4P6ZM

Crystal structure of the human bst2 cytoplasmic domain and the hiv-1 vpu cytoplasmic domain bound to the clathrin adaptor protein complex 1 (ap1) core
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
422
structure length
415
Chain Sequence
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords AP-1 complex subunit gamma-1
publication title Structural basis of HIV-1 Vpu-mediated BST2 antagonism via hijacking of the clathrin adaptor protein complex 1.
pubmed doi rcsb
source organism Mus musculus
total genus 89
structure length 415
sequence length 422
ec nomenclature
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4p6zM01
2HF6A 4NEED 4P6ZS 5MC7A 4UQIS 2XA7M 2VGLS 2JKRM 2JKTI 3TJZC 4P6ZM 4UQIM 2VGLM 1W63M 2FH5A 1W63Q 2JKRI 1NRJA 2XA7S 2JKTM
chains in the Genus database with same CATH superfamily
2J3TC 3T1SA 5HWVA 2IA2A 5CGWA 3MQQA 2Y2IA 4X1LA 1MBLA 4ZRRA 4YNRA 5TBMA 1T19A 1YLPA 1UWPX 3WS0A 1TD5A 5JYPA 1YAXA 4NXEA 2PR6A 4E3OA 4F94A 3ISGA 5FAQA 3HUNA 4BBUA 4CLCB 3LR0A 3EEAA 4WM9A 1BULA 2VLGA 5CHMA 4C3QA 3DW0A 5FEFA 4JXVA 4MLLA 3ZVTA 3FV7A 3PBNA 3H7WB 1VM1A 2ZOHA 1Z09A 2M7VA 3Q07A 3IWOA 2AVXA 3AGEA 1T1CA 4KZ4A 4GD8A 1XA1A 5TJJA 4LPZA 2W3FA 4DF6A 1S67L 1TEMA 4IBRA 3ZYTA 1VHMA 4IUHA 1NWZA 4EBLA 2K7SA 4YWZA 5HZHA 1N4OA 3N8LA 4B4ZA 1PRQA 4F3LB 2ZD8A 2ZMVA 4CLCC 3CITA 5TBMB 2X71A 2UWXA 2EA9A 3O86A 4MNRA 5FL3A 2JE5A 3VSLA 4N1HA 1FCMA 4HH3A 1XKZA 2JN7A 3HLWA 1L3LA 3MXRA 4Y5FA 1OTIA 4PHTA 1YKDA 2P74A 1BLSA 5EVIA 4B4XA 3ZDJA 3BRMA 5GLAA 2ZC5B 3UPPA 2E8IA 4KZ7A 5CEDA 2ZC4B 5FAOA 5FQKA 1LL9A 3CAXA 1FIKA 3HLCA 1ZHHB 3KO6A 2VEAA 2DRWA 3V3SA 4MCWA 2VJWA 2ZBBA 4D2OA 2A24B 2A49A 3S7QA 3T12B 4BD1A 5I94A 3M2JA 2WGWA 3CPTB 4R3JA 1NLZA 4LCLA 4N9KA 3LR3A 4UQIM 4UA6A 1D1JA 4LRYC 4PKYA 4EEPA 2GX5A 4HY8A 4P6BA 4ME4A 2I9VA 5FDHA 1IFQA 1VETB 3JYIA 2V0UA 3IHBA 4ZJ1A 3HLGA 1DJCA 4S2NA 4X56A 4P6ZM 4PM5A 1QMFA 1CEGA 3AGFA 3FKVA 3C4PA 