3K3DA

The n-terminal pas domain crystal structure of rv1364c from mycobacterium tuberculosis at 2.3 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
127
Chain Sequence
MDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Rv1364c/MT1410
publication title The N-Terminal Pas Domain Crystal Structure of Rv1364C from Mycobacterium Tuberculosis at 2.3 Angstrom.
rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 32
structure length 127
sequence length 134
ec nomenclature
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3k3dA00
3LIFA 1S4RA 2H28A 3VE4A 1OJ5A 4HP4A 3HJKA 1GSXA 3F1NA 2L4RA 4LPZA 2A24A 1P97A 3LI9A 5A8BA 2QHKA 4I3IA 3K3CA 3LIAA 1DP9A 2PHYA 3NHQA 5IS1A 3MFXA 1OTAA 1S67L 5F6AA 5HWVA 4B9OA 2V1BA 1V9ZA 3BWLA 1OTDA 5DJTA 3UMEA 4I5SA 2PD8A 4WUJA 2R78A 5DKKA 1N9OA 2M1CA 2PDRA 2W27A 1XJ4A 4JGQA 3LIBA 4HJ6A 4EETB 2V1AA 4BBVA 4LLOB 3SW1A 1VB6A 3EEHA 2INWA 5G4YA 2L0WA 3F1PA 2W0NA 4JGOA 2D01A 4K08A 4EXOA 3KX0X 2QKPA 5I5LA 3LUQA 4MN5A 1OTEA 3UB9A 1XJ2A 3CAXA 5G4ZA 1LSWA 1T1BA 4KUKA 5J4EA 1XJ3A 4XT2B 4GCZA 1DP6A 3B33A 3LI8A 3LIDA 4L9FA 3HJIA 3D72A 2YKHA 4R3AA 1OTIA 2EA9A 5AVFA 3LICA 1P0ZA 1F98A 2ZOIA 4HHDA 2WKRA 3OLOA 3H7WA 1D06A 2KDKA 3FG8A 4HH2A 3CLOA 3F1OA 3A0VA 4M4XA 5F5YA 1Y28A 1N9LA 4HH3A 3PHYA 3RH8B 1DP8A 1T19A 3VOLA 1MZUA 3FC7A 4NXFA 2VV7A 4HJ3A 5EFWA 2OOLA 5HDDA 4EERA 1DRMA 3UB8A 4GHIB 4GS9B 4H6JA 1JNUA 1BYWA 3MXQA 4PKYA 3LYXA 3H82A 2GJ3A 4LRXC 1KOUA 2PR5A 4WN5A 3A0RA 5HDSA 4HJ4A 1UGUA 4WF0A 4EEUA 1XJ6A 5IU1A 4WL9A 2V9AA 2V0WA 4LRZE 3IS2B 2D02A 4HI4A 2J80A 3MR0A 3UMDA 4JGPA 1UWPX 4EQ1A 3CWFA 1TS8A 2QJ5A 3RTYA 1EW0A 3MQQA 4L9EA 3MJQA 3C2WA 1V9YA 4I3AA 4NXEA 2JHEA 5HWTA 5TBMA 1WA9A 4HY8A 1LSXA 3VE3A 3F1NB 1OT6A 4MN6A 1T1AA 2A24B 4H6JB 2BASA 2PR6A 5AVEA 5HZHA 4NXGA 1GSVA 3A0SA 4I39A 2JN7A 2ZBBA 4F3LA 2KX6A 2V0UA 2PYPA 3BY8A 4BBUA 5F69A 5HSQA 5DJUA 3G6OA 2VEAA 3NOTC 1LT0A 2VV8A 3EWKA 2CMNA 2P7JA 3C8CA 3ICYA 2OWHA 3GECA 2WKPA 5F68A 1N9NA 1NWZA 4LRYC 2YKFA 1OT9A 4RQ9A 4KQDA 1S1YA 4EESA 2Z6CA 2VLGA 3F1PB 1OTBA 3LIEA 1UWNX 3IBRA 5DKLA 3T50A 5TBMB 3GDIA 3K3DA 3PYPA 4GW9A 4R38A 1G28A 1TS6A 1XFQA 4NXBA 4XT2A 4JGRA 4L9GA 2PYRA 4R6LA 4HP9A 4HQAA 4F3LB 2VV6A 5HD5A 2Z6DA 1GSWA 3H7WB 1F9IA 4HOIA 4DJ3A 3NJAA 1S66L 3F1OB 4PKYG 4HNBA 2OWJA 1XFNA 3E4PA 1T18A 4EW7A 2ZOHA 2B02A 3ZQ5A 1TS0A 2PD7A 4E04A 4GHIA 4GS9A 1X0OA 2QWSA 2K7SA 5J7EA 3ULFA 3MQOA 5HD3A 3H82B 4DJ2A 1T1CA 4HIAA 1TS7A 3NOPC 2QJ7A 3IS2A 3E4QA 4I38A 4BBTA 2HV1A 3H9WA 3UB6A 4WLAA 4EEPA 3P7NA 5KIZA 1LSVA 1OJGA 1S4SA 3UB7A 3BY9A 2I9VA 3UE6A 5J3WA 1LL8A 4YWZA 4I3JA 4R70A 5HDCA 1S1ZA 4KUOA 2L1MA 1ODVA 2WKQA 5HWWA 3NOUC 3E4OA 1D7EA
chains in the Genus database with same CATH superfamily
1XA7A 3VV4A 2AVXA 3JPUA 4S2IA 2R9WA 3G2ZA 1ESUA 2Y2NA 4NG2A 2L4RA 2VGLS 1YQSA 1PRQA 5FI2A 1I2SA 3HUNA 5TR7A 3LI9A 1U60A 4D2OA 2HDQA 2RCXA 1KDWA 5FAPA 4Y7PA 2PU2A 5M18A 2CC1A 1K57A 2ZC7A 3QP2A 5IT5A 2NUTC 3VP1A 2DMWA 2V8FA 3LR3A 1RCJA 3BQAA 1OTAA 1VEUB 1S67L 1STZA 5HWVA 2Y4AA 1E3UD 1KVMA 2PAVP 3BWLA 5CERA 4FCFA 2P74A 2R78A 5DKKA 1ERQA 4FD8A 2PDRA 1HD8A 2ZM2A 1XJ4A 2FH5A 4JGQA 3S7PA 4Q0IA 2V8CA 2KLIA 4ZAMA 3ITAA 1JVJA 1JWZA 3M6HA 5EVIC 4X68A 2L0WA 2W0NA 4JGOA 3ZG8B 3HBRA 2D01A 3ZHHA 1H8YA 1TVFA 3GV9A 4A5RA 3LUQA 1F5MA 1OTEA 5DTKA 5JYPA 1ES4A 3Q7ZA 2MJ6A 1T1BA 2P04A 4JXVA 4KUKA 2DNSA 5GLBA 5IHVA 3QP5A 3V5MA 5K5BA 4ZTKA 2PBYA 2H5SA 2Y2PA 4L9FA 1OTIA 3IHBA 1YLZA 2GDNA 1W7FA 3DTKA 1XPBA 5C5KA 1L3LA 4IVKA 4P6ZS 3IXGA 3QP8A 4G3WA 3IXHA 3CLOA 2ZC3B 3A0VA 3CJMA 3WS0A 3JVVA 5JYOA 5KZHA 4X69A 1DP8A 1T19A 4GZBA 3FC7A 4NXFA 2VV7A 4HJ3A 4N9KA 2ZL1A 4OONA 5EFWA 4EERA 1DRMA 3ZNYA 4GHIB 4UA9A 2Y2OA 1TDGA 2BG1A 4MN7A 4ZJ3A 3LEQA 3H82A 2GJ3A 4LRXC 1KOUA 2PR5A 4NEED 4KQQA 1XJ6A 4CPKA 3A3FA 2OAQ1 1LI9A 3M6BA 3T4TA 3UDFA 4L0LA 1AWIA 5EVIB 2J80A 3S4XA 5GHXA 3UDIA 4UA7A 1NRJA 2VGJA 4PM8A 3MR0A 5E2FA 2E8IA 4YOFA 4JXWA 4XUZA 4ME4A 3UMDA 1NZOA 2Q9NA 1GHMA 2PT7A 1NRFA 3T4LA 2XA7M 5DF7A 3N8LA 5F82A 2HDSA 4CQHA 1IYOA 2W3EA 4QHCA 2QJ5A 2QPNA 3RTYA 2Z2LB 1NLYA 3LR5A 5AQBA 4L9EA 5M1AA 1V9YA 2H0TA 3FPVA 1ONGA 1E4DA 4DMZA 1FIKA 4I3AA 1IFQA 2EX8A 5HWTA 5EUAA 1CQAA 4WBGA 3VE3A 4IHQA 4IBRA 4S2LA 1FR1A 2XK1A 2BASA 5D3OA 5FDHA 3KSGA 4F94A 3LCEA 2BLSA 2PR6A 5AVEA 2XD5A 4E6WA 2XROA 5L09A 2XH9A 3QP4A 5I94A 3RFBA 4CLCC 4YINA 3VP3A 2XSSA 4ZJ1A 2PYPA 2OSUA 1FILA 2A2LA 3BY8A 1VEUA 3DTIA 2WK0A 3NY4A 3NBLA 1FSYA 4QD4A 1GCEA 2WGVA 1IKIA 4R0QA 1ESIA 5FA7A 5KSCA 1LI0A 3GECA 3NCKA 4UQIM 1N9NA 4MLLA 4OPYA 1OT9A 4Z9QA 1Y54A 1H3QA 3BEBA 1OTBA 4Y0OA 3EOIA 4KG6A 2EFUA 1KE4A 1C3BA 3OC2A 1CF0A 1VETB 4KQRA 3IF5A 1MC0A 4IBXA 2J3TD 1TS6A 3DWKA 1H8ZA 2FFFB 4N92A 2XEPA 4LCMA 2PYRA 4HBTA 3GRJA 4UAAA 4DE2A 1MPLA 5HD5A 2X01A 4IUKA 1IKGA 3EGXC 2ZC4B 3OPPA 1F9IA 4HOIA 4Y2FA 2O99A 3NJAA 4BMWA 3F1OB 4PKYG 3OZHA 3K2NA 4PHTA 4CLCB 3ISGA 2JBFA 4LV0A 4H8RA 1P9WA 4EW7A 5EPHA 5DFYA 2Y8HA 4QY5A 3OPHA 1N9BA 4GHIA 5HW3A 2QWSA 3CPTB 2K7SA 5CX7A 5L8MA 3IF6C 2B5RA 5DF9A 4JKTA 2VJWA 2Y59A 3NOPC 1YMXA 1M6KA 3VSLA 3ZG0A 3SH9A 2OLVA 4I38A 5EVIA 2EWVA 1PI5A 2HV1A 5FQJA 3V3RA 