3K3DA

The n-terminal pas domain crystal structure of rv1364c from mycobacterium tuberculosis at 2.3 angstrom
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
127
Chain Sequence
MDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein Rv1364c/MT1410
publication title The N-Terminal Pas Domain Crystal Structure of Rv1364C from Mycobacterium Tuberculosis at 2.3 Angstrom.
rcsb
source organism Mycobacterium tuberculosis
total genus 32
structure length 127
sequence length 134
ec nomenclature
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08448 PAS_4 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3k3dA00
2ZOIA 2Z6CA 2W27A 1XFQA 4I38A 3IBRA 3NOUC 4HIAA 2KX6A 2Z6DA 2OWHA 1S1YA 2JHEA 4EXOA 3E4OA 3LIAA 4F3LB 1T19A 5TBMB 3GECA 1OTAA 3MQOA 1LT0A 2H28A 5J4EA 4HJ3A 4H6JB 3LIFA 4EESA 2QKPA 4EETB 4LRZE 3H7WA 1P97A 4LPZA 3D72A 4MN5A 3F1PA 3NJAA 1S4RA 3PHYA 3H82B 3MJQA 2ZOHA 3RH8B 2QHKA 4NXEA 1OTDA 4LRYC 1DP9A 3F1NA 3UMDA 1GSWA 2PYPA 3T50A 5J7EA 1LSVA 3SW1A 1N9NA 4KUKA 3BWLA 4I39A 4R3AA 2L1MA 4HH2A 5HD5A 5IS1A 1OTBA 3K3DA 2YKHA 1TS6A 2L0WA 5HSQA 3NOPC 3KX0X 2B02A 3UMEA 5EFWA 3LICA 2OOLA 3NOTC 2KDKA 3FC7A 2VV7A 3A0RA 5F5YA 4MN6A 3P7NA 2WKPA 1MZUA 1UGUA 1V9ZA 1JNUA 4KUOA 5J3WA 2PHYA 2VV6A 1OT9A 3BY8A 1UWPX 2VEAA 4GS9A 3UB7A 2V1AA 2K7SA 3LIEA 5G4YA 1UWNX 2D02A 3UB6A 3VE3A 5DKLA 3G6OA 4XT2A 2A24B 3ZQ5A 1X0OA 4WUJA 1VB6A 2I9VA 2R78A 4HP9A 2OWJA 4HQAA 1Y28A 5F6AA 2CMNA 4WN5A 3H7WB 2PD7A 5HDDA 2PDRA 4HH3A 3IS2B 3EWKA 5HDSA 1G28A 2PR6A 4WL9A 4I5SA 4RQ9A 4HHDA 2M1CA 4HNBA 3F1OA 2PD8A 1BYWA 1S67L 4I3AA 3MFXA 1OTIA 2V0WA 5HWWA 4LRXC 2D01A 3UB8A 5HZHA 1S1ZA 4GHIB 3LI8A 5HWTA 1GSVA 1TS8A 4HJ4A 2QJ7A 2V0UA 3CWFA 2WKQA 4EW7A 4I3IA 4LLOB 1XFNA 3UB9A 3MQQA 4DJ2A 3FG8A 2GJ3A 4R6LA 2EA9A 2PYRA 4R38A 4WF0A 4L9EA 1EW0A 4DJ3A 1TS7A 2W0NA 4R70A 1S66L 4JGQA 4F3LA 2VLGA 4JGPA 4EEUA 1N9OA 5TBMA 3RTYA 3BY9A 3CLOA 4HOIA 3NHQA 3LIBA 3VE4A 4H6JA 5DJTA 3MR0A 3LI9A 4HJ6A 4NXGA 1XJ6A 2ZBBA 3E4QA 3K3CA 3H82A 2PR5A 4YWZA 4WLAA 2QJ5A 3LIDA 5I5LA 1DRMA 4M4XA 5AVEA 1V9YA 1OJ5A 1XJ3A 4GCZA 4EERA 3OLOA 3A0VA 2YKFA 1DP6A 4HY8A 3MXQA 5F68A 4E04A 1GSXA 5DKKA 1ODVA 4BBUA 3VOLA 3F1PB 1S4SA 3HJIA 3LYXA 3LUQA 4EEPA 5AVFA 4KQDA 3F1NB 1F98A 1XJ4A 4K08A 1F9IA 2J80A 1LSXA 4PKYA 5HWVA 1T1BA 5IU1A 2JN7A 2V1BA 2A24A 1T1AA 1TS0A 1OTEA 4BBTA 4GW9A 1T18A 3CAXA 4JGOA 1NWZA 3B33A 4L9GA 5G4ZA 1XJ2A 3E4PA 5KIZA 4HP4A 1WA9A 3GDIA 3IS2A 4BBVA 1N9LA 1D06A 2P7JA 4GS9B 1D7EA 3A0SA 3H9WA 1P0ZA 3C2WA 4B9OA 5A8BA 4GHIA 3EEHA 4HI4A 3C8CA 5DJUA 4XT2B 1OT6A 3PYPA 4NXFA 4PKYG 1LL8A 4I3JA 5F69A 3HJKA 3ICYA 2INWA 1T1CA 1OJGA 3UE6A 2V9AA 1LSWA 5HD3A 2VV8A 2HV1A 2L4RA 4JGRA 2QWSA 1DP8A 2BASA 3F1OB 4L9FA 5HDCA 2WKRA 4NXBA 3ULFA 4EQ1A 1KOUA
chains in the Genus database with same CATH superfamily
3KYEA 2HJEA 4I38A 3IBRA 1FCOA 4ZRRA 2WGWB 5MC7A 4IBXA 5CXWA 4HIAA 1TDLA 3C4OA 2KX6A 3WS0A 3LEZA 4FH2A 2P08A 3IWIA 1KE4A 3ZHHA 4X68A 2Z6DA 4PM7A 1S1YA 3DWKA 2CC1A 2ZMFA 3LIAA 5EVIA 4Y0OA 5CEDA 1T19A 3I7JA 2V20A 5JYPA 4CLCD 4BD0A 3NI9A 1LT0A 2H28A 4F94A 2Z2LB 5FQMA 1CJFA 3WS1A 2QKPA 3HLWA 1IOUA 3BW6A 5EVLA 4S2NA 3D72A 3FKWA 3W8KA 3NJAA 3N8LA 3JPUA 3MJQA 5L10A 3RH8B 2EWVA 4NXEA 1XX2A 2XK1A 3TG9A 1K4FA 3OBFA 4E3LA 5HAPA 1W63M 5CHMA 4CPKA 4DRTA 5EVEA 2OLVA 2HDQA 5GLCA 5EVID 4I39A 1YPRA 3QNBA 2X71A 3T4LA 1ZG6A 5HL6A 3NDGA 3SS4A 5IS1A 3FZCA 2YKHA 3MQ0A 3UMEA 3LICA 2KDKA 3A0RA 3V67A 3UDFA 4ETZA 3QP4A 3D3OA 1MKIA 4OPYA 4R0QA 4HEFA 1M6KA 4KUOA 1H8ZA 1OT9A 1UWPX 2VEAA 5FQJA 3T1RA 4WM9A 3A3JA 3QP6A 3SOIA 3P01A 1TVFA 4XXRA 2J8YA 4UEYA 2OLUA 5G4YA 2ZQAA 4ARZB 4Q0JA 4E3IA 2H0TA 3M6BA 4EUVA 1S0WA 1DJAA 1YM1A 3KSFA 1GHPA 4WEJA 2A24B 4WEKA 5CRFA 1X0OA 5CGXA 4WUJA 2EFXA 1ES3A 2WKHA 2XLNA 4HP9A 4WMCD 3D9YA 4D2OA 1VHMA 3TOIA 5F6AA 1NZOA 2E8IA 1OPXA 2PD7A 4Q0IA 2ZMVA 3VFFA 2VZWA 4N1HA 4ZTKA 3ZFZA 4WL9A 1RGYA 4L0LA 4QD4A 1WYCA 2P9VB 2M1CA 3C5AA 2XDMA 3F1OA 3HLCA 4I3AA 1LL9A 2ZM0A 3SH9A 2D01A 3OPHA 5HZHA 2B18A 4GHIB 5DF7A 4GJ4A 1FCMA 1TS8A 1E4DA 1ERMA 1YMSA 3CWFA 1PZPA 4LLOB 5DTTA 4JF4A 4B4XA 4R6LA 3PR6A 5HW3A 3T4SA 1NYYA 1XGIA 1JWVA 4K0XA 3UN7A 4MBFA 1K6SA 5FDHA 2IWBA 3ZG0A 5FI6A 5FASA 3EQVA 3IH8A 2B5RA 4EEUA 3Q82A 5TBMA 3MSHA 3RTYA 3BY9A 1IKIA 2Q0OA 1IKGA 1FR6A 3LIBA 3VE4A 1XA1A 4H6JA 4QWOA 3FPVA 3NY4A 1NLYA 3T4KA 2WGVA 3BM6A 4DDYA 2XEPA 1ERQA 3QP5A 2QZ6A 3ZVWA 5HL1A 1K55A 5CTMA 1NZUA 2NUTC 2VX8A 4X69A 1W7FA 1CEFA 1FQGA 4GCZA 4GB7A 4EERA 2FH5A 4X56A 4GD8A 1PWGA 1WE4A 2ACGA 4UA9A 3V3RA 3G2YA 1NRFA 3MXQA 3LFVA 5F68A 1GSXA 3RXXA 3W4QA 4OQHA 3IWOA 1ODVA 1W8QA 3VOLA 4BD1A 1HTZA 1S4SA 2KOIA 5C5KA 4Y13A 3LUQA 5A93A 4KZ3A 3ZNTA 2HPBA 5CHUA 2E8JA 2ZLYA 5L2FA 4BL3A 3LY4A 1YT4A 4Y17A 3GMWA 3IHAA 5DFYA 3U2AA 3FYZA 1L3LA 5F83A 2H10A 2ZD8A 2XROA 5KMWA 1NXYA 4R4RA 4KQRA 2XD5A 2ZC5B 5CGWA 3UY6A 4Q8IA 2GX5A 1TS0A 2Q9MA 1T18A 2HDUA 4JGOA 1YLTA 2Y2QA 4ME4A 5G4ZA 4X25A 3N8SA 5FEFA 4S2IA 4ID4A 2WZZA 3PBQA 1EI5A 3OPLA 5GLDA 3VSLA 1D7EA 5AQ7A 4PMAA 3UDIA 1G6OA 3H9WA 4II7A 3LR4A 2JKFA 3EEHA 3A3DA 3G2ZA 3EQUA 5DJUA 3NDEA 1OT6A 3BFEA 2J3TC 1H5XA 4FUWA 4PM8A 5FI7A 