3R7WA 1V9ZA 3DAVA 5HDDA 1Z6FA 3VP1A 3SS4A 1MWTA 1MWUA 4GKUA 1NJ4A 5EVIB 5AJGA 2B5RA 1ES5A 3RJUA 4P85A 1XX2A 4GHIB 2WGIA 5EE8A 2KX6A 2OWHA 4WELA 5GHYA 2ZM8A 4EXOA 4HI4A 3M6BA 4WYYA 3MF0A 1RCJA 4DJ3A 2WKHA 4R4SA 3N7WA 3CLOA 4R23A 1MZUA 2Y2PA 1N9LA 2QJ7A 4OPRA 4FSFA 4GS9B 4O0PA 1M6KA 1N9BA 4OONA 4LRXC 3CG5A 3T50A 2WGWB 2XA7M 3ZVWA 2VGLS 4K0XA 5FEGA 4KUKA 5EVLA 4YFMA 1IELA 3M2KA 4DDSA 3EGDC 2R9XA 1K55C 4LFUA 3V5MA 2IWBA 5EPHA 1STZA 5BOHA 4PAUA 3ZG9B 4EERA 3H82B 4NXGA 2O9BA 4X25A 3IXHA 3Q81A 1MWRA 2D01A 5EVIC 4S2LA 5F6AA 3ZNYA 3PTEA 1PI4A 1GHPA 2ZOIA 2GDNA 5AVFA 4MN5A 1GA9A 3CMZA 2ACGA 4FD8A 3DTKA 3SH7A 3K2NA 2HPBA 4KQDA 1ZG4A 4RX3A 2QYBA 3LEZA 2KLIA 4LV3A 3UB7A 4KZ9A 3GECA 2V20A 3IH9A 2O9CA 3KSFA 3W4OA 2G7UA 3SS5A 2Y2HA 3IT9A 1CF0A 1P9WA 1P97A 1DJAA 3LIBA 4QU3A 3T4KA 4PM7A 3F1PA 3QP2A 4C6YA 1SCWA 4HH2A 2H5SA 3WS2A 1MWSA 4OLGA 4E3NA 2ZQCA 1XJ2A 4KZ5A 2I72A 2XFTA 3B47A 4DN0A 1LT0A 5HWTA 5KZHA 3LUQA 4HOIA 5DJTA 3BQAA 5L10A 2J7VA 4GB7A 2Y2OA 4JGRA 2JKRM 2ZQ7A 1BLHA 3PBQA 4WZ4A 2PYRA 2QPNA 2Z2MB 3FZCA 2PR5A 3C2WA 5F5YA 3S22A 3VE4A 3LR4A 5DTTA 1MKIA 3MSHA 1CQAA 2OSUA 4QPRA 3SW1A 3WS4A 4KZ8A 5FSRA 1S1ZA 4E6WA 1RGZA 1K57C 4HBTA 4D60A 2V8CA 5EOEA 5EM1A 4MN6A 5GL9A 3D72A 1S1YA 4WF0A 1G28A 2PDRA 1IYOA 1SHVA 1ERQA 3QP5A 3F1PB 3OCNA 3VP2A 3QP1A 5I5LA 3PYPA 4LLOB 5GLBA 2W27A 1Y28A 3BLSA 3VP4A 5G4YA 4EESA 5G4ZA 5EM0A 1JWZA 3HLBA 4GDBA 3RFBA 2JKTM 4E3KA 5HAIA 4FOFA 4X55A 3OPHA 1PYYA 3C5AA 2Y2JA 4GLQA 4EBNA 2BTFP 3BFCA 1PWDA 3UO9A 4FH4A 2BASA 4DRTA 1F5MA 1SKOB 3EOIA 5CXWA 1UWNX 3LFVA 1E4DA 5FQ9A 4UEYA 1IYQA 2G2UA 3T1RA 5AQAA 3Q1FA 3MFDA 1GHMA 4ETXA 3N4IA 4WMCA 3U4LP 5LBRA 5CRFA 3KYQA 1VEUA 3G2ZA 1MXOA 4PPRA 1NY0A 1K56A 3BW6A 4II7A 3UB6A 5FATA 3BWLA 5FQIA 2K31A 5HX9A 2Y4AA 5AQBA 1BLCA 4NXFA 1TS0A 4S2JA 3UE0A 1CK3A 1LSWA 2J80A 4JPMA 3WWXA 3GSGA 5HAPA 2ZQAA 4R70A 4WEKA 1NXYA 5DJUA 5DF7A 1FR1A 1LHYA 3MQ0A 4UQIS 4CLCA 2XSSA 5DTKA 4WEJA 1YT4A 