2ZQ7A 4IEDA 1P9RA 5AQ9A 3P7NA 4FH2A 4E3KA 5AQAA 1OJGA 1S4SA 2WUQA 3MZEA 2V2FF 3BY9A 3Q7VB 4Q8IA 3PBSA 4LV3A 4FTXA 1CJFA 3KYZA 3OPLA 3WS5A 2ZM0A 3VFHA 1ODVA 5HWWA 5EVLA 4GDNA 4OLGA 3DW0A 4GN2A 3WS1A 1YKDA 5EM1A 3U4LP 3KSFA 2W1TB 3VE4A 1Z6FA 5CHUA 3IWIA 3CI6A 2O0YA 3UPNA 3C7UA 4KZ7A 4B4XA 4LCLA 3EQVA 1TDLA 4X1MA 1P97A 5F1GA 1YLPA 2WAFA 4QPRA 5G18A 4I3IA 4II7A 3TG9A 4BWIA 4S2OA 3P98A 1RGZA 1HVBA 1EROA 4E3IA 3UO9A 3A3IA 5FL3A 5A92A 2PHYA 4UA6A 1FCNA 3MFXA 3G32A 4ZBEA 4BD1A 3MZDA 1QMFA 2V1BA 4GNUA 1V9ZA 5DJTA 3T1RA 4R23A 4HEFA 2PD8A 2W27A 5KSHA 2QYBA 5EE8A 3M2KA 3U2AA 3LIBA 3HLDA 2V1AA 4EETB 3DWZA 4R3JA 1IYSA 2B95A 4LLOB 3SW1A 4PPRA 4EU0A 3EEHA 2R9XA 5G4YA 2HDUA 2NUPC 4EBPA 3IH8A 5HPFA 1I2WA 4WZ5C 4GD8A 4EXOA 1KE3A 3KX0X 3PBRA 2QKPA 4XUXA 4NETA 3UPPA 4Y0TA 3N4IA 1VETA 4MN5A 2ZMFA 1GA0A 3UB9A 4LFUA 5G4ZA 3D3OA 3O87A 3D4FA 2J9PA 1XJ3A 4X25A 4WYYA 1DP6A 3B33A 3N7WA 3LI8A 3D72A 2YKHA 2Y2JA 2EA9A 2HP5A 3S7QA 4DDYA 4DF6A 4OOLA 4X56A 1F98A 1DJBA 2V20A 2WKRA 4EV4A 3MS6A 4BD0A 5A90A 5FEGA 2XGNA 4EQIA 4Y15A 1SZVA 1ZC2A 3F1OA 3VMAA 2Q9MA 1Y28A 1N9LA 4CLCA 3RH8B 3BLSA 5CTMA 1MZUA 5KMWA 2A49A 2C6WB 2FZ0A 4X1LA 4PMAA 3UB8A 5AJGA 1KGEA 3T4QA 3PR6A 3B47A 4GS9B 4H6JA 3CPTA 4Q0HA 1JNUA 1BYWA 3V67A 4PKYA 1TF1A 3T4OA 2O9AA 4WN5A 3A0RA 1H5XA 1XGIA 3W4OA 2VGLM 5A93A 3BFEA 5IU1A 1LLBA 5E2HA 2V9AA 2XF3A 4JPMA 3BECA 3SS3A 1K56D 2D02A 1BT5A 2Y2HA 4OQGA 2PU4A 4WZ4A 1EI5A 3Q7VA 2KOIA 3MBZA 2WGWB 1G6AA 3ZNTA 3FKWA 1YAXA 3C4PA 3G2YA 4EQ1A 4KZ4A 1NZUA 3SS4A 3LR0A 4KZBA 3LY3A 2VA0A 2W1TA 2WKHA 5EVEA 3ZVWA 5TBMA 1SDNA 1WA9A 4HY8A 4WMCA 4PM9A 2O9CA 3DTEA 4MCWA 3F1NB 4E3NA 1K4EA 1OT6A 2VK3A 2HJEA 1T1AA 3SH7A 4EWFA 2A24B 1N4OA 3DBAA 2J3WA 5HZHA 4NXGA 5TJJA 1GSVA 5EOOA 2HP9A 4I39A 1PNEA 2ZQ9A 2JN7A 2ZJ9A 4F3LA 1GHPA 1MWUA 3R7WB 2ZMVA 2VGKA 5EOEA 4BBUA 4GJ4A 4X53A 5DJUA 3QHYA 4U3TA 3IF6A 3S22A 3OPRA 1L0FA 3UE1A 4S2JA 2HJ9C 5E43A 2FFYA 1LT0A 3Q82A 2Y2GA 2O9BA 3VP2A 4NK3A 3A3EA 2CMNA 2P7JA 4KZ3A 2Y91A 4B4ZA 3FV7A 3UE3A 2OWHA 3GTCA 2OLUA 4P0MA 3HREA 1HLUP 2EWWA 4P6ZM 4FSFA 5F68A 1NWZA 2YKFA 4WMCD 3TSGA 1S1YA 1SHVA 2VLGA 2LB9A 1XKZA 3LIEA 1K6SA 4OP5A 3IX3A 3T50A 5DKLA 5FQKA 2E8JA 3GDIA 3C5AA 5HAQA 2IA2A 5TGFA 4GW9A 1XGJA 4R38A 4S2PA 1XFQA 2XLNA 3IXBA 3SS5A 4JGRA 1K6RA 3BFGA 4L9GA 4JXSA 4O8GA 4P87A 3C4OA 4R6LA 3HUOA 3IHAA 4HQAA 3AGEA 2Y79A 4EUZA 5CEDA 2GX5A 1LHYA 2Z6DA 3NIAA 5FI7A 4FOFA 1GSWA 3H7WB 4KENB 3BM6A 5GL9A 5L10A 1CI8A 1E25A 1A0KA 3IT9A 3MXRA 3I7JA 1LL9A 1VM1A 1XFNA 1ES2A 2H0YA 1FCMA 3KYEA 4OOYA 3ZQ5A 3BJNA 4GS9A 1QMEA 4OP8A 3E0YA 3ULFA 1Q2PA 1YLTA 3MKEA 3G4PA 5CTNA 3ITBA 4R1GA 5HD3A 4KZ6A 3IXDA 2HGVA 4IVIA 4BLMA 1MXOA 4K0XA 3A3DA 5FDSA 1L0DA 1DY6A 4Y13A 3T12B 2HP6A 3ZG9B 4WLAA 4EEPA 4WZ5A 1LSVA 3M2JA 3UE6A 4I3JA 1TD5A 5CHMA 3KO6A 3MMHA 3O88A 3GSGA 2WKQA 1W8QA 5HPIA 4B88A 2Y2KA 4FUWA 5TFQA 3PAEA 2J8YA 3LIFA 3E98A 2H28A 4PAUA 2ZQ8A 1OJ5A 3D9YA 3PBNA 3BW6A 5E2GA 2WKEA 2JKTM 2ZC5B 4B93A 1GSXA 1K55C 3F1NA 3N6IA 2P9VB 4LPZA 3V50A 2X02A 2A24A 5HAIA 2OV5A 4ZDXA 1SKOB 5A8BA 3UB5P 1W63M 4YNRA 3BFFA 3LFVA 3BQ8A 2JKRM 3R7WA 2UWXA 4G3VA 3NHQA 2WZXA 4OPZA 3P09A 3S1YA 3OCNA 5A91A 5DTTA 3L7HA 5F6AA 4R3BA 1OTDA 1MWSA 3T1XA 1XP4A 4I5SA 1GA9A 5FQ9A 4WUJA 2K31A 1N9OA 2Y2MA 4NKPA 3EQUA 2M7VA 3O86A 3A3JA 2ZD8A 3E2LA 4N9LA 2WADA 3FPWA 4BBVA 3HLWA 1ES3A 1VB6A 1F2KA 5E2EA 1YLYA 2XFTA 4OQHA 4DXCA 1DJCA 4X6TA 5MC7A 2XQZA 1FOFA 2H10A 1PIOA 3LY4A 1XJ2A 3VP0A 4ARZB 2Y2IA 1LSWA 4QWOA 4U0XA 5J4EA 3VFFA 2A3UA 4XT2B 4UHUA 1O7EA 2EX6A 1YT4A 1RP5A 1SKFA 1W63Q 5AVFA 2JKGA 2WGIA 1ACFA 3Q07A 3LICA 1VQQA 2RL3A 4E3MA 2XRNA 1WE4A 4MEZA 4BL2A 3OLOA 1J9MA 5DTSA 3H7WA 4ETZA 2XD1A 1D06A 4MNRA 2WZZA 3FG8A 4HH2A 4C6YA 4M4XA 1ZKJA 1XXMA 3VOZA 3S7NA 1FR6A 3VOLA 1NLZA 3RXXA 2OOLA 5HDDA 1KGFA 1FCOA 3MQ0A 5FASA 4R4SA 3HL9A 3NECA 3MXQA 1H0MA 1ES5A 5GHZA 5CHJA 2HZ5A 5EVID 4HESA 1K54C 4HJ4A 1UGUA 3R4KA 1BSGA 4S2NC 4WL9A 4DE0A 2V0WA 3CHWP 5EV0A 2PBDP 3SOIA 4HI4A 3EEAA 2UV0E 4BL3A 3HLEA 1DJAA 3B42A 4GDBA 3G31A 5HFOA 1D1JA 5BOHA 1RGYA 4JGPA 2EXBA 5HL6A 2LB5A 3CWFA 5FI6A 3WRZA 4QY6A 4OQIA 5FQQA 5GLCA 5CECA 3MF0A 3UPOA 5FSRA 4KZ8A 2EX2A 5F83A 1LSXA 5HL1A 1M40A 2P9VA 4PM5A 2JC7A 4MN6A 4WEJA 1PI4A 2G2UA 1SKOA 3KSHA 4DDSA 4Q0JA 3A0SA 1PW8A 1JTGA 2ZBBA 3BRMA 3BFDA 2V0UA 3CUEC 1L0EA 1PWCA 3QP6A 5F69A 5HSQA 4RX2A 4Y0UA 3T4SA 3IQAA 4JLFA 4GKUA 2GZAA 2J7VA 1ALQA 1BUEA 1PWDA 4N1XA 3C8CA 3JVUA 3BYDA 1YLJA 3W2ZA 1BULA 3VSKA 4P85A 4LRYC 4OKPA 1BLCA 2WKIA 2QZ6A 4RQ9A 4WEKA 3F1PB 4E6XA 3IWQA 4JF6A 3JYIA 4RA7A 1IELA 4FH4A 3GQZA 2K2NA 4K0WA 2Q0OA 3WWXA 3HLCA 3K3DA 3V39A 3QNBA 4ARZA 3ZFZA 3B3XA 2P08A 1KGGA 4LV2A 2EX9A 3KYQA 4DN0A 4XT2A 4OPRA 4DRTA 1K55A 2ZQDA 1ZHHB 1YLWA 5CGWA 1MBLA 3N8SA 3L9KA 2JCHA 1L2SA 4CLCD 3G34A 4MBFA 3UE0A 3FWLA 4JF4A 5EECA 4DJ3A 1G6OA 1S66L 3LEZA 1FQGA 4E3LA 2BTFP 1K38A 1Z09A 3HUMA 4GLQA 1K0KA 1CEGA 2OWJA 4X55A 4AFIA 3E4PA 1T18A 3AGDA 4K91A 4HBUA 1KE0A 1PFLA 2PD7A 5F1FA 4E04A 2JKFA 1X0OA 1OPXA 2HF6A 4BQMA 3N8RA 3UY6A 4DJ2A 4OOMA 2ZM8A 1I5QA 3W4PA 1T1CA 2W3GA 3FKVA 1TS7A 4P6BA 1MWRA 2QJ7A 4R4RA 4DKIA 1W8YA 3E4QA 4BBTA 2WYXA 5GLDA 3H9WA 3QNCA 3UB6A 1YSPA 2DCFA 4ZJ2A 5KIZA 4WM9A 3G35A 2I9VA 5FQMA 4LENA 3C38A 3ZG7B 1S1ZA 1IYPA 1FSWA 4MDZA 2J9OA 3CG5A 1NYMA 2JKTI 1S4RA 2I72A 1MY8A 3E2KA 3T1SA 3IH9A 3GR2A 1BTLA 4HP4A 3UNWA 3MKFA 3W4QA 3T4JA 3HJKA 4S2MA 2VZWA 2OAP1 1IOUA 5CGXA 4RX3A 4M3KA 3NDGA 3C30A 4U0TA 5LBRA 1CEFA 3SZTA 4CJNA 2JKRI 5J8XA 2QHKA 4KG2A 1H8MA 3P01A 4Y5FA 1MWTA 2XR0A 3K3CA 3MXSA 4GB7A 3LIAA 3UN7A 2V1ZA 1DP9A 3CITA 3ZG5A 4MBKA 5IS1A 2XA7S 1IYQA 3TE8A 4B9OA 1HTZA 2W1RA 4O0PA 2HPBA 3UMEA 1TEMA 2ZQCA 4Y17A 1K54A 2M1CA 5FAQA 3UDXA 4KZ5A 3IX8A 2XFSA 3ZCZA 4S2NA 2ACGA 2PRFA 4HJ6A 4OPQA 4CLCE 4PM7A 1PW1A 3RXWA 4OVDA 1JWPA 4BJPA 4LV1A 4EBNA 1MKMA 2INWA 4C75A 3F1PA 3WS2A 1K25A 4K08A 2ZC6B 4GOGA 4ESPA 3S7OA 5I5LA 3CAXA 1LL5A 1YSQA 3PTEA 1PYYA 3FYZA 1BLHA 3MFDA 3T4KA 2G7UA 3T1QB 5CXWA 2B18A 4GCZA 5HARA 1JWVA 4N1HA 3MSHA 4BENA 3LIDA 2WAEA 3HJIA 2WGWA 4R3AA 3ZYTA 2IWBA 1P0ZA 4QB8A 2ZOIA 4HHDA 1BLPA 2Y2QA 4UQIS 2KDKA 3OOVA 4XXRA 5U47A 5F5YA 3Q1FA 4GD6A 4HH3A 3PHYA 3TOIA 3CUEA 3TJZC 1CK3A 3HCYA 4WELA 1YM1A 3GMWA 1K57C 4QJGA 1XA1A 4QU3A 2GNXA 3VP4A 3BLMA 4E3OA 4OLDA 1SCWA 3ZDJA 4C3QA 1HZOA 2ZMAA 4ZRRA 3PBQA 1AXBA 3ZVTA 3LYXA 4Z1WA 1ZG4A 3CZDA 1CI9A 5HDSA 3PAGA 4WF0A 4EEUA 5HAPA 4D60A 3KSIA 4UEYA 3IWOA 1PZPA 3OBFA 5FAOA 4S2KA 3O5YA 3SH8A 1L0GA 4LRZE 3IS2B 1Y4OA 1BLSA 4MBHA 4DE1A 4MMNA 3VOYA 2DRWA 4KQOA 1NJ4A 3HVFA 2Z2MB 1UWPX 1PWGA 1ZG6A 1TS8A 3BFCA 1EW0A 3MQQA 2ZLYA 5FATA 2XDMA 3EGDC 3MJQA 3C2WA 5CEBA 4KG5A 1PZOA 4OQ0A 3TW8A 4NXEA 2JHEA 4O01A 2JE5A 3IX4A 4IUHA 3W8KA 4KZAA 4IJGA 4H6JB 4DXBA 1S6RA 5M19A 1W79A 4YFMA 1WYCA 1EWZA 2IWCA 3ZGAB 3MZFA 2KX6A 3LR4A 2EFXA 3FZCA 3DTMA 3O3VA 1NY0A 1YMSA 1G68A 2VX8A 2HDRA 5DFXA 1J3WA 2X71A 4RVAA 3G6OA 2VEAA 4JBFA 1SDEA 3HLBA 3NOTC 2IWDA 4OH0A 2VV8A 3EWKA 3HLGA 3ICYA 1MKIA 3WRTA 5AQ7A 3RJUA 1W5DA 3NC8A 4JF5A 2WKPA 5HX9A 2W3FA 4KZ9A 4ETXA 5DF8A 1YPRA 4KQDA 4EESA 2G2WA 2Z6CA 2Y2LA 2M7UA 1UWNX 3IBRA 4LGWA 5TBMB 3GVBA 4DE3A 3V3SA 5GHYA 5L07A 3PYPA 1ERMA 3IBJA 1G28A 4E3JA 5GLAA 4NXBA 5CRFA 4EBLA 4PM6A 3CMZA 1IEMA 4HP9A 5L2FA 4F3LB 5CGSA 1S0WA 2VV6A 4EUVA 4JXGA 3IF6B 1G5UA 1ZTUA 5FEFA 3NI9A 3Q81A 1K4FA 4HNBA 2ZL1B 2J3TC 2ZOHA 2B02A 1ONHA 2Y55A 2ZQAA 1TS0A 1Q2QA 3AGFA 1NXYA 1JTDA 1NYYA 5J7EA 3NDEA 2VKSA 1XX2A 1OMEA 1VHMA 3C7VA 3MQOA 3H82B 1O07A 1BZAA 2W3DA 3DAVA 4HIAA 2W3HA 1KDSA 3LO7A 2EXAA 3IS2A 4ID4A 3HLFA 4O7DA 3PBTA 1KVLA 2QMIA 4RYEA 4G3KA 3PBOA 3PXPA 1GHIA 3UB7A 3WS4A 3OCLA 3LGOA 1K56A 3G30A 4Y3IA 5J3WA 1LL8A 5FQIA 4YWZA 4R70A 1E3UA 2C5WB 5HDCA 5DVAA 3NULA 4KUOA 2L1MA 3TRCA 3NOUC 3E4OA 5EM0A 1D7EA 3QP1A 1WYBA
chains in the Genus database with same CATH topology
1YKDA 2JKTI 3LIFA 3VV4A 3E98A 1S4RA 2H28A 4PAUA 3KSFA 2W1TB 3VE4A 1OJ5A 3PBNA 4HP4A 3BW6A 3CI6A 2O0YA 2JKTM 3T4JA 3HJKA 4B93A 1GSXA 3F1NA 2L4RA 2VGLS 2OAP1 2VZWA 4LPZA 1IOUA 3EQVA 2A24A 1P97A 5LBRA 3C30A 3LI9A 5A8BA 4QPRA 2JKRI 2QHKA 4I3IA 1H8MA 4II7A 1W63M 3P01A 4BWIA 4Y5FA 4YNRA 3K3CA 3LFVA 3BQ8A 2JKRM 5FL3A 3LIAA 1DP9A 3R7WA 2PHYA 5IT5A 4G3VA 3NHQA 3CITA 2NUTC 5IS1A 2DMWA 3LR3A 3MFXA 3OCNA 2XA7S 3BQAA 1OTAA 1S67L 1STZA 5F6AA 3TE8A 5HWVA 4B9OA 2V1BA 2W1RA 1V9ZA 3BWLA 4O0PA 1OTDA 5DJTA 3UMEA 4I5SA 2PD8A 4WUJA 2R78A 5DKKA 2K31A 1N9OA 4NKPA 2M1CA 2PDRA 2W27A 3EQUA 2M7VA 5KSHA 2QYBA 1XJ4A 2FH5A 4JGQA 3U2AA 3LIBA 3S7PA 4HJ6A 4Q0IA 4EETB 2V1AA 3FPWA 2KLIA 4CLCE 4BBVA 4LLOB 3SW1A 1VB6A 4BJPA 4EU0A 3EEHA 1MKMA 2INWA 5G4YA 2L0WA 3F1PA 2NUPC 2W0NA 5HPFA 4JGOA 5MC7A 2D01A 4K08A 4EXOA 3PBRA 3KX0X 2QKPA 3S7OA 5I5LA 3LUQA 1F5MA 4MN5A 2ZMFA 1OTEA 3UB9A 1XJ2A 3CAXA 5G4ZA 1YSQA 3D3OA 4ARZB 1LSWA 2MJ6A 1T1BA 3T4KA 2P04A 2G7UA 4KUKA 5J4EA 1XJ3A 2B18A 4XT2B 4GCZA 1DP6A 3B33A 5K5BA 3LI8A 3LIDA 4L9FA 3HJIA 3D72A 2YKHA 4R3AA 1OTIA 2EA9A 1W63Q 5AVFA 3S7QA 3ZYTA 4OOLA 3LICA 1P0ZA 1F98A 2XRNA 2ZOIA 4HHDA 2WKRA 3OLOA 5C5KA 3H7WA 4UQIS 4ETZA 1D06A 2KDKA 3FG8A 3OOVA 4G3WA 4P6ZS 4HH2A 3CLOA 3F1OA 3A0VA 4M4XA 5F5YA 3JVVA 1Y28A 1N9LA 4CLCA 4HH3A 3PHYA 3RH8B 1DP8A 3S7NA 1T19A 3VOLA 1NLZA 1MZUA 3CUEA 3FC7A 3TJZC 4NXFA 2VV7A 4HJ3A 5EFWA 3HCYA 2OOLA 5HDDA 2FZ0A 4EERA 4WELA 1DRMA 3MQ0A 3UB8A 5AJGA 2GNXA 3T4QA 4GHIB 3PR6A 3B47A 4GS9B 4H6JA 4Q0HA 1JNUA 1BYWA 4ZRRA 3V67A 4MN7A 3MXQA 3PBQA 4PKYA 1TF1A 3LYXA 4Z1WA 3T4OA 2O9AA 2GJ3A 3H82A 4LRXC 1KOUA 2PR5A 4NEED 4WN5A 3A0RA 5HDSA 4HJ4A 1UGUA 2VGLM 4WF0A 4EEUA 1XJ6A 3KSIA 5IU1A 4UEYA 3R4KA 2OAQ1 4WL9A 3OBFA 2V9AA 2V0WA 3O5YA 3T4TA 4LRZE 3IS2B 2D02A 4L0LA 4HI4A 3EEAA 2J80A 4MMNA 1NRJA 3MR0A 4KQOA 4YOFA 3B42A 4ME4A 3UMDA 2KOIA 2PT7A 1YAXA 3T4LA 2XA7M 4JGPA 1UWPX 4EQ1A 5HL6A 2LB5A 3CWFA 4CQHA 1TS8A 2W3EA 3LR0A 2QJ5A 3RTYA 1EW0A 3MQQA 1NLYA 3LR5A 2VA0A 3MF0A 3EGDC 3MJQA 3C2WA 4L9EA 1V9YA 3FPVA 2W1TA 4DMZA 4I3AA 1IFQA 3TW8A 4NXEA 2JHEA 5HWTA 4O01A 5TBMA 1WA9A 4HY8A 1LSXA 4IUHA 2O9CA 5HPIA 4MCWA 3VE3A 3F1NB 4IHQA 1OT6A 2HJEA 4MN6A 1T1AA 4WEJA 2A24B 4H6JB 4IJGA 2BASA 3DBAA 3KSGA 2J3WA 3KSHA 4Q0JA 2PR6A 5AVEA 5HZHA 4NXGA 5TJJA 2XROA 1GSVA 3A0SA 4I39A 3RFBA 2JN7A 2ZBBA 4CLCC 4F3LA 2KX6A 2V0UA 3LR4A 2XSSA 3CUEC 2PYPA 3R7WB 2A2LA 2ZMVA 3BY8A 2VX8A 