3K3DA

The n-terminal pas domain crystal structure of rv1364c from mycobacterium tuberculosis at 2.3 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
127
Chain Sequence
b'MDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Rv1364c/MT1410
molecule tags Signaling protein
source organism Mycobacterium tuberculosis
publication title The N-Terminal Pas Domain Crystal Structure of Rv1364C from Mycobacterium Tuberculosis at 2.3 Angstrom.
rcsb
total genus 32
structure length 127
sequence length 134
ec nomenclature
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3k3dA00
4EESA 4F3LB 4MN5A 4NXBA 4EXOA 3FG8A 1P97A 4GS9A 2V9AA 3ULFA 4XT2A 5IU1A 5DKLA 1XJ4A 4EW7A 5HWWA 1TS7A 1TS0A 3UB7A 1G28A 4PKYG 4HP4A 1GSXA 5G4ZA 1V9YA 1X0OA 5J4EA 1D06A 4R70A 5J7EA 3LIBA 2Z6CA 1DP8A 3EEHA 1ODVA 2PR6A 4BBVA 2A24B 1OT6A 3T50A 4DJ3A 1KOUA 1OT9A 5DKKA 1GSVA 1N9OA 3MXQA 2VV8A 3H7WB 1OTAA 2J80A 3MR0A 2PYRA 5KIZA 2VEAA 1N9LA 5F5YA 3P7NA 4HIAA 1OTDA 4HI4A 1EW0A 3EWKA 4WF0A 2INWA 2QJ7A 4WUJA 5HZHA 1S1YA 1TS6A 1LT0A 2L4RA 3GECA 3LUQA 4WL9A 2WKRA 4R3AA 4R38A 5J3WA 3BY9A 3ICYA 3CWFA 3K3CA 4WN5A 3NOPC 4LRYC 2I9VA 1BYWA 3G6OA 2D02A 1DP6A 2H28A 2WKPA 2W0NA 4GCZA 1GSWA 1LSXA 3E4OA 4I38A 3UMEA 3UMDA 2QHKA 4GW9A 3UB6A 1OJ5A 2JN7A 2Z6DA 3H82B 2YKHA 4JGRA 4BBUA 2YKFA 1F9IA 5TBMB 2PHYA 3IS2A 5DJUA 3VE4A 2ZOIA 2JHEA 2PYPA 3LIFA 2V0WA 2P7JA 4F3LA 2QJ5A 3F1OB 5AVEA 3LICA 4KUKA 3KX0X 5AVFA 4GHIA 3UB8A 5A8BA 3F1NB 4LLOB 4BBTA 3E4PA 4JGOA 5EFWA 3PYPA 3NOUC 1LSWA 5F68A 1S66L 5HD5A 1T1CA 4H6JA 5HDSA 4GHIB 3LI9A 1NWZA 3F1PA 3H7WA 4NXFA 5TBMA 3K3DA 4GS9B 2L1MA 5HWTA 4K08A 2A24A 4EERA 1TS8A 3C2WA 5F6AA 2V1BA 2WKQA 4PKYA 4RQ9A 3MQQA 5HDCA 4B9OA 4HJ3A 4HH2A 2KDKA 3CAXA 3H82A 1XFQA 4I5SA 4E04A 2W27A 1N9NA 3A0SA 1UWNX 4WLAA 1WA9A 4EETB 3HJIA 2BASA 2VV7A 2EA9A 3GDIA 4HP9A 4I3JA 1V9ZA 1UWPX 2V0UA 5HWVA 2B02A 5F69A 3MFXA 2ZBBA 4HJ6A 4HQAA 5DJTA 3LIEA 3MQOA 1OTBA 5I5LA 3PHYA 5HDDA 4M4XA 1XJ2A 3SW1A 3BWLA 1XJ3A 3F1NA 1D7EA 4I3IA 3HJKA 1VB6A 1S67L 2R78A 1S1ZA 3IBRA 3B33A 3NOTC 3A0VA 4I39A 4XT2B 3ZQ5A 3RH8B 3BY8A 5G4YA 4I3AA 4EQ1A 1DRMA 1LL8A 3F1PB 4L9EA 3D72A 4L9GA 2CMNA 4NXEA 2VV6A 3UB9A 2GJ3A 4MN6A 1DP9A 4KUOA 1T1AA 2D01A 1XJ6A 3UE6A 1LSVA 1P0ZA 2OOLA 2ZOHA 3IS2B 3NHQA 2HV1A 1T1BA 1UGUA 2PD8A 2PD7A 3C8CA 4JGQA 3NJAA 3MJQA 4H6JB 2K7SA 4HOIA 5HSQA 4LRZE 2M1CA 3VE3A 1F98A 2PR5A 4JGPA 2QKPA 1JNUA 3RTYA 3A0RA 2VLGA 4HJ4A 2L0WA 1T18A 3H9WA 1XFNA 1OJGA 2OWJA 3LIAA 4HHDA 3FC7A 4EEUA 1OTEA 2PDRA 1S4RA 3LYXA 4HNBA 4HY8A 5IS1A 4L9FA 1S4SA 4R6LA 3VOLA 4EEPA 4NXGA 3LIDA 4KQDA 3OLOA 1MZUA 2QWSA 3F1OA 4LRXC 2KX6A 2V1AA 4HH3A 3CLOA 1OTIA 4DJ2A 4YWZA 3E4QA 4LPZA 2OWHA 1T19A 1Y28A 3LI8A 5HD3A
chains in the Genus database with same CATH superfamily
4ME4A 3UPOA 5FAQA 3HBRA 1VETB 1FILA 1YMXA 2W3FA 2WZZA 3HUNA 1IYSA 2P74A 1CF0A 5DKKA 1GSVA 3EGDC 2PYRA 1TDGA 2ZQAA 2XA7M 2VKSA 5TR7A 1TS6A 5J3WA 4X69A 3MKFA 1Z6FA 3KSGA 4UEYA 1K4FA 1NRJA 3H82B 2YKFA 2X01A 1W8QA 2ZOIA 3LIFA 5GHXA 3B47A 4R4SA 2ACGA 3GMWA 4P6ZM 5FEGA 2W1TB 5DTSA 3KX0X 5FQKA 4S2NA 4GHIA 1KDWA 4LV3A 2X02A 5EFWA 1H5XA 1FOFA 3LFVA 4ID4A 5U47A 5HDSA 1YSPA 3CUEC 4ZBEA 3LR3A 3G32A 4ARZA 1KGEA 5FQJA 4K0XA 4N92A 4GN2A 5DF9A 2FH5A 3Q7ZA 3W4OA 4Z9QA 2J9OA 5CTNA 2WZXA 3P01A 3MZEA 3QP2A 1I5QA 5CXWA 1LL9A 2OOLA 2HGVA 1WE4A 3SH9A 2QMIA 5F1FA 1KE0A 1OJGA 4EWFA 3T4QA 4LCMA 5IT5A 2ZQDA 4GJ4A 4ZAMA 3W4QA 3L7HA 1L2SA 3IHBA 4UHUA 2W3EA 1XX2A 4PM9A 4PM5A 3SZTA 5G4ZA 4BQMA 4K0WA 4ARZB 4EBNA 1KGFA 2R9WA 4EUZA 2Q9NA 1Q2PA 2Y79A 1D1JA 3PAGA 4R38A 3SOIA 4WN5A 5EOEA 4WBGA 1BYWA 2D02A 1YMSA 2PU4A 3QHYA 5EUAA 3HLCA 5JYOA 5LBRA 3OOVA 3CZDA 3VE4A 2V0WA 3BM6A 4OVDA 2Y4AA 3T4KA 4BBTA 4JGOA 2Q0OA 2VGLM 4GS9B 2A24A 1TS8A 4KQRA 5DF7A 1CEFA 4RQ9A 4F94A 1CQAA 3H82A 4LV0A 4S2PA 2JC7A 2ZC7A 5DFXA 5HL6A 2EA9A 3DTEA 2QZ6A 2ZC5B 4Y2FA 2HJEA 1W8YA 3O3VA 3LEZA 3NHQA 3C8CA 1UGUA 2OV5A 3NJAA 3BJNA 1YLWA 5GL9A 3RTYA 2AVXA 4EV4A 1GA9A 4BD1A 4L0LA 4IUKA 2JKFA 5A93A 1KGGA 4ETXA 5HL1A 1ONGA 3T1QB 4CJNA 4JXWA 3VP2A 5FDHA 1DJAA 1HZOA 2V9AA 3LY4A 3FV7A 5EM0A 1ERQA 3V3SA 1G28A 1MXOA 2BLSA 5HFOA 4UA9A 3QP5A 4KZ5A 2A24B 2GX5A 1OT9A 2XEPA 3ITAA 3EEAA 2OSUA 4HI4A 4FH2A 3KSFA 1SKOA 1FIKA 3CWFA 3ZG8B 3WS4A 2Y2GA 3JYIA 2OAP1 4JGRA 5FSRA 3T1RA 4X6TA 1XA7A 4E3IA 2JKRI 4R3BA 4EUVA 2L1MA 2JCHA 3OC2A 2HDRA 3AGFA 3VV4A 1DJBA 3RXXA 4N1XA 2B18A 4KENB 2LB9A 1BULA 1ERMA 3PHYA 4OQGA 4ZTKA 3MFDA 3BWLA 2NUPC 2G2UA 1TF1A 3W8KA 2VGKA 1W79A 1U60A 4NXEA 2EX2A 1DP9A 3SS3A 3VOYA 1P0ZA 3MSHA 3ULFA 4X55A 1PNEA 3TE8A 3P09A 3UN7A 4G3WA 1JWZA 4S2IA 3VE3A 3IXHA 2RL3A 1IOUA 3O5YA 4HHDA 4KZ9A 1S4SA 3LIDA 1YLJA 1FR6A 1PI4A 3MBZA 2H5SA 3LI8A 1P97A 3NBLA 2WGVA 1W63Q 3C7VA 4BMWA 5J4EA 4CLCC 2PR6A 4HESA 1ZTUA 3T50A 5FATA 3S4XA 1STZA 5HAIA 3MR0A 3E98A 4QWOA 4HIAA 1IYPA 4WF0A 2QJ7A 1S1YA 2L4RA 4MBHA 3KSHA 3TSGA 3TOIA 4QY6A 1YPRA 3KSIA 1YLYA 5HARA 3QNCA 5FQQA 4MBFA 2HPBA 3IXDA 1S6RA 1ZHHB 5DJUA 5E2GA 3LICA 1SDNA 3VFFA 1MKIA 3PBOA 4GLQA 3MKEA 3LI9A 3ZHHA 1Z09A 4EU0A 4HH2A 4C3QA 3QP6A 2MJ6A 1WA9A 3HJIA 3MS6A 1V9ZA 3VP4A 1XJ2A 1G6OA 1F5MA 