3LIFA 4DE2A 4Y3IA 5A91A 2DNSA 3NBLA 3FG8A 3IXGA 3CWFA 3CHWP 4RX2A 3HUOA 3VFFA 4L0LA 4BLMA 2Z2LB 3FYZA 5E2HA 4BBVA 5CGSA 1RGYA 1YLZA 4E3JA 4P6ZS 5HL1A 2QHKA 4MMNA 2D02A 1XFQA 3T4SA 3SZTA 2CMNA 3A3DA 3HREA 3PHYA 3IX8A 4G3VA 3ULFA 2IWCA 2FZ0A 3P01A 1LL5A 4O8GA 3JPUA 3RXXA 4GZBA 2HGVA 5DTSA 4A5RA 3V50A 4EWFA 4KG2A 3JVUA 4FH2A 4Y7PA 2RCXA 3H9WA 2X01A 3BLMA 3IHAA 2EWVA 4RVAA 1G5UA 2HP6A 3ITBA 5TR7A 2KDKA 4F3LA 2EX9A 4DE0A 1KVLA 4E3LA 5EV0A 4GOGA 4KG6A 2EWWA 3NCKA 2JKRI 1XJ3A 1AXBA 2EFXA 4LV1A 1E25A 4I38A 3NECA 3UMDA 3HVFA 3IBJA 2NUTC 5KMWA 2XD5A 3E0YA 5EECA 5J8XA 4BJPA 3NJAA 3C7VA 2P7JA 1EROA 4N9LA 5GHXA 3U2AA 4R4RA 2A24A 5HSQA 1K6SA 5A92A 3L7HA 1F98A 1FCNA 4QWOA 4HNBA 3VMAA 3GRJA 3CPTA 1ES3A 5D3OA 1DY6A 4X69A 2M7UA 4OPYA 1XGIA 1MKMA 4KZAA 3IF6B 3FKWA 3M6HA 4K0WA 1YLTA 2L1MA 2JCHA 1HLUP 3EQVA 4HBUA 1VETA 3NDGA 5KSHA 5HD5A 2JKTI 1K55A 2Y8HA 4H8RA 3HL9A 1BYWA 1S0WA 4WUJA 2BG1A 1PFLA 4JXGA 3PXPA 3BY8A 2VV7A 3SH9A 4KZ3A 1K4EA 4NEED 1XGJA 4HESA 3FC7A 3ZG0A 1OTBA 4EV4A 5KIZA 3BFGA 5HARA 1PIOA 1LSVA 4GHIA 1FSWA 4CPKA 1T1AA 3ZHHA 3GV9A 3V39A 1MPLA 5IHVA 4GS9A 1EI5A 3G34A 5HL6A 3UN7A 3IF6C 4KQOA 3LCEA 2OLVA 3B33A 3O88A 4NK3A 4WLAA 3OBFA 4UA9A 2JHEA 2VGKA 4GNUA 1ACFA 4JXWA 4R38A 3F1OB 1BZAA 1ALQA 3H82A 3VOLA 1YLYA 5DFYA 1TDGA 1KGEA 1H8MA 3IBRA 1DP6A 4KZBA 3K3DA 3ZQ5A 1XFNA 3ZGAB 1S6RA 2A2LA 5FQMA 3KSIA 1C3BA 3VOYA 4OQIA 2OAQ1 2XR0A 2ZLYA 3ITAA 3QP6A 1BUEA 5MC7A 3NOPC 1HTZA 1S66L 3EGXC 2VA0A 4B93A 3HBRA 3D3OA 3NOUC 4ZTKA 3OPRA 3FPVA 1KE3A 4KUOA 3S7PA 3MZFA 2ZL1B 3IS2B 1GHIA 3OC2A 3DTMA 1BT5A 3UDXA 3MXQA 2W3HA 1SDEA 3TE8A 4RA7A 2ZMFA 3E4OA 4U0XA 4G3WA 3MR0A 3MZDA 4JGOA 2KOIA 1LI0A 3NULA 4B88A 1YLWA 3VP3A 1K57A 4G3KA 5TFQA 3SH8A 4NG2A 2J3WA 5J3WA 1KOUA 4R1GA 3IX3A 3LICA 4QB8A 1L0FA 1IYSA 1OTEA 3D9YA 4JBFA 3F1NB 3G4PA 3G35A 5DVAA 2HDRA 4OQGA 1ES2A 5HD3A 5A90A 1YSPA 1MY8A 2HZ5A 2PT7A 3GMWA 5A93A 4CJNA 4O01A 3N8RA 5KSCA 4NXBA 2W0NA 1M40A 1FCOA 