1KVMA 3T1QB 5HAQA 2G7UA 4S2LA 4I3JA 1Q2QA 1W63Q 5F69A 3PTEA 5FAQA 3OCLA 2OAQ1 1ONGA 4Y3IA 3T4QA 2X02A 2VV8A 3S7PA 5HFOA 3MKEA 4JGRA 1E25A 4FCFA 4GNUA 2HP6A 2PT7A 3RXWA 2DRWA 3QP8A 4ETXA 4L9FA 4NXBA 4P6ZS 4GLQA 3R7WB 2W27A 1JTGA 3M2JA 4C6YA 3T4OA 4LV2A 2XA7S 2IA2A 3BECA 4CQHA 3NOUC 2MJ6A 3RJUA 3ZYTA 3MZFA 3LCEA 1GA0A 4P6ZM 3D4FA 2OWHA 1YKDA 2JHEA 1D1JA 3WRTA 4OP8A 4ESPA 1PRQA 2XA7M 4PM6A 1BZAA 3DW0A 3LO7A 3DBAA 3T4TA 4F3LB 2VGKA 4NKPA 1BT5A 3MQOA 4DF6A 5HAIA 3HUNA 3S1YA 1BTLA 4EESA 4EETB 2J9PA 4KZBA 4DXBA 1S4RA 3H82B 2ZOHA 3CUEC 1HVBA 1XKZA 3U4LP 3UMDA 2Y59A 1GSWA 2Y2JA 3C7UA 3T50A 3B42A 5TJJA 1N9NA 4KUKA 2M7UA 3BWLA 3HL9A 4R3AA 2X01A 2VK3A 2ZL1B 5HPFA 1YLZA 5AQBA 3V5MA 3PBNA 3K3DA 4P85A 3Q7VB 4IVKA 4OOLA 3DAVA 1VEUB 3A3EA 1SHVA 2QPNA 5EFWA 3RFBA 1J9MA 4NG2A 4IEDA 1IFQA 1MWRA 1PWCA 5F5YA 4GKUA 3VP2A 1JNUA 2VV6A 1TF1A 3B3XA 4S2MA 1CQAA 4QB8A 3Q07A 1IYQA 2VGLS 2V1AA 1H8YA 3OCNA 1N9BA 1DY6A 2Y2GA 3UB6A 3TW8A 4Q0HA 3S7NA 2O99A 4O01A 5DKLA 1O7EA 1AXBA 4ZJ2A 3DTMA 4LCLA 2VGLM 3GSGA 1YSQA 4Y15A 4IHQA 4OONA 2EXAA 2W1TB 1BSGA 1VQQA 2WGIA 2Y8HA 1H8MA 2Z2MB 5HDDA 1JVJA 4RA7A 3JYIA 4HH3A 3A3IA 4AFIA 2XQZA 3ZG7B 3T1SA 5HDSA 3TRCA 3VP3A 3ITBA 2M7VA 3FKVA 3VOZA 3IF6B 3O88A 2A49A 1AWIA 1BYWA 3MZEA 4EBLA 1BLPA 4JLFA 1OTIA 2V0WA 4FH4A 5HWWA 3EGDC 5K5BA 4LRXC 1MKMA 3E0YA 3UB8A 1K54C 3IH9A 3KSGA 4G3WA 4HJ4A 2V0UA 4Z1WA 3N7WA 4N9LA 1K57A 1W8YA 4I3IA 3VP0A 5KSCA 1XFNA 4S2OA 3UB9A 3SS3A 3O86A 4DJ2A 1SCWA 2GJ3A 2JKGA 4DE3A 4MNRA 1FILA 4U0TA 1VETB 4R70A 1ESUA 3HLGA 4JGQA 5DTKA 2VLGA 1N9OA 4IBRA 4E3NA 4Y0UA 3CLOA 4CLCB 4KZ9A 2EX2A 2Y2NA 2H0YA 4GDBA 4WMCA 1FR1A 4OQ0A 1JWZA 4NXGA 5FATA 3E4QA 3K3CA 1GHIA 5FAPA 2VKSA 2HJ9C 4MLLA 3LIDA 2OSUA 1L0GA 1HZOA 2W3GA 4OH0A 1DRMA 5AVEA 2WKIA 4PAUA 5EVIB 5AQ9A 1IEMA 2PU2A 4Y5FA 4UHUA 3OLOA 5FEGA 3NULA 3A0VA 4P87A 2XSSA 2YKFA 1DP6A 3PAGA 4P0MA 3V39A 1MC0A 2DCFA 4E04A 5DKKA 4N92A 3SH7A 1FIKA 5FQKA 4JXSA 3W2ZA 3LYXA 4QY5A 3GR2A 4MDZA 3CMZA 5AVFA 4DDSA 2V1ZA 1PFLA 3ZG9B 4K08A 3PBTA 3ZVTA 3FV7A 1LSXA 3G30A 1SZVA 1XP4A 2GNXA 4HBUA 5HWVA 2GZAA 4GOGA 2V1BA 2IWDA 4JXGA 4OPQA 3DTIA 3MZDA 2Y2HA 1CI8A 4IUHA 1M40A 1NWZA 3NCKA 4CLCE 1PIOA 4YNRA 3IXBA 5FQIA 2ZC4B 1PZOA 1DJBA 1WA9A 5IT5A 3IS2A 2ZM2A 1TEMA 3VV4A 4OP5A 4LENA 3OPPA 3UE3A 5EM0A 5FDSA 3M6HA 1I2SA 1IYPA 4EQIA 4OLGA 4NETA 4BJPA 1ZC2A 4KG2A 2V2FF 5A91A 4R1GA 2FFFB 3C8CA 1F2KA 1MBLA 3PYPA 3UE1A 3C38A 2JKTM 4K91A 4PKYG 4DN0A 3SS5A 1LL8A 3V50A 2WZXA 2Y79A 4ZJ1A 2BLSA 2WUQA 3HJKA 3ICYA 2INWA 2AVXA 4XUXA 5GLAA 2P74A 3UPPA 4WBGA 3HUOA 2V9AA 5HD3A 4PHTA 4YINA 4ZJ3A 1OMEA 4U0XA 2R9WA 3LY3A 2QWSA 4FTXA 4MEZA 3F1OB 4QU3A 1BUEA 3ZDJA 1K38A 1H3QA 4H8RA 5HDCA 1STZA 5U47A 1KOUA 2ZOIA 5CTNA 2BG1A 1ES2A 3GRJA 2V8CA 4Y0TA 2Y2PA 2K2NA 3OPRA 3DTEA 4RVAA 4JF6A 1PW1A 2J3TD 4GZBA 2RCXA 4X55A 2Q9NA 3O3VA 3CITA 4RX2A 3LEQA 4YOFA 5TBMB 3E2KA 3GECA 3IXDA 1NY0A 4FOFA 4H6JB 2G2UA 3A3FA 4HESA 3WWXA 3LIFA 3IF5A 2Y55A 4PPRA 5D3OA 3H7WA 1P97A 4OOYA 2OAP1 3F1PA 1KDSA 1LHYA 3IX3A 3UDXA 3QP2A 3ITAA 4LFUA 2XRNA 2QHKA 1OTDA 3BRMA 4LRYC 3IHBA 3F1NA 4UA7A 3BJNA 2PYPA 5J7EA 1LSVA 3B47A 2DNSA 2L1MA 1PNEA 5HD5A 1Y54A 1OTBA 1P9WA 3L7HA 3NOPC 2W1RA 1XXMA 2B02A 4B4ZA 3CI6A 2EWWA 5E2GA 2OOLA 5L07A 1K55C 3CHWP 3FC7A 2VV7A 1GHMA 1ZTUA 4MBKA 2VA0A 3DWZA 3GV9A 4LV1A 2ZM8A 4DMZA 1MZUA 1V9ZA 3DTKA 3VSKA 5AQAA 2EXBA 3BQAA 2O0YA 4GS9A 2JKTI 1KDWA 3LIEA 4MN7A 1UWNX 4CJNA 1BULA 1SKOA 1J3WA 1GA9A 3G4PA 3T12B 1G68A 4JXWA 1YLYA 1ZKJA 1ZG4A 3N6IA 5LBRA 3VE3A 4XT2A 3ZQ5A 2ZC6B 4R23A 3HUMA 2I9VA 5E2EA 3QP1A 5GLBA 3WS2A 1QMFA 4HQAA 5EUAA 2ZMAA 3ZG8B 4JXVA 3H7WB 5CECA 3MKFA 3CJMA 1VM1A 3EWKA 4IJGA 4WZ5C 4RQ9A 2ZQCA 1RGZA 3VOYA 2VGJA 3MFXA 2WKEA 1F5MA 4JBFA 3CPTA 1LI9A 3T1XA 4UQIS 1S1ZA 2I72A 3GQZA 3LI8A 1HLUP 5HWTA 3O5YA 4NEED 3WS5A 2J3WA 2WGWA 2QJ7A 2WKQA 5E2HA 4R4SA 4X6TA 5DVAA 5FA7A 3MQQA 1NJ4A 2Y2IA 3HLFA 1K56D 5A92A 1K54A 2EA9A 2PYRA 3ISGA 4R38A 2KLIA 4WF0A 4UQIM 1EW0A 4DJ3A 1TS7A 1BLHA 3OZHA 1LLBA 3C4PA 1S66L 5EPHA 4DE2A 3LGOA 3NBLA 4JGPA 3WS4A 1PW8A 1GCEA 2Y2KA 4B88A 3SH8A 1MWUA 1SDNA 4DXCA 4EU0A 3Q7ZA 4O8GA 4YFMA 3S22A 3IXGA 5M1AA 5DJTA 4FD8A 3M2KA 3LI9A 4HJ6A 3IWQA 1KE3A 3MS6A 3S7OA 1S6RA 3HLDA 1IELA 3BLSA 2PR5A 4WLAA 2QJ5A 5DFXA 3MBZA 1KGGA 3BFFA 2UWXA 4R3BA 4IUKA 4OPRA 5AJGA 1KGEA 4M4XA 1N4OA 3TE8A 2HDSA 4N9KA 4MBHA 1V9YA 1OJ5A 2O9CA 3BFDA 2ZC7A 4E3MA 2QMIA 3G35A 5BOHA 2DMWA 4KZ8A 3KYQA 1IYSA 4LGWA 1EROA 1WYBA 5FQQA 1ONHA 3VP1A 2RL3A 2EFUA 4BBUA 1PWDA 2XH9A 1MPLA 4KZ4A 4EEPA 1ESIA 4S2KA 1TDGA 3PBOA 4OQIA 4JKTA 1YSPA 4S2JA 1Z6FA 2J80A 5CGSA 4ARZA 4UAAA 1DJCA 4PKYA 2XFTA 1SDEA 5F82A 2JCHA 3UB5P 3ZCZA 2A24A 3KYZA 4GN2A 4EUZA 1OTEA 4BBTA 3CAXA 2JC7A 1O07A 3MXRA 3B33A 3IF6C 1K4EA 1XJ2A 5KIZA 3HLBA 4KENB 4X1LA 3GDIA 4BBVA 3BFCA 1N9LA 2UV0E 1I2WA 4PM9A 2P9VA 2HZ5A 3IXHA 3SZTA 2R9XA 3A0SA 4JF5A 4QPRA 3CG5A 2FZ0A 1YAXA 3C2WA 1FCNA 4B9OA 5A8BA 4GHIA 2WAEA 4HI4A 5DF9A 2QYBA 4NXFA 3G32A 2BTFP 4RX3A 1K0KA 4D60A 3VP4A 3HREA 3G34A 5E43A 3ZNYA 4EV4A 4CLCC 4QY6A 1IYOA 3MXSA 1OJGA 1YLJA 3EOIA 3UO9A 3UE6A 4G3VA 4OPZA 3GVBA 2HV1A 4ZBEA 4LV0A 1CK3A 1G6AA 