3EGXC 2JC7A 3HLDA 2V1ZA 3A0VA 4Y2FA 3N4IA 1EWZA 4EBLA 1KVLA 5HSQA 4EW7A 2XQZA 4DKIA 4PKYA 2DMWA 3F1PA 1ES2A 4OLGA 4OVDA 2ZMAA 5G4ZA 4O01A 1JWPA 1N9NA 3LCEA 4BBUA 3N7WA 3T4LA 1K54C 3A3EA 3C30A 4QY5A 2CMNA 2WK0A 1ERMA 1GSVA 4EQIA 1H8ZA 3K3CA 1YMSA 2JE5A 3OPRA 1NY0A 3M6BA 4OQHA 3HVFA 1MWRA 3MXSA 1OT6A 4O7DA 5DFXA 5FAOA 3RXXA 1ZHHB 4LV1A 1AXBA 3ZG5A 3DTMA 5D3OA 5J4EA 3K3DA 1TDLA 4KZ7A 3A0SA 3T4KA 1YLPA 2XF3A 2XH9A 4FD8A 3CAXA 3LGOA 5FQIA 4H6JA 2VGLM 2OLVA 3A0RA 3QNCA 4KZ9A 1WA9A 3OBFA 5HDDA 4N92A 2ZMFA 3ZDJA 3NOPC 5DF9A 2FFFB 1ESIA 4ARZA 3TE8A 3Q81A 1NXYA 2OAQ1 4P0MA 2FZ0A 4CLCB 4DDYA 2J7VA 4HP9A 4DRTA 3HJKA 2X71A 4UA9A 1NWZA 5I5LA 2KLIA 2ZJ9A 3MZEA 2P9VB 1LSWA 2P04A 3ITBA 1VQQA 4HNBA 3C2WA 5CTMA 4E3MA 4A5RA 4KENB 5HWTA 3UB9A 4K0XA 3TRCA 4X25A 2RCXA 5GLCA 4WL9A 1RP5A 4ETXA 3BFGA 3NY4A 5LBRA 2GNXA 3MKFA 4OP5A 1TF1A 4U0TA 4OQGA 2HDQA 2FH5A 2WGWB 4BBVA 3VSLA 2PHYA 1OJGA 4XT2A 1IELA 1ONHA 3OPPA 4S2IA 1NJ4A 4JGRA 1BUEA 4Q0HA 4FOFA 1K4FA 3SH9A 2W27A 3EEAA 3Q7ZA 4OKPA 1XJ4A 5FDSA 3JPUA 5FQMA 3T4OA 4BJPA 4EETB 3LUQA 2ZBBA 4WF0A 1OTEA 1FQGA 2J3TD 1MXOA 2HV1A 1GHIA 4HI4A 2PYRA 4EQ1A 3R4KA 3UPPA 1W8QA 3F1PB 3PXPA 5EVLA 3F1OB 3PBSA 3IS2A 3ZG0A 3W4OA 4CLCC 4XUZA 4KG5A 2ZQAA 2A24A 2YKHA 2J3WA 2BLSA 3NJAA 2V2FF 4WZ5A 5AQBA 3GDIA 3LYXA 2HP5A 1XFNA 3UMDA 5F69A 2QMIA 2Q0OA 5KSCA 1KDSA 2Q9NA 2O9AA 1CEFA 4MN7A 4BL3A 2E8IA 3TW8A 2HJEA 3D72A 3HCYA 5FQQA 4PM7A 2WUQA 1S66L 4BD1A 1RCJA 2HP6A 5FAPA 1H3QA 4OPYA 3TJZC 3PBRA 5AVFA 2V8CA 2ZM0A 3A3IA 3BFCA 5TFQA 5A92A 4QHCA 3LIAA 3P7NA 4GN2A 2EFUA 4JBFA 2Y4AA 1G68A 4OPQA 3RH8B 2G2WA 5CERA 3EWKA 1YT4A 1J9MA 1PZPA 3LICA 1IFQA 5CEDA 5EFWA 4I5SA 2XA7M 3SH7A 4P87A 3IBJA 1K54A 4LCMA 3VP0A 1FIKA 3SH8A 4ZTKA 1K55C 2PDRA 4NXBA 2Q9MA 3FG8A 1VETA 3LR5A 3VOLA 4LLOB 3PBOA 3NI9A 1IKIA 1XJ6A 1KVMA 2EXAA 1Y54A 3MFXA 4P85A 1P97A 2GJ3A 3IHBA 3S7PA 2K31A 4C6YA 2X02A 3NECA 3ZG8B 1MKIA 3BYDA 2HF6A 2INWA 3C8CA 3VMAA 5EPHA 3OPLA 4IVKA 3GTCA 4R3AA 2OAP1 3VP4A 2I72A 4Y17A 5A93A 3MF0A 2ZL1A 4H8RA 2BTFP 2ACGA 4XT2B 3HUOA 4X6TA 4LGWA 3L7HA 5HZHA 2LB9A 1Z6FA 2IWDA 3LI8A 3UDFA 3QP5A 4UA6A 4KZ3A 4WMCD 4S2KA 2Y2MA 3I7JA 3PHYA 2VGJA 1IEMA 4MMNA 1WYBA 4F3LA 2P7JA 3O3VA 4DXBA 1KE4A 4QY6A 2EX8A 2ZC5B 4R23A 3AGEA 3LEQA 4KZ8A 3DWZA 3T4QA 1CK3A 3IS2B 3T1QB 3MXRA 4OOLA 1IYQA 2V20A 4ID4A 1GCEA 1PYYA 1E4DA 3P09A 4GS9A 1PRQA 2PU4A 3BWLA 3M6HA 3IHAA 3EQVA 2W0NA 3NDGA 1NYYA 4CQHA 3DAVA 1TDGA 5KSHA 4HESA 1YLJA 1I5QA 5F1FA 5F68A 3S1YA 1TS7A 1LSVA 4MCWA 3PAGA 3IQAA 1YPRA 2WAFA 1CEGA 4HBTA 1W7FA 4E3OA 5E2GA 3MXQA 3ULFA 3GMWA 4L9GA 2ZC6B 5J3WA 3ZNYA 5HW3A 3D3OA 5CRFA 1F2KA 5JYOA 3HL9A 2VGKA 3UN7A 1L0EA 5FATA 3BFFA 4YINA 3BJNA 4YOFA 1OJ5A 1K25A 1YM1A 4OQ0A 5A90A 5CGXA 1VEUA 4E04A 3T1RA 4P6ZS 2P08A 1LL5A 4R38A 4Y0TA 1ES4A 2V9AA 3G2YA 4WELA 3RFBA 3JVUA 1WYCA 3VSKA 4Y0UA 4MBHA 2P9VA 1OMEA 3N6IA 3UE3A 1TS6A 3SZTA 3T4TA 2XEPA 1CI8A 1S0WA 2KX6A 3ZG7B 2ZQ9A 2J9OA 3KX0X 3MQQA 5GL9A 1DY6A 4I3JA 2Z6CA 2DNSA 4HOIA 1G28A 1GA9A 4QB8A 4JGPA 1Y28A 3MR0A 4N1XA 4GZBA 3KSHA 2OLUA 1HD8A 3P01A 2Y2IA 3VV4A 4WZ5C 2BG1A 4ZAMA 3WRTA 3G2ZA 3BM6A 2JKFA 5HWWA 2WGWA 4R3BA 1G6AA 4X69A 2HDSA 3LI9A 3H7WB 4GDNA 1K57A 3U2AA 3IXDA 2VV6A 5KIZA 1K38A 2ZL1B 5C5KA 3V67A 2Y2GA 4PM8A 3S7OA 2H5SA 5DFYA 2WYXA 3FWLA 5FQKA 1ODVA 1XFQA 2XRNA 3OCLA 1T19A 3C7VA 4N9KA 1K56A 4RVAA 1K55A 4Q8IA 3QP8A 3S7NA 1FR6A 4EBPA 4B4ZA 2K7SA 4JXSA 1UGUA 2ZQ7A 1TEMA 2W1TB 4F3LB 1IYPA 4B4XA 4R70A 4G3WA 2VLGA 1FCNA 1P9RA 1JWVA 3F1OA 1U60A 3S7QA 3WS5A 5CHUA 3PBTA 4N9LA 1K0KA 2Y2KA 1YSQA 3HREA 3TSGA 4HQAA 4R3JA 5EE8A 4BLMA 5EOEA 2V1AA 5EV0A 1JNUA 2E8JA 1SHVA 4GHIB 4GS9B 3PBNA 3B47A 4ZBEA 4PM5A 4OLDA 4HJ6A 4B88A 4I38A 2G7UA 2XROA 3E2LA 1XGIA 5CECA 5HL1A 4E3IA 2ZC4B 3BLMA 3C4PA 1TVFA 2HDUA 1XX2A 3LR0A 5CTNA 3T4SA 1N9OA 2AVXA 2OOLA 1D7EA 2DCFA 1YKDA 3NHQA 2Z6DA 2O0YA 2I9VA 1ERQA 5FSRA 4L9FA 4HJ3A 4K91A 3HLCA 3HUNA 2XK1A 1VEUB 2ZC7A 2QKPA 1JVJA 3IT9A 4JF4A 5FASA 2Y8HA 4NEED 2H28A 1EROA 3V50A 2V8FA 3O86A 4EBNA 1LLBA 3IXBA 4IUHA 4XUXA 2WADA 4U3TA 1FILA 1UWPX 3B33A 3IXHA 4LENA 4DE0A 4DJ3A 3KO6A 5AJGA 4AFIA 1TS8A 2QJ5A 3SS4A 2XD1A 3C5AA 4FH4A 2B18A 1E3UD 2DRWA 3BQ8A 4FH2A 3VE3A 4D60A 1O7EA 2VJWA 2ZOIA 3E0YA 4LRYC 1Q2QA 3ZFZA 2PBDP 4WBGA 2XDMA 3IH8A 4C3QA 5GHZA 1XGJA 2ZC3B 4GDBA 3A3FA 5HL6A 4E6XA 3LIDA 5HAPA 3TOIA 1D1JA 3RTYA 3RJUA 2PD8A 4E3JA 5F5YA 4HBUA 1KOUA 2Z2LB 3FPVA 2H0TA 4B9OA 3CITA 3CWFA 4E3LA 3HLEA 2PR6A 5FEGA 4GNUA 2Y79A 2OWJA 2FFYA 1L2SA 5TJJA 2X01A 5GLDA 1SKFA 5CEBA 1VHMA 4UHUA 1KGGA 1L0DA 5FQJA 2WZZA 5M1AA 3OZHA 5CGWA 1BTLA 2Y2PA 3FV7A 4BENA 2M7VA 5L2FA 1JWZA 1MKMA 4QWOA 5FDHA 3CI6A 4UAAA 4MDZA 4JF6A 2XD5A 2H0YA 3V3RA 1MC0A 3IH9A 4JXVA 4PM6A 3NBLA 3GVBA 2M7UA 2A2LA 5EOOA 1ES3A 2R78A 4S2NC 5AQAA 1DP6A 2Y2NA 1ZC2A 2IA2A 2OWHA 4FUWA 5DKLA 3G34A 2CC1A 1RGZA 4L0LA 4BQMA 4R1GA 4X68A 4NK3A 2W3FA 3HLGA 3E2KA 1LT0A 4IEDA 4FCFA 2JKRI 1K57C 4MLLA 4II7A 2HP9A 4GKUA 1V9ZA 4S2LA 4LRZE 3HLBA 3AGDA 3MS6A 4MN6A 3FC7A 2WKEA 1MPLA 1JTGA 3D4FA 2W3DA 4YFMA 2W3HA 3CUEA 5HD5A 4ZJ3A 2YKFA 5A91A 2JKTM 4BBTA 3IXGA 1PW1A 3UE0A 1LL8A 1RGYA 4FSFA 2C5WB 2BASA 3EGDC 1PI5A 1XA1A 5FAQA 2Y2HA 4EUVA 1PWCA 3Q82A 3G4PA 3C7UA 4KQDA 2Y2OA 1YQSA 3PYPA 3QNBA 1CQAA 3L9KA 3T12B 1IOUA 1V9YA 3M2JA 1YLTA 5U47A 4MN5A 2GZAA 5AQ7A 4OH0A 5IT5A 5MC7A 2PU2A 1TS0A 3OOVA 4WYYA 3ZG9B 5GHXA 2RL3A 4KUOA 3LIBA 5J7EA 2J8YA 4Q0JA 1SZVA 3H7WA 3CPTB 3MMHA 5EVIA 3D9YA 4N1HA 3UB7A 1PWGA 3O88A 1PWDA 4E3NA 1P0ZA 3BY8A 5DKKA 4ZDXA 2D01A 4WLAA 3UNWA 4BD0A 1ZKJA 1OPXA 5FI2A 3DBAA 4KZ4A 1NLZA 2VZWA 4DE1A 3V5MA 3LFVA 3QHYA 1DJBA 2W1TA 3ZVWA 2JBFA 4WEKA 2XLNA 4MEZA 1M6KA 4HEFA 4UQIM 1J3WA 1FSYA 1K6SA 3B3XA 3P98A 3H82A 4OOYA 1GSWA 4EU0A 1PI4A 