3E2LA

Crystal structure of the kpc-2 beta-lactamase/beta-lactamase inhibitor protein (blip)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
260
Chain Sequence
b'AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPSDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenemase
molecule tags Hydrolase/hydrolase inhibitor
source organism Klebsiella pneumoniae
publication title Structural and biochemical characterization of the interaction between KPC-2 beta-lactamase and beta-lactamase inhibitor protein
pubmed doi rcsb
total genus 93
structure length 260
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3e2lA00
1O7EA 1Q2QA 3CJMA 5HFOA 3WWXA 3ZGAB 4Y0OA 3GSGA 3QNCA 2R9XA 2ZM0A 1GA0A 3GTCA 1ESUA 4DDYA 3P98A 2H10A 4BQMA 3VP2A 4X68A 3WRTA 4GN2A 1FR1A 1TDLA 3O3VA 3HBRA 3VOYA 3O87A 5AQAA 4E3JA 4RYEA 5CEDA 3BFGA 1BLHA 3V3SA 4ID4A 1JVJA 1CI8A 3E2LA 4KG6A 1YT4A 3RXXA 2WUQA 5EPHA 5BOHA 1YLPA 2H0TA 4FH2A 1FQGA 4N9LA 2HDSA 1NRFA 2EXAA 3WS1A 5A92A 1SKFA 1QMEA 5EOEA 1PWGA 1S0WA 1K54A 2Y59A 3G32A 5FQQA 1NYMA 3LO7A 5AQ9A 2H0YA 2WADA 2EX9A 4KZ5A 5HAIA 1MXOA 4WMCA 4XUZA 4EUZA 2WGWA 1LI9A 2WYXA 3ZG5A 1NY0A 3SOIA 1ZKJA 3NCKA 4YINA 1FCMA 4QB8A 1GA9A 1I2SA 3M2KA 4DF6A 4OONA 4C75A 4EBPA 4UA6A 2HP9A 4OOLA 4KZ7A 2Z2MB 4ZBEA 1H8YA 3A3EA 4OLDA 1FOFA 3VOZA 4KZAA 3SS4A 4HBTA 2X01A 1YMSA 2EX2A 3UO9A 2J7VA 1ERMA 1ES2A 4OQIA 4F94A 3FWLA 5A93A 5CTMA 1CI9A 3IF5A 3BRMA 1WYBA 1K4EA 2EX8A 3NDEA 1ALQA 4JXSA 3HLWA 3V39A 1ES5A 1N4OA 4OLGA 1K57C 2Z2LB 3VSLA 3S1YA 1BLSA 3UNWA 5F1FA 4FCFA 4QD4A 1H5XA 1EI5A 5KZHA 3IF6C 4E3KA 4FSFA 1GCEA 1XA7A 2JCHA 3DWZA 3PBQA 1XGIA 2Y2OA 3VSKA 4E3NA 1K55A 2HP5A 4ZJ2A 4DXBA 1M40A 1GHIA 4PPRA 1NZOA 4IBRA 3VFHA 2HDQA 3BFEA 2C5WB 1G68A 1W8QA 2WAEA 1MY8A 3CZDA 3G34A 3PTEA 5GHYA 2J9OA 4S2IA 2XK1A 1RGZA 3FKWA 4HBUA 4U0XA 3I7JA 4QHCA 4CPKA 3OPPA 3G4PA 5FI2A 1MWUA 3C4PA 2VGJA 3HLEA 5CGWA 5E2GA 3Q7VB 3UE3A 4BD1A 1K54C 4FH4A 1JWZA 5TFQA 2Y2LA 3NDGA 4R0QA 4QJGA 1PI5A 5F1GA 3G2ZA 4WMCD 3SS3A 2HDUA 1W79A 4QY5A 5M19A 1JWPA 3JYIA 4JXGA 1KE0A 1EWZA 3IH8A 4R3BA 5GLCA 5FAPA 5GLDA 3A3FA 2ZM2A 2CC1A 1W8YA 3EQVA 4QY6A 4JXWA 3DW0A 3BFCA 1TDGA 4MLLA 4P6BA 3N4IA 4A5RA 1Y54A 2ZQCA 3SH9A 4HESA 3WS4A 3PAGA 5G18A 3IWIA 3CMZA 4GD6A 1L0GA 2Y2NA 4K0WA 2ZC3B 5FQKA 3AGEA 1HTZA 5FSRA 5TR7A 2EFXA 5FQJA 2P74A 4E3IA 1JTGA 2XR0A 1LI0A 2R9WA 4IVIA 1YLWA 4OP5A 3MXRA 1QMFA 5FASA 5E2FA 4NETA 5FI6A 3W4QA 4OH0A 3IHAA 4OPZA 1NZUA 1K4FA 1KGEA 3N8LA 3VMAA 4S2NC 1L0EA 3QNBA 5DF9A 3W8KA 5HAQA 3IHBA 2XGNA 3MZFA 4KG2A 3BECA 4D2OA 1E3UA 3N7WA 1WE4A 3HLBA 2V2FF 2V1ZA 4NK3A 1PIOA 2E8IA 2X02A 3NIAA 5M1AA 1XPBA 5DTSA 3B3XA 3BLSA 3IWQA 3UDFA 3IXBA 4P85A 3ZG0A 4RVAA 2FFYA 2ZC7A 2ZJ9A 1MWRA 5D3OA 4R1GA 3V50A 2HP6A 2WZXA 4X55A 5EE8A 4PM9A 5EECA 3ITBA 1S6RA 3LCEA 5CTNA 5FDHA 2ZMAA 2V20A 3V5MA 5GLBA 2G2UA 1TVFA 1W5DA 2RL3A 4X6TA 3SS5A 4YFMA 3ZNTA 3UDIA 5I94A 1YQSA 5KSHA 4M3KA 3EQUA 4E6XA 2ZC4B 3VP0A 4Y0UA 1IYSA 3RXWA 4KQRA 4KZ9A 1CEGA 1VM1A 4BL3A 2ZC6B 5JYOA 4WBGA 2QPNA 3DWKA 1W7FA 1GHPA 3FZCA 3O86A 3ZHHA 3NY4A 1IELA 4IBXA 5CRFA 3V3RA 1BLPA 5DTTA 2Y2QA 4OKPA 4OOMA 4WZ5C 4KZ4A 4WZ4A 1K6RA 1BLCA 1RCJA 1SCWA 1YLTA 2XEPA 4PM7A 1MBLA 1XXMA 3TSGA 3GRJA 3HL9A 3FV7A 1HZOA 2GDNA 3OZHA 3PBSA 4GD8A 2Y2JA 5KMWA 4BD0A 4E3OA 2HPBA 1J9MA 1LL9A 3ZFZA 1JTDA 2I72A 3MKEA 4LV1A 1MKIA 4PM5A 1KDSA 5AQ7A 2XFTA 5CHUA 5FATA 4DE2A 1BT5A 5JYPA 1YLYA 3RJUA 4OPRA 5DF7A 2BG1A 4KG5A 2WGIA 3MXSA 5E2EA 4EV4A 4DE3A 4MBHA 2Y2MA 3IQAA 1BULA 3PAEA 3UY6A 2PBYA 4U0TA 3DTMA 1DJBA 1KGFA 3MBZA 1KE4A 1XP4A 3Q1FA 2ZQAA 3PBRA 5CEBA 4KZ6A 4C6YA 1E25A 4WM9A 4WYYA 3ZG8B 1C3BA 3IT9A 4MBFA 3IXHA 3W4OA 1SDEA 2XF3A 3NC8A 4N92A 3C7UA 3BYDA 5A90A 4GZBA 1XX2A 3FKVA 4JBFA 1E4DA 3VFFA 4JPMA 1KVMA 2WKHA 1SHVA 4BENA 3G31A 4X53A 3MFDA 3Q7ZA 1WYCA 4P0MA 1PWDA 3HVFA 3HLCA 3TOIA 1ONGA 2ZQ9A 4QU3A 5EUAA 1BZAA 2Y55A 3WS2A 2ZQ7A 3WS0A 3ZVTA 5DF8A 4B4XA 1YMXA 4WEKA 5CGSA 3OCLA 1DJCA 1ONHA 2EXBA 4ZJ3A 1BSGA 4N9KA 3HREA 2P9VA 4Q8IA 1NXYA 3Q82A 1K56D 3ZG7B 3D4FA 3N8SA 3UPNA 3ZDJA 3G2YA 4LV3A 3GR2A 4JXVA 1CK3A 1IYOA 2J9PA 3BM6A 1Q2PA 3QHYA 2IWBA 1KE3A 5GL9A 1SDNA 3ZVWA 1I5QA 4Y7PA 4EQIA 4ZAMA 4R4SA 3OCNA 4WEJA 4R3JA 2QZ6A 2XLNA 4C3QA 1YLJA 5HARA 4WELA 4IEDA 3M6HA 4MNRA 4S2MA 4KZ8A 3A3JA 4S2KA 4PM6A 4R4RA 4LCLA 3C4OA 2OLUA 4KZBA 1RGYA 5EOOA 1IKGA 4JF6A 5EVID 5F83A 4EWFA 5GLAA 3C5AA 4DE0A 1PI4A 3G30A 3HUNA 4L0LA 1GHMA 3PBOA 2ZC5B 5FQ9A 5HX9A 4LV0A 4E6WA 4BLMA 4BL2A 2PU2A 2WGWB 3IF6A 2XD5A 3BFFA 4GB7A 2ZM8A 5EVIA 4N1HA 3ZCZA 4DRTA 2PU4A 4KENB 4PMAA 2EX6A 1XA1A 1KVLA 3OPHA 1MPLA 4H8RA 4R23A 3AGDA 4Y0TA 1VQQA 3Q07A 5CGXA 1L2SA 1NJ4A 1ZG6A 4JLFA 3GV9A 4IVKA 1LL5A 3HLFA 3UE0A 5EVLA 1K25A 3P09A 4O7DA 4Z9QA 1OMEA 3UPOA 5EVIC 1PWCA 4UA9A 1RP5A 3UPPA 4KQQA 2WAFA 3VP4A 3VP3A 1M6KA 3E2KA 5EVIB 4GOGA 2WZZA 1BUEA 1Z6FA 2Q9NA 3VP1A 2G2WA 4S2JA 3WS5A 5CERA 4OPYA 4E3LA 5A91A 1PYYA 1K56A 1H8ZA 1FSYA 1O07A 2B5RA 4PM8A 3IH9A 5CHJA 3UN7A 5FQIA 1IKIA 2OSUA 1JWVA 2Y2IA 2WKEA 2Q9MA 3ZG9B 3OPLA 5E2HA 4DKIA 1E3UD 4E3MA 4RX3A 4EBLA 3HUOA 1IYQA 3G35A 2WK0A 1FCNA 4P87A 1ESIA 2XFSA 3MKFA 4X69A 3LEZA 1U60A 5DVAA 3A3IA 1FR6A 2Y2GA 3HLGA 4OP8A 5HW3A 3GQZA 4OQHA 4UA7A 4B88A 1FSWA 4DXCA 3A3DA 2VGKA 3HLDA 3BFDA 5FAOA 5IHVA 1G6AA 5U47A 4ZTKA 3UDXA 2DCFA 2JE5A 2ZD8A 3HUMA 3OPRA 4KZ3A 2WGVA 4S2LA 1K55C 2P9VB 3IF6B 4B4ZA 3W4PA 4U3TA 2A3UA 3ISGA 4UAAA 4GDBA 1AXBA 4UHUA 1NYYA 3GVBA 3IWOA 4DDSA 4BJPA 1L0FA 5GHZA 1ZC2A 1KGGA 5E43A 3BLMA 4WZ5A 2ZLYA 5F82A 1YLZA 1ERQA 4HEFA 1HD8A 1LLBA 4K0XA 5HAPA 1PW8A 4CJNA 2DRWA 4X56A 4GNUA 4MBKA 1XKZA 2DNSA 1HVBA 1ZG4A 1IYPA 3AGFA 3S22A 4N1XA 5DTKA 2Y4AA 1PZOA 3PBTA 3Q7VA 4K91A 3M2JA 3BEBA 1IEMA 3FYZA 3SH7A 3TG9A 2J8YA 3M6BA 4RA7A 2XH9A 2BLSA 3NI9A 3MZDA 2H5SA 4MEZA 4LCMA 4JKTA 5FA7A 1ES3A 5HL1A 4EBNA 3LY3A 1KDWA 2Y91A 1TEMA 5FAQA 1FCOA 5CHMA 4GKUA 2XQZA 3WRZA 4LV2A 1N9BA 5L2FA 4GDNA 4OQGA 4LENA 2XDMA 2JC7A 2RCXA 2UWXA 4S2PA 4OQ0A 2WKIA 3Q81A 1K57A 3C7VA 1MWSA 3ZNYA 4OVDA 4DE1A 1MWTA 3MZEA 1YM1A 4XUXA 2FFFB 2ZQDA 1PW1A 1EROA 2OLVA 4FD8A 4JF4A 4OPQA 3NBLA 2JBFA 1PZPA 2XD1A 5AQBA 3UE1A 4ZDXA 3LY4A 5FQMA 2EFUA 1DY6A 5FI7A 3N6IA 2C6WB 3IXDA 1L0DA 2IWCA 4RX2A 3OC2A 5CXWA 2Y2PA 5GHXA 1XGJA 4ZJ1A 1DJAA 4S2NA 3SH8A 3S4XA 4XXRA 3GMWA 5CECA 3O88A 2IWDA 2A49A 4S2OA 5TGFA 5J8XA 2Y2HA 1CEFA 3N8RA 2ZQ8A 1I2WA 4OOYA 2Y2KA 2OV5A 4JF5A 5KSCA 2X71A 1ES4A 3ITAA 1K6SA 4KQOA 3PBNA 2HDRA 1BTLA 2QMIA 5M18A 1K38A 1LHYA 3CG5A 3IXGA
chains in the Genus database with same CATH superfamily