2PAVP 4MEZA 2FFFB 4IEDA 2O9AA 2X02A 4QD4A 4JF6A 2HF6A 4PM8A 3UMEA 5EFWA 3JVVA 4OP5A 1IKIA 1E3UA 5GHZA 2WZXA 3O3VA 4C75A 2WKPA 4BQMA 4WZ5C 3RH8B 4ZJ3A 1PWCA 5CERA 4Q8IA 1XXMA 4OQHA 2PD7A 4HJ3A 2P9VB 5L07A 4P0MA 3WRZA 2HP5A 3VE3A 4E3MA 3LR5A 3ZCZA 4R3BA 3IQAA 4DE3A 1DP9A 1G68A 2C5WB 3DTIA 3IF5A 4Y2FA 1D7EA 2XROA 4DKIA 1L2SA 3N6IA 2OOLA 1IYPA 3TW8A 1L0EA 4N92A 1YLJA 3B3XA 3NC8A 4OH0A 3T4QA 1VQQA 3IWQA 1KVMA 1H8ZA 1NYYA 3PBSA 1DJBA 3UB8A 4YINA 3W8KA 4JF4A 3Q82A 3RXWA 1GSXA 3OCLA 4O7DA 4EW7A 3GTCA 2WK0A 4JLFA 1WYCA 3LIEA 2HV1A 2RL3A 1SKOA 3GQZA 1Y4OA 3PBOA 4FTXA 3UPNA 3MS6A 4OOLA 3CUEA 3ZFZA 3P7NA 4I3IA 1O07A 2WAFA 1QMEA 2V9AA 3NY4A 1O7EA 1JNUA 2WKIA 4QY6A 4DDYA 3IH8A 1UGUA 4OPQA 3UDIA 3HJIA 4Y15A 4S2MA 2ZM0A 1KDWA 5A8BA 2XLNA 2ZC7A 4S2PA 3S7NA 1YQSA 2Y2GA 3OOVA 3PAEA 3CI6A 2ZQ8A 3T1QB 3NIAA 5AVEA 1T1BA 3E2LA 5HFOA 4DMZA 1WYBA 1OTAA 4N1XA 2W3EA 1TDLA 4OLDA 4EUVA 4DXCA 1OTDA 1XJ4A 5DKLA 4ZBEA 4UA7A 2WKQA 5F83A 1CEFA 3QP8A 4OKPA 2J9OA 2VKSA 2PU4A 3S7OA 4GDNA 4MN7A 4EETB 2ZJ9A 1HZOA 2L4RA 5F1GA 1OJ5A 3T4TA 1H3QA 1G6OA 1OT6A 3BECA 1NZUA 4U3TA 4KQRA 3KYZA 1RP5A 4HQAA 4GCZA 4HIAA 4JXSA 1G6AA 4X6TA 1FQGA 3UB9A 2BLSA 1W63Q 2XRNA 2INWA 1TS6A 1IOUA 4B9OA 2JKGA 3C8CA 5FI6A 2PD8A 1XP4A 5DF9A 2EX8A 5TGFA 1JTGA 2Q0OA 2EX2A 3PAGA 1IKGA 1NYMA 3NDEA 4FUWA 1DP8A 3HCYA 3HLDA 4QHCA 4GN2A 3QP4A 2EX6A 2L0WA 3S4XA 3MBZA 3MKFA 4NKPA 3A0VA 3CUEC 1DRMA 5C5KA 2Z6DA 4MDZA 2V8FA 4BL3A 1LLBA 3E4PA 1TS7A 3ZG5A 5FAPA 4JKTA 2OWJA 4RQ9A 5EUAA 2O99A 1S4RA 5FQQA 3T4LA 3VV4A 1W7FA 4I3AA 1KGFA 2EXAA 3QNCA 3IF6A 1CI9A 4OP8A 4LV0A 1ZG6A 4OVDA 3QHYA 3FPWA 3FWLA 3HUMA 3BFDA 3GVBA 1K54A 2G2WA 1W8QA 1PWGA 2Y2LA 5CX7A 4EU0A 3W4PA 4CQHA 2XA7S 4K08A 3UE6A 5F69A 2Y91A 1GSVA 1KDSA 2B95A 5IU1A 3ZNTA 4BWIA 2C6WB 3Q7VB 1KE0A 3BY9A 1PZOA 4R6LA 3PR6A 4ETZA 2DCFA 5IT5A 2XFSA 4I3JA 2CC1A 4WBGA 4OQ0A 4Y13A 2NUPC 4EEUA 3BQ8A 3IXDA 4DJ2A 1LSXA 4BENA 5FA7A 5FASA 2HDUA 4U0TA 1ESUA 