5EUAA 3NOTC 3LO7A 1NRFA 4GHIA 1OT9A 2QJ7A 1BLSA 3MJQA 3KSFA 3IBRA 5HAQA 2VA0A 3VP3A 4EWFA 5EVEA 2EWWA 3ZYTA 3EEHA 3DTIA 3MBZA 5GLBA 2O9CA 3LR3A 5CGSA 2PD7A 3CG5A 5BOHA 4IBXA 5DF7A 4EV4A 1F98A 3AGFA 1LHYA 3UDXA 5IS1A 3G6OA 1NRJA 3SS5A 4UEYA 3T4JA 2V1BA 3FPWA 5HWVA 4JXWA 5G4YA 1OTDA 3GQZA 4RQ9A 1XPBA 3UE1A 5DTTA 2JCHA 3WRZA 4BWIA 4PHTA 1FOFA 2WKRA 1OTIA 1L3LA 2QZ6A 3T1XA 4JPMA 3UB5P 4R4SA 1AWIA 3KYEA 1ZTUA 3W4PA 3HJIA 5HAIA 3BFEA 4IVIA 4NXGA 2HGVA 5E2EA 1IKGA 1HLUP 2J3TC 4JGQA 3DTKA 1EI5A 1H8YA 1I2SA 3MKEA 4CLCD 3WS1A 2PBYA 5HD3A 4S2NA 5TBMA 4RA7A 1ACFA 4NETA 4Y0OA 3GRJA 1H5XA 4NXFA 2EX9A 3MQOA 2L0WA 5G18A 1T18A 3IX8A 4GW9A 3T50A 1BLPA 3PR6A 2WGIA 3IWIA 3WS2A 1ZG6A 3V39A 2C6WB 4O8GA 2JKGA 4G3VA 5EM1A 5EVIB 1QMFA 3G35A 3BY9A 4YNRA 1XKZA 2VV8A 1PFLA 2XSSA 4R4RA 4CJNA 2HPBA 3ISGA 2VGLS 4WM9A 1XJ3A 3A3DA 2Y2JA 2HJ9C 2QWSA 1BULA 3GV9A 1ES5A 1SKOB 1PIOA 2OSUA 4K08A 3IF6B 4X53A 2OV5A 3V3SA 3UB8A 2QHKA 3UO9A 3H82B 3UDIA 4HH3A 5KZHA 4IUKA 4QU3A 1K56D 4S2MA 1MWSA 2V0UA 2ZM2A 3OCNA 2XFSA 3VP2A 4I3IA 5DVAA 3CUEC 4HY8A 1S1YA 3UB6A 1GSXA 1MWTA 1S1ZA 1TD5A 4X56A 3KSGA 2G2UA 2KDKA 3KYQA 2LB5A 4HP4A 4X55A 2ZM8A 2JKRM 5F6AA 1MZUA 1MWUA 5HARA 3G30A 5KMWA 4DN0A 1L0FA 1UWNX 1DJAA 2ZD8A 2O9BA 4EEUA 3PTEA 1SCWA 2IWCA 5TGFA 1W5DA 3GECA 1YSPA 3LY3A 3LY4A 2HDRA 2L4RA 4S2JA 2R9WA 3BLSA 3BW6A 5FQ9A
chains in the Genus database with same CATH topology
3HUOA 4UAAA 4X6TA 3BECA 5AQ9A 3GR2A 1ALQA 4JF6A 4F94A 1BSGA 2XD5A 2ZQDA 4KG6A 5EVIC 2H0YA 3V3RA 3VFHA 3DW0A 3IH9A 4GD6A 4JXVA 4PM6A 3NBLA 3GVBA 1S6RA 4KQRA 1Z6FA 4OONA 2IWDA 1QMEA 3UDFA 3GSGA 4WEJA 4E6WA 4K0WA 1FCMA 5EOOA 4R0QA 4UA6A 1ES3A 4KZ3A 4WMCD 4S2KA 2Y2MA 4PMAA 3A3JA 3I7JA 4S2NC 1KE0A 5AQAA 5CHJA 2VGJA 1IEMA 1FR1A 2ZLYA 1BT5A 4S2OA 1WYBA 2Y2NA 1ZC2A 2EX6A 4KZ6A 3O3VA 3W4QA 3HBRA 4DXBA 3G32A 1WE4A 3G34A 1CI9A 1N9BA 4LV0A 1KE4A 2CC1A 1KE3A 4QY6A 1LI9A 1YMXA 2EX8A 2ZC5B 1RGZA 4R23A 3NIAA 3IF6C 3Q7VA 4L0LA 3ZVTA 3AGEA 3IWQA 3M2KA 4JF5A 4KZ8A 4BQMA 4R1GA 3DWZA 1MBLA 4NK3A 4X68A 2EFXA 3RXWA 1CK3A 1XP4A 3MXRA 3N8SA 1IYQA 4OOLA 2V20A 1I2WA 2UWXA 4ID4A 3HLGA 1GCEA 1E3UA 1ZG4A 3G31A 3E2KA 4OP8A 1PYYA 1ESUA 4IEDA 4EUZA 4FCFA 1M40A 1E4DA 3P09A 1K57C 4MLLA 2PU4A 3M6HA 5FI6A 4GD8A 3LEZA 4GB7A 5CXWA 2HP9A 4GKUA 3IHAA 3EQVA 2Y2LA 4S2LA 5DTKA 3MZDA 4M3KA 3NDGA 3S22A 1NYYA 1TDGA 3NDEA 3HLBA 3AGDA 2WKEA 1MPLA 5KSHA 1JTGA 2GDNA 3D4FA 3OPHA 4DF6A 2XR0A 1IYSA 2A3UA 4YFMA 4LV3A 3ZGAB 4HESA 1YLJA 1I5QA 4ZJ3A 2P74A 5F1FA 4OPZA 3S1YA 5FA7A 5A91A 2JC7A 3HLDA 2V1ZA 3PAGA 3Q07A 3IQAA 2WAFA 3IXGA 1PW1A 1EWZA 3N4IA 1KVLA 3UE0A 1CEGA 4HBTA 4EBLA 1W7FA 2XQZA 4XXRA 5E2GA 4DKIA 4E3OA 3GMWA 1ES2A 3UPNA 4OLGA 4OVDA 1RGYA 2ZMAA 1L0GA 1JWPA 2ZC6B 4FSFA 2C5WB 1PI5A 1XA1A 1BZAA 3LCEA 4RYEA 5FAQA 3ZNYA 5HW3A 2Y2HA 3N7WA 4OPRA 2H10A 5DF8A 5CRFA 1K54C 3A3EA 1PWCA 4QY5A 3Q82A 1DJCA 3G4PA 3BFDA 3C7UA 2WK0A 5JYOA 2Y2OA 3HL9A 1ERMA 1YQSA 2VGKA 3UN7A 1L0EA 5FATA 1YLZA 3QNBA 4EQIA 1H8ZA 3BFFA 4YINA 1YMSA 4QJGA 3M2JA 2JE5A 3OPRA 1K25A 1YM1A 1YLTA 4S2PA 1NY0A 4OQ0A 3M6BA 5U47A 5A90A 3TG9A 4BL2A 5AQ7A 4OQHA 5CGXA 5F83A 3HVFA 4OH0A 5IHVA 2PU2A 1MWRA 4WYYA 3ZG9B 5GHXA 4KZBA 2RL3A 3MXSA 1LL5A 3IF5A 4Y0TA 2J8YA 5M19A 1ES4A 4P6BA 3G2YA 4WELA 4O7DA 4JKTA 5FAOA 4C75A 3RXXA 4LV1A 1WYCA 2ZQCA 3VSKA 4Y0UA 5EVIA 1AXBA 3ZG5A 3DTMA 5D3OA 1HVBA 4MBHA 2P9VA 1OMEA 1PWGA 4N1HA 3O88A 1PWDA 1TDLA 3N6IA 4KZ7A 3UE3A 4E3NA 3BEBA 4ZDXA 2XEPA 3CMZA 3HLWA 1YLPA 3UNWA 1CI8A 4BD0A 1S0WA 1ZKJA 2XF3A 2ZQ9A 3ZG7B 2J9OA 1FCOA 5GL9A 1DY6A 3WS4A 5EECA 5FI2A 1XXMA 2DNSA 4KZ4A 2XH9A 4FD8A 1GA9A 4QB8A 5FQIA 5GLAA 4LCLA 1GA0A 4DE1A 2OLVA 3QNCA 4KZ9A 3V5MA 3WS0A 5F1GA 4N1XA 4N92A 4GZBA 3ZDJA 3QHYA 1DJBA 5I94A 2OLUA 5DF9A 1HD8A 3ZVWA 2FFFB 2JBFA 1BLHA 4WEKA 2Y2IA 1ESIA 4JLFA 4WZ5C 2BG1A 2XLNA 4ZAMA 3WRTA 3Q81A 1NXYA 4DE2A 4MEZA 1M6KA 4P0MA 3IWOA 4HEFA 1FSYA 3NCKA 1K6SA 3G2ZA 3B3XA 3BM6A 3P98A 2J7VA 4DDYA 4OOYA 4U0XA 4RX2A 4DRTA 1PI4A 2WGWA 4R3BA 1G6AA 4X69A 3CJMA 5EUAA 2HDSA 4GDNA 2X71A 4UA9A 1K57A 3IXDA 3LO7A 2ZJ9A 3MZEA 1K38A 4D2OA 1LI0A 2P9VB 5CHMA 1NRFA 2Y2GA 4PM8A 4Z9QA 4DXCA 3ITBA 2H5SA 1VQQA 2Y59A 1BLSA 1LL9A 2WYXA 3FWLA 5FQKA 5F82A 5HAQA 1SDNA 3OCLA 3W8KA 4EWFA 3VP3A 3FZCA 2B5RA 3C7VA 4N9KA 2QPNA 3MBZA 1K56A 3VP1A 5CTMA 5DTSA 4RVAA 1K55A 5GLBA 3ZCZA 4E3MA 4Q8IA 4A5RA 4KENB 1JTDA 5CGSA 1FR6A 3CG5A 4EBPA 5BOHA 4IBXA 5DF7A 4K0XA 4B4ZA 4EV4A 5JYPA 4JXSA 3AGFA 1LHYA 2ZQ7A 4MBFA 1TEMA 3UDXA 1IYPA 2RCXA 5GLCA 4B4XA 2R9XA 1RP5A 3SS5A 1FCNA 3Q1FA 4KQOA 2Z2MB 1XA7A 3BFGA 3NY4A 1JWVA 1U60A 4JXWA 3Q7VB 3GQZA 3WS5A 1NZUA 5CHUA 3MKFA 1XPBA 3PBTA 4N9LA 4OP5A 4U0TA 3SS3A 2Y2KA 4OQGA 2HDQA 2WGWB 3HREA 3TSGA 3VSLA 4UA7A 4R3JA 5EE8A 2A49A 3UE1A 4MBKA 1IELA 4BLMA 4E3KA 1ONHA 2JCHA 3OPPA 4S2IA 5DTTA 5EOEA 3WRZA 1NJ4A 1BUEA 1YLWA 2ZQ8A 1SHVA 1FOFA 3NC8A 3PBNA 1K4FA 3MZFA 3SH9A 2QZ6A 4ZBEA 4PM5A 3ITAA 4OLDA 3Q7ZA 1W79A 4JPMA 5TR7A 4OKPA 1SDEA 5FQMA 4R4SA 4B88A 4BJPA 4KQQA 3W4PA 4ZJ1A 3OC2A 1GHMA 3E2LA 5HAIA 1XGIA 3BFEA 5CECA 4IVIA 1FQGA 5HL1A 1MXOA 3FKVA 1GHIA 4OOMA 5E2EA 4E3IA 2ZC4B 3UY6A 2EXBA 1IKGA 3BLMA 2XGNA 1HZOA 3C4PA 1EI5A 1H8YA 1TVFA 3CZDA 3UPPA 1I2SA 1W8QA 2HDUA 1XX2A 3MKEA 5EVLA 3WS1A 1PZOA 2PBYA 3PBSA 3ZG0A 4QD4A 4WMCA 3W4OA 4XUZA 4KG5A 4S2NA 2ZQAA 5CTNA 4RA7A 1IYOA 4NETA 2WKHA 3JYIA 1Q2PA 2BLSA 4PM9A 4Y0OA 2V2FF 3FKWA 4WZ5A 2J9PA 2DCFA 4KG2A 5EVID 3GRJA 5AQBA 3VOZA 2WZXA 2Y91A 1ERQA 1H5XA 2HP5A 5FSRA 3IF6A 2EX9A 2QMIA 3HLFA 4K91A 5G18A 3HLCA 1E25A 3HUNA 2XK1A 2ZC7A 1JVJA 5KSCA 1KDSA 2Q9NA 1CEFA 3IT9A 4KZAA 4JF4A 4BL3A 1BLPA 2E8IA 2WGIA 3IWIA 3WS2A 5FASA 3FYZA 3PBQA 1ZG6A 5J8XA 3V39A 2C6WB 1EROA 5FQQA 3V50A 4PM7A 1YLYA 2WUQA 3O86A 4EBNA 1LLBA 