3K3DA

The n-terminal pas domain crystal structure of rv1364c from mycobacterium tuberculosis at 2.3 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
127
Chain Sequence
MDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Rv1364c/MT1410
publication title The N-Terminal Pas Domain Crystal Structure of Rv1364C from Mycobacterium Tuberculosis at 2.3 Angstrom.
rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 32
structure length 127
sequence length 134
ec nomenclature
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3k3dA00
4EESA 3ICYA 3SW1A 4JGPA 3EWKA 4HP9A 1S67L 4I3IA 1XFQA 3UB9A 1OTIA 4NXGA 4JGRA 3NJAA 3LIFA 1P97A 3EEHA 3CWFA 3IS2B 4HHDA 3MFXA 4LRXC 3KX0X 4F3LB 1V9ZA 3LIAA 2JN7A 2INWA 3MQQA 3NHQA 2PDRA 1N9OA 2PR6A 3A0RA 3G6OA 2VV6A 5EFWA 2PHYA 2WKRA 4XT2A 1OTEA 1F98A 2J80A 3GDIA 5J7EA 3NOUC 1T1BA 4R6LA 5HDDA 3BY8A 3LIBA 4I3JA 2V0UA 5HD5A 4MN6A 4EETB 2PYPA 4BBVA 3CAXA 1V9YA 4LPZA 4HJ4A 5AVFA 3IS2A 4HQAA 1S1ZA 3B33A 4KUOA 4F3LA 1DP8A 1OJGA 2R78A 5G4ZA 3FC7A 3LIDA 3F1OA 2A24B 2PD7A 5IU1A 1S4SA 1DP9A 4R3AA 5HD3A 1LT0A 5HDCA 3H9WA 3F1PB 4EQ1A 3UB6A 2L1MA 2GJ3A 4I5SA 2BASA 3VE3A 4NXBA 3UB7A 3K3CA 1LSVA 4HP4A 1OJ5A 1OTAA 5I5LA 2D01A 3RTYA 2VEAA 5HWTA 2Z6CA 2QWSA 1T19A 4B9OA 4K08A 2L0WA 5TBMB 1OTDA 3E4PA 4EXOA 1VB6A 5DJUA 2V1BA 1D7EA 3RH8B 1T1CA 2A24A 3K3DA 4GHIB 3A0SA 1G28A 5F6AA 1T1AA 4I38A 4EEPA 1F9IA 3NOTC 1UGUA 2V1AA 3MXQA 3VOLA 3E4OA 4HOIA 1S4RA 5J3WA 4H6JB 1LL8A 4HY8A 5F68A 2ZOHA 2JHEA 4PKYA 3LYXA 2PR5A 1OTBA 2PD8A 2WKQA 2QHKA 5TBMA 4HH3A 1TS7A 4NXFA 4L9FA 1LSXA 3H7WB 3IBRA 1S66L 3H82B 1UWPX 2VV7A 4GHIA 3T50A 1XJ6A 3BWLA 5HDSA 2K7SA 3MR0A 2H28A 4WN5A 2YKFA 2KDKA 3D72A 1OT9A 2HV1A 1DP6A 2CMNA 5HZHA 4H6JA 2B02A 4KUKA 4DJ3A 1KOUA 1N9NA 3MQOA 3ULFA 4EEUA 2W27A 1UWNX 1OT6A 2QJ5A 2KX6A 4LLOB 5KIZA 4I39A 5HWVA 4L9GA 4NXEA 3UMDA 1P0ZA 2ZBBA 4HNBA 1DRMA 1XFNA 3H7WA 4EW7A 4LRYC 4JGOA 5F5YA 1MZUA 3PHYA 5G4YA 4PKYG 3CLOA 2OOLA 1TS0A 1GSXA 2QJ7A 4DJ2A 1GSVA 4MN5A 1XJ2A 4R70A 3C2WA 2M1CA 3E4QA 3LI9A 1GSWA 2YKHA 1TS6A 3OLOA 2ZOIA 3F1PA 5A8BA 4HI4A 5AVEA 3UE6A 1ODVA 4KQDA 3F1NB 4BBUA 3LIEA 3HJKA 4HH2A 5HWWA 2L4RA 3VE4A 3UB8A 4WUJA 1S1YA 3F1OB 5J4EA 4WL9A 3LUQA 4GS9B 3GECA 2PYRA 4I3AA 5DJTA 2EA9A 3LICA 3C8CA 4HIAA 3UMEA 3HJIA 2V9AA 2QKPA 4E04A 4L9EA 4WF0A 4GCZA 2VLGA 4LRZE 3P7NA 4EERA 1T18A 3PYPA 3ZQ5A 1WA9A 1N9LA 5DKLA 5HSQA 3F1NA 3LI8A 3MJQA 2OWJA 1XJ4A 2WKPA 4HJ6A 3A0VA 1LSWA 4HJ3A 4M4XA 4RQ9A 1XJ3A 1BYWA 2V0WA 4YWZA 5IS1A 1JNUA 2OWHA 5F69A 4GS9A 3BY9A 3NOPC 1X0OA 4R38A 1D06A 1EW0A 4WLAA 1NWZA 2Z6DA 5DKKA 3H82A 2D02A 2VV8A 4BBTA 2I9VA 4GW9A 2W0NA 4XT2B 1Y28A 1TS8A 3FG8A 2P7JA 4JGQA
chains in the Genus database with same CATH superfamily
2BTFP 3RXWA 3CPTA 2WAFA 1PWCA 2Y2QA 1PFLA 3KSHA 3FV7A 5GHXA 5CGWA 1S67L 1PWDA 4OVDA 2XF3A 5FI7A 3LO7A 4BENA 4JGRA 1H8ZA 3LIFA 4Y13A 4S2LA 5TFQA 3CWFA 5CEBA 5C5KA 2PU4A 4F3LB 1PZOA 1KDSA 5E2HA 1H5XA 1L2SA 1PW8A 4ETXA 4NK3A 4KZBA 4KQOA 1N9OA 3G34A 4WEKA 2PU2A 1YQSA 3OPLA 4RA7A 1K4EA 4XT2A 4BQMA 3ZG9B 4P85A 2HDSA 3C7VA 3CMZA 3WS5A 3ZG0A 3W2ZA 3FWLA 1EI5A 4R6LA 5HDDA 3LIBA 4I3JA 4RVAA 5HD5A 5FQ9A 3IF6C 3S7NA 4EV4A 3OCLA 4BBVA 5CHUA 1L0GA 1MC0A 4LPZA 4WM9A 4HJ4A 5DVAA 4HQAA 4KUOA 4F3LA 2FFYA 3W4OA 1OJGA 3OZHA 4QPRA 3IH9A 1BLSA 2XR0A 2PD7A 3BFGA 5FI6A 3QP6A 1DP9A 5AQ9A 2QZ6A 4N1HA 4FTXA 4LENA 2PBYA 2GJ3A 3VE3A 4NXBA 3SS4A 1SKFA 1YAXA 4Y0TA 3KO6A 2JCHA 3CJMA 1GHMA 4B9OA 4S2NA 1YMSA 3WS4A 3G2YA 4WZ5C 3E4PA 1O7EA 1VB6A 1D7EA 4ME4A 5E2EA 3LEQA 4DXBA 3OOVA 3RH8B 3IX4A 3VP0A 5FEFA 5CGSA 5F6AA 3MKFA 2FFFB 4EEPA 1BT5A 2V1AA 2Y2NA 3E4OA 4HOIA 4EQIA 1S4RA 3A3DA 4H6JB 2G2UA 1LL8A 4Y0OA 4FD8A 4HY8A 2EX8A 1W63M 1XX2A 4OOMA 2JHEA 4ZTKA 3IF5A 1ESIA 4PKYA 3LYXA 5CTMA 3IT9A 1OTBA 3QHYA 4MNRA 3GVBA 4KQRA 4RYEA 4OP8A 1MY8A 3PBNA 1TS7A 4NXFA 2XLNA 2VGKA 3IBRA 1KE3A 4K0WA 3HLGA 4M3KA 3O86A 1UWPX 3ZG7B 3SH7A 1CJFA 4GZBA 2I72A 2ZL1B 5K5BA 1STZA 1XA1A 3C4OA 3M2JA 1K25A 5KSCA 2HV1A 1JWPA 3QP5A 4GKUA 4KZ7A 3QNCA 4H6JA 2EX6A 1SHVA 2Y2OA 2XEPA 1BUEA 4LCLA 3MQOA 4DE1A 4IBRA 3TG9A 3W4PA 1BULA 1ONGA 4F94A 3FYZA 3UE3A 1FCMA 4LLOB 3HCYA 2ZMFA 5HWVA 4L9GA 3PBRA 1PZPA 1P0ZA 2Y2IA 2ZBBA 1XFNA 2OAP1 1PIOA 1ERQA 2P08A 2PRFA 5F5YA 3ZGAB 4YINA 1ZG6A 1BLPA 3CLOA 1IYQA 2OOLA 3QP1A 2ZL1A 3V5MA 1NXYA 4R4SA 4Q0IA 1CI9A 5AQ7A 4Y5FA 2Y2JA 3E4QA 1P9WA 4EBPA 5KSHA 3A3EA 2YKHA 4JPMA 3UDXA 4X56A 2ZM2A 1QMEA 4JLFA 3RJUA 3Q07A 5DTSA 2WKHA 1IYPA 4UHUA 3ZNYA 2B95A 5CHMA 2EFUA 3IHBA 3LIEA 1WYBA 4HH2A 1LI9A 3T4QA 1Z09A 1E25A 5CHJA 2WAEA 1NLZA 1S1YA 5J4EA 4E3NA 4N1XA 4WL9A 4GS9B 1G6OA 5EV0A 4Z9QA 2WUQA 5FI2A 5F1GA 3TRCA 5DJTA 4FSFA 4YOFA 3BLSA 4OP5A 1FILA 4HIAA 1FIKA 4GD6A 4QY5A 4HBTA 3ZDJA 1MWUA 2XGNA 3HJIA 2QKPA 4E04A 4X6TA 5GL9A 4E3MA 4NEED 3VSKA 3KYEA 2VLGA 3NC8A 5KMWA 4LRZE 4N9LA 3G2ZA 1BZAA 2V2FF 5FQQA 1FCOA 1RCJA 4DE3A 3PBOA 2RL3A 5DFYA 3VP3A 2A3UA 1VETB 2XD1A 4MBFA 4Y3IA 4KZ6A 3N6IA 5E2GA 3N8RA 3AGFA 2EFXA 3G31A 1XJ3A 1I5QA 3C7UA 4YWZA 2IWBA 5IS1A 2MJ6A 5F69A 4GS9A 5TGFA 4E6XA 1X0OA 4IEDA 1MWTA 1YMXA 1YSPA 2Z6DA 1HVBA 3TSGA 2QMIA 2I9VA 3FKVA 