3IBRA 1P9RA 1ES4A 1H3QA 5AQ7A 2EFUA 3UPNA 4BL2A 1T1BA 1IKGA 1BLPA 3G31A 4Y0TA 5HAQA 3UE0A 2PR5A 2JKRM 3LCEA 1JNUA 1XFNA 1S4RA 5EE8A 4DDYA 4YNRA 3T4SA 2XD1A 4NXBA 1TS0A 1C3BA 3PTEA 1X0OA 3M2JA 4WYYA 3CG5A 1I2WA 5L09A 3GTCA 3WS1A 3LGOA 3ZDJA 4DE2A 1OMEA 4KG6A 4X53A 5HAPA 2H28A 1DP6A 5L10A 2W0NA 5F82A 3NCKA 3LR0A 4BBUA 4X1LA 4Y0OA 4GB7A 2XGNA 4N1HA 2JHEA 1HVBA 5EVIA 4OLGA 1WYBA 5M1AA 4DF6A 1XPBA 4KG5A 4P0MA 5HPFA 1LL5A 3GSGA 4EERA 4KZ7A 5CRFA 2JBFA 3FWLA 3T4JA 3WWXA 4PKYA 5HDCA 4B9OA 4HJ3A 1RCJA 5CHMA 4Z1WA 3L9KA 3P98A 2XFSA 3LEQA 2JKGA 1UWPX 5HWVA 4N9LA 4HJ6A 5HDDA 1KE3A 1Y54A 1S1ZA 3V5MA 3B33A 3MZDA 4JF4A 3RH8B 4MDZA 1KVMA 3MXRA 1PZOA 1GCEA 1XGJA 4KZ4A 4R0QA 1K57A 2IWCA 1F98A 4JGPA 1ZC2A 3A0RA 1T18A 5FI6A 5CGXA 1LI0A 4L9FA 1PWCA 4GDNA 4EBPA 1ES2A 4LRXC 3CLOA 1OTIA 1RGYA 2ZC6B 3D9YA 4XT2A 3VSLA 2ZM8A 4R70A 4DXBA 1ODVA 1SKFA 1GHMA 1LHYA 3M2KA 3IT9A 4Y13A 3IWIA 2I72A 2INWA 3PAEA 4B4XA 4ZDXA 1L0DA 5EOOA 2Y2OA 3FYZA 2XLNA 1LSXA 3SS4A 1FCNA 4P85A 2YKHA 3T4LA 2V2FF 1E25A 1FSYA 4GKUA 4OPZA 2CC1A 3VOZA 3C4OA 2QJ5A 4KUKA 3C30A 2ZMAA 4O0PA 2WKHA 3O88A 5GLBA 1BZAA 3H7WA 4GD6A 3C2WA 3HLDA 5CEBA 1AWIA 1SZVA 4S2MA 1ZG6A 2V0UA 4X1MA 4H8RA 5DJTA 3TRCA 4OPYA 3MQOA 3T4TA 3MF0A 1JWPA 3BLSA 2R78A 4ETZA 2PRFA 3LO7A 2XR0A 4MCWA 4KUOA 2D01A 1HLUP 2ZOHA 2NUTC 3S1YA 3K2NA 1ALQA 3G30A 4LPZA 1CJFA 1K6SA 5TGFA 4KZ3A 3UDFA 3Q81A 5EM1A 1NXYA 1Y28A 2GZAA 1MY8A 1JTGA 4MN5A 4OQIA 3PBQA 1BT5A 2H10A 2Z6CA 4XXRA 2Q9MA 5CECA 3H7WB 1OTAA 4JXVA 3DBAA 4MN7A 2J9PA 3AGEA 2DMWA 5HZHA 1J9MA 2H0YA 3TW8A 2V8FA 3HCYA 3BY9A 1NZOA 2ZC4B 4DKIA 4R23A 1K38A 3OPLA 3IX8A 1EI5A 3JPUA 3NECA 4GW9A 3UB6A 4NG2A 3BLMA 4CLCD 3F1OB 5HW3A 2Y2NA 3E4PA 1G6AA 5F68A 3GVBA 2Y59A 3DTKA 5F6AA 2EWVA 3BFCA 2J3TC 5DFYA 2XRNA 1FSWA 3BFEA 4WLAA 5E43A 1RGZA 4I3JA 3GQZA 1ESIA 2WK0A 2ZBBA 4YFMA 5DTKA 3HJKA 1K55C 4KQQA 3CITA 1IYOA 1LL8A 2P9VA 4WZ5A 1PI5A 4LENA 1XJ6A 2WUQA 4CQHA 2VA0A 4HEFA 2XD5A 5TFQA 3HLGA 4LV2A 5IS1A 4HY8A 1VEUB 1NYYA 2WADA 3T12B 1VETA 4NXGA 3A3IA 4DE0A 5FI2A 5FQ9A 1PWDA 1K25A 3IBJA 5CGWA 2ZL1B 3A3FA 4OP5A 5M18A 4ZJ1A 3C38A 1MWSA 3GV9A 4GS9A 5IU1A 4FD8A 2PBDP 4RX3A 3N4IA 1YT4A 3EEHA 1DP8A 2O9BA 4KZ6A 4PAUA 2VV8A 3TJZC 5F5YA 3JVVA 3HL9A 1XKZA 1DY6A 1K4EA 2HDQA 2W1TA 2Y2IA 2HF6A 5E2HA 3FPVA 2JKTM 3CMZA 4JXGA 1GSWA 4I38A 4RX2A 1N4OA 3M6HA 2VGLS 2Z6DA 4IHQA 3OPHA 4OOYA 1E3UD 3U2AA 4GOGA 5AJGA 2HDUA 4WMCD 5HD5A 2V20A 3A3JA 5L07A 3E2LA 4X68A 2K2NA 3SS5A 2EX8A 4N9KA 2WKQA 4RYEA 3CAXA 3V67A 2A3UA 1BUEA 1TD5A 3IH9A 5KZHA 2RCXA 1XJ3A 4CPKA 4I3IA 4I39A 1MPLA 4UA6A 4D60A 2CMNA 4MN6A 3KYZA 5A92A 2HJ9C 3IS2B 2W1RA 4CLCB 3IF6A 4JF5A 4YOFA 3C4PA 4HNBA 5AQAA 2Z2MB 4KQDA 2PBYA 4UAAA 4YWZA 1ES5A 5F83A 4EESA 4PPRA 3DW0A 1O07A 4HBTA 1M6KA 2Y91A 1IELA 3BFGA 4Y15A 1OTDA 3C5AA 3WS2A 1JWVA 3NOPC 3G6OA 3I7JA 4WZ5C 3N6IA 5EV0A 3RJUA 1F9IA 2M7UA 1L0EA 2VK3A 1K0KA 5E2EA 3UY6A 4MNRA 4QPRA 2QYBA 1EWZA 3QP4A 3VP0A 1MBLA 3IF6B 3CPTA 4FTXA 4OOLA 4WM9A 2E8JA 4M3KA 4NETA 3VSKA 4E04A 4HP9A 3G2ZA 4R4RA 2O99A 3CHWP 4S2JA 2Z2LB 3N8RA 1D7EA 3UO9A 4XT2B 3ZQ5A 1FCMA 3GR2A 5J8XA 3UB9A 4BD0A 3U4LP 2DCFA 4OKPA 3RXWA 1OPXA 5GLAA 1F2KA 5C5KA 5HSQA 3AGDA 1TEMA 3Q07A 3QP8A 4EEUA 2ZJ9A 4B93A 4R6LA 1VQQA 2QWSA 4IVIA 4JLFA 4QHCA 2V1AA 2VX8A 4LCLA 3E4QA 3M6BA 4F3LB 1BSGA 4OLDA 2P08A 4FOFA 4UQIM 2XDMA 4LV1A 1LLBA 3LIBA 3CPTB 2LB5A 2J8YA 4ZRRA 1OT6A 2OLUA 5A91A 4BENA 5KIZA 3BEBA 3DAVA 3GECA 3VP1A 4WL9A 1ESUA 4MLLA 5M19A 2A49A 2ZQ9A 2ZMVA 3GRJA 1I2SA 4U3TA 3UMEA 5TBMB 2WKIA 4MBKA 4OPRA 1Y4OA 4QJGA 1PW8A 1VM1A 2XK1A 4ZJ3A 4JPMA 5FAOA 4LLOB 2ZQCA 3UE1A 1LSWA 3ZYTA 5K5BA 4K08A 3LY3A 3NC8A 5CEDA 3S7NA 4R1GA 4JKTA 2KDKA 4DRTA 3A0SA 2BASA 4UQIS 1KVLA 4CLCE 2B02A 5HPIA 2R9XA 2H0TA 4EBLA 4M4XA 1SKOB 3PBRA 2GDNA 2BG1A 4QB8A 3KYQA 4WELA 2ZD8A 3MMHA 2WGIA 4RA7A 1YSQA 4WEJA 4L9EA 3LR4A 1PYYA 5IHVA 4LRZE 1ES3A 3B42A 5CHUA 1RP5A 5CHJA 3LYXA 2EX9A 3UPPA 2XSSA 4E6WA 1K54A 4S2NC 4IBRA 2FFYA 4OQ0A 3S7OA 5CGSA 3IXGA 3EQVA 1H8MA 1ZKJA 3ITBA 2VJWA 3BYDA 5CX7A 3OCLA 1W63M 3UB7A 2E8IA 5GHYA 4HP4A 3IX4A 1D06A 2W3DA 4LGWA 5J7EA 2Y55A 1SHVA 1YAXA 4BL3A 1NLZA 4WMCA 3BQAA 1MWRA 3Q1FA 1E3UA 1P9WA 2X71A 2EXBA 5KSHA 4NK3A 3G2YA 2JN7A 4II7A 3T4OA 3PBNA 3E2KA 5AVEA 4DXCA 1PRQA 2JKTI 3UB8A 3G4PA 3NOUC 3NDEA 1J3WA 2DNSA 1NWZA 2WAEA 2Y8HA 4WEKA 3A3EA 2ZLYA 2WGWA 4IEDA 4E3MA 1H8YA 3HLBA 4OPQA 4QY5A 4Y7PA 2Y2JA 5EVIC 3IH8A 3ZG5A 4HQAA 2Y2KA 5I5LA 2EFXA 2ZL1A 1LI9A 1NLYA 4DE3A 5EPHA 3R7WB 5DF8A 3BY8A 4GNUA 5F1GA 2VV6A 2V1ZA 3ZVTA 4EQ1A 5A90A 1GHPA 4H6JB 4NKPA 3WS5A 4C75A 1IEMA 2FZ0A 3FC7A 4C6YA 5GLDA 3BW6A 2K31A 1K54C 1IYQA 5FEFA 3WS0A 4Y17A 4DJ2A 4D2OA 2P9VB 4QD4A 1MWUA 2XA7S 5KMWA 2O9CA 3FG8A 1TS7A 2EX6A 4PMAA 1PW1A 1BLHA 2HP6A 2PT7A 1KOUA 1FR1A 1W5DA 4JXSA 2ZQ8A 2VEAA 1YLZA 4B88A 1VEUA 4E3LA 3BFDA 1FQGA 3ZVWA 2FFFB 2KOIA 2IA2A 2I9VA 3OPRA 2J3TD 1EROA 4GCZA 5AQ9A 3E4OA 5FDSA 4FUWA 5EVLA 1E4DA 5DTTA 2G7UA 4F3LA 3HVFA 2M7VA 3MXSA 3PYPA 2Y2PA 4GHIB 1YKDA 4NXFA 4O7DA 4MMNA 3VP3A 1ZG4A 1ONHA 5BOHA 1PFLA 4I5SA 3V50A 4OONA 1K56D 4IBXA 1L3LA 3LIEA 2Y2HA 1AXBA 3A0VA 1K57C 4KZBA 3WRZA 5G4YA 