5EVIB 1QMFA 2EX2A 4BD1A 1N4OA 3IXBA 1O07A 4OQIA 1RCJA 4CPKA 2HP6A 3S4XA 3G35A 4XUXA 5FAPA 2WADA 1XKZA 4U3TA 4DE3A 2WGVA 4R4RA 4OPYA 3PBRA 4CJNA 2HPBA 3IXHA 3ISGA 4LENA 5GHYA 4DE0A 2ZM0A 4WM9A 3A3IA 3BFCA 5TFQA 3A3DA 2Y2JA 5A92A 4QHCA 3SS4A 1MY8A 2XD1A 1W8YA 2IWBA 3C5AA 4FH4A 4WZ4A 1BULA 1E3UD 2WKIA 2DRWA 4GN2A 1ONGA 2EFUA 4JBFA 4FH2A 5HX9A 2Y4AA 1G68A 4OPQA 3GV9A 1ES5A 2G2WA 3N8LA 5CERA 1YT4A 1J9MA 1PZPA 1PIOA 2OSUA 4RX3A 1O7EA 5CEDA 4X53A 3IF6B 5HFOA 2OV5A 1Q2QA 1KDWA 3V3SA 3ZHHA 3ZFZA 4WBGA 3SH7A 4P87A 2XDMA 3IH8A 3UO9A 4C3QA 1K4EA 1K54A 1XGJA 2Y2QA 2ZC3B 3C4OA 5GHZA 4DDSA 3UDIA 4LCMA 4PPRA 3UPOA 4GDBA 3A3FA 3VP0A 4E6XA 5KZHA 4QU3A 1K56D 2XFTA 4S2MA 1MWSA 3SH8A 3TOIA 5HAPA 2ZM2A 3OCNA 1PW8A 2XFSA 1GHPA 3MFDA 3ZNTA 3EQUA 1K55C 4ZTKA 3VP2A 5DVAA 2Q9MA 3RJUA 4E3JA 4MNRA 4ZJ2A 1NZOA 3PBOA 3NI9A 1IKIA 1MWTA 4HBUA 4X56A 1KVMA 5E2HA 2Z2LB 2EXAA 1NYMA 1Y54A 5M18A 4P85A 2H0TA 2G2UA 5E43A 1K6RA 4X55A 3IHBA 5E2FA 2ZM8A 4E3LA 5FI7A 3HLEA 4C6YA 2X02A 3ZG8B 1MKIA 3BYDA 4LV2A 1MWUA 2WAEA 4GNUA 4Y7PA 2Y55A 3VOYA 2FFYA 1KGFA 1L2SA 4KZ5A 5HARA 3SOIA 3VMAA 3DWKA 5EPHA 2X01A 5GLDA 1SKFA 3HUMA 5CEBA 3G30A 1BLCA 1HTZA 3OPLA 5KMWA 4UHUA 3N8RA 3WWXA 1L0FA 4IVKA 1KGGA 3GTCA 1L0DA 1DJAA 1KGEA 5FQJA 2ZD8A 3PTEA 2WZZA 4IBRA 5M1AA 1SCWA 3PAEA 4JXGA 2IWCA 3VP4A 2I72A 5TGFA 3OZHA 1W5DA 5CGWA 1BTLA 3LY3A 2Y2PA 5A93A 3LY4A 2HDRA 1FSWA 3FV7A 4BENA 1VM1A 4S2JA 5L2FA 3O87A 1JWZA 2R9WA 3BLSA 1C3BA 4GOGA 5FDHA 5FQ9A 3BRMA 4H8RA 3VFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUO A;  4UAA A;  4X6T A;  3BEC A;  5AQ9 A;  3GR2 A;  1ALQ A;  4JF6 A;  4F94 A;  1BSG A;  2XD5 A;  2ZQD A;  4KG6 A;  5EVI C;  2H0Y A;  3V3R A;  3VFH A;  3DW0 A;  3IH9 A;  4GD6 A;  4JXV A;  4PM6 A;  3NBL A;  3GVB A;  1S6R A;  4KQR A;  1Z6F A;  4OON A;  2IWD A;  1QME A;  3UDF A;  3GSG A;  4WEJ A;  4E6W A;  4K0W A;  1FCM A;  5EOO A;  4R0Q A;  4UA6 A;  1ES3 A;  4KZ3 A;  4WMC D;  4S2K A;  2Y2M A;  4PMA A;  3A3J A;  3I7J A;  4S2N C;  1KE0 A;  5AQA A;  5CHJ A;  2VGJ A;  1IEM A;  1FR1 A;  2ZLY A;  1BT5 A;  4S2O A;  1WYB A;  2Y2N A;  1ZC2 A;  2EX6 A;  4KZ6 A;  3O3V A;  3W4Q A;  3HBR A;  4DXB A;  3G32 A;  1WE4 A;  3G34 A;  1CI9 A;  1N9B A;  4LV0 A;  1KE4 A;  2CC1 A;  1KE3 A;  4QY6 A;  1LI9 A;  1YMX A;  2EX8 A;  2ZC5 B;  1RGZ A;  4R23 A;  3NIA A;  3IF6 C;  3Q7V A;  4L0L A;  3ZVT A;  3AGE A;  3IWQ A;  3M2K A;  4JF5 A;  4KZ8 A;  4BQM A;  4R1G A;  3DWZ A;  1MBL A;  4NK3 A;  4X68 A;  2EFX A;  3RXW A;  1CK3 A;  1XP4 A;  3MXR A;  3N8S A;  1IYQ A;  4OOL A;  2V20 A;  1I2W A;  2UWX A;  4ID4 A;  3HLG A;  1GCE A;  1E3U A;  1ZG4 A;  3G31 A;  3E2K A;  4OP8 A;  1PYY A;  1ESU A;  4IED A;  4EUZ A;  4FCF A;  1M40 A;  1E4D A;  3P09 A;  1K57 C;  4MLL A;  2PU4 A;  3M6H A;  5FI6 A;  4GD8 A;  3LEZ A;  4GB7 A;  5CXW A;  2HP9 A;  4GKU A;  3IHA A;  3EQV A;  2Y2L A;  4S2L A;  5DTK A;  3MZD A;  4M3K A;  3NDG A;  3S22 A;  1NYY A;  1TDG A;  3NDE A;  3HLB A;  3AGD A;  2WKE A;  1MPL A;  5KSH A;  1JTG A;  2GDN A;  3D4F A;  3OPH A;  4DF6 A;  2XR0 A;  1IYS A;  2A3U A;  4YFM A;  4LV3 A;  3ZGA B;  4HES A;  1YLJ A;  1I5Q A;  4ZJ3 A;  2P74 A;  5F1F A;  4OPZ A;  3S1Y A;  5FA7 A;  5A91 A;  2JC7 A;  3HLD A;  2V1Z A;  3PAG A;  3Q07 A;  3IQA A;  2WAF A;  3IXG A;  1PW1 A;  1EWZ A;  3N4I A;  1KVL A;  3UE0 A;  1CEG A;  4HBT A;  4EBL A;  1W7F A;  2XQZ A;  4XXR A;  5E2G A;  4DKI A;  4E3O A;  3GMW A;  1ES2 A;  3UPN A;  4OLG A;  4OVD A;  1RGY A;  2ZMA A;  1L0G A;  1JWP A;  2ZC6 B;  4FSF A;  2C5W B;  1PI5 A;  1XA1 A;  1BZA A;  3LCE A;  4RYE A;  5FAQ A;  3ZNY A;  5HW3 A;  2Y2H A;  3N7W A;  4OPR A;  2H10 A;  5DF8 A;  5CRF A;  1K54 C;  3A3E A;  1PWC A;  4QY5 A;  3Q82 A;  1DJC A;  3G4P A;  3BFD A;  3C7U A;  2WK0 A;  5JYO A;  2Y2O A;  3HL9 A;  1ERM A;  1YQS A;  2VGK A;  3UN7 A;  1L0E A;  5FAT A;  1YLZ A;  3QNB A;  4EQI A;  1H8Z A;  3BFF A;  4YIN A;  1YMS A;  4QJG A;  3M2J A;  2JE5 A;  3OPR A;  1K25 A;  1YM1 A;  1YLT A;  4S2P A;  1NY0 A;  4OQ0 A;  3M6B A;  5U47 A;  5A90 A;  3TG9 A;  4BL2 A;  5AQ7 A;  4OQH A;  5CGX A;  5F83 A;  3HVF A;  4OH0 A;  5IHV A;  2PU2 A;  1MWR A;  4WYY A;  3ZG9 B;  5GHX A;  4KZB A;  2RL3 A;  3MXS A;  1LL5 A;  3IF5 A;  4Y0T A;  2J8Y A;  5M19 A;  1ES4 A;  4P6B A;  3G2Y A;  4WEL A;  4O7D A;  4JKT A;  5FAO A;  4C75 A;  3RXX A;  4LV1 A;  1WYC A;  2ZQC A;  3VSK A;  4Y0U A;  5EVI A;  1AXB A;  3ZG5 A;  3DTM A;  5D3O A;  1HVB A;  4MBH A;  2P9V A;  1OME A;  1PWG A;  4N1H A;  3O88 A;  1PWD A;  1TDL A;  3N6I A;  4KZ7 A;  3UE3 A;  4E3N A;  3BEB A;  4ZDX A;  2XEP A;  3CMZ A;  3HLW A;  1YLP A;  3UNW A;  1CI8 A;  4BD0 A;  1S0W A;  1ZKJ A;  2XF3 A;  2ZQ9 A;  3ZG7 B;  2J9O A;  1FCO A;  5GL9 A;  1DY6 A;  3WS4 A;  5EEC A;  5FI2 A;  1XXM A;  2DNS A;  4KZ4 A;  2XH9 A;  4FD8 A;  1GA9 A;  4QB8 A;  5FQI A;  5GLA A;  4LCL A;  1GA0 A;  4DE1 A;  2OLV A;  3QNC A;  4KZ9 A;  3V5M A;  3WS0 A;  5F1G A;  4N1X A;  4N92 A;  4GZB A;  3ZDJ A;  3QHY A;  1DJB A;  5I94 A;  2OLU A;  5DF9 A;  1HD8 A;  3ZVW A;  2FFF B;  2JBF A;  1BLH A;  4WEK A;  2Y2I A;  1ESI A;  4JLF A;  4WZ5 C;  2BG1 A;  2XLN A;  4ZAM A;  3WRT A;  3Q81 A;  1NXY A;  4DE2 A;  4MEZ A;  1M6K A;  4P0M A;  3IWO A;  4HEF A;  1FSY A;  3NCK A;  1K6S A;  3G2Z A;  3B3X A;  3BM6 A;  3P98 A;  2J7V A;  4DDY A;  4OOY A;  4U0X A;  4RX2 A;  4DRT A;  1PI4 A;  2WGW A;  4R3B A;  1G6A A;  4X69 A;  3CJM A;  5EUA A;  2HDS A;  4GDN A;  2X71 A;  4UA9 A;  1K57 A;  3IXD A;  3LO7 A;  2ZJ9 A;  3MZE A;  1K38 A;  4D2O A;  1LI0 A;  2P9V B;  5CHM A;  1NRF A;  2Y2G A;  4PM8 A;  4Z9Q A;  4DXC A;  3ITB A;  2H5S A;  1VQQ A;  2Y59 A;  1BLS A;  1LL9 A;  2WYX A;  3FWL A;  5FQK A;  5F82 A;  