4RX3A 3VOYA 4EWFA 2Z2MB 2C5WB 1IKIA 1IOUA 4JGPA 4HP9A 2RCXA 4DMZA 2O99A 2O9CA 3U4LP 1OTIA 3NJAA 4ESPA 1TD5A 3IS2B 5AQAA 3MFXA 3KX0X 2VA0A 2HJ9C 2PAVP 3LIAA 3GV9A 1XP4A 2JN7A 5MC7A 4OONA 5L8MA 2EX9A 3KSGA 3G6OA 2VV6A 2IWCA 3MMHA 2PHYA 3UB5P 2K2NA 4Y0UA 3BQ8A 2IWDA 3SOIA 1CF0A 1F98A 1LHYA 2J80A 3ZVTA 4OQ0A 5J7EA 1L0DA 3NOUC 3G30A 2V20A 2Y91A 2HDQA 4ETZA 3BY8A 5CX7A 2V0UA 5CGXA 4MN6A 5HX9A 3OPHA 4QJGA 2HF6A 3HLFA 4GD8A 4KZAA 4PM8A 4B4ZA 3ZCZA 2Q9MA 4A5RA 1YLJA 5AVFA 5FDHA 2GX5A 3IS2A 1MWSA 2W3FA 1FSYA 1DP8A 3VOZA 3FKWA 4NKPA 1S0WA 1CQAA 1GCEA 1YT4A 3WS0A 4CLCB 3FC7A 4LCMA 4R4RA 2GNXA 1TEMA 3F1OA 2Y79A 5IU1A 2X01A 1H3QA 4OOYA 3UE0A 1LL5A 1AXBA 4R3AA 2W1RA 3GMWA 3M2KA 1Q2PA 1SKOB 5HDCA 3PAEA 3E2LA 1NY0A 2VKSA 3K2NA 4JXWA 3UB6A 2L1MA 3KSFA 1M6KA 3TOIA 3O87A 3LFVA 4S2PA 1Y54A 2BASA 4I5SA 3UB7A 2Y55A 4Q0HA 3K3CA 1LSVA 3DTEA 4PM9A 2XH9A 1OTAA 1PYYA 3OBFA 5HWTA 2QWSA 3BM6A 3BRMA 3N7WA 4OKPA 2L0WA 4R1GA 4FH4A 5FA7A 3B42A 5DJUA 2W3GA 3T1XA 1ZKJA 3CHWP 3QP4A 3A0SA 2PT7A 2PBDP 1K6SA 1ESUA 1IEMA 4LV3A 1SKOA 3O3VA 4I38A 4E3LA 1ES3A 1K57C 5AQBA 1KVMA 3HLDA 3VOLA 2A49A 2Q0OA 2W1TB 4DE2A 3PAGA 2B5RA 3NY4A 5F68A 1VHMA 4PM6A 3W8KA 5GLAA 4H8RA 5FQIA 2Y8HA 1PRQA 1KGEA 1YSQA 4Q0JA 1ZG4A 2QHKA 5FAOA 4GNUA 4WMCA 3AGEA 5F1FA 4L9FA 1LSXA 2WADA 4RX2A 4DDYA 3EGDC 3H82B 3LY3A 2VV7A 3SZTA 1ERMA 1F5MA 3CZDA 3MXSA 3MR0A 2Y2PA 2H28A 2Q9NA 5EE8A 3C30A 3D72A 5A92A 1FR6A 3C38A 3LR5A 2W1TA 5HZHA 1PWGA 3Q81A 4OQIA 3VFFA 3ZG8B 4GLQA 4KG6A 1W8YA 3PR6A 1N9NA 1U60A 5EPHA 4EEUA 3ZFZA 1GHPA 1UWNX 3DBAA 2QJ5A 5BOHA 1MXOA 3HLCA 4E3IA 5KIZA 1N4OA 4I39A 4BJPA 3R4KA 4X55A 3V50A 3UMDA 3NULA 2FH5A 3B47A 3NDGA 4OLDA 3SH8A 5CTNA 4HNBA 4MBHA 1DRMA 4LRYC 3WS2A 3OC2A 2ZQDA 3PHYA 4HEFA 1K54C 1E3UD 2WGWB 4PKYG 1JVJA 4P87A 1L0EA 3D3OA 3E98A 3VP4A 5EOOA 2AVXA 4X25A 1GSXA 3MQ0A 2VK3A 4OPQA 1HLUP 1XJ2A 1FSWA 2M1CA 1MKMA 5M18A 2WZZA 4DKIA 1KGGA 4ZJ1A 3HL9A 1HZOA 4G3VA 4HBUA 4WELA 3NDEA 1ZTUA 2WGVA 3UE6A 3F1NB 4BBUA 4Q8IA 2O9AA 4G3WA 4KZ5A 5FASA 2V8CA 2PYRA 3MFDA 4WYYA 1DY6A 4JXVA 1G6AA 5FQMA 3DTMA 1DJCA 2K31A 1IYSA 4UA7A 4FCFA 2E8JA 2HDRA 4L9EA 3UPOA 4O7DA 1Y4OA 5FAQA 3HLEA 3IXDA 1SDEA 2XFTA 4K91A 1K0KA 1EROA 3PYPA 3QP2A 5CEDA 2LB5A 1K6RA 4QD4A 3G32A 1W7FA 5HSQA 3F1NA 3CITA 4CQHA 5GLCA 4E3KA 1G68A 4HJ6A 3A0VA 1LSWA 3T1SA 3MKEA 4M4XA 1SZVA 2R9WA 1BYWA 2V0WA 2WKEA 4XUXA 3NBLA 5EVIB 3N4IA 4R38A 1K57A 2J9PA 1F2KA 2ZJ9A 5DFXA 3OPRA 3P09A 1NWZA 2WYXA 2ZC3B 3TW8A 2EWWA 5DKKA 3LY4A 1N9BA 2D02A 4BBTA 1NRJA 1BSGA 1W63Q 4GW9A 2W0NA 1H8MA 3A3FA 3ITAA 4OQGA 5HL1A 2P7JA 4JGQA 4GOGA 1E3UA 2O0YA 2H0TA 3Q82A 5D3OA 3S4XA 1MWRA 5EECA 4PPRA 4I3IA 4OPRA 4MMNA 1C3BA 2ZQ8A 4NXGA 2DCFA 2HP9A 5I94A 4E3OA 3MSHA 1XGJA 4S2JA 1QMFA 1P97A 4ARZB 4ID4A 4KZ9A 4LRXC 4IHQA 3UPPA 4U0XA 2P74A 5EVIA 3V67A 4GN2A 4IVKA 3MQQA 4JXSA 4D2OA 3VSLA 1MPLA 2PR6A 2HDUA 3MF0A 3A0RA 5CECA 2E8IA 3HBRA 3BFDA 3DWZA 5FQKA 5EFWA 2WKRA 4Z1WA 1OTEA 2XFSA 1CEGA 3UPNA 3GDIA 1PI4A 4CLCC 3IXGA 4OOLA 4MN7A 4PMAA 3I7JA 3JYIA 1SDNA 2J3TC 3T4TA 3BYDA 2DRWA 2VX8A 5A93A 2GZAA 3CAXA 1V9YA 3LGOA 4KQQA 2XA7M 2HP5A 1K54A 1S1ZA 3B33A 1TF1A 3MBZA 3EGXC 2XSSA 1HTZA 3EQUA 5DTTA 5CERA 1ACFA 2M7UA 5G4ZA 1LL9A 1FQGA 2XQZA 2OV5A 3NCKA 4U0TA 3LIDA 3HLBA 4MEZA 2A24B 1G5UA 1ES4A 1S4SA 4ZRRA 1LT0A 3OCNA 4PAUA 3H9WA 3F1PB 4NG2A 4EQ1A 4KG5A 1LI0A 4LGWA 1RGYA 4D60A 2BG1A 3A3JA 3UO9A 1OJ5A 1Z6FA 3BFCA 2G7UA 3AGDA 4JF6A 4BLMA 3RTYA 2XA7S 1OMEA 1T19A 5LBRA 4K08A 4IUKA 1PNEA 2ZQAA 1L0FA 4CLCD 5EOEA 5TBMB 1VETA 2OLUA 3RFBA 5A91A 1OTDA 4EXOA 1LLBA 1JWZA 1YKDA 3VV4A 3UDIA 2J3TD 2H5SA 2IA2A 3B3XA 1T1CA 3MZDA 2A24A 4X69A 3K3DA 3L7HA 2GDNA 4GHIB 3T4JA 1TDLA 1ES5A 3SS5A 3BEBA 2JKTI 1F9IA 3NOTC 3EQVA 1UGUA 3PXPA 3MXQA 4UA9A 1S6RA 4OH0A 3LR3A 2VGLM 4P0MA 1JTDA 1IELA 4EUZA 4GB7A 4XUZA 2H0YA 4UEYA 4KZ8A 4NETA 2ZOHA 3FPWA 3WRTA 3KYQA 4UA6A 4WMCD 4L0LA 5EVLA 4S2KA 4ZJ3A 5JYPA 4OQHA 2WKQA 5TBMA 3RXXA 1H8YA 2OLVA 3BECA 3H7WB 4CPKA 1S66L 1GA0A 4LV1A 4GHIA 2ZQCA 1FR1A 3V39A 1XJ6A 3BWLA 1GHIA 3IX8A 5HDSA 3M6BA 2NUPC 1GA9A 1ZHHB 1IFQA 4WN5A 5FDSA 2V1ZA 2VGLS 4WEJA 2YKFA 1YLZA 4ZJ2A 1OT9A 1DP6A 3VP1A 1NLYA 1Q2QA 2C6WB 2G2WA 3HREA 2WKIA 3KSIA 2B02A 4S2IA 3GTCA 1TDGA 3ULFA 2Y2GA 3SH9A 1AWIA 4Y17A 2W3HA 3V3SA 1OT6A 2Y59A 4JBFA 2KX6A 1MBLA 1DJAA 4IBXA 2WK0A 5M19A 5EM0A 5CXWA 1I2WA 3T4OA 4MLLA 1CI8A 3E2KA 3H7WA 4R0QA 4B4XA 4EW7A 4QWOA 4E6WA 3SS3A 1MZUA 5G4YA 2EX2A 3LEZA 3P98A 4KENB 2Z2LB 4CLCA 2JC7A 3TJZC 4K0XA 4EBNA 1GSVA 4MN5A 4R70A 4JXGA 5CRFA 3BFEA 4CJNA 2JKRI 3LI9A 5L09A 1GSWA 3T1QB 4C3QA 3OLOA 2XRNA 3O88A 1RGZA 1XA7A 4BWIA 3MZEA 4DE0A 3M6HA 4O0PA 5IT5A 4HI4A 3S1YA 5U47A 3CG5A 3JPUA 1RP5A 3WWXA 5EM1A 1ODVA 4KQDA 1NYYA 1CK3A 1HD8A 2B18A 3HJKA 4MCWA 5DF7A 4LFUA 4PHTA 5GHYA 3GR2A 4PM5A 3MXRA 2ZLYA 4I3AA 3ZNTA 4N92A 2ZM8A 4KG2A 2EA9A 3T4LA 2J8YA 3N8LA 2V8FA 1YLTA 3S22A 2V9AA 4WF0A 1P9RA 4GCZA 5DF9A 3G35A 4JF5A 5EVIC 2R9XA 3DTKA 1NZUA 2XDMA 3P7NA 4QHCA 5TJJA 1PI5A 4EERA 3UE1A 1T18A 2EXBA 5DKLA 1YLPA 3LI8A 4GJ4A 4OPYA 3G4PA 2WKPA 4QB8A 1VQQA 1MKIA 1JNUA 3BY9A 3S7PA 4X53A 3WS1A 4E3JA 4FOFA 3C4PA 1D06A 