4BBUA 5F69A 5HSQA 4GJ4A 5DJUA 5DFXA 3T4SA 3G6OA 2VEAA 2GZAA 2HJ9C 3NOTC 1LT0A 2O9BA 2VV8A 3EWKA 2CMNA 3ICYA 2P7JA 3C8CA 3JVUA 3UE3A 2OWHA 3GECA 3W2ZA 4UQIM 2WKPA 2EWWA 2W3FA 4P6ZM 4ETXA 4FSFA 5F68A 1N9NA 1NWZA 4LRYC 2YKFA 1OT9A 4RQ9A 4WEKA 4KQDA 1S1YA 4EESA 2Z6CA 2M7UA 2VLGA 3F1PB 2LB9A 1H3QA 1OTBA 3LIEA 1UWNX 3IBRA 5DKLA 3T50A 3EOIA 5TBMB 3OC2A 2K2NA 3GDIA 3K3DA 2IA2A 4ARZA 3PYPA 4GW9A 1MC0A 2J3TD 4R38A 2P08A 1G28A 3IBJA 1TS6A 1XFQA 4NXBA 3KYQA 4DN0A 4XT2A 4JGRA 4L9GA 4O8GA 2PYRA 4R6LA 4HP9A 4HQAA 4F3LB 1ZHHB 2VV6A 5HD5A 2Y79A 4EUVA 2GX5A 4IUKA 4CLCD 2Z6DA 3EGXC 4FOFA 1GSWA 3H7WB 1F9IA 1ZTUA 4HOIA 4Y2FA 4DJ3A 2O99A 3NJAA 1G6OA 1S66L 4BMWA 3F1OB 4PKYG 3K2NA 4PHTA 4CLCB 4GLQA 4HNBA 2OWJA 1XFNA 4AFIA 3E4PA 1P9WA 1T18A 4EW7A 2J3TC 5DFYA 2Y8HA 2ZOHA 2B02A 3ZQ5A 3BJNA 1TS0A 2PD7A 4E04A 4GHIA 4GS9A 1X0OA 2QWSA 2K7SA 1OPXA 3E0YA 3ULFA 5J7EA 2HF6A 5CX7A 5L8MA 2VKSA 1VHMA 3MQOA 5HD3A 3H82B 4DJ2A 4OOMA 1T1CA 2W3GA 5DF9A 2W3DA 2HGVA 4HIAA 2W3HA 1TS7A 2VJWA 3NOPC 2QJ7A 3IS2A 3E4QA 4I38A 4BBTA 3PBTA 2EWVA 2HV1A 3H9WA 3UB6A 1YSPA 4WLAA 4EEPA 4G3KA 1P9RA 3P7NA 5KIZA 1LSVA 1OJGA 3PBOA 3PXPA 1S4SA 3UB7A 3OCLA 3BY9A 2I9VA 4Y3IA 3UE6A 5J3WA 1LL8A 4YWZA 3PBSA 4I3JA 3C38A 1TD5A 4R70A 3KO6A 5HDCA 3MMHA 3KYZA 1S1ZA 4KUOA 2L1MA 1ODVA 2WKQA 4MDZA 3TRCA 5HWWA 3NOUC 3E4OA 1D7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIF A;  1S4R A;  2H28 A;  3VE4 A;  1OJ5 A;  4HP4 A;  3HJK A;  1GSX A;  3F1N A;  2L4R A;  4LPZ A;  2A24 A;  1P97 A;  3LI9 A;  5A8B A;  2QHK A;  4I3I A;  3K3C A;  3LIA A;  1DP9 A;  2PHY A;  3NHQ A;  5IS1 A;  3MFX A;  1OTA A;  1S67 L;  5F6A A;  5HWV A;  4B9O A;  2V1B A;  1V9Z A;  3BWL A;  1OTD A;  5DJT A;  3UME A;  4I5S A;  2PD8 A;  4WUJ A;  2R78 A;  5DKK A;  1N9O A;  2M1C A;  2PDR A;  2W27 A;  1XJ4 A;  4JGQ A;  3LIB A;  4HJ6 A;  4EET B;  2V1A A;  4BBV A;  4LLO B;  3SW1 A;  1VB6 A;  3EEH A;  2INW A;  5G4Y A;  2L0W A;  3F1P A;  2W0N A;  4JGO A;  2D01 A;  4K08 A;  4EXO A;  3KX0 X;  2QKP A;  5I5L A;  3LUQ A;  4MN5 A;  1OTE A;  3UB9 A;  1XJ2 A;  3CAX A;  5G4Z A;  1LSW A;  1T1B A;  4KUK A;  5J4E A;  1XJ3 A;  4XT2 B;  4GCZ A;  1DP6 A;  3B33 A;  3LI8 A;  3LID A;  4L9F A;  3HJI A;  3D72 A;  2YKH A;  4R3A A;  1OTI A;  2EA9 A;  5AVF A;  3LIC A;  1P0Z A;  1F98 A;  2ZOI A;  4HHD A;  2WKR A;  3OLO A;  3H7W A;  1D06 A;  2KDK A;  3FG8 A;  4HH2 A;  3CLO A;  3F1O A;  3A0V A;  4M4X A;  5F5Y A;  1Y28 A;  1N9L A;  4HH3 A;  3PHY A;  3RH8 B;  1DP8 A;  1T19 A;  3VOL A;  1MZU A;  3FC7 A;  4NXF A;  2VV7 A;  4HJ3 A;  5EFW A;  2OOL A;  5HDD A;  4EER A;  1DRM A;  3UB8 A;  4GHI B;  4GS9 B;  4H6J A;  1JNU A;  1BYW A;  3MXQ A;  4PKY A;  3LYX A;  3H82 A;  2GJ3 A;  4LRX C;  1KOU A;  2PR5 A;  4WN5 A;  3A0R A;  5HDS A;  4HJ4 A;  1UGU A;  4WF0 A;  4EEU A;  1XJ6 A;  5IU1 A;  4WL9 A;  2V9A A;  2V0W A;  4LRZ E;  3IS2 B;  2D02 A;  4HI4 A;  2J80 A;  3MR0 A;  3UMD A;  4JGP A;  1UWP X;  4EQ1 A;  3CWF A;  1TS8 A;  2QJ5 A;  3RTY A;  1EW0 A;  3MQQ A;  4L9E A;  3MJQ A;  3C2W A;  1V9Y A;  4I3A A;  4NXE A;  2JHE A;  5HWT A;  5TBM A;  1WA9 A;  4HY8 A;  1LSX A;  3VE3 A;  3F1N B;  1OT6 A;  4MN6 A;  1T1A A;  2A24 B;  4H6J B;  2BAS A;  2PR6 A;  5AVE A;  5HZH A;  4NXG A;  1GSV A;  3A0S A;  4I39 A;  2JN7 A;  2ZBB A;  4F3L A;  2KX6 A;  2V0U A;  2PYP A;  3BY8 A;  4BBU A;  5F69 A;  5HSQ A;  5DJU A;  3G6O A;  2VEA A;  3NOT C;  1LT0 A;  2VV8 A;  3EWK A;  2CMN A;  2P7J A;  3C8C A;  3ICY A;  2OWH A;  3GEC A;  2WKP A;  5F68 A;  1N9N A;  1NWZ A;  4LRY C;  2YKF A;  1OT9 A;  4RQ9 A;  4KQD A;  1S1Y A;  4EES A;  2Z6C A;  2VLG A;  3F1P B;  1OTB A;  3LIE A;  1UWN X;  3IBR A;  5DKL A;  3T50 A;  5TBM B;  3GDI A;  3K3D A;  3PYP A;  4GW9 A;  4R38 A;  1G28 A;  1TS6 A;  1XFQ A;  4NXB A;  4XT2 A;  4JGR A;  4L9G A;  2PYR A;  4R6L A;  4HP9 A;  4HQA A;  4F3L B;  2VV6 A;  5HD5 A;  2Z6D A;  1GSW A;  3H7W B;  1F9I A;  4HOI A;  4DJ3 A;  3NJA A;  1S66 L;  3F1O B;  4PKY G;  4HNB A;  2OWJ A;  1XFN A;  3E4P A;  1T18 A;  4EW7 A;  2ZOH A;  2B02 A;  3ZQ5 A;  1TS0 A;  2PD7 A;  4E04 A;  4GHI A;  4GS9 A;  1X0O A;  2QWS A;  2K7S A;  5J7E A;  3ULF A;  3MQO A;  5HD3 A;  3H82 B;  4DJ2 A;  1T1C A;  4HIA A;  1TS7 A;  3NOP C;  2QJ7 A;  3IS2 A;  3E4Q A;  4I38 A;  4BBT A;  2HV1 A;  3H9W A;  3UB6 A;  4WLA A;  4EEP A;  3P7N A;  5KIZ A;  1LSV A;  1OJG A;  1S4S A;  3UB7 A;  3BY9 A;  2I9V A;  3UE6 A;  5J3W A;  1LL8 A;  4YWZ A;  4I3J A;  4R70 A;  5HDC A;  1S1Z A;  4KUO A;  2L1M A;  1ODV A;  2WKQ A;  5HWW A;  3NOU C;  3E4O A;  1D7E A; 
#chains in the Genus database with same CATH topology
