4P6ZM

Crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
422
structure length
415
Chain Sequence
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 Vpu-mediated BST2 antagonism via hijacking of the clathrin adaptor protein complex 1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords AP-1 complex subunit gamma-1
total genus 89
structure length 415
sequence length 422
ec nomenclature
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4p6zM01
4NEED 2VGLS 2JKTM 2JKTI 4UQIS 2FH5A 1NRJA 4P6ZS 3TJZC 4P6ZM 1W63Q 2VGLM 2JKRM 2HF6A 2JKRI 1W63M 2XA7S 5MC7A 2XA7M 4UQIM
chains in the Genus database with same CATH superfamily
3PBQA 4NK3A 2XFTA 4UA7A 3M6BA 3I7JA 4U0XA 4DDYA 3HUOA 1W63Q 2Y2LA 5EE8A 4NXBA 4I3IA 3LY4A 1L0FA 1ES3A 2EWVA 1BULA 5DTKA 2Z2MB 1E3UD 3ZDJA 5K5BA 5F1FA 4G3KA 2ZOIA 4PM5A 3NC8A 4R4RA 3VP2A 1ERQA 3UDIA 3MXRA 4OLGA 2ZM0A 2MJ6A 3B42A 3MQ0A 5L8MA 1WYCA 2XRNA 3GECA 2EX6A 5CGSA 4NEED 3IF5A 5GHXA 5JYPA 2HP6A 2G2WA 4S2NA 4KZBA 1G68A 1K6RA 1DP9A 1BYWA 4JF5A 3NOPC 4HOIA 2L4RA 2XK1A 1CEGA 2WAEA 4U0TA 3HUNA 4M3KA 4FOFA 2WZXA 4GOGA 3U4LP 4GW9A 5TFQA 1IKIA 4DXBA 2HDQA 4R3JA 1G6OA 1SHVA 3Q7VA 3V39A 3C2WA 5CRFA 4X1MA 4E3IA 5E2FA 5M1AA 1VHMA 2HP9A 1GCEA 4BENA 3IXHA 4XUXA 4E3MA 3KSIA 4QY6A 3ZCZA 4JXGA 1MBLA 2JKFA 2JC7A 2HGVA 3FZCA 3K3CA 3PAEA 4Y3IA 5HAPA 3A3FA 3OZHA 4NXGA 3HL9A 3ZYTA 2PDRA 2XA7M 4IVKA 4GHIA 2Z6DA 3LI9A 1L3LA 2M7VA 1K56D 5EM1A 1Z6FA 4MEZA 2V1AA 1XX2A 3UO9A 4E3JA 4DKIA 3OCLA 2V20A 1PW8A 2JE5A 3LR0A 1TF1A 3ZFZA 2J3WA 3M2KA 4Q8IA 3WS5A 5HAQA 1ZKJA 1VETB 3VP4A 3RXXA 4X6TA 5HX9A 1YLYA 1WE4A 3E4PA 4S2NC 2W3GA 1BSGA 4OPYA 3O87A 5DTSA 2PR5A 1FIKA 3N8LA 3ZG8B 1UGUA 4H6JA 4O7DA 1D1JA 3CZDA 4N1XA 3H7WA 3S4XA 3MKEA 4GS9B 1TVFA 1GA0A 2INWA 4LV3A 3UE0A 3NCKA 3C30A 3U2AA 4HQAA 3S7OA 2OWJA 2J7VA 3WRTA 1IEMA 3VFFA 4OOMA 5A92A 1SKFA 3V3RA 4LV2A 4RA7A 3SH9A 2ZC5B 4EV4A 2E8JA 4Y17A 5EVIB 3PR6A 2KOIA 3NBLA 2VKSA 1FSWA 4K0WA 3JPUA 5GLDA 2ACGA 2H0TA 3IHBA 1NLZA 1CI8A 1WYBA 3N8RA 4RVAA 1TS7A 3DTIA 1IFQA 4MNRA 3LYXA 3UE6A 5L2FA 2ZQ9A 1TEMA 2BTFP 3MKFA 2Z2LB 1I5QA 3QP4A 2B18A 3FC7A 3T12B 4A5RA 2BG1A 4E04A 5L09A 4JGQA 1KOUA 3KO6A 4EEPA 4DJ2A 3PBSA 1DJAA 4OPRA 2WKEA 5EM0A 1N9NA 4WZ4A 1GHPA 3IX4A 4KQRA 1XJ6A 5DF7A 3PXPA 4EBLA 4DRTA 2V1ZA 3MBZA 1ZHHB 2ZQ8A 3PTEA 3P01A 2OLVA 3K3DA 3KYQA 1PZPA 3CWFA 1BTLA 4GDBA 1YLTA 2VZWA 3FYZA 1HTZA 4F3LA 1NY0A 4HBTA 5FAQA 5GL9A 3H82B 3NDGA 1Z09A 3TRCA 3FKVA 4II7A 3FWLA 4OONA 2GDNA 4DDSA 3VP1A 3BQAA 3CHWP 4CLCD 2EX2A 5HPFA 2V9AA 3GQZA 3W2ZA 5AQ7A 1OJ5A 1IYOA 5FI7A 3LR3A 1CJFA 3UNWA 2B95A 3VP3A 5GLCA 2QPNA 2HJ9C 1H3QA 4KZ7A 1TDGA 1ACFA 3S7QA 5DTTA 2W1TB 4DMZA 5G4YA 2H28A 2Y2MA 2JN7A 4HBUA 2Y2PA 2W1RA 5EVID 2V1BA 3VOLA 3N6IA 1CK3A 5FI6A 4EUZA 1FQGA 2QHKA 1I2SA 2FZ0A 3OLOA 1ONHA 2PU2A 2R78A 5HARA 3BQ8A 5CEDA 3NOUC 1IOUA 3HCYA 3PBRA 1K56A 3MZEA 2A3UA 4CLCE 3G31A 5EVIA 4O01A 3H7WB 5GLAA 2H0YA 4KZ5A 1K54A 2QMIA 2W3HA 4S2MA 4BL3A 2D01A 4CLCC 1MXOA 4X56A 2P9VB 5HL1A 2A24A 5HAIA 3D72A 3T4LA 4KUKA 3DW0A 3EEAA 3LIAA 1FR1A 5DF9A 4LV0A 3A3JA 3CMZA 2EA9A 2ZQCA 3EOIA 3SH8A 1RGZA 5C5KA 3B3XA 2VJWA 3RTYA 4JXSA 3WRZA 4B4XA 1MWRA 1NXYA 3UB7A 2I72A 2Y2OA 1E4DA 2P74A 4KG6A 2XEPA 4KZ9A 1VB6A 4MMNA 3ZVTA 4YOFA 4MBFA 4E3KA 2PD8A 4HH3A 3LIDA 4K08A 3HJIA 4MCWA 4R6LA 3BW6A 4GJ4A 5E2GA 1M40A 3FPWA 3BECA 1O07A 3VSLA 1K57C 1V9ZA 1U60A 4I5SA 5DJUA 1NZOA 4L9EA 4HJ3A 5CTNA 3GVBA 3MZFA 4QJGA 3DBAA 4E6XA 3BM6A 1ESUA 4WEKA 1PWCA 4E3OA 1YAXA 3M2JA 4FH2A 2O0YA 1N9LA 2HDRA 3ZG7B 2QJ5A 4CLCA 4PAUA 1EWZA 3UMDA 1T19A 4B4ZA 4ID4A 3QHYA 3FPVA 3CAXA 3EEHA 4N1HA 1YPRA 5FL3A 3SH7A 4UEYA 4PM7A 2XGNA 3MFDA 4MBKA 4HIAA 2JHEA 1NYMA 4MBHA 3LIFA 4EU0A 1YLZA 3RJUA 4KZAA 1JWVA 5HL6A 5AVEA 2V8FA 4EW7A 2Y91A 4S2PA 2UV0E 3KSGA 1IYQA 1W63M 2XA7S 3ITAA 2ZL1A 4Y7PA 3Q07A 3PBTA 3MFXA 1LSWA 5CX7A 4BBTA 2P08A 1VEUB 2YKFA 4N92A 3T4SA 1IYPA 2ZC7A 3A0RA 3QP6A 4S2JA 3CPTB 5DF8A 1OPXA 3Q1FA 5A8BA 5KIZA 4JXVA 3VSKA 1AWIA 1YMSA 3D3OA 3PAGA 4LPZA 1BLHA 4AFIA 1PYYA 2WKPA 4S2LA 1I2WA 2PHYA 3IF6C 2Y2QA 1PRQA 1K25A 1YT4A 3HLEA 1HLUP 3G30A 1Y28A 5HW3A 1MKMA 3N4IA 2Y2KA 2ZOHA 3DTMA 5CGWA 3NHQA 1P9RA 4R70A 4IBRA 5A93A 5EV0A 3O3VA 4JXWA 4BBUA 2VGLM 1XPBA 1S1ZA 1TD5A 5KZHA 3BWLA 2C5WB 3E2LA 5EOOA 2EWWA 2XQZA 4Y0UA 3BLSA 5A91A 1Q2QA 2Q9NA 3EQUA 2FFYA 4OQGA 4R1GA 3MQQA 3OPLA 3EGXC 3HREA 2VV7A 4LFUA 2P9VA 4RQ9A 4Y5FA 3N7WA 1CEFA 1J3WA 4ZDXA 4I38A 3TG9A 4BMWA 4EBPA 3WWXA 2Y2JA 2FFFB 4MN7A 3IBRA 2KX6A 