4BD1A 3CUEA 4WLAA 5L2FA 3H82A 1K56D 2VV8A 1W79A 2J3WA 3MS6A 1VM1A 4AFIA 3UNWA 2EXAA 1KE0A 3IBJA 1VEUB 1Y28A 1TS8A 3FG8A 1KVLA 4EESA 5KZHA 3ICYA 3SW1A 2QYBA 2ZC7A 3OPPA 2EWVA 3EWKA 4R23A 4OPZA 1BTLA 4EBLA 1XFQA 2JE5A 3UB9A 5HL6A 1IKGA 5HFOA 1BLCA 5HAIA 5EVID 3BQAA 3EEHA 4KZ3A 4HHDA 3HUOA 4DXCA 5J8XA 1V9ZA 4EUVA 2HP6A 3LR0A 4S2OA 2BLSA 5F82A 1K55A 4O8GA 2INWA 3NHQA 2Y2MA 2PDRA 4DDSA 1W5DA 4UQIM 2WGWA 2ACGA 1H0MA 1VEUA 4JF4A 2J7VA 2JKTM 3ZG5A 1T1BA 2Y2KA 3JVVA 1I2SA 4EETB 2WGIA 1SCWA 3PBSA 4PM7A 2DMWA 4QY6A 2PYPA 4CLCE 1E4DA 3P01A 3NI9A 3IXBA 3MZFA 2WZXA 2DNSA 1CEFA 5TR7A 2O9BA 3T4SA 3VFHA 3S7QA 2R78A 1NJ4A 4HESA 3E0YA 1YLWA 3GRJA 4UQIS 3HVFA 4X1LA 2JKGA 3GQZA 3FZCA 1YM1A 3IF6B 1JTGA 2VZWA 5HD3A 2JKFA 3BW6A 4X1MA 2W3DA 2ZC5B 3Q7ZA 1J3WA 4II7A 2KOIA 3Q7VB 4DRTA 4ZAMA 2X02A 4JKTA 3ZYTA 5HAPA 4Y15A 4HP4A 3C5AA 3NECA 5I5LA 2D01A 1K56A 4KZ4A 2HJEA 4YNRA 3U2AA 3PBTA 3KYZA 2VEAA 2Z6CA 1XXMA 3HLWA 4U3TA 3IWQA 2LB9A 1FOFA 3QNBA 2HGVA 5FQJA 3ZVWA 3HUNA 4B88A 4FH2A 1ES2A 3ITBA 5F83A 2X71A 2KLIA 2V1BA 3LR4A 3FPVA 3QP8A 3IWIA 3IXHA 1G28A 3T1RA 3IF6A 3GSGA 4R3BA 2M7VA 1T1AA 1DJBA 3UDFA 4XXRA 4WBGA 5E2FA 5AJGA 4GDNA 4C6YA 3ISGA 1YLYA 3Q7VA 5J3WA 3V3RA 3S7OA 5HAQA 2JKRM 4UAAA 5EUAA 5HPIA 4O01A 5HPFA 1FCNA 4BD0A 1J9MA 3R7WB 2PR5A 3IHAA 3EEAA 4QU3A 3EOIA 4R3JA 2PD8A 4IJGA 5JYOA 5L10A 4HH3A 3W4QA 1KE4A 2J9OA 4MBKA 4BMWA 2FZ0A 4BL3A 3D4FA 4ARZA 3N8SA 2XD5A 2HPBA 5GLBA 3T50A 2XK1A 1ZC2A 2ZD8A 2K7SA 3IH8A 2KDKA 2UWXA 2CMNA 2ZM0A 4WZ5A 3NIAA 3O5YA 1IYOA 3IQAA 5IHVA 2HZ5A 3VMAA 1NYMA 4KUKA 4DJ3A 1KOUA 3T12B 1XGIA 2Y4AA 5DF8A 2W27A 4LV0A 2P9VB 1K38A 3R7WA 4IUHA 4G3KA 3WRZA 1KGFA 1L3LA 4NXEA 4GDBA 2VJWA 3PBQA 5FAPA 4JGOA 1D1JA 3DWKA 5E43A 1O07A 1TS0A 1M40A 2NUTC 3BJNA 5FEGA 2ZQ7A 1NRFA 1PW1A 2QJ7A 4DJ2A 5HW3A 1A0KA 2ZMVA 2H10A 3C2WA 1NZOA 3HUMA 4ZBEA 4S2MA 1TS6A 1KDWA 2ZC6B 3DW0A 5FL3A 4N9KA 4WZ4A 2Y2HA 2ZOIA 3VP2A 1W8QA 3F1PA 5A8BA 2P04A 5G18A 3BFFA 3LCEA 3CUEC 1ALQA 5AVEA 2P9VA 4Y2FA 2VGJA 3CI6A 4EU0A 5HWWA 1XPBA 4DF6A 2L4RA 5DTKA 3VE4A 3UB8A 4WUJA 3T4KA 3F1OB 4C75A 1XKZA 2OSUA 4MDZA 3LUQA 3GECA 3TE8A 4S2NC 1WYCA 3L9KA 2A2LA 3LICA 3C8CA 4LV2A 1TVFA 2JBFA 3DTIA 4B93A 3UMEA 2XROA 5A90A 1OPXA 4OLGA 1WE4A 4P6ZM 4BL2A 1YPRA 4Y7PA 1K55C 3CPTB 3D9YA 3DAVA 3ZQ5A 1WA9A 3A3IA 1N9LA 2ZC4B 2UV0E 4IVIA 3IX3A 1JWVA 3MJQA 2W3EA 4YFMA 2OWJA 1XJ4A 3PTEA 1BLHA 4HJ3A 5FATA 4RQ9A 5GHZA 4P6BA 2ZMAA 2OAQ1 3IWOA 2Y2LA 2OWHA 5FSRA 3JVUA 3NOPC 1K4FA 4DN0A 5M1AA 5L07A 5GLDA 1ONHA 5EVEA 1EWZA 4P6ZS 4X68A 3UN7A 3UY6A 2ZQ9A 4ZDXA 1EW0A 2CC1A 3Q1FA 3BLMA 3ZHHA 2QPNA 4XT2B 4FUWA 5HARA
chains in the Genus database with same CATH topology
4EESA 2O0YA 3ICYA 1IOUA 3SW1A 2QYBA 2EWVA 4JGPA 3EWKA 4HP9A 3KSHA 1S67L 4DMZA 4I3IA 2O99A 2O9CA 1XFQA 4MMNA 3UB9A 1OTIA 4NXGA 5HL6A 4JGRA 3NJAA 3LIFA 1P97A 3BQAA 3EEHA 4ARZB 1TD5A 3CWFA 3IS2B 4HHDA 3MFXA 4LRXC 5C5KA 3KX0X 4F3LB 1V9ZA 4IHQA 2VA0A 3V67A 4EUVA 2HJ9C 3LIAA 3LR0A 4ETXA 2JN7A 4O8GA 5MC7A 2INWA 3MQQA 3NHQA 2PDRA 4KQOA 5L8MA 1N9OA 2PR6A 3MF0A 4UQIM 3A0RA 3KSGA 4WEKA 3G6OA 2VV6A 5EFWA 3MMHA 2PHYA 2WKRA 4XT2A 4Z1WA 2K2NA 1OTEA 3BQ8A 1F98A 2J80A 3GDIA 2JKTM 3W2ZA 5J7EA 3NOUC 4CLCC 1T1BA 4OOLA 4R6LA 4ETZA 5HDDA 3BY8A 3JVVA 3LIBA 4I3JA 2V0UA 4MN7A 5CX7A 5HD5A 4MN6A 4EETB 3S7NA 2HF6A 2J3TC 3T4TA 3OCLA 3PBSA 2DMWA 2VX8A 2PYPA 4BBVA 2GZAA 3CAXA 4CLCE 1V9YA 1MC0A 3P01A 4LPZA 2XA7M 4HJ4A 5AVFA 2GX5A 3IS2A 2W3FA 4HQAA 1S1ZA 3B33A 4KUOA 2O9BA 1TF1A 3T4SA 1DP8A 3EGXC 4F3LA 2XSSA 3EQUA 4NKPA 1OJGA 3S7QA 2R78A 2M7UA 5G4ZA 4QPRA 3E0YA 4CLCB 3FC7A 4UQIS 3LIDA 2GNXA 3F1OA 2A24B 2PD7A 2Y79A 5IU1A 1H3QA 1S4SA 4ZRRA 1DP9A 4R3AA 2W1RA 2VZWA 1LT0A 5HD3A 3OCNA 4PAUA 5HDCA 3H9WA 3BW6A 2W3DA 3F1PB 2VKSA 4EQ1A 3K2NA 4II7A 3UB6A 2KOIA 2L1MA 3KSFA 3LFVA 2GJ3A 4I5SA 2BASA 3VE3A 4NXBA 3ZYTA 3UB7A 4Q0HA 3K3CA 1LSVA 1YAXA 4HP4A 1OJ5A 1OTAA 2G7UA 5I5LA 2D01A 3RTYA 3KO6A 2XA7S 2HJEA 4YNRA 3U2AA 3PBTA 3KYZA 3OBFA 2VEAA 5HWTA 2Z6CA 2QWSA 1T19A 4B9OA 5LBRA 4K08A 2LB9A 4IUKA 4CLCD 2L0WA 5TBMB 2HGVA 3RFBA 1OTDA 3E4PA 4EXOA 1VB6A 3B42A 1YKDA 3VV4A 5DJUA 2KLIA 2V1BA 1D7EA 3LR4A 4ME4A 2J3TD 2W3GA 3FPVA 2IA2A 3OOVA 3RH8B 1T1CA 2A24A 3K3DA 4GHIB 3A0SA 2PT7A 1G28A 3T4JA 5F6AA 2M7VA 1T1AA 4I38A 2JKTI 4EEPA 1F9IA 3NOTC 3EQVA 5AJGA 1UGUA 2V1AA 3PXPA 3MXQA 3VOLA 3E4OA 4HOIA 3LR3A 2VGLM 2W1TB 1S4RA 5J3WA 4H6JB 3S7OA 4UEYA 1LL8A 4HY8A 5F68A 2JKRM 1W63M 5HPIA 3FPWA 1VHMA 2ZOHA 4OOMA 4O01A 3KYQA 2JHEA 5HPFA 2Y8HA 4PKYA 4L0LA 3LYXA 2PR5A 3R7WB 3EEAA 3EOIA 1OTBA 2PD8A 1YSQA 4IJGA 4Q0JA 2WKQA 2QHKA 5TBMA 4HH3A 3PBNA 1TS7A 4NXFA 4BMWA 2FZ0A 4L9FA 1LSXA 3H7WB 3IBRA 1S66L 4ARZA 3EGDC 3H82B 1UWPX 2VV7A 4GHIA 3T50A 1F5MA 1XJ6A 3BWLA 5HDSA 5K5BA 1STZA 2NUPC 2K7SA 3MR0A 1ZHHB 1IFQA 2H28A 4WN5A 2VGLS 4WEJA 2YKFA 2KDKA 3C30A 3D72A 3C38A 1OT9A 3LR5A 2HV1A 1DP6A 2CMNA 2W1TA 5HZHA 1NLYA 3O5YA 4H6JA 3KSIA 2B02A 4GLQA 3PR6A 4KUKA 4DJ3A 1KOUA 1N9NA 3MQOA 3ULFA 2W3HA 4EEUA 2W27A 1UWNX 3DBAA 1OT6A 2QJ5A 4IUHA 3R7WA 4G3KA 3UE3A 2KX6A 4LLOB 3HCYA 5KIZA 4I39A 2ZMFA 5HWVA 4BJPA 4L9GA 3R4KA 3PBRA 4NXEA 3UMDA 1P0ZA 