 1XA7 A;  3VV4 A;  2AVX A;  3JPU A;  4S2I A;  2R9W A;  3G2Z A;  1ESU A;  2Y2N A;  4NG2 A;  2L4R A;  2VGL S;  1YQS A;  1PRQ A;  5FI2 A;  1I2S A;  3HUN A;  5TR7 A;  3LI9 A;  1U60 A;  4D2O A;  2HDQ A;  2RCX A;  1KDW A;  5FAP A;  4Y7P A;  2PU2 A;  5M18 A;  2CC1 A;  1K57 A;  2ZC7 A;  3QP2 A;  5IT5 A;  2NUT C;  3VP1 A;  2DMW A;  2V8F A;  3LR3 A;  1RCJ A;  3BQA A;  1OTA A;  1VEU B;  1S67 L;  1STZ A;  5HWV A;  2Y4A A;  1E3U D;  1KVM A;  2PAV P;  3BWL A;  5CER A;  4FCF A;  2P74 A;  2R78 A;  5DKK A;  1ERQ A;  4FD8 A;  2PDR A;  1HD8 A;  2ZM2 A;  1XJ4 A;  2FH5 A;  4JGQ A;  3S7P A;  4Q0I A;  2V8C A;  2KLI A;  4ZAM A;  3ITA A;  1JVJ A;  1JWZ A;  3M6H A;  5EVI C;  4X68 A;  2L0W A;  2W0N A;  4JGO A;  3ZG8 B;  3HBR A;  2D01 A;  3ZHH A;  1H8Y A;  1TVF A;  3GV9 A;  4A5R A;  3LUQ A;  1F5M A;  1OTE A;  5DTK A;  5JYP A;  1ES4 A;  3Q7Z A;  2MJ6 A;  1T1B A;  2P04 A;  4JXV A;  4KUK A;  2DNS A;  5GLB A;  5IHV A;  3QP5 A;  3V5M A;  5K5B A;  4ZTK A;  2PBY A;  2H5S A;  2Y2P A;  4L9F A;  1OTI A;  3IHB A;  1YLZ A;  2GDN A;  1W7F A;  3DTK A;  1XPB A;  5C5K A;  1L3L A;  4IVK A;  4P6Z S;  3IXG A;  3QP8 A;  4G3W A;  3IXH A;  3CLO A;  2ZC3 B;  3A0V A;  3CJM A;  3WS0 A;  3JVV A;  5JYO A;  5KZH A;  4X69 A;  1DP8 A;  1T19 A;  4GZB A;  3FC7 A;  4NXF A;  2VV7 A;  4HJ3 A;  4N9K A;  2ZL1 A;  4OON A;  5EFW A;  4EER A;  1DRM A;  3ZNY A;  4GHI B;  4UA9 A;  2Y2O A;  1TDG A;  2BG1 A;  4MN7 A;  4ZJ3 A;  3LEQ A;  3H82 A;  2GJ3 A;  4LRX C;  1KOU A;  2PR5 A;  4NEE D;  4KQQ A;  1XJ6 A;  4CPK A;  3A3F A;  2OAQ 1;  1LI9 A;  3M6B A;  3T4T A;  3UDF A;  4L0L A;  1AWI A;  5EVI B;  2J80 A;  3S4X A;  5GHX A;  3UDI A;  4UA7 A;  1NRJ A;  2VGJ A;  4PM8 A;  3MR0 A;  5E2F A;  2E8I A;  4YOF A;  4JXW A;  4XUZ A;  4ME4 A;  3UMD A;  1NZO A;  2Q9N A;  1GHM A;  2PT7 A;  1NRF A;  3T4L A;  2XA7 M;  5DF7 A;  3N8L A;  5F82 A;  2HDS A;  4CQH A;  1IYO A;  2W3E A;  4QHC A;  2QJ5 A;  2QPN A;  3RTY A;  2Z2L B;  1NLY A;  3LR5 A;  5AQB A;  4L9E A;  5M1A A;  1V9Y A;  2H0T A;  3FPV A;  1ONG A;  1E4D A;  4DMZ A;  1FIK A;  4I3A A;  1IFQ A;  2EX8 A;  5HWT A;  5EUA A;  1CQA A;  4WBG A;  3VE3 A;  4IHQ A;  4IBR A;  4S2L A;  1FR1 A;  2XK1 A;  2BAS A;  5D3O A;  5FDH A;  3KSG A;  4F94 A;  3LCE A;  2BLS A;  2PR6 A;  5AVE A;  2XD5 A;  4E6W A;  2XRO A;  5L09 A;  2XH9 A;  3QP4 A;  5I94 A;  3RFB A;  4CLC C;  4YIN A;  3VP3 A;  2XSS A;  4ZJ1 A;  2PYP A;  2OSU A;  1FIL A;  2A2L A;  3BY8 A;  1VEU A;  3DTI A;  2WK0 A;  3NY4 A;  3NBL A;  1FSY A;  4QD4 A;  1GCE A;  2WGV A;  1IKI A;  4R0Q A;  1ESI A;  5FA7 A;  5KSC A;  1LI0 A;  3GEC A;  3NCK A;  4UQI M;  1N9N A;  4MLL A;  4OPY A;  1OT9 A;  4Z9Q A;  1Y54 A;  1H3Q A;  3BEB A;  1OTB A;  4Y0O A;  3EOI A;  4KG6 A;  2EFU A;  1KE4 A;  1C3B A;  3OC2 A;  1CF0 A;  1VET B;  4KQR A;  3IF5 A;  1MC0 A;  4IBX A;  2J3T D;  1TS6 A;  3DWK A;  1H8Z A;  2FFF B;  4N92 A;  2XEP A;  4LCM A;  2PYR A;  4HBT A;  3GRJ A;  4UAA A;  4DE2 A;  1MPL A;  5HD5 A;  2X01 A;  4IUK A;  1IKG A;  3EGX C;  2ZC4 B;  3OPP A;  1F9I A;  4HOI A;  4Y2F A;  2O99 A;  3NJA A;  4BMW A;  3F1O B;  4PKY G;  3OZH A;  3K2N A;  4PHT A;  4CLC B;  3ISG A;  2JBF A;  4LV0 A;  4H8R A;  1P9W A;  4EW7 A;  5EPH A;  5DFY A;  2Y8H A;  4QY5 A;  3OPH A;  1N9B A;  4GHI A;  5HW3 A;  2QWS A;  3CPT B;  2K7S A;  5CX7 A;  5L8M A;  3IF6 C;  2B5R A;  5DF9 A;  4JKT A;  2VJW A;  2Y59 A;  3NOP C;  1YMX A;  1M6K A;  3VSL A;  3ZG0 A;  3SH9 A;  2OLV A;  4I38 A;  5EVI A;  2EWV A;  1PI5 A;  2HV1 A;  5FQJ A;  3V3R A;  2ZQ7 A;  4IED A;  1P9R A;  5AQ9 A;  3P7N A;  4FH2 A;  4E3K A;  5AQA A;  1OJG A;  1S4S A;  2WUQ A;  3MZE A;  2V2F F;  3BY9 A;  3Q7V B;  4Q8I A;  3PBS A;  4LV3 A;  4FTX A;  1CJF A;  3KYZ A;  3OPL A;  3WS5 A;  2ZM0 A;  3VFH A;  1ODV A;  5HWW A;  5EVL A;  4GDN A;  4OLG A;  3DW0 A;  4GN2 A;  3WS1 A;  1YKD A;  5EM1 A;  3U4L P;  3KSF A;  2W1T B;  3VE4 A;  1Z6F A;  5CHU A;  3IWI A;  3CI6 A;  2O0Y A;  3UPN A;  3C7U A;  4KZ7 A;  4B4X A;  4LCL A;  3EQV A;  1TDL A;  4X1M A;  1P97 A;  5F1G A;  1YLP A;  2WAF A;  4QPR A;  5G18 A;  4I3I A;  4II7 A;  3TG9 A;  4BWI A;  4S2O A;  3P98 A;  1RGZ A;  1HVB A;  1ERO A;  4E3I A;  3UO9 A;  3A3I A;  5FL3 A;  5A92 A;  2PHY A;  4UA6 A;  1FCN A;  3MFX A;  3G32 A;  4ZBE A;  4BD1 A;  3MZD A;  1QMF A;  2V1B A;  4GNU A;  1V9Z A;  5DJT A;  3T1R A;  4R23 A;  4HEF A;  2PD8 A;  2W27 A;  5KSH A;  2QYB A;  5EE8 A;  3M2K A;  3U2A A;  3LIB A;  3HLD A;  2V1A A;  4EET B;  3DWZ A;  4R3J A;  1IYS A;  2B95 A;  4LLO B;  3SW1 A;  4PPR A;  4EU0 A;  3EEH A;  2R9X A;  5G4Y A;  2HDU A;  2NUP C;  4EBP A;  3IH8 A;  5HPF A;  1I2W A;  4WZ5 C;  4GD8 A;  4EXO A;  1KE3 A;  3KX0 X;  3PBR A;  2QKP A;  4XUX A;  4NET A;  3UPP A;  4Y0T A;  3N4I A;  1VET A;  4MN5 A;  2ZMF A;  1GA0 A;  3UB9 A;  4LFU A;  5G4Z A;  3D3O A;  3O87 A;  3D4F A;  2J9P A;  1XJ3 A;  4X25 A;  4WYY A;  1DP6 A;  3B33 A;  3N7W A;  3LI8 A;  3D72 A;  2YKH A;  2Y2J A;  2EA9 A;  2HP5 A;  3S7Q A;  4DDY A;  4DF6 A;  4OOL A;  4X56 A;  1F98 A;  1DJB A;  2V20 A;  2WKR A;  4EV4 A;  3MS6 A;  4BD0 A;  5A90 A;  5FEG A;  2XGN A;  4EQI A;  4Y15 A;  1SZV A;  1ZC2 A;  3F1O A;  3VMA A;  2Q9M A;  1Y28 A;  1N9L A;  4CLC A;  3RH8 B;  3BLS A;  5CTM A;  1MZU A;  5KMW A;  2A49 A;  2C6W B;  2FZ0 A;  4X1L A;  4PMA A;  3UB8 A;  5AJG A;  1KGE A;  3T4Q A;  3PR6 A;  3B47 A;  4GS9 B;  4H6J A;  3CPT A;  4Q0H A;  1JNU A;  1BYW A;  3V67 A;  4PKY A;  1TF1 A;  3T4O A;  2O9A A;  4WN5 A;  3A0R A;  1H5X A;  1XGI A;  3W4O A;  2VGL M;  5A93 A;  3BFE A;  5IU1 A;  1LLB A;  5E2H A;  2V9A