2KOIA 2ZM0A 1GA0A 4DDYA 4X68A 4ZRRA 4E3JA 5CEDA 3BFGA 3F1PA 1CI8A 1YT4A 2WUQA 1YLPA 4PAUA 1NRFA 2EXAA 3WS1A 5A92A 2I9VA 1PWGA 1S0WA 2Y59A 1NYMA 1LI9A 4MN5A 4R38A 1NY0A 3IX3A 2O9AA 2QWSA 3M2KA 4KZ7A 4DN0A 1CF0A 3G6OA 3SS4A 4P6ZS 4I3AA 3UO9A 1OTIA 4HH3A 5A93A 5CTMA 3KSHA 3IF5A 2EX8A 1K4EA 1ALQA 4OLGA 1K57C 2Z2LB 4FCFA 4QD4A 1H5XA 3IF6C 2PDRA 2JKTM 3PBQA 3VSKA 1K55A 4DXBA 4O0PA 3S7OA 5AJGA 3VFHA 3NOUC 5EFWA 3G34A 4R70A 3I7JA 3G4PA 3BQ8A 2VGJA 3HLEA 5E2GA 3W2ZA 1J3WA 1VB6A 3LIDA 3G2ZA 3SS3A 2HDUA 1CJFA 1EWZA 2W1TB 4R3BA 5GLCA 3A3FA 1GSVA 4QY6A 1F2KA 2CMNA 3DW0A 4K08A 4HI4A 2PR5A 3SH9A 4HESA 3LGOA 3PAGA 3IWIA 1HTZA 2VGLS 2EFXA 1LI0A 2R9WA 1YPRA 5AVFA 5E2FA 2J3WA 3EGXC 3IHAA 3ULFA 2PAVP 3IHBA 3MZFA 5I5LA 1E3UA 2GJ3A 1WE4A 4CLCB 5EM1A 3MMHA 3DTKA 5K5BA 3B3XA 3BQAA 4UQIS 4RVAA 2K7SA 3NOTC 2HP6A 2WZXA 1Y28A 1NLYA 3ITBA 3LCEA 5FDHA 2ZMAA 2V20A 3IS2B 4LLOB 3IX8A 3D3OA 1W5DA 4X6TA 4GHIA 3UDIA 1H8MA 5F69A 2P7JA 4KZ9A 4BL3A 3KSFA 3QP8A 1GHPA 5F68A 5CRFA 3V3RA 1BLPA 5DTTA 3NECA 4OOMA 4WZ4A 1K6RA 1BLCA 1YLTA 1MBLA 3PBSA 3VE3A 3ZFZA 1GSWA 1JTDA 1DP6A 2I72A 3MKEA 4HJ6A 5HL6A 3S7PA 1FIKA 2PT7A 2XFTA 3K2NA 1OPXA 1V9YA 3T4OA 5HZHA 2W3HA 2WGIA 2BASA 4MBHA 2QKPA 4U0TA 3EEAA 3MBZA 1XP4A 1W63Q 2ZQAA 4CLCD 3VOLA 4KZ6A 3KYQA 2G7UA 1Z09A 4Y3IA 4EUVA 3NC8A 3BYDA 4GZBA 3IBRA 4JBFA 1Y4OA 1E4DA 3B33A 5IS1A 3G31A 3Q7ZA 4EW7A 3HVFA 3HLCA 3TOIA 1YMXA 4NXFA 3MSHA 3NHQA 4ZJ3A 1DP8A 2OOLA 2EA9A 3HREA 3PYPA 4UQIM 4Q8IA 3KSGA 1K56D 3T12B 3N8SA 2L0WA 2B18A 1CK3A 3D72A 1K0KA 2J9PA 2LB5A 3VV4A 5GL9A 4BBVA 2XLNA 4C3QA 1VETB 4JGQA 1S1YA 1T18A 4KZ8A 4S2KA 2OLUA 4KZBA 4XT2B 4DE0A 2ZC5B 1F5MA 4LV0A 2JN7A 2XSSA 2PU2A 3T50A 4GB7A 5EVIA 3LIEA 4HY8A 4NG2A 4R23A 5MC7A 5CGXA 4I5SA 3HLFA 1N9OA 1ZTUA 5EVLA 4O8GA 1XJ2A 4O7DA 4Z9QA 1NRJA 1OMEA 3UPOA 3UPPA 2WKRA 1M6KA 5HD3A 1BUEA 4GS9A 2G2WA 4S2JA 3LR5A 4OPYA 3UN7A 1O07A 1FSYA 2LB9A 1OJGA 2PHYA 1JWVA 4B93A 3F1NB 2Q9MA 3FG8A 1MZUA 4E3MA 4RX3A 2Z6DA 4P87A 4X69A 3LEZA 5DVAA 2VLGA 4XT2A 4UA7A 4B88A 5IHVA 4MCWA 5U47A 3UDXA 3HUMA 4HJ3A 2WGVA 4S2LA 2P9VB 5L07A 1UWNX 4U3TA 3ISGA 4GDBA 1AXBA 5J4EA 4BJPA 2V1AA 4ETXA 1ZC2A 2OWJA 4WZ5A 1VEUA 3UB8A 4HEFA 4BBUA 1LLBA 4K0XA 4AFIA 5HAPA 1PW8A 3AGFA 1HVBA 1ZG4A 3UB5P 2V8FA 3PBTA 2V0UA 4K91A 5FEGA 3SH7A 1IEMA 1XJ6A 2VEAA 3MQOA 2XH9A 3MZDA 4MEZA 3U2AA 3A0RA 1OTEA 4EERA 1KDWA 1N9BA 3VE4A 1LSXA 2HF6A 2RCXA 3C7VA 5HWWA 2FFFB 2Z6CA 2ZQDA 1PZPA 2XD1A 5FI7A 2PD7A 4RX2A 3OC2A 5CXWA 4Z1WA 4FUWA 3S4XA 5CECA 2A49A 5TGFA 2E8JA 5J8XA 3IX4A 5A8BA 3MQQA 1S4RA 3T4LA 3DAVA 3EGDC 2HDRA 3RXWA 3GECA 3K3CA 4Y0OA 2J80A 3QNCA 2R9XA 1S4SA 3P98A 3VP2A 1FR1A 3VOYA 4RYEA 1JVJA 3E2LA 3RXXA 4FH2A 2W3FA 1TS8A 4CLCE 4KZ5A 3KSIA 5FDSA 4YINA 1FCMA 1GA9A 1I2SA 4UA6A 4ZBEA 3A3EA 4OLDA 3VOZA 4KZAA 2X01A 5F6AA 4F94A 3T1XA 2VV7A 1CI9A 5DJTA 3BRMA 2OWHA 3HLWA 1ES5A 1LL8A 5F1FA 3KO6A 1EI5A 4NKPA 4E3KA 1GCEA 1XA7A 1SZVA 2Y2OA 5LBRA 1M40A 4PPRA 2HJEA 2HV1A 1G68A 2WAEA 1MY8A 5GHYA 3LIBA 2J9OA 1RGZA 2PYPA 2ZOHA 4HBUA 4CPKA 4QHCA 5FI2A 5CGWA 3UE3A 1K54C 1JWZA 2XA7M 3NDGA 4YOFA 5M19A 4QY5A 1MC0A 1TS6A 1JWPA 3LEQA 2VGLM 5FAPA 4EU0A 5GLDA 2CC1A 2YKHA 4MLLA 2O9BA 3CHWP 1Y54A 2ZQCA 2VKSA 5G18A 1NLZA 2PD8A 4I3IA 1L0GA 4HOIA 3CITA 2ZC3B 5FSRA 5FQJA 2P74A 5DFYA 4E3IA 5TJJA 1QMFA 3C2WA 5FASA 4OH0A 4OPZA 1K4FA 1KGEA 3N8LA 1L0EA 4D2OA 2HGVA 3HJKA 3JVUA 3NIAA 5FEFA 2A2LA 5DTSA 3V67A 2FFYA 2ZC7A 1MWRA 3V50A 4R1GA 2GNXA 4ARZB 3F1PB 5CTNA 2G2UA 4UEYA 2RL3A 3R7WA 3BY8A 3ZNTA 5HPIA 1W63M 1P9RA 4M3KA 4E6XA 4Y0UA 3MF0A 4KQRA 4HP4A 1VM1A 3CUEA 3UB6A 5JYOA 4WBGA 2QPNA 1W7FA 4PKYA 3UMDA 3NY4A 1IELA 3OOVA 2Y2QA 1XJ4A 4WZ5C 4KZ4A 1RCJA 1XXMA 2MJ6A 4GD8A 2W3DA 3OZHA 3T4QA 5KMWA 2QHKA 1JNUA 3EWKA 1J9MA 2JKRI 1F9IA 4PM5A 1KDSA 4DE2A 5FATA 3RJUA 4OPRA 5DF7A 1XFQA 4EV4A 5E2EA 1BULA 4CQHA 1DJBA 2PBDP 1KE4A 3ZG8B 3IT9A 4HIAA 3W4OA 1SDEA 5A90A 4MMNA 1V9ZA 4JPMA 1KVMA 4BENA 3LYXA 3ZVTA 4WEKA 1ONHA 2EXBA 1BSGA 1NXYA 4Q0JA 3UE6A 3D4FA 3UPNA 3P01A 4LV3A 1IYOA 3KX0X 2VZWA 2B95A 3ZVWA 1I5QA 1XFNA 2HZ5A 2QZ6A 4LRYC 1YLJA 4LFUA 1YSQA 4PM6A 2KDKA 2JHEA 3LI9A 3MJQA 5EOOA 5F83A 4EWFA 2V0WA 4L0LA 1GHMA 4MN6A 5HX9A 4ESPA 4BLMA 4BL2A 2XD5A 5C5KA 1LT0A 3OLOA 2GX5A 3ZCZA 4DRTA 5HDDA 2ZOIA 2W27A 2EX6A 1KVLA 3OPHA 4Y0TA 3Q07A 1NJ4A 4IVKA 1LL5A 4MN7A 3P09A 5L10A 4CLCC 1PWCA 2WAFA 3VP3A 5TBMA 3WS5A 5CERA 5A91A 1K56A 2B5RA 4PM8A 4WN5A 2OSUA 4I39A 3ZG9B 4Y13A 3OPLA 3HCYA 4LPZA 1IYQA 3A3IA 1TS0A 5TBMB 3H82B 4OQHA 1FSWA 2VGKA 4NEED 3HLDA 1G6AA 2PR6A 4ZTKA 2DCFA 2ZD8A 3MFXA 3OPRA 3A0VA 4B4ZA 5J7EA 3BY9A 2ZMFA 3C38A 3SZTA 2J3TC 2DRWA 4MBKA 3MS6A 4N1XA 5DTKA 1PFLA 3TG9A 3LR0A 2YKFA 2BLSA 3NI9A 2H5SA 4LCMA 3TJZC 1ES3A 1TEMA 2DMWA 2OAP1 5FAQA 3BWLA 4YNRA 4OQGA 1LSWA 2XDMA 2JC7A 2UWXA 1AWIA 3Q81A 2AVXA 3H9WA 3ZNYA 4DE1A 4XUXA 1CQAA 1P97A 1EROA 4Y2FA 5AQBA 3UE1A 4ZDXA 4YWZA 4G3KA 5FQMA 2EFUA 3IXDA 4ZJ1A 5GHXA 3SH8A 1DJAA 4XXRA 2IWDA 4S2OA 3KYEA 1CEFA 3TRCA 2ZQ8A 4G3VA 2OV5A 4JF5A 5DJUA 3SW1A 1K6SA 1BTLA 1LHYA 3CG5A 1O7EA 5HFOA 3B47A 3GSGA 3GTCA 1ESUA 3E4PA 4BQMA 4GN2A 1TDLA 3O3VA 3HBRA 3O87A 1BLHA 3V3SA 4ID4A 2QYBA 4KG6A 5BOHA 3GDIA 2HDSA 1QMEA 5EOEA 5FQQA 3G32A 3LO7A 2EX9A 2P08A 5HAIA 5L8MA 4EUZA 1FILA 2WGWA 3ZG5A 1ZKJA 4M4XA 4QB8A 1OT9A 3FPVA 4DF6A 4C75A 4EBPA 1A0KA 2HP9A 4OOLA 2Z2MB 4ETZA 1FOFA 4HBTA 1YMSA 1ZHHB 2J7VA 1ES2A 4OQIA 1STZA 1WYBA 4JXSA 4MDZA 4G3WA 3QP1A 3S1YA 1BLSA 2PRFA 4PHTA 4GHIB 4FSFA 3DWZA 1XGIA 4WUJA 2XA7S 4ZJ2A 1NZOA 2VX8A 4IBRA 2HDQA 3HJIA 2C5WB 3CZDA 2XK1A 3OPPA 3Q7VB 4BD1A 4WF0A 4FH4A 5TFQA 1D06A 2Y2LA 4R0QA 4QJGA 1W79A 1OJ5A 1G5UA 3F1OA 1KE0A 2KX6A 3IH8A 1D1JA 4DJ3A 2ZM2A 2KLIA 3LI8A 1W8YA 4GS9B 3NOPC 1S66L 3BFCA 2QJ7A 2W3GA 4P6BA 3N4IA 4PKYG 3WS4A 2XRNA 2Y2NA 1P0ZA 4K0WA 5FQKA 5HWVA 2VV8A 2XR0A 1YLWA 3QP5A 3W4QA 5HAQA 3W8KA 3BECA 4X25A 2JKTI 4HJ4A 1XPBA 2PYRA 2P04A 3UDFA 3IXBA 3ZG0A 4KUOA 2ZJ9A 4X55A 2W3EA 2JKFA 3S7QA 3ZQ5A 1TVFA 2ACGA 3SS5A 2QJ5A 3B42A 3PXPA 4F3LB 4GLQA 2ZC4B 2ZC6B 3H7WA 3DWKA 4OKPA 1SCWA 2XEPA 4EEPA 5HDSA 3T4JA 3TSGA 3GRJA 3HL9A 1HZOA 1T1AA 2GDNA 2Y2JA 2K2NA 4E3OA 2HPBA 1LL9A 4LV1A 2W1TA 5CHUA 1BT5A 1PRQA 3QP4A 5JYPA 1VETA 2BG1A 3MXSA 4DE3A 5KIZA 2Y2MA 3IQAA 3UY6A 3E4OA 1KGFA 3DTEA 5CEBA 4WM9A 2ZMVA 1MKMA 3IXHA 3LFVA 3CAXA 4N92A 1XX2A 3FKVA 3VFFA 4HHDA 1SHVA 4X53A 1P9WA 2VV6A 1PNEA 5EUAA 2ZQ7A 1T1BA 3OCLA 3S7NA 2D01A 2P9VA 4CLCA 4FTXA 3ZG7B 4BBTA 1L3LA 3ZDJA 3G2YA 3GR2A 4JXVA 3FC7A 3LICA 2O99A 1Q2PA 2IWBA 4Q0HA 3NULA 4FOFA 4IEDA 3M6HA 3A3JA 3LR3A 4R4RA 4LCLA 1RGYA 4JF6A 2INWA 3EOIA 3C5AA 4GJ4A 4HQAA 4GCZA 4F3LA 5L09A 4E04A 4E6WA 3BFFA 2UV0E 4EETB 3IBJA 4JGOA 4N1HA 1T1CA 5IT5A 4I3JA 1XA1A 4H8RA 3AGDA 4NXEA 1VQQA 1K25A 5EVIC 4UA9A 1RP5A 4IUHA 1X0OA 3E2KA 5EVIB 4HH2A 2WZZA 3VP1A 1SKOA 4E3LA 3R7WB 1PYYA 1H8ZA 5FQIA 2Y2IA 1E3UD 4EBLA 3G35A 1TS7A 2WK0A 1UWPX 1OT6A 3MKFA 4BWIA 1U60A 4OP8A 5HW3A 3GQZA 4BMWA 3E98A 5G4YA 2M7UA 5DKKA 4IHQA 3A3DA 3BFDA 5FAOA 4KZ3A 2FH5A 1WA9A 3IF6B 1OTDA 3W4PA 2A3UA 4RQ9A 4UHUA 4DDSA 2XROA 1G28A 2M7VA 5GHZA 5E43A 3BLMA 3ICYA 1YLZA 1HD8A 1TD5A 4IUKA 4X56A 1GSXA 1XKZA 2DNSA 1IYPA 4Y15A 3S22A 2W1RA 4WLAA 2Y4AA 1PZOA 3Q7VA 5HDCA 3M2JA 3FYZA 3M6BA 5HL1A 4EXOA 4EBNA 2VJWA 4LRXC 1FCOA 5AVEA 5L2FA 4GDNA 4L9FA 1HLUP 4LENA 4LGWA 4OQ0A 2WKIA 2ZL1A 3H82A 