2FH5A 3B47A 2VJWA 2ZBBA 4HNBA 3T4OA 1DRMA 1XFNA 3H7WA 3PBQA 4EW7A 4LRYC 2OAP1 2P08A 3OC2A 4JGOA 5F5YA 1MZUA 3PHYA 5G4YA 4PKYG 3CLOA 2OOLA 1TS0A 3BJNA 2NUTC 3D3OA 3E98A 4CLCA 1GSXA 3TJZC 3MQ0A 2QJ7A 4DJ2A 1GSVA 4MN5A 4Q0IA 1XJ2A 2ZMVA 4Y5FA 4R70A 3C2WA 2M1CA 3E4QA 1MKMA 1P9WA 2JKRI 3LI9A 5KSHA 1GSWA 2YKHA 1TS6A 3OLOA 2XRNA 5FL3A 2ZOIA 4BWIA 3F1PA 5A8BA 2P04A 4O0PA 4G3VA 3CUEC 5IT5A 4WELA 4HI4A 1ZTUA 5AVEA 4Y2FA 3CI6A 3UE6A 1ODVA 4KQDA 3F1NB 4BBUA 4EU0A 2B18A 3LIEA 3HJKA 4MCWA 4HH2A 3T4QA 5HWWA 2O9AA 2L4RA 4PHTA 4G3WA 1NLZA 3VE4A 3UB8A 4WUJA 3T4KA 1S1YA 3F1OB 5J4EA 4MDZA 4WL9A 3LUQA 4GS9B 3GECA 3TE8A 1G6OA 2PYRA 4I3AA 3TRCA 5DJTA 4FSFA 2A2LA 4YOFA 2EA9A 3T4LA 3LICA 2K31A 3C8CA 4HIAA 4B93A 3UMEA 2XROA 3HJIA 2V9AA 2QKPA 4E04A 4L9EA 4WF0A 1P9RA 4NEED 1OPXA 4GCZA 4P6ZM 2VLGA 5DF9A 4LRZE 3P7NA 5TJJA 4EERA 1T18A 3PYPA 3PBOA 2LB5A 3ZQ5A 5DFYA 1WA9A 1N9LA 5DKLA 5HSQA 3F1NA 3LI8A 4GJ4A 4Y3IA 3MJQA 2W3EA 3CITA 4CQHA 2OWJA 1XJ4A 2WKPA 4HJ6A 3A0VA 1LSWA 4HJ3A 4M4XA 4RQ9A 1XJ3A 1BYWA 2V0WA 4YWZA 5IS1A 2MJ6A 1JNUA 2OAQ1 2OWHA 5F69A 4GS9A 3JVUA 3BY9A 3NOPC 3S7PA 4DN0A 4FOFA 1X0OA 4R38A 1D06A 5DFXA 1YSPA 3CUEA 4P6ZS 1EW0A 4WLAA 1NWZA 2Z6DA 3TW8A 2EWWA 5DKKA 3H82A 2D02A 2VV8A 4BBTA 2I9VA 1NRJA 1W63Q 2J3WA 4AFIA 4GW9A 2W0NA 4XT2B 3IBJA 1H8MA 1Y28A 1TS8A 3FG8A 2P7JA 4JGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  3ICY A;  3SW1 A;  4JGP A;  3EWK A;  4HP9 A;  1S67 L;  4I3I A;  1XFQ A;  3UB9 A;  1OTI A;  4NXG A;  4JGR A;  3NJA A;  3LIF A;  1P97 A;  3EEH A;  3CWF A;  3IS2 B;  4HHD A;  3MFX A;  4LRX C;  3KX0 X;  4F3L B;  1V9Z A;  3LIA A;  2JN7 A;  2INW A;  3MQQ A;  3NHQ A;  2PDR A;  1N9O A;  2PR6 A;  3A0R A;  3G6O A;  2VV6 A;  5EFW A;  2PHY A;  2WKR A;  4XT2 A;  1OTE A;  1F98 A;  2J80 A;  3GDI A;  5J7E A;  3NOU C;  1T1B A;  4R6L A;  5HDD A;  3BY8 A;  3LIB A;  4I3J A;  2V0U A;  5HD5 A;  4MN6 A;  4EET B;  2PYP A;  4BBV A;  3CAX A;  1V9Y A;  4LPZ A;  4HJ4 A;  5AVF A;  3IS2 A;  4HQA A;  1S1Z A;  3B33 A;  4KUO A;  4F3L A;  1DP8 A;  1OJG A;  2R78 A;  5G4Z A;  3FC7 A;  3LID A;  3F1O A;  2A24 B;  2PD7 A;  5IU1 A;  1S4S A;  1DP9 A;  4R3A A;  5HD3 A;  1LT0 A;  5HDC A;  3H9W A;  3F1P B;  4EQ1 A;  3UB6 A;  2L1M A;  2GJ3 A;  4I5S A;  2BAS A;  3VE3 A;  4NXB A;  3UB7 A;  3K3C A;  1LSV A;  4HP4 A;  1OJ5 A;  1OTA A;  5I5L A;  2D01 A;  3RTY A;  2VEA A;  5HWT A;  2Z6C A;  2QWS A;  1T19 A;  4B9O A;  4K08 A;  2L0W A;  5TBM B;  1OTD A;  3E4P A;  4EXO A;  1VB6 A;  5DJU A;  2V1B A;  1D7E A;  3RH8 B;  1T1C A;  2A24 A;  3K3D A;  4GHI B;  3A0S A;  1G28 A;  5F6A A;  1T1A A;  4I38 A;  4EEP A;  1F9I A;  3NOT C;  1UGU A;  2V1A A;  3MXQ A;  3VOL A;  3E4O A;  4HOI A;  1S4R A;  5J3W A;  4H6J B;  1LL8 A;  4HY8 A;  5F68 A;  2ZOH A;  2JHE A;  4PKY A;  3LYX A;  2PR5 A;  1OTB A;  2PD8 A;  2WKQ A;  2QHK A;  5TBM A;  4HH3 A;  1TS7 A;  4NXF A;  4L9F A;  1LSX A;  3H7W B;  3IBR A;  1S66 L;  3H82 B;  1UWP X;  2VV7 A;  4GHI A;  3T50 A;  1XJ6 A;  3BWL A;  5HDS A;  2K7S A;  3MR0 A;  2H28 A;  4WN5 A;  2YKF A;  2KDK A;  3D72 A;  1OT9 A;  2HV1 A;  1DP6 A;  2CMN A;  5HZH A;  4H6J A;  2B02 A;  4KUK A;  4DJ3 A;  1KOU A;  1N9N A;  3MQO A;  3ULF A;  4EEU A;  2W27 A;  1UWN X;  1OT6 A;  2QJ5 A;  2KX6 A;  4LLO B;  5KIZ A;  4I39 A;  5HWV A;  4L9G A;  4NXE A;  3UMD A;  1P0Z A;  2ZBB A;  4HNB A;  1DRM A;  1XFN A;  3H7W A;  4EW7 A;  4LRY C;  4JGO A;  5F5Y A;  1MZU A;  3PHY A;  5G4Y A;  4PKY G;  3CLO A;  2OOL A;  1TS0 A;  1GSX A;  2QJ7 A;  4DJ2 A;  1GSV A;  4MN5 A;  1XJ2 A;  4R70 A;  3C2W A;  2M1C A;  3E4Q A;  3LI9 A;  1GSW A;  2YKH A;  1TS6 A;  3OLO A;  2ZOI A;  3F1P A;  5A8B A;  4HI4 A;  5AVE A;  3UE6 A;  1ODV A;  4KQD A;  3F1N B;  4BBU A;  3LIE A;  3HJK A;  4HH2 A;  5HWW A;  2L4R A;  3VE4 A;  3UB8 A;  4WUJ A;  1S1Y A;  3F1O B;  5J4E A;  4WL9 A;  3LUQ A;  4GS9 B;  3GEC A;  2PYR A;  4I3A A;  5DJT A;  2EA9 A;  3LIC A;  3C8C A;  4HIA A;  3UME A;  3HJI A;  2V9A A;  2QKP A;  4E04 A;  4L9E A;  4WF0 A;  4GCZ A;  2VLG A;  4LRZ E;  3P7N A;  4EER A;  1T18 A;  3PYP A;  3ZQ5 A;  1WA9 A;  1N9L A;  5DKL A;  5HSQ A;  3F1N A;  3LI8 A;  3MJQ A;  2OWJ A;  1XJ4 A;  2WKP A;  4HJ6 A;  3A0V A;  1LSW A;  4HJ3 A;  4M4X A;  4RQ9 A;  1XJ3 A;  1BYW A;  2V0W A;  4YWZ A;  5IS1 A;  1JNU A;  2OWH A;  5F69 A;  4GS9 A;  3BY9 A;  3NOP C;  1X0O A;  4R38 A;  1D06 A;  1EW0 A;  4WLA A;  1NWZ A;  2Z6D A;  5DKK A;  3H82 A;  2D02 A;  2VV8 A;  4BBT A;  2I9V A;  4GW9 A;  2W0N A;  4XT2 B;  1Y28 A;  1TS8 A;  3FG8 A;  2P7J A;  4JGQ A; 
#chains in the Genus database with same CATH topology