4S2KA 3D72A 3ZG9B 4KZ8A 3IF5A 2PD8A 3E0YA 4JGQA 4HOIA 3EOIA 4PHTA 1W7FA 5EVIB 4OP8A 2ZC3B 4DDSA 3LIAA 1PIOA 2PDRA 4LFUA 1BTLA 4EEPA 3PR6A 1QMFA 4GDBA 4JBFA 3F1OA 2M1CA 1T19A 4EXOA 3QP1A 4KG2A 1HD8A 3LR5A 4XUZA 4OH0A 2C5WB 5FI7A 1KDSA 4DJ3A 3KYEA 3DWZA 3ZCZA 3S22A 2PAVP 2V8CA 3P7NA 3SH7A 5G18A 5GLCA 4U0TA 2WKRA 3ICYA 1TVFA 1SCWA 3IQAA 2WKPA 4Y5FA 1XP4A 1CEGA 3UMDA 4E3KA 1OJ5A 1YQSA 1DJCA 4O8GA 3S7PA 2PHYA 5EVEA 2P7JA 4ZJ2A 1CI9A 2WAFA 5A8BA 3F1NB 2IWBA 4P6ZS 1S66L 2UWXA 3TG9A 4PM7A 3K3DA 5HWTA 4A5RA 2C6WB 3MQQA 3V3RA 4Q0HA 1XFQA 2ZM2A 4DN0A 2OAQ1 1G68A 4OQHA 2ZM0A 5GHZA 1L0FA 4WZ4A 2A2LA 1S0WA 1VB6A 1S67L 4PM8A 3HLWA 3FKVA 1NYMA 1TDLA 3UE3A 1VHMA 3HREA 3WRTA 1PWGA 1H8ZA 5FL3A 3CI6A 1G5UA 2PU2A 3OBFA 3OLOA 1IKIA 3MQ0A 3FKWA 5L2FA 4AFIA 4BJPA 2G2WA 1QMEA 2OWHA 4JF6A 2XROA 5DKLA 3IWOA 4O01A 4PKYG 2WGWB 2EXAA 5D3OA 2B95A 3ISGA 2B5RA 1N9OA 2HP9A 3MXQA 3DTMA 1N9LA 4KZAA 1EW0A 3ZNTA 4NEED 4KQOA 3R7WA 3EQUA 3K3CA 4E3JA 3IX3A 4R3JA 4G3VA 3NY4A 2HZ5A 3BECA 3JVUA 3ZG0A 1XXMA 3Q7VA 5FA7A 4Y0UA 3IS2A 2W3GA 2PYPA 3D3OA 3VFHA 4CLCA 1YM1A 2W3HA 4BWIA 3BFFA 2KLIA 1BLSA 5FQMA 4K91A 5HX9A 4MEZA 4FH4A 2JE5A 1CK3A 5L8MA 1ACFA 4DE1A 4EQIA 2ZQ7A 3F1NA 1NZUA 1XA1A 5CTMA 3FPWA 5MC7A 2GJ3A 1GA0A 1T1AA 2VGJA 2HV1A 5DVAA 1L0GA 3T1SA 3W2ZA 2VLGA 4HJ4A 2XF3A 2Y2LA 3OCNA 4YINA 3HLFA 4X25A 4U0XA 3Q7VB 5AQBA 1CI8A 1K56A 2VZWA 3HUMA 5HD3A 4B4ZA 5KSCA 3V39A 4EW7A 1XJ4A 5FQIA 2GNXA 1GSXA 2XFTA 2EWWA 5TJJA 3PXPA 4BBVA 2P04A 3O87A 1K55A 3BRMA 1MKMA 4WUJA 2O9AA 1YLTA 1LT0A 3UNWA 4PM6A 1BLCA 3IXBA 2J7VA 4G3KA 3C7UA 1KE4A 5FASA 1K6RA 4QU3A 3KO6A 4IVKA 3A3DA 3ZG7B 3G35A 4ESPA 4GZBA 5E2FA 4H6JA 3IF6C 3F1PA 4HBUA 4E6XA 4Q0JA 3CUEA 4EETB 3T1XA 5F69A 3MFXA 2WKEA 3NOTC 5EECA 4Q8IA 5JYPA 3NIAA 4I3AA 1DRMA 4Q0IA 4S2LA 3R4KA 1O7EA 2XH9A 2PD7A 4OOMA 3MJQA 3Q82A 2K7SA 4IJGA 4IUHA 3W4PA 3ZNYA 1A0KA 3ZGAB 1MC0A 1Q2QA 1JTDA 3QNBA 3PBTA 2OWJA 3N7WA 4DMZA 1OTEA 1GHIA 1MZUA 3G34A 4RVAA 2IWDA 3BQ8A 4HH3A 4UA7A 3UDIA 1MWTA 2ZMFA 2BTFP 3B3XA 5FAPA 5HWWA 3IWQA 1V9YA 1SDEA 2Y2QA 3HLEA 3D4FA 4E3NA 3SH8A 2J80A 3IHAA 3EWKA 3N8SA 3LUQA 3N8LA 4R3AA 4Y3IA 5I94A 4LRYC 3DTIA 1PZPA 3O86A 3NULA 1FCOA 1N9BA 1JVJA 2QHKA 3MZFA 3HUOA 2J3WA 4S2OA 3FZCA 3UDXA 3OPPA 4P6BA 4X56A 5EVID 5AVFA 5CERA 1H0MA 1T1CA 2HDSA 2QPNA 2WYXA 5TBMA 3VMAA 3PBSA 2V1BA 1HTZA 2HP5A 2W27A 1N9NA 1UWNX 2VV7A 3GDIA 2OLVA 4XUXA 3OZHA 4FCFA 1IFQA 1OTBA 3CJMA 3NI9A 3SW1A 2DRWA 4P87A 3ZFZA 3F1PB 4L9GA 3DWKA 3UE6A 4GD8A 1LSVA 3EGXC 1NRFA 2QKPA 3RFBA 2L0WA 3H9WA 1NY0A 1YLPA 1M40A 3S7QA 2Y2MA 2XQZA 3NDGA 3VOLA 4BLMA 1WYCA 2KX6A 2UV0E 4FSFA 3UB5P 2O0YA 4E3OA 1NJ4A 1XGIA
chains in the Genus database with same CATH topology
4EESA 4ME4A 4NXBA 4EXOA 3LR5A 1TS0A 2W3FA 1X0OA 4DJ3A 5DKKA 1GSVA 3EGDC 2PYRA 2XA7M 3P7NA 1OTDA 2VKSA 1TS6A 5J3WA 2WKRA 3ICYA 3NOPC 3G6OA 2H28A 1DP6A 2WKPA 3KSGA 4UEYA 2W0NA 4Y5FA 3LR0A 3UMDA 1NRJA 1OJ5A 3H82B 4BBUA 2YKFA 4O8GA 3S7PA 1F9IA 2M7UA 2PHYA 2ZOIA 2JHEA 3LIFA 3B47A 2P7JA 4P6ZM 2W1TB 3KX0X 4QPRA 2QYBA 4GHIA 5A8BA 3F1NB 5EFWA 4P6ZS 1S66L 3LFVA 5HDSA 1YSPA 3CUEC 5HPFA 3LR3A 4EERA 3K3DA 4OOLA 5HWTA 4ARZA 3T4JA 4PKYA 5HDCA 3MQQA 4B9OA 4HJ3A 4Q0HA 5DF9A 4E04A 1XFQA 4Z1WA 2FH5A 4DN0A 4HP9A 2OAQ1 1UWPX 5HWVA 2O99A 4HJ6A 5HDDA 3P01A 2A2LA 1D7EA 1VB6A 1S67L 4XT2B 1S1ZA 3ZQ5A 3B33A 3RH8B 4MDZA 3UB9A 3UE3A 1VHMA 2OOLA 1OPXA 2HGVA 5C5KA 5HSQA 1F98A 4JGPA 5FL3A 3A0RA 1T18A 4EEUA 1OJGA 3CI6A 3T4QA 4L9FA 5IT5A 4B93A 4R6LA 3OBFA 3OLOA 2QWSA 4GJ4A 3MQ0A 4LRXC 2V1AA 2VX8A 3CLOA 1OTIA 4AFIA 4BJPA 3E4QA 2W3EA 2OWHA 4F3LB 2XROA 4XT2A 2P08A 4FOFA 5DKLA 4O01A 4UQIM 4PKYG 5G4ZA 4R70A 3LIBA 2LB5A 1ODVA 4ZRRA 4ARZB 1OT6A 1N9OA 3MXQA 5KIZA 1N9LA 2Y79A 1EW0A 2INWA 4NEED 4KQOA 3GECA 3R7WA 4WL9A 3EQUA 4R38A 3K3CA 4WN5A 1BYWA 2D02A 2ZMVA 4G3VA 1LSXA 3JVUA 3UMEA 5LBRA 2YKHA 3OOVA 3T4LA 5TBMB 3IS2A 2W3GA 3VE4A 2PYPA 3D3OA 2V0WA 2QJ5A 4KUKA 3T4KA 4CLCA 4LLOB 3C30A 4BBTA 4JGOA 4O0PA 1LSWA 2W3HA 3ZYTA 2VGLM 5K5BA 3H7WA 4GS9B 4BWIA 4K08A 2A24A 2KLIA 1TS8A 3C2WA 4RQ9A 3S7NA 2KDKA 3H82A 3A0SA 5DFXA 5HL6A 2BASA 2EA9A 4UQIS 2V0UA 5L8MA 4CLCE 2B02A 5HPIA 5DJTA 3TRCA 3MQOA 3T4TA 4M4XA 3PBRA 3MF0A 3F1NA 2R78A 3KYQA 4WELA 3FPWA 4ETZA 5MC7A 3MMHA 4Y2FA 4MCWA 2GJ3A 4KUOA 1T1AA 2D01A 1YSQA 2HJEA 4WEJA 2ZOHA 3NHQA 2NUTC 2HV1A 3C8CA 1UGUA 3K2NA 3LR4A 4L9EA 3NJAA 3BJNA 4LRZE 3B42A 3W2ZA 3RTYA 2VLGA 4HJ4A 4LPZA 3LYXA 3OCNA 2XSSA 4L0LA 4IUKA 3S7OA 4ETXA 3EQVA 1Y28A 2VZWA 1H8MA 2GZAA 5HD3A 4MN5A 2VJWA 2V9AA 5CX7A 4EW7A 3OCLA 1XJ4A 1W63M 3UB7A 3PBQA 1G28A 2GNXA 1GSXA 4HP4A 1D06A 2W3DA 5J7EA 2Z6CA 2EWWA 5TJJA 3PXPA 4BBVA 2A24B 1YAXA 2GX5A 1OT9A 2P04A 3H7WB 1NLZA 1OTAA 3EEAA 3BQAA 3DBAA 1MKMA 4MN7A 4HI4A 2DMWA 5HZHA 3KSFA 4WUJA 2O9AA 1LT0A 1P9WA 3TW8A 3HCYA 3BY9A 3CWFA 5KSHA 4G3KA 4GW9A 3UB6A 2JN7A 2OAP1 1T19A 4JGRA 4II7A 3T4OA 4CLCD 3KO6A 3PBNA 5AVEA 3F1OB 2JKTI 3UB8A 3E4PA 3NOUC 5F68A 4H6JA 2JKRI 1NWZA 3F1PA 4EUVA 2Y8HA 2L1MA 5F6AA 2EWVA 4WEKA 2J3TC 4Q0JA 3OC2A 5DFYA 2XRNA 3CUEA 3VV4A 4WLAA 4EETB 2B18A 4I3JA 5F69A 3MFXA 2ZBBA 4HQAA 5I5LA 2LB9A 3PHYA 1NLYA 3BWLA 2NUPC 