5EM1A 1DP8A 4FSFA 3TJZC 4NK3A 2HF6A 5FL3A 3FPWA 1CEGA 3GTCA 4X53A 2Z6CA 3UE0A 4B93A 1XFQA 1Z09A 4BENA 3BQ8A 5G18A 2Y91A 4OLDA 4OOMA 4GD6A 4C3QA 4BL2A 5EVIC 3Q1FA 3K2NA 4X1MA 2W3FA 5L09A 5FI2A 5HPIA 4IVIA 4EXOA 3E4OA 5EECA 5JYOA 2Y2OA 5CHJA 2VJWA 5DF8A 2HDRA 1W5DA 1OTAA 4S2NC 2Y2LA 2W3HA 1QMEA 2J7VA 5J4EA 4HJ3A 1K57C 4OKPA 1MWTA 4LRZE 4LPZA 4MN5A 2ZQ9A 3PHYA 2HGVA 3R4KA 1FSWA 1DP9A 2Y2MA 1A0KA 4KZ6A 5EOEA 3EGXC 4E6WA 3KO6A 4WZ4A 1BLSA 1EWZA 3VFHA 3SW1A 3MF0A 5GL9A 2NUPC 4HH2A 5M19A 4Z9QA 3EEAA 3VMAA 1LL5A 1TS6A 2L0WA 3UNWA 4QHCA 5HSQA 3KX0X 5HX9A 2A3UA 3IT9A 3NOTC 3KSIA 3ZGAB 1Y4OA 2PU4A 4BLMA 4MN6A 3P7NA 4BQMA 2WKPA 2W3DA 1UGUA 3UPNA 3O87A 5J3WA 2PHYA 3T4JA 3BY8A 2WADA 3MFDA 2WK0A 1YLWA 2ZC3B 3UB7A 5IHVA 4MMNA 3BFGA 2O9AA 1JTDA 3P09A 2K7SA 2FFYA 4A5RA 1HD8A 2PBDP 2D02A 1ES5A 1ES4A 3WRZA 3G6OA 3NECA 3P98A 3PBSA 1VB6A 2JBFA 2R78A 2PAVP 3IBJA 4QJGA 2OWJA 1Y28A 1E3UA 1YMXA 2CMNA 2HP9A 4WN5A 4RYEA 4KZ7A 1LI0A 4C75A 1FSYA 2PDRA 3HVFA 3IS2B 4KZAA 2C6WB 1Q2PA 2XD1A 3JVVA 1G5UA 2XGNA 1G28A 3Q81A 2PR6A 1YLPA 4I5SA 5TR7A 4HHDA 4HNBA 1U60A 4OQGA 2PD8A 1CF0A 1S67L 2ZJ9A 1RP5A 1XA7A 4WYYA 4DE1A 4WZ5A 3R7WA 1GSVA 5CX7A 4K0WA 1I5QA 3AGEA 4S2PA 5TFQA 4EW7A 4LV3A 3PAEA 4BMWA 1E3UD 3FG8A 1BLCA 4L9EA 4EWFA 3IQAA 4M3KA 3CUEA 4KG5A 2W0NA 1XGJA 3V3SA 2EX6A 3IX4A 5A90A 4F3LA 2XF3A 3N8RA 1SKFA 1L0FA 1PI4A 2Y4AA 3BYDA 3NHQA 4HOIA 4WELA 1K6RA 1TD5A 3C30A 3QHYA 5J8XA 3NC8A 2WYXA 3MR0A 5GHYA 5CERA 3UPOA 1MWSA 2ZQDA 4E3OA 1XJ6A 2ZBBA 3BLMA 3H82A 4YWZA 3E98A 5I94A 2EX8A 2K31A 2JKRM 1NRJA 2WAFA 5I5LA 4E3KA 4UA6A 1NYMA 4N1XA 3CZDA 1C3BA 1XJ3A 2ZL1A 5EE8A 3AGFA 1L0EA 3OOVA 1W79A 1PI5A 3FWLA 3Q7VA 4Y7PA 4GDNA 3ZG5A 5CEBA 1VEUA 4HY8A 4DKIA 1XPBA 1K56A 3C7VA 5TGFA 1H0MA 3F1PB 3HJIA 1JWPA 4G3KA 1L2SA 4EBPA 1KVLA 2A2LA 4EBNA 1PYYA 5FSRA 4E3JA 4KQDA 3MMHA 3F1NB 1L0DA 4OVDA 2GDNA 1F98A 1XJ4A 1F9IA 3QNCA 5HARA 3IX8A 2EX9A 2HP5A 3OC2A 4O7DA 2IWCA 1T1BA 3LR0A 3E2LA 5IU1A 2JN7A 5F1GA 3S4XA 2V8FA 1T1AA 4DE0A 5KZHA 1ALQA 4GW9A 2B95A 3L9KA 2PBYA 4P6BA 3TSGA 2OV5A 3PXPA 4L9GA 2G2WA 2LB9A 2W1TA 5L8MA 2LB5A 3E4PA 4KQQA 2P04A 4HP4A 3LR5A 2W3EA 1D06A 2P7JA 3AGDA 3PBRA 3IF6A 3HBRA 4U3TA 4GS9B 2ZQ7A 1MXOA 2XR0A 4O0PA 1NLZA 3W4OA 4ZAMA 2JE5A 3KSHA 5EOOA 1SKOB 5KSHA 4BWIA 1K25A 2PRFA 4LCMA 1P0ZA 4JPMA 5F1FA 1FOFA 3NIAA 1KGFA 1P9RA 5FQ9A 2XFSA 3JVUA 4KG6A 1RCJA 4XT2B 5DTSA 1CI9A 2J9OA 1ACFA 2ZQ8A 4R3JA 5EV0A 3HLEA 4MCWA 3G31A 5GHZA 3W4PA 1MY8A 4Y2FA 2O9BA 3BEBA 4ZDXA 1YQSA 1T1CA 5E2FA 1VETA 4HBTA 1LSWA 4KQOA 3LR3A 2C5WB 1ZHHB 2L4RA 5FAOA 3S7QA 5GHXA 4E6XA 1KE0A 2H5SA 2BASA 4CLCA 4XUZA 5M18A 2JKRI 3HCYA 4KZ5A 2WKRA 3ULFA 4EQ1A 3CPTB 3N4IA 4PM5A
chains in the Genus database with same CATH topology
2ZOIA 3FPWA 2Z6CA 4GLQA 3R7WB 2W27A 4B93A 2HJEA 1XFQA 4I38A 3T4OA 3IBRA 2XA7S 2IA2A 4ZRRA 3BQ8A 5MC7A 4CQHA 4OOMA 3NOUC 2K2NA 2MJ6A 3ZYTA 4HIAA 2KX6A 3K2NA 2P08A 2W3FA 4P6ZM 2Z6DA 2J3TD 2OWHA 1S1YA 1YKDA 2JHEA 5HPIA 2ZMFA 2XA7M 3E4OA 4EXOA 3LIAA 2VJWA 3CITA 3DBAA 3T4TA 4F3LB 1T19A 4NKPA 4YOFA 5TBMB 4CLCD 3GECA 1OTAA 3MQOA 2W3HA 1LT0A 2H28A 4FOFA 5J4EA 4HJ3A 4H6JB 3LIFA 4EESA 2QKPA 1IOUA 4EETB 4LRZE 3BW6A 3H7WA 1P97A 4LPZA 2OAP1 3D72A 4MN5A 3F1PA 3NJAA 1S4RA 3PHYA 3H82B 3MJQA 2HGVA 2ZOHA 2XRNA 3RH8B 2EWVA 3R4KA 2QHKA 3CUEC 4NXEA 1OTDA 4LRYC 1DP9A 3EGXC 3F1NA 3OBFA 3UMDA 1GSWA 3KO6A 3BJNA 2PYPA 3T50A 5J7EA 1LSVA 1W63M 3B42A 3B47A 5TJJA 3SW1A 1N9NA 4KUKA 3MF0A 2M7UA 3BWLA 4I39A 2NUPC 4R3AA 3T4LA 2L1MA 5HPFA 5HL6A 4HH2A 5HD5A 5IS1A 1OTBA 3PBNA 3K3DA 1P9WA 3EEAA 2YKHA 1TS6A 2L0WA 5HSQA 3MQ0A 3KX0X 3NOPC 4OOLA 2W1RA 2B02A 3CI6A 3UMEA 2EWWA 5EFWA 3LICA 2OOLA 3RFBA 3NOTC 2KDKA 3FC7A 3KSIA 2VV7A 3A0RA 1ZTUA 1IFQA 2VA0A 5F5YA 3V67A 4MN6A 4ETZA 3P7NA 3D3OA 2WKPA 2W3DA 4DMZA 1MZUA 1UGUA 1V9ZA 1JNUA 4KUOA 5J3WA 2PHYA 1TF1A 2VV6A 1OT9A 3T4JA 3BY8A 1UWPX 2VEAA 3BQAA 2O0YA 4GS9A 3UB7A 4MMNA 2JKTI 2VGLS 3P01A 2O9AA 2V1AA 4UEYA 3OCNA 2K7SA 3LIEA 5G4YA 4MN7A 1UWNX 2D02A 4ARZB 4Q0JA 3UB6A 3TW8A 4EUVA 4Q0HA 5LBRA 3S7NA 3VE3A 2O99A 4O01A 5DKLA 3G6OA 3KSFA 4XT2A 4WEJA 2A24B 4WEKA 3PBSA 1X0OA 3ZQ5A 2VGLM 4WUJA 1VB6A 2I9VA 2R78A 3IBJA 1YSQA 4HP9A 2OWJA 1VHMA 4HQAA 1Y28A 4IHQA 5F6AA 2CMNA 2W1TB 1OPXA 3H7WB 4WN5A 2Y8HA 1H8MA 2PD7A 5HDDA 4Q0IA 2ZMVA 2PDRA 4HH3A 2VZWA 3IS2B 3EWKA 4AFIA 4IJGA 3JVVA 5HDSA 3TRCA 1G28A 2PR6A 4WL9A 2M7VA 4I5SA 4RQ9A 4L0LA 4HHDA 2M1CA 4HNBA 3F1OA 2PD8A 1BYWA 1S67L 4I3AA 3MFXA 1OTIA 2V0WA 5HWWA 3EGDC 1F5MA 5K5BA 4LRXC 1MKMA 2D01A 3E0YA 3UB8A 4UQIS 5HZHA 1S1ZA 2B18A 4GHIB 3LI8A 4GJ4A 5HWTA 3R7WA 1GSVA 5CX7A 3O5YA 1TS8A 4NEED 2J3WA 3KSGA 4G3WA 4HJ4A 2QJ7A 2V0UA 3CWFA 4Z1WA 2WKQA 4EW7A 4I3IA 4LLOB 1XFNA 3UB9A 3MQQA 4BMWA 4DJ2A 3FG8A 2GJ3A 4R6LA 2EA9A 2PYRA 4R38A 2KLIA 4WF0A 3PR6A 4L9EA 1EW0A 4UQIM 3T4SA 4DJ3A 1TS7A 3CUEA 2W0NA 4R70A 1S66L 3EQVA 4JGQA 4F3LA 2VLGA 4JGPA 4EEUA 1N9OA 5TBMA 3RTYA 3BY9A 3CLOA 4CLCB 4HOIA 3NHQA 4WELA 1TD5A 3C30A 3LIBA 3VE4A 4H6JA 4EU0A 4O8GA 3FPVA 5DJTA 3MR0A 1NLYA 3T4KA 3LI9A 4HJ6A 4NXGA 1XJ6A 2ZBBA 3E4QA 3S7OA 3K3CA 3H82A 2PR5A 4YWZA 3E98A 4WLAA 2QJ5A 2VKSA 2HJ9C 3LIDA 2K31A 