 2BTF P;  3RXW A;  3CPT A;  2WAF A;  1PWC A;  2Y2Q A;  1PFL A;  3KSH A;  3FV7 A;  5GHX A;  5CGW A;  1S67 L;  1PWD A;  4OVD A;  2XF3 A;  5FI7 A;  3LO7 A;  4BEN A;  4JGR A;  1H8Z A;  3LIF A;  4Y13 A;  4S2L A;  5TFQ A;  3CWF A;  5CEB A;  5C5K A;  2PU4 A;  4F3L B;  1PZO A;  1KDS A;  5E2H A;  1H5X A;  1L2S A;  1PW8 A;  4ETX A;  4NK3 A;  4KZB A;  4KQO A;  1N9O A;  3G34 A;  4WEK A;  2PU2 A;  1YQS A;  3OPL A;  4RA7 A;  1K4E A;  4XT2 A;  4BQM A;  3ZG9 B;  4P85 A;  2HDS A;  3C7V A;  3CMZ A;  3WS5 A;  3ZG0 A;  3W2Z A;  3FWL A;  1EI5 A;  4R6L A;  5HDD A;  3LIB A;  4I3J A;  4RVA A;  5HD5 A;  5FQ9 A;  3IF6 C;  3S7N A;  4EV4 A;  3OCL A;  4BBV A;  5CHU A;  1L0G A;  1MC0 A;  4LPZ A;  4WM9 A;  4HJ4 A;  5DVA A;  4HQA A;  4KUO A;  4F3L A;  2FFY A;  3W4O A;  1OJG A;  3OZH A;  4QPR A;  3IH9 A;  1BLS A;  2XR0 A;  2PD7 A;  3BFG A;  5FI6 A;  3QP6 A;  1DP9 A;  5AQ9 A;  2QZ6 A;  4N1H A;  4FTX A;  4LEN A;  2PBY A;  2GJ3 A;  3VE3 A;  4NXB A;  3SS4 A;  1SKF A;  1YAX A;  4Y0T A;  3KO6 A;  2JCH A;  3CJM A;  1GHM A;  4B9O A;  4S2N A;  1YMS A;  3WS4 A;  3G2Y A;  4WZ5 C;  3E4P A;  1O7E A;  1VB6 A;  1D7E A;  4ME4 A;  5E2E A;  3LEQ A;  4DXB A;  3OOV A;  3RH8 B;  3IX4 A;  3VP0 A;  5FEF A;  5CGS A;  5F6A A;  3MKF A;  2FFF B;  4EEP A;  1BT5 A;  2V1A A;  2Y2N A;  3E4O A;  4HOI A;  4EQI A;  1S4R A;  3A3D A;  4H6J B;  2G2U A;  1LL8 A;  4Y0O A;  4FD8 A;  4HY8 A;  2EX8 A;  1W63 M;  1XX2 A;  4OOM A;  2JHE A;  4ZTK A;  3IF5 A;  1ESI A;  4PKY A;  3LYX A;  5CTM A;  3IT9 A;  1OTB A;  3QHY A;  4MNR A;  3GVB A;  4KQR A;  4RYE A;  4OP8 A;  1MY8 A;  3PBN A;  1TS7 A;  4NXF A;  2XLN A;  2VGK A;  3IBR A;  1KE3 A;  4K0W A;  3HLG A;  4M3K A;  3O86 A;  1UWP X;  3ZG7 B;  3SH7 A;  1CJF A;  4GZB A;  2I72 A;  2ZL1 B;  5K5B A;  1STZ A;  1XA1 A;  3C4O A;  3M2J A;  1K25 A;  5KSC A;  2HV1 A;  1JWP A;  3QP5 A;  4GKU A;  4KZ7 A;  3QNC A;  4H6J A;  2EX6 A;  1SHV A;  2Y2O A;  2XEP A;  1BUE A;  4LCL A;  3MQO A;  4DE1 A;  4IBR A;  3TG9 A;  3W4P A;  1BUL A;  1ONG A;  4F94 A;  3FYZ A;  3UE3 A;  1FCM A;  4LLO B;  3HCY A;  2ZMF A;  5HWV A;  4L9G A;  3PBR A;  1PZP A;  1P0Z A;  2Y2I A;  2ZBB A;  1XFN A;  2OAP 1;  1PIO A;  1ERQ A;  2P08 A;  2PRF A;  5F5Y A;  3ZGA B;  4YIN A;  1ZG6 A;  1BLP A;  3CLO A;  1IYQ A;  2OOL A;  3QP1 A;  2ZL1 A;  3V5M A;  1NXY A;  4R4S A;  4Q0I A;  1CI9 A;  5AQ7 A;  4Y5F A;  2Y2J A;  3E4Q A;  1P9W A;  4EBP A;  5KSH A;  3A3E A;  2YKH A;  4JPM A;  3UDX A;  4X56 A;  2ZM2 A;  1QME A;  4JLF A;  3RJU A;  3Q07 A;  5DTS A;  2WKH A;  1IYP A;  4UHU A;  3ZNY A;  2B95 A;  5CHM A;  2EFU A;  3IHB A;  3LIE A;  1WYB A;  4HH2 A;  1LI9 A;  3T4Q A;  1Z09 A;  1E25 A;  5CHJ A;  2WAE A;  1NLZ A;  1S1Y A;  5J4E A;  4E3N A;  4N1X A;  4WL9 A;  4GS9 B;  1G6O A;  5EV0 A;  4Z9Q A;  2WUQ A;  5FI2 A;  5F1G A;  3TRC A;  5DJT A;  4FSF A;  4YOF A;  3BLS A;  4OP5 A;  1FIL A;  4HIA A;  1FIK A;  4GD6 A;  4QY5 A;  4HBT A;  3ZDJ A;  1MWU A;  2XGN A;  3HJI A;  2QKP A;  4E04 A;  4X6T A;  5GL9 A;  4E3M A;  4NEE D;  3VSK A;  3KYE A;  2VLG A;  3NC8 A;  5KMW A;  4LRZ E;  4N9L A;  3G2Z A;  1BZA A;  2V2F F;  5FQQ A;  1FCO A;  1RCJ A;  4DE3 A;  3PBO A;  2RL3 A;  5DFY A;  3VP3 A;  2A3U A;  1VET B;  2XD1 A;  4MBF A;  4Y3I A;  4KZ6 A;  3N6I A;  5E2G A;  3N8R A;  3AGF A;  2EFX A;  3G31 A;  1XJ3 A;  1I5Q A;  3C7U A;  4YWZ A;  2IWB A;  5IS1 A;  2MJ6 A;  5F69 A;  4GS9 A;  5TGF A;  4E6X A;  1X0O A;  4IED A;  1MWT A;  1YMX A;  1YSP A;  2Z6D A;  1HVB A;  3TSG A;  2QMI A;  2I9V A;  3FKV A;  4RX3 A;  3VOY A;  4EWF A;  2Z2M B;  2C5W B;  1IKI A;  1IOU A;  4JGP A;  4HP9 A;  2RCX A;  4DMZ A;  2O99 A;  2O9C A;  3U4L P;  1OTI A;  3NJA A;  4ESP A;  1TD5 A;  3IS2 B;  5AQA A;  3MFX A;  3KX0 X;  2VA0 A;  2HJ9 C;  2PAV P;  3LIA A;  3GV9 A;  1XP4 A;  2JN7 A;  5MC7 A;  4OON A;  5L8M A;  2EX9 A;  3KSG A;  3G6O A;  2VV6 A;  2IWC A;  3MMH A;  2PHY A;  3UB5 P;  2K2N A;  4Y0U A;  3BQ8 A;  2IWD A;  3SOI A;  1CF0 A;  1F98 A;  1LHY A;  2J80 A;  3ZVT A;  4OQ0 A;  5J7E A;  1L0D A;  3NOU C;  3G30 A;  2V20 A;  2Y91 A;  2HDQ A;  4ETZ A;  3BY8 A;  5CX7 A;  2V0U A;  5CGX A;  4MN6 A;  5HX9 A;  3OPH A;  4QJG A;  2HF6 A;  3HLF A;  4GD8 A;  4KZA A;  4PM8 A;  4B4Z A;  3ZCZ A;  2Q9M A;  4A5R A;  1YLJ A;  5AVF A;  5FDH A;  2GX5 A;  3IS2 A;  1MWS A;  2W3F A;  1FSY A;  1DP8 A;  3VOZ A;  3FKW A;  4NKP A;  1S0W A;  1CQA A;  1GCE A;  1YT4 A;  3WS0 A;  4CLC B;  3FC7 A;  4LCM A;  4R4R A;  2GNX A;  1TEM A;  3F1O A;  2Y79 A;  5IU1 A;  2X01 A;  1H3Q A;  4OOY A;  3UE0 A;  1LL5 A;  1AXB A;  4R3A A;  2W1R A;  3GMW A;  3M2K A;  1Q2P A;  1SKO B;  5HDC A;  3PAE A;  3E2L A;  1NY0 A;  2VKS A;  3K2N A;  4JXW A;  3UB6 A;  2L1M A;  3KSF A;  1M6K A;  3TOI A;  3O87 A;  3LFV A;  4S2P A;  1Y54 A;  2BAS A;  4I5S A;  3UB7 A;  2Y55 A;  4Q0H A;  3K3C A;  1LSV A;  3DTE A;  4PM9 A;  2XH9 A;  1OTA A;  1PYY A;  3OBF A;  5HWT A;  2QWS A;  3BM6 A;  3BRM A;  3N7W A;  4OKP A;  2L0W A;  4R1G A;  4FH4 A;  5FA7 A;  3B42 A;  5DJU A;  2W3G A;  3T1X A;  1ZKJ A;  3CHW P;  3QP4 A;  3A0S A;  2PT7 A;  2PBD P;  1K6S A;  1ESU A;  1IEM A;  4LV3 A;  1SKO A;  3O3V A;  4I38 A;  4E3L A;  1ES3 A;  1K57 C;  5AQB A;  1KVM A;  3HLD A;  3VOL A;  2A49 A;  2Q0O A;  2W1T B;  4DE2 A;  3PAG A;  2B5R A;  3NY4 A;  5F68 A;  1VHM A;  4PM6 A;  3W8K A;  5GLA A;  4H8R A;  5FQI A;  2Y8H A;  1PRQ A;  1KGE A;  1YSQ A;  4Q0J A;  1ZG4 A;  2QHK A;  5FAO A;  4GNU A;  4WMC A;  3AGE A;  5F1F A;  4L9F A;  1LSX A;  2WAD A;  4RX2 A;  4DDY A;  3EGD C;  3H82 B;  3LY3 A;  2VV7 A;  3SZT A;  1ERM A;  1F5M A;  