2VV6A 1XFQA 1XKZA 2PT7A 1PI5A 3R7WB 3IX8A 3F1PA 1FILA 3K2NA 1PNEA 3BEBA 4FUWA 2P04A 5EUAA 5F1GA 4C6YA 3P98A 3Q7ZA 1XGIA 3T4KA 3Q82A 5BOHA 5HD5A 3O86A 3MXSA 2QJ7A 1DP6A 5IS1A 3IF6A 4BQMA 2O9CA 3FV7A 3UB5P 1FCOA 2D02A 2ZQ7A 3S1YA 4GB7A 2XF3A 4LRXC 1IKGA 3LIEA 3F1OB 5DKKA 3BFCA 4IUHA 1CF0A 1E3UA 4NXFA 3WS0A 1KVMA 2XH9A 5E43A 3HJKA 2Q0OA 4UA6A 2ZC3B 3BFGA 2IWBA 1T1AA 3BFEA 4FCFA 1PIOA 3G32A 3A3EA 4HEFA 1QMEA 3LIBA 4GD8A 3GV9A 4MN6A 4I3JA 1FR6A 4LGWA 4DJ3A 2IA2A 1HVBA 4ZAMA 1KE3A 4WZ5C 5KMWA 2HF6A 4O8GA 4UQIS 5L07A 1DP8A 1KVLA 1P9WA 3F1NB 4P0MA 1MWSA 4YWZA 4P85A 4GNUA 3UPOA 4DN0A 2G7UA 4UQIM 3C4OA 4GS9A 4IJGA 2ZMFA 2QKPA 3LFVA 1IYSA 5HDSA 3HLDA 4X55A 4PMAA 5IHVA 1ONGA 1FCMA 1TDLA 3QP2A 1GSWA 4DXCA 3CITA 2WGVA 3GRJA 4QHCA 1XFNA 4DE3A 3T1QB 1X0OA 5FDHA 4KUOA 4QD4A 3IBJA 3PYPA 4HNBA 5CERA 4NXEA 1FOFA 1N9OA 3BYDA 2WKRA 4X69A 5E2EA 3EWKA 2L0WA 2PD7A 3GDIA 4P6ZM 2H5SA 3G2YA 1S67L 3O88A 2EFXA 3OCNA 2LB5A 3NIAA 3MSHA 4S2KA 5FQIA 1K0KA 4R23A 4P6BA 5E2HA 2L1MA 3IXDA 4RX3A 2IWCA 4WZ5A 3C7UA 3F1PB 2WGWA 4B93A 2EX9A 3FKWA 2X02A 3S7PA 3ITBA 4GD6A 2BASA 1GSXA 1F2KA 2RL3A 3IXGA 2IWDA 3NOTC 3DTKA 2JKRI 3VOZA 4KG2A 4MDZA 1J9MA 1CI9A 3N8SA 5DFYA 5FAOA 4KQOA 4I39A 1Y4OA 2ZQAA 1P97A 5F68A 3ZNTA 3SOIA 1SZVA 2Y2HA 1ZC2A 2G2UA 2ZMAA 3V50A 4WMCD 3CUEC 1PW1A 2Z6CA 3PBNA 1H8MA 4DE2A 3T4JA 5HPIA 1RGYA 3NY4A 1AXBA 4F3LB 1NRFA 1KGGA 4ETZA 5F5YA 5F6AA 4S2IA 4K91A 4RX2A 1LL8A 3KSHA 1L0DA 3KYEA 5AJGA 4X53A 4EWFA 4PM8A 5FSRA 1XA7A 5M18A 4WF0A 2O99A 4OLDA 3BRMA 4OQHA 4LCLA 2A2LA 4Q0IA 4LLOB 4ZJ2A 1UWNX 4GLQA 3B33A 3NJAA 2ZM8A 3RFBA 4GKUA 4EUVA 1XJ4A 3DWZA 5AQBA 1TS0A 3HBRA 2QYBA 3CI6A 4K0XA 3SS5A 4O0PA 1UWPX 2OOLA 4YINA 3AGDA 3GTCA 4DF6A 3F1OA 1OTEA 3LICA 3SS4A 5CTMA 1XJ3A 2VX8A 4R3BA 4X1LA 1BZAA 4OQIA 2WKHA 4HHDA 4BLMA 5HFOA 4ETXA 1W8QA 5G4ZA 2V0WA 5FI2A 4EQ1A 2NUPC 3VE3A 4RYEA 3UE3A 1LL5A 1KGEA 2V2FF 4ARZB 3WS4A 3IX3A 4Y2FA 2VEAA 4JF4A 1YMXA 5EVLA 3VE4A 4U3TA 2UWXA 4OKPA 4N9LA 2V8CA 2R9XA 5F69A 3UPNA 3AGEA 3VP0A 3M6HA 1ZG4A 3PHYA 2ZBBA 4PM9A 1N9BA 4Z9QA 3CG5A 2PRFA 1T18A 4N9KA 2ZC6B 3IH9A 1H8YA 4LRYC 3UB9A 3W4PA 4JGOA 4DE1A 4L9GA 2EX8A 5AQAA 3VOYA 4ESPA 5EVIC 1BUEA 4HI4A 4IVIA 2M1CA 2W27A 1EI5A 2OLUA 2GNXA 2AVXA 2VGKA 3NULA 1LHYA 1EW0A 2V0UA 2CC1A 1K6SA 1D06A 4B9OA 5TBMA 2PR6A 5EPHA 2K2NA 2VA0A 2JKTM 4JKTA 5FAPA 4ZRRA 1ODVA 2ZD8A 1S0WA 2WYXA 2H10A 3ZVWA 1G28A 5L10A 1JTGA 4UA9A 5HSQA 2JCHA 2GZAA 5GLBA 4R3AA 2E8IA 4KQQA 3T4TA 1ALQA 4Y0OA 2Y2GA 5FA7A 4QU3A 1LI0A 2OSUA 1KE4A 3BY9A 3EGDC 4EXOA 2J8YA 3W4QA 2XLNA 1FSYA 5HZHA 3OOVA 1XGJA 3HLFA 2WUQA 3FG8A 1GSVA 3ZG0A 1Q2PA 3DWKA 1MWTA 3IHAA 1SCWA 1EROA 2PAVP 3BJNA 1S4RA 2RCXA 3LUQA 3UN7A 2JKGA 1GHIA 3R7WA 4Y0TA 2O9BA 5FQJA 2VGLS 5G18A 1SDNA 4HJ4A 3ZNYA 5GHYA 5TR7A 2ZM2A 3KSFA 4ZTKA 4IEDA 2ZQDA 3QP5A 1KDSA 2WZZA 5EOEA 4PKYA 5FDSA 4E3LA 2XDMA 3TOIA 1LL9A 3RXWA 3O5YA 5CECA 1BT5A 2W3EA 3OC2A 4WLAA 1WA9A 5I5LA 2HZ5A 1G5UA 4XT2A 1YM1A 2W3DA 4WEJA 3BFDA 3IWOA 3BFFA 3ZHHA 2XROA 3HLWA 3IWIA 1D7EA 4Y13A 3R4KA 2Y55A 4LV1A 2CMNA 4S2OA 2R9WA 4WMCA 4M4XA 2Y79A 3C7VA 3OPRA 1ES4A 4C75A 4GZBA 1BLPA 4DE0A 2W0NA 1YLWA 2FH5A 2DMWA 1RP5A 3V3SA 5D3OA 1ESIA 2XR0A 1KE0A 3BY8A 4JGRA 4FH4A 3GMWA 5FQKA 4X68A 5DFXA 3Q7VB 4IHQA 4Q0JA 1K55A 5FQQA 2M7UA 2JKRM 1G6AA 3C4PA 3DTEA 5MC7A 5J7EA 4R4SA 5F82A 3A3IA 2DCFA 2ZJ9A 3H82A 1ZG6A 3HLGA 4OP5A 3UY6A 1W8YA 3IF6B 3SS3A 4ZBEA 1TS6A 4IUKA 3CJMA 5DJTA 2A49A 3JVUA 4JPMA 2OV5A 4ZJ3A 2EXBA 3G2ZA 4Z1WA 1LSXA 5F83A 3H9WA 1K38A 3UB6A 4XT2B 2OAQ1 2Y59A 4UHUA 2KLIA 3ZG9B 1DJCA 2EXAA 4HY8A 1GHMA 3CPTA 2DNSA 2B5RA 1LLBA 4ME4A 4EEUA 3T4QA 4C3QA 2HDUA 1DRMA 1YSQA 3T50A 2ZMVA 3OBFA 3P7NA 3UMEA 3NECA 4BL2A 3TJZC 3E0YA 2PYPA 3E2KA 1NZUA 4I3AA 3HUMA 5CGXA 1W7FA 3OPPA 2Q9MA 4NKPA 4FD8A 1YQSA 2W3FA 3ICYA 1JWPA 3ISGA 1STZA 1BLSA 1JTDA 1K55C 3ZQ5A 4GCZA 2GX5A 3W4OA 4NETA 1H5XA 1FCNA 1ES2A 4NG2A 5I94A 2VK3A 4E6WA 4GDNA 4L0LA 4KZ4A 2PBDP 2Y2NA 3V5MA 5CHUA 4PPRA 5FASA 2K31A 2EFUA 3L7HA 1GA9A 3V67A 4MN5A 4JLFA 5U47A 4Q0HA 2QZ6A 4PM6A 2A24B 2ZC4B 1OT6A 4KZ6A 3LEQA 2XD5A 2J9PA 3BLMA 4XUZA 2WADA 4EERA 2ZLYA 5J8XA 4F94A 3S7NA 1NRJA 1QMFA 4EETB 1XXMA 3KYZA 3LO7A 1T1CA 4JGPA 3A3DA 4WYYA 4YFMA 1YLJA 4JF6A 1W5DA 2C6WB 1XA1A 2X71A 3A0SA 4QPRA 2OAP1 3W8KA 3IS2B 4OOLA 4B88A 3G4PA 4H8RA 1PFLA 1M6KA 5J4EA 4G3VA 1F98A 3CLOA 2Y2IA 3ZG5A 2HDSA 1XP4A 4HP4A 5TJJA 3NI9A 3G34A 2HJEA 2DRWA 2P7JA 1YLPA 3QNCA 2J9OA 4BD0A 1OT9A 5HDCA 3LR4A 2J3TD 1PI4A 4WL9A 3ZGAB 2WGWB 