3R7WB 3HJKA 3NOTC 1TF1A 3CITA 3BY8A 4I3AA 1DRMA 1LL8A 4NXEA 2VV6A 4Q0IA 1DP9A 1XJ6A 3R4KA 1P0ZA 4EQ1A 2PD7A 3ULFA 3TE8A 4OOMA 3MJQA 4H6JB 2K7SA 4G3WA 4NKPA 4IJGA 4CQHA 2VA0A 4IUHA 3VE3A 1MC0A 1IOUA 3O5YA 3PBTA 4HHDA 2OWJA 2FZ0A 3FC7A 4DMZA 1OTEA 5IS1A 4HY8A 3BW6A 2K31A 1S4SA 4NXGA 3LIDA 1MZUA 3BQ8A 4HH3A 3IBJA 4DJ2A 2ZMFA 3LI8A 2XA7S 3C38A 2O9CA 3FG8A 1P97A 4GS9A 5HWWA 5IU1A 1W63Q 1TS7A 1V9YA 4BMWA 5J4EA 4CLCC 3EEHA 1DP8A 2PR6A 1ZTUA 2O9BA 2PT7A 3T50A 1KOUA 4PAUA 2VV8A 2J80A 1STZA 3MR0A 3TJZC 2VEAA 3E98A 5F5YA 4HIAA 3JVVA 3EWKA 4WF0A 2QJ7A 1S1YA 2L4RA 3LUQA 4R3AA 3KSHA 4Y3IA 2KOIA 2W1TA 2IA2A 4LRYC 2HF6A 2I9VA 3FPVA 2JKTM 2J3TD 3KSIA 4GCZA 1GSWA 3E4OA 4I38A 2QHKA 2VGLS 2Z6DA 4IHQA 2J3WA 1ZHHB 5DJUA 2G7UA 4F3LA 3LICA 3U2AA 5AVFA 5AJGA 2M7VA 3PYPA 5HD5A 3PBOA 1T1CA 4GLQA 4GHIB 1YKDA 3LI9A 4NXFA 5TBMA 2K2NA 3PBSA 4MMNA 2V1BA 2WKQA 4EU0A 4HH2A 3CAXA 4I5SA 2W27A 1N9NA 1UWNX 2MJ6A 1WA9A 3V67A 3HJIA 2VV7A 3GDIA 1TD5A 1V9ZA 1IFQA 3LIEA 1OTBA 1XJ2A 3SW1A 1XJ3A 1G6OA 1F5MA 4I3IA 4I39A 3IBRA 1P9RA 3A0VA 1H3QA 5G4YA 3F1PB 3D72A 4L9GA 2CMNA 4MN6A 3KYZA 3UE6A 2HJ9C 1LSVA 3IS2B 1T1BA 2PD8A 3E0YA 4JGQA 4HOIA 3EOIA 4PHTA 2W1RA 3EGXC 2PR5A 2JKRM 2QKPA 1JNUA 4CLCB 3RFBA 2L0WA 3H9WA 1XFNA 4YOFA 3LIAA 2PDRA 1S4RA 4HNBA 3S7QA 3VOLA 4EEPA 4KQDA 4YNRA 3PR6A 3T4SA 3F1OA 2KX6A 4FSFA 2O0YA 4YWZA 2M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  4F3L B;  4MN5 A;  4NXB A;  4EXO A;  3FG8 A;  1P97 A;  4GS9 A;  2V9A A;  3ULF A;  4XT2 A;  5IU1 A;  5DKL A;  1XJ4 A;  4EW7 A;  5HWW A;  1TS7 A;  1TS0 A;  3UB7 A;  1G28 A;  4PKY G;  4HP4 A;  1GSX A;  5G4Z A;  1V9Y A;  1X0O A;  5J4E A;  1D06 A;  4R70 A;  5J7E A;  3LIB A;  2Z6C A;  1DP8 A;  3EEH A;  1ODV A;  2PR6 A;  4BBV A;  2A24 B;  1OT6 A;  3T50 A;  4DJ3 A;  1KOU A;  1OT9 A;  5DKK A;  1GSV A;  1N9O A;  3MXQ A;  2VV8 A;  3H7W B;  1OTA A;  2J80 A;  3MR0 A;  2PYR A;  5KIZ A;  2VEA A;  1N9L A;  5F5Y A;  3P7N A;  4HIA A;  1OTD A;  4HI4 A;  1EW0 A;  3EWK A;  4WF0 A;  2INW A;  2QJ7 A;  4WUJ A;  5HZH A;  1S1Y A;  1TS6 A;  1LT0 A;  2L4R A;  3GEC A;  3LUQ A;  4WL9 A;  2WKR A;  4R3A A;  4R38 A;  5J3W A;  3BY9 A;  3ICY A;  3CWF A;  3K3C A;  4WN5 A;  3NOP C;  4LRY C;  2I9V A;  1BYW A;  3G6O A;  2D02 A;  1DP6 A;  2H28 A;  2WKP A;  2W0N A;  4GCZ A;  1GSW A;  1LSX A;  3E4O A;  4I38 A;  3UME A;  3UMD A;  2QHK A;  4GW9 A;  3UB6 A;  1OJ5 A;  2JN7 A;  2Z6D A;  3H82 B;  2YKH A;  4JGR A;  4BBU A;  2YKF A;  1F9I A;  5TBM B;  2PHY A;  3IS2 A;  5DJU A;  3VE4 A;  2ZOI A;  2JHE A;  2PYP A;  3LIF A;  2V0W A;  2P7J A;  4F3L A;  2QJ5 A;  3F1O B;  5AVE A;  3LIC A;  4KUK A;  3KX0 X;  5AVF A;  4GHI A;  3UB8 A;  5A8B A;  3F1N B;  4LLO B;  4BBT A;  3E4P A;  4JGO A;  5EFW A;  3PYP A;  3NOU C;  1LSW A;  5F68 A;  1S66 L;  5HD5 A;  1T1C A;  4H6J A;  5HDS A;  4GHI B;  3LI9 A;  1NWZ A;  3F1P A;  3H7W A;  4NXF A;  5TBM A;  3K3D A;  4GS9 B;  2L1M A;  5HWT A;  4K08 A;  2A24 A;  4EER A;  1TS8 A;  3C2W A;  5F6A A;  2V1B A;  2WKQ A;  4PKY A;  4RQ9 A;  3MQQ A;  5HDC A;  4B9O A;  4HJ3 A;  4HH2 A;  2KDK A;  3CAX A;  3H82 A;  1XFQ A;  4I5S A;  4E04 A;  2W27 A;  1N9N A;  3A0S A;  1UWN X;  4WLA A;  1WA9 A;  4EET B;  3HJI A;  2BAS A;  2VV7 A;  2EA9 A;  3GDI A;  4HP9 A;  4I3J A;  1V9Z A;  1UWP X;  2V0U A;  5HWV A;  2B02 A;  5F69 A;  3MFX A;  2ZBB A;  4HJ6 A;  4HQA A;  5DJT A;  3LIE A;  3MQO A;  1OTB A;  5I5L A;  3PHY A;  5HDD A;  4M4X A;  1XJ2 A;  3SW1 A;  3BWL A;  1XJ3 A;  3F1N A;  1D7E A;  4I3I A;  3HJK A;  1VB6 A;  1S67 L;  2R78 A;  1S1Z A;  3IBR A;  3B33 A;  3NOT C;  3A0V A;  4I39 A;  4XT2 B;  3ZQ5 A;  3RH8 B;  3BY8 A;  5G4Y A;  4I3A A;  4EQ1 A;  1DRM A;  1LL8 A;  3F1P B;  4L9E A;  3D72 A;  4L9G A;  2CMN A;  4NXE A;  2VV6 A;  3UB9 A;  2GJ3 A;  4MN6 A;  1DP9 A;  4KUO A;  1T1A A;  2D01 A;  1XJ6 A;  3UE6 A;  1LSV A;  1P0Z A;  2OOL A;  2ZOH A;  3IS2 B;  3NHQ A;  2HV1 A;  1T1B A;  1UGU A;  2PD8 A;  2PD7 A;  3C8C A;  4JGQ A;  3NJA A;  3MJQ A;  4H6J B;  2K7S A;  4HOI A;  5HSQ A;  4LRZ E;  2M1C A;  3VE3 A;  1F98 A;  2PR5 A;  4JGP A;  2QKP A;  1JNU A;  3RTY A;  3A0R A;  2VLG A;  4HJ4 A;  2L0W A;  1T18 A;  3H9W A;  1XFN A;  1OJG A;  2OWJ A;  3LIA A;  4HHD A;  3FC7 A;  4EEU A;  1OTE A;  2PDR A;  1S4R A;  3LYX A;  4HNB A;  4HY8 A;  5IS1 A;  4L9F A;  1S4S A;  4R6L A;  3VOL A;  4EEP A;  4NXG A;  3LID A;  4KQD A;  3OLO A;  1MZU A;  2QWS A;  3F1O A;  4LRX C;  2KX6 A;  2V1A A;  4HH3 A;  3CLO A;  1OTI A;  4DJ2 A;  4YWZ A;  3E4Q A;  4LPZ A;  2OWH A;  1T19 A;  1Y28 A;  3LI8 A;  5HD3 A; 
#chains in the Genus database with same CATH topology