3CZD A;  3MXS A;  3MR0 A;  2Y2P A;  2H28 A;  2Q9N A;  5EE8 A;  3C30 A;  3D72 A;  5A92 A;  1FR6 A;  3C38 A;  3LR5 A;  2W1T A;  5HZH A;  1PWG A;  3Q81 A;  4OQI A;  3VFF A;  3ZG8 B;  4GLQ A;  4KG6 A;  1W8Y A;  3PR6 A;  1N9N A;  1U60 A;  5EPH A;  4EEU A;  3ZFZ A;  1GHP A;  1UWN X;  3DBA A;  2QJ5 A;  5BOH A;  1MXO A;  3HLC A;  4E3I A;  5KIZ A;  1N4O A;  4I39 A;  4BJP A;  3R4K A;  4X55 A;  3V50 A;  3UMD A;  3NUL A;  2FH5 A;  3B47 A;  3NDG A;  4OLD A;  3SH8 A;  5CTN A;  4HNB A;  4MBH A;  1DRM A;  4LRY C;  3WS2 A;  3OC2 A;  2ZQD A;  3PHY A;  4HEF A;  1K54 C;  1E3U D;  2WGW B;  4PKY G;  1JVJ A;  4P87 A;  1L0E A;  3D3O A;  3E98 A;  3VP4 A;  5EOO A;  2AVX A;  4X25 A;  1GSX A;  3MQ0 A;  2VK3 A;  4OPQ A;  1HLU P;  1XJ2 A;  1FSW A;  2M1C A;  1MKM A;  5M18 A;  2WZZ A;  4DKI A;  1KGG A;  4ZJ1 A;  3HL9 A;  1HZO A;  4G3V A;  4HBU A;  4WEL A;  3NDE A;  1ZTU A;  2WGV A;  3UE6 A;  3F1N B;  4BBU A;  4Q8I A;  2O9A A;  4G3W A;  4KZ5 A;  5FAS A;  2V8C A;  2PYR A;  3MFD A;  4WYY A;  1DY6 A;  4JXV A;  1G6A A;  5FQM A;  3DTM A;  1DJC A;  2K31 A;  1IYS A;  4UA7 A;  4FCF A;  2E8J A;  2HDR A;  4L9E A;  3UPO A;  4O7D A;  1Y4O A;  5FAQ A;  3HLE A;  3IXD A;  1SDE A;  2XFT A;  4K91 A;  1K0K A;  1ERO A;  3PYP A;  3QP2 A;  5CED A;  2LB5 A;  1K6R A;  4QD4 A;  3G32 A;  1W7F A;  5HSQ A;  3F1N A;  3CIT A;  4CQH A;  5GLC A;  4E3K A;  1G68 A;  4HJ6 A;  3A0V A;  1LSW A;  3T1S A;  3MKE A;  4M4X A;  1SZV A;  2R9W A;  1BYW A;  2V0W A;  2WKE A;  4XUX A;  3NBL A;  5EVI B;  3N4I A;  4R38 A;  1K57 A;  2J9P A;  1F2K A;  2ZJ9 A;  5DFX A;  3OPR A;  3P09 A;  1NWZ A;  2WYX A;  2ZC3 B;  3TW8 A;  2EWW A;  5DKK A;  3LY4 A;  1N9B A;  2D02 A;  4BBT A;  1NRJ A;  1BSG A;  1W63 Q;  4GW9 A;  2W0N A;  1H8M A;  3A3F A;  3ITA A;  4OQG A;  5HL1 A;  2P7J A;  4JGQ A;  4GOG A;  1E3U A;  2O0Y A;  2H0T A;  3Q82 A;  5D3O A;  3S4X A;  1MWR A;  5EEC A;  4PPR A;  4I3I A;  4OPR A;  4MMN A;  1C3B A;  2ZQ8 A;  4NXG A;  2DCF A;  2HP9 A;  5I94 A;  4E3O A;  3MSH A;  1XGJ A;  4S2J A;  1QMF A;  1P97 A;  4ARZ B;  4ID4 A;  4KZ9 A;  4LRX C;  4IHQ A;  3UPP A;  4U0X A;  2P74 A;  5EVI A;  3V67 A;  4GN2 A;  4IVK A;  3MQQ A;  4JXS A;  4D2O A;  3VSL A;  1MPL A;  2PR6 A;  2HDU A;  3MF0 A;  3A0R A;  5CEC A;  2E8I A;  3HBR A;  3BFD A;  3DWZ A;  5FQK A;  5EFW A;  2WKR A;  4Z1W A;  1OTE A;  2XFS A;  1CEG A;  3UPN A;  3GDI A;  1PI4 A;  4CLC C;  3IXG A;  4OOL A;  4MN7 A;  4PMA A;  3I7J A;  3JYI A;  1SDN A;  2J3T C;  3T4T A;  3BYD A;  2DRW A;  2VX8 A;  5A93 A;  2GZA A;  3CAX A;  1V9Y A;  3LGO A;  4KQQ A;  2XA7 M;  2HP5 A;  1K54 A;  1S1Z A;  3B33 A;  1TF1 A;  3MBZ A;  3EGX C;  2XSS A;  1HTZ A;  3EQU A;  5DTT A;  5CER A;  1ACF A;  2M7U A;  5G4Z A;  1LL9 A;  1FQG A;  2XQZ A;  2OV5 A;  3NCK A;  4U0T A;  3LID A;  3HLB A;  4MEZ A;  2A24 B;  1G5U A;  1ES4 A;  1S4S A;  4ZRR A;  1LT0 A;  3OCN A;  4PAU A;  3H9W A;  3F1P B;  4NG2 A;  4EQ1 A;  4KG5 A;  1LI0 A;  4LGW A;  1RGY A;  4D60 A;  2BG1 A;  3A3J A;  3UO9 A;  1OJ5 A;  1Z6F A;  3BFC A;  2G7U A;  3AGD A;  4JF6 A;  4BLM A;  3RTY A;  2XA7 S;  1OME A;  1T19 A;  5LBR A;  4K08 A;  4IUK A;  1PNE A;  2ZQA A;  1L0F A;  4CLC D;  5EOE A;  5TBM B;  1VET A;  2OLU A;  3RFB A;  5A91 A;  1OTD A;  4EXO A;  1LLB A;  1JWZ A;  1YKD A;  3VV4 A;  3UDI A;  2J3T D;  2H5S A;  2IA2 A;  3B3X A;  1T1C A;  3MZD A;  2A24 A;  4X69 A;  3K3D A;  3L7H A;  2GDN A;  4GHI B;  3T4J A;  1TDL A;  1ES5 A;  3SS5 A;  3BEB A;  2JKT I;  1F9I A;  3NOT C;  3EQV A;  1UGU A;  3PXP A;  3MXQ A;  4UA9 A;  1S6R A;  4OH0 A;  3LR3 A;  2VGL M;  4P0M A;  1JTD A;  1IEL A;  4EUZ A;  4GB7 A;  4XUZ A;  2H0Y A;  4UEY A;  4KZ8 A;  4NET A;  2ZOH A;  3FPW A;  3WRT A;  3KYQ A;  4UA6 A;  4WMC D;  4L0L A;  5EVL A;  4S2K A;  4ZJ3 A;  5JYP A;  4OQH A;  2WKQ A;  5TBM A;  3RXX A;  1H8Y A;  2OLV A;  3BEC A;  3H7W B;  4CPK A;  1S66 L;  1GA0 A;  4LV1 A;  4GHI A;  2ZQC A;  1FR1 A;  3V39 A;  1XJ6 A;  3BWL A;  1GHI A;  3IX8 A;  5HDS A;  3M6B A;  2NUP C;  1GA9 A;  1ZHH B;  1IFQ A;  4WN5 A;  5FDS A;  2V1Z A;  2VGL S;  4WEJ A;  2YKF A;  1YLZ A;  4ZJ2 A;  1OT9 A;  1DP6 A;  3VP1 A;  1NLY A;  1Q2Q A;  2C6W B;  2G2W A;  3HRE A;  2WKI A;  3KSI A;  2B02 A;  4S2I A;  3GTC A;  1TDG A;  3ULF A;  2Y2G A;  3SH9 A;  1AWI A;  4Y17 A;  2W3H A;  3V3S A;  1OT6 A;  2Y59 A;  4JBF A;  2KX6 A;  1MBL A;  1DJA A;  4IBX A;  2WK0 A;  5M19 A;  5EM0 A;  5CXW A;  1I2W A;  3T4O A;  4MLL A;  1CI8 A;  3E2K A;  3H7W A;  4R0Q A;  4B4X A;  4EW7 A;  4QWO A;  4E6W A;  3SS3 A;  1MZU A;  5G4Y A;  2EX2 A;  3LEZ A;  3P98 A;  4KEN B;  2Z2L B;  4CLC A;  2JC7 A;  3TJZ C;  4K0X A;  4EBN A;  1GSV A;  4MN5 A;  4R70 A;  4JXG A;  5CRF A;  3BFE A;  4CJN A;  2JKR I;  3LI9 A;  5L09 A;  1GSW A;  3T1Q B;  4C3Q A;  3OLO A;  2XRN A;  3O88 A;  1RGZ A;  1XA7 A;  4BWI A;  3MZE A;  4DE0 A;  3M6H A;  4O0P A;  5IT5 A;  4HI4 A;  3S1Y A;  5U47 A;  3CG5 A;  3JPU A;  1RP5 A;  3WWX A;  5EM1 A;  1ODV A;  4KQD A;  1NYY A;  1CK3 A;  1HD8 A;  2B18 A;  3HJK A;  4MCW A;  5DF7 A;  4LFU A;  4PHT A;  5GHY A;  3GR2 A;  4PM5 A;  3MXR