3LCEA 4XXRA 3UPPA 1HZOA 4GHIB 3D9YA 5EECA 3VV4A 4Y15A 4GN2A 2J80A 5HDDA 3T4OA 3T1SA 4WM9A 3LGOA 1VETA 5FATA 3RH8B 1MC0A 1P0ZA 4BBVA 2Y8HA 5A90A 5IT5A 1DY6A 5EVEA 3G35A 4HJ6A 3CUEA 5CXWA 4CQHA 4EQIA 4OPZA 2WKQA 1KDWA 3VFHA 1LSVA 2W1TA 2QWSA 4P87A 3JVVA 5M19A 3EQVA 4WN5A 1PWDA 5HD3A 3IQAA 4OOYA 3HLBA 3MS6A 4QY5A 5HWVA 2PU4A 2XFSA 4BJPA 1F9IA 1L0EA 4KG5A 1JNUA 3D4FA 4OP8A 5HWWA 3LEZA 1V9YA 1NYYA 1ERMA 1MY8A 1XJ2A 3LR5A 2WKIA 2BLSA 2X01A 2NUTC 1H0MA 4E3NA 5KSCA 4OVDA 2VV8A 4BWIA 2WGIA 3NDEA 2B02A 2VGJA 1LI9A 5CHMA 3UDXA 1LT0A 4ARZA 4HP9A 1PWGA 2PBYA 2Y4AA 4L9FA 2JBFA 1NJ4A 1SDEA 3IXBA 5TGFA 3AGFA 1KGFA 3JYIA 4HH2A 2HV1A 3KX0X 3P09A 4LRZE 3WS2A 5JYOA 4LENA 5DVAA 1Y54A 4X25A 2O9AA 2OWHA 3C5AA 5TBMB 3VMAA 1VQQA 1SKOA 3SZTA 3OPHA 4YNRA 2I9VA 1O7EA 3G6OA 1ES5A 1OTIA 4UAAA 3S22A 3MZDA 1HD8A 5DKLA 3UB8A 3GSGA 5HWTA 2LB9A 1W79A 4HESA 1K4FA 3UE1A 5CEBA 5AVFA 1NWZA 3WS1A 3T1XA 1DJBA 3LI8A 4KZ8A 3B47A 3LY3A 4WBGA 1T1BA 4G3WA 4D2OA 2GJ3A 3IWQA 4BD1A 2K7SA 4P6ZS 4QWOA 1RCJA 3IT9A 3E4QA 4ZJ1A 1OJGA 3IS2A 1NLYA 3C8CA 1IELA 5AQ9A 1OTBA 3HVFA 1A0KA 2XD1A 1S6RA 4KZ3A 3ULFA 4D60A 1MZUA 3L9KA 5FQ9A 4CPKA 4PKYG 1MKIA 3UDFA 1S1YA 3QNBA 2WAFA 4CLCB 1YSPA 3E4OA 1K57A 1MPLA 4LCMA 1K4EA 5CHJA 4QB8A 4JBFA 3IH8A 4H6JB 5IU1A 3GR2A 1S4SA 2WK0A 1ZTUA 1SKOB 1PZOA 3MF0A 3MXQA 3E98A 4MLLA 3QP8A 3MR0A 4OH0A 1JVJA 3C38A 2JKTI 2KDKA 1N4OA 1VM1A 2PYRA 3Q81A 4EBNA 5FEGA 3T1RA 3QP1A 1CQAA 3F1NA 1VEUA 2XSSA 1L0GA 5GHZA 4OPQA 1MWUA 1K54C 1BLCA 1H8ZA 1C3BA 1L2SA 3PBOA 2J3TC 4EESA 1F5MA 4R38A 1JWZA 4FSFA 1OMEA 3MQOA 1OTAA 3A0VA 5FQMA 4WUJA 3TSGA 4IBXA 4FTXA 1E25A 3DAVA 2HP5A 2HPBA 4CJNA 5EFWA 1YKDA 5FEFA 3TW8A 4R0QA 5LBRA 2ZL1B 2YKHA 3MMHA 1TS8A 3TE8A 5J3WA 3MJQA 4WELA 5KSHA 4OQ0A 1OTDA 3HLCA 4PHTA 2VLGA 4KENB 3SW1A 4KQDA 1S66L
chains in the Genus database with same CATH topology
3PBQA 1P97A 5F68A 1STZA 1VB6A 3ZQ5A 4MMNA 4GCZA 4YOFA 3CUEC 2Z6CA 3PBNA 1H8MA 2GX5A 2PD8A 4HH3A 3T4JA 5HPIA 1W63Q 3LIDA 4K08A 4NXBA 4F3LB 4ETZA 3HJIA 5F5YA 5F6AA 4L0LA 4I3IA 1LL8A 4MCWA 3KSHA 4R6LA 5AJGA 3BW6A 2EWVA 2K31A 4GJ4A 3FPWA 5K5BA 3V67A 4MN5A 1V9ZA 4G3KA 4Q0HA 2ZOIA 4WF0A 2O99A 4I5SA 5DJUA 2A24B 4L9EA 2A2LA 4Q0IA 4LLOB 4HJ3A 1OT6A 1UWNX 4GLQA 3DBAA 3B33A 3NJAA 4WEKA 4EERA 2MJ6A 3B42A 3MQ0A 5L8MA 3RFBA 1YAXA 3S7NA 1NRJA 2XRNA 3GECA 4EETB 2O0YA 4EUVA 1XJ4A 1N9LA 2QJ5A 4NEED 4CLCA 4PAUA 1TS0A 3KYZA 3UMDA 1T19A 1T1CA 3FPVA 3CAXA 3EEHA 2QYBA 3CI6A 4JGPA 5FL3A 1DP9A 1BYWA 4UEYA 3NOPC 4O0PA 1UWPX 4HOIA 2L4RA 2OOLA 3A0SA 4QPRA 4HIAA 2JHEA 2OAP1 3F1OA 1OTEA 4EU0A 3LIFA 3LICA 4FOFA 3IS2B 4OOLA 5HL6A 5AVEA 4GW9A 4EW7A 5J4EA 4G3VA 1F98A 1XJ3A 3CLOA 2VX8A 3KSGA 1G6OA 4HP4A 5TJJA 1W63M 2XA7S 3C2WA 2HJEA 3PBTA 4HHDA 3MFXA 1LSWA 5CX7A 4BBTA 4ETXA 2P7JA 5G4ZA 2P08A 2V0WA 4EQ1A 1VHMA 2YKFA 2NUPC 3VE3A 3T4SA 3UE3A 1OT9A 5HDCA 3A0RA 3LR4A 2J3TD 4ARZB 1OPXA 4WL9A 5A8BA 5KIZA 3KSIA 4Y2FA 2VEAA 2HGVA 3D3OA 4GHIB 4LPZA 3VE4A 4AFIA 3K3CA 3VV4A 4Y3IA 4NXGA 2WKPA 5F69A 3ZYTA 2J80A 5HDDA 2PDRA 2XA7M 2PHYA 3T4OA 4GHIA 2Z6DA 3PHYA 3RH8B 3LI9A 2ZBBA 2M7VA 1MC0A 1P0ZA 4BBVA 2Y8HA 1Y28A 1T18A 5IT5A 1MKMA 2V1AA 4LRYC 3UB9A 4HJ6A 4JGOA 2ZOHA 3CUEA 4CQHA 4L9GA 3OCLA 3NHQA 2WKQA 1P9RA 3LR0A 4R70A 4HI4A 1LSVA 2W1TA 1TF1A 2M1CA 2QWSA 2W27A 4BBUA 2VGLM 2J3WA 2GNXA 3JVVA 1S1ZA 1TD5A 3EQVA 4WN5A 3BWLA 1EW0A 2V0UA 3E4PA 2W3GA 2EWWA 1D06A 5HD3A 4B9OA 5TBMA 2PR6A 2PR5A 2K2NA 2VA0A 5HWVA 2JKTM 3EQUA 4BJPA 1F9IA 4ZRRA 1ODVA 1UGUA 3MQQA 4H6JA 3H7WA 1JNUA 3EGXC 5HWWA 1G28A 2VV7A 4RQ9A 4GS9B 4Y5FA 1V9YA 4I38A 5HSQA 4BMWA 2GZAA 2INWA 1XJ2A 3LR5A 4R3AA 3C30A 4MN7A 3IBRA 2KX6A 2VV6A 3U2AA 4HQAA 3S7OA 3T4TA 2NUTC 2OWJA 1XFQA 2PT7A 2VV8A 4BWIA 4OOMA 3BY9A 3R7WB 3EGDC 4EXOA 2B02A 3F1PA 3K2NA 1LT0A 2P04A 4ARZA 4HP9A 5HZHA 3OOVA 3PR6A 4L9FA 3FG8A 1GSVA 3T4KA 2KOIA 2VKSA 5HD5A 2QJ7A 1DP6A 3BJNA 5IS1A 2O9CA 1NLZA 1S4RA 4HH2A 2HV1A 3KX0X 4LRZE 1TS7A 3LUQA 3R7WA 1IFQA 2D02A 3LYXA 3UE6A 2O9BA 4LRXC 2VGLS 4HJ4A 2O9AA 3LIEA 3F1OB 2OWHA 5DKKA 5TBMB 4IUHA 4NXFA 2B18A 3KSFA 3FC7A 4YNRA 2I9VA 4E04A 3G6OA 4JGQA 3HJKA 1KOUA 1OTIA 3KO6A 4EEPA 4PKYA 3PBSA 4DJ2A 5DKLA 1N9NA 3O5YA 1T1AA 3UB8A 2W3EA 4WLAA 3OC2A 1XJ6A 5HWTA 1WA9A 2LB9A 5I5LA 3PXPA 4XT2A 2W3DA 4WEJA 3LIBA 4MN6A 1ZHHB 3P01A 4I3JA 3K3DA 5AVFA 3KYQA 1NWZA 4DJ3A 3LI8A 2IA2A 2XROA 3CWFA 3B47A 1T1BA 1D7EA 2VZWA 4G3WA 3R4KA 4F3LA 2HF6A 2CMNA 4O8GA 4M4XA 2Y79A 4UQIS 2GJ3A 3H82B 2K7SA 4P6ZS 1DP8A 1P9WA 3F1NB 3TRCA 2W0NA 