1MWSA 3L7HA 1YAXA 1EW0A 1MWTA 3MZEA 1YM1A 4OPQA 2OLVA 3D9YA 4JGRA 4EEUA 3NBLA 2JKGA 3LY4A 3O5YA 3N6IA 4ARZA 1L0DA 2IWCA 5HPFA 3K3DA 1XGJA 4S2NA 1OTAA 4Q0IA 2Y2HA 1UGUA 1I2WA 2Y2KA 2V8CA 3PR6A 2A24A 4KQOA 1ES4A 3PBNA 4ME4A 2BTFP 5M18A 2O9CA 3MQ0A 3IXGA 1Q2QA 3CJMA 5IU1A 3WWXA 3ZGAB 3LIAA 2H10A 5DFXA 3WRTA 5AQAA 3T1QB 1N9LA 5EPHA 2H0TA 4I38A 1FQGA 1DP9A 4N9LA 3C30A 1SKFA 3CI6A 1K54A 2L1MA 5AQ9A 2H0YA 2WADA 2FZ0A 1MXOA 4WMCA 4XUZA 2WYXA 3MXQA 3SOIA 3NCKA 4EESA 2HJ9C 4DJ2A 2ZBBA 4OONA 5HSQA 1H8YA 3C8CA 4H6JA 5J3WA 2EX2A 1ERMA 3OBFA 3UMEA 3FWLA 3UB9A 3NDEA 3CUEC 2EWWA 3V39A 1N4OA 2WKQA 3VSLA 3UNWA 2NUTC 5KZHA 2JCHA 4E3NA 2HP5A 2WKPA 1GHIA 3BW6A 1ACFA 3BFEA 1W8QA 3PTEA 2B02A 4X1LA 4S2IA 3NJAA 3FKWA 4U0XA 1MWUA 3C4PA 3ZYTA 1PI5A 5F1GA 4WMCD 4Y17A 3JYIA 4JXGA 3QP6A 1XJ3A 3DTIA 3EQVA 4JXWA 3TW8A 1TDGA 4WL9A 4A5RA 4QPRA 3E0YA 4HP9A 3CMZA 4GD6A 3AGEA 5HWTA 1NWZA 1YKDA 5TR7A 3U4LP 1JTGA 4IVIA 4QWOA 4OP5A 3MXRA 4KUKA 3QP2A 4NETA 5FI6A 1NZUA 3VMAA 3JPUA 4S2NC 3QNBA 5DF9A 5EVEA 2XGNA 4KG2A 3N7WA 1KOUA 3HLBA 2V2FF 2V1ZA 4NK3A 1PIOA 2E8IA 2X02A 1IFQA 3IS2A 5M1AA 2ZL1B 1D7EA 3BLSA 3IWQA 4P85A 5D3OA 1YSPA 5EE8A 1VHMA 1T19A 4PM9A 3H7WB 5EECA 3L9KA 1S6RA 3V5MA 4IJGA 5GLBA 4YFMA 5EM0A 5I94A 2EWVA 2GZAA 1YQSA 5KSHA 3EQUA 3VP0A 1IYSA 1CEGA 1G6OA 3FZCA 2A24B 3O86A 3ZHHA 4IBXA 2JKRM 2IA2A 4II7A 1S1ZA 4PM7A 1BYWA 3FV7A 3CLOA 4BD0A 1MKIA 5AQ7A 3MR0A 1YLYA 4GW9A 4KG5A 2VK3A 3E4QA 3PAEA 4R6LA 2PBYA 1F98A 4NXGA 3DTMA 3Q1FA 3PBRA 4C6YA 1E25A 4WYYA 1C3BA 4LRZE 4MBFA 1N9NA 2XF3A 3C7UA 2WKHA 3MFDA 1WYCA 4P0MA 1PWDA 1ONGA 2ZQ9A 4QU3A 1BZAA 2Y55A 3WS2A 3WS0A 4B4XA 5DF8A 3TE8A 3BJNA 5CGSA 1DJCA 4N9KA 3T1RA 3Q82A 3T4KA 3RFBA 2NUPC 3BM6A 4R3AA 3QHYA 3LUQA 1KE3A 1SDNA 4Y7PA 4EQIA 4ZAMA 4R4SA 3OCNA 4WEJA 2J3TD 4R3JA 5HARA 4WELA 4MNRA 1LSVA 4S2MA 4L9GA 4Y5FA 3C4OA 4O01A 1IKGA 5EVID 5GLAA 2D02A 1PI4A 3G30A 3HUNA 3EEHA 3PBOA 5FQ9A 4B9OA 4HNBA 2WGWB 3IF6A 2ZM8A 2PU4A 4DMZA 4KENB 4KQDA 1H3QA 4PMAA 2OAQ1 5G4ZA 1SKOB 1MPLA 1L2SA 2L4RA 1ZG6A 4JLFA 4L9EA 3GV9A 3T4TA 3UE0A 2Y79A 3JVVA 4JGPA 4KQQA 3VP4A 4GOGA 1Z6FA 2Q9NA 5CHJA 3IH9A 2H28A 1IKIA 2WKEA 5E2HA 4DKIA 2W0NA 2M1CA 3HUOA 1FCNA 1ESIA 2XFSA 1FR6A 2Y2GA 3HLGA 4X1MA 2VA0A 3LR4A 1IOUA 3RTYA 1S67L 4H6JB 4DXCA 3F1NA 5HD5A 2JE5A 1H0MA 1VEUB 2O0YA 4EQ1A 1K55C 5F5YA 4UAAA 1NYYA 3GVBA 3IWOA 5FL3A 1L0FA 1KGGA 1OTBA 1TF1A 3RH8B 2ZLYA 3KYZA 5F82A 1ERQA 2V9AA 4CJNA 4GNUA 3CPTA 4D60A 3A0SA 2Q0OA 3DBAA 2K31A 3FPWA 3BEBA 2J8YA 4RA7A 3P7NA 4JKTA 5FA7A 3LY3A 5CX7A 1ODVA 2Y91A 3CWFA 4GKUA 2XQZA 5CHMA 5DKLA 3WRZA 4LV2A 5EV0A 2R78A 4S2PA 3UB7A 4NXBA 4P6ZM 1K57A 4OVDA 1PW1A 4FD8A 4JF4A 2JBFA 1DY6A 2C6WB 3T1SA 2Y2PA 3PHYA 3GMWA 3O88A 3R4KA 1DRMA 3N8RA 4OOYA 3F1OB 5KSCA 3CPTB 2Y8HA 3LIFA 2X71A 2V1BA 3ITAA 2QMIA 3T4SA 1K38A
chains in the Genus database with same CATH topology
1O7EA 1Q2QA 3CJMA 5HFOA 3WWXA 3ZGAB 4Y0OA 3GSGA 3QNCA 2R9XA 2ZM0A 1GA0A 3GTCA 1ESUA 4DDYA 3P98A 2H10A 4BQMA 3VP2A 4X68A 3WRTA 4GN2A 1FR1A 1TDLA 3O3VA 3HBRA 3VOYA 3O87A 5AQAA 4E3JA 4RYEA 5CEDA 3BFGA 1BLHA 3V3SA 4ID4A 1JVJA 1CI8A 3E2LA 4KG6A 1YT4A 3RXXA 2WUQA 5EPHA 5BOHA 1YLPA 2H0TA 4FH2A 1FQGA 4N9LA 2HDSA 1NRFA 2EXAA 3WS1A 5A92A 1SKFA 1QMEA 5EOEA 1PWGA 1S0WA 1K54A 2Y59A 3G32A 5FQQA 1NYMA 3LO7A 5AQ9A 2H0YA 2WADA 2EX9A 4KZ5A 5HAIA 1MXOA 4WMCA 4XUZA 4EUZA 2WGWA 1LI9A 2WYXA 3ZG5A 1NY0A 3SOIA 1ZKJA 3NCKA 4YINA 1FCMA 4QB8A 1GA9A 1I2SA 3M2KA 4DF6A 4OONA 4C75A 4EBPA 4UA6A 2HP9A 4OOLA 4KZ7A 2Z2MB 4ZBEA 1H8YA 3A3EA 4OLDA 1FOFA 3VOZA 4KZAA 3SS4A 4HBTA 2X01A 1YMSA 2EX2A 3UO9A 2J7VA 1ERMA 1ES2A 4OQIA 4F94A 3FWLA 5A93A 5CTMA 1CI9A 3IF5A 3BRMA 1WYBA 1K4EA 2EX8A 3NDEA 1ALQA 4JXSA 3HLWA 3V39A 1ES5A 1N4OA 4OLGA 1K57C 2Z2LB 3VSLA 3S1YA 1BLSA 3UNWA 5F1FA 4FCFA 4QD4A 1H5XA 1EI5A 5KZHA 3IF6C 4E3KA 4FSFA 1GCEA 1XA7A 2JCHA 3DWZA 3PBQA 1XGIA 2Y2OA 3VSKA 4E3NA 1K55A 2HP5A 4ZJ2A 4DXBA 1M40A 1GHIA 4PPRA 1NZOA 4IBRA 3VFHA 2HDQA 3BFEA 2C5WB 1G68A 1W8QA 2WAEA 1MY8A 3CZDA 3G34A 3PTEA 5GHYA 2J9OA 4S2IA 2XK1A 1RGZA 3FKWA 4HBUA 4U0XA 3I7JA 4QHCA 4CPKA 3OPPA 3G4PA 5FI2A 1MWUA 3C4PA 2VGJA 3HLEA 5CGWA 5E2GA 3Q7VB 3UE3A 4BD1A 1K54C 4FH4A 1JWZA 5TFQA 2Y2LA 3NDGA 4R0QA 4QJGA 1PI5A 5F1GA 3G2ZA 4WMCD 3SS3A 2HDUA 1W79A 4QY5A 5M19A 1JWPA 3JYIA 4JXGA 1KE0A 1EWZA 3IH8A 4R3BA 5GLCA 5FAPA 5GLDA 3A3FA 2ZM2A 2CC1A 1W8YA 3EQVA 4QY6A 4JXWA 3DW0A 3BFCA 1TDGA 4MLLA 4P6BA 3N4IA 4A5RA 1Y54A 2ZQCA 3SH9A 4HESA 3WS4A 3PAGA 5G18A 3IWIA 3CMZA 4GD6A 1L0GA 2Y2NA 4K0WA 2ZC3B 5FQKA 3AGEA 1HTZA 5FSRA 5TR7A 2EFXA 5FQJA 2P74A 4E3IA 1JTGA 2XR0A 1LI0A 2R9WA 4IVIA 1YLWA 4OP5A 3MXRA 1QMFA 5FASA 5E2FA 4NETA 5FI6A 3W4QA 4OH0A 3IHAA 4OPZA 1NZUA 1K4FA 1KGEA 3N8LA 3VMAA 4S2NC 1L0EA 3QNBA 5DF9A 3W8KA 5HAQA 3IHBA 2XGNA 3MZFA 4KG2A 3BECA 4D2OA 1E3UA 3N7WA 1WE4A 3HLBA 2V2FF 2V1ZA 4NK3A 1PIOA 2E8IA 2X02A 3NIAA 5M1AA 1XPBA 5DTSA 3B3XA 3BLSA 3IWQA 3UDFA 3IXBA 4P85A 3ZG0A 4RVAA 2FFYA 2ZC7A 2ZJ9A 1MWRA 5D3OA 4R1GA 3V50A 2HP6A 2WZXA 4X55A 5EE8A 4PM9A 5EECA 3ITBA 1S6RA 3LCEA 5CTNA 5FDHA 2ZMAA 2V20A 3V5MA 5GLBA 2G2UA 1TVFA 1W5DA 2RL3A 4X6TA 3SS5A 4YFMA 3ZNTA 3UDIA 5I94A 1YQSA 5KSHA 4M3KA 3EQUA 4E6XA 2ZC4B 3VP0A 4Y0UA 1IYSA 3RXWA 4KQRA 4KZ9A 1CEGA 1VM1A 4BL3A 2ZC6B 5JYOA 4WBGA 2QPNA 3DWKA 1W7FA 1GHPA 3FZCA 3O86A 3ZHHA 3NY4A 1IELA 4IBXA 5CRFA 3V3RA 1BLPA 5DTTA 2Y2QA 4OKPA 4OOMA 4WZ5C 4KZ4A 4WZ4A 1K6RA 1BLCA 1RCJA 1SCWA 1YLTA 2XEPA 4PM7A 1MBLA 1XXMA 3TSGA 3GRJA 3HL9A 3FV7A 1HZOA 2GDNA 3OZHA 3PBSA 4GD8A 2Y2JA 5KMWA 4BD0A 4E3OA 2HPBA 1J9MA 1LL9A 3ZFZA 1JTDA 2I72A 3MKEA 4LV1A 1MKIA 4PM5A 1KDSA 5AQ7A 2XFTA 5CHUA 5FATA 4DE2A 1BT5A 5JYPA 1YLYA 3RJUA 4OPRA 5DF7A 2BG1A 4KG5A 2WGIA 3MXSA 5E2EA 4EV4A 4DE3A 4MBHA 2Y2MA 3IQAA 1BULA 3PAEA 3UY6A 2PBYA 4U0TA 3DTMA 1DJBA 1KGFA 3MBZA 1KE4A 1XP4A 3Q1FA 2ZQAA 3PBRA 5CEBA 4KZ6A 4C6YA 1E25A 4WM9A 4WYYA 3ZG8B 1C3BA 3IT9A 4MBFA 3IXHA 3W4OA 1SDEA 2XF3A 3NC8A 4N92A 3C7UA 3BYDA 5A90A 4GZBA 1XX2A 3FKVA 4JBFA 1E4DA 3VFFA 4JPMA 1KVMA 2WKHA 1SHVA 4BENA 3G31A 4X53A 3MFDA 3Q7ZA 1WYCA 4P0MA 1PWDA 3HVFA 3HLCA 3TOIA 1ONGA 2ZQ9A 4QU3A 5EUAA 1BZAA 2Y55A 3WS2A 2ZQ7A 3WS0A 3ZVTA 5DF8A 4B4XA 1YMXA 4WEKA 5CGSA 3OCLA 1DJCA 1ONHA 2EXBA 4ZJ3A 1BSGA 4N9KA 3HREA 2P9VA 4Q8IA 1NXYA 3Q82A 1K56D 3ZG7B 3D4FA 3N8SA 3UPNA 3ZDJA 3G2YA 4LV3A 3GR2A 4JXVA 1CK3A 1IYOA 2J9PA 3BM6A 1Q2PA 3QHYA 2IWBA 1KE3A 5GL9A 1SDNA 3ZVWA 1I5QA 4Y7PA 4EQIA 4ZAMA 4R4SA 3OCNA 4WEJA 4R3JA 2QZ6A 2XLNA 4C3QA 1YLJA 5HARA 4WELA 4IEDA 3M6HA 4MNRA 4S2MA 4KZ8A 3A3JA 4S2KA 4PM6A 4R4RA 4LCLA 3C4OA 2OLUA 4KZBA 1RGYA 5EOOA 1IKGA 4JF6A 5EVID 5F83A 4EWFA 5GLAA 3C5AA 4DE0A 1PI4A 3G30A 3HUNA 4L0LA 1GHMA 3PBOA 2ZC5B 5FQ9A 5HX9A 4LV0A 4E6WA 4BLMA 4BL2A 2PU2A 2WGWB 3IF6A 2XD5A 3BFFA 4GB7A 2ZM8A 5EVIA 4N1HA 3ZCZA 4DRTA 2PU4A 4KENB 4PMAA 2EX6A 1XA1A 1KVLA 3OPHA 1MPLA 4H8RA 4R23A 3AGDA 4Y0TA 1VQQA 3Q07A 5CGXA 1L2SA 1NJ4A 1ZG6A 4JLFA 3GV9A 4IVKA 1LL5A 3HLFA 3UE0A 5EVLA 