1PW1A 2ZMAA 5HW3A 2HP9A 3MJQA 2W1TB 3C4OA 2UV0E 1OPXA 4Z1WA 4I39A 2FH5A 3DTEA 4KENB 4IVIA 3OZHA 5AQ9A 5CECA 3F1OA 4KG5A 5HAQA 2LB5A 4EBPA 4GW9A 3T4JA 4PMAA 2XEPA 3Q7ZA 3UPOA 2J9PA 3CZDA 4JGQA 1D06A 1W63M 1JWVA 3UB5P 4Y0TA 3E2KA 3NI9A 4Y0OA 3DWZA 3G30A 1K0KA 3DWKA 4UHUA 3O87A 1AWIA 1SKFA 5F68A 2PBYA 5CEBA 2XH9A 5FI7A 3UY6A 4HJ6A 2JBFA 3BYDA 5GLDA 3R4KA 5F82A 2VGJA 4ESPA 4LENA 1BTLA 4LCMA 5F1FA 3GDIA 3A3EA 3UE3A 2K2NA 2J3TD 2ZQ9A 1VB6A 1Q2PA 2ZL1A 1TS8A 3IS2A 5E2FA 4I5SA 4XUXA 3LIAA 3DBAA 4Q0IA 3B42A 5DKKA 4Z9QA 2QWSA 3ZG8B 1EWZA 3UDFA 3HJKA 2ZQDA 1K54C 1NRJA 2WZZA 2R78A 1X0OA 3LI8A 3VSKA 3LIDA 4BL2A 3MQOA 1CJFA 2A3UA 3VFHA 5AQ7A 2PBDP 2V1ZA 4BMWA 4WZ5A 3NOTC 5HDCA 3QNBA 5J7EA 3P98A 3NHQA 3OPLA 2WAEA 3BEBA 1SZVA 4Y0UA 4L9FA 1HD8A 4GD6A 4WMCD 4MBFA 2M1CA 3F1NA 2E8JA 3E4QA 3D4FA 2EFUA 3MKEA 3WS1A 1LL8A 1ZTUA 1K56D 1MC0A 1PI5A 3VP0A 1I5QA 2O0YA 3TSGA 3N8SA 4QJGA 5FI2A 4OOMA 3E98A 3TG9A 2Y79A 5G18A 2LB9A 2WKEA 4MBHA 4JF5A 3EQUA 1CI8A 5JYOA 2VZWA 2GZAA 5E2GA 4CLCD 3A3IA 3WRTA 2VV6A 2GJ3A 4H6JA 2XF3A 2P04A 5L2FA 2HJEA 1N9NA 4ZAMA 2XDMA 1JTDA 2B02A 3C7UA 4Y17A 5M1AA 1OT9A 3T1XA 2P9VA 4XUZA 2R9WA 4LRZE 1L0DA 4R3AA 2H0TA 2QMIA 1OJGA 3IWIA 4EQIA 2XD1A 2VX8A 5EVEA 1K38A 1ONGA 4ARZA 1ERMA 4DE1A 1P0ZA 1XPBA 1PNEA 4IUKA 2YKHA 1YPRA 3A3FA 1Y54A 3G6OA 3A0RA 4IJGA 4X68A 2H28A 3LI9A 3LY3A 1A0KA 4GJ4A 3W2ZA 1TVFA 3R7WB 2H0YA 3LO7A 1P9RA 5HDSA 3HLEA 2V1BA 2Y2QA 3EWKA 1J9MA 3A0SA 1YM1A 4R0QA 2QZ6A 5E43A 4M4XA 4H6JB 1BSGA 2HJ9C 2WYXA 2OAP1 4HEFA 3V3RA 3WS5A 5GLCA 2XQZA 4L9EA 4IVKA 4HP9A 3MFXA 2QKPA 4KZ6A 3KX0X 1ZC2A 3G31A 4HP4A 2B18A 3CJMA 2VV8A 3KSHA 2DMWA 4L9GA 1W79A 5L8MA 1FR6A 1LI9A 2Y55A 1YMXA 1Q2QA 1H8YA 1ZKJA 1NLYA 2Y2NA 4S2NC 4ARZB 4P87A 3I7JA 2OV5A 1ESIA 1K6RA 3IX4A 2EXBA 2JKFA 4X53A 5K5BA 4RYEA 5EOOA 5HPFA 5CHJA 1GA0A 1YMSA 4S2IA 5L09A 3BFFA 3TJZC 4XXRA 2V0WA 4XT2A 5E2EA 1K25A 1KE4A 2V2FF 3OLOA 1GCEA 4ID4A 2MJ6A 4E6XA 1W8YA 2ZC6B 