4YWZA 2FH5A 2DMWA 3E4QA 4II7A 1OJGA 4DN0A 2G7UA 3IS2A 1NLYA 3C8CA 4UQIM 3BQAA 4CLCD 4GS9A 4IJGA 1OTBA 2ZMFA 3BY8A 4JGRA 5HPFA 2QKPA 2V9AA 3LFVA 3W2ZA 3ULFA 5HDSA 1OJ5A 5DFXA 3LR3A 1MZUA 4PKYG 1S1YA 4IHQA 1GSWA 2HJ9C 3CITA 1H3QA 4Q0JA 1YSPA 3E4OA 4CLCB 3S7QA 1XFNA 2W1TB 4DMZA 5G4YA 2H28A 2M7UA 2JKRM 1X0OA 5MC7A 5J7EA 4H6JB 5IU1A 2JN7A 1S4SA 4KUOA 1ZTUA 3H82A 3MF0A 3MXQA 3IBJA 3PYPA 4HNBA 3E98A 4NXEA 1N9OA 1TS6A 2W1RA 2WKRA 4IUKA 2V1BA 5DJTA 3EWKA 3JVUA 2L0WA 2PD7A 3GDIA 3VOLA 4P6ZM 2QHKA 3MR0A 2FZ0A 3C38A 3OLOA 1LSXA 2JKTI 4Z1WA 3H9WA 2R78A 2KDKA 3UB6A 1S67L 2PYRA 3BQ8A 3NOUC 1IOUA 3OCNA 2LB5A 3HCYA 3PBRA 4XT2B 2OAQ1 3F1NA 2KLIA 2XSSA 4CLCE 4O01A 3H7WB 4HY8A 2L1MA 2W3HA 4ME4A 4EEUA 3PBOA 3F1PB 2J3TC 3T4QA 2D01A 4CLCC 4EESA 1F5MA 1DRMA 1YSQA 4R38A 4B93A 4FSFA 3MQOA 3T50A 1OTAA 2ZMVA 2A24A 3A0VA 3D72A 3T4LA 4KUKA 3OBFA 3P7NA 4WUJA 3S7PA 3UMEA 3EEAA 3LIAA 5DF9A 3TJZC 2BASA 3E0YA 5EFWA 1GSXA 2PYPA 1YKDA 2EA9A 3TW8A 3NOTC 4I3AA 3EOIA 5LBRA 2JKRI 2YKHA 4NKPA 3MMHA 5C5KA 2VJWA 3RTYA 1TS8A 3TE8A 5J3WA 4MDZA 3MJQA 4WELA 5KSHA 5DFYA 4KQOA 1OTDA 4I39A 4PHTA 3UB7A 2VLGA 3SW1A 4KQDA 2W3FA 3ICYA 1S66L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEE D;  2VGL S;  2JKT M;  2JKT I;  4UQI S;  2FH5 A;  1NRJ A;  4P6Z S;  3TJZ C;  4P6Z M;  1W63 Q;  2VGL M;  2JKR M;  2HF6 A;  2JKR I;  1W63 M;  2XA7 S;  5MC7 A;  2XA7 M;  4UQI M; 
#chains in the Genus database with same CATH topology
 3PBQ A;  4NK3 A;  2XFT A;  4UA7 A;  3M6B A;  3I7J A;  4U0X A;  4DDY A;  3HUO A;  1W63 Q;  2Y2L A;  5EE8 A;  4NXB A;  4I3I A;  3LY4 A;  1L0F A;  1ES3 A;  2EWV A;  1BUL A;  5DTK A;  2Z2M B;  1E3U D;  3ZDJ A;  5K5B A;  5F1F A;  4G3K A;  2ZOI A;  4PM5 A;  3NC8 A;  4R4R A;  3VP2 A;  1ERQ A;  3UDI A;  3MXR A;  4OLG A;  2ZM0 A;  2MJ6 A;  3B42 A;  3MQ0 A;  5L8M A;  1WYC A;  2XRN A;  3GEC A;  2EX6 A;  5CGS A;  4NEE D;  3IF5 A;  5GHX A;  5JYP A;  2HP6 A;  2G2W A;  4S2N A;  4KZB A;  1G68 A;  1K6R A;  1DP9 A;  1BYW A;  4JF5 A;  3NOP C;  4HOI A;  2L4R A;  2XK1 A;  1CEG A;  2WAE A;  4U0T A;  3HUN A;  4M3K A;  4FOF A;  2WZX A;  4GOG A;  3U4L P;  4GW9 A;  5TFQ A;  1IKI A;  4DXB A;  2HDQ A;  4R3J A;  1G6O A;  1SHV A;  3Q7V A;  3V39 A;  3C2W A;  5CRF A;  4X1M A;  4E3I A;  5E2F A;  5M1A A;  1VHM A;  2HP9 A;  1GCE A;  4BEN A;  3IXH A;  4XUX A;  4E3M A;  3KSI A;  4QY6 A;  3ZCZ A;  4JXG A;  1MBL A;  2JKF A;  2JC7 A;  2HGV A;  3FZC A;  3K3C A;  3PAE A;  4Y3I A;  5HAP A;  3A3F A;  3OZH A;  4NXG A;  3HL9 A;  3ZYT A;  2PDR A;  2XA7 M;  4IVK A;  4GHI A;  2Z6D A;  3LI9 A;  1L3L A;  2M7V A;  1K56 D;  5EM1 A;  1Z6F A;  4MEZ A;  2V1A A;  1XX2 A;  3UO9 A;  4E3J A;  4DKI A;  3OCL A;  2V20 A;  1PW8 A;  2JE5 A;  3LR0 A;  1TF1 A;  3ZFZ A;  2J3W A;  3M2K A;  4Q8I A;  3WS5 A;  5HAQ A;  1ZKJ A;  1VET B;  3VP4 A;  3RXX A;  4X6T A;  5HX9 A;  1YLY A;  1WE4 A;  3E4P A;  4S2N C;  2W3G A;  1BSG A;  4OPY A;  3O87 A;  5DTS A;  2PR5 A;  1FIK A;  3N8L A;  3ZG8 B;  1UGU A;  4H6J A;  4O7D A;  1D1J A;  3CZD A;  4N1X A;  3H7W A;  3S4X A;  3MKE A;  4GS9 B;  1TVF A;  1GA0 A;  2INW A;  4LV3 A;  3UE0 A;  3NCK A;  3C30 A;  3U2A A;  4HQA A;  3S7O A;  2OWJ A;  2J7V A;  3WRT A;  1IEM A;  3VFF A;  4OOM A;  5A92 A;  1SKF A;  3V3R A;  4LV2 A;  4RA7 A;  3SH9 A;  2ZC5 B;  4EV4 A;  2E8J A;  4Y17 A;  5EVI B;  3PR6 A;  2KOI A;  3NBL A;  2VKS A;  1FSW A;  4K0W A;  3JPU A;  5GLD A;  2ACG A;  2H0T A;  3IHB A;  1NLZ A;  1CI8 A;  1WYB A;  3N8R A;  4RVA A;  1TS7 A;  3DTI A;  1IFQ A;  4MNR A;  3LYX A;  3UE6 A;  5L2F A;  2ZQ9 A;  1TEM A;  2BTF P;  3MKF A;  2Z2L B;  1I5Q A;  3QP4 A;  2B18 A;  3FC7 A;  3T12 B;  4A5R A;  2BG1 A;  4E04 A;  5L09 A;  4JGQ A;  1KOU A;  3KO6 A;  4EEP A;  4DJ2 A;  3PBS A;  1DJA A;  4OPR A;  2WKE A;  5EM0 A;  1N9N A;  4WZ4 A;  1GHP A;  3IX4 A;  4KQR A;  1XJ6 A;  5DF7 A;  3PXP A;  4EBL A;  4DRT A;  2V1Z A;  3MBZ A;  1ZHH B;  2ZQ8 A;  3PTE A;  3P01 A;  2OLV A;  3K3D A;  3KYQ A;  1PZP A;  3CWF A;  1BTL A;  4GDB A;  1YLT A;  2VZW A;  3FYZ A;  1HTZ A;  4F3L A;  1NY0 A;  4HBT A;  5FAQ A;  5GL9 A;  3H82 B;  3NDG A;  1Z09 A;  3TRC A;  3FKV A;  4II7 A;  3FWL A;  4OON A;  2GDN A;  4DDS A;  3VP1 A;  3BQA A;  3CHW P;  4CLC D;  2EX2 A;  5HPF A;  2V9A A;  3GQZ A;  3W2Z A;  5AQ7 A;  1OJ5 A;  1IYO A;  5FI7 A;  3LR3 A;  1CJF A;  3UNW A;  2B95 A;  3VP3 A;  5GLC A;  2QPN A;  2HJ9 C;  1H3Q A;  4KZ7 A;  1TDG A;  1ACF A;  3S7Q A;  5DTT A;  2W1T B;  4DMZ A;  5G4Y A;  2H28 A;  2Y2M A;  2JN7 A;  4HBU A;  2Y2P A;  2W1R A;  5EVI D;  2V1B A;  3VOL A;  3N6I A;  1CK3 A;  5FI6 A;  4EUZ A;  1FQG A;  2QHK A;  1I2S A;  2FZ0 A;  3OLO A;  1ONH A;  2PU2 A;  2R78 A;  5HAR A;  3BQ8 A;  5CED A;  3NOU C;  1IOU A;  3HCY A;  3PBR A;  1K56 A;  3MZE A;  2A3U A;  4CLC E;  3G31 A;  5EVI A;  4O01 A;  3H7W B;  5GLA A;  2H0Y A;  4KZ5 A;  1K54 A;  2QMI A;  2W3H A;  4S2M A;  4BL3 A;  2D01 A;  4CLC C;  1MXO A;  4X56 A;  2P9V B;  5HL1 A;  2A24 A;  5HAI A;  3D72 A;  3T4L A;  4KUK A;  3DW0 A;  3EEA A;  3LIA A;  1FR1 A;  5DF9 A;  4LV0 A;  3A3J A;  3CMZ A;  2EA9 A;  2ZQC A;  3EOI A;  3SH8 A;  1RGZ A;  5C5K A;  3B3X A;  2VJW A;  3RTY A;  4JXS A;  3WRZ A;  4B4X A;  1MWR A;  1NXY A;  3UB7 A;  2I72 A;  2Y2O A;  1E4D A;  2P74 A;  4KG6 A;  2XEP A;  4KZ9 A;  1VB6 A;  4MMN A;  3ZVT A;  4YOF A;  4MBF A;  4E3K A;  2PD8 A;  4HH3 A;  3LID A;  4K08 A;  3HJI A;  4MCW A;  4R6L A;  3BW6 A;  4GJ4 A;  5E2G A;  1M40 A;  3FPW A;  3BEC A;  1O07 A;  3VSL A;  1K57 C;  1V9Z A;  1U60 A;  4I5S A;  5DJU A;  1NZO A;  4L9E A;  4HJ3 A;  5CTN A;  3GVB A;  3MZF A;  4QJG A;  3DBA A;  4E6X A;  3BM6 A;  1ESU A;  4WEK A;  1PWC A;  4E3O A;  1YAX A;  3M2J A;  4FH2 A;  2O0Y A;  1N9L A;  2HDR A;  3ZG7 B;  2QJ5 A;  4CLC A;  4PAU A;  1EWZ A;  3UMD A;  1T19 A;  4B4Z A;  4ID4 A;  3QHY A;  3FPV A;  3CAX A;  3EEH A;  4N1H A;  1YPR A;  5FL3 A;  3SH7 A;  4UEY A;  4PM7 A;  2XGN A;  3MFD A;  4MBK A;  4HIA A;  2JHE A;  1NYM A;  4MBH A;  3LIF A;  4EU0 A;  1YLZ A;  3RJU A;  4KZA A;  1JWV A;  5HL6 A;  5AVE A;  2V8F A;  4EW7 A;  2Y91 A;  4S2P A;  2UV0 E;  3KSG A;  1IYQ A;  1W63 M;  2XA7 S;  3ITA A;  2ZL1 A;  4Y7P A;  3Q07 A;  3PBT A;  3MFX A;  1LSW A;  5CX7 A;  4BBT A;  2P08 A;  1VEU B;  2YKF A;  4N92 A;  3T4S A;  1IYP A;  2ZC7 A;  3A0R A;  3QP6 A;  4S2J A;  3CPT B;  5DF8 A;  1OPX A;  3Q1F A;  5A8B A;  5KIZ A;  4JXV A;  3VSK A;  1AWI A;  1YMS A;  3D3O A;  3PAG A;  4LPZ A;  1BLH A;  4AFI A;  1PYY A;  2WKP A;  4S2L A;  1I2W A;  2PHY A;  3IF6 C;  2Y2Q A;  1PRQ A;  1K25 A;  1YT4 A;  3HLE A;  1HLU P;  3G30 A;  1Y28 A;  5HW3 A;  1MKM A;  3N4I A;  2Y2K A;  2ZOH A;  3DTM A;  5CGW A;  3NHQ A;  1P9R A;  4R70 A;  4IBR A;  5A93 A;  5EV0 A;  3O3V A;  4JXW A;  4BBU A;  2VGL M;  1XPB A;  1S1Z A;  1TD5 A;  5KZH A;  3BWL A;  2C5W B;  3E2L A;  5EOO A;  2EWW A;  2XQZ A;  4Y0U A;  3BLS A;  5A91 A;  1Q2Q A;  2Q9N A;  3EQU A;  2FFY A;  4OQG A;  4R1G A;  3MQQ A;  3OPL A;  3EGX C;  3HRE A;  2VV7 A;  4LFU A;  2P9V A;  4RQ9 A;  4Y5F A;  3N7W A;  1CEF A;  1J3W A;  4ZDX A;  4I38 A;  3TG9 A;  4BMW A;  4EBP A;  3WWX A;  2Y2J A;  2FFF B;  4MN7 A;  3IBR A;  2KX6 A;  2VV6 A;  1XFQ A;  1XKZ A;  2PT7 A;  1PI5 A;  3R7W B;  3IX8 A;  3F1P A;  1FIL A;  3K2N A;  1PNE A;  3BEB A;  4FUW A;  2P04 A;  5EUA A;  5F1G A;  4C6Y A;  3P98 A;  3Q7Z A;  1XGI A;  3T4K A;  3Q82 A;  5BOH A;  5HD5 A;  3O86 A;  3MXS A;  2QJ7 A;  1DP6 A;  5IS1 A;  3IF6 A;  4BQM A;  2O9C A;  3FV7 A;  3UB5 P;  1FCO A;  2D02 A;  2ZQ7 A;  3S1Y A;  4GB7 A;  2XF3 A;  4LRX C;  1IKG A;  3LIE A;  3F1O B;  5DKK A;  3BFC A;  4IUH A;  1CF0 A;  1E3U A;  4NXF A;  3WS0 A;  1KVM A;  2XH9 A;  5E43 A;  3HJK A;  2Q0O A;  4UA6 A;  2ZC3 B;  3BFG A;  2IWB A;  1T1A A;  3BFE A;  4FCF A;  1PIO A;  3G32 A;  3A3E A;  4HEF A;  1QME A;  3LIB A;  4GD8 A;  3GV9 A;  4MN6 A;  4I3J A;  1FR6 A;  4LGW A;  4DJ3 A;  2IA2 A;  1HVB A;  4ZAM A;  1KE3 A;  4WZ5 C;  5KMW A;  2HF6 A;  4O8G A;  4UQI S;  5L07 A;  1DP8 A;  1KVL A;  1P9W A;  3F1N B;  4P0M A;  1MWS A;  4YWZ A;  4P85 A;  4GNU A;  3UPO A;  4DN0 A;  2G7U A;  4UQI M;  3C4O A;  4GS9 A;  4IJG A;  2ZMF A;  2QKP A;  3LFV A;  1IYS A;  5HDS A;  3HLD A;  4X55 A;  4PMA A;  5IHV A;  1ONG A;  1FCM A;  1TDL A;  3QP2 A;  1GSW A;  4DXC A;  3CIT A;  2WGV A;  3GRJ A;  4QHC A;  1XFN A;  4DE3 A;  3T1Q B;  1X0O A;  5FDH A;  4KUO A;  4QD4 A;  3IBJ A;  3PYP A;  4HNB A;  5CER A;  4NXE A;  1FOF A;  1N9O A;  3BYD A;  2WKR A;  4X69 A;  5E2E A;  3EWK A;  2L0W A;  2PD7 A;  3GDI A;  4P6Z M;  2H5S A;  3G2Y A;  1S67 L;  3O88 A;  2EFX A;  3OCN A;  2LB5 A;  3NIA A;  3MSH A;  4S2K A;  5FQI A;  1K0K A;  4R23 A;  4P6B A;  5E2H A;  2L1M A;  3IXD A;  4RX3 A;  2IWC A;  4WZ5 A;  3C7U A;  3F1P B;  2WGW A;  4B93 A;  2EX9 A;  3FKW A;  2X02 A;  3S7P A;  3ITB A;  4GD6 A;  2BAS A;  1GSX A;  1F2K A;  2RL3 A;  3IXG A;  2IWD A;  3NOT C;  3DTK A;  2JKR I;  3VOZ A;  4KG2 A;  4MDZ A;  1J9M