A;  2XF3 A;  4JPM A;  3BEC A;  3SS3 A;  1K56 D;  2D02 A;  1BT5 A;  2Y2H A;  4OQG A;  2PU4 A;  4WZ4 A;  1EI5 A;  3Q7V A;  2KOI A;  3MBZ A;  2WGW B;  1G6A A;  3ZNT A;  3FKW A;  1YAX A;  3C4P A;  3G2Y A;  4EQ1 A;  4KZ4 A;  1NZU A;  3SS4 A;  3LR0 A;  4KZB A;  3LY3 A;  2VA0 A;  2W1T A;  2WKH A;  5EVE A;  3ZVW A;  5TBM A;  1SDN A;  1WA9 A;  4HY8 A;  4WMC A;  4PM9 A;  2O9C A;  3DTE A;  4MCW A;  3F1N B;  4E3N A;  1K4E A;  1OT6 A;  2VK3 A;  2HJE A;  1T1A A;  3SH7 A;  4EWF A;  2A24 B;  1N4O A;  3DBA A;  2J3W A;  5HZH A;  4NXG A;  5TJJ A;  1GSV A;  5EOO A;  2HP9 A;  4I39 A;  1PNE A;  2ZQ9 A;  2JN7 A;  2ZJ9 A;  4F3L A;  1GHP A;  1MWU A;  3R7W B;  2ZMV A;  2VGK A;  5EOE A;  4BBU A;  4GJ4 A;  4X53 A;  5DJU A;  3QHY A;  4U3T A;  3IF6 A;  3S22 A;  3OPR A;  1L0F A;  3UE1 A;  4S2J A;  2HJ9 C;  5E43 A;  2FFY A;  1LT0 A;  3Q82 A;  2Y2G A;  2O9B A;  3VP2 A;  4NK3 A;  3A3E A;  2CMN A;  2P7J A;  4KZ3 A;  2Y91 A;  4B4Z A;  3FV7 A;  3UE3 A;  2OWH A;  3GTC A;  2OLU A;  4P0M A;  3HRE A;  1HLU P;  2EWW A;  4P6Z M;  4FSF A;  5F68 A;  1NWZ A;  2YKF A;  4WMC D;  3TSG A;  1S1Y A;  1SHV A;  2VLG A;  2LB9 A;  1XKZ A;  3LIE A;  1K6S A;  4OP5 A;  3IX3 A;  3T50 A;  5DKL A;  5FQK A;  2E8J A;  3GDI A;  3C5A A;  5HAQ A;  2IA2 A;  5TGF A;  4GW9 A;  1XGJ A;  4R38 A;  4S2P A;  1XFQ A;  2XLN A;  3IXB A;  3SS5 A;  4JGR A;  1K6R A;  3BFG A;  4L9G A;  4JXS A;  4O8G A;  4P87 A;  3C4O A;  4R6L A;  3HUO A;  3IHA A;  4HQA A;  3AGE A;  2Y79 A;  4EUZ A;  5CED A;  2GX5 A;  1LHY A;  2Z6D A;  3NIA A;  5FI7 A;  4FOF A;  1GSW A;  3H7W B;  4KEN B;  3BM6 A;  5GL9 A;  5L10 A;  1CI8 A;  1E25 A;  1A0K A;  3IT9 A;  3MXR A;  3I7J A;  1LL9 A;  1VM1 A;  1XFN A;  1ES2 A;  2H0Y A;  1FCM A;  3KYE A;  4OOY A;  3ZQ5 A;  3BJN A;  4GS9 A;  1QME A;  4OP8 A;  3E0Y A;  3ULF A;  1Q2P A;  1YLT A;  3MKE A;  3G4P A;  5CTN A;  3ITB A;  4R1G A;  5HD3 A;  4KZ6 A;  3IXD A;  2HGV A;  4IVI A;  4BLM A;  1MXO A;  4K0X A;  3A3D A;  5FDS A;  1L0D A;  1DY6 A;  4Y13 A;  3T12 B;  2HP6 A;  3ZG9 B;  4WLA A;  4EEP A;  4WZ5 A;  1LSV A;  3M2J A;  3UE6 A;  4I3J A;  1TD5 A;  5CHM A;  3KO6 A;  3MMH A;  3O88 A;  3GSG A;  2WKQ A;  1W8Q A;  5HPI A;  4B88 A;  2Y2K A;  4FUW A;  5TFQ A;  3PAE A;  2J8Y A;  3LIF A;  3E98 A;  2H28 A;  4PAU A;  2ZQ8 A;  1OJ5 A;  3D9Y A;  3PBN A;  3BW6 A;  5E2G A;  2WKE A;  2JKT M;  2ZC5 B;  4B93 A;  1GSX A;  1K55 C;  3F1N A;  3N6I A;  2P9V B;  4LPZ A;  3V50 A;  2X02 A;  2A24 A;  5HAI A;  2OV5 A;  4ZDX A;  1SKO B;  5A8B A;  3UB5 P;  1W63 M;  4YNR A;  3BFF A;  3LFV A;  3BQ8 A;  2JKR M;  3R7W A;  2UWX A;  4G3V A;  3NHQ A;  2WZX A;  4OPZ A;  3P09 A;  3S1Y A;  3OCN A;  5A91 A;  5DTT A;  3L7H A;  5F6A A;  4R3B A;  1OTD A;  1MWS A;  3T1X A;  1XP4 A;  4I5S A;  1GA9 A;  5FQ9 A;  4WUJ A;  2K31 A;  1N9O A;  2Y2M A;  4NKP A;  3EQU A;  2M7V A;  3O86 A;  3A3J A;  2ZD8 A;  3E2L A;  4N9L A;  2WAD A;  3FPW A;  4BBV A;  3HLW A;  1ES3 A;  1VB6 A;  1F2K A;  5E2E A;  1YLY A;  2XFT A;  4OQH A;  4DXC A;  1DJC A;  4X6T A;  5MC7 A;  2XQZ A;  1FOF A;  2H10 A;  1PIO A;  3LY4 A;  1XJ2 A;  3VP0 A;  4ARZ B;  2Y2I A;  1LSW A;  4QWO A;  4U0X A;  5J4E A;  3VFF A;  2A3U A;  4XT2 B;  4UHU A;  1O7E A;  2EX6 A;  1YT4 A;  1RP5 A;  1SKF A;  1W63 Q;  5AVF A;  2JKG A;  2WGI A;  1ACF A;  3Q07 A;  3LIC A;  1VQQ A;  2RL3 A;  4E3M A;  2XRN A;  1WE4 A;  4MEZ A;  4BL2 A;  3OLO A;  1J9M A;  5DTS A;  3H7W A;  4ETZ A;  2XD1 A;  1D06 A;  4MNR A;  2WZZ A;  3FG8 A;  4HH2 A;  4C6Y A;  4M4X A;  1ZKJ A;  1XXM A;  3VOZ A;  3S7N A;  1FR6 A;  3VOL A;  1NLZ A;  3RXX A;  2OOL A;  5HDD A;  1KGF A;  1FCO A;  3MQ0 A;  5FAS A;  4R4S A;  3HL9 A;  3NEC A;  3MXQ A;  1H0M A;  1ES5 A;  5GHZ A;  5CHJ A;  2HZ5 A;  5EVI D;  4HES A;  1K54 C;  4HJ4 A;  1UGU A;  3R4K A;  1BSG A;  4S2N C;  4WL9 A;  4DE0 A;  2V0W A;  3CHW P;  5EV0 A;  2PBD P;  3SOI A;  4HI4 A;  3EEA A;  2UV0 E;  4BL3 A;  3HLE A;  1DJA A;  3B42 A;  4GDB A;  3G31 A;  5HFO A;  1D1J A;  5BOH A;  1RGY A;  4JGP A;  2EXB A;  5HL6 A;  2LB5 A;  3CWF A;  5FI6 A;  3WRZ A;  4QY6 A;  4OQI A;  5FQQ A;  5GLC A;  5CEC A;  3MF0 A;  3UPO A;  5FSR A;  4KZ8 A;  2EX2 A;  5F83 A;  1LSX A;  5HL1 A;  1M40 A;  2P9V A;  4PM5 A;  2JC7 A;  4MN6 A;  4WEJ A;  1PI4 A;  2G2U A;  1SKO A;  3KSH A;  4DDS A;  4Q0J A;  3A0S A;  1PW8 A;  1JTG A;  2ZBB A;  3BRM A;  3BFD A;  2V0U A;  3CUE C;  1L0E A;  1PWC A;  3QP6 A;  5F69 A;  5HSQ A;  4RX2 A;  4Y0U A;  3T4S A;  3IQA A;  4JLF A;  4GKU A;  2GZA A;  2J7V A;  1ALQ A;  1BUE A;  1PWD A;  4N1X A;  3C8C A;  3JVU A;  3BYD A;  1YLJ A;  3W2Z A;  1BUL A;  3VSK A;  4P85 A;  4LRY C;  4OKP A;  1BLC A;  2WKI A;  2QZ6 A;  4RQ9 A;  4WEK A;  3F1P B;  4E6X A;  3IWQ A;  4JF6 A;  3JYI A;  4RA7 A;  1IEL A;  4FH4 A;  3GQZ A;  2K2N A;  4K0W A;  2Q0O A;  3WWX A;  3HLC A;  3K3D A;  3V39 A;  3QNB A;  4ARZ A;  3ZFZ A;  3B3X A;  2P08 A;  1KGG A;  4LV2 A;  2EX9 A;  3KYQ A;  4DN0 A;  4XT2 A;  4OPR A;  4DRT A;  1K55 A;  2ZQD A;  1ZHH B;  1YLW A;  5CGW A;  1MBL A;  3N8S A;  3L9K A;  2JCH A;  1L2S A;  4CLC D;  3G34 A;  4MBF A;  3UE0 