5DFXA 2JKRM 1NRJA 5I5LA 2NUTC 2VX8A 4IUKA 5AJGA 2W3GA 1DRMA 4M4XA 3TE8A 5AVEA 4PAUA 1V9YA 1OJ5A 1XJ3A 4GCZA 2O9CA 4EERA 4Y5FA 3OLOA 2DMWA 2FH5A 3OOVA 3KYQA 3A0VA 2XSSA 2YKFA 1DP6A 4HY8A 3MXQA 1MC0A 3LFVA 5F68A 4E04A 1GSXA 5DKKA 1ODVA 4BBUA 3VOLA 3F1PB 1S4SA 3HJIA 2KOIA 4G3KA 3W2ZA 5C5KA 3LYXA 3LUQA 4EEPA 4MDZA 5AVFA 2A2LA 4KQDA 3MMHA 3F1NB 3PBOA 1F98A 1XJ4A 4K08A 5DFYA 3U2AA 3PBTA 1F9IA 1YSPA 2J80A 1LSXA 4ARZA 2XROA 2GNXA 4PKYA 3OC2A 5HWVA 1T1BA 3LR0A 2GZAA 5IU1A 2JN7A 2V1BA 2A24A 3KYZA 1T1AA 2GX5A 1TS0A 1OTEA 4BBTA 4GW9A 1T18A 4IUHA 3CAXA 4JGOA 3PXPA 1NWZA 4CLCE 3B33A 2LB9A 2W1TA 4L9GA 4YNRA 5L8MA 4ME4A 5G4ZA 2LB5A 1XJ2A 3E4PA 5KIZA 2P04A 4HP4A 1WA9A 3LR5A 2W3EA 5IT5A 3GDIA 3IS2A 4BBVA 3PBQA 3VV4A 1N9LA 1D06A 2P7JA 3PBRA 4GS9B 1D7EA 3UE3A 3A0SA 4O0PA 1NLZA 1G6OA 3H9WA 4QPRA 3KSHA 4II7A 5KSHA 2FZ0A 3LR4A 1YAXA 4BJPA 4BWIA 1P0ZA 3C2WA 4B9OA 5A8BA 4GHIA 1P9RA 3EEHA 3EQUA 4HI4A 5DF9A 3C8CA 5DJUA 2QYBA 3JVUA 4XT2B 1OT6A 3PYPA 3C38A 2J3TC 4NXFA 2JKTM 4MCWA 4PKYG 2G7UA 4DN0A 1LL8A 4I3JA 4Y2FA 2O9BA 2Y79A 1W63Q 5F69A 4CLCC 3HJKA 3ICYA 2INWA 3OCLA 1T1CA 1OJGA 2OAQ1 3EOIA 4Y3IA 3UE6A 2V9AA 4G3VA 3T4QA 1LSWA 5HD3A 4PHTA 2VV8A 4KQOA 3S7PA 3LR3A 2HV1A 1ZHHB 2L4RA 4JGRA 3S7QA 2QWSA 1DP8A 2BASA 2PT7A 3F1OB 4FSFA 4CLCA 3TJZC 2HF6A 2JKRI 4ETXA 1H3QA 3HCYA 4L9FA 5HDCA 1STZA 2WKRA 4NXBA 5FL3A 3ULFA 4EQ1A 1KOUA 4P6ZS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOI A;  2Z6C A;  2W27 A;  1XFQ A;  4I38 A;  3IBR A;  3NOU C;  4HIA A;  2KX6 A;  2Z6D A;  2OWH A;  1S1Y A;  2JHE A;  4EXO A;  3E4O A;  3LIA A;  4F3L B;  1T19 A;  5TBM B;  3GEC A;  1OTA A;  3MQO A;  1LT0 A;  2H28 A;  5J4E A;  4HJ3 A;  4H6J B;  3LIF A;  4EES A;  2QKP A;  4EET B;  4LRZ E;  3H7W A;  1P97 A;  4LPZ A;  3D72 A;  4MN5 A;  3F1P A;  3NJA A;  1S4R A;  3PHY A;  3H82 B;  3MJQ A;  2ZOH A;  3RH8 B;  2QHK A;  4NXE A;  1OTD A;  4LRY C;  1DP9 A;  3F1N A;  3UMD A;  1GSW A;  2PYP A;  3T50 A;  5J7E A;  1LSV A;  3SW1 A;  1N9N A;  4KUK A;  3BWL A;  4I39 A;  4R3A A;  2L1M A;  4HH2 A;  5HD5 A;  5IS1 A;  1OTB A;  3K3D A;  2YKH A;  1TS6 A;  2L0W A;  5HSQ A;  3NOP C;  3KX0 X;  2B02 A;  3UME A;  5EFW A;  3LIC A;  2OOL A;  3NOT C;  2KDK A;  3FC7 A;  2VV7 A;  3A0R A;  5F5Y A;  4MN6 A;  3P7N A;  2WKP A;  1MZU A;  1UGU A;  1V9Z A;  1JNU A;  4KUO A;  5J3W A;  2PHY A;  2VV6 A;  1OT9 A;  3BY8 A;  1UWP X;  2VEA A;  4GS9 A;  3UB7 A;  2V1A A;  2K7S A;  3LIE A;  5G4Y A;  1UWN X;  2D02 A;  3UB6 A;  3VE3 A;  5DKL A;  3G6O A;  4XT2 A;  2A24 B;  3ZQ5 A;  1X0O A;  4WUJ A;  1VB6 A;  2I9V A;  2R78 A;  4HP9 A;  2OWJ A;  4HQA A;  1Y28 A;  5F6A A;  2CMN A;  4WN5 A;  3H7W B;  2PD7 A;  5HDD A;  2PDR A;  4HH3 A;  3IS2 B;  3EWK A;  5HDS A;  1G28 A;  2PR6 A;  4WL9 A;  4I5S A;  4RQ9 A;  4HHD A;  2M1C A;  4HNB A;  3F1O A;  2PD8 A;  1BYW A;  1S67 L;  4I3A A;  3MFX A;  1OTI A;  2V0W A;  5HWW A;  4LRX C;  2D01 A;  3UB8 A;  5HZH A;  1S1Z A;  4GHI B;  3LI8 A;  5HWT A;  1GSV A;  1TS8 A;  4HJ4 A;  2QJ7 A;  2V0U A;  3CWF A;  2WKQ A;  4EW7 A;  4I3I A;  4LLO B;  1XFN A;  3UB9 A;  3MQQ A;  4DJ2 A;  3FG8 A;  2GJ3 A;  4R6L A;  2EA9 A;  2PYR A;  4R38 A;  4WF0 A;  4L9E A;  1EW0 A;  4DJ3 A;  1TS7 A;  2W0N A;  4R70 A;  1S66 L;  4JGQ A;  4F3L A;  2VLG A;  4JGP A;  4EEU A;  1N9O A;  5TBM A;  3RTY A;  3BY9 A;  3CLO A;  4HOI A;  3NHQ A;  3LIB A;  3VE4 A;  4H6J A;  5DJT A;  3MR0 A;  3LI9 A;  4HJ6 A;  4NXG A;  1XJ6 A;  2ZBB A;  3E4Q A;  3K3C A;  3H82 A;  2PR5 A;  4YWZ A;  4WLA A;  2QJ5 A;  3LID A;  5I5L A;  1DRM A;  4M4X A;  5AVE A;  1V9Y A;  1OJ5 A;  1XJ3 A;  4GCZ A;  4EER A;  3OLO A;  3A0V A;  2YKF A;  1DP6 A;  4HY8 A;  3MXQ A;  5F68 A;  4E04 A;  1GSX A;  5DKK A;  1ODV A;  4BBU A;  3VOL A;  3F1P B;  1S4S A;  3HJI A;  3LYX A;  3LUQ A;  4EEP A;  5AVF A;  4KQD A;  3F1N B;  1F98 A;  1XJ4 A;  4K08 A;  1F9I A;  2J80 A;  1LSX A;  4PKY A;  5HWV A;  1T1B A;  5IU1 A;  2JN7 A;  2V1B A;  2A24 A;  1T1A A;  1TS0 A;  1OTE A;  4BBT A;  4GW9 A;  1T18 A;  3CAX A;  4JGO A;  1NWZ A;  3B33 A;  4L9G A;  5G4Z A;  1XJ2 A;  3E4P A;  5KIZ A;  4HP4 A;  1WA9 A;  3GDI A;  3IS2 A;  4BBV A;  1N9L A;  1D06 A;  2P7J A;  4GS9 B;  1D7E A;  3A0S A;  3H9W A;  1P0Z A;  3C2W A;  4B9O A;  5A8B A;  4GHI A;  3EEH A;  4HI4 A;  3C8C A;  5DJU A;  4XT2 B;  1OT6 A;  3PYP A;  4NXF A;  4PKY G;  1LL8 A;  4I3J A;  5F69 A;  3HJK A;  3ICY A;  2INW A;  1T1C A;  1OJG A;  3UE6 A;  2V9A A;  1LSW A;  5HD3 A;  2VV8 A;  2HV1 A;  2L4R A;  4JGR A;  2QWS A;  1DP8 A;  2BAS A;  3F1O B;  4L9F A;  5HDC A;  2WKR A;  4NXB A;  3ULF A;  4EQ1 A;  1KOU A; 
#chains in the Genus database with same CATH topology