5HAQ A;  1SDN A;  3OCL A;  3W8K A;  4EWF A;  3VP3 A;  3FZC A;  2B5R A;  3C7V A;  4N9K A;  2QPN A;  3MBZ A;  1K56 A;  3VP1 A;  5CTM A;  5DTS A;  4RVA A;  1K55 A;  5GLB A;  3ZCZ A;  4E3M A;  4Q8I A;  4A5R A;  4KEN B;  1JTD A;  5CGS A;  1FR6 A;  3CG5 A;  4EBP A;  5BOH A;  4IBX A;  5DF7 A;  4K0X A;  4B4Z A;  4EV4 A;  5JYP A;  4JXS A;  3AGF A;  1LHY A;  2ZQ7 A;  4MBF A;  1TEM A;  3UDX A;  1IYP A;  2RCX A;  5GLC A;  4B4X A;  2R9X A;  1RP5 A;  3SS5 A;  1FCN A;  3Q1F A;  4KQO A;  2Z2M B;  1XA7 A;  3BFG A;  3NY4 A;  1JWV A;  1U60 A;  4JXW A;  3Q7V B;  3GQZ A;  3WS5 A;  1NZU A;  5CHU A;  3MKF A;  1XPB A;  3PBT A;  4N9L A;  4OP5 A;  4U0T A;  3SS3 A;  2Y2K A;  4OQG A;  2HDQ A;  2WGW B;  3HRE A;  3TSG A;  3VSL A;  4UA7 A;  4R3J A;  5EE8 A;  2A49 A;  3UE1 A;  4MBK A;  1IEL A;  4BLM A;  4E3K A;  1ONH A;  2JCH A;  3OPP A;  4S2I A;  5DTT A;  5EOE A;  3WRZ A;  1NJ4 A;  1BUE A;  1YLW A;  2ZQ8 A;  1SHV A;  1FOF A;  3NC8 A;  3PBN A;  1K4F A;  3MZF A;  3SH9 A;  2QZ6 A;  4ZBE A;  4PM5 A;  3ITA A;  4OLD A;  3Q7Z A;  1W79 A;  4JPM A;  5TR7 A;  4OKP A;  1SDE A;  5FQM A;  4R4S A;  4B88 A;  4BJP A;  4KQQ A;  3W4P A;  4ZJ1 A;  3OC2 A;  1GHM A;  3E2L A;  5HAI A;  1XGI A;  3BFE A;  5CEC A;  4IVI A;  1FQG A;  5HL1 A;  1MXO A;  3FKV A;  1GHI A;  4OOM A;  5E2E A;  4E3I A;  2ZC4 B;  3UY6 A;  2EXB A;  1IKG A;  3BLM A;  2XGN A;  1HZO A;  3C4P A;  1EI5 A;  1H8Y A;  1TVF A;  3CZD A;  3UPP A;  1I2S A;  1W8Q A;  2HDU A;  1XX2 A;  3MKE A;  5EVL A;  3WS1 A;  1PZO A;  2PBY A;  3PBS A;  3ZG0 A;  4QD4 A;  4WMC A;  3W4O A;  4XUZ A;  4KG5 A;  4S2N A;  2ZQA A;  5CTN A;  4RA7 A;  1IYO A;  4NET A;  2WKH A;  3JYI A;  1Q2P A;  2BLS A;  4PM9 A;  4Y0O A;  2V2F F;  3FKW A;  4WZ5 A;  2J9P A;  2DCF A;  4KG2 A;  5EVI D;  3GRJ A;  5AQB A;  3VOZ A;  2WZX A;  2Y91 A;  1ERQ A;  1H5X A;  2HP5 A;  5FSR A;  3IF6 A;  2EX9 A;  2QMI A;  3HLF A;  4K91 A;  5G18 A;  3HLC A;  1E25 A;  3HUN A;  2XK1 A;  2ZC7 A;  1JVJ A;  5KSC A;  1KDS A;  2Q9N A;  1CEF A;  3IT9 A;  4KZA A;  4JF4 A;  4BL3 A;  1BLP A;  2E8I A;  2WGI A;  3IWI A;  3WS2 A;  5FAS A;  3FYZ A;  3PBQ A;  1ZG6 A;  5J8X A;  3V39 A;  2C6W B;  1ERO A;  5FQQ A;  3V50 A;  4PM7 A;  1YLY A;  2WUQ A;  3O86 A;  4EBN A;  1LLB A;  5EVI B;  1QMF A;  2EX2 A;  4BD1 A;  1N4O A;  3IXB A;  1O07 A;  4OQI A;  1RCJ A;  4CPK A;  2HP6 A;  3S4X A;  3G35 A;  4XUX A;  5FAP A;  2WAD A;  1XKZ A;  4U3T A;  4DE3 A;  2WGV A;  4R4R A;  4OPY A;  3PBR A;  4CJN A;  2HPB A;  3IXH A;  3ISG A;  4LEN A;  5GHY A;  4DE0 A;  2ZM0 A;  4WM9 A;  3A3I A;  3BFC A;  5TFQ A;  3A3D A;  2Y2J A;  5A92 A;  4QHC A;  3SS4 A;  1MY8 A;  2XD1 A;  1W8Y A;  2IWB A;  3C5A A;  4FH4 A;  4WZ4 A;  1BUL A;  1E3U D;  2WKI A;  2DRW A;  4GN2 A;  1ONG A;  2EFU A;  4JBF A;  4FH2 A;  5HX9 A;  2Y4A A;  1G68 A;  4OPQ A;  3GV9 A;  1ES5 A;  2G2W A;  3N8L A;  5CER A;  1YT4 A;  1J9M A;  1PZP A;  1PIO A;  2OSU A;  4RX3 A;  1O7E A;  5CED A;  4X53 A;  3IF6 B;  5HFO A;  2OV5 A;  1Q2Q A;  1KDW A;  3V3S A;  3ZHH A;  3ZFZ A;  4WBG A;  3SH7 A;  4P87 A;  2XDM A;  3IH8 A;  3UO9 A;  4C3Q A;  1K4E A;  1K54 A;  1XGJ A;  2Y2Q A;  2ZC3 B;  3C4O A;  5GHZ A;  4DDS A;  3UDI A;  4LCM A;  4PPR A;  3UPO A;  4GDB A;  3A3F A;  3VP0 A;  4E6X A;  5KZH A;  4QU3 A;  1K56 D;  2XFT A;  4S2M A;  1MWS A;  3SH8 A;  3TOI A;  5HAP A;  2ZM2 A;  3OCN A;  1PW8 A;  2XFS A;  1GHP A;  3MFD A;  3ZNT A;  3EQU A;  1K55 C;  4ZTK A;  3VP2 A;  5DVA A;  2Q9M A;  3RJU A;  4E3J A;  4MNR A;  4ZJ2 A;  1NZO A;  3PBO A;  3NI9 A;  1IKI A;  1MWT A;  4HBU A;  4X56 A;  1KVM A;  5E2H A;  2Z2L B;  2EXA A;  1NYM A;  1Y54 A;  5M18 A;  4P85 A;  2H0T A;  2G2U A;  5E43 A;  1K6R A;  4X55 A;  3IHB A;  5E2F A;  2ZM8 A;  4E3L A;  5FI7 A;  3HLE A;  4C6Y A;  2X02 A;  3ZG8 B;  1MKI A;  3BYD A;  4LV2 A;  1MWU A;  2WAE A;  4GNU A;  4Y7P A;  2Y55 A;  3VOY A;  2FFY A;  1KGF A;  1L2S A;  4KZ5 A;  5HAR A;  3SOI A;  3VMA A;  3DWK A;  5EPH A;  2X01 A;  5GLD A;  1SKF A;  3HUM A;  5CEB A;  3G30 A;  1BLC A;  1HTZ A;  3OPL A;  5KMW A;  4UHU A;  3N8R A;  3WWX A;  1L0F A;  4IVK A;  1KGG A;  3GTC A;  1L0D A;  1DJA A;  1KGE A;  5FQJ A;  2ZD8 A;  3PTE A;  2WZZ A;  4IBR A;  5M1A A;  1SCW A;  3PAE A;  4JXG A;  2IWC A;  3VP4 A;  2I72 A;  5TGF A;  3OZH A;  1W5D A;  5CGW A;  1BTL A;  3LY3 A;  2Y2P A;  5A93 A;  3LY4 A;  2HDR A;  1FSW A;  3FV7 A;  4BEN A;  1VM1 A;  4S2J A;  5L2F A;  3O87 A;  1JWZ A;  2R9W A;  3BLS A;  1C3B A;  4GOG A;  5FDH A;  5FQ9 A;  3BRM A;  4H8R A;  3VFF A; 
#chains in the Genus database with same CATH topology
 3BEC A;  3GR2 A;  5CX7 A;  2NUT C;  2ZQD A;  4KG6 A;  5EVI C;  4KQR A;  4Q0I A;  4WEJ A;  4K0W A;  1FCM A;  3C38 A;  4PMA A;  3A3J A;  2PT7 A;  3UE6 A;  2W3E A;  2L1M A;  2ZLY A;  1BT5 A;  4S2O A;  1G6O A;  5L07 A;  3W4Q A;  3HBR A;  3U4L P;  4I39 A;  5L10 A;  2JN7 A;  2WKP A;  4DJ2 A;  1KE3 A;  1LI9 A;  1YMX A;  3IF6 C;  3Q7V A;  3ZVT A;  4ME4 A;  3IWQ A;  3M2K A;  4LPZ A;  5DJU A;  3E98 A;  5TBM B;  1I2W A;  2UWX A;  1E3U A;  5AVE A;  1ESU A;  2JHE A;  4CLC E;  1M40 A;  2HZ5 A;  4GCZ A;  5CXW A;  2UV0 E;  3NDE A;  1T1A A;  3F1N B;  1H0M A;  5HDS A;  2GDN A;  3OPH A;  1IYS A;  3E4O A;  1PNE A;  3CPT A;  1BYW A;  4OPZ A;  1DP8 A;  5FA7 A;  1YAX A;  3Q07 A;  4XXR A;  3UPN A;  4GJ4 A;  1L0G A;  1BZA A;  4RYE A;  4ESP A;  4OPR A;  2H10 A;  5DF8 A;  1DJC A;  3BFD A;  4EXO A;  3R7W A;  1YLZ A;  2XA7 S;  4QJG A;  2KOI A;  1W63 M;  4S2P A;  5IU1 A;  2PRF A;  3TG9 A;  4BL2 A;  1H8M A;  5F83 A;  5IHV A;  2J80 A;  1D06 A;  4KZB A;  3IF5 A;  2VX8 A;  5M19 A;  3BQA A;  4P6B A;  5HPF A;  4JKT A;  4C75 A;  2ZMV A;  2ZQC A;  2V0W A;  1HVB A;  5DJT