A;  2ZLY A;  4I3A A;  3ZNT A;  4N92 A;  2ZM8 A;  4KG2 A;  2EA9 A;  3T4L A;  2J8Y A;  3N8L A;  2V8F A;  1YLT A;  3S22 A;  2V9A A;  4WF0 A;  1P9R A;  4GCZ A;  5DF9 A;  3G35 A;  4JF5 A;  5EVI C;  2R9X A;  3DTK A;  1NZU A;  2XDM A;  3P7N A;  4QHC A;  5TJJ A;  1PI5 A;  4EER A;  3UE1 A;  1T18 A;  2EXB A;  5DKL A;  1YLP A;  3LI8 A;  4GJ4 A;  4OPY A;  3G4P A;  2WKP A;  4QB8 A;  1VQQ A;  1MKI A;  1JNU A;  3BY9 A;  3S7P A;  4X53 A;  3WS1 A;  4E3J A;  4FOF A;  3C4P A;  1D06 A;  4BD1 A;  3CUE A;  4WLA A;  5L2F A;  3H82 A;  1K56 D;  2VV8 A;  1W79 A;  2J3W A;  3MS6 A;  1VM1 A;  4AFI A;  3UNW A;  2EXA A;  1KE0 A;  3IBJ A;  1VEU B;  1Y28 A;  1TS8 A;  3FG8 A;  1KVL A;  4EES A;  5KZH A;  3ICY A;  3SW1 A;  2QYB A;  2ZC7 A;  3OPP A;  2EWV A;  3EWK A;  4R23 A;  4OPZ A;  1BTL A;  4EBL A;  1XFQ A;  2JE5 A;  3UB9 A;  5HL6 A;  1IKG A;  5HFO A;  1BLC A;  5HAI A;  5EVI D;  3BQA A;  3EEH A;  4KZ3 A;  4HHD A;  3HUO A;  4DXC A;  5J8X A;  1V9Z A;  4EUV A;  2HP6 A;  3LR0 A;  4S2O A;  2BLS A;  5F82 A;  1K55 A;  4O8G A;  2INW A;  3NHQ A;  2Y2M A;  2PDR A;  4DDS A;  1W5D A;  4UQI M;  2WGW A;  2ACG A;  1H0M A;  1VEU A;  4JF4 A;  2J7V A;  2JKT M;  3ZG5 A;  1T1B A;  2Y2K A;  3JVV A;  1I2S A;  4EET B;  2WGI A;  1SCW A;  3PBS A;  4PM7 A;  2DMW A;  4QY6 A;  2PYP A;  4CLC E;  1E4D A;  3P01 A;  3NI9 A;  3IXB A;  3MZF A;  2WZX A;  2DNS A;  1CEF A;  5TR7 A;  2O9B A;  3T4S A;  3VFH A;  3S7Q A;  2R78 A;  1NJ4 A;  4HES A;  3E0Y A;  1YLW A;  3GRJ A;  4UQI S;  3HVF A;  4X1L A;  2JKG A;  3GQZ A;  3FZC A;  1YM1 A;  3IF6 B;  1JTG A;  2VZW A;  5HD3 A;  2JKF A;  3BW6 A;  4X1M A;  2W3D A;  2ZC5 B;  3Q7Z A;  1J3W A;  4II7 A;  2KOI A;  3Q7V B;  4DRT A;  4ZAM A;  2X02 A;  4JKT A;  3ZYT A;  5HAP A;  4Y15 A;  4HP4 A;  3C5A A;  3NEC A;  5I5L A;  2D01 A;  1K56 A;  4KZ4 A;  2HJE A;  4YNR A;  3U2A A;  3PBT A;  3KYZ A;  2VEA A;  2Z6C A;  1XXM A;  3HLW A;  4U3T A;  3IWQ A;  2LB9 A;  1FOF A;  3QNB A;  2HGV A;  5FQJ A;  3ZVW A;  3HUN A;  4B88 A;  4FH2 A;  1ES2 A;  3ITB A;  5F83 A;  2X71 A;  2KLI A;  2V1B A;  3LR4 A;  3FPV A;  3QP8 A;  3IWI A;  3IXH A;  1G28 A;  3T1R A;  3IF6 A;  3GSG A;  4R3B A;  2M7V A;  1T1A A;  1DJB A;  3UDF A;  4XXR A;  4WBG A;  5E2F A;  5AJG A;  4GDN A;  4C6Y A;  3ISG A;  1YLY A;  3Q7V A;  5J3W A;  3V3R A;  3S7O A;  5HAQ A;  2JKR M;  4UAA A;  5EUA A;  5HPI A;  4O01 A;  5HPF A;  1FCN A;  4BD0 A;  1J9M A;  3R7W B;  2PR5 A;  3IHA A;  3EEA A;  4QU3 A;  3EOI A;  4R3J A;  2PD8 A;  4IJG A;  5JYO A;  5L10 A;  4HH3 A;  3W4Q A;  1KE4 A;  2J9O A;  4MBK A;  4BMW A;  2FZ0 A;  4BL3 A;  3D4F A;  4ARZ A;  3N8S A;  2XD5 A;  2HPB A;  5GLB A;  3T50 A;  2XK1 A;  1ZC2 A;  2ZD8 A;  2K7S A;  3IH8 A;  2KDK A;  2UWX A;  2CMN A;  2ZM0 A;  4WZ5 A;  3NIA A;  3O5Y A;  1IYO A;  3IQA A;  5IHV A;  2HZ5 A;  3VMA A;  1NYM A;  4KUK A;  4DJ3 A;  1KOU A;  3T12 B;  1XGI A;  2Y4A A;  5DF8 A;  2W27 A;  4LV0 A;  2P9V B;  1K38 A;  3R7W A;  4IUH A;  4G3K A;  3WRZ A;  1KGF A;  1L3L A;  4NXE A;  4GDB A;  2VJW A;  3PBQ A;  5FAP A;  4JGO A;  1D1J A;  3DWK A;  5E43 A;  1O07 A;  1TS0 A;  1M40 A;  2NUT C;  3BJN A;  5FEG A;  2ZQ7 A;  1NRF A;  1PW1 A;  2QJ7 A;  4DJ2 A;  5HW3 A;  1A0K A;  2ZMV A;  2H10 A;  3C2W A;  1NZO A;  3HUM A;  4ZBE A;  4S2M A;  1TS6 A;  1KDW A;  2ZC6 B;  3DW0 A;  5FL3 A;  4N9K A;  4WZ4 A;  2Y2H A;  2ZOI A;  3VP2 A;  1W8Q A;  3F1P A;  5A8B A;  2P04 A;  5G18 A;  3BFF A;  3LCE A;  3CUE C;  1ALQ A;  5AVE A;  2P9V A;  4Y2F A;  2VGJ A;  3CI6 A;  4EU0 A;  5HWW A;  1XPB A;  4DF6 A;  2L4R A;  5DTK A;  3VE4 A;  3UB8 A;  4WUJ A;  3T4K A;  3F1O B;  4C75 A;  1XKZ A;  2OSU A;  4MDZ A;  3LUQ A;  3GEC A;  3TE8 A;  4S2N C;  1WYC A;  3L9K A;  2A2L A;  3LIC A;  3C8C A;  4LV2 A;  1TVF A;  2JBF A;  3DTI A;  4B93 A;  3UME A;  2XRO A;  5A90 A;  1OPX A;  4OLG A;  1WE4 A;  4P6Z M;  4BL2 A;  1YPR A;  4Y7P A;  1K55 C;  3CPT B;  3D9Y A;  3DAV A;  3ZQ5 A;  1WA9 A;  3A3I A;  1N9L A;  2ZC4 B;  2UV0 E;  4IVI A;  3IX3 A;  1JWV A;  3MJQ A;  2W3E A;  4YFM A;  2OWJ A;  1XJ4 A;  3PTE A;  1BLH A;  4HJ3 A;  5FAT A;  4RQ9 A;  5GHZ A;  4P6B A;  2ZMA A;  2OAQ 1;  3IWO A;  2Y2L A;  2OWH A;  5FSR A;  3JVU A;  3NOP C;  1K4F A;  4DN0 A;  5M1A A;  5L07 A;  5GLD A;  1ONH A;  5EVE A;  1EWZ A;  4P6Z S;  4X68 A;  3UN7 A;  3UY6 A;  2ZQ9 A;  4ZDX A;  1EW0 A;  2CC1 A;  3Q1F A;  3BLM A;  3ZHH A;  2QPN A;  4XT2 B;  4FUW A;  5HAR A; 
#chains in the Genus database with same CATH homology