1K25A 3P09A 4O7DA 4Z9QA 1OMEA 3UPOA 5EVIC 1PWCA 4UA9A 1RP5A 3UPPA 4KQQA 2WAFA 3VP4A 3VP3A 1M6KA 3E2KA 5EVIB 4GOGA 2WZZA 1BUEA 1Z6FA 2Q9NA 3VP1A 2G2WA 4S2JA 3WS5A 5CERA 4OPYA 4E3LA 5A91A 1PYYA 1K56A 1H8ZA 1FSYA 1O07A 2B5RA 4PM8A 3IH9A 5CHJA 3UN7A 5FQIA 1IKIA 2OSUA 1JWVA 2Y2IA 2WKEA 2Q9MA 3ZG9B 3OPLA 5E2HA 4DKIA 1E3UD 4E3MA 4RX3A 4EBLA 3HUOA 1IYQA 3G35A 2WK0A 1FCNA 4P87A 1ESIA 2XFSA 3MKFA 4X69A 3LEZA 1U60A 5DVAA 3A3IA 1FR6A 2Y2GA 3HLGA 4OP8A 5HW3A 3GQZA 4OQHA 4UA7A 4B88A 1FSWA 4DXCA 3A3DA 2VGKA 3HLDA 3BFDA 5FAOA 5IHVA 1G6AA 5U47A 4ZTKA 3UDXA 2DCFA 2JE5A 2ZD8A 3HUMA 3OPRA 4KZ3A 2WGVA 4S2LA 1K55C 2P9VB 3IF6B 4B4ZA 3W4PA 4U3TA 2A3UA 3ISGA 4UAAA 4GDBA 1AXBA 4UHUA 1NYYA 3GVBA 3IWOA 4DDSA 4BJPA 1L0FA 5GHZA 1ZC2A 1KGGA 5E43A 3BLMA 4WZ5A 2ZLYA 5F82A 1YLZA 1ERQA 4HEFA 1HD8A 1LLBA 4K0XA 5HAPA 1PW8A 4CJNA 2DRWA 4X56A 4GNUA 4MBKA 1XKZA 2DNSA 1HVBA 1ZG4A 1IYPA 3AGFA 3S22A 4N1XA 5DTKA 2Y4AA 1PZOA 3PBTA 3Q7VA 4K91A 3M2JA 3BEBA 1IEMA 3FYZA 3SH7A 3TG9A 2J8YA 3M6BA 4RA7A 2XH9A 2BLSA 3NI9A 3MZDA 2H5SA 4MEZA 4LCMA 4JKTA 5FA7A 1ES3A 5HL1A 4EBNA 3LY3A 1KDWA 2Y91A 1TEMA 5FAQA 1FCOA 5CHMA 4GKUA 2XQZA 3WRZA 4LV2A 1N9BA 5L2FA 4GDNA 4OQGA 4LENA 2XDMA 2JC7A 2RCXA 2UWXA 4S2PA 4OQ0A 2WKIA 3Q81A 1K57A 3C7VA 1MWSA 3ZNYA 4OVDA 4DE1A 1MWTA 3MZEA 1YM1A 4XUXA 2FFFB 2ZQDA 1PW1A 1EROA 2OLVA 4FD8A 4JF4A 4OPQA 3NBLA 2JBFA 1PZPA 2XD1A 5AQBA 3UE1A 4ZDXA 3LY4A 5FQMA 2EFUA 1DY6A 5FI7A 3N6IA 2C6WB 3IXDA 1L0DA 2IWCA 4RX2A 3OC2A 5CXWA 2Y2PA 5GHXA 1XGJA 4ZJ1A 1DJAA 4S2NA 3SH8A 3S4XA 4XXRA 3GMWA 5CECA 3O88A 2IWDA 2A49A 4S2OA 5TGFA 5J8XA 2Y2HA 1CEFA 3N8RA 2ZQ8A 1I2WA 4OOYA 2Y2KA 2OV5A 4JF5A 5KSCA 2X71A 1ES4A 3ITAA 1K6SA 4KQOA 3PBNA 2HDRA 1BTLA 2QMIA 5M18A 1K38A 1LHYA 3CG5A 3IXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7E A;  1Q2Q A;  3CJM A;  5HFO A;  3WWX A;  3ZGA B;  4Y0O A;  3GSG A;  3QNC A;  2R9X A;  2ZM0 A;  1GA0 A;  3GTC A;  1ESU A;  4DDY A;  3P98 A;  2H10 A;  4BQM A;  3VP2 A;  4X68 A;  3WRT A;  4GN2 A;  1FR1 A;  1TDL A;  3O3V A;  3HBR A;  3VOY A;  3O87 A;  5AQA A;  4E3J A;  4RYE A;  5CED A;  3BFG A;  1BLH A;  3V3S A;  4ID4 A;  1JVJ A;  1CI8 A;  3E2L A;  4KG6 A;  1YT4 A;  3RXX A;  2WUQ A;  5EPH A;  5BOH A;  1YLP A;  2H0T A;  4FH2 A;  1FQG A;  4N9L A;  2HDS A;  1NRF A;  2EXA A;  3WS1 A;  5A92 A;  1SKF A;  1QME A;  5EOE A;  1PWG A;  1S0W A;  1K54 A;  2Y59 A;  3G32 A;  5FQQ A;  1NYM A;  3LO7 A;  5AQ9 A;  2H0Y A;  2WAD A;  2EX9 A;  4KZ5 A;  5HAI A;  1MXO A;  4WMC A;  4XUZ A;  4EUZ A;  2WGW A;  1LI9 A;  2WYX A;  3ZG5 A;  1NY0 A;  3SOI A;  1ZKJ A;  3NCK A;  4YIN A;  1FCM A;  4QB8 A;  1GA9 A;  1I2S A;  3M2K A;  4DF6 A;  4OON A;  4C75 A;  4EBP A;  4UA6 A;  2HP9 A;  4OOL A;  4KZ7 A;  2Z2M B;  4ZBE A;  1H8Y A;  3A3E A;  4OLD A;  1FOF A;  3VOZ A;  4KZA A;  3SS4 A;  4HBT A;  2X01 A;  1YMS A;  2EX2 A;  3UO9 A;  2J7V A;  1ERM A;  1ES2 A;  4OQI A;  4F94 A;  3FWL A;  5A93 A;  5CTM A;  1CI9 A;  3IF5 A;  3BRM A;  1WYB A;  1K4E A;  2EX8 A;  3NDE A;  1ALQ A;  4JXS A;  3HLW A;  3V39 A;  1ES5 A;  1N4O A;  4OLG A;  1K57 C;  2Z2L B;  3VSL A;  3S1Y A;  1BLS A;  3UNW A;  5F1F A;  4FCF A;  4QD4 A;  1H5X A;  1EI5 A;  5KZH A;  3IF6 C;  4E3K A;  4FSF A;  1GCE A;  1XA7 A;  2JCH A;  3DWZ A;  3PBQ A;  1XGI A;  2Y2O A;  3VSK A;  4E3N A;  1K55 A;  2HP5 A;  4ZJ2 A;  4DXB A;  1M40 A;  1GHI A;  4PPR A;  1NZO A;  4IBR A;  3VFH A;  2HDQ A;  3BFE A;  2C5W B;  1G68 A;  1W8Q A;  2WAE A;  1MY8 A;  3CZD A;  3G34 A;  3PTE A;  5GHY A;  2J9O A;  4S2I A;  2XK1 A;  1RGZ A;  3FKW A;  4HBU A;  4U0X A;  3I7J A;  4QHC A;  4CPK A;  3OPP A;  3G4P A;  5FI2 A;  1MWU A;  3C4P A;  2VGJ A;  3HLE A;  5CGW A;  5E2G A;  3Q7V B;  3UE3 A;  4BD1 A;  1K54 C;  4FH4 A;  1JWZ A;  5TFQ A;  2Y2L A;  3NDG A;  4R0Q A;  4QJG A;  1PI5 A;  5F1G A;  3G2Z A;  4WMC D;  3SS3 A;  2HDU A;  1W79 A;  4QY5 A;  5M19 A;  1JWP A;  3JYI A;  4JXG A;  1KE0 A;  1EWZ A;  3IH8 A;  4R3B A;  5GLC A;  5FAP A;  5GLD A;  3A3F A;  2ZM2 A;  2CC1 A;  1W8Y A;  3EQV A;  4QY6 A;  4JXW A;  3DW0 A;  3BFC A;  1TDG A;  4MLL A;  4P6B A;  3N4I A;  4A5R A;  1Y54 A;  2ZQC A;  3SH9 A;  4HES A;  3WS4 A;  3PAG A;  5G18 A;  3IWI A;  3CMZ A;  4GD6 A;  1L0G A;  2Y2N A;  4K0W A;  2ZC3 B;  5FQK A;  3AGE A;  1HTZ A;  5FSR A;  5TR7 A;  2EFX A;  5FQJ A;  2P74 A;  4E3I A;  1JTG A;  2XR0 A;  1LI0 A;  2R9W A;  4IVI A;  1YLW A;  4OP5 A;  3MXR A;  1QMF A;  5FAS A;  5E2F A;  4NET A;  5FI6 A;  3W4Q A;  4OH0 A;  3IHA A;  4OPZ A;  1NZU A;  1K4F A;  1KGE A;  3N8L A;  3VMA A;  4S2N C;  1L0E A;  3QNB A;  5DF9 A;  3W8K A;  5HAQ A;  3IHB A;  2XGN A;  3MZF A;  4KG2 A;  3BEC A;  4D2O A;  1E3U A;  3N7W A;  1WE4 A;  3HLB A;  2V2F F;  2V1Z A;  4NK3 A;  1PIO A;  2E8I A;  2X02 A;  3NIA A;  5M1A A;  1XPB A;  5DTS A;  3B3X A;  3BLS A;  3IWQ A;  3UDF A;  3IXB A;  4P85 A;  3ZG0 A;  4RVA A;  2FFY A;  2ZC7 A;  2ZJ9 A;  1MWR A;  5D3O A;  4R1G A;  3V50 A;  2HP6 A;  2WZX A;  4X55 A;  5EE8 A;  4PM9 A;  5EEC A;  3ITB A;  1S6R A;  3LCE A;  5CTN A;  5FDH A;  2ZMA A;  2V20 A;  3V5M A;  5GLB A;  2G2U A;  1TVF A;  1W5D A;  2RL3 A;  4X6T A;  3SS5 A;  4YFM A;  3ZNT A;  3UDI A;  5I94 A;  1YQS A;  5KSH A;  4M3K A;  3EQU A;  4E6X A;  2ZC4 B;  3VP0 A;  4Y0U A;  1IYS A;  3RXW A;  4KQR A;  4KZ9 A;  1CEG A;  1VM1 A;  4BL3 A;  2ZC6 B;  5JYO A;  4WBG A;  2QPN A;  3DWK A;  1W7F A;  1GHP A;  3FZC A;  3O86 A;  3ZHH A;  3NY4 A;  1IEL A;  4IBX A;  5CRF A;  3V3R A;  1BLP A;  5DTT A;  2Y2Q A;  4OKP A;  4OOM A;  4WZ5 C;  4KZ4 A;  4WZ4 A;  1K6R A;  1BLC A;  1RCJ A;  1SCW A;  1YLT A;  2XEP A;  4PM7 A;  1MBL A;  1XXM A;  3TSG A;  3GRJ A;  3HL9 A;  3FV7 A;  1HZO A;  2GDN A;  3OZH A;  3PBS A;  4GD8 A;  2Y2J A;  5KMW A;  4BD0 A;  4E3O A;  2HPB A;  1J9M A;  1LL9 A;  3ZFZ A;  1JTD A;  2I72 A;  3MKE A;  4LV1 A;  1MKI A;  4PM5 A;  1KDS A;  5AQ7 A;  2XFT A;  5CHU A;  5FAT A;  4DE2 A;  1BT5 A;  5JYP A;  1YLY A;  3RJU A;  4OPR A;  5DF7 A;  2BG1 A;  4KG5 A;  2WGI A;  3MXS A;  5E2E A;  4EV4 A;  4DE3 A;  4MBH A;  2Y2M A;  3IQA A;  1BUL A;  3PAE A;  3UY6 A;  2PBY A;  4U0T A;  3DTM A;  1DJB A;  1KGF A;  3MBZ A;  1KE4 A;  1XP4 A;  3Q1F A;  2ZQA A;  3PBR A;  5CEB A;  4KZ6 A;  4C6Y A;  1E25 A;  4WM9 A;  4WYY A;  3ZG8 B;  1C3B A;  3IT9 A;  4MBF A;  3IXH A;  3W4O A;  1SDE A;  2XF3 A;  3NC8 A;  4N92 A;  3C7U A;  3BYD A;  5A90 A;  4GZB A;  1XX2 A;  3FKV A;  4JBF A;  1E4D A;  3VFF A;  4JPM A;  1KVM A;  2WKH A;  1SHV A;  4BEN A;  3G31 A;  4X53 A;  3MFD A;  3Q7Z A;  1WYC A;  4P0M A;  1PWD A;  3HVF A;  3HLC A;  3TOI A;  1ONG A;  2ZQ9 A;  4QU3 A;  5EUA A;  1BZA A;  2Y55 A;  3WS2 A;  2ZQ7 A;  3WS0 A;  3ZVT A;  5DF8 A;  4B4X A;  1YMX A;  4WEK A;  5CGS A;  3OCL A;  1DJC A;  1ONH A;  2EXB A;  4ZJ3 A;  1BSG A;  4N9K A;  3HRE A;  2P9V A;  4Q8I A;  1NXY A;  3Q82 A;  1K56 D;  3ZG7 B;  3D4F A;  3N8S A;  3UPN A;  3ZDJ A;  3G2Y