 4ME4 A;  3UPO A;  5FAQ A;  3HBR A;  1VET B;  1FIL A;  1YMX A;  2W3F A;  2WZZ A;  3HUN A;  1IYS A;  2P74 A;  1CF0 A;  5DKK A;  1GSV A;  3EGD C;  2PYR A;  1TDG A;  2ZQA A;  2XA7 M;  2VKS A;  5TR7 A;  1TS6 A;  5J3W A;  4X69 A;  3MKF A;  1Z6F A;  3KSG A;  4UEY A;  1K4F A;  1NRJ A;  3H82 B;  2YKF A;  2X01 A;  1W8Q A;  2ZOI A;  3LIF A;  5GHX A;  3B47 A;  4R4S A;  2ACG A;  3GMW A;  4P6Z M;  5FEG A;  2W1T B;  5DTS A;  3KX0 X;  5FQK A;  4S2N A;  4GHI A;  1KDW A;  4LV3 A;  2X02 A;  5EFW A;  1H5X A;  1FOF A;  3LFV A;  4ID4 A;  5U47 A;  5HDS A;  1YSP A;  3CUE C;  4ZBE A;  3LR3 A;  3G32 A;  4ARZ A;  1KGE A;  5FQJ A;  4K0X A;  4N92 A;  4GN2 A;  5DF9 A;  2FH5 A;  3Q7Z A;  3W4O A;  4Z9Q A;  2J9O A;  5CTN A;  2WZX A;  3P01 A;  3MZE A;  3QP2 A;  1I5Q A;  5CXW A;  1LL9 A;  2OOL A;  2HGV A;  1WE4 A;  3SH9 A;  2QMI A;  5F1F A;  1KE0 A;  1OJG A;  4EWF A;  3T4Q A;  4LCM A;  5IT5 A;  2ZQD A;  4GJ4 A;  4ZAM A;  3W4Q A;  3L7H A;  1L2S A;  3IHB A;  4UHU A;  2W3E A;  1XX2 A;  4PM9 A;  4PM5 A;  3SZT A;  5G4Z A;  4BQM A;  4K0W A;  4ARZ B;  4EBN A;  1KGF A;  2R9W A;  4EUZ A;  2Q9N A;  1Q2P A;  2Y79 A;  1D1J A;  3PAG A;  4R38 A;  3SOI A;  4WN5 A;  5EOE A;  4WBG A;  1BYW A;  2D02 A;  1YMS A;  2PU4 A;  3QHY A;  5EUA A;  3HLC A;  5JYO A;  5LBR A;  3OOV A;  3CZD A;  3VE4 A;  2V0W A;  3BM6 A;  4OVD A;  2Y4A A;  3T4K A;  4BBT A;  4JGO A;  2Q0O A;  2VGL M;  4GS9 B;  2A24 A;  1TS8 A;  4KQR A;  5DF7 A;  1CEF A;  4RQ9 A;  4F94 A;  1CQA A;  3H82 A;  4LV0 A;  4S2P A;  2JC7 A;  2ZC7 A;  5DFX A;  5HL6 A;  2EA9 A;  3DTE A;  2QZ6 A;  2ZC5 B;  4Y2F A;  2HJE A;  1W8Y A;  3O3V A;  3LEZ A;  3NHQ A;  3C8C A;  1UGU A;  2OV5 A;  3NJA A;  3BJN A;  1YLW A;  5GL9 A;  3RTY A;  2AVX A;  4EV4 A;  1GA9 A;  4BD1 A;  4L0L A;  4IUK A;  2JKF A;  5A93 A;  1KGG A;  4ETX A;  5HL1 A;  1ONG A;  3T1Q B;  4CJN A;  4JXW A;  3VP2 A;  5FDH A;  1DJA A;  1HZO A;  2V9A A;  3LY4 A;  3FV7 A;  5EM0 A;  1ERQ A;  3V3S A;  1G28 A;  1MXO A;  2BLS A;  5HFO A;  4UA9 A;  3QP5 A;  4KZ5 A;  2A24 B;  2GX5 A;  1OT9 A;  2XEP A;  3ITA A;  3EEA A;  2OSU A;  4HI4 A;  4FH2 A;  3KSF A;  1SKO A;  1FIK A;  3CWF A;  3ZG8 B;  3WS4 A;  2Y2G A;  3JYI A;  2OAP 1;  4JGR A;  5FSR A;  3T1R A;  4X6T A;  1XA7 A;  4E3I A;  2JKR I;  4R3B A;  4EUV A;  2L1M A;  2JCH A;  3OC2 A;  2HDR A;  3AGF A;  3VV4 A;  1DJB A;  3RXX A;  4N1X A;  2B18 A;  4KEN B;  2LB9 A;  1BUL A;  1ERM A;  3PHY A;  4OQG A;  4ZTK A;  3MFD A;  3BWL A;  2NUP C;  2G2U A;  1TF1 A;  3W8K A;  2VGK A;  1W79 A;  1U60 A;  4NXE A;  2EX2 A;  1DP9 A;  3SS3 A;  3VOY A;  1P0Z A;  3MSH A;  3ULF A;  4X55 A;  1PNE A;  3TE8 A;  3P09 A;  3UN7 A;  4G3W A;  1JWZ A;  4S2I A;  3VE3 A;  3IXH A;  2RL3 A;  1IOU A;  3O5Y A;  4HHD A;  4KZ9 A;  1S4S A;  3LID A;  1YLJ A;  1FR6 A;  1PI4 A;  3MBZ A;  2H5S A;  3LI8 A;  1P97 A;  3NBL A;  2WGV A;  1W63 Q;  3C7V A;  4BMW A;  5J4E A;  4CLC C;  2PR6 A;  4HES A;  1ZTU A;  3T50 A;  5FAT A;  3S4X A;  1STZ A;  5HAI A;  3MR0 A;  3E98 A;  4QWO A;  4HIA A;  1IYP A;  4WF0 A;  2QJ7 A;  1S1Y A;  2L4R A;  4MBH A;  3KSH A;  3TSG A;  3TOI A;  4QY6 A;  1YPR A;  3KSI A;  1YLY A;  5HAR A;  3QNC A;  5FQQ A;  4MBF A;  2HPB A;  3IXD A;  1S6R A;  1ZHH B;  5DJU A;  5E2G A;  3LIC A;  1SDN A;  3VFF A;  1MKI A;  3PBO A;  4GLQ A;  3MKE A;  3LI9 A;  3ZHH A;  1Z09 A;  4EU0 A;  4HH2 A;  4C3Q A;  3QP6 A;  2MJ6 A;  1WA9 A;  3HJI A;  3MS6 A;  1V9Z A;  3VP4 A;  1XJ2 A;  1G6O A;  1F5M A;  3IBR A;  1P9R A;  1ES4 A;  1H3Q A;  5AQ7 A;  2EFU A;  3UPN A;  4BL2 A;  1T1B A;  1IKG A;  1BLP A;  3G31 A;  4Y0T A;  5HAQ A;  3UE0 A;  2PR5 A;  2JKR M;  3LCE A;  1JNU A;  1XFN A;  1S4R A;  5EE8 A;  4DDY A;  4YNR A;  3T4S A;  2XD1 A;  4NXB A;  1TS0 A;  1C3B A;  3PTE A;  1X0O A;  3M2J A;  4WYY A;  3CG5 A;  1I2W A;  5L09 A;  3GTC A;  3WS1 A;  3LGO A;  3ZDJ A;  4DE2 A;  1OME A;  4KG6 A;  4X53 A;  5HAP A;  2H28 A;  1DP6 A;  5L10 A;  2W0N A;  5F82 A;  3NCK A;  3LR0 A;  4BBU A;  4X1L A;  4Y0O A;  4GB7 A;  2XGN A;  4N1H A;  2JHE A;  1HVB A;  5EVI A;  4OLG A;  1WYB A;  5M1A A;  4DF6 A;  1XPB A;  4KG5 A;  4P0M A;  5HPF A;  1LL5 A;  3GSG A;  4EER A;  4KZ7 A;  5CRF A;  2JBF A;  3FWL A;  3T4J A;  3WWX A;  4PKY A;  5HDC A;  4B9O A;  4HJ3 A;  1RCJ A;  5CHM A;  4Z1W A;  3L9K A;  3P98 A;  2XFS A;  3LEQ A;  2JKG A;  1UWP X;  5HWV A;  4N9L A;  4HJ6 A;  5HDD A;  1KE3 A;  1Y54 A;  1S1Z A;  3V5M A;  3B33 A;  3MZD A;  4JF4 A;  3RH8 B;  4MDZ A;  1KVM A;  3MXR A;  1PZO A;  1GCE A;  1XGJ A;  4KZ4 A;  4R0Q A;  1K57 A;  2IWC A;  1F98 A;  4JGP A;  1ZC2 A;  3A0R A;  1T18 A;  5FI6 A;  5CGX A;  1LI0 A;  4L9F A;  1PWC A;  4GDN A;  4EBP A;  1ES2 A;  4LRX C;  3CLO A;  1OTI A;  1RGY A;  2ZC6 B;  3D9Y A;  4XT2 A;  3VSL A;  2ZM8 A;  4R70 A;  4DXB A;  1ODV A;  1SKF A;  1GHM A;  1LHY A;  3M2K A;  3IT9 A;  4Y13 A;  3IWI A;  2I72 A;  2INW A;  3PAE A;  4B4X A;  4ZDX A;  1L0D A;  5EOO A;  2Y2O A;  3FYZ A;  2XLN A;  1LSX A;  3SS4 A;  1FCN A;  4P85 A;  2YKH A;  3T4L A;  2V2F F;  1E25 A;  1FSY A;  4GKU A;  4OPZ A;  2CC1 A;  3VOZ A;  3C4O A;  2QJ5 A;  4KUK A;  3C30 A;  2ZMA A;  4O0P A;  2WKH A;  3O88 A;  5GLB A;  1BZA A;  3H7W A;  4GD6 A;  3C2W A;  3HLD A;  5CEB A;  1AWI A;  1SZV A;  4S2M A;  1ZG6 A;  2V0U A;  4X1M A;  4H8R A;  5DJT A;  3TRC A;  4OPY A;  3MQO A;  3T4T A;  3MF0 A;  1JWP A;  3BLS A;  2R78 A;  4ETZ A;  2PRF A;  3LO7 A;  2XR0 A;  4MCW A;  4KUO A;  2D01 A;  1HLU P;  2ZOH A;  2NUT C;  3S1Y A;  3K2N A;  1ALQ A;  3G30 A;  4LPZ A;  1CJF A;  1K6S A;  5TGF A;  4KZ3 A;  3UDF A;  3Q81 