A;  3K2N A;  2QYB A;  3DTE A;  3BEB A;  3CMZ A;  3HLW A;  3IX4 A;  1Z09 A;  1FCO A;  3WS4 A;  5EEC A;  1XXM A;  5GLA A;  4LCL A;  1GA0 A;  3WS0 A;  3QP1 A;  5F1G A;  4R6L A;  5I94 A;  4PAU A;  1BLH A;  4JLF A;  3EOI A;  4DE2 A;  2ZOH A;  3NUL A;  2D02 A;  4LRX C;  3IWO A;  3NCK A;  4U0X A;  4RX2 A;  1W63 Q;  2PYP A;  4GLQ A;  3CJM A;  1F5M A;  4O0P A;  1CJF A;  4L9E A;  4D2O A;  1LI0 A;  5CHM A;  4Z9Q A;  4DXC A;  2Y59 A;  1LL9 A;  4BMW A;  2B02 A;  2K2N A;  3IX3 A;  5F82 A;  1SDN A;  3W8K A;  1XJ2 A;  3FZC A;  2B5R A;  4LFU A;  5FL3 A;  4EER A;  4X1L A;  2QPN A;  3VP1 A;  1N9L A;  5DTS A;  3ZCZ A;  4H6J B;  1JTD A;  4NKP A;  5JYP A;  2B95 A;  1G5U A;  1S4S A;  4MBF A;  4UQI S;  5HPI A;  1F9I A;  4Y5F A;  2R9X A;  4ARZ B;  1STZ A;  3Q1F A;  4KQO A;  2Z2M B;  1XA7 A;  3Q7V B;  1NZU A;  3SS3 A;  1S4R A;  4UA7 A;  2A49 A;  4MBK A;  4E3K A;  1YLW A;  2ZQ8 A;  3LR4 A;  3NC8 A;  2VEA A;  3E4Q A;  3MZF A;  3ITA A;  3LIE A;  5TR7 A;  1W79 A;  3QP6 A;  2WKQ A;  1SDE A;  4KQQ A;  3JVV A;  4ZJ1 A;  3OC2 A;  4KUK A;  4DMZ A;  1GHM A;  3FKV A;  3UME A;  4OOM A;  3O5Y A;  3UY6 A;  2EXB A;  4EEP A;  2XGN A;  1HZO A;  3QP2 A;  5L09 A;  1VB6 A;  3CZD A;  1CF0 A;  4YWZ A;  1PZO A;  4PKY G;  4QD4 A;  4WMC A;  3SW1 A;  3CHW P;  3VE4 A;  1IYO A;  1LSX A;  3KSI A;  2WKH A;  3JYI A;  1Q2P A;  4PM9 A;  3FKW A;  2J9P A;  5EVI D;  4KG2 A;  3R7W B;  1DRM A;  4G3K A;  1SKO A;  3KYZ A;  4JGO A;  2WZX A;  3VOZ A;  2Y91 A;  4Y13 A;  3IF6 A;  3LIF A;  3HLF A;  1E25 A;  3ZQ5 A;  1NLY A;  4KZA A;  1P9W A;  3FYZ A;  3PBQ A;  5J8X A;  4HH2 A;  2MJ6 A;  2NUP C;  1YLY A;  4X1M A;  2EX2 A;  1N4O A;  3B42 A;  1O07 A;  4OQI A;  1T1B A;  4CPK A;  3S4X A;  2PR5 A;  4DE3 A;  2WGV A;  5GHY A;  2A24 B;  4B93 A;  1MY8 A;  1W8Y A;  2IWB A;  4WZ4 A;  2WKI A;  1ONG A;  1EW0 A;  5HX9 A;  4NG2 A;  3N8L A;  5K5B A;  4RX3 A;  5HFO A;  1KDW A;  3ZHH A;  3MQ0 A;  1K4E A;  2Y2Q A;  3C4O A;  4DDS A;  4WN5 A;  4PPR A;  3UPO A;  2XFT A;  4Y3I A;  1A0K A;  1PW8 A;  1GHP A;  3MFD A;  3ZNT A;  3EQU A;  4MNR A;  4ZJ2 A;  1NZO A;  5E2H A;  1NYM A;  5M18 A;  3MSH A;  5E43 A;  1K6R A;  5E2F A;  1S67 L;  5FI7 A;  2VKS A;  4LV2 A;  4QPR A;  2WAE A;  4Y7P A;  2Y55 A;  3VOY A;  1KGF A;  4KZ5 A;  3SOI A;  3DWK A;  3HUM A;  4WUJ A;  1BLC A;  1HTZ A;  3N8R A;  3WWX A;  1Y4O A;  4CLC A;  1KGE A;  4IBR A;  3PAE A;  4JXG A;  1X0O A;  2VV7 A;  1FSW A;  1VM1 A;  4HIA A;  3O87 A;  1C3B A;  4GOG A;  3BRM A;  3VFF A;  2EA9 A;  5EM0 A;  5AQ9 A;  1VET B;  1ALQ A;  4F94 A;  1BSG A;  4ZRR A;  3VFH A;  3DW0 A;  4GD6 A;  1S6R A;  4OON A;  3W2Z A;  1QME A;  3GSG A;  4E6W A;  3F1N A;  4R0Q A;  4HJ4 A;  3T1S A;  2M1C A;  5A8B A;  1KE0 A;  2GX5 A;  5CHJ A;  2W3G A;  1FR1 A;  5L8M A;  3OLO A;  2EX6 A;  4KZ6 A;  3G32 A;  1WE4 A;  5FEF A;  1CI9 A;  2EWV A;  1N9B A;  4LV0 A;  4Y15 A;  2JKT I;  4IJG A;  3NIA A;  3E4P A;  4EES A;  2O99 A;  3H9W A;  4JF5 A;  4Z1W A;  1MBL A;  2EFX A;  3RXW A;  3CLO A;  1XP4 A;  3N8S A;  1ZG4 A;  3NOU C;  2VK3 A;  3G31 A;  4OP8 A;  4IHQ A;  4M4X A;  4I3A A;  4HHD A;  3QP4 A;  4EUZ A;  1T1C A;  2W1R A;  2PAV P;  5FI6 A;  1OTA A;  4ETZ A;  4FTX A;  5HDC A;  4GD8 A;  3LEZ A;  4GB7 A;  3ICY A;  2Y2L A;  5DTK A;  3MZD A;  1OTB A;  4M3K A;  3S22 A;  1DP9 A;  2XR0 A;  4DF6 A;  2A3U A;  3ZGA B;  4LV3 A;  2P74 A;  4P6Z M;  4NXE A;  3EGX C;  2JC7 A;  3HLD A;  2V1Z A;  3A0V A;  4Y2F A;  3N4I A;  1EWZ A;  4EBL A;  1KVL A;  5HSQ A;  4EW7 A;  2XQZ A;  4DKI A;  4PKY A;  2DMW A;  3F1P A;  1ES2 A;  4OLG A;  4OVD A;  2ZMA A;  5G4Z A;  4O01 A;  1JWP A;  1N9N A;  3LCE A;  4BBU A;  3N7W A;  3T4L A;  1K54 C;  3A3E A;  3C30 A;  4QY5 A;  2CMN A;  2WK0 A;  1ERM A;  1GSV A;  4EQI A;  1H8Z A;  3K3C A;  1YMS A;  2JE5 A;  3OPR A;  1NY0 A;  3M6B A;  4OQH A;  3HVF A;  1MWR A;  3MXS A;  1OT6 A;  4O7D A;  5DFX A;  5FAO A;  3RXX A;  1ZHH B;  4LV1 A;  1AXB A;  3ZG5 A;  3DTM A;  5D3O A;  5J4E A;  3K3D A;  1TDL A;  4KZ7 A;  3A0S A;  3T4K A;  1YLP A;  2XF3 A;  2XH9 A;  4FD8 A;  3CAX A;  3LGO A;  5FQI A;  4H6J A;  2VGL M;  2OLV A;  3A0R A;  3QNC A;  4KZ9 A;  1WA9 A;  3OBF A;  5HDD A;  4N92 A;  2ZMF A;  3ZDJ A;  3NOP C;  5DF9 A;  2FFF B;  1ESI A;  4ARZ A;  3TE8 A;  3Q81 A;  1NXY A;  2OAQ 1;  4P0M A;  2FZ0 A;  4CLC B;  4DDY A;  2J7V A;  4HP9 A;  4DRT A;  3HJK A;  2X71 A;  4UA9 A;  1NWZ A;  5I5L A;  2KLI A;  2ZJ9 A;  3MZE A;  2P9V B;  1LSW A;  2P04 A;  3ITB A;  1VQQ A;  4HNB A;  3C2W A;  5CTM A;  4E3M A;  4A5R A;  4KEN B;  5HWT A;  3UB9 A;  4K0X A;  3TRC A;  4X25 A;  2RCX A;  5GLC A;  4WL9 A;  1RP5 A;  4ETX A;  3BFG A;  3NY4 A;  5LBR A;  2GNX A;  3MKF A;  4OP5 A;  1TF1 A;  4U0T A;  4OQG A;  2HDQ A;  2FH5 A;  2WGW B;  4BBV A;  3VSL A;  2PHY A;  1OJG A;  4XT2 A;  1IEL A;  1ONH A;  3OPP A;  4S2I A;  1NJ4 A;  4JGR A;  1BUE A;  4Q0H A;  4FOF A;  1K4F A;  3SH9 A;  2W27 A;  3EEA A;  3Q7Z A;  4OKP A;  1XJ4 A;  5FDS A;  3JPU A;  5FQM A;  3T4O A;  4BJP A;  4EET B;  3LUQ A;  2ZBB A;  4WF0 A;  1OTE A;  1FQG A;  2J3T D;  1MXO A;  2HV1 A;  1GHI A;  4HI4 A;  2PYR A;  4EQ1 A;  3R4K A;  3UPP A;  1W8Q A;  3F1P B;  3PXP A;  5EVL A;  3F1O B;  3PBS A;  3IS2 A;  3ZG0 A;  3W4O A;  4CLC C;  4XUZ A;  4KG5 A;  2ZQA A;  2A24 A;  2YKH A;  2J3W A;  2BLS A;  3NJA A;  2V2F F;  4WZ5 A;  5AQB A;  3GDI A;  3LYX A;  2HP5 A;  1XFN A;  3UMD A;  5F69 A;  2QMI A;  2Q0O A;  5KSC A;  1KDS A;  2Q9N A;  2O9A A;  1CEF A;  4MN7 A;  4BL3 A;  2E8I A;  3TW8 A;  2HJE A;  3D72 A;  3HCY A;  5FQQ A;  4PM7 A;  2WUQ A;  1S66 L;  4BD1 A;  1RCJ A;  2HP6 A;  5FAP A;  1H3Q A;  4OPY A;  3TJZ C;  3PBR A;  5AVF A;  2V8C A;  2ZM0 A;  3A3I