A;  3FWL A;  4JF4 A;  5EEC A;  4DJ3 A;  1G6O A;  1S66 L;  3LEZ A;  1FQG A;  4E3L A;  2BTF P;  1K38 A;  1Z09 A;  3HUM A;  4GLQ A;  1K0K A;  1CEG A;  2OWJ A;  4X55 A;  4AFI A;  3E4P A;  1T18 A;  3AGD A;  4K91 A;  4HBU A;  1KE0 A;  1PFL A;  2PD7 A;  5F1F A;  4E04 A;  2JKF A;  1X0O A;  1OPX A;  2HF6 A;  4BQM A;  3N8R A;  3UY6 A;  4DJ2 A;  4OOM A;  2ZM8 A;  1I5Q A;  3W4P A;  1T1C A;  2W3G A;  3FKV A;  1TS7 A;  4P6B A;  1MWR A;  2QJ7 A;  4R4R A;  4DKI A;  1W8Y A;  3E4Q A;  4BBT A;  2WYX A;  5GLD A;  3H9W A;  3QNC A;  3UB6 A;  1YSP A;  2DCF A;  4ZJ2 A;  5KIZ A;  4WM9 A;  3G35 A;  2I9V A;  5FQM A;  4LEN A;  3C38 A;  3ZG7 B;  1S1Z A;  1IYP A;  1FSW A;  4MDZ A;  2J9O A;  3CG5 A;  1NYM A;  2JKT I;  1S4R A;  2I72 A;  1MY8 A;  3E2K A;  3T1S A;  3IH9 A;  3GR2 A;  1BTL A;  4HP4 A;  3UNW A;  3MKF A;  3W4Q A;  3T4J A;  3HJK A;  4S2M A;  2VZW A;  2OAP 1;  1IOU A;  5CGX A;  4RX3 A;  4M3K A;  3NDG A;  3C30 A;  4U0T A;  5LBR A;  1CEF A;  3SZT A;  4CJN A;  2JKR I;  5J8X A;  2QHK A;  4KG2 A;  1H8M A;  3P01 A;  4Y5F A;  1MWT A;  2XR0 A;  3K3C A;  3MXS A;  4GB7 A;  3LIA A;  3UN7 A;  2V1Z A;  1DP9 A;  3CIT A;  3ZG5 A;  4MBK A;  5IS1 A;  2XA7 S;  1IYQ A;  3TE8 A;  4B9O A;  1HTZ A;  2W1R A;  4O0P A;  2HPB A;  3UME A;  1TEM A;  2ZQC A;  4Y17 A;  1K54 A;  2M1C A;  5FAQ A;  3UDX A;  4KZ5 A;  3IX8 A;  2XFS A;  3ZCZ A;  4S2N A;  2ACG A;  2PRF A;  4HJ6 A;  4OPQ A;  4CLC E;  4PM7 A;  1PW1 A;  3RXW A;  4OVD A;  1JWP A;  4BJP A;  4LV1 A;  4EBN A;  1MKM A;  2INW A;  4C75 A;  3F1P A;  3WS2 A;  1K25 A;  4K08 A;  2ZC6 B;  4GOG A;  4ESP A;  3S7O A;  5I5L A;  3CAX A;  1LL5 A;  1YSQ A;  3PTE A;  1PYY A;  3FYZ A;  1BLH A;  3MFD A;  3T4K A;  2G7U A;  3T1Q B;  5CXW A;  2B18 A;  4GCZ A;  5HAR A;  1JWV A;  4N1H A;  3MSH A;  4BEN A;  3LID A;  2WAE A;  3HJI A;  2WGW A;  4R3A A;  3ZYT A;  2IWB A;  1P0Z A;  4QB8 A;  2ZOI A;  4HHD A;  1BLP A;  2Y2Q A;  4UQI S;  2KDK A;  3OOV A;  4XXR A;  5U47 A;  5F5Y A;  3Q1F A;  4GD6 A;  4HH3 A;  3PHY A;  3TOI A;  3CUE A;  3TJZ C;  1CK3 A;  3HCY A;  4WEL A;  1YM1 A;  3GMW A;  1K57 C;  4QJG A;  1XA1 A;  4QU3 A;  2GNX A;  3VP4 A;  3BLM A;  4E3O A;  4OLD A;  1SCW A;  3ZDJ A;  4C3Q A;  1HZO A;  2ZMA A;  4ZRR A;  3PBQ A;  1AXB A;  3ZVT A;  3LYX A;  4Z1W A;  1ZG4 A;  3CZD A;  1CI9 A;  5HDS A;  3PAG A;  4WF0 A;  4EEU A;  5HAP A;  4D60 A;  3KSI A;  4UEY A;  3IWO A;  1PZP A;  3OBF A;  5FAO A;  4S2K A;  3O5Y A;  3SH8 A;  1L0G A;  4LRZ E;  3IS2 B;  1Y4O A;  1BLS A;  4MBH A;  4DE1 A;  4MMN A;  3VOY A;  2DRW A;  4KQO A;  1NJ4 A;  3HVF A;  2Z2M B;  1UWP X;  1PWG A;  1ZG6 A;  1TS8 A;  3BFC A;  1EW0 A;  3MQQ A;  2ZLY A;  5FAT A;  2XDM A;  3EGD C;  3MJQ A;  3C2W A;  5CEB A;  4KG5 A;  1PZO A;  4OQ0 A;  3TW8 A;  4NXE A;  2JHE A;  4O01 A;  2JE5 A;  3IX4 A;  4IUH A;  3W8K A;  4KZA A;  4IJG A;  4H6J B;  4DXB A;  1S6R A;  5M19 A;  1W79 A;  4YFM A;  1WYC A;  1EWZ A;  2IWC A;  3ZGA B;  3MZF A;  2KX6 A;  3LR4 A;  2EFX A;  3FZC A;  3DTM A;  3O3V A;  1NY0 A;  1YMS A;  1G68 A;  2VX8 A;  2HDR A;  5DFX A;  1J3W A;  2X71 A;  4RVA A;  3G6O A;  2VEA A;  4JBF A;  1SDE A;  3HLB A;  3NOT C;  2IWD A;  4OH0 A;  2VV8 A;  3EWK A;  3HLG A;  3ICY A;  1MKI A;  3WRT A;  5AQ7 A;  3RJU A;  1W5D A;  3NC8 A;  4JF5 A;  2WKP A;  5HX9 A;  2W3F A;  4KZ9 A;  4ETX A;  5DF8 A;  1YPR A;  4KQD A;  4EES A;  2G2W A;  2Z6C A;  2Y2L A;  2M7U A;  1UWN X;  3IBR A;  4LGW A;  5TBM B;  3GVB A;  4DE3 A;  3V3S A;  5GHY A;  5L07 A;  3PYP A;  1ERM A;  3IBJ A;  1G28 A;  4E3J A;  5GLA A;  4NXB A;  5CRF A;  4EBL A;  4PM6 A;  3CMZ A;  1IEM A;  4HP9 A;  5L2F A;  4F3L B;  5CGS A;  1S0W A;  2VV6 A;  4EUV A;  4JXG A;  3IF6 B;  1G5U A;  1ZTU A;  5FEF A;  3NI9 A;  3Q81 A;  1K4F A;  4HNB A;  2ZL1 B;  2J3T C;  2ZOH A;  2B02 A;  1ONH A;  2Y55 A;  2ZQA A;  1TS0 A;  1Q2Q A;  3AGF A;  1NXY A;  1JTD A;  1NYY A;  5J7E A;  3NDE A;  2VKS A;  1XX2 A;  1OME A;  1VHM A;  3C7V A;  3MQO A;  3H82 B;  1O07 A;  1BZA A;  2W3D A;  3DAV A;  4HIA A;  2W3H A;  1KDS A;  3LO7 A;  2EXA A;  3IS2 A;  4ID4 A;  3HLF A;  4O7D A;  3PBT A;  1KVL A;  2QMI A;  4RYE A;  4G3K A;  3PBO A;  3PXP A;  1GHI A;  3UB7 A;  3WS4 A;  3OCL A;  3LGO A;  1K56 A;  3G30 A;  4Y3I A;  5J3W A;  1LL8 A;  5FQI A;  4YWZ A;  4R70 A;  1E3U A;  2C5W B;  5HDC A;  5DVA A;  3NUL A;  4KUO A;  2L1M A;  3TRC A;  3NOU C;  3E4O A;  5EM0 A;  1D7E A;  3QP1 A;  1WYB A; 
#chains in the Genus database with same CATH homology