A;  5EM1 A;  1NXY A;  1Y28 A;  2GZA A;  1MY8 A;  1JTG A;  4MN5 A;  4OQI A;  3PBQ A;  1BT5 A;  2H10 A;  2Z6C A;  4XXR A;  2Q9M A;  5CEC A;  3H7W B;  1OTA A;  4JXV A;  3DBA A;  4MN7 A;  2J9P A;  3AGE A;  2DMW A;  5HZH A;  1J9M A;  2H0Y A;  3TW8 A;  2V8F A;  3HCY A;  3BY9 A;  1NZO A;  2ZC4 B;  4DKI A;  4R23 A;  1K38 A;  3OPL A;  3IX8 A;  1EI5 A;  3JPU A;  3NEC A;  4GW9 A;  3UB6 A;  4NG2 A;  3BLM A;  4CLC D;  3F1O B;  5HW3 A;  2Y2N A;  3E4P A;  1G6A A;  5F68 A;  3GVB A;  2Y59 A;  3DTK A;  5F6A A;  2EWV A;  3BFC A;  2J3T C;  5DFY A;  2XRN A;  1FSW A;  3BFE A;  4WLA A;  5E43 A;  1RGZ A;  4I3J A;  3GQZ A;  1ESI A;  2WK0 A;  2ZBB A;  4YFM A;  5DTK A;  3HJK A;  1K55 C;  4KQQ A;  3CIT A;  1IYO A;  1LL8 A;  2P9V A;  4WZ5 A;  1PI5 A;  4LEN A;  1XJ6 A;  2WUQ A;  4CQH A;  2VA0 A;  4HEF A;  2XD5 A;  5TFQ A;  3HLG A;  4LV2 A;  5IS1 A;  4HY8 A;  1VEU B;  1NYY A;  2WAD A;  3T12 B;  1VET A;  4NXG A;  3A3I A;  4DE0 A;  5FI2 A;  5FQ9 A;  1PWD A;  1K25 A;  3IBJ A;  5CGW A;  2ZL1 B;  3A3F A;  4OP5 A;  5M18 A;  4ZJ1 A;  3C38 A;  1MWS A;  3GV9 A;  4GS9 A;  5IU1 A;  4FD8 A;  2PBD P;  4RX3 A;  3N4I A;  1YT4 A;  3EEH A;  1DP8 A;  2O9B A;  4KZ6 A;  4PAU A;  2VV8 A;  3TJZ C;  5F5Y A;  3JVV A;  3HL9 A;  1XKZ A;  1DY6 A;  1K4E A;  2HDQ A;  2W1T A;  2Y2I A;  2HF6 A;  5E2H A;  3FPV A;  2JKT M;  3CMZ A;  4JXG A;  1GSW A;  4I38 A;  4RX2 A;  1N4O A;  3M6H A;  2VGL S;  2Z6D A;  4IHQ A;  3OPH A;  4OOY A;  1E3U D;  3U2A A;  4GOG A;  5AJG A;  2HDU A;  4WMC D;  5HD5 A;  2V20 A;  3A3J A;  5L07 A;  3E2L A;  4X68 A;  2K2N A;  3SS5 A;  2EX8 A;  4N9K A;  2WKQ A;  4RYE A;  3CAX A;  3V67 A;  2A3U A;  1BUE A;  1TD5 A;  3IH9 A;  5KZH A;  2RCX A;  1XJ3 A;  4CPK A;  4I3I A;  4I39 A;  1MPL A;  4UA6 A;  4D60 A;  2CMN A;  4MN6 A;  3KYZ A;  5A92 A;  2HJ9 C;  3IS2 B;  2W1R A;  4CLC B;  3IF6 A;  4JF5 A;  4YOF A;  3C4P A;  4HNB A;  5AQA A;  2Z2M B;  4KQD A;  2PBY A;  4UAA A;  4YWZ A;  1ES5 A;  5F83 A;  4EES A;  4PPR A;  3DW0 A;  1O07 A;  4HBT A;  1M6K A;  2Y91 A;  1IEL A;  3BFG A;  4Y15 A;  1OTD A;  3C5A A;  3WS2 A;  1JWV A;  3NOP C;  3G6O A;  3I7J A;  4WZ5 C;  3N6I A;  5EV0 A;  3RJU A;  1F9I A;  2M7U A;  1L0E A;  2VK3 A;  1K0K A;  5E2E A;  3UY6 A;  4MNR A;  4QPR A;  2QYB A;  1EWZ A;  3QP4 A;  3VP0 A;  1MBL A;  3IF6 B;  3CPT A;  4FTX A;  4OOL A;  4WM9 A;  2E8J A;  4M3K A;  4NET A;  3VSK A;  4E04 A;  4HP9 A;  3G2Z A;  4R4R A;  2O99 A;  3CHW P;  4S2J A;  2Z2L B;  3N8R A;  1D7E A;  3UO9 A;  4XT2 B;  3ZQ5 A;  1FCM A;  3GR2 A;  5J8X A;  3UB9 A;  4BD0 A;  3U4L P;  2DCF A;  4OKP A;  3RXW A;  1OPX A;  5GLA A;  1F2K A;  5C5K A;  5HSQ A;  3AGD A;  1TEM A;  3Q07 A;  3QP8 A;  4EEU A;  2ZJ9 A;  4B93 A;  4R6L A;  1VQQ A;  2QWS A;  4IVI A;  4JLF A;  4QHC A;  2V1A A;  2VX8 A;  4LCL A;  3E4Q A;  3M6B A;  4F3L B;  1BSG A;  4OLD A;  2P08 A;  4FOF A;  4UQI M;  2XDM A;  4LV1 A;  1LLB A;  3LIB A;  3CPT B;  2LB5 A;  2J8Y A;  4ZRR A;  1OT6 A;  2OLU A;  5A91 A;  4BEN A;  5KIZ A;  3BEB A;  3DAV A;  3GEC A;  3VP1 A;  4WL9 A;  1ESU A;  4MLL A;  5M19 A;  2A49 A;  2ZQ9 A;  2ZMV A;  3GRJ A;  1I2S A;  4U3T A;  3UME A;  5TBM B;  2WKI A;  4MBK A;  4OPR A;  1Y4O A;  4QJG A;  1PW8 A;  1VM1 A;  2XK1 A;  4ZJ3 A;  4JPM A;  5FAO A;  4LLO B;  2ZQC A;  3UE1 A;  1LSW A;  3ZYT A;  5K5B A;  4K08 A;  3LY3 A;  3NC8 A;  5CED A;  3S7N A;  4R1G A;  4JKT A;  2KDK A;  4DRT A;  3A0S A;  2BAS A;  4UQI S;  1KVL A;  4CLC E;  2B02 A;  5HPI A;  2R9X A;  2H0T A;  4EBL A;  4M4X A;  1SKO B;  3PBR A;  2GDN A;  2BG1 A;  4QB8 A;  3KYQ A;  4WEL A;  2ZD8 A;  3MMH A;  2WGI A;  4RA7 A;  1YSQ A;  4WEJ A;  4L9E A;  3LR4 A;  1PYY A;  5IHV A;  4LRZ E;  1ES3 A;  3B42 A;  5CHU A;  1RP5 A;  5CHJ A;  3LYX A;  2EX9 A;  3UPP A;  2XSS A;  4E6W A;  1K54 A;  4S2N C;  4IBR A;  2FFY A;  4OQ0 A;  3S7O A;  5CGS A;  3IXG A;  3EQV A;  1H8M A;  1ZKJ A;  3ITB A;  2VJW A;  3BYD A;  5CX7 A;  3OCL A;  1W63 M;  3UB7 A;  2E8I A;  5GHY A;  4HP4 A;  3IX4 A;  1D06 A;  2W3D A;  4LGW A;  5J7E A;  2Y55 A;  1SHV A;  1YAX A;  4BL3 A;  1NLZ A;  4WMC A;  3BQA A;  1MWR A;  3Q1F A;  1E3U A;  1P9W A;  2X71 A;  2EXB A;  5KSH A;  4NK3 A;  3G2Y A;  2JN7 A;  4II7 A;  3T4O A;  3PBN A;  3E2K A;  5AVE A;  4DXC A;  1PRQ A;  2JKT I;  3UB8 A;  3G4P A;  3NOU C;  3NDE A;  1J3W A;  2DNS A;  1NWZ A;  2WAE A;  2Y8H A;  4WEK A;  3A3E A;  2ZLY A;  2WGW A;  4IED A;  4E3M A;  1H8Y A;  3HLB A;  4OPQ A;  4QY5 A;  4Y7P A;  2Y2J A;  5EVI C;  3IH8 A;  3ZG5 A;  4HQA A;  2Y2K A;  5I5L A;  2EFX A;  2ZL1 A;  1LI9 A;  1NLY A;  4DE3 A;  5EPH A;  3R7W B;  5DF8 A;  3BY8 A;  4GNU A;  5F1G A;  2VV6 A;  2V1Z A;  3ZVT A;  4EQ1 A;  5A90 A;  1GHP A;  4H6J B;  4NKP A;  3WS5 A;  4C75 A;  1IEM A;  2FZ0 A;  3FC7 A;  4C6Y A;  5GLD A;  3BW6 A;  2K31 A;  1K54 C;  1IYQ A;  5FEF A;  3WS0 A;  4Y17 A;  4DJ2 A;  4D2O A;  2P9V B;  4QD4 A;  1MWU A;  2XA7 S;  5KMW A;  2O9C A;  3FG8 A;  1TS7 A;  2EX6 A;  4PMA A;  1PW1 A;  1BLH A;  2HP6 A;  2PT7 A;  1KOU A;  1FR1 A;  1W5D A;  4JXS A;  2ZQ8 A;  2VEA A;  1YLZ A;  4B88 A;  1VEU A;  4E3L A;  3BFD