A;  1CI9 A;  3N8S A;  5DFY A;  5FAO A;  4KQO A;  4I39 A;  1Y4O A;  2ZQA A;  1P97 A;  5F68 A;  3ZNT A;  3SOI A;  1SZV A;  2Y2H A;  1ZC2 A;  2G2U A;  2ZMA A;  3V50 A;  4WMC D;  3CUE C;  1PW1 A;  2Z6C A;  3PBN A;  1H8M A;  4DE2 A;  3T4J A;  5HPI A;  1RGY A;  3NY4 A;  1AXB A;  4F3L B;  1NRF A;  1KGG A;  4ETZ A;  5F5Y A;  5F6A A;  4S2I A;  4K91 A;  4RX2 A;  1LL8 A;  3KSH A;  1L0D A;  3KYE A;  5AJG A;  4X53 A;  4EWF A;  4PM8 A;  5FSR A;  1XA7 A;  5M18 A;  4WF0 A;  2O99 A;  4OLD A;  3BRM A;  4OQH A;  4LCL A;  2A2L A;  4Q0I A;  4LLO B;  4ZJ2 A;  1UWN X;  4GLQ A;  3B33 A;  3NJA A;  2ZM8 A;  3RFB A;  4GKU A;  4EUV A;  1XJ4 A;  3DWZ A;  5AQB A;  1TS0 A;  3HBR A;  2QYB A;  3CI6 A;  4K0X A;  3SS5 A;  4O0P A;  1UWP X;  2OOL A;  4YIN A;  3AGD A;  3GTC A;  4DF6 A;  3F1O A;  1OTE A;  3LIC A;  3SS4 A;  5CTM A;  1XJ3 A;  2VX8 A;  4R3B A;  4X1L A;  1BZA A;  4OQI A;  2WKH A;  4HHD A;  4BLM A;  5HFO A;  4ETX A;  1W8Q A;  5G4Z A;  2V0W A;  5FI2 A;  4EQ1 A;  2NUP C;  3VE3 A;  4RYE A;  3UE3 A;  1LL5 A;  1KGE A;  2V2F F;  4ARZ B;  3WS4 A;  3IX3 A;  4Y2F A;  2VEA A;  4JF4 A;  1YMX A;  5EVL A;  3VE4 A;  4U3T A;  2UWX A;  4OKP A;  4N9L A;  2V8C A;  2R9X A;  5F69 A;  3UPN A;  3AGE A;  3VP0 A;  3M6H A;  1ZG4 A;  3PHY A;  2ZBB A;  4PM9 A;  1N9B A;  4Z9Q A;  3CG5 A;  2PRF A;  1T18 A;  4N9K A;  2ZC6 B;  3IH9 A;  1H8Y A;  4LRY C;  3UB9 A;  3W4P A;  4JGO A;  4DE1 A;  4L9G A;  2EX8 A;  5AQA A;  3VOY A;  4ESP A;  5EVI C;  1BUE A;  4HI4 A;  4IVI A;  2M1C A;  2W27 A;  1EI5 A;  2OLU A;  2GNX A;  2AVX A;  2VGK A;  3NUL A;  1LHY A;  1EW0 A;  2V0U A;  2CC1 A;  1K6S A;  1D06 A;  4B9O A;  5TBM A;  2PR6 A;  5EPH A;  2K2N A;  2VA0 A;  2JKT M;  4JKT A;  5FAP A;  4ZRR A;  1ODV A;  2ZD8 A;  1S0W A;  2WYX A;  2H10 A;  3ZVW A;  1G28 A;  5L10 A;  1JTG A;  4UA9 A;  5HSQ A;  2JCH A;  2GZA A;  5GLB A;  4R3A A;  2E8I A;  4KQQ A;  3T4T A;  1ALQ A;  4Y0O A;  2Y2G A;  5FA7 A;  4QU3 A;  1LI0 A;  2OSU A;  1KE4 A;  3BY9 A;  3EGD C;  4EXO A;  2J8Y A;  3W4Q A;  2XLN A;  1FSY A;  5HZH A;  3OOV A;  1XGJ A;  3HLF A;  2WUQ A;  3FG8 A;  1GSV A;  3ZG0 A;  1Q2P A;  3DWK A;  1MWT A;  3IHA A;  1SCW A;  1ERO A;  2PAV P;  3BJN A;  1S4R A;  2RCX A;  3LUQ A;  3UN7 A;  2JKG A;  1GHI A;  3R7W A;  4Y0T A;  2O9B A;  5FQJ A;  2VGL S;  5G18 A;  1SDN A;  4HJ4 A;  3ZNY A;  5GHY A;  5TR7 A;  2ZM2 A;  3KSF A;  4ZTK A;  4IED A;  2ZQD A;  3QP5 A;  1KDS A;  2WZZ A;  5EOE A;  4PKY A;  5FDS A;  4E3L A;  2XDM A;  3TOI A;  1LL9 A;  3RXW A;  3O5Y A;  5CEC A;  1BT5 A;  2W3E A;  3OC2 A;  4WLA A;  1WA9 A;  5I5L A;  2HZ5 A;  1G5U A;  4XT2 A;  1YM1 A;  2W3D A;  4WEJ A;  3BFD A;  3IWO A;  3BFF A;  3ZHH A;  2XRO A;  3HLW A;  3IWI A;  1D7E A;  4Y13 A;  3R4K A;  2Y55 A;  4LV1 A;  2CMN A;  4S2O A;  2R9W A;  4WMC A;  4M4X A;  2Y79 A;  3C7V A;  3OPR A;  1ES4 A;  4C75 A;  4GZB A;  1BLP A;  4DE0 A;  2W0N A;  1YLW A;  2FH5 A;  2DMW A;  1RP5 A;  3V3S A;  5D3O A;  1ESI A;  2XR0 A;  1KE0 A;  3BY8 A;  4JGR A;  4FH4 A;  3GMW A;  5FQK A;  4X68 A;  5DFX A;  3Q7V B;  4IHQ A;  4Q0J A;  1K55 A;  5FQQ A;  2M7U A;  2JKR M;  1G6A A;  3C4P A;  3DTE A;  5MC7 A;  5J7E A;  4R4S A;  5F82 A;  3A3I A;  2DCF A;  2ZJ9 A;  3H82 A;  1ZG6 A;  3HLG A;  4OP5 A;  3UY6 A;  1W8Y A;  3IF6 B;  3SS3 A;  4ZBE A;  1TS6 A;  4IUK A;  3CJM A;  5DJT A;  2A49 A;  3JVU A;  4JPM A;  2OV5 A;  4ZJ3 A;  2EXB A;  3G2Z A;  4Z1W A;  1LSX A;  5F83 A;  3H9W A;  1K38 A;  3UB6 A;  4XT2 B;  2OAQ 1;  2Y59 A;  4UHU A;  2KLI A;  3ZG9 B;  1DJC A;  2EXA A;  4HY8 A;  1GHM A;  3CPT A;  2DNS A;  2B5R A;  1LLB A;  4ME4 A;  4EEU A;  3T4Q A;  4C3Q A;  2HDU A;  1DRM A;  1YSQ A;  3T50 A;  2ZMV A;  3OBF A;  3P7N A;  3UME A;  3NEC A;  4BL2 A;  3TJZ C;  3E0Y A;  2PYP A;  3E2K A;  1NZU A;  4I3A A;  3HUM A;  5CGX A;  1W7F A;  3OPP A;  2Q9M A;  4NKP A;  4FD8 A;  1YQS A;  2W3F A;  3ICY A;  1JWP A;  3ISG A;  1STZ A;  1BLS A;  1JTD A;  1K55 C;  3ZQ5 A;  4GCZ A;  2GX5 A;  3W4O A;  4NET A;  1H5X A;  1FCN A;  1ES2 A;  4NG2 A;  5I94 A;  2VK3 A;  4E6W A;  4GDN A;  4L0L A;  4KZ4 A;  2PBD P;  2Y2N A;  3V5M A;  5CHU A;  4PPR A;  5FAS A;  2K31 A;  2EFU A;  3L7H A;  1GA9 A;  3V67 A;  4MN5 A;  4JLF A;  5U47 A;  4Q0H A;  2QZ6 A;  4PM6 A;  2A24 B;  2ZC4 B;  1OT6 A;  4KZ6 A;  3LEQ A;  2XD5 A;  2J9P A;  3BLM A;  4XUZ A;  2WAD A;  4EER A;  2ZLY A;  5J8X A;  4F94 A;  3S7N A;  1NRJ A;  1QMF A;  4EET B;  1XXM A;  3KYZ A;  3LO7 A;  1T1C A;  4JGP