 1YKD A;  2JKT I;  3LIF A;  3VV4 A;  3E98 A;  1S4R A;  2H28 A;  4PAU A;  3KSF A;  2W1T B;  3VE4 A;  1OJ5 A;  3PBN A;  4HP4 A;  3BW6 A;  3CI6 A;  2O0Y A;  2JKT M;  3T4J A;  3HJK A;  4B93 A;  1GSX A;  3F1N A;  2L4R A;  2VGL S;  2OAP 1;  2VZW A;  4LPZ A;  1IOU A;  3EQV A;  2A24 A;  1P97 A;  5LBR A;  3C30 A;  3LI9 A;  5A8B A;  4QPR A;  2JKR I;  2QHK A;  4I3I A;  1H8M A;  4II7 A;  1W63 M;  3P01 A;  4BWI A;  4Y5F A;  4YNR A;  3K3C A;  3LFV A;  3BQ8 A;  2JKR M;  5FL3 A;  3LIA A;  1DP9 A;  3R7W A;  2PHY A;  5IT5 A;  4G3V A;  3NHQ A;  3CIT A;  2NUT C;  5IS1 A;  2DMW A;  3LR3 A;  3MFX A;  3OCN A;  2XA7 S;  3BQA A;  1OTA A;  1S67 L;  1STZ A;  5F6A A;  3TE8 A;  5HWV A;  4B9O A;  2V1B A;  2W1R A;  1V9Z A;  3BWL A;  4O0P A;  1OTD A;  5DJT A;  3UME A;  4I5S A;  2PD8 A;  4WUJ A;  2R78 A;  5DKK A;  2K31 A;  1N9O A;  4NKP A;  2M1C A;  2PDR A;  2W27 A;  3EQU A;  2M7V A;  5KSH A;  2QYB A;  1XJ4 A;  2FH5 A;  4JGQ A;  3U2A A;  3LIB A;  3S7P A;  4HJ6 A;  4Q0I A;  4EET B;  2V1A A;  3FPW A;  2KLI A;  4CLC E;  4BBV A;  4LLO B;  3SW1 A;  1VB6 A;  4BJP A;  4EU0 A;  3EEH A;  1MKM A;  2INW A;  5G4Y A;  2L0W A;  3F1P A;  2NUP C;  2W0N A;  5HPF A;  4JGO A;  5MC7 A;  2D01 A;  4K08 A;  4EXO A;  3PBR A;  3KX0 X;  2QKP A;  3S7O A;  5I5L A;  3LUQ A;  1F5M A;  4MN5 A;  2ZMF A;  1OTE A;  3UB9 A;  1XJ2 A;  3CAX A;  5G4Z A;  1YSQ A;  3D3O A;  4ARZ B;  1LSW A;  2MJ6 A;  1T1B A;  3T4K A;  2P04 A;  2G7U A;  4KUK A;  5J4E A;  1XJ3 A;  2B18 A;  4XT2 B;  4GCZ A;  1DP6 A;  3B33 A;  5K5B A;  3LI8 A;  3LID A;  4L9F A;  3HJI A;  3D72 A;  2YKH A;  4R3A A;  1OTI A;  2EA9 A;  1W63 Q;  5AVF A;  3S7Q A;  3ZYT A;  4OOL A;  3LIC A;  1P0Z A;  1F98 A;  2XRN A;  2ZOI A;  4HHD A;  2WKR A;  3OLO A;  5C5K A;  3H7W A;  4UQI S;  4ETZ A;  1D06 A;  2KDK A;  3FG8 A;  3OOV A;  4G3W A;  4P6Z S;  4HH2 A;  3CLO A;  3F1O A;  3A0V A;  4M4X A;  5F5Y A;  3JVV A;  1Y28 A;  1N9L A;  4CLC A;  4HH3 A;  3PHY A;  3RH8 B;  1DP8 A;  3S7N A;  1T19 A;  3VOL A;  1NLZ A;  1MZU A;  3CUE A;  3FC7 A;  3TJZ C;  4NXF A;  2VV7 A;  4HJ3 A;  5EFW A;  3HCY A;  2OOL A;  5HDD A;  2FZ0 A;  4EER A;  4WEL A;  1DRM A;  3MQ0 A;  3UB8 A;  5AJG A;  2GNX A;  3T4Q A;  4GHI B;  3PR6 A;  3B47 A;  4GS9 B;  4H6J A;  4Q0H A;  1JNU A;  1BYW A;  4ZRR A;  3V67 A;  4MN7 A;  3MXQ A;  3PBQ A;  4PKY A;  1TF1 A;  3LYX A;  4Z1W A;  3T4O A;  2O9A A;  2GJ3 A;  3H82 A;  4LRX C;  1KOU A;  2PR5 A;  4NEE D;  4WN5 A;  3A0R A;  5HDS A;  4HJ4 A;  1UGU A;  2VGL M;  4WF0 A;  4EEU A;  1XJ6 A;  3KSI A;  5IU1 A;  4UEY A;  3R4K A;  2OAQ 1;  4WL9 A;  3OBF A;  2V9A A;  2V0W A;  3O5Y A;  3T4T A;  4LRZ E;  3IS2 B;  2D02 A;  4L0L A;  4HI4 A;  3EEA A;  2J80 A;  4MMN A;  1NRJ A;  3MR0 A;  4KQO A;  4YOF A;  3B42 A;  4ME4 A;  3UMD A;  2KOI A;  2PT7 A;  1YAX A;  3T4L A;  2XA7 M;  4JGP A;  1UWP X;  4EQ1 A;  5HL6 A;  2LB5 A;  3CWF A;  4CQH A;  1TS8 A;  2W3E A;  3LR0 A;  2QJ5 A;  3RTY A;  1EW0 A;  3MQQ A;  1NLY A;  3LR5 A;  2VA0 A;  3MF0 A;  3EGD C;  3MJQ A;  3C2W A;  4L9E A;  1V9Y A;  3FPV A;  2W1T A;  4DMZ A;  4I3A A;  1IFQ A;  3TW8 A;  4NXE A;  2JHE A;  5HWT A;  4O01 A;  5TBM A;  1WA9 A;  4HY8 A;  1LSX A;  4IUH A;  2O9C A;  5HPI A;  4MCW A;  3VE3 A;  3F1N B;  4IHQ A;  1OT6 A;  2HJE A;  4MN6 A;  1T1A A;  4WEJ A;  2A24 B;  4H6J B;  4IJG A;  2BAS A;  3DBA A;  3KSG A;  2J3W A;  3KSH A;  4Q0J A;  2PR6 A;  5AVE A;  5HZH A;  4NXG A;  5TJJ A;  2XRO A;  1GSV A;  3A0S A;  4I39 A;  3RFB A;  2JN7 A;  2ZBB A;  4CLC C;  4F3L A;  2KX6 A;  2V0U A;  3LR4 A;  2XSS A;  3CUE C;  2PYP A;  3R7W B;  2A2L A;  2ZMV A;  3BY8 A;  2VX8 A;  4BBU A;  5F69 A;  5HSQ A;  4GJ4 A;  5DJU A;  5DFX A;  3T4S A;  3G6O A;  2VEA A;  2GZA A;  2HJ9 C;  3NOT C;  1LT0 A;  2O9B A;  2VV8 A;  3EWK A;  2CMN A;  3ICY A;  2P7J A;  3C8C A;  3JVU A;  3UE3 A;  2OWH A;  3GEC A;  3W2Z A;  4UQI M;  2WKP A;  2EWW A;  2W3F A;  4P6Z M;  4ETX A;  4FSF A;  5F68 A;  1N9N A;  1NWZ A;  4LRY C;  2YKF A;  1OT9 A;  4RQ9 A;  4WEK A;  4KQD A;  1S1Y A;  4EES A;  2Z6C A;  2M7U A;  2VLG A;  3F1P B;  2LB9 A;  1H3Q A;  1OTB A;  3LIE A;  1UWN X;  3IBR A;  5DKL A;  3T50 A;  3EOI A;  5TBM B;  3OC2 A;  2K2N A;  3GDI A;  3K3D A;  2IA2 A;  4ARZ A;  3PYP A;  4GW9 A;  1MC0 A;  2J3T D;  4R38 A;  2P08 A;  1G28 A;  3IBJ A;  1TS6 A;  1XFQ A;  4NXB A;  3KYQ A;  4DN0 A;  4XT2 A;  4JGR A;  4L9G A;  4O8G A;  2PYR A;  4R6L A;  4HP9 A;  4HQA A;  4F3L B;  1ZHH B;  2VV6 A;  5HD5 A;  2Y79 A;  4EUV A;  2GX5 A;  4IUK A;  4CLC D;  2Z6D A;  3EGX C;  4FOF A;  1GSW A;  3H7W B;  1F9I A;  1ZTU A;  4HOI A;  4Y2F A;  4DJ3 A;  2O99 A;  3NJA A;  1G6O A;  1S66 L;  4BMW A;  3F1O B;  4PKY G;  3K2N A;  4PHT A;  4CLC B;  4GLQ A;  4HNB A;  2OWJ A;  1XFN A;  4AFI A;  3E4P A;  1P9W A;  1T18 A;  4EW7 A;  2J3T C;  5DFY A;  2Y8H A;  2ZOH A;  2B02 A;  3ZQ5 A;  3BJN A;  1TS0 A;  2PD7 A;  4E04 A;  4GHI A;  4GS9 A;  1X0O A;  2QWS A;  2K7S A;  1OPX A;  3E0Y A;  3ULF A;  5J7E A;  2HF6 A;  5CX7 A;  5L8M A;  2VKS A;  1VHM A;  3MQO A;  5HD3 A;  3H82 B;  4DJ2 A;  4OOM A;  1T1C A;  2W3G A;  5DF9 A;  2W3D A;  2HGV A;  4HIA A;  2W3H A;  1TS7 A;  2VJW A;  3NOP C;  2QJ7 A;  3IS2 A;  3E4Q A;  4I38 A;  4BBT A;  3PBT A;  2EWV A;  2HV1 A;  3H9W A;  3UB6 A;  1YSP A;  4WLA A;  4EEP A;  4G3K A;  1P9R A;  3P7N A;  5KIZ A;  1LSV A;  1OJG A;  3PBO A;  3PXP A;  1S4S A;  3UB7 A;  3OCL A;  3BY9 A;  2I9V A;  4Y3I A;  3UE6 A;  5J3W A;  1LL8 A;  4YWZ A;  3PBS A;  4I3J A;  3C38 A;  1TD5 A;  4R70 A;  3KO6 A;  5HDC A;  3MMH A;  3KYZ A;  1S1Z A;  4KUO A;  2L1M A;  1ODV A;  2WKQ A;  4MDZ A;  3TRC A;  5HWW A;  3NOU C;  3E4O A;  1D7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...