3KYEA 2WKRA 5CTMA 5EVID 1EW0A 4JGPA 1FILA 4EQ1A 3BM6A 4NETA 3O5YA 4PKYG 3KSGA 4S2OA 1S4SA 4FCFA 2ZC3B 4AFIA 4LV2A 3IXBA 5CTNA 3MXSA 1W5DA 1T18A 5FDSA 5HPIA 3TOIA 3S1YA 1I2SA 3T4OA 5HWWA 3LY4A 3MMHA 4Q0JA 5J4EA 4KQQA 1ODVA 5U47A 4ZJ2A 3LYXA 3G32A 4EUZA 4HHDA 3SOIA 1XJ6A 4E04A 1HVBA 4XT2B 2VGLM 1J3WA 1FSYA 2VK3A 3OPPA 2Y59A 3UE1A 1KGGA 3EEHA 2WADA 2PYPA 3BFEA 2GNXA 1WA9A 1F2KA 2PHYA 2YKFA 4CLCE 2Y2KA 4OOYA 5IS1A 1YSQA 4E3IA 3VOZA 4M3KA 4DXBA 2ZM2A 3HLFA 2Q9NA 2WGVA 4PM6A 3ZG7B 3P09A 3GR2A 4QY5A 3PBRA 4K91A 1FOFA 2WUQA 4WN5A 1V9YA 3TRCA 1PZPA 4S2KA 4BBTA 3AGDA 3W4QA 1GSWA 3MZEA 1OMEA 1N9OA 2PU2A 1SDNA 4LGWA 3BJNA 3PBTA 1ES4A 1NRFA 3RTYA 1U60A 3Q7VA 1BLPA 1JWPA 2FFYA 3SS3A 2QJ5A 1I2WA 3C38A 4ZDXA 1WE4A 5CGXA 5FQJA 1NZOA 2HDSA 3ICYA 5DFXA 1PW8A 1JVJA 2Y2MA 4BD0A 2HDQA 3A3JA 3C30A 3K3CA 2JC7A 4MBKA 2IWDA 4YOFA 2W3GA 2W1TA 5M18A 1H0MA 2W3DA 3H7WA 2Z6CA 2P08A 1L0GA 2J8YA 4OPZA 3G2YA 4WL9A 1TF1A 1H5XA 5M19A 3LEQA 2XK1A 4UAAA 2XGNA 4X1MA 1IEMA 3LGOA 2Q9MA 4Q0HA 1E3UD 1K4FA 4IBXA 2PRFA 2OLUA 1XA7A 3UNWA 1ONHA 2W1RA 3L9KA 4PM9A 1VEUB 4IHQA 3V67A 2V1AA 1F9IA 2H10A 4HJ4A 5CHUA 5DF8A
chains in the Genus database with same CATH topology
2J3TC 3LI8A 2HF6A 4FOFA 5HWVA 3LIDA 2IA2A 3MQOA 3UMEA 5EFWA 3MQQA 3JVVA 4BMWA 3NOTC 5HDCA 4ZRRA 4YNRA 5TBMA 5J7EA 3NHQA 2WKPA 1T19A 1UWPX 4GLQA 3RH8B 4L9FA 1TD5A 1YAXA 4NXEA 2PR6A 2M1CA 3F1NA 2PD7A 4HJ3A 4BBUA 3E4QA 2BASA 4CLCB 3LR0A 3EEAA 1LL8A 1ZTUA 2VLGA 1F5MA 1MC0A 3EOIA 3VE3A 2O0YA 1UWNX 3LFVA 4UEYA 3LR5A 4ETXA 1DP9A 4OOMA 3E98A 4Y2FA 3PBNA 1D7EA 3H7WB 2Y79A 5LBRA 2LB9A 2XROA 3KYQA 2ZOHA 2OOLA 2M7VA 3TW8A 3BW6A 4II7A 3EQUA 3UB6A 2VZWA 2GZAA 1T1CA 4CLCD 3BWLA 2K31A 3T4QA 2VV6A 2GJ3A 4H6JA 5TJJA 4LPZA 4NXFA 1TS0A 3PBSA 2W3FA 2P04A 3UB8A 1S67L 2HJEA 1LSWA 1N9NA 2J80A 2B02A 1GSXA 4R70A 3ZYTA 3OCLA 4WEKA 4EW7A 1OT9A 1VHMA 5DJUA 4IUHA 3MQ0A 1NWZA 4UQIS 2K7SA 4YWZA 2XSSA 4CLCA 5HZHA 3LIEA 2HV1A 4LRZE 