 3KYE A;  2HJE A;  4I38 A;  3IBR A;  1FCO A;  4ZRR A;  2WGW B;  5MC7 A;  4IBX A;  5CXW A;  4HIA A;  1TDL A;  3C4O A;  2KX6 A;  3WS0 A;  3LEZ A;  4FH2 A;  2P08 A;  3IWI A;  1KE4 A;  3ZHH A;  4X68 A;  2Z6D A;  4PM7 A;  1S1Y A;  3DWK A;  2CC1 A;  2ZMF A;  3LIA A;  5EVI A;  4Y0O A;  5CED A;  1T19 A;  3I7J A;  2V20 A;  5JYP A;  4CLC D;  4BD0 A;  3NI9 A;  1LT0 A;  2H28 A;  4F94 A;  2Z2L B;  5FQM A;  1CJF A;  3WS1 A;  2QKP A;  3HLW A;  1IOU A;  3BW6 A;  5EVL A;  4S2N A;  3D72 A;  3FKW A;  3W8K A;  3NJA A;  3N8L A;  3JPU A;  3MJQ A;  5L10 A;  3RH8 B;  2EWV A;  4NXE A;  1XX2 A;  2XK1 A;  3TG9 A;  1K4F A;  3OBF A;  4E3L A;  5HAP A;  1W63 M;  5CHM A;  4CPK A;  4DRT A;  5EVE A;  2OLV A;  2HDQ A;  5GLC A;  5EVI D;  4I39 A;  1YPR A;  3QNB A;  2X71 A;  3T4L A;  1ZG6 A;  5HL6 A;  3NDG A;  3SS4 A;  5IS1 A;  3FZC A;  2YKH A;  3MQ0 A;  3UME A;  3LIC A;  2KDK A;  3A0R A;  3V67 A;  3UDF A;  4ETZ A;  3QP4 A;  3D3O A;  1MKI A;  4OPY A;  4R0Q A;  4HEF A;  1M6K A;  4KUO A;  1H8Z A;  1OT9 A;  1UWP X;  2VEA A;  5FQJ A;  3T1R A;  4WM9 A;  3A3J A;  3QP6 A;  3SOI A;  3P01 A;  1TVF A;  4XXR A;  2J8Y A;  4UEY A;  2OLU A;  5G4Y A;  2ZQA A;  4ARZ B;  4Q0J A;  4E3I A;  2H0T A;  3M6B A;  4EUV A;  1S0W A;  1DJA A;  1YM1 A;  3KSF A;  1GHP A;  4WEJ A;  2A24 B;  4WEK A;  5CRF A;  1X0O A;  5CGX A;  4WUJ A;  2EFX A;  1ES3 A;  2WKH A;  2XLN A;  4HP9 A;  4WMC D;  3D9Y A;  4D2O A;  1VHM A;  3TOI A;  5F6A A;  1NZO A;  2E8I A;  1OPX A;  2PD7 A;  4Q0I A;  2ZMV A;  3VFF A;  2VZW A;  4N1H A;  4ZTK A;  3ZFZ A;  4WL9 A;  1RGY A;  4L0L A;  4QD4 A;  1WYC A;  2P9V B;  2M1C A;  3C5A A;  2XDM A;  3F1O A;  3HLC A;  4I3A A;  1LL9 A;  2ZM0 A;  3SH9 A;  2D01 A;  3OPH A;  5HZH A;  2B18 A;  4GHI B;  5DF7 A;  4GJ4 A;  1FCM A;  1TS8 A;  1E4D A;  1ERM A;  1YMS A;  3CWF A;  1PZP A;  4LLO B;  5DTT A;  4JF4 A;  4B4X A;  4R6L A;  3PR6 A;  5HW3 A;  3T4S A;  1NYY A;  1XGI A;  1JWV A;  4K0X A;  3UN7 A;  4MBF A;  1K6S A;  5FDH A;  2IWB A;  3ZG0 A;  5FI6 A;  5FAS A;  3EQV A;  3IH8 A;  2B5R A;  4EEU A;  3Q82 A;  5TBM A;  3MSH A;  3RTY A;  3BY9 A;  1IKI A;  2Q0O A;  1IKG A;  1FR6 A;  3LIB A;  3VE4 A;  1XA1 A;  4H6J A;  4QWO A;  3FPV A;  3NY4 A;  1NLY A;  3T4K A;  2WGV A;  3BM6 A;  4DDY A;  2XEP A;  1ERQ A;  3QP5 A;  2QZ6 A;  3ZVW A;  5HL1 A;  1K55 A;  5CTM A;  1NZU A;  2NUT C;  2VX8 A;  4X69 A;  1W7F A;  1CEF A;  1FQG A;  4GCZ A;  4GB7 A;  4EER A;  2FH5 A;  4X56 A;  4GD8 A;  1PWG A;  1WE4 A;  2ACG A;  4UA9 A;  3V3R A;  3G2Y A;  1NRF A;  3MXQ A;  3LFV A;  5F68 A;  1GSX A;  3RXX A;  3W4Q A;  4OQH A;  3IWO A;  1ODV A;  1W8Q A;  3VOL A;  4BD1 A;  1HTZ A;  1S4S A;  2KOI A;  5C5K A;  4Y13 A;  3LUQ A;  5A93 A;  4KZ3 A;  3ZNT A;  2HPB A;  5CHU A;  2E8J A;  2ZLY A;  5L2F A;  4BL3 A;  3LY4 A;  1YT4 A;  4Y17 A;  3GMW A;  3IHA A;  5DFY A;  3U2A A;  3FYZ A;  1L3L A;  5F83 A;  2H10 A;  2ZD8 A;  2XRO A;  5KMW A;  1NXY A;  4R4R A;  4KQR A;  2XD5 A;  2ZC5 B;  5CGW A;  3UY6 A;  4Q8I A;  2GX5 A;  1TS0 A;  2Q9M A;  1T18 A;  2HDU A;  4JGO A;  1YLT A;  2Y2Q A;  4ME4 A;  5G4Z A;  4X25 A;  3N8S A;  5FEF A;  4S2I A;  4ID4 A;  2WZZ A;  3PBQ A;  1EI5 A;  3OPL A;  5GLD A;  3VSL A;  1D7E A;  5AQ7 A;  4PMA A;  3UDI A;  1G6O A;  3H9W A;  4II7 A;  3LR4 A;  2JKF A;  3EEH A;  3A3D A;  3G2Z A;  3EQU A;  5DJU A;  3NDE A;  1OT6 A;  3BFE A;  2J3T C;  1H5X A;  4FUW A;  4PM8 A;  5FI7 A;  1KVM A;  3T1Q B;  5HAQ A;  2G7U A;  4S2L A;  4I3J A;  1Q2Q A;  1W63 Q;  5F69 A;  3PTE A;  5FAQ A;  3OCL A;  2OAQ 1;  1ONG A;  4Y3I A;  3T4Q A;  2X02 A;  2VV8 A;  3S7P A;  5HFO A;  3MKE A;  4JGR A;  1E25 A;  4FCF A;  4GNU A;  2HP6 A;  2PT7 A;  3RXW A;  2DRW A;  3QP8 A;  4ETX A;  4L9F A;  4NXB A;  4P6Z S;  4GLQ A;  3R7W B;  2W27 A;  1JTG A;  3M2J A;  4C6Y A;  3T4O A;  4LV2 A;  2XA7 S;  2IA2 A;  3BEC A;  4CQH A;  3NOU C;  2MJ6 A;  3RJU A;  3ZYT A;  3MZF A;  3LCE A;  1GA0 A;  4P6Z M;  3D4F A;  2OWH A;  1YKD A;  2JHE A;  1D1J A;  3WRT A;  4OP8 A;  4ESP A;  1PRQ A;  2XA7 M;  4PM6 A;  1BZA A;  3DW0 A;  3LO7 A;  3DBA A;  3T4T A;  4F3L B;  2VGK A;  4NKP A;  1BT5 A;  3MQO A;  4DF6 A;  5HAI A;  3HUN A;  3S1Y A;  1BTL A;  4EES A;  4EET B;  2J9P A;  4KZB A;  4DXB A;  1S4R A;  3H82 B;  2ZOH A;  3CUE C;  1HVB A;  1XKZ A;  3U4L P;  3UMD A;  2Y59 A;  1GSW A;  2Y2J A;  3C7U A;  3T50 A;  3B42 A;  5TJJ A;  1N9N A;  4KUK A;  2M7U A;  3BWL A;  3HL9 A;  4R3A A;  2X01 A;  2VK3 A;  2ZL1 B;  5HPF A;  1YLZ A;  5AQB A;  3V5M A;  3PBN A;  3K3D A;  4P85 A;  3Q7V B;  4IVK A;  4OOL A;  3DAV A;  1VEU B;  3A3E A;  1SHV A;  2QPN A;  5EFW A;  3RFB A;  1J9M A;  4NG2 A;  4IED A;  1IFQ A;  1MWR A;  1PWC A;  5F5Y A;  4GKU A;  3VP2 A;  1JNU A;  2VV6 A;  1TF1 A;  3B3X A;  4S2M A;  1CQA A;  4QB8 A;  3Q07 A;  1IYQ A;  2VGL S;  2V1A A;  1H8Y A;  3OCN A;  1N9B A;  1DY6 A;  2Y2G A;  3UB6 A;  3TW8 A;  4Q0H A;  3S7N A;  2O99 A;  4O01 A;  5DKL A;  1O7E A;  1AXB A;  4ZJ2 A;  3DTM A;  4LCL A;  2VGL M;  3GSG A;  1YSQ A;  4Y15 A;  4IHQ A;  4OON A;  2EXA A;  2W1T B;  1BSG A;  1VQQ A;  2WGI A;  2Y8H A;  1H8M A;  2Z2M B;  5HDD A;  1JVJ A;  4RA7 A;  3JYI A;  4HH3 A;  3A3I A;  4AFI A;  2XQZ A;  3ZG7 B;  3T1S A;  5HDS A;  3TRC A;  3VP3 A;  3ITB A;  2M7V A;  3FKV A;  3VOZ A;  3IF6 B;  3O88 A;  2A49 A;  1AWI A;  1BYW A;  3MZE A;  4EBL A;  1BLP A;  4JLF A;  1OTI A;  2V0W A;  4FH4 A;  5HWW A;  3EGD C;  5K5B A;  4LRX C;  1MKM A;  3E0Y A;  3UB8 A;  1K54 C;  3IH9 A;  3KSG A;  4G3W A;  4HJ4 A;  2V0U A;  4Z1W A;  3N7W A;  4N9L A;  1K57 A;  1W8Y