A;  1FQG A;  3ZVW A;  2FFF B;  2KOI A;  2IA2 A;  2I9V A;  3OPR A;  2J3T D;  1ERO A;  4GCZ A;  5AQ9 A;  3E4O A;  5FDS A;  4FUW A;  5EVL A;  1E4D A;  5DTT A;  2G7U A;  4F3L A;  3HVF A;  2M7V A;  3MXS A;  3PYP A;  2Y2P A;  4GHI B;  1YKD A;  4NXF A;  4O7D A;  4MMN A;  3VP3 A;  1ZG4 A;  1ONH A;  5BOH A;  1PFL A;  4I5S A;  3V50 A;  4OON A;  1K56 D;  4IBX A;  1L3L A;  3LIE A;  2Y2H A;  1AXB A;  3A0V A;  1K57 C;  4KZB A;  3WRZ A;  5G4Y A;  4S2K A;  3D72 A;  3ZG9 B;  4KZ8 A;  3IF5 A;  2PD8 A;  3E0Y A;  4JGQ A;  4HOI A;  3EOI A;  4PHT A;  1W7F A;  5EVI B;  4OP8 A;  2ZC3 B;  4DDS A;  3LIA A;  1PIO A;  2PDR A;  4LFU A;  1BTL A;  4EEP A;  3PR6 A;  1QMF A;  4GDB A;  4JBF A;  3F1O A;  2M1C A;  1T19 A;  4EXO A;  3QP1 A;  4KG2 A;  1HD8 A;  3LR5 A;  4XUZ A;  4OH0 A;  2C5W B;  5FI7 A;  1KDS A;  4DJ3 A;  3KYE A;  3DWZ A;  3ZCZ A;  3S22 A;  2PAV P;  2V8C A;  3P7N A;  3SH7 A;  5G18 A;  5GLC A;  4U0T A;  2WKR A;  3ICY A;  1TVF A;  1SCW A;  3IQA A;  2WKP A;  4Y5F A;  1XP4 A;  1CEG A;  3UMD A;  4E3K A;  1OJ5 A;  1YQS A;  1DJC A;  4O8G A;  3S7P A;  2PHY A;  5EVE A;  2P7J A;  4ZJ2 A;  1CI9 A;  2WAF A;  5A8B A;  3F1N B;  2IWB A;  4P6Z S;  1S66 L;  2UWX A;  3TG9 A;  4PM7 A;  3K3D A;  5HWT A;  4A5R A;  2C6W B;  3MQQ A;  3V3R A;  4Q0H A;  1XFQ A;  2ZM2 A;  4DN0 A;  2OAQ 1;  1G68 A;  4OQH A;  2ZM0 A;  5GHZ A;  1L0F A;  4WZ4 A;  2A2L A;  1S0W A;  1VB6 A;  1S67 L;  4PM8 A;  3HLW A;  3FKV A;  1NYM A;  1TDL A;  3UE3 A;  1VHM A;  3HRE A;  3WRT A;  1PWG A;  1H8Z A;  5FL3 A;  3CI6 A;  1G5U A;  2PU2 A;  3OBF A;  3OLO A;  1IKI A;  3MQ0 A;  3FKW A;  5L2F A;  4AFI A;  4BJP A;  2G2W A;  1QME A;  2OWH A;  4JF6 A;  2XRO A;  5DKL A;  3IWO A;  4O01 A;  4PKY G;  2WGW B;  2EXA A;  5D3O A;  2B95 A;  3ISG A;  2B5R A;  1N9O A;  2HP9 A;  3MXQ A;  3DTM A;  1N9L A;  4KZA A;  1EW0 A;  3ZNT A;  4NEE D;  4KQO A;  3R7W A;  3EQU A;  3K3C A;  4E3J A;  3IX3 A;  4R3J A;  4G3V A;  3NY4 A;  2HZ5 A;  3BEC A;  3JVU A;  3ZG0 A;  1XXM A;  3Q7V A;  5FA7 A;  4Y0U A;  3IS2 A;  2W3G A;  2PYP A;  3D3O A;  3VFH A;  4CLC A;  1YM1 A;  2W3H A;  4BWI A;  3BFF A;  2KLI A;  1BLS A;  5FQM A;  4K91 A;  5HX9 A;  4MEZ A;  4FH4 A;  2JE5 A;  1CK3 A;  5L8M A;  1ACF A;  4DE1 A;  4EQI A;  2ZQ7 A;  3F1N A;  1NZU A;  1XA1 A;  5CTM A;  3FPW A;  5MC7 A;  2GJ3 A;  1GA0 A;  1T1A A;  2VGJ A;  2HV1 A;  5DVA A;  1L0G A;  3T1S A;  3W2Z A;  2VLG A;  4HJ4 A;  2XF3 A;  2Y2L A;  3OCN A;  4YIN A;  3HLF A;  4X25 A;  4U0X A;  3Q7V B;  5AQB A;  1CI8 A;  1K56 A;  2VZW A;  3HUM A;  5HD3 A;  4B4Z A;  5KSC A;  3V39 A;  4EW7 A;  1XJ4 A;  5FQI A;  2GNX A;  1GSX A;  2XFT A;  2EWW A;  5TJJ A;  3PXP A;  4BBV A;  2P04 A;  3O87 A;  1K55 A;  3BRM A;  1MKM A;  4WUJ A;  2O9A A;  1YLT A;  1LT0 A;  3UNW A;  4PM6 A;  1BLC A;  3IXB A;  2J7V A;  4G3K A;  3C7U A;  1KE4 A;  5FAS A;  1K6R A;  4QU3 A;  3KO6 A;  4IVK A;  3A3D A;  3ZG7 B;  3G35 A;  4ESP A;  4GZB A;  5E2F A;  4H6J A;  3IF6 C;  3F1P A;  4HBU A;  4E6X A;  4Q0J A;  3CUE A;  4EET B;  3T1X A;  5F69 A;  3MFX A;  2WKE A;  3NOT C;  5EEC A;  4Q8I A;  5JYP A;  3NIA A;  4I3A A;  1DRM A;  4Q0I A;  4S2L A;  3R4K A;  1O7E A;  2XH9 A;  2PD7 A;  4OOM A;  3MJQ A;  3Q82 A;  2K7S A;  4IJG A;  4IUH A;  3W4P A;  3ZNY A;  1A0K A;  3ZGA B;  1MC0 A;  1Q2Q A;  1JTD A;  3QNB A;  3PBT A;  2OWJ A;  3N7W A;  4DMZ A;  1OTE A;  1GHI A;  1MZU A;  3G34 A;  4RVA A;  2IWD A;  3BQ8 A;  4HH3 A;  4UA7 A;  3UDI A;  1MWT A;  2ZMF A;  2BTF P;  3B3X A;  5FAP A;  5HWW A;  3IWQ A;  1V9Y A;  1SDE A;  2Y2Q A;  3HLE A;  3D4F A;  4E3N A;  3SH8 A;  2J80 A;  3IHA A;  3EWK A;  3N8S A;  3LUQ A;  3N8L A;  4R3A A;  4Y3I A;  5I94 A;  4LRY C;  3DTI A;  1PZP A;  3O86 A;  3NUL A;  1FCO A;  1N9B A;  1JVJ A;  2QHK A;  3MZF A;  3HUO A;  2J3W A;  4S2O A;  3FZC A;  3UDX A;  3OPP A;  4P6B A;  4X56 A;  5EVI D;  5AVF A;  5CER A;  1H0M A;  1T1C A;  2HDS A;  2QPN A;  2WYX A;  5TBM A;  3VMA A;  3PBS A;  2V1B A;  1HTZ A;  2HP5 A;  2W27 A;  1N9N A;  1UWN X;  2VV7 A;  3GDI A;  2OLV A;  4XUX A;  3OZH A;  4FCF A;  1IFQ A;  1OTB A;  3CJM A;  3NI9 A;  3SW1 A;  2DRW A;  4P87 A;  3ZFZ A;  3F1P B;  4L9G A;  3DWK A;  3UE6 A;  4GD8 A;  1LSV A;  3EGX C;  1NRF A;  2QKP A;  3RFB A;  2L0W A;  3H9W A;  1NY0 A;  1YLP A;  1M40 A;  3S7Q A;  2Y2M A;  2XQZ A;  3NDG A;  3VOL A;  4BLM A;  1WYC A;  2KX6 A;  2UV0 E;  4FSF A;  3UB5 P;  2O0Y A;  4E3O A;  1NJ4 A;  1XGI A; 
#chains in the Genus database with same CATH homology