A;  3A3D A;  4WYY A;  4YFM A;  1YLJ A;  4JF6 A;  1W5D A;  2C6W B;  1XA1 A;  2X71 A;  3A0S A;  4QPR A;  2OAP 1;  3W8K A;  3IS2 B;  4OOL A;  4B88 A;  3G4P A;  4H8R A;  1PFL A;  1M6K A;  5J4E A;  4G3V A;  1F98 A;  3CLO A;  2Y2I A;  3ZG5 A;  2HDS A;  1XP4 A;  4HP4 A;  5TJJ A;  3NI9 A;  3G34 A;  2HJE A;  2DRW A;  2P7J A;  1YLP A;  3QNC A;  2J9O A;  4BD0 A;  1OT9 A;  5HDC A;  3LR4 A;  2J3T D;  1PI4 A;  4WL9 A;  3ZGA B;  2WGW B;  3LCE A;  4XXR A;  3UPP A;  1HZO A;  4GHI B;  3D9Y A;  5EEC A;  3VV4 A;  4Y15 A;  4GN2 A;  2J80 A;  5HDD A;  3T4O A;  3T1S A;  4WM9 A;  3LGO A;  1VET A;  5FAT A;  3RH8 B;  1MC0 A;  1P0Z A;  4BBV A;  2Y8H A;  5A90 A;  5IT5 A;  1DY6 A;  5EVE A;  3G35 A;  4HJ6 A;  3CUE A;  5CXW A;  4CQH A;  4EQI A;  4OPZ A;  2WKQ A;  1KDW A;  3VFH A;  1LSV A;  2W1T A;  2QWS A;  4P87 A;  3JVV A;  5M19 A;  3EQV A;  4WN5 A;  1PWD A;  5HD3 A;  3IQA A;  4OOY A;  3HLB A;  3MS6 A;  4QY5 A;  5HWV A;  2PU4 A;  2XFS A;  4BJP A;  1F9I A;  1L0E A;  4KG5 A;  1JNU A;  3D4F A;  4OP8 A;  5HWW A;  3LEZ A;  1V9Y A;  1NYY A;  1ERM A;  1MY8 A;  1XJ2 A;  3LR5 A;  2WKI A;  2BLS A;  2X01 A;  2NUT C;  1H0M A;  4E3N A;  5KSC A;  4OVD A;  2VV8 A;  4BWI A;  2WGI A;  3NDE A;  2B02 A;  2VGJ A;  1LI9 A;  5CHM A;  3UDX A;  1LT0 A;  4ARZ A;  4HP9 A;  1PWG A;  2PBY A;  2Y4A A;  4L9F A;  2JBF A;  1NJ4 A;  1SDE A;  3IXB A;  5TGF A;  3AGF A;  1KGF A;  3JYI A;  4HH2 A;  2HV1 A;  3KX0 X;  3P09 A;  4LRZ E;  3WS2 A;  5JYO A;  4LEN A;  5DVA A;  1Y54 A;  4X25 A;  2O9A A;  2OWH A;  3C5A A;  5TBM B;  3VMA A;  1VQQ A;  1SKO A;  3SZT A;  3OPH A;  4YNR A;  2I9V A;  1O7E A;  3G6O A;  1ES5 A;  1OTI A;  4UAA A;  3S22 A;  3MZD A;  1HD8 A;  5DKL A;  3UB8 A;  3GSG A;  5HWT A;  2LB9 A;  1W79 A;  4HES A;  1K4F A;  3UE1 A;  5CEB A;  5AVF A;  1NWZ A;  3WS1 A;  3T1X A;  1DJB A;  3LI8 A;  4KZ8 A;  3B47 A;  3LY3 A;  4WBG A;  1T1B A;  4G3W A;  4D2O A;  2GJ3 A;  3IWQ A;  4BD1 A;  2K7S A;  4P6Z S;  4QWO A;  1RCJ A;  3IT9 A;  3E4Q A;  4ZJ1 A;  1OJG A;  3IS2 A;  1NLY A;  3C8C A;  1IEL A;  5AQ9 A;  1OTB A;  3HVF A;  1A0K A;  2XD1 A;  1S6R A;  4KZ3 A;  3ULF A;  4D60 A;  1MZU A;  3L9K A;  5FQ9 A;  4CPK A;  4PKY G;  1MKI A;  3UDF A;  1S1Y A;  3QNB A;  2WAF A;  4CLC B;  1YSP A;  3E4O A;  1K57 A;  1MPL A;  4LCM A;  1K4E A;  5CHJ A;  4QB8 A;  4JBF A;  3IH8 A;  4H6J B;  5IU1 A;  3GR2 A;  1S4S A;  2WK0 A;  1ZTU A;  1SKO B;  1PZO A;  3MF0 A;  3MXQ A;  3E98 A;  4MLL A;  3QP8 A;  3MR0 A;  4OH0 A;  1JVJ A;  3C38 A;  2JKT I;  2KDK A;  1N4O A;  1VM1 A;  2PYR A;  3Q81 A;  4EBN A;  5FEG A;  3T1R A;  3QP1 A;  1CQA A;  3F1N A;  1VEU A;  2XSS A;  1L0G A;  5GHZ A;  4OPQ A;  1MWU A;  1K54 C;  1BLC A;  1H8Z A;  1C3B A;  1L2S A;  3PBO A;  2J3T C;  4EES A;  1F5M A;  4R38 A;  1JWZ A;  4FSF A;  1OME A;  3MQO A;  1OTA A;  3A0V A;  5FQM A;  4WUJ A;  3TSG A;  4IBX A;  4FTX A;  1E25 A;  3DAV A;  2HP5 A;  2HPB A;  4CJN A;  5EFW A;  1YKD A;  5FEF A;  3TW8 A;  4R0Q A;  5LBR A;  2ZL1 B;  2YKH A;  3MMH A;  1TS8 A;  3TE8 A;  5J3W A;  3MJQ A;  4WEL A;  5KSH A;  4OQ0 A;  1OTD A;  3HLC A;  4PHT A;  2VLG A;  4KEN B;  3SW1 A;  4KQD A;  1S66 L; 
#chains in the Genus database with same CATH homology
 3PBQ A;  1P97 A;  5F68 A;  1STZ A;  1VB6 A;  3ZQ5 A;  4MMN A;  4GCZ A;  4YOF A;  3CUE C;  2Z6C A;  3PBN A;  1H8M A;  2GX5 A;  2PD8 A;  4HH3 A;  3T4J A;  5HPI A;  1W63 Q;  3LID A;  4K08 A;  4NXB A;  4F3L B;  4ETZ A;  3HJI A;  5F5Y A;  5F6A A;  4L0L A;  4I3I A;  1LL8 A;  4MCW A;  3KSH A;  4R6L A;  5AJG A;  3BW6 A;  2EWV A;  2K31 A;  4GJ4 A;  3FPW A;  5K5B A;  3V67 A;  4MN5 A;  1V9Z A;  4G3K A;  4Q0H A;  2ZOI A;  4WF0 A;  2O99 A;  4I5S A;  5DJU A;  2A24 B;  4L9E A;  2A2L A;  4Q0I A;  4LLO B;  4HJ3 A;  1OT6 A;  1UWN X;  4GLQ A;  3DBA A;  3B33 A;  3NJA A;  4WEK A;  4EER A;  2MJ6 A;  3B42 A;  3MQ0 A;  5L8M A;  3RFB A;  1YAX A;  3S7N A;  1NRJ A;  2XRN A;  3GEC A;  4EET B;  2O0Y A;  4EUV A;  1XJ4 A;  1N9L A;  2QJ5 A;  4NEE D;  4CLC A;  4PAU A;  1TS0 A;  3KYZ A;  3UMD A;  1T19 A;  1T1C A;  3FPV A;  3CAX A;  3EEH A;  2QYB A;  3CI6 A;  4JGP A;  5FL3 A;  1DP9 A;  1BYW A;  4UEY A;  3NOP C;  4O0P A;  1UWP X;  4HOI A;  2L4R A;  2OOL A;  3A0S A;  4QPR A;  4HIA A;  2JHE A;  2OAP 1;  3F1O A;  1OTE A;  4EU0 A;  3LIF A;  3LIC A;  4FOF A;  3IS2 B;  4OOL A;  5HL6 A;  5AVE A;  4GW9 A;  4EW7 A;  5J4E A;  4G3V A;  1F98 A;  1XJ3 A;  3CLO A;  2VX8 A;  3KSG A;  1G6O A;  4HP4 A;  