A;  4LV3 A;  3GR2 A;  4JXV A;  1CK3 A;  1IYO A;  2J9P A;  3BM6 A;  1Q2P A;  3QHY A;  2IWB A;  1KE3 A;  5GL9 A;  1SDN A;  3ZVW A;  1I5Q A;  4Y7P A;  4EQI A;  4ZAM A;  4R4S A;  3OCN A;  4WEJ A;  4R3J A;  2QZ6 A;  2XLN A;  4C3Q A;  1YLJ A;  5HAR A;  4WEL A;  4IED A;  3M6H A;  4MNR A;  4S2M A;  4KZ8 A;  3A3J A;  4S2K A;  4PM6 A;  4R4R A;  4LCL A;  3C4O A;  2OLU A;  4KZB A;  1RGY A;  5EOO A;  1IKG A;  4JF6 A;  5EVI D;  5F83 A;  4EWF A;  5GLA A;  3C5A A;  4DE0 A;  1PI4 A;  3G30 A;  3HUN A;  4L0L A;  1GHM A;  3PBO A;  2ZC5 B;  5FQ9 A;  5HX9 A;  4LV0 A;  4E6W A;  4BLM A;  4BL2 A;  2PU2 A;  2WGW B;  3IF6 A;  2XD5 A;  3BFF A;  4GB7 A;  2ZM8 A;  5EVI A;  4N1H A;  3ZCZ A;  4DRT A;  2PU4 A;  4KEN B;  4PMA A;  2EX6 A;  1XA1 A;  1KVL A;  3OPH A;  1MPL A;  4H8R A;  4R23 A;  3AGD A;  4Y0T A;  1VQQ A;  3Q07 A;  5CGX A;  1L2S A;  1NJ4 A;  1ZG6 A;  4JLF A;  3GV9 A;  4IVK A;  1LL5 A;  3HLF A;  3UE0 A;  5EVL A;  1K25 A;  3P09 A;  4O7D A;  4Z9Q A;  1OME A;  3UPO A;  5EVI C;  1PWC A;  4UA9 A;  1RP5 A;  3UPP A;  4KQQ A;  2WAF A;  3VP4 A;  3VP3 A;  1M6K A;  3E2K A;  5EVI B;  4GOG A;  2WZZ A;  1BUE A;  1Z6F A;  2Q9N A;  3VP1 A;  2G2W A;  4S2J A;  3WS5 A;  5CER A;  4OPY A;  4E3L A;  5A91 A;  1PYY A;  1K56 A;  1H8Z A;  1FSY A;  1O07 A;  2B5R A;  4PM8 A;  3IH9 A;  5CHJ A;  3UN7 A;  5FQI A;  1IKI A;  2OSU A;  1JWV A;  2Y2I A;  2WKE A;  2Q9M A;  3ZG9 B;  3OPL A;  5E2H A;  4DKI A;  1E3U D;  4E3M A;  4RX3 A;  4EBL A;  3HUO A;  1IYQ A;  3G35 A;  2WK0 A;  1FCN A;  4P87 A;  1ESI A;  2XFS A;  3MKF A;  4X69 A;  3LEZ A;  1U60 A;  5DVA A;  3A3I A;  1FR6 A;  2Y2G A;  3HLG A;  4OP8 A;  5HW3 A;  3GQZ A;  4OQH A;  4UA7 A;  4B88 A;  1FSW A;  4DXC A;  3A3D A;  2VGK A;  3HLD A;  3BFD A;  5FAO A;  5IHV A;  1G6A A;  5U47 A;  4ZTK A;  3UDX A;  2DCF A;  2JE5 A;  2ZD8 A;  3HUM A;  3OPR A;  4KZ3 A;  2WGV A;  4S2L A;  1K55 C;  2P9V B;  3IF6 B;  4B4Z A;  3W4P A;  4U3T A;  2A3U A;  3ISG A;  4UAA A;  4GDB A;  1AXB A;  4UHU A;  1NYY A;  3GVB A;  3IWO A;  4DDS A;  4BJP A;  1L0F A;  5GHZ A;  1ZC2 A;  1KGG A;  5E43 A;  3BLM A;  4WZ5 A;  2ZLY A;  5F82 A;  1YLZ A;  1ERQ A;  4HEF A;  1HD8 A;  1LLB A;  4K0X A;  5HAP A;  1PW8 A;  4CJN A;  2DRW A;  4X56 A;  4GNU A;  4MBK A;  1XKZ A;  2DNS A;  1HVB A;  1ZG4 A;  1IYP A;  3AGF A;  3S22 A;  4N1X A;  5DTK A;  2Y4A A;  1PZO A;  3PBT A;  3Q7V A;  4K91 A;  3M2J A;  3BEB A;  1IEM A;  3FYZ A;  3SH7 A;  3TG9 A;  2J8Y A;  3M6B A;  4RA7 A;  2XH9 A;  2BLS A;  3NI9 A;  3MZD A;  2H5S A;  4MEZ A;  4LCM A;  4JKT A;  5FA7 A;  1ES3 A;  5HL1 A;  4EBN A;  3LY3 A;  1KDW A;  2Y91 A;  1TEM A;  5FAQ A;  1FCO A;  5CHM A;  4GKU A;  2XQZ A;  3WRZ A;  4LV2 A;  1N9B A;  5L2F A;  4GDN A;  4OQG A;  4LEN A;  2XDM A;  2JC7 A;  2RCX A;  2UWX A;  4S2P A;  4OQ0 A;  2WKI A;  3Q81 A;  1K57 A;  3C7V A;  1MWS A;  3ZNY A;  4OVD A;  4DE1 A;  1MWT A;  3MZE A;  1YM1 A;  4XUX A;  2FFF B;  2ZQD A;  1PW1 A;  1ERO A;  2OLV A;  4FD8 A;  4JF4 A;  4OPQ A;  3NBL A;  2JBF A;  1PZP A;  2XD1 A;  5AQB A;  3UE1 A;  4ZDX A;  3LY4 A;  5FQM A;  2EFU A;  1DY6 A;  5FI7 A;  3N6I A;  2C6W B;  3IXD A;  1L0D A;  2IWC A;  4RX2 A;  3OC2 A;  5CXW A;  2Y2P A;  5GHX A;  1XGJ A;  4ZJ1 A;  1DJA A;  4S2N A;  3SH8 A;  3S4X A;  4XXR A;  3GMW A;  5CEC A;  3O88 A;  2IWD A;  2A49 A;  4S2O A;  5TGF A;  5J8X A;  2Y2H A;  1CEF A;  3N8R A;  2ZQ8 A;  1I2W A;  4OOY A;  2Y2K A;  2OV5 A;  4JF5 A;  5KSC A;  2X71 A;  1ES4 A;  3ITA A;  1K6S A;  4KQO A;  3PBN A;  2HDR A;  1BTL A;  2QMI A;  5M18 A;  1K38 A;  1LHY A;  3CG5 A;  3IXG A; 
#chains in the Genus database with same CATH topology
 2KOI A;  2ZM0 A;  1GA0 A;  4DDY A;  4X68 A;  4ZRR A;  4E3J A;  5CED A;  3BFG A;  3F1P A;  1CI8 A;  1YT4 A;  2WUQ A;  1YLP A;  4PAU A;  1NRF A;  2EXA A;  3WS1 A;  5A92 A;  2I9V A;  1PWG A;  1S0W A;  2Y59 A;  1NYM A;  1LI9 A;  4MN5 A;  4R38 A;  1NY0 A;  3IX3 A;  2O9A A;  2QWS A;  3M2K A;  4KZ7 A;  4DN0 A;  1CF0 A;  3G6O A;  3SS4 A;  4P6Z S;  4I3A A;  3UO9 A;  1OTI A;  4HH3 A;  5A93 A;  5CTM A;  3KSH A;  3IF5 A;  2EX8 A;  1K4E A;  1ALQ A;  4OLG A;  1K57 C;  2Z2L B;  4FCF A;  4QD4 A;  1H5X A;  3IF6 C;  2PDR A;  2JKT M;  3PBQ A;  3VSK A;  1K55 A;  4DXB A;  4O0P A;  3S7O A;  5AJG A;  3VFH A;  3NOU C;  5EFW A;  3G34 A;  4R70 A;  3I7J A;  3G4P A;  3BQ8 A;  2VGJ A;  3HLE A;  5E2G A;  3W2Z A;  1J3W A;  1VB6 A;  3LID A;  3G2Z A;  3SS3 A;  2HDU A;  1CJF A;  1EWZ A;  2W1T B;  4R3B A;  5GLC A;  3A3F A;  1GSV A;  4QY6 A;  1F2K A;  2CMN A;  3DW0 A;  4K08 A;  4HI4 A;  2PR5 A;  3SH9 A;  4HES A;  3LGO A;  3PAG A;  3IWI A;  1HTZ A;  2VGL S;  2EFX A;  1LI0 A;  2R9W A;  1YPR A;  5AVF A;  5E2F A;  2J3W A;  3EGX C;  3IHA A;  3ULF A;  2PAV P;  3IHB A;  3MZF A;  5I5L A;  1E3U A;  2GJ3 A;  1WE4 A;  4CLC B;  5EM1 A;  3MMH A;  3DTK A;  5K5B A;  3B3X A;  3BQA A;  4UQI S;  4RVA A;  2K7S A;  3NOT C;  2HP6 A;  2WZX A;  1Y28 A;  1NLY A;  3ITB A;  3LCE A;  5FDH A;  2ZMA A;  2V20 A;  3IS2 B;  4LLO B;  3IX8 A;  3D3O A;  1W5D A;  4X6T A;  4GHI A;  3UDI A;  1H8M A;  5F69 A;  2P7J A;  4KZ9 A;  4BL3 A;  3KSF A;  3QP8 A;  1GHP A;  5F68 A;  5CRF A;  3V3R A;  1BLP A;  5DTT A;  3NEC A;  4OOM A;  4WZ4 A;  1K6R A;  1BLC A;  1YLT A;  1MBL A;  3PBS A;  3VE3 A;  3ZFZ A;  1GSW A;  1JTD A;  1DP6 A;  2I72 A;  3MKE A;  4HJ6 A;  5HL6 A;  3S7P A;  1FIK A;  2PT7 A;  2XFT A;  3K2N A;  1OPX A;  1V9Y A;  3T4O A;  5HZH A;  2W3H A;  2WGI A;  2BAS A;  4MBH A;  2QKP A;  4U0T A;  3EEA A;  3MBZ A;  1XP4 A;  1W63 Q;  2ZQA A;  4CLC D;  3VOL A;  4KZ6 A;  3KYQ A;  2G7U A;  1Z09 A;  4Y3I A;  4EUV A;  3NC8 A;  3BYD A;  4GZB A;  3IBR A;  4JBF A;  1Y4O A;  1E4D A;  3B33 A;  5IS1 A;  3G31 A;  3Q7Z A;  4EW7 A;  3HVF A;  3HLC A;  3TOI A;  1YMX A;  4NXF A;  3MSH A;  3NHQ A;  4ZJ3 A;  1DP8 A;  2OOL A;  2EA9 A;  3HRE A;  3PYP A;  4UQI M;  4Q8I A;  3KSG A;  1K56 D;  3T12 B;  3N8S A;  2L0W A;  2B18 A;  1CK3 A;  3D72 A;  1K0K A;  2J9P A;  2LB5 A;  3VV4 A;  5GL9 A;  4BBV A;  2XLN A;  4C3Q A;  1VET B;  4JGQ A;  1S1Y A;  1T18 A;  4KZ8 A;  4S2K A;  2OLU A;  4KZB A;  4XT2 B;  4DE0 A;  2ZC5 B;  1F5M A;  4LV0 A;  2JN7 A;  2XSS A;  2PU2 A;  3T50 A;  4GB7 A;  5EVI A;  3LIE A;  4HY8 A;  4NG2 A;  4R23 A;  5MC7 A;  5CGX A;  4I5S A;  3HLF A;  1N9O A;  1ZTU A;  5EVL A;  4O8G A;  1XJ2 A;  4O7D A;  4Z9Q A;  1NRJ A;  1OME A;  3UPO A;  3UPP A;  2WKR A;  1M6K A;  5HD3 A;  1BUE A;  4GS9 A;  2G2W A;  4S2J A;  3LR5 A;  4OPY A;  3UN7 A;  1O07 A;  1FSY A;  2LB9 A;  1OJG A;  2PHY A;  1JWV A;  4B93 A;  3F1N B;  2Q9M A;  3FG8 A;  1MZU A;  4E3M A;  4RX3 A;  2Z6D A;  4P87 A;  4X69 A;  3LEZ A;  5DVA A;  2VLG A;  4XT2 A;  4UA7 A;  4B88 A;  5IHV A;  4MCW A;  5U47 A;  3UDX A;  3HUM A;  4HJ3 A;  2WGV A;  4S2L A;  2P9V B;  5L07 A;  1UWN X;  4U3T A;  3ISG A;  4GDB A;  1AXB A;  5J4E A;  4BJP A;  2V1A A;  4ETX A;  1ZC2 