4WEJA 4F3LB 4R3AA 3LIFA 3PBOA 2ZMVA 4CLCC 3CITA 5TBMB 1OJGA 2EA9A 4Y3IA 5FL3A 4OOLA 2VX8A 3CUEA 3FG8A 3CWFA 4ARZA 3P7NA 4I3IA 4HH3A 2JN7A 4L0LA 1P0ZA 2V9AA 4BBVA 4IUKA 4Y5FA 2YKHA 1OTIA 4PHTA 4P6ZS 1JNUA 1YKDA 2QHKA 3G6OA 2D02A 4MMNA 1XFQA 3T4SA 1UGUA 3A0RA 4IJGA 2H28A 3LI9A 3HJIA 2CMNA 3PHYA 4G3VA 3ULFA 3CAXA 5A8BA 2FZ0A 3P01A 4GJ4A 3W2ZA 4O8GA 1ZHHB 3KO6A 2VEAA 3R7WB 4MCWA 1P9RA 3S7NA 2VJWA 5HDSA 2HGVA 2V1BA 3EWKA 3A0SA 3OOVA 2ZBBA 3JVUA 2A24B 3CI6A 3S7QA 3H9WA 2EWVA 1NLZA 5AVEA 1T1BA 4M4XA 4H6JB 3LR3A 2KDKA 4DMZA 4F3LA 2HJ9C 4UQIM 2OAP1 2EWWA 1OTAA 4LRYC 4PKYA 4EEPA 4L9EA 2GX5A 2JKRI 1XJ3A 4HP9A 3MFXA 4HY8A 2W3EA 2QKPA 3KX0X 4ME4A 2I9VA 4I38A 4HP4A 3UMDA 1IFQA 4EUVA 2B18A 3KSHA 1OTDA 1XJ4A 2DMWA 2VV8A 4L9GA 3IBJA 5DKLA 2WKQA 2NUTC 2V0UA 5L8MA 2VKSA 3E0YA 3S7OA 4MN7A 4P6ZM 4EETB 1NLYA 4BJPA 4ARZB 3NJAA 2L4RA 1OJ5A 2P7JA 3T4TA 1H3QA 1G6OA 3R7WA 5K5BA 1V9ZA 5HDDA 3U2AA 1OT6A 5HPFA 5AJGA 2A24A 5HSQA 3KYZA 1F98A 4HNBA 4HQAA 4GCZA 4HIAA 4GHIB 2KX6A 2OWHA 4WELA 3TJZC 4EXOA 4HI4A 3UB9A 2V0WA 4XT2A 3MF0A 2M7UA 4DJ3A 1W63Q 2XRNA 2INWA 1MKMA 1TS6A 3CLOA 1MZUA 3OLOA 1IOUA 1N9LA 2QJ7A 4B9OA 2MJ6A 4FSFA 4GS9B 3C8CA 4O0PA 2PD8A 2L1MA 4LRXC 5DF9A 3EQVA 3T50A 2XA7M 2VGLS 5KSHA 2WKRA 5HD5A 2JKTI 4KUKA 2Y8HA 1EW0A 1DP8A 3HCYA 4JGPA 1BYWA 4EQ1A 3EGDC 2L0WA 4WUJA 3O5YA 4PKYG 3KSGA 1STZA 4NKPA 1S4SA 3A0VA 3CUEC 1DRMA 5C5KA 2Z6DA 4PAUA 3PXPA 4MDZA 4EERA 3BY8A 3H82B 4AFIA 2VV7A 4NEED 4NXGA 3E4PA 1TS7A 3FC7A 2O9BA 2OWJA 4RQ9A 1OTBA 2O99A 1S4RA 3T4LA 5KIZA 2D01A 3VV4A 4I3AA 1LSVA 1T18A 4GHIA 5HPIA 3T4OA 5HWWA 1T1AA 5F6AA 3MMHA 4Q0JA 5J4EA 1ODVA 4GS9A 3LYXA 2ZOIA 4HHDA 1XJ6A 5HL6A 4E04A 4KQOA 5AVFA 3FPWA 4MN5A 3B33A 4WLAA 4XT2B 3OBFA 2VGLM 2JHEA 3K2NA 5CX7A 4EU0A 4KQDA 4CQHA 2QYBA 2XA7S 4R38A 4K08A 3F1OB 3UE6A 3EEHA 5F69A 2PYPA 2KLIA 2GNXA 1WA9A 3UB7A 1GSVA 3H82A 5IU1A 3VOLA 4BWIA 2PHYA 5DFYA 3GECA 2YKFA 1H8MA 4CLCE 3IBRA 5IS1A 2O9CA 3KSFA 1DP6A 