 4EES A;  4ME4 A;  4NXB A;  4EXO A;  3LR5 A;  1TS0 A;  2W3F A;  1X0O A;  4DJ3 A;  5DKK A;  1GSV A;  3EGD C;  2PYR A;  2XA7 M;  3P7N A;  1OTD A;  2VKS A;  1TS6 A;  5J3W A;  2WKR A;  3ICY A;  3NOP C;  3G6O A;  2H28 A;  1DP6 A;  2WKP A;  3KSG A;  4UEY A;  2W0N A;  4Y5F A;  3LR0 A;  3UMD A;  1NRJ A;  1OJ5 A;  3H82 B;  4BBU A;  2YKF A;  4O8G A;  3S7P A;  1F9I A;  2M7U A;  2PHY A;  2ZOI A;  2JHE A;  3LIF A;  3B47 A;  2P7J A;  4P6Z M;  2W1T B;  3KX0 X;  4QPR A;  2QYB A;  4GHI A;  5A8B A;  3F1N B;  5EFW A;  4P6Z S;  1S66 L;  3LFV A;  5HDS A;  1YSP A;  3CUE C;  5HPF A;  3LR3 A;  4EER A;  3K3D A;  4OOL A;  5HWT A;  4ARZ A;  3T4J A;  4PKY A;  5HDC A;  3MQQ A;  4B9O A;  4HJ3 A;  4Q0H A;  5DF9 A;  4E04 A;  1XFQ A;  4Z1W A;  2FH5 A;  4DN0 A;  4HP9 A;  2OAQ 1;  1UWP X;  5HWV A;  2O99 A;  4HJ6 A;  5HDD A;  3P01 A;  2A2L A;  1D7E A;  1VB6 A;  1S67 L;  4XT2 B;  1S1Z A;  3ZQ5 A;  3B33 A;  3RH8 B;  4MDZ A;  3UB9 A;  3UE3 A;  1VHM A;  2OOL A;  1OPX A;  2HGV A;  5C5K A;  5HSQ A;  1F98 A;  4JGP A;  5FL3 A;  3A0R A;  1T18 A;  4EEU A;  1OJG A;  3CI6 A;  3T4Q A;  4L9F A;  5IT5 A;  4B93 A;  4R6L A;  3OBF A;  3OLO A;  2QWS A;  4GJ4 A;  3MQ0 A;  4LRX C;  2V1A A;  2VX8 A;  3CLO A;  1OTI A;  4AFI A;  4BJP A;  3E4Q A;  2W3E A;  2OWH A;  4F3L B;  2XRO A;  4XT2 A;  2P08 A;  4FOF A;  5DKL A;  4O01 A;  4UQI M;  4PKY G;  5G4Z A;  4R70 A;  3LIB A;  2LB5 A;  1ODV A;  4ZRR A;  4ARZ B;  1OT6 A;  1N9O A;  3MXQ A;  5KIZ A;  1N9L A;  2Y79 A;  1EW0 A;  2INW A;  4NEE D;  4KQO A;  3GEC A;  3R7W A;  4WL9 A;  3EQU A;  4R38 A;  3K3C A;  4WN5 A;  1BYW A;  2D02 A;  2ZMV A;  4G3V A;  1LSX A;  3JVU A;  3UME A;  5LBR A;  2YKH A;  3OOV A;  3T4L A;  5TBM B;  3IS2 A;  2W3G A;  3VE4 A;  2PYP A;  3D3O A;  2V0W A;  2QJ5 A;  4KUK A;  3T4K A;  4CLC A;  4LLO B;  3C30 A;  4BBT A;  4JGO A;  4O0P A;  1LSW A;  2W3H A;  3ZYT A;  2VGL M;  5K5B A;  3H7W A;  4GS9 B;  4BWI A;  4K08 A;  2A24 A;  2KLI A;  1TS8 A;  3C2W A;  4RQ9 A;  3S7N A;  2KDK A;  3H82 A;  3A0S A;  5DFX A;  5HL6 A;  2BAS A;  2EA9 A;  4UQI S;  2V0U A;  5L8M A;  4CLC E;  2B02 A;  5HPI A;  5DJT A;  3TRC A;  3MQO A;  3T4T A;  4M4X A;  3PBR A;  3MF0 A;  3F1N A;  2R78 A;  3KYQ A;  4WEL A;  3FPW A;  4ETZ A;  5MC7 A;  3MMH A;  4Y2F A;  4MCW A;  2GJ3 A;  4KUO A;  1T1A A;  2D01 A;  1YSQ A;  2HJE A;  4WEJ A;  2ZOH A;  3NHQ A;  2NUT C;  2HV1 A;  3C8C A;  1UGU A;  3K2N A;  3LR4 A;  4L9E A;  3NJA A;  3BJN A;  4LRZ E;  3B42 A;  3W2Z A;  3RTY A;  2VLG A;  4HJ4 A;  4LPZ A;  3LYX A;  3OCN A;  2XSS A;  4L0L A;  4IUK A;  3S7O A;  4ETX A;  3EQV A;  1Y28 A;  2VZW A;  1H8M A;  2GZA A;  5HD3 A;  4MN5 A;  2VJW A;  2V9A A;  5CX7 A;  4EW7 A;  3OCL A;  1XJ4 A;  1W63 M;  3UB7 A;  3PBQ A;  1G28 A;  2GNX A;  1GSX A;  4HP4 A;  1D06 A;  2W3D A;  5J7E A;  2Z6C A;  2EWW A;  5TJJ A;  3PXP A;  4BBV A;  2A24 B;  1YAX A;  2GX5 A;  1OT9 A;  2P04 A;  3H7W B;  1NLZ A;  1OTA A;  3EEA A;  3BQA A;  3DBA A;  1MKM A;  4MN7 A;  4HI4 A;  2DMW A;  5HZH A;  3KSF A;  4WUJ A;  2O9A A;  1LT0 A;  1P9W A;  3TW8 A;  3HCY A;  3BY9 A;  3CWF A;  5KSH A;  4G3K A;  4GW9 A;  3UB6 A;  2JN7 A;  2OAP 1;  1T19 A;  4JGR A;  4II7 A;  3T4O A;  4CLC D;  3KO6 A;  3PBN A;  5AVE A;  3F1O B;  2JKT I;  3UB8 A;  3E4P A;  3NOU C;  5F68 A;  4H6J A;  2JKR I;  1NWZ A;  3F1P A;  4EUV A;  2Y8H A;  2L1M A;  5F6A A;  2EWV A;  4WEK A;  2J3T C;  4Q0J A;  3OC2 A;  5DFY A;  2XRN A;  3CUE A;  3VV4 A;  4WLA A;  4EET B;  2B18 A;  4I3J A;  5F69 A;  3MFX A;  2ZBB A;  4HQA A;  5I5L A;  2LB9 A;  3PHY A;  1NLY A;  3BWL A;  2NUP C;  3R7W B;  3HJK A;  3NOT C;  1TF1 A;  3CIT A;  3BY8 A;  4I3A A;  1DRM A;  1LL8 A;  4NXE A;  2VV6 A;  4Q0I A;  1DP9 A;  1XJ6 A;  3R4K A;  1P0Z A;  4EQ1 A;  2PD7 A;  3ULF A;  3TE8 A;  4OOM A;  3MJQ A;  4H6J B;  2K7S A;  4G3W A;  4NKP A;  4IJG A;  4CQH A;  2VA0 A;  4IUH A;  3VE3 A;  1MC0 A;  1IOU A;  3O5Y A;  3PBT A;  4HHD A;  2OWJ A;  2FZ0 A;  3FC7 A;  4DMZ A;  1OTE A;  5IS1 A;  4HY8 A;  3BW6 A;  2K31 A;  1S4S A;  4NXG A;  3LID A;  1MZU A;  3BQ8 A;  4HH3 A;  3IBJ A;  4DJ2 A;  2ZMF A;  3LI8 A;  2XA7 S;  3C38 A;  2O9C A;  3FG8 A;  1P97 A;  4GS9 A;  5HWW A;  5IU1 A;  1W63 Q;  1TS7 A;  1V9Y A;  4BMW A;  5J4E A;  4CLC C;  3EEH A;  1DP8 A;  2PR6 A;  1ZTU A;  2O9B A;  2PT7 A;  3T50 A;  1KOU A;  4PAU A;  2VV8 A;  2J80 A;  1STZ A;  3MR0 A;  3TJZ C;  2VEA A;  3E98 A;  5F5Y A;  4HIA A;  3JVV A;  3EWK A;  4WF0 A;  2QJ7 A;  1S1Y A;  2L4R A;  3LUQ A;  4R3A A;  3KSH A;  4Y3I A;  2KOI A;  2W1T A;  2IA2 A;  4LRY C;  2HF6 A;  2I9V A;  3FPV A;  2JKT M;  2J3T D;  3KSI A;  4GCZ A;  1GSW A;  3E4O A;  4I38 A;  2QHK A;  2VGL S;  2Z6D A;  4IHQ A;  2J3W A;  1ZHH B;  5DJU A;  2G7U A;  4F3L A;  3LIC A;  3U2A A;  5AVF A;  5AJG A;  2M7V A;  3PYP A;  5HD5 A;  3PBO A;  1T1C A;  4GLQ A;  4GHI B;  1YKD A;  3LI9 A;  4NXF A;  5TBM A;  2K2N A;  3PBS A;  4MMN A;  2V1B A;  2WKQ A;  4EU0 A;  4HH2 A;  3CAX A;  4I5S A;  2W27 A;  1N9N A;  1UWN X;  2MJ6 A;  1WA9 A;  3V67 A;  3HJI A;  2VV7 A;  3GDI A;  1TD5 A;  1V9Z A;  1IFQ A;  3LIE A;  1OTB A;  1XJ2 A;  3SW1 A;  1XJ3 A;  1G6O A;  1F5M A;  4I3I A;  4I39 A;  3IBR A;  1P9R A;  3A0V A;  1H3Q A;  5G4Y A;  3F1P B;  3D72 A;  4L9G A;  2CMN A;  4MN6 A;  3KYZ A;  3UE6 A;  2HJ9 C;  1LSV A;  3IS2 B;  1T1B A;  2PD8 A;  3E0Y A;  4JGQ A;  4HOI A;  3EOI A;  4PHT A;  2W1R A;  3EGX C;  2PR5 A;  2JKR M;  2QKP A;  1JNU A;  4CLC B;  3RFB A;  2L0W A;  3H9W A;  1XFN A;  4YOF A;  3LIA A;  2PDR A;  1S4R A;  4HNB A;  3S7Q A;  3VOL A;  4EEP A;  4KQD A;  4YNR A;  3PR6 A;  3T4S A;  3F1O A;  2KX6 A;  4FSF A;  2O0Y A;  4YWZ A;  2M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...