A;  2OWJ A;  4WZ5 A;  1VEU A;  3UB8 A;  4HEF A;  4BBU A;  1LLB A;  4K0X A;  4AFI A;  5HAP A;  1PW8 A;  3AGF A;  1HVB A;  1ZG4 A;  3UB5 P;  2V8F A;  3PBT A;  2V0U A;  4K91 A;  5FEG A;  3SH7 A;  1IEM A;  1XJ6 A;  2VEA A;  3MQO A;  2XH9 A;  3MZD A;  4MEZ A;  3U2A A;  3A0R A;  1OTE A;  4EER A;  1KDW A;  1N9B A;  3VE4 A;  1LSX A;  2HF6 A;  2RCX A;  3C7V A;  5HWW A;  2FFF B;  2Z6C A;  2ZQD A;  1PZP A;  2XD1 A;  5FI7 A;  2PD7 A;  4RX2 A;  3OC2 A;  5CXW A;  4Z1W A;  4FUW A;  3S4X A;  5CEC A;  2A49 A;  5TGF A;  2E8J A;  5J8X A;  3IX4 A;  5A8B A;  3MQQ A;  1S4R A;  3T4L A;  3DAV A;  3EGD C;  2HDR A;  3RXW A;  3GEC A;  3K3C A;  4Y0O A;  2J80 A;  3QNC A;  2R9X A;  1S4S A;  3P98 A;  3VP2 A;  1FR1 A;  3VOY A;  4RYE A;  1JVJ A;  3E2L A;  3RXX A;  4FH2 A;  2W3F A;  1TS8 A;  4CLC E;  4KZ5 A;  3KSI A;  5FDS A;  4YIN A;  1FCM A;  1GA9 A;  1I2S A;  4UA6 A;  4ZBE A;  3A3E A;  4OLD A;  3VOZ A;  4KZA A;  2X01 A;  5F6A A;  4F94 A;  3T1X A;  2VV7 A;  1CI9 A;  5DJT A;  3BRM A;  2OWH A;  3HLW A;  1ES5 A;  1LL8 A;  5F1F A;  3KO6 A;  1EI5 A;  4NKP A;  4E3K A;  1GCE A;  1XA7 A;  1SZV A;  2Y2O A;  5LBR A;  1M40 A;  4PPR A;  2HJE A;  2HV1 A;  1G68 A;  2WAE A;  1MY8 A;  5GHY A;  3LIB A;  2J9O A;  1RGZ A;  2PYP A;  2ZOH A;  4HBU A;  4CPK A;  4QHC A;  5FI2 A;  5CGW A;  3UE3 A;  1K54 C;  1JWZ A;  2XA7 M;  3NDG A;  4YOF A;  5M19 A;  4QY5 A;  1MC0 A;  1TS6 A;  1JWP A;  3LEQ A;  2VGL M;  5FAP A;  4EU0 A;  5GLD A;  2CC1 A;  2YKH A;  4MLL A;  2O9B A;  3CHW P;  1Y54 A;  2ZQC A;  2VKS A;  5G18 A;  1NLZ A;  2PD8 A;  4I3I A;  1L0G A;  4HOI A;  3CIT A;  2ZC3 B;  5FSR A;  5FQJ A;  2P74 A;  5DFY A;  4E3I A;  5TJJ A;  1QMF A;  3C2W A;  5FAS A;  4OH0 A;  4OPZ A;  1K4F A;  1KGE A;  3N8L A;  1L0E A;  4D2O A;  2HGV A;  3HJK A;  3JVU A;  3NIA A;  5FEF A;  2A2L A;  5DTS A;  3V67 A;  2FFY A;  2ZC7 A;  1MWR A;  3V50 A;  4R1G A;  2GNX A;  4ARZ B;  3F1P B;  5CTN A;  2G2U A;  4UEY A;  2RL3 A;  3R7W A;  3BY8 A;  3ZNT A;  5HPI A;  1W63 M;  1P9R A;  4M3K A;  4E6X A;  4Y0U A;  3MF0 A;  4KQR A;  4HP4 A;  1VM1 A;  3CUE A;  3UB6 A;  5JYO A;  4WBG A;  2QPN A;  1W7F A;  4PKY A;  3UMD A;  3NY4 A;  1IEL A;  3OOV A;  2Y2Q A;  1XJ4 A;  4WZ5 C;  4KZ4 A;  1RCJ A;  1XXM A;  2MJ6 A;  4GD8 A;  2W3D A;  3OZH A;  3T4Q A;  5KMW A;  2QHK A;  1JNU A;  3EWK A;  1J9M A;  2JKR I;  1F9I A;  4PM5 A;  1KDS A;  4DE2 A;  5FAT A;  3RJU A;  4OPR A;  5DF7 A;  1XFQ A;  4EV4 A;  5E2E A;  1BUL A;  4CQH A;  1DJB A;  2PBD P;  1KE4 A;  3ZG8 B;  3IT9 A;  4HIA A;  3W4O A;  1SDE A;  5A90 A;  4MMN A;  1V9Z A;  4JPM A;  1KVM A;  4BEN A;  3LYX A;  3ZVT A;  4WEK A;  1ONH A;  2EXB A;  1BSG A;  1NXY A;  4Q0J A;  3UE6 A;  3D4F A;  3UPN A;  3P01 A;  4LV3 A;  1IYO A;  3KX0 X;  2VZW A;  2B95 A;  3ZVW A;  1I5Q A;  1XFN A;  2HZ5 A;  2QZ6 A;  4LRY C;  1YLJ A;  4LFU A;  1YSQ A;  4PM6 A;  2KDK A;  2JHE A;  3LI9 A;  3MJQ A;  5EOO A;  5F83 A;  4EWF A;  2V0W A;  4L0L A;  1GHM A;  4MN6 A;  5HX9 A;  4ESP A;  4BLM A;  4BL2 A;  2XD5 A;  5C5K A;  1LT0 A;  3OLO A;  2GX5 A;  3ZCZ A;  4DRT A;  5HDD A;  2ZOI A;  2W27 A;  2EX6 A;  1KVL A;  3OPH A;  4Y0T A;  3Q07 A;  1NJ4 A;  4IVK A;  1LL5 A;  4MN7 A;  3P09 A;  5L10 A;  4CLC C;  1PWC A;  2WAF A;  3VP3 A;  5TBM A;  3WS5 A;  5CER A;  5A91 A;  1K56 A;  2B5R A;  4PM8 A;  4WN5 A;  2OSU A;  4I39 A;  3ZG9 B;  4Y13 A;  3OPL A;  3HCY A;  4LPZ A;  1IYQ A;  3A3I A;  1TS0 A;  5TBM B;  3H82 B;  4OQH A;  1FSW A;  2VGK A;  4NEE D;  3HLD A;  1G6A A;  2PR6 A;  4ZTK A;  2DCF A;  2ZD8 A;  3MFX A;  3OPR A;  3A0V A;  4B4Z A;  5J7E A;  3BY9 A;  2ZMF A;  3C38 A;  3SZT A;  2J3T C;  2DRW A;  4MBK A;  3MS6 A;  4N1X A;  5DTK A;  1PFL A;  3TG9 A;  3LR0 A;  2YKF A;  2BLS A;  3NI9 A;  2H5S A;  4LCM A;  3TJZ C;  1ES3 A;  1TEM A;  2DMW A;  2OAP 1;  5FAQ A;  3BWL A;  4YNR A;  4OQG A;  1LSW A;  2XDM A;  2JC7 A;  2UWX A;  1AWI A;  3Q81 A;  2AVX A;  3H9W A;  3ZNY A;  4DE1 A;  4XUX A;  1CQA A;  1P97 A;  1ERO A;  4Y2F A;  5AQB A;  3UE1 A;  4ZDX A;  4YWZ A;  4G3K A;  5FQM A;  2EFU A;  3IXD A;  4ZJ1 A;  5GHX A;  3SH8 A;  1DJA A;  4XXR A;  2IWD A;  4S2O A;  3KYE A;  1CEF A;  3TRC A;  2ZQ8 A;  4G3V A;  2OV5 A;  4JF5 A;  5DJU A;  3SW1 A;  1K6S A;  1BTL A;  1LHY A;  3CG5 A;  1O7E A;  5HFO A;  3B47 A;  3GSG A;  3GTC A;  1ESU A;  3E4P A;  4BQM A;  4GN2 A;  1TDL A;  3O3V A;  3HBR A;  3O87 A;  1BLH A;  3V3S A;  4ID4 A;  2QYB A;  4KG6 A;  5BOH A;  3GDI A;  2HDS A;  1QME A;  5EOE A;  5FQQ A;  3G32 A;  3LO7 A;  2EX9 A;  2P08 A;  5HAI A;  5L8M A;  4EUZ A;  1FIL A;  2WGW A;  3ZG5 A;  1ZKJ A;  4M4X A;  4QB8 A;  1OT9 A;  3FPV A;  4DF6 A;  4C75 A;  4EBP A;  1A0K A;  2HP9 A;  4OOL A;  2Z2M B;  4ETZ A;  1FOF A;  4HBT A;  1YMS A;  1ZHH B;  2J7V A;  1ES2 A;  4OQI A;  1STZ A;  1WYB A;  4JXS A;  4MDZ A;  4G3W A;  3QP1 A;  3S1Y A;  1BLS A;  2PRF A;  4PHT A;  4GHI B;  4FSF A;  3DWZ A;  1XGI A;  4WUJ A;  2XA7 S;  4ZJ2 A;  1NZO A;  2VX8 A;  4IBR A;  2HDQ A;  3HJI A;  2C5W B;  3CZD A;  2XK1 A;  3OPP A;  3Q7V B;  4BD1 A;  4WF0 A;  4FH4 A;  5TFQ A;  1D06 A;  2Y2L A;  4R0Q A;  4QJG A;  1W79 A;  1OJ5 A;  1G5U A;  3F1O A;  1KE0 A;  2KX6 A;  3IH8 A;  1D1J A;  4DJ3 A;  2ZM2 A;  2KLI A;  3LI8 A;  1W8Y A;  4GS9 B;  3NOP C;  1S66 L;  3BFC A;  2QJ7 A;  2W3G A;  4P6B A;  3N4I A;  4PKY G;  3WS4 A;  2XRN A;  2Y2N A;  1P0Z A;  4K0W A;  5FQK A;  5HWV A;  2VV8 A;  2XR0 A;  1YLW A;  3QP5 A;  3W4Q A;  5HAQ A;  3W8K A;  3BEC A;  4X25 A;  2JKT I;  4HJ4 A;  1XPB A;  2PYR A;  2P04 A;  3UDF A;  3IXB A;  3ZG0 A;  4KUO A;  2ZJ9 A;  4X55 A;  2W3E A;  2JKF A;  3S7Q A;  3ZQ5 A;  1TVF A;  2ACG A;  3SS5 A;  2QJ5 A;  3B42 A;  3PXP A;  4F3L B;  4GLQ A;  2ZC4 B;  2ZC6 B;  3H7W A;  3DWK A;  4OKP A;  1SCW A;  2XEP A;  4EEP A;  5HDS A;  3T4J A;  3TSG A;  3GRJ A;  3HL9 A;  1HZO A;  1T1A A;  2GDN A;  2Y2J A;  2K2N A;  4E3O A;  2HPB A;  1LL9 A;  4LV1 A;  2W1T A;  5CHU A;  1BT5 A;  1PRQ A;  3QP4 A;  5JYP A;  1VET A;  2BG1 A;  3MXS A;  4DE3 A;  5KIZ A;  2Y2M A;  3IQA A;  3UY6 A;  3E4O A;  1KGF A;  3DTE A;  5CEB A;  4WM9 A;  2ZMV A;  1MKM A;  3IXH A;  3LFV A;  3CAX A;  4N92 A;  1XX2 A;  3FKV A;  3VFF A;  4HHD A;  1SHV A;  4X53 A;  1P9W A;  2VV6 A;  1PNE A;  5EUA A;  2ZQ7 A;  1T1B A;  3OCL A;  3S7N A;  2D01 A;  2P9V A;  4CLC A;  4FTX A;  3ZG7 B;  4BBT A;  1L3L A;  3ZDJ A;  3G2Y A;  3GR2 A;  4JXV A;  3FC7 A;  3LIC A;  2O99 A;  1Q2P A;  2IWB A;  4Q0H A;  3NUL A;  4FOF A;  4IED A;  3M6H A;  3A3J A;  3LR3 A;  4R4R A;  4LCL A;  1RGY A;  4JF6 A;  2INW A;  3EOI A;  3C5A A;  4GJ4 A;  4HQA A;  4GCZ A;  4F3L A;  5L09 A;  4E04 A;  4E6W A;  3BFF A;  2UV0 E;  4EET B;  3IBJ A;  4JGO A;  4N1H A;  1T1C A;  5IT5 A;  4I3J A;  1XA1 A;  4H8R A;  3AGD A;  4NXE A;  1VQQ A;  1K25 A;  5EVI C;  4UA9 A;  1RP5 A;  4IUH A;  1X0O A;  3E2K A;  5EVI B;  4HH2 A;  2WZZ A;  3VP1 A;  1SKO A;  4E3L