A;  4I3I A;  3VP0 A;  5KSC A;  1XFN A;  4S2O A;  3UB9 A;  3SS3 A;  3O86 A;  4DJ2 A;  1SCW A;  2GJ3 A;  2JKG A;  4DE3 A;  4MNR A;  1FIL A;  4U0T A;  1VET B;  4R70 A;  1ESU A;  3HLG A;  4JGQ A;  5DTK A;  2VLG A;  1N9O A;  4IBR A;  4E3N A;  4Y0U A;  3CLO A;  4CLC B;  4KZ9 A;  2EX2 A;  2Y2N A;  2H0Y A;  4GDB A;  4WMC A;  1FR1 A;  4OQ0 A;  1JWZ A;  4NXG A;  5FAT A;  3E4Q A;  3K3C A;  1GHI A;  5FAP A;  2VKS A;  2HJ9 C;  4MLL A;  3LID A;  2OSU A;  1L0G A;  1HZO A;  2W3G A;  4OH0 A;  1DRM A;  5AVE A;  2WKI A;  4PAU A;  5EVI B;  5AQ9 A;  1IEM A;  2PU2 A;  4Y5F A;  4UHU A;  3OLO A;  5FEG A;  3NUL A;  3A0V A;  4P87 A;  2XSS A;  2YKF A;  1DP6 A;  3PAG A;  4P0M A;  3V39 A;  1MC0 A;  2DCF A;  4E04 A;  5DKK A;  4N92 A;  3SH7 A;  1FIK A;  5FQK A;  4JXS A;  3W2Z A;  3LYX A;  4QY5 A;  3GR2 A;  4MDZ A;  3CMZ A;  5AVF A;  4DDS A;  2V1Z A;  1PFL A;  3ZG9 B;  4K08 A;  3PBT A;  3ZVT A;  3FV7 A;  1LSX A;  3G30 A;  1SZV A;  1XP4 A;  2GNX A;  4HBU A;  5HWV A;  2GZA A;  4GOG A;  2V1B A;  2IWD A;  4JXG A;  4OPQ A;  3DTI A;  3MZD A;  2Y2H A;  1CI8 A;  4IUH A;  1M40 A;  1NWZ A;  3NCK A;  4CLC E;  1PIO A;  4YNR A;  3IXB A;  5FQI A;  2ZC4 B;  1PZO A;  1DJB A;  1WA9 A;  5IT5 A;  3IS2 A;  2ZM2 A;  1TEM A;  3VV4 A;  4OP5 A;  4LEN A;  3OPP A;  3UE3 A;  5EM0 A;  5FDS A;  3M6H A;  1I2S A;  1IYP A;  4EQI A;  4OLG A;  4NET A;  4BJP A;  1ZC2 A;  4KG2 A;  2V2F F;  5A91 A;  4R1G A;  2FFF B;  3C8C A;  1F2K A;  1MBL A;  3PYP A;  3UE1 A;  3C38 A;  2JKT M;  4K91 A;  4PKY G;  4DN0 A;  3SS5 A;  1LL8 A;  3V50 A;  2WZX A;  2Y79 A;  4ZJ1 A;  2BLS A;  2WUQ A;  3HJK A;  3ICY A;  2INW A;  2AVX A;  4XUX A;  5GLA A;  2P74 A;  3UPP A;  4WBG A;  3HUO A;  2V9A A;  5HD3 A;  4PHT A;  4YIN A;  4ZJ3 A;  1OME A;  4U0X A;  2R9W A;  3LY3 A;  2QWS A;  4FTX A;  4MEZ A;  3F1O B;  4QU3 A;  1BUE A;  3ZDJ A;  1K38 A;  1H3Q A;  4H8R A;  5HDC A;  1STZ A;  5U47 A;  1KOU A;  2ZOI A;  5CTN A;  2BG1 A;  1ES2 A;  3GRJ A;  2V8C A;  4Y0T A;  2Y2P A;  2K2N A;  3OPR A;  3DTE A;  4RVA A;  4JF6 A;  1PW1 A;  2J3T D;  4GZB A;  2RCX A;  4X55 A;  2Q9N A;  3O3V A;  3CIT A;  4RX2 A;  3LEQ A;  4YOF A;  5TBM B;  3E2K A;  3GEC A;  3IXD A;  1NY0 A;  4FOF A;  4H6J B;  2G2U A;  3A3F A;  4HES A;  3WWX A;  3LIF A;  3IF5 A;  2Y55 A;  4PPR A;  5D3O A;  3H7W A;  1P97 A;  4OOY A;  2OAP 1;  3F1P A;  1KDS A;  1LHY A;  3IX3 A;  3UDX A;  3QP2 A;  3ITA A;  4LFU A;  2XRN A;  2QHK A;  1OTD A;  3BRM A;  4LRY C;  3IHB A;  3F1N A;  4UA7 A;  3BJN A;  2PYP A;  5J7E A;  1LSV A;  3B47 A;  2DNS A;  2L1M A;  1PNE A;  5HD5 A;  1Y54 A;  1OTB A;  1P9W A;  3L7H A;  3NOP C;  2W1R A;  1XXM A;  2B02 A;  4B4Z A;  3CI6 A;  2EWW A;  5E2G A;  2OOL A;  5L07 A;  1K55 C;  3CHW P;  3FC7 A;  2VV7 A;  1GHM A;  1ZTU A;  4MBK A;  2VA0 A;  3DWZ A;  3GV9 A;  4LV1 A;  2ZM8 A;  4DMZ A;  1MZU A;  1V9Z A;  3DTK A;  3VSK A;  5AQA A;  2EXB A;  3BQA A;  2O0Y A;  4GS9 A;  2JKT I;  1KDW A;  3LIE A;  4MN7 A;  1UWN X;  4CJN A;  1BUL A;  1SKO A;  1J3W A;  1GA9 A;  3G4P A;  3T12 B;  1G68 A;  4JXW A;  1YLY A;  1ZKJ A;  1ZG4 A;  3N6I A;  5LBR A;  3VE3 A;  4XT2 A;  3ZQ5 A;  2ZC6 B;  4R23 A;  3HUM A;  2I9V A;  5E2E A;  3QP1 A;  5GLB A;  3WS2 A;  1QMF A;  4HQA A;  5EUA A;  2ZMA A;  3ZG8 B;  4JXV A;  3H7W B;  5CEC A;  3MKF A;  3CJM A;  1VM1 A;  3EWK A;  4IJG A;  4WZ5 C;  4RQ9 A;  2ZQC A;  1RGZ A;  3VOY A;  2VGJ A;  3MFX A;  2WKE A;  1F5M A;  4JBF A;  3CPT A;  1LI9 A;  3T1X A;  4UQI S;  1S1Z A;  2I72 A;  3GQZ A;  3LI8 A;  1HLU P;  5HWT A;  3O5Y A;  4NEE D;  3WS5 A;  2J3W A;  2WGW A;  2QJ7 A;  2WKQ A;  5E2H A;  4R4S A;  4X6T A;  5DVA A;  5FA7 A;  3MQQ A;  1NJ4 A;  2Y2I A;  3HLF A;  1K56 D;  5A92 A;  1K54 A;  2EA9 A;  2PYR A;  3ISG A;  4R38 A;  2KLI A;  4WF0 A;  4UQI M;  1EW0 A;  4DJ3 A;  1TS7 A;  1BLH A;  3OZH A;  1LLB A;  3C4P A;  1S66 L;  5EPH A;  4DE2 A;  3LGO A;  3NBL A;  4JGP A;  3WS4 A;  1PW8 A;  1GCE A;  2Y2K A;  4B88 A;  3SH8 A;  1MWU A;  1SDN A;  4DXC A;  4EU0 A;  3Q7Z A;  4O8G A;  4YFM A;  3S22 A;  3IXG A;  5M1A A;  5DJT A;  4FD8 A;  3M2K A;  3LI9 A;  4HJ6 A;  3IWQ A;  1KE3 A;  3MS6 A;  3S7O A;  1S6R A;  3HLD A;  1IEL A;  3BLS A;  2PR5 A;  4WLA A;  2QJ5 A;  5DFX A;  3MBZ A;  1KGG A;  3BFF A;  2UWX A;  4R3B A;  4IUK A;  4OPR A;  5AJG A;  1KGE A;  4M4X A;  1N4O A;  3TE8 A;  2HDS A;  4N9K A;  4MBH A;  1V9Y A;  1OJ5 A;  2O9C A;  3BFD A;  2ZC7 A;  4E3M A;  2QMI A;  3G35 A;  5BOH A;  2DMW A;  4KZ8 A;  3KYQ A;  1IYS A;  4LGW A;  1ERO A;  1WYB A;  5FQQ A;  1ONH A;  3VP1 A;  2RL3 A;  2EFU A;  4BBU A;  1PWD A;  2XH9 A;  1MPL A;  4KZ4 A;  4EEP A;  1ESI A;  4S2K A;  1TDG A;  3PBO A;  4OQI A;  4JKT A;  1YSP A;  4S2J A;  1Z6F A;  2J80 A;  5CGS A;  4ARZ A;  4UAA A;  1DJC A;  4PKY A;  2XFT A;  1SDE A;  5F82 A;  2JCH A;  3UB5 P;  3ZCZ A;  2A24 A;  3KYZ A;  4GN2 A;  4EUZ A;  1OTE A;  4BBT A;  3CAX A;  2JC7 A;  1O07 A;  3MXR A;  3B33 A;  3IF6 C;  1K4E A;  1XJ2 A;  5KIZ A;  3HLB A;  4KEN B;  4X1L A;  3GDI A;  4BBV A;  3BFC A;  1N9L A;  2UV0 E;  1I2W A;  4PM9 A;  2P9V A;  2HZ5 A;  3IXH A;  3SZT A;  