A;  3BFC A;  5TFQ A;  5A92 A;  4QHC A;  3LIA A;  3P7N A;  4GN2 A;  2EFU A;  4JBF A;  2Y4A A;  1G68 A;  4OPQ A;  3RH8 B;  2G2W A;  5CER A;  3EWK A;  1YT4 A;  1J9M A;  1PZP A;  3LIC A;  1IFQ A;  5CED A;  5EFW A;  4I5S A;  2XA7 M;  3SH7 A;  4P87 A;  3IBJ A;  1K54 A;  4LCM A;  3VP0 A;  1FIK A;  3SH8 A;  4ZTK A;  1K55 C;  2PDR A;  4NXB A;  2Q9M A;  3FG8 A;  1VET A;  3LR5 A;  3VOL A;  4LLO B;  3PBO A;  3NI9 A;  1IKI A;  1XJ6 A;  1KVM A;  2EXA A;  1Y54 A;  3MFX A;  4P85 A;  1P97 A;  2GJ3 A;  3IHB A;  3S7P A;  2K31 A;  4C6Y A;  2X02 A;  3NEC A;  3ZG8 B;  1MKI A;  3BYD A;  2HF6 A;  2INW A;  3C8C A;  3VMA A;  5EPH A;  3OPL A;  4IVK A;  3GTC A;  4R3A A;  2OAP 1;  3VP4 A;  2I72 A;  4Y17 A;  5A93 A;  3MF0 A;  2ZL1 A;  4H8R A;  2BTF P;  2ACG A;  4XT2 B;  3HUO A;  4X6T A;  4LGW A;  3L7H A;  5HZH A;  2LB9 A;  1Z6F A;  2IWD A;  3LI8 A;  3UDF A;  3QP5 A;  4UA6 A;  4KZ3 A;  4WMC D;  4S2K A;  2Y2M A;  3I7J A;  3PHY A;  2VGJ A;  1IEM A;  4MMN A;  1WYB A;  4F3L A;  2P7J A;  3O3V A;  4DXB A;  1KE4 A;  4QY6 A;  2EX8 A;  2ZC5 B;  4R23 A;  3AGE A;  3LEQ A;  4KZ8 A;  3DWZ A;  3T4Q A;  1CK3 A;  3IS2 B;  3T1Q B;  3MXR A;  4OOL A;  1IYQ A;  2V20 A;  4ID4 A;  1GCE A;  1PYY A;  1E4D A;  3P09 A;  4GS9 A;  1PRQ A;  2PU4 A;  3BWL A;  3M6H A;  3IHA A;  3EQV A;  2W0N A;  3NDG A;  1NYY A;  4CQH A;  3DAV A;  1TDG A;  5KSH A;  4HES A;  1YLJ A;  1I5Q A;  5F1F A;  5F68 A;  3S1Y A;  1TS7 A;  1LSV A;  4MCW A;  3PAG A;  3IQA A;  1YPR A;  2WAF A;  1CEG A;  4HBT A;  1W7F A;  4E3O A;  5E2G A;  3MXQ A;  3ULF A;  3GMW A;  4L9G A;  2ZC6 B;  5J3W A;  3ZNY A;  5HW3 A;  3D3O A;  5CRF A;  1F2K A;  5JYO A;  3HL9 A;  2VGK A;  3UN7 A;  1L0E A;  5FAT A;  3BFF A;  4YIN A;  3BJN A;  4YOF A;  1OJ5 A;  1K25 A;  1YM1 A;  4OQ0 A;  5A90 A;  5CGX A;  1VEU A;  4E04 A;  3T1R A;  4P6Z S;  2P08 A;  1LL5 A;  4R38 A;  4Y0T A;  1ES4 A;  2V9A A;  3G2Y A;  4WEL A;  3RFB A;  3JVU A;  1WYC A;  3VSK A;  4Y0U A;  4MBH A;  2P9V A;  1OME A;  3N6I A;  3UE3 A;  1TS6 A;  3SZT A;  3T4T A;  2XEP A;  1CI8 A;  1S0W A;  2KX6 A;  3ZG7 B;  2ZQ9 A;  2J9O A;  3KX0 X;  3MQQ A;  5GL9 A;  1DY6 A;  4I3J A;  2Z6C A;  2DNS A;  4HOI A;  1G28 A;  1GA9 A;  4QB8 A;  4JGP A;  1Y28 A;  3MR0 A;  4N1X A;  4GZB A;  3KSH A;  2OLU A;  1HD8 A;  3P01 A;  2Y2I A;  3VV4 A;  4WZ5 C;  2BG1 A;  4ZAM A;  3WRT A;  3G2Z A;  3BM6 A;  2JKF A;  5HWW A;  2WGW A;  4R3B A;  1G6A A;  4X69 A;  2HDS A;  3LI9 A;  3H7W B;  4GDN A;  1K57 A;  3U2A A;  3IXD A;  2VV6 A;  5KIZ A;  1K38 A;  2ZL1 B;  5C5K A;  3V67 A;  2Y2G A;  4PM8 A;  3S7O A;  2H5S A;  5DFY A;  2WYX A;  3FWL A;  5FQK A;  1ODV A;  1XFQ A;  2XRN A;  3OCL A;  1T19 A;  3C7V A;  4N9K A;  1K56 A;  4RVA A;  1K55 A;  4Q8I A;  3QP8 A;  3S7N A;  1FR6 A;  4EBP A;  4B4Z A;  2K7S A;  4JXS A;  1UGU A;  2ZQ7 A;  1TEM A;  2W1T B;  4F3L B;  1IYP A;  4B4X A;  4R70 A;  4G3W A;  2VLG A;  1FCN A;  1P9R A;  1JWV A;  3F1O A;  1U60 A;  3S7Q A;  3WS5 A;  5CHU A;  3PBT A;  4N9L A;  1K0K A;  2Y2K A;  1YSQ A;  3HRE A;  3TSG A;  4HQA A;  4R3J A;  5EE8 A;  4BLM A;  5EOE A;  2V1A A;  5EV0 A;  1JNU A;  2E8J A;  1SHV A;  4GHI B;  4GS9 B;  3PBN A;  3B47 A;  4ZBE A;  4PM5 A;  4OLD A;  4HJ6 A;  4B88 A;  4I38 A;  2G7U A;  2XRO A;  3E2L A;  1XGI A;  5CEC A;  5HL1 A;  4E3I A;  2ZC4 B;  3BLM A;  3C4P A;  1TVF A;  2HDU A;  1XX2 A;  3LR0 A;  5CTN A;  3T4S A;  1N9O A;  2AVX A;  2OOL A;  1D7E A;  2DCF A;  1YKD A;  3NHQ A;  2Z6D A;  2O0Y A;  2I9V A;  1ERQ A;  5FSR A;  4L9F A;  4HJ3 A;  4K91 A;  3HLC A;  3HUN A;  2XK1 A;  1VEU B;  2ZC7 A;  2QKP A;  1JVJ A;  3IT9 A;  4JF4 A;  5FAS A;  2Y8H A;  4NEE D;  2H28 A;  1ERO A;  3V50 A;  2V8F A;  3O86 A;  4EBN A;  1LLB A;  3IXB A;  4IUH A;  4XUX A;  2WAD A;  4U3T A;  1FIL A;  1UWP X;  3B33 A;  3IXH A;  4LEN A;  4DE0 A;  4DJ3 A;  3KO6 A;  5AJG A;  4AFI A;  1TS8 A;  2QJ5 A;  3SS4 A;  2XD1 A;  3C5A A;  4FH4 A;  2B18 A;  1E3U D;  2DRW A;  3BQ8 A;  4FH2 A;  3VE3 A;  4D60 A;  1O7E A;  2VJW A;  2ZOI A;  3E0Y A;  4LRY C;  1Q2Q A;  3ZFZ A;  2PBD P;  4WBG A;  2XDM A;  3IH8 A;  4C3Q A;  5GHZ A;  1XGJ A;  2ZC3 B;  4GDB A;  3A3F A;  5HL6 A;  4E6X A;  3LID A;  5HAP A;  3TOI A;  1D1J A;  3RTY A;  3RJU A;  2PD8 A;  4E3J A;  5F5Y A;  4HBU A;  1KOU A;  2Z2L B;  3FPV A;  2H0T A;  4B9O A;  3CIT A;  3CWF A;  4E3L A;  3HLE A;  2PR6 A;  5FEG A;  4GNU A;  2Y79 A;  2OWJ A;  2FFY A;  1L2S A;  5TJJ A;  2X01 A;  5GLD A;  1SKF A;  5CEB A;  1VHM A;  4UHU A;  1KGG A;  1L0D A;  5FQJ A;  2WZZ A;  5M1A A;  3OZH A;  5CGW A;  1BTL A;  2Y2P A;  3FV7 A;  4BEN A;  2M7V A;  5L2F A;  1JWZ A;  1MKM A;  4QWO A;  5FDH A;  3CI6 A;  4UAA A;  4MDZ A;  4JF6 A;  2XD5 A;  2H0Y A;  3V3R A;  1MC0 A;  3IH9 A;  4JXV A;  4PM6 A;  3NBL A;  3GVB A;  2M7U A;  2A2L A;  5EOO A;  1ES3 A;  2R78 A;  4S2N C;  5AQA A;  1DP6 A;  2Y2N A;  1ZC2 A;  2IA2 A;  2OWH A;  4FUW A;  5DKL A;  3G34 A;  2CC1 A;  1RGZ A;  4L0L A;  4BQM A;  4R1G A;  4X68 A;  4NK3 A;  2W3F A;  3HLG A;  3E2K A;  1LT0 A;  4IED A;  4FCF A;  2JKR I;  1K57 C;  4MLL A;  4II7 A;  2HP9 A;  4GKU A;  1V9Z A;  4S2L A;  4LRZ E;  3HLB A;  3AGD A;  3MS6 A;  4MN6 A;  3FC7 A;  2WKE A;  1MPL A;  1JTG A;  3D4F A;  2W3D A;  4YFM A;  2W3H A;  3CUE A;  5HD5 A;  4ZJ3 A;  2YKF A;  5A91 A;  2JKT M;  4BBT A;  3IXG A;  1PW1 A;  3UE0 A;  1LL8 A;  1RGY A;  4FSF A;  2C5W B;  2BAS A;  3EGD C;  1PI5 A;  1XA1 A;  5FAQ A;  2Y2H A;  4EUV A;  1PWC A;  3Q82 A;  3G4P A;  3C7U A;  4KQD A;  2Y2O A;  1YQS A;  3PYP A;  3QNB A;  1CQA A;  3L9K A;  3T12 B;  1IOU A;  1V9Y A;  3M2J A;  1YLT A;  5U47 A;  4MN5 A;  2GZA A;  5AQ7 A;  4OH0 A;  5IT5 A;  5MC7 A;  2PU2 A;  1TS0 A;  3OOV A;  4WYY A;  