A;  3R7W B;  1PYY A;  1H8Z A;  5FQI A;  2Y2I A;  1E3U D;  4EBL A;  3G35 A;  1TS7 A;  2WK0 A;  1UWP X;  1OT6 A;  3MKF A;  4BWI A;  1U60 A;  4OP8 A;  5HW3 A;  3GQZ A;  4BMW A;  3E98 A;  5G4Y A;  2M7U A;  5DKK A;  4IHQ A;  3A3D A;  3BFD A;  5FAO A;  4KZ3 A;  2FH5 A;  1WA9 A;  3IF6 B;  1OTD A;  3W4P A;  2A3U A;  4RQ9 A;  4UHU A;  4DDS A;  2XRO A;  1G28 A;  2M7V A;  5GHZ A;  5E43 A;  3BLM A;  3ICY A;  1YLZ A;  1HD8 A;  1TD5 A;  4IUK A;  4X56 A;  1GSX A;  1XKZ A;  2DNS A;  1IYP A;  4Y15 A;  3S22 A;  2W1R A;  4WLA A;  2Y4A A;  1PZO A;  3Q7V A;  5HDC A;  3M2J A;  3FYZ A;  3M6B A;  5HL1 A;  4EXO A;  4EBN A;  2VJW A;  4LRX C;  1FCO A;  5AVE A;  5L2F A;  4GDN A;  4L9F A;  1HLU P;  4LEN A;  4LGW A;  4OQ0 A;  2WKI A;  2ZL1 A;  3H82 A;  1MWS A;  3L7H A;  1YAX A;  1EW0 A;  1MWT A;  3MZE A;  1YM1 A;  4OPQ A;  2OLV A;  3D9Y A;  4JGR A;  4EEU A;  3NBL A;  2JKG A;  3LY4 A;  3O5Y A;  3N6I A;  4ARZ A;  1L0D A;  2IWC A;  5HPF A;  3K3D A;  1XGJ A;  4S2N A;  1OTA A;  4Q0I A;  2Y2H A;  1UGU A;  1I2W A;  2Y2K A;  2V8C A;  3PR6 A;  2A24 A;  4KQO A;  1ES4 A;  3PBN A;  4ME4 A;  2BTF P;  5M18 A;  2O9C A;  3MQ0 A;  3IXG A;  1Q2Q A;  3CJM A;  5IU1 A;  3WWX A;  3ZGA B;  3LIA A;  2H10 A;  5DFX A;  3WRT A;  5AQA A;  3T1Q B;  1N9L A;  5EPH A;  2H0T A;  4I38 A;  1FQG A;  1DP9 A;  4N9L A;  3C30 A;  1SKF A;  3CI6 A;  1K54 A;  2L1M A;  5AQ9 A;  2H0Y A;  2WAD A;  2FZ0 A;  1MXO A;  4WMC A;  4XUZ A;  2WYX A;  3MXQ A;  3SOI A;  3NCK A;  4EES A;  2HJ9 C;  4DJ2 A;  2ZBB A;  4OON A;  5HSQ A;  1H8Y A;  3C8C A;  4H6J A;  5J3W A;  2EX2 A;  1ERM A;  3OBF A;  3UME A;  3FWL A;  3UB9 A;  3NDE A;  3CUE C;  2EWW A;  3V39 A;  1N4O A;  2WKQ A;  3VSL A;  3UNW A;  2NUT C;  5KZH A;  2JCH A;  4E3N A;  2HP5 A;  2WKP A;  1GHI A;  3BW6 A;  1ACF A;  3BFE A;  1W8Q A;  3PTE A;  2B02 A;  4X1L A;  4S2I A;  3NJA A;  3FKW A;  4U0X A;  1MWU A;  3C4P A;  3ZYT A;  1PI5 A;  5F1G A;  4WMC D;  4Y17 A;  3JYI A;  4JXG A;  3QP6 A;  1XJ3 A;  3DTI A;  3EQV A;  4JXW A;  3TW8 A;  1TDG A;  4WL9 A;  4A5R A;  4QPR A;  3E0Y A;  4HP9 A;  3CMZ A;  4GD6 A;  3AGE A;  5HWT A;  1NWZ A;  1YKD A;  5TR7 A;  3U4L P;  1JTG A;  4IVI A;  4QWO A;  4OP5 A;  3MXR A;  4KUK A;  3QP2 A;  4NET A;  5FI6 A;  1NZU A;  3VMA A;  3JPU A;  4S2N C;  3QNB A;  5DF9 A;  5EVE A;  2XGN A;  4KG2 A;  3N7W A;  1KOU A;  3HLB A;  2V2F F;  2V1Z A;  4NK3 A;  1PIO A;  2E8I A;  2X02 A;  1IFQ A;  3IS2 A;  5M1A A;  2ZL1 B;  1D7E A;  3BLS A;  3IWQ A;  4P85 A;  5D3O A;  1YSP A;  5EE8 A;  1VHM A;  1T19 A;  4PM9 A;  3H7W B;  5EEC A;  3L9K A;  1S6R A;  3V5M A;  4IJG A;  5GLB A;  4YFM A;  5EM0 A;  5I94 A;  2EWV A;  2GZA A;  1YQS A;  5KSH A;  3EQU A;  3VP0 A;  1IYS A;  1CEG A;  1G6O A;  3FZC A;  2A24 B;  3O86 A;  3ZHH A;  4IBX A;  2JKR M;  2IA2 A;  4II7 A;  1S1Z A;  4PM7 A;  1BYW A;  3FV7 A;  3CLO A;  4BD0 A;  1MKI A;  5AQ7 A;  3MR0 A;  1YLY A;  4GW9 A;  4KG5 A;  2VK3 A;  3E4Q A;  3PAE A;  4R6L A;  2PBY A;  1F98 A;  4NXG A;  3DTM A;  3Q1F A;  3PBR A;  4C6Y A;  1E25 A;  4WYY A;  1C3B A;  4LRZ E;  4MBF A;  1N9N A;  2XF3 A;  3C7U A;  2WKH A;  3MFD A;  1WYC A;  4P0M A;  1PWD A;  1ONG A;  2ZQ9 A;  4QU3 A;  1BZA A;  2Y55 A;  3WS2 A;  3WS0 A;  4B4X A;  5DF8 A;  3TE8 A;  3BJN A;  5CGS A;  1DJC A;  4N9K A;  3T1R A;  3Q82 A;  3T4K A;  3RFB A;  2NUP C;  3BM6 A;  4R3A A;  3QHY A;  3LUQ A;  1KE3 A;  1SDN A;  4Y7P A;  4EQI A;  4ZAM A;  4R4S A;  3OCN A;  4WEJ A;  2J3T D;  4R3J A;  5HAR A;  4WEL A;  4MNR A;  1LSV A;  4S2M A;  4L9G A;  4Y5F A;  3C4O A;  4O01 A;  1IKG A;  5EVI D;  5GLA A;  2D02 A;  1PI4 A;  3G30 A;  3HUN A;  3EEH A;  3PBO A;  5FQ9 A;  4B9O A;  4HNB A;  2WGW B;  3IF6 A;  2ZM8 A;  2PU4 A;  4DMZ A;  4KEN B;  4KQD A;  1H3Q A;  4PMA A;  2OAQ 1;  5G4Z A;  1SKO B;  1MPL A;  1L2S A;  2L4R A;  1ZG6 A;  4JLF A;  4L9E A;  3GV9 A;  3T4T A;  3UE0 A;  2Y79 A;  3JVV A;  4JGP A;  4KQQ A;  3VP4 A;  4GOG A;  1Z6F A;  2Q9N A;  5CHJ A;  3IH9 A;  2H28 A;  1IKI A;  2WKE A;  5E2H A;  4DKI A;  2W0N A;  2M1C A;  3HUO A;  1FCN A;  1ESI A;  2XFS A;  1FR6 A;  2Y2G A;  3HLG A;  4X1M A;  2VA0 A;  3LR4 A;  1IOU A;  3RTY A;  1S67 L;  4H6J B;  4DXC A;  3F1N A;  5HD5 A;  2JE5 A;  1H0M A;  1VEU B;  2O0Y A;  4EQ1 A;  1K55 C;  5F5Y A;  4UAA A;  1NYY A;  3GVB A;  3IWO A;  5FL3 A;  1L0F A;  1KGG A;  1OTB A;  1TF1 A;  3RH8 B;  2ZLY A;  3KYZ A;  5F82 A;  1ERQ A;  2V9A A;  4CJN A;  4GNU A;  3CPT A;  4D60 A;  3A0S A;  2Q0O A;  3DBA A;  2K31 A;  3FPW A;  3BEB A;  2J8Y A;  4RA7 A;  3P7N A;  4JKT A;  5FA7 A;  3LY3 A;  5CX7 A;  1ODV A;  2Y91 A;  3CWF A;  4GKU A;  2XQZ A;  5CHM A;  5DKL A;  3WRZ A;  4LV2 A;  5EV0 A;  2R78 A;  4S2P A;  3UB7 A;  4NXB A;  4P6Z M;  1K57 A;  4OVD A;  1PW1 A;  4FD8 A;  4JF4 A;  2JBF A;  1DY6 A;  2C6W B;  3T1S A;  2Y2P A;  3PHY A;  3GMW A;  3O88 A;  3R4K A;  1DRM A;  3N8R A;  4OOY A;  3F1O B;  5KSC A;  3CPT B;  2Y8H A;  3LIF A;  2X71 A;  2V1B A;  3ITA A;  2QMI A;  3T4S A;  1K38 A; 
#chains in the Genus database with same CATH homology
 1O7E A;  1Q2Q A;  3CJM A;  5HFO A;  3WWX A;  3ZGA B;  4Y0O A;  3GSG A;  3QNC A;  2R9X A;  2ZM0 A;  1GA0 A;  3GTC A;  1ESU A;  4DDY A;  3P98 A;  2H10 A;  4BQM A;  3VP2 A;  4X68 A;  3WRT A;  4GN2 A;  1FR1 A;  1TDL A;  3O3V A;  3HBR A;  3VOY A;  3O87 A;  5AQA A;  4E3J A;  4RYE A;  5CED A;  3BFG A;  1BLH A;  3V3S A;  4ID4 A;  1JVJ A;  1CI8 A;  3E2L A;  4KG6 A;  1YT4 A;  3RXX A;  2WUQ A;  5EPH A;  5BOH A;  1YLP A;  2H0T A;  4FH2 A;  1FQG A;  4N9L A;  2HDS A;  1NRF A;  2EXA A;  3WS1 A;  5A92 A;  1SKF A;  1QME A;  5EOE A;  1PWG A;  1S0W A;  1K54 A;  2Y59 A;  3G32 A;  5FQQ A;  1NYM A;  3LO7 A;  5AQ9 A;  2H0Y A;  2WAD A;  2EX9 A;  4KZ5 A;  5HAI A;  1MXO A;  4WMC A;  4XUZ A;  4EUZ A;  2WGW A;  1LI9 A;  2WYX A;  3ZG5 A;  1NY0 A;  3SOI A;  1ZKJ A;  3NCK A;  4YIN A;  1FCM A;  4QB8 A;  1GA9 A;  1I2S A;  3M2K A;  4DF6 A;  4OON A;  4C75 A;  4EBP A;  4UA6 A;  2HP9 A;  4OOL A;  4KZ7 A;  2Z2M B;  4ZBE A;  1H8Y A;  3A3E A;  4OLD A;  1FOF A;  3VOZ A;  4KZA A;  3SS4 A;  4HBT A;  2X01 A;  1YMS A;  2EX2 A;  3UO9 A;  2J7V A;  1ERM A;  1ES2 A;  4OQI A;  4F94 A;  3FWL A;  5A93 A;  5CTM A;  1CI9 A;  3IF5 A;  3BRM A;  1WYB A;  1K4E A;  2EX8 A;  3NDE A;  1ALQ A;  4JXS A;  3HLW A;  3V39 A;  1ES5 A;  1N4O A;  4OLG A;  1K57 C;  2Z2L B;  3VSL A;  3S1Y A;  1BLS A;  3UNW A;  5F1F A;  4FCF A;  4QD4 A;  1H5X A;  1EI5 A;  5KZH A;  3IF6 C;  4E3K A;  4FSF A;  1GCE A;  1XA7 A;  2JCH A;  3DWZ A;  3PBQ A;  1XGI A;  2Y2O A;  3VSK A;  4E3N A;  1K55 A;  2HP5 A;  4ZJ2 A;  4DXB A;  1M40 A;  1GHI A;  4PPR A;  1NZO A;  4IBR A;  3VFH A;  2HDQ A;  3BFE A;  2C5W B;  1G68 A;  1W8Q A;  2WAE A;  1MY8 A;  3CZD A;  3G34 A;  3PTE A;  5GHY A;  2J9O A;  4S2I A;  2XK1 A;  1RGZ A;  3FKW A;  4HBU A;  4U0X A;  3I7J A;  4QHC A;  4CPK A;  3OPP A;  3G4P A;  5FI2 A;  1MWU