2R9X A;  3A0S A;  4JF5 A;  4QPR A;  3CG5 A;  2FZ0 A;  1YAX A;  3C2W A;  1FCN A;  4B9O A;  5A8B A;  4GHI A;  2WAE A;  4HI4 A;  5DF9 A;  2QYB A;  4NXF A;  3G32 A;  2BTF P;  4RX3 A;  1K0K A;  4D60 A;  3VP4 A;  3HRE A;  3G34 A;  5E43 A;  3ZNY A;  4EV4 A;  4CLC C;  4QY6 A;  1IYO A;  3MXS A;  1OJG A;  1YLJ A;  3EOI A;  3UO9 A;  3UE6 A;  4G3V A;  4OPZ A;  3GVB A;  2HV1 A;  4ZBE A;  4LV0 A;  1CK3 A;  1G6A A;  5EM1 A;  1DP8 A;  4FSF A;  3TJZ C;  4NK3 A;  2HF6 A;  5FL3 A;  3FPW A;  1CEG A;  3GTC A;  4X53 A;  2Z6C A;  3UE0 A;  4B93 A;  1XFQ A;  1Z09 A;  4BEN A;  3BQ8 A;  5G18 A;  2Y91 A;  4OLD A;  4OOM A;  4GD6 A;  4C3Q A;  4BL2 A;  5EVI C;  3Q1F A;  3K2N A;  4X1M A;  2W3F A;  5L09 A;  5FI2 A;  5HPI A;  4IVI A;  4EXO A;  3E4O A;  5EEC A;  5JYO A;  2Y2O A;  5CHJ A;  2VJW A;  5DF8 A;  2HDR A;  1W5D A;  1OTA A;  4S2N C;  2Y2L A;  2W3H A;  1QME A;  2J7V A;  5J4E A;  4HJ3 A;  1K57 C;  4OKP A;  1MWT A;  4LRZ E;  4LPZ A;  4MN5 A;  2ZQ9 A;  3PHY A;  2HGV A;  3R4K A;  1FSW A;  1DP9 A;  2Y2M A;  1A0K A;  4KZ6 A;  5EOE A;  3EGX C;  4E6W A;  3KO6 A;  4WZ4 A;  1BLS A;  1EWZ A;  3VFH A;  3SW1 A;  3MF0 A;  5GL9 A;  2NUP C;  4HH2 A;  5M19 A;  4Z9Q A;  3EEA A;  3VMA A;  1LL5 A;  1TS6 A;  2L0W A;  3UNW A;  4QHC A;  5HSQ A;  3KX0 X;  5HX9 A;  2A3U A;  3IT9 A;  3NOT C;  3KSI A;  3ZGA B;  1Y4O A;  2PU4 A;  4BLM A;  4MN6 A;  3P7N A;  4BQM A;  2WKP A;  2W3D A;  1UGU A;  3UPN A;  3O87 A;  5J3W A;  2PHY A;  3T4J A;  3BY8 A;  2WAD A;  3MFD A;  2WK0 A;  1YLW A;  2ZC3 B;  3UB7 A;  5IHV A;  4MMN A;  3BFG A;  2O9A A;  1JTD A;  3P09 A;  2K7S A;  2FFY A;  4A5R A;  1HD8 A;  2PBD P;  2D02 A;  1ES5 A;  1ES4 A;  3WRZ A;  3G6O A;  3NEC A;  3P98 A;  3PBS A;  1VB6 A;  2JBF A;  2R78 A;  2PAV P;  3IBJ A;  4QJG A;  2OWJ A;  1Y28 A;  1E3U A;  1YMX A;  2CMN A;  2HP9 A;  4WN5 A;  4RYE A;  4KZ7 A;  1LI0 A;  4C75 A;  1FSY A;  2PDR A;  3HVF A;  3IS2 B;  4KZA A;  2C6W B;  1Q2P A;  2XD1 A;  3JVV A;  1G5U A;  2XGN A;  1G28 A;  3Q81 A;  2PR6 A;  1YLP A;  4I5S A;  5TR7 A;  4HHD A;  4HNB A;  1U60 A;  4OQG A;  2PD8 A;  1CF0 A;  1S67 L;  2ZJ9 A;  1RP5 A;  1XA7 A;  4WYY A;  4DE1 A;  4WZ5 A;  3R7W A;  1GSV A;  5CX7 A;  4K0W A;  1I5Q A;  3AGE A;  4S2P A;  5TFQ A;  4EW7 A;  4LV3 A;  3PAE A;  4BMW A;  1E3U D;  3FG8 A;  1BLC A;  4L9E A;  4EWF A;  3IQA A;  4M3K A;  3CUE A;  4KG5 A;  2W0N A;  1XGJ A;  3V3S A;  2EX6 A;  3IX4 A;  5A90 A;  4F3L A;  2XF3 A;  3N8R A;  1SKF A;  1L0F A;  1PI4 A;  2Y4A A;  3BYD A;  3NHQ A;  4HOI A;  4WEL A;  1K6R A;  1TD5 A;  3C30 A;  3QHY A;  5J8X A;  3NC8 A;  2WYX A;  3MR0 A;  5GHY A;  5CER A;  3UPO A;  1MWS A;  2ZQD A;  4E3O A;  1XJ6 A;  2ZBB A;  3BLM A;  3H82 A;  4YWZ A;  3E98 A;  5I94 A;  2EX8 A;  2K31 A;  2JKR M;  1NRJ A;  2WAF A;  5I5L A;  4E3K A;  4UA6 A;  1NYM A;  4N1X A;  3CZD A;  1C3B A;  1XJ3 A;  2ZL1 A;  5EE8 A;  3AGF A;  1L0E A;  3OOV A;  1W79 A;  1PI5 A;  3FWL A;  3Q7V A;  4Y7P A;  4GDN A;  3ZG5 A;  5CEB A;  1VEU A;  4HY8 A;  4DKI A;  1XPB A;  1K56 A;  3C7V A;  5TGF A;  1H0M A;  3F1P B;  3HJI A;  1JWP A;  4G3K A;  1L2S A;  4EBP A;  1KVL A;  2A2L A;  4EBN A;  1PYY A;  5FSR A;  4E3J A;  4KQD A;  3MMH A;  3F1N B;  1L0D A;  4OVD A;  2GDN A;  1F98 A;  1XJ4 A;  1F9I A;  3QNC A;  5HAR A;  3IX8 A;  2EX9 A;  2HP5 A;  3OC2 A;  4O7D A;  2IWC A;  1T1B A;  3LR0 A;  3E2L A;  5IU1 A;  2JN7 A;  5F1G A;  3S4X A;  2V8F A;  1T1A A;  4DE0 A;  5KZH A;  1ALQ A;  4GW9 A;  2B95 A;  3L9K A;  2PBY A;  4P6B A;  3TSG A;  2OV5 A;  3PXP A;  4L9G A;  2G2W A;  2LB9 A;  2W1T A;  5L8M A;  2LB5 A;  3E4P A;  4KQQ A;  2P04 A;  4HP4 A;  3LR5 A;  2W3E A;  1D06 A;  2P7J A;  3AGD A;  3PBR A;  3IF6 A;  3HBR A;  4U3T A;  4GS9 B;  2ZQ7 A;  1MXO A;  2XR0 A;  4O0P A;  1NLZ A;  3W4O A;  4ZAM A;  2JE5 A;  3KSH A;  5EOO A;  1SKO B;  5KSH A;  4BWI A;  1K25 A;  2PRF A;  4LCM A;  1P0Z A;  4JPM A;  5F1F A;  1FOF A;  3NIA A;  1KGF A;  1P9R A;  5FQ9 A;  2XFS A;  3JVU A;  4KG6 A;  1RCJ A;  4XT2 B;  5DTS A;  1CI9 A;  2J9O A;  1ACF A;  2ZQ8 A;  4R3J A;  5EV0 A;  3HLE A;  4MCW A;  3G31 A;  5GHZ A;  3W4P A;  1MY8 A;  4Y2F A;  2O9B A;  3BEB A;  4ZDX A;  1YQS A;  1T1C A;  5E2F A;  1VET A;  4HBT A;  1LSW A;  4KQO A;  3LR3 A;  2C5W B;  1ZHH B;  2L4R A;  5FAO A;  3S7Q A;  5GHX A;  4E6X A;  1KE0 A;  2H5S A;  2BAS A;  4CLC A;  4XUZ A;  5M18 A;  2JKR I;  3HCY A;  4KZ5 A;  2WKR A;  3ULF A;  4EQ1 A;  3CPT B;  3N4I A;  4PM5 A; 
#chains in the Genus database with same CATH homology