3ZG9 B;  5GHX A;  2RL3 A;  4KUO A;  3LIB A;  5J7E A;  2J8Y A;  4Q0J A;  1SZV A;  3H7W A;  3CPT B;  3MMH A;  5EVI A;  3D9Y A;  4N1H A;  3UB7 A;  1PWG A;  3O88 A;  1PWD A;  4E3N A;  1P0Z A;  3BY8 A;  5DKK A;  4ZDX A;  2D01 A;  4WLA A;  3UNW A;  4BD0 A;  1ZKJ A;  1OPX A;  5FI2 A;  3DBA A;  4KZ4 A;  1NLZ A;  2VZW A;  4DE1 A;  3V5M A;  3LFV A;  3QHY A;  1DJB A;  2W1T A;  3ZVW A;  2JBF A;  4WEK A;  2XLN A;  4MEZ A;  1M6K A;  4HEF A;  4UQI M;  1J3W A;  1FSY A;  1K6S A;  3B3X A;  3P98 A;  3H82 A;  4OOY A;  1GSW A;  4EU0 A;  1PI4 A;  5EUA A;  3NOT C;  3LO7 A;  1NRF A;  4GHI A;  1OT9 A;  2QJ7 A;  1BLS A;  3MJQ A;  3KSF A;  3IBR A;  5HAQ A;  2VA0 A;  3VP3 A;  4EWF A;  5EVE A;  2EWW A;  3ZYT A;  3EEH A;  3DTI A;  3MBZ A;  5GLB A;  2O9C A;  3LR3 A;  5CGS A;  2PD7 A;  3CG5 A;  5BOH A;  4IBX A;  5DF7 A;  4EV4 A;  1F98 A;  3AGF A;  1LHY A;  3UDX A;  5IS1 A;  3G6O A;  1NRJ A;  3SS5 A;  4UEY A;  3T4J A;  2V1B A;  3FPW A;  5HWV A;  4JXW A;  5G4Y A;  1OTD A;  3GQZ A;  4RQ9 A;  1XPB A;  3UE1 A;  5DTT A;  2JCH A;  3WRZ A;  4BWI A;  4PHT A;  1FOF A;  2WKR A;  1OTI A;  1L3L A;  2QZ6 A;  3T1X A;  4JPM A;  3UB5 P;  4R4S A;  1AWI A;  3KYE A;  1ZTU A;  3W4P A;  3HJI A;  5HAI A;  3BFE A;  4IVI A;  4NXG A;  2HGV A;  5E2E A;  1IKG A;  1HLU P;  2J3T C;  4JGQ A;  3DTK A;  1EI5 A;  1H8Y A;  1I2S A;  3MKE A;  4CLC D;  3WS1 A;  2PBY A;  5HD3 A;  4S2N A;  5TBM A;  4RA7 A;  1ACF A;  4NET A;  4Y0O A;  3GRJ A;  1H5X A;  4NXF A;  2EX9 A;  3MQO A;  2L0W A;  5G18 A;  1T18 A;  3IX8 A;  4GW9 A;  3T50 A;  1BLP A;  3PR6 A;  2WGI A;  3IWI A;  3WS2 A;  1ZG6 A;  3V39 A;  2C6W B;  4O8G A;  2JKG A;  4G3V A;  5EM1 A;  5EVI B;  1QMF A;  3G35 A;  3BY9 A;  4YNR A;  1XKZ A;  2VV8 A;  1PFL A;  2XSS A;  4R4R A;  4CJN A;  2HPB A;  3ISG A;  2VGL S;  4WM9 A;  1XJ3 A;  3A3D A;  2Y2J A;  2HJ9 C;  2QWS A;  1BUL A;  3GV9 A;  1ES5 A;  1SKO B;  1PIO A;  2OSU A;  4K08 A;  3IF6 B;  4X53 A;  2OV5 A;  3V3S A;  3UB8 A;  2QHK A;  3UO9 A;  3H82 B;  3UDI A;  4HH3 A;  5KZH A;  4IUK A;  4QU3 A;  1K56 D;  4S2M A;  1MWS A;  2V0U A;  2ZM2 A;  3OCN A;  2XFS A;  3VP2 A;  4I3I A;  5DVA A;  3CUE C;  4HY8 A;  1S1Y A;  3UB6 A;  1GSX A;  1MWT A;  1S1Z A;  1TD5 A;  4X56 A;  3KSG A;  2G2U A;  2KDK A;  3KYQ A;  2LB5 A;  4HP4 A;  4X55 A;  2ZM8 A;  2JKR M;  5F6A A;  1MZU A;  1MWU A;  5HAR A;  3G30 A;  5KMW A;  4DN0 A;  1L0F A;  1UWN X;  1DJA A;  2ZD8 A;  2O9B A;  4EEU A;  3PTE A;  1SCW A;  2IWC A;  5TGF A;  1W5D A;  3GEC A;  1YSP A;  3LY3 A;  3LY4 A;  2HDR A;  2L4R A;  4S2J A;  2R9W A;  3BLS A;  3BW6 A;  5FQ9 A; 
#chains in the Genus database with same CATH homology
 3HUO A;  4UAA A;  4X6T A;  3BEC A;  5AQ9 A;  3GR2 A;  1ALQ A;  4JF6 A;  4F94 A;  1BSG A;  2XD5 A;  2ZQD A;  4KG6 A;  5EVI C;  2H0Y A;  3V3R A;  3VFH A;  3DW0 A;  3IH9 A;  4GD6 A;  4JXV A;  4PM6 A;  3NBL A;  3GVB A;  1S6R A;  4KQR A;  1Z6F A;  4OON A;  2IWD A;  1QME A;  3UDF A;  3GSG A;  4WEJ A;  4E6W A;  4K0W A;  1FCM A;  5EOO A;  4R0Q A;  4UA6 A;  1ES3 A;  4KZ3 A;  4WMC D;  4S2K A;  2Y2M A;  4PMA A;  3A3J A;  3I7J A;  4S2N C;  1KE0 A;  5AQA A;  5CHJ A;  2VGJ A;  1IEM A;  1FR1 A;  2ZLY A;  1BT5 A;  4S2O A;  1WYB A;  2Y2N A;  1ZC2 A;  2EX6 A;  4KZ6 A;  3O3V A;  3W4Q A;  3HBR A;  4DXB A;  3G32 A;  1WE4 A;  3G34 A;  1CI9 A;  1N9B A;  4LV0 A;  1KE4 A;  2CC1 A;  1KE3 A;  4QY6 A;  1LI9 A;  1YMX A;  2EX8 A;  2ZC5 B;  1RGZ A;  4R23 A;  3NIA A;  3IF6 C;  3Q7V A;  4L0L A;  3ZVT A;  3AGE A;  3IWQ A;  3M2K A;  4JF5 A;  4KZ8 A;  4BQM A;  4R1G A;  3DWZ A;  1MBL A;  4NK3 A;  4X68 A;  2EFX A;  3RXW A;  1CK3 A;  1XP4 A;  3MXR A;  3N8S A;  1IYQ A;  4OOL A;  2V20 A;  1I2W A;  2UWX A;  4ID4 A;  3HLG A;  1GCE A;  1E3U A;  1ZG4 A;  3G31 A;  3E2K A;  4OP8 A;  1PYY A;  1ESU A;  4IED A;  4EUZ A;  4FCF A;  1M40 A;  1E4D A;  3P09 A;  1K57 C;  4MLL A;  2PU4 A;  3M6H A;  5FI6 A;  4GD8 A;  3LEZ A;  4GB7 A;  5CXW A;  2HP9 A;  4GKU A;  3IHA A;  3EQV A;  2Y2L A;  4S2L A;  5DTK A;  3MZD A;  4M3K A;  3NDG A;  3S22 A;  1NYY A;  1TDG A;  3NDE A;  3HLB A;  3AGD A;  2WKE A;  1MPL A;  5KSH A;  1JTG A;  2GDN A;  3D4F A;  3OPH A;  4DF6 A;  2XR0 A;  1IYS A;  2A3U A;  4YFM A;  4LV3 A;  3ZGA B;  4HES A;  1YLJ A;  1I5Q A;  4ZJ3 A;  2P74 A;  5F1F A;  4OPZ A;  3S1Y A;  5FA7 A;  5A91 A;  2JC7 A;  3HLD A;  2V1Z A;  3PAG A;  3Q07 A;  3IQA A;  2WAF A;  3IXG A;  1PW1 A;  1EWZ A;  3N4I A;  1KVL A;  3UE0 A;  1CEG A;  4HBT A;  4EBL A;  1W7F A;  2XQZ A;  4XXR A;  5E2G A;  4DKI A;  4E3O A;  3GMW A;  1ES2 A;  3UPN A;  4OLG A;  4OVD A;  1RGY A;  2ZMA A;  1L0G A;  1JWP A;  2ZC6 B;  4FSF A;  2C5W B;  1PI5 A;  1XA1 A;  1BZA A;  3LCE A;  4RYE A;  5FAQ A;  3ZNY A;  5HW3 A;  2Y2H A;  3N7W A;  4OPR A;  2H10 A;  5DF8 A;  5CRF A;  1K54 C;  3A3E A;  1PWC A;  4QY5 A;  3Q82 A;  1DJC A;  3G4P A;  3BFD A;  3C7U A;  2WK0 A;  5JYO A;  2Y2O A;  3HL9 A;  1ERM A;  1YQS A;  2VGK A;  3UN7 A;  1L0E A;  5FAT A;  1YLZ A;  3QNB A;  4EQI A;  1H8Z A;  3BFF A;  4YIN A;  1YMS A;  4QJG A;  3M2J A;  2JE5 A;  3OPR A;  1K25 A;  1YM1 A;  1YLT A;  4S2P A;  1NY0 A;  4OQ0 A;  3M6B A;  5U47 A;  5A90 A;  3TG9 A;  4BL2 A;  5AQ7 A;  4OQH A;  5CGX A;  5F83 A;  3HVF A;  4OH0 A;  5IHV A;  2PU2 A;  1MWR A;  4WYY A;  3ZG9 B;  5GHX A;  4KZB A;  2RL3 A;  3MXS A;  1LL5 A;  3IF5 A;  4Y0T A;  2J8Y A;  5M19 A;  1ES4 A;  4P6B A;  3G2Y A;  4WEL A;  4O7D A;  4JKT A;  5FAO A;  4C75 A;  3RXX A;  4LV1 A;  1WYC A;  2ZQC A;  3VSK A;  4Y0U A;  5EVI A;  1AXB A;  3ZG5 A;  3DTM A;  5D3O A;  1HVB A;  4MBH A;  2P9V A;  1OME A;  1PWG A;  4N1H A;  3O88 A;  1PWD A;  1TDL A;  3N6I A;  4KZ7 A;  3UE3 A;  4E3N A;  3BEB A;  4ZDX A;  