 4EES A;  2O0Y A;  3ICY A;  1IOU A;  3SW1 A;  2QYB A;  2EWV A;  4JGP A;  3EWK A;  4HP9 A;  3KSH A;  1S67 L;  4DMZ A;  4I3I A;  2O99 A;  2O9C A;  1XFQ A;  4MMN A;  3UB9 A;  1OTI A;  4NXG A;  5HL6 A;  4JGR A;  3NJA A;  3LIF A;  1P97 A;  3BQA A;  3EEH A;  4ARZ B;  1TD5 A;  3CWF A;  3IS2 B;  4HHD A;  3MFX A;  4LRX C;  5C5K A;  3KX0 X;  4F3L B;  1V9Z A;  4IHQ A;  2VA0 A;  3V67 A;  4EUV A;  2HJ9 C;  3LIA A;  3LR0 A;  4ETX A;  2JN7 A;  4O8G A;  5MC7 A;  2INW A;  3MQQ A;  3NHQ A;  2PDR A;  4KQO A;  5L8M A;  1N9O A;  2PR6 A;  3MF0 A;  4UQI M;  3A0R A;  3KSG A;  4WEK A;  3G6O A;  2VV6 A;  5EFW A;  3MMH A;  2PHY A;  2WKR A;  4XT2 A;  4Z1W A;  2K2N A;  1OTE A;  3BQ8 A;  1F98 A;  2J80 A;  3GDI A;  2JKT M;  3W2Z A;  5J7E A;  3NOU C;  4CLC C;  1T1B A;  4OOL A;  4R6L A;  4ETZ A;  5HDD A;  3BY8 A;  3JVV A;  3LIB A;  4I3J A;  2V0U A;  4MN7 A;  5CX7 A;  5HD5 A;  4MN6 A;  4EET B;  3S7N A;  2HF6 A;  2J3T C;  3T4T A;  3OCL A;  3PBS A;  2DMW A;  2VX8 A;  2PYP A;  4BBV A;  2GZA A;  3CAX A;  4CLC E;  1V9Y A;  1MC0 A;  3P01 A;  4LPZ A;  2XA7 M;  4HJ4 A;  5AVF A;  2GX5 A;  3IS2 A;  2W3F A;  4HQA A;  1S1Z A;  3B33 A;  4KUO A;  2O9B A;  1TF1 A;  3T4S A;  1DP8 A;  3EGX C;  4F3L A;  2XSS A;  3EQU A;  4NKP A;  1OJG A;  3S7Q A;  2R78 A;  2M7U A;  5G4Z A;  4QPR A;  3E0Y A;  4CLC B;  3FC7 A;  4UQI S;  3LID A;  2GNX A;  3F1O A;  2A24 B;  2PD7 A;  2Y79 A;  5IU1 A;  1H3Q A;  1S4S A;  4ZRR A;  1DP9 A;  4R3A A;  2W1R A;  2VZW A;  1LT0 A;  5HD3 A;  3OCN A;  4PAU A;  5HDC A;  3H9W A;  3BW6 A;  2W3D A;  3F1P B;  2VKS A;  4EQ1 A;  3K2N A;  4II7 A;  3UB6 A;  2KOI A;  2L1M A;  3KSF A;  3LFV A;  2GJ3 A;  4I5S A;  2BAS A;  3VE3 A;  4NXB A;  3ZYT A;  3UB7 A;  4Q0H A;  3K3C A;  1LSV A;  1YAX A;  4HP4 A;  1OJ5 A;  1OTA A;  2G7U A;  5I5L A;  2D01 A;  3RTY A;  3KO6 A;  2XA7 S;  2HJE A;  4YNR A;  3U2A A;  3PBT A;  3KYZ A;  3OBF A;  2VEA A;  5HWT A;  2Z6C A;  2QWS A;  1T19 A;  4B9O A;  5LBR A;  4K08 A;  2LB9 A;  4IUK A;  4CLC D;  2L0W A;  5TBM B;  2HGV A;  3RFB A;  1OTD A;  3E4P A;  4EXO A;  1VB6 A;  3B42 A;  1YKD A;  3VV4 A;  5DJU A;  2KLI A;  2V1B A;  1D7E A;  3LR4 A;  4ME4 A;  2J3T D;  2W3G A;  3FPV A;  2IA2 A;  3OOV A;  3RH8 B;  1T1C A;  2A24 A;  3K3D A;  4GHI B;  3A0S A;  2PT7 A;  1G28 A;  3T4J A;  5F6A A;  2M7V A;  1T1A A;  4I38 A;  2JKT I;  4EEP A;  1F9I A;  3NOT C;  3EQV A;  5AJG A;  1UGU A;  2V1A A;  3PXP A;  3MXQ A;  3VOL A;  3E4O A;  4HOI A;  3LR3 A;  2VGL M;  2W1T B;  1S4R A;  5J3W A;  4H6J B;  3S7O A;  4UEY A;  1LL8 A;  4HY8 A;  5F68 A;  2JKR M;  1W63 M;  5HPI A;  3FPW A;  1VHM A;  2ZOH A;  4OOM A;  4O01 A;  3KYQ A;  2JHE A;  5HPF A;  2Y8H A;  4PKY A;  4L0L A;  3LYX A;  2PR5 A;  3R7W B;  3EEA A;  3EOI A;  1OTB A;  2PD8 A;  1YSQ A;  4IJG A;  4Q0J A;  2WKQ A;  2QHK A;  5TBM A;  4HH3 A;  3PBN A;  1TS7 A;  4NXF A;  4BMW A;  2FZ0 A;  4L9F A;  1LSX A;  3H7W B;  3IBR A;  1S66 L;  4ARZ A;  3EGD C;  3H82 B;  1UWP X;  2VV7 A;  4GHI A;  3T50 A;  1F5M A;  1XJ6 A;  3BWL A;  5HDS A;  5K5B A;  1STZ A;  2NUP C;  2K7S A;  3MR0 A;  1ZHH B;  1IFQ A;  2H28 A;  4WN5 A;  2VGL S;  4WEJ A;  2YKF A;  2KDK A;  3C30 A;  3D72 A;  3C38 A;  1OT9 A;  3LR5 A;  2HV1 A;  1DP6 A;  2CMN A;  2W1T A;  5HZH A;  1NLY A;  3O5Y A;  4H6J A;  3KSI A;  2B02 A;  4GLQ A;  3PR6 A;  4KUK A;  4DJ3 A;  1KOU A;  1N9N A;  3MQO A;  3ULF A;  2W3H A;  4EEU A;  2W27 A;  1UWN X;  3DBA A;  1OT6 A;  2QJ5 A;  4IUH A;  3R7W A;  4G3K A;  3UE3 A;  2KX6 A;  4LLO B;  3HCY A;  5KIZ A;  4I39 A;  2ZMF A;  5HWV A;  4BJP A;  4L9G A;  3R4K A;  3PBR A;  4NXE A;  3UMD A;  1P0Z A;  2FH5 A;  3B47 A;  2VJW A;  2ZBB A;  4HNB A;  3T4O A;  1DRM A;  1XFN A;  3H7W A;  3PBQ A;  4EW7 A;  4LRY C;  2OAP 1;  2P08 A;  3OC2 A;  4JGO A;  5F5Y A;  1MZU A;  3PHY A;  5G4Y A;  4PKY G;  3CLO A;  2OOL A;  1TS0 A;  3BJN A;  2NUT C;  3D3O A;  3E98 A;  4CLC A;  1GSX A;  3TJZ C;  3MQ0 A;  2QJ7 A;  4DJ2 A;  1GSV A;  4MN5 A;  4Q0I A;  1XJ2 A;  2ZMV A;  4Y5F A;  4R70 A;  3C2W A;  2M1C A;  3E4Q A;  1MKM A;  1P9W A;  2JKR I;  3LI9 A;  5KSH A;  1GSW A;  2YKH A;  1TS6 A;  3OLO A;  2XRN A;  5FL3 A;  2ZOI A;  4BWI A;  3F1P A;  5A8B A;  2P04 A;  4O0P A;  4G3V A;  3CUE C;  5IT5 A;  4WEL A;  4HI4 A;  1ZTU A;  5AVE A;  4Y2F A;  3CI6 A;  3UE6 A;  1ODV A;  4KQD A;  3F1N B;  4BBU A;  4EU0 A;  2B18 A;  3LIE A;  3HJK A;  4MCW A;  4HH2 A;  3T4Q A;  5HWW A;  2O9A A;  2L4R A;  4PHT A;  4G3W A;  1NLZ A;  3VE4 A;  3UB8 A;  4WUJ A;  3T4K A;  1S1Y A;  3F1O B;  5J4E A;  4MDZ A;  4WL9 A;  3LUQ A;  4GS9 B;  3GEC A;  3TE8 A;  1G6O A;  2PYR A;  4I3A A;  3TRC A;  5DJT A;  4FSF A;  2A2L A;  4YOF A;  2EA9 A;  3T4L A;  3LIC A;  2K31 A;  3C8C A;  4HIA A;  4B93 A;  3UME A;  2XRO A;  3HJI A;  2V9A A;  2QKP A;  4E04 A;  4L9E A;  4WF0 A;  1P9R A;  4NEE D;  1OPX A;  4GCZ A;  4P6Z M;  2VLG A;  5DF9 A;  4LRZ E;  3P7N A;  5TJJ A;  4EER A;  1T18 A;  3PYP A;  3PBO A;  2LB5 A;  3ZQ5 A;  5DFY A;  1WA9 A;  1N9L A;  5DKL A;  5HSQ A;  3F1N A;  3LI8 A;  4GJ4 A;  4Y3I A;  3MJQ A;  2W3E A;  3CIT A;  4CQH A;  2OWJ A;  1XJ4 A;  2WKP A;  4HJ6 A;  3A0V A;  1LSW A;  4HJ3 A;  4M4X A;  4RQ9 A;  1XJ3 A;  1BYW A;  2V0W A;  4YWZ A;  5IS1 A;  2MJ6 A;  1JNU A;  2OAQ 1;  2OWH A;  5F69 A;  4GS9 A;  3JVU A;  3BY9 A;  3NOP C;  3S7P A;  4DN0 A;  4FOF A;  1X0O A;  4R38 A;  1D06 A;  5DFX A;  1YSP A;  3CUE A;  4P6Z S;  1EW0 A;  4WLA A;  1NWZ A;  2Z6D A;  3TW8 A;  2EWW A;  5DKK A;  3H82 A;  2D02 A;  2VV8 A;  4BBT A;  2I9V A;  1NRJ A;  1W63 Q;  2J3W A;  4AFI A;  4GW9 A;  2W0N A;  4XT2 B;  3IBJ A;  1H8M A;  1Y28 A;  1TS8 A;  3FG8 A;  2P7J A;  4JGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...