 2ZOI A;  3FPW A;  2Z6C A;  4GLQ A;  3R7W B;  2W27 A;  4B93 A;  2HJE A;  1XFQ A;  4I38 A;  3T4O A;  3IBR A;  2XA7 S;  2IA2 A;  4ZRR A;  3BQ8 A;  5MC7 A;  4CQH A;  4OOM A;  3NOU C;  2K2N A;  2MJ6 A;  3ZYT A;  4HIA A;  2KX6 A;  3K2N A;  2P08 A;  2W3F A;  4P6Z M;  2Z6D A;  2J3T D;  2OWH A;  1S1Y A;  1YKD A;  2JHE A;  5HPI A;  2ZMF A;  2XA7 M;  3E4O A;  4EXO A;  3LIA A;  2VJW A;  3CIT A;  3DBA A;  3T4T A;  4F3L B;  1T19 A;  4NKP A;  4YOF A;  5TBM B;  4CLC D;  3GEC A;  1OTA A;  3MQO A;  2W3H A;  1LT0 A;  2H28 A;  4FOF A;  5J4E A;  4HJ3 A;  4H6J B;  3LIF A;  4EES A;  2QKP A;  1IOU A;  4EET B;  4LRZ E;  3BW6 A;  3H7W A;  1P97 A;  4LPZ A;  2OAP 1;  3D72 A;  4MN5 A;  3F1P A;  3NJA A;  1S4R A;  3PHY A;  3H82 B;  3MJQ A;  2HGV A;  2ZOH A;  2XRN A;  3RH8 B;  2EWV A;  3R4K A;  2QHK A;  3CUE C;  4NXE A;  1OTD A;  4LRY C;  1DP9 A;  3EGX C;  3F1N A;  3OBF A;  3UMD A;  1GSW A;  3KO6 A;  3BJN A;  2PYP A;  3T50 A;  5J7E A;  1LSV A;  1W63 M;  3B42 A;  3B47 A;  5TJJ A;  3SW1 A;  1N9N A;  4KUK A;  3MF0 A;  2M7U A;  3BWL A;  4I39 A;  2NUP C;  4R3A A;  3T4L A;  2L1M A;  5HPF A;  5HL6 A;  4HH2 A;  5HD5 A;  5IS1 A;  1OTB A;  3PBN A;  3K3D A;  1P9W A;  3EEA A;  2YKH A;  1TS6 A;  2L0W A;  5HSQ A;  3MQ0 A;  3KX0 X;  3NOP C;  4OOL A;  2W1R A;  2B02 A;  3CI6 A;  3UME A;  2EWW A;  5EFW A;  3LIC A;  2OOL A;  3RFB A;  3NOT C;  2KDK A;  3FC7 A;  3KSI A;  2VV7 A;  3A0R A;  1ZTU A;  1IFQ A;  2VA0 A;  5F5Y A;  3V67 A;  4MN6 A;  4ETZ A;  3P7N A;  3D3O A;  2WKP A;  2W3D A;  4DMZ A;  1MZU A;  1UGU A;  1V9Z A;  1JNU A;  4KUO A;  5J3W A;  2PHY A;  1TF1 A;  2VV6 A;  1OT9 A;  3T4J A;  3BY8 A;  1UWP X;  2VEA A;  3BQA A;  2O0Y A;  4GS9 A;  3UB7 A;  4MMN A;  2JKT I;  2VGL S;  3P01 A;  2O9A A;  2V1A A;  4UEY A;  3OCN A;  2K7S A;  3LIE A;  5G4Y A;  4MN7 A;  1UWN X;  2D02 A;  4ARZ B;  4Q0J A;  3UB6 A;  3TW8 A;  4EUV A;  4Q0H A;  5LBR A;  3S7N A;  3VE3 A;  2O99 A;  4O01 A;  5DKL A;  3G6O A;  3KSF A;  4XT2 A;  4WEJ A;  2A24 B;  4WEK A;  3PBS A;  1X0O A;  3ZQ5 A;  2VGL M;  4WUJ A;  1VB6 A;  2I9V A;  2R78 A;  3IBJ A;  1YSQ A;  4HP9 A;  2OWJ A;  1VHM A;  4HQA A;  1Y28 A;  4IHQ A;  5F6A A;  2CMN A;  2W1T B;  1OPX A;  3H7W B;  4WN5 A;  2Y8H A;  1H8M A;  2PD7 A;  5HDD A;  4Q0I A;  2ZMV A;  2PDR A;  4HH3 A;  2VZW A;  3IS2 B;  3EWK A;  4AFI A;  4IJG A;  3JVV A;  5HDS A;  3TRC A;  1G28 A;  2PR6 A;  4WL9 A;  2M7V A;  4I5S A;  4RQ9 A;  4L0L A;  4HHD A;  2M1C A;  4HNB A;  3F1O A;  2PD8 A;  1BYW A;  1S67 L;  4I3A A;  3MFX A;  1OTI A;  2V0W A;  5HWW A;  3EGD C;  1F5M A;  5K5B A;  4LRX C;  1MKM A;  2D01 A;  3E0Y A;  3UB8 A;  4UQI S;  5HZH A;  1S1Z A;  2B18 A;  4GHI B;  3LI8 A;  4GJ4 A;  5HWT A;  3R7W A;  1GSV A;  5CX7 A;  3O5Y A;  1TS8 A;  4NEE D;  2J3W A;  3KSG A;  4G3W A;  4HJ4 A;  2QJ7 A;  2V0U A;  3CWF A;  4Z1W A;  2WKQ A;  4EW7 A;  4I3I A;  4LLO B;  1XFN A;  3UB9 A;  3MQQ A;  4BMW A;  4DJ2 A;  3FG8 A;  2GJ3 A;  4R6L A;  2EA9 A;  2PYR A;  4R38 A;  2KLI A;  4WF0 A;  3PR6 A;  4L9E A;  1EW0 A;  4UQI M;  3T4S A;  4DJ3 A;  1TS7 A;  3CUE A;  2W0N A;  4R70 A;  1S66 L;  3EQV A;  4JGQ A;  4F3L A;  2VLG A;  4JGP A;  4EEU A;  1N9O A;  5TBM A;  3RTY A;  3BY9 A;  3CLO A;  4CLC B;  4HOI A;  3NHQ A;  4WEL A;  1TD5 A;  3C30 A;  3LIB A;  3VE4 A;  4H6J A;  4EU0 A;  4O8G A;  3FPV A;  5DJT A;  3MR0 A;  1NLY A;  3T4K A;  3LI9 A;  4HJ6 A;  4NXG A;  1XJ6 A;  2ZBB A;  3E4Q A;  3S7O A;  3K3C A;  3H82 A;  2PR5 A;  4YWZ A;  3E98 A;  4WLA A;  2QJ5 A;  2VKS A;  2HJ9 C;  3LID A;  2K31 A;  5DFX A;  2JKR M;  1NRJ A;  5I5L A;  2NUT C;  2VX8 A;  4IUK A;  5AJG A;  2W3G A;  1DRM A;  4M4X A;  3TE8 A;  5AVE A;  4PAU A;  1V9Y A;  1OJ5 A;  1XJ3 A;  4GCZ A;  2O9C A;  4EER A;  4Y5F A;  3OLO A;  2DMW A;  2FH5 A;  3OOV A;  3KYQ A;  3A0V A;  2XSS A;  2YKF A;  1DP6 A;  4HY8 A;  3MXQ A;  1MC0 A;  3LFV A;  5F68 A;  4E04 A;  1GSX A;  5DKK A;  1ODV A;  4BBU A;  3VOL A;  3F1P B;  1S4S A;  3HJI A;  2KOI A;  4G3K A;  3W2Z A;  5C5K A;  3LYX A;  3LUQ A;  4EEP A;  4MDZ A;  5AVF A;  2A2L A;  4KQD A;  3MMH A;  3F1N B;  3PBO A;  1F98 A;  1XJ4 A;  4K08 A;  5DFY A;  3U2A A;  3PBT A;  1F9I A;  1YSP A;  2J80 A;  1LSX A;  4ARZ A;  2XRO A;  2GNX A;  4PKY A;  3OC2 A;  5HWV A;  1T1B A;  3LR0 A;  2GZA A;  5IU1 A;  2JN7 A;  2V1B A;  2A24 A;  3KYZ A;  1T1A A;  2GX5 A;  1TS0 A;  1OTE A;  4BBT A;  4GW9 A;  1T18 A;  4IUH A;  3CAX A;  4JGO A;  3PXP A;  1NWZ A;  4CLC E;  3B33 A;  2LB9 A;  2W1T A;  4L9G A;  4YNR A;  5L8M A;  4ME4 A;  5G4Z A;  2LB5 A;  1XJ2 A;  3E4P A;  5KIZ A;  2P04 A;  4HP4 A;  1WA9 A;  3LR5 A;  2W3E A;  5IT5 A;  3GDI A;  3IS2 A;  4BBV A;  3PBQ A;  3VV4 A;  1N9L A;  1D06 A;  2P7J A;  3PBR A;  4GS9 B;  1D7E A;  3UE3 A;  3A0S A;  4O0P A;  1NLZ A;  1G6O A;  3H9W A;  4QPR A;  3KSH A;  4II7 A;  5KSH A;  2FZ0 A;  3LR4 A;  1YAX A;  4BJP A;  4BWI A;  1P0Z A;  3C2W A;  4B9O A;  5A8B A;  4GHI A;  1P9R A;  3EEH A;  3EQU A;  4HI4 A;  5DF9 A;  3C8C A;  5DJU A;  2QYB A;  3JVU A;  4XT2 B;  1OT6 A;  3PYP A;  3C38 A;  2J3T C;  4NXF A;  2JKT M;  4MCW A;  4PKY G;  2G7U A;  4DN0 A;  1LL8 A;  4I3J A;  4Y2F A;  2O9B A;  2Y79 A;  1W63 Q;  5F69 A;  4CLC C;  3HJK A;  3ICY A;  2INW A;  3OCL A;  1T1C A;  1OJG A;  2OAQ 1;  3EOI A;  4Y3I A;  3UE6 A;  2V9A A;  4G3V A;  3T4Q A;  1LSW A;  5HD3 A;  4PHT A;  2VV8 A;  4KQO A;  3S7P A;  3LR3 A;  2HV1 A;  1ZHH B;  2L4R A;  4JGR A;  3S7Q A;  2QWS A;  1DP8 A;  2BAS A;  2PT7 A;  3F1O B;  4FSF A;  4CLC A;  3TJZ C;  2HF6 A;  2JKR I;  4ETX A;  1H3Q A;  3HCY A;  4L9F A;  5HDC A;  1STZ A;  2WKR A;  4NXB A;  5FL3 A;  3ULF A;  4EQ1 A;  1KOU A;  4P6Z S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...