A;  3C4P A;  2VGJ A;  3HLE A;  5CGW A;  5E2G A;  3Q7V B;  3UE3 A;  4BD1 A;  1K54 C;  4FH4 A;  1JWZ A;  5TFQ A;  2Y2L A;  3NDG A;  4R0Q A;  4QJG A;  1PI5 A;  5F1G A;  3G2Z A;  4WMC D;  3SS3 A;  2HDU A;  1W79 A;  4QY5 A;  5M19 A;  1JWP A;  3JYI A;  4JXG A;  1KE0 A;  1EWZ A;  3IH8 A;  4R3B A;  5GLC A;  5FAP A;  5GLD A;  3A3F A;  2ZM2 A;  2CC1 A;  1W8Y A;  3EQV A;  4QY6 A;  4JXW A;  3DW0 A;  3BFC A;  1TDG A;  4MLL A;  4P6B A;  3N4I A;  4A5R A;  1Y54 A;  2ZQC A;  3SH9 A;  4HES A;  3WS4 A;  3PAG A;  5G18 A;  3IWI A;  3CMZ A;  4GD6 A;  1L0G A;  2Y2N A;  4K0W A;  2ZC3 B;  5FQK A;  3AGE A;  1HTZ A;  5FSR A;  5TR7 A;  2EFX A;  5FQJ A;  2P74 A;  4E3I A;  1JTG A;  2XR0 A;  1LI0 A;  2R9W A;  4IVI A;  1YLW A;  4OP5 A;  3MXR A;  1QMF A;  5FAS A;  5E2F A;  4NET A;  5FI6 A;  3W4Q A;  4OH0 A;  3IHA A;  4OPZ A;  1NZU A;  1K4F A;  1KGE A;  3N8L A;  3VMA A;  4S2N C;  1L0E A;  3QNB A;  5DF9 A;  3W8K A;  5HAQ A;  3IHB A;  2XGN A;  3MZF A;  4KG2 A;  3BEC A;  4D2O A;  1E3U A;  3N7W A;  1WE4 A;  3HLB A;  2V2F F;  2V1Z A;  4NK3 A;  1PIO A;  2E8I A;  2X02 A;  3NIA A;  5M1A A;  1XPB A;  5DTS A;  3B3X A;  3BLS A;  3IWQ A;  3UDF A;  3IXB A;  4P85 A;  3ZG0 A;  4RVA A;  2FFY A;  2ZC7 A;  2ZJ9 A;  1MWR A;  5D3O A;  4R1G A;  3V50 A;  2HP6 A;  2WZX A;  4X55 A;  5EE8 A;  4PM9 A;  5EEC A;  3ITB A;  1S6R A;  3LCE A;  5CTN A;  5FDH A;  2ZMA A;  2V20 A;  3V5M A;  5GLB A;  2G2U A;  1TVF A;  1W5D A;  2RL3 A;  4X6T A;  3SS5 A;  4YFM A;  3ZNT A;  3UDI A;  5I94 A;  1YQS A;  5KSH A;  4M3K A;  3EQU A;  4E6X A;  2ZC4 B;  3VP0 A;  4Y0U A;  1IYS A;  3RXW A;  4KQR A;  4KZ9 A;  1CEG A;  1VM1 A;  4BL3 A;  2ZC6 B;  5JYO A;  4WBG A;  2QPN A;  3DWK A;  1W7F A;  1GHP A;  3FZC A;  3O86 A;  3ZHH A;  3NY4 A;  1IEL A;  4IBX A;  5CRF A;  3V3R A;  1BLP A;  5DTT A;  2Y2Q A;  4OKP A;  4OOM A;  4WZ5 C;  4KZ4 A;  4WZ4 A;  1K6R A;  1BLC A;  1RCJ A;  1SCW A;  1YLT A;  2XEP A;  4PM7 A;  1MBL A;  1XXM A;  3TSG A;  3GRJ A;  3HL9 A;  3FV7 A;  1HZO A;  2GDN A;  3OZH A;  3PBS A;  4GD8 A;  2Y2J A;  5KMW A;  4BD0 A;  4E3O A;  2HPB A;  1J9M A;  1LL9 A;  3ZFZ A;  1JTD A;  2I72 A;  3MKE A;  4LV1 A;  1MKI A;  4PM5 A;  1KDS A;  5AQ7 A;  2XFT A;  5CHU A;  5FAT A;  4DE2 A;  1BT5 A;  5JYP A;  1YLY A;  3RJU A;  4OPR A;  5DF7 A;  2BG1 A;  4KG5 A;  2WGI A;  3MXS A;  5E2E A;  4EV4 A;  4DE3 A;  4MBH A;  2Y2M A;  3IQA A;  1BUL A;  3PAE A;  3UY6 A;  2PBY A;  4U0T A;  3DTM A;  1DJB A;  1KGF A;  3MBZ A;  1KE4 A;  1XP4 A;  3Q1F A;  2ZQA A;  3PBR A;  5CEB A;  4KZ6 A;  4C6Y A;  1E25 A;  4WM9 A;  4WYY A;  3ZG8 B;  1C3B A;  3IT9 A;  4MBF A;  3IXH A;  3W4O A;  1SDE A;  2XF3 A;  3NC8 A;  4N92 A;  3C7U A;  3BYD A;  5A90 A;  4GZB A;  1XX2 A;  3FKV A;  4JBF A;  1E4D A;  3VFF A;  4JPM A;  1KVM A;  2WKH A;  1SHV A;  4BEN A;  3G31 A;  4X53 A;  3MFD A;  3Q7Z A;  1WYC A;  4P0M A;  1PWD A;  3HVF A;  3HLC A;  3TOI A;  1ONG A;  2ZQ9 A;  4QU3 A;  5EUA A;  1BZA A;  2Y55 A;  3WS2 A;  2ZQ7 A;  3WS0 A;  3ZVT A;  5DF8 A;  4B4X A;  1YMX A;  4WEK A;  5CGS A;  3OCL A;  1DJC A;  1ONH A;  2EXB A;  4ZJ3 A;  1BSG A;  4N9K A;  3HRE A;  2P9V A;  4Q8I A;  1NXY A;  3Q82 A;  1K56 D;  3ZG7 B;  3D4F A;  3N8S A;  3UPN A;  3ZDJ A;  3G2Y A;  4LV3 A;  3GR2 A;  4JXV A;  1CK3 A;  1IYO A;  2J9P A;  3BM6 A;  1Q2P A;  3QHY A;  2IWB A;  1KE3 A;  5GL9 A;  1SDN A;  3ZVW A;  1I5Q A;  4Y7P A;  4EQI A;  4ZAM A;  4R4S A;  3OCN A;  4WEJ A;  4R3J A;  2QZ6 A;  2XLN A;  4C3Q A;  1YLJ A;  5HAR A;  4WEL A;  4IED A;  3M6H A;  4MNR A;  4S2M A;  4KZ8 A;  3A3J A;  4S2K A;  4PM6 A;  4R4R A;  4LCL A;  3C4O A;  2OLU A;  4KZB A;  1RGY A;  5EOO A;  1IKG A;  4JF6 A;  5EVI D;  5F83 A;  4EWF A;  5GLA A;  3C5A A;  4DE0 A;  1PI4 A;  3G30 A;  3HUN A;  4L0L A;  1GHM A;  3PBO A;  2ZC5 B;  5FQ9 A;  5HX9 A;  4LV0 A;  4E6W A;  4BLM A;  4BL2 A;  2PU2 A;  2WGW B;  3IF6 A;  2XD5 A;  3BFF A;  4GB7 A;  2ZM8 A;  5EVI A;  4N1H A;  3ZCZ A;  4DRT A;  2PU4 A;  4KEN B;  4PMA A;  2EX6 A;  1XA1 A;  1KVL A;  3OPH A;  1MPL A;  4H8R A;  4R23 A;  3AGD A;  4Y0T A;  1VQQ A;  3Q07 A;  5CGX A;  1L2S A;  1NJ4 A;  1ZG6 A;  4JLF A;  3GV9 A;  4IVK A;  1LL5 A;  3HLF A;  3UE0 A;  5EVL A;  1K25 A;  3P09 A;  4O7D A;  4Z9Q A;  1OME A;  3UPO A;  5EVI C;  1PWC A;  4UA9 A;  1RP5 A;  3UPP A;  4KQQ A;  2WAF A;  3VP4 A;  3VP3 A;  1M6K A;  3E2K A;  5EVI B;  4GOG A;  2WZZ A;  1BUE A;  1Z6F A;  2Q9N A;  3VP1 A;  2G2W A;  4S2J A;  3WS5 A;  5CER A;  4OPY A;  4E3L A;  5A91 A;  1PYY A;  1K56 A;  1H8Z A;  1FSY A;  1O07 A;  2B5R A;  4PM8 A;  3IH9 A;  5CHJ A;  3UN7 A;  5FQI A;  1IKI A;  2OSU A;  1JWV A;  2Y2I A;  2WKE A;  2Q9M A;  3ZG9 B;  3OPL A;  5E2H A;  4DKI A;  1E3U D;  4E3M A;  4RX3 A;  4EBL A;  3HUO A;  1IYQ A;  3G35 A;  2WK0 A;  1FCN A;  4P87 A;  1ESI A;  2XFS A;  3MKF A;  4X69 A;  3LEZ A;  1U60 A;  5DVA A;  3A3I A;  1FR6 A;  2Y2G A;  3HLG A;  4OP8 A;  5HW3 A;  3GQZ A;  4OQH A;  4UA7 A;  4B88 A;  1FSW A;  4DXC A;  3A3D A;  2VGK A;  3HLD A;  3BFD A;  5FAO A;  5IHV A;  1G6A A;  5U47 A;  4ZTK A;  3UDX A;  2DCF A;  2JE5 A;  2ZD8 A;  3HUM A;  3OPR A;  4KZ3 A;  2WGV A;  4S2L A;  1K55 C;  2P9V B;  3IF6 B;  4B4Z A;  3W4P A;  4U3T A;  2A3U A;  3ISG A;  4UAA A;  4GDB A;  1AXB A;  4UHU A;  1NYY A;  3GVB A;  3IWO A;  4DDS A;  4BJP A;  1L0F A;  5GHZ A;  1ZC2 A;  1KGG A;  5E43 A;  3BLM A;  4WZ5 A;  2ZLY A;  5F82 A;  1YLZ A;  1ERQ A;  4HEF A;  1HD8 A;  1LLB A;  4K0X A;  5HAP A;  1PW8 A;  4CJN A;  2DRW A;  4X56 A;  4GNU A;  4MBK A;  1XKZ A;  2DNS A;  1HVB A;  1ZG4 A;  1IYP A;  3AGF A;  3S22 A;  4N1X A;  5DTK A;  2Y4A A;  1PZO A;  3PBT A;  3Q7V A;  4K91 A;  3M2J A;  3BEB A;  1IEM A;  3FYZ A;  3SH7 A;  3TG9 A;  2J8Y A;  3M6B A;  4RA7 A;  2XH9 A;  2BLS A;  3NI9 A;  3MZD A;  2H5S A;  4MEZ A;  4LCM A;  4JKT A;  5FA7 A;  1ES3 A;  5HL1 A;  4EBN A;  3LY3 A;  1KDW A;  2Y91 A;  1TEM A;  5FAQ A;  1FCO A;  5CHM A;  4GKU A;  2XQZ A;  3WRZ A;  4LV2 A;  1N9B A;  5L2F A;  4GDN A;  4OQG A;  4LEN A;  2XDM A;  2JC7 A;  2RCX A;  2UWX A;  4S2P A;  4OQ0 A;  2WKI A;  3Q81 A;  1K57 A;  3C7V A;  1MWS A;  3ZNY A;  4OVD A;  4DE1 A;  1MWT A;  3MZE A;  1YM1 A;  4XUX A;  2FFF B;  2ZQD A;  1PW1 A;  1ERO A;  2OLV A;  4FD8 A;  4JF4 A;  4OPQ A;  3NBL A;  2JBF A;  1PZP A;  2XD1 A;  5AQB A;  3UE1 A;  4ZDX A;  3LY4 A;  5FQM A;  2EFU A;  1DY6 A;  5FI7 A;  3N6I A;  2C6W B;  3IXD A;  1L0D A;  2IWC A;  4RX2 A;  3OC2 A;  5CXW A;  2Y2P A;  5GHX A;  1XGJ A;  4ZJ1 A;  1DJA A;  4S2N A;  3SH8 A;  3S4X A;  4XXR A;  3GMW A;  5CEC A;  3O88 A;  2IWD A;  2A49 A;  4S2O A;  5TGF A;  5J8X A;  2Y2H A;  1CEF A;  3N8R A;  2ZQ8 A;  1I2W A;  4OOY A;  2Y2K A;  2OV5 A;  4JF5 A;  5KSC A;  2X71 A;  1ES4 A;  3ITA A;  1K6S A;  4KQO A;  3PBN A;  2HDR A;  1BTL A;  2QMI A;  5M18 A;  1K38 A;  1LHY A;  3CG5 A;  3IXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...