5TJJ A;  1W63 M;  2XA7 S;  3C2W A;  2HJE A;  3PBT A;  4HHD A;  3MFX A;  1LSW A;  5CX7 A;  4BBT A;  4ETX A;  2P7J A;  5G4Z A;  2P08 A;  2V0W A;  4EQ1 A;  1VHM A;  2YKF A;  2NUP C;  3VE3 A;  3T4S A;  3UE3 A;  1OT9 A;  5HDC A;  3A0R A;  3LR4 A;  2J3T D;  4ARZ B;  1OPX A;  4WL9 A;  5A8B A;  5KIZ A;  3KSI A;  4Y2F A;  2VEA A;  2HGV A;  3D3O A;  4GHI B;  4LPZ A;  3VE4 A;  4AFI A;  3K3C A;  3VV4 A;  4Y3I A;  4NXG A;  2WKP A;  5F69 A;  3ZYT A;  2J80 A;  5HDD A;  2PDR A;  2XA7 M;  2PHY A;  3T4O A;  4GHI A;  2Z6D A;  3PHY A;  3RH8 B;  3LI9 A;  2ZBB A;  2M7V A;  1MC0 A;  1P0Z A;  4BBV A;  2Y8H A;  1Y28 A;  1T18 A;  5IT5 A;  1MKM A;  2V1A A;  4LRY C;  3UB9 A;  4HJ6 A;  4JGO A;  2ZOH A;  3CUE A;  4CQH A;  4L9G A;  3OCL A;  3NHQ A;  2WKQ A;  1P9R A;  3LR0 A;  4R70 A;  4HI4 A;  1LSV A;  2W1T A;  1TF1 A;  2M1C A;  2QWS A;  2W27 A;  4BBU A;  2VGL M;  2J3W A;  2GNX A;  3JVV A;  1S1Z A;  1TD5 A;  3EQV A;  4WN5 A;  3BWL A;  1EW0 A;  2V0U A;  3E4P A;  2W3G A;  2EWW A;  1D06 A;  5HD3 A;  4B9O A;  5TBM A;  2PR6 A;  2PR5 A;  2K2N A;  2VA0 A;  5HWV A;  2JKT M;  3EQU A;  4BJP A;  1F9I A;  4ZRR A;  1ODV A;  1UGU A;  3MQQ A;  4H6J A;  3H7W A;  1JNU A;  3EGX C;  5HWW A;  1G28 A;  2VV7 A;  4RQ9 A;  4GS9 B;  4Y5F A;  1V9Y A;  4I38 A;  5HSQ A;  4BMW A;  2GZA A;  2INW A;  1XJ2 A;  3LR5 A;  4R3A A;  3C30 A;  4MN7 A;  3IBR A;  2KX6 A;  2VV6 A;  3U2A A;  4HQA A;  3S7O A;  3T4T A;  2NUT C;  2OWJ A;  1XFQ A;  2PT7 A;  2VV8 A;  4BWI A;  4OOM A;  3BY9 A;  3R7W B;  3EGD C;  4EXO A;  2B02 A;  3F1P A;  3K2N A;  1LT0 A;  2P04 A;  4ARZ A;  4HP9 A;  5HZH A;  3OOV A;  3PR6 A;  4L9F A;  3FG8 A;  1GSV A;  3T4K A;  2KOI A;  2VKS A;  5HD5 A;  2QJ7 A;  1DP6 A;  3BJN A;  5IS1 A;  2O9C A;  1NLZ A;  1S4R A;  4HH2 A;  2HV1 A;  3KX0 X;  4LRZ E;  1TS7 A;  3LUQ A;  3R7W A;  1IFQ A;  2D02 A;  3LYX A;  3UE6 A;  2O9B A;  4LRX C;  2VGL S;  4HJ4 A;  2O9A A;  3LIE A;  3F1O B;  2OWH A;  5DKK A;  5TBM B;  4IUH A;  4NXF A;  2B18 A;  3KSF A;  3FC7 A;  4YNR A;  2I9V A;  4E04 A;  3G6O A;  4JGQ A;  3HJK A;  1KOU A;  1OTI A;  3KO6 A;  4EEP A;  4PKY A;  3PBS A;  4DJ2 A;  5DKL A;  1N9N A;  3O5Y A;  1T1A A;  3UB8 A;  2W3E A;  4WLA A;  3OC2 A;  1XJ6 A;  5HWT A;  1WA9 A;  2LB9 A;  5I5L A;  3PXP A;  4XT2 A;  2W3D A;  4WEJ A;  3LIB A;  4MN6 A;  1ZHH B;  3P01 A;  4I3J A;  3K3D A;  5AVF A;  3KYQ A;  1NWZ A;  4DJ3 A;  3LI8 A;  2IA2 A;  2XRO A;  3CWF A;  3B47 A;  1T1B A;  1D7E A;  2VZW A;  4G3W A;  3R4K A;  4F3L A;  2HF6 A;  2CMN A;  4O8G A;  4M4X A;  2Y79 A;  4UQI S;  2GJ3 A;  3H82 B;  2K7S A;  4P6Z S;  1DP8 A;  1P9W A;  3F1N B;  3TRC A;  2W0N A;  4YWZ A;  2FH5 A;  2DMW A;  3E4Q A;  4II7 A;  1OJG A;  4DN0 A;  2G7U A;  3IS2 A;  1NLY A;  3C8C A;  4UQI M;  3BQA A;  4CLC D;  4GS9 A;  4IJG A;  1OTB A;  2ZMF A;  3BY8 A;  4JGR A;  5HPF A;  2QKP A;  2V9A A;  3LFV A;  3W2Z A;  3ULF A;  5HDS A;  1OJ5 A;  5DFX A;  3LR3 A;  1MZU A;  4PKY G;  1S1Y A;  4IHQ A;  1GSW A;  2HJ9 C;  3CIT A;  1H3Q A;  4Q0J A;  1YSP A;  3E4O A;  4CLC B;  3S7Q A;  1XFN A;  2W1T B;  4DMZ A;  5G4Y A;  2H28 A;  2M7U A;  2JKR M;  1X0O A;  5MC7 A;  5J7E A;  4H6J B;  5IU1 A;  2JN7 A;  1S4S A;  4KUO A;  1ZTU A;  3H82 A;  3MF0 A;  3MXQ A;  3IBJ A;  3PYP A;  4HNB A;  3E98 A;  4NXE A;  1N9O A;  1TS6 A;  2W1R A;  2WKR A;  4IUK A;  2V1B A;  5DJT A;  3EWK A;  3JVU A;  2L0W A;  2PD7 A;  3GDI A;  3VOL A;  4P6Z M;  2QHK A;  3MR0 A;  2FZ0 A;  3C38 A;  3OLO A;  1LSX A;  2JKT I;  4Z1W A;  3H9W A;  2R78 A;  2KDK A;  3UB6 A;  1S67 L;  2PYR A;  3BQ8 A;  3NOU C;  1IOU A;  3OCN A;  2LB5 A;  3HCY A;  3PBR A;  4XT2 B;  2OAQ 1;  3F1N A;  2KLI A;  2XSS A;  4CLC E;  4O01 A;  3H7W B;  4HY8 A;  2L1M A;  2W3H A;  4ME4 A;  4EEU A;  3PBO A;  3F1P B;  2J3T C;  3T4Q A;  2D01 A;  4CLC C;  4EES A;  1F5M A;  1DRM A;  1YSQ A;  4R38 A;  4B93 A;  4FSF A;  3MQO A;  3T50 A;  1OTA A;  2ZMV A;  2A24 A;  3A0V A;  3D72 A;  3T4L A;  4KUK A;  3OBF A;  3P7N A;  4WUJ A;  3S7P A;  3UME A;  3EEA A;  3LIA A;  5DF9 A;  3TJZ C;  2BAS A;  3E0Y A;  5EFW A;  1GSX A;  2PYP A;  1YKD A;  2EA9 A;  3TW8 A;  3NOT C;  4I3A A;  3EOI A;  5LBR A;  2JKR I;  2YKH A;  4NKP A;  3MMH A;  5C5K A;  2VJW A;  3RTY A;  1TS8 A;  3TE8 A;  5J3W A;  4MDZ A;  3MJQ A;  4WEL A;  5KSH A;  5DFY A;  4KQO A;  1OTD A;  4I39 A;  4PHT A;  3UB7 A;  2VLG A;  3SW1 A;  4KQD A;  2W3F A;  3ICY A;  1S66 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...