2XEP A;  3CMZ A;  3HLW A;  1YLP A;  3UNW A;  1CI8 A;  4BD0 A;  1S0W A;  1ZKJ A;  2XF3 A;  2ZQ9 A;  3ZG7 B;  2J9O A;  1FCO A;  5GL9 A;  1DY6 A;  3WS4 A;  5EEC A;  5FI2 A;  1XXM A;  2DNS A;  4KZ4 A;  2XH9 A;  4FD8 A;  1GA9 A;  4QB8 A;  5FQI A;  5GLA A;  4LCL A;  1GA0 A;  4DE1 A;  2OLV A;  3QNC A;  4KZ9 A;  3V5M A;  3WS0 A;  5F1G A;  4N1X A;  4N92 A;  4GZB A;  3ZDJ A;  3QHY A;  1DJB A;  5I94 A;  2OLU A;  5DF9 A;  1HD8 A;  3ZVW A;  2FFF B;  2JBF A;  1BLH A;  4WEK A;  2Y2I A;  1ESI A;  4JLF A;  4WZ5 C;  2BG1 A;  2XLN A;  4ZAM A;  3WRT A;  3Q81 A;  1NXY A;  4DE2 A;  4MEZ A;  1M6K A;  4P0M A;  3IWO A;  4HEF A;  1FSY A;  3NCK A;  1K6S A;  3G2Z A;  3B3X A;  3BM6 A;  3P98 A;  2J7V A;  4DDY A;  4OOY A;  4U0X A;  4RX2 A;  4DRT A;  1PI4 A;  2WGW A;  4R3B A;  1G6A A;  4X69 A;  3CJM A;  5EUA A;  2HDS A;  4GDN A;  2X71 A;  4UA9 A;  1K57 A;  3IXD A;  3LO7 A;  2ZJ9 A;  3MZE A;  1K38 A;  4D2O A;  1LI0 A;  2P9V B;  5CHM A;  1NRF A;  2Y2G A;  4PM8 A;  4Z9Q A;  4DXC A;  3ITB A;  2H5S A;  1VQQ A;  2Y59 A;  1BLS A;  1LL9 A;  2WYX A;  3FWL A;  5FQK A;  5F82 A;  5HAQ A;  1SDN A;  3OCL A;  3W8K A;  4EWF A;  3VP3 A;  3FZC A;  2B5R A;  3C7V A;  4N9K A;  2QPN A;  3MBZ A;  1K56 A;  3VP1 A;  5CTM A;  5DTS A;  4RVA A;  1K55 A;  5GLB A;  3ZCZ A;  4E3M A;  4Q8I A;  4A5R A;  4KEN B;  1JTD A;  5CGS A;  1FR6 A;  3CG5 A;  4EBP A;  5BOH A;  4IBX A;  5DF7 A;  4K0X A;  4B4Z A;  4EV4 A;  5JYP A;  4JXS A;  3AGF A;  1LHY A;  2ZQ7 A;  4MBF A;  1TEM A;  3UDX A;  1IYP A;  2RCX A;  5GLC A;  4B4X A;  2R9X A;  1RP5 A;  3SS5 A;  1FCN A;  3Q1F A;  4KQO A;  2Z2M B;  1XA7 A;  3BFG A;  3NY4 A;  1JWV A;  1U60 A;  4JXW A;  3Q7V B;  3GQZ A;  3WS5 A;  1NZU A;  5CHU A;  3MKF A;  1XPB A;  3PBT A;  4N9L A;  4OP5 A;  4U0T A;  3SS3 A;  2Y2K A;  4OQG A;  2HDQ A;  2WGW B;  3HRE A;  3TSG A;  3VSL A;  4UA7 A;  4R3J A;  5EE8 A;  2A49 A;  3UE1 A;  4MBK A;  1IEL A;  4BLM A;  4E3K A;  1ONH A;  2JCH A;  3OPP A;  4S2I A;  5DTT A;  5EOE A;  3WRZ A;  1NJ4 A;  1BUE A;  1YLW A;  2ZQ8 A;  1SHV A;  1FOF A;  3NC8 A;  3PBN A;  1K4F A;  3MZF A;  3SH9 A;  2QZ6 A;  4ZBE A;  4PM5 A;  3ITA A;  4OLD A;  3Q7Z A;  1W79 A;  4JPM A;  5TR7 A;  4OKP A;  1SDE A;  5FQM A;  4R4S A;  4B88 A;  4BJP A;  4KQQ A;  3W4P A;  4ZJ1 A;  3OC2 A;  1GHM A;  3E2L A;  5HAI A;  1XGI A;  3BFE A;  5CEC A;  4IVI A;  1FQG A;  5HL1 A;  1MXO A;  3FKV A;  1GHI A;  4OOM A;  5E2E A;  4E3I A;  2ZC4 B;  3UY6 A;  2EXB A;  1IKG A;  3BLM A;  2XGN A;  1HZO A;  3C4P A;  1EI5 A;  1H8Y A;  1TVF A;  3CZD A;  3UPP A;  1I2S A;  1W8Q A;  2HDU A;  1XX2 A;  3MKE A;  5EVL A;  3WS1 A;  1PZO A;  2PBY A;  3PBS A;  3ZG0 A;  4QD4 A;  4WMC A;  3W4O A;  4XUZ A;  4KG5 A;  4S2N A;  2ZQA A;  5CTN A;  4RA7 A;  1IYO A;  4NET A;  2WKH A;  3JYI A;  1Q2P A;  2BLS A;  4PM9 A;  4Y0O A;  2V2F F;  3FKW A;  4WZ5 A;  2J9P A;  2DCF A;  4KG2 A;  5EVI D;  3GRJ A;  5AQB A;  3VOZ A;  2WZX A;  2Y91 A;  1ERQ A;  1H5X A;  2HP5 A;  5FSR A;  3IF6 A;  2EX9 A;  2QMI A;  3HLF A;  4K91 A;  5G18 A;  3HLC A;  1E25 A;  3HUN A;  2XK1 A;  2ZC7 A;  1JVJ A;  5KSC A;  1KDS A;  2Q9N A;  1CEF A;  3IT9 A;  4KZA A;  4JF4 A;  4BL3 A;  1BLP A;  2E8I A;  2WGI A;  3IWI A;  3WS2 A;  5FAS A;  3FYZ A;  3PBQ A;  1ZG6 A;  5J8X A;  3V39 A;  2C6W B;  1ERO A;  5FQQ A;  3V50 A;  4PM7 A;  1YLY A;  2WUQ A;  3O86 A;  4EBN A;  1LLB A;  5EVI B;  1QMF A;  2EX2 A;  4BD1 A;  1N4O A;  3IXB A;  1O07 A;  4OQI A;  1RCJ A;  4CPK A;  2HP6 A;  3S4X A;  3G35 A;  4XUX A;  5FAP A;  2WAD A;  1XKZ A;  4U3T A;  4DE3 A;  2WGV A;  4R4R A;  4OPY A;  3PBR A;  4CJN A;  2HPB A;  3IXH A;  3ISG A;  4LEN A;  5GHY A;  4DE0 A;  2ZM0 A;  4WM9 A;  3A3I A;  3BFC A;  5TFQ A;  3A3D A;  2Y2J A;  5A92 A;  4QHC A;  3SS4 A;  1MY8 A;  2XD1 A;  1W8Y A;  2IWB A;  3C5A A;  4FH4 A;  4WZ4 A;  1BUL A;  1E3U D;  2WKI A;  2DRW A;  4GN2 A;  1ONG A;  2EFU A;  4JBF A;  4FH2 A;  5HX9 A;  2Y4A A;  1G68 A;  4OPQ A;  3GV9 A;  1ES5 A;  2G2W A;  3N8L A;  5CER A;  1YT4 A;  1J9M A;  1PZP A;  1PIO A;  2OSU A;  4RX3 A;  1O7E A;  5CED A;  4X53 A;  3IF6 B;  5HFO A;  2OV5 A;  1Q2Q A;  1KDW A;  3V3S A;  3ZHH A;  3ZFZ A;  4WBG A;  3SH7 A;  4P87 A;  2XDM A;  3IH8 A;  3UO9 A;  4C3Q A;  1K4E A;  1K54 A;  1XGJ A;  2Y2Q A;  2ZC3 B;  3C4O A;  5GHZ A;  4DDS A;  3UDI A;  4LCM A;  4PPR A;  3UPO A;  4GDB A;  3A3F A;  3VP0 A;  4E6X A;  5KZH A;  4QU3 A;  1K56 D;  2XFT A;  4S2M A;  1MWS A;  3SH8 A;  3TOI A;  5HAP A;  2ZM2 A;  3OCN A;  1PW8 A;  2XFS A;  1GHP A;  3MFD A;  3ZNT A;  3EQU A;  1K55 C;  4ZTK A;  3VP2 A;  5DVA A;  2Q9M A;  3RJU A;  4E3J A;  4MNR A;  4ZJ2 A;  1NZO A;  3PBO A;  3NI9 A;  1IKI A;  1MWT A;  4HBU A;  4X56 A;  1KVM A;  5E2H A;  2Z2L B;  2EXA A;  1NYM A;  1Y54 A;  5M18 A;  4P85 A;  2H0T A;  2G2U A;  5E43 A;  1K6R A;  4X55 A;  3IHB A;  5E2F A;  2ZM8 A;  4E3L A;  5FI7 A;  3HLE A;  4C6Y A;  2X02 A;  3ZG8 B;  1MKI A;  3BYD A;  4LV2 A;  1MWU A;  2WAE A;  4GNU A;  4Y7P A;  2Y55 A;  3VOY A;  2FFY A;  1KGF A;  1L2S A;  4KZ5 A;  5HAR A;  3SOI A;  3VMA A;  3DWK A;  5EPH A;  2X01 A;  5GLD A;  1SKF A;  3HUM A;  5CEB A;  3G30 A;  1BLC A;  1HTZ A;  3OPL A;  5KMW A;  4UHU A;  3N8R A;  3WWX A;  1L0F A;  4IVK A;  1KGG A;  3GTC A;  1L0D A;  1DJA A;  1KGE A;  5FQJ A;  2ZD8 A;  3PTE A;  2WZZ A;  4IBR A;  5M1A A;  1SCW A;  3PAE A;  4JXG A;  2IWC A;  3VP4 A;  2I72 A;  5TGF A;  3OZH A;  1W5D A;  5CGW A;  1BTL A;  3LY3 A;  2Y2P A;  5A93 A;  3LY4 A;  2HDR A;  1FSW A;  3FV7 A;  4BEN A;  1VM1 A;  4S2J A;  5L2F A;  3O87 A;  1JWZ A;  2R9W A;  3BLS A;  1C3B A;  4GOG A;  5FDH A;  5FQ9 A;  3BRM A;  4H8R A;  3VFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...