1YSQA 2G7UA 3BY9A 3K3DA 3ZQ5A 4R6LA 3PR6A 1XFNA 4ETZA 2A2LA 5IT5A 3KSIA 1P9WA 1P97A 4I3JA 3LIBA 3T4KA 2OAQ1 3F1PA 2NUPC 4EEUA 3BQ8A 5MC7A 3NOPC 4DJ2A 1LSXA 1S66L 3EGXC 2VA0A 4HH2A 3PBRA 4B93A 3D3OA 3NOUC 4WN5A 3MJQA 2W1TB 1V9YA 3TRCA 1OPXA 4Z1WA 3FPVA 4I39A 1XJ2A 2FH5A 4BBTA 3B47A 4DN0A 1GSWA 1LT0A 5HWTA 3LUQA 4KUOA 4HOIA 3S7PA 3IS2B 1N9OA 3OC2A 5DJTA 3BQAA 3F1OA 3MXQA 4JGRA 3BJNA 2LB5A 3PBTA 2W3HA 2JKRM 3RTYA 3TE8A 4GW9A 3T4JA 3PBQA 2PYRA 2ZMFA 3E4OA 2PR5A 4JGQA 1D06A 4G3WA 1W63M 2QJ5A 3C38A 3C2WA 5F5YA 3VE4A 3LR4A 3MR0A 4JGOA 2KOIA 4QPRA 3SW1A 3ICYA 4G3KA 5DFXA 2J3WA 1S1ZA 5J3WA 1KOUA 5F68A 3LICA 4HJ6A 4MN6A 3C30A 3K3CA 3R4KA 1OTEA 3D72A 1S1YA 4YOFA 2W3GA 4WF0A 2W1TA 3GDIA 1G28A 3F1NB 2W3DA 3UE3A 2K2NA 2PDRA 3H7WA 2J3TD 2Z6CA 2P08A 1VB6A 3F1PB 3OCNA 5I5LA 4WL9A 1TF1A 3PYPA 3IS2A 1TS8A 4LLOB 5HD3A 1YSPA 2W27A 1Y28A 4I5SA 2PT7A 5G4YA 3LIAA 4Q0HA 4EESA 3DBAA 4O01A 4Q0IA 5G4ZA 3B42A 5DKKA 2QWSA 4NXBA 2W0NA 2W1RA 3HJKA 1NRJA 4IHQA 3RFBA 3V67A 2V1AA 1F9IA 4HJ4A 2R78A 1X0OA 2JKTM 2O9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF6 A;  4NEE D;  4P6Z S;  5MC7 A;  4UQI S;  2XA7 M;  2VGL S;  2JKR M;  2JKT I;  3TJZ C;  4P6Z M;  4UQI M;  2VGL M;  1W63 M;  2FH5 A;  1W63 Q;  2JKR I;  1NRJ A;  2XA7 S;  2JKT M; 
#chains in the Genus database with same CATH topology
 2J3T C;  3T1S A;  5HWV A;  2IA2 A;  5CGW A;  3MQQ A;  2Y2I A;  4X1L A;  1MBL A;  4ZRR A;  4YNR A;  5TBM A;  1T19 A;  1YLP A;  1UWP X;  3WS0 A;  1TD5 A;  5JYP A;  1YAX A;  4NXE A;  2PR6 A;  4E3O A;  4F94 A;  3ISG A;  5FAQ A;  3HUN A;  4BBU A;  4CLC B;  3LR0 A;  3EEA A;  4WM9 A;  1BUL A;  2VLG A;  5CHM A;  4C3Q A;  3DW0 A;  5FEF A;  4JXV A;  4MLL A;  3ZVT A;  3FV7 A;  3PBN A;  3H7W B;  1VM1 A;  2ZOH A;  1Z09 A;  2M7V A;  3Q07 A;  3IWO A;  2AVX A;  3AGE A;  1T1C A;  4KZ4 A;  4GD8 A;  1XA1 A;  5TJJ A;  4LPZ A;  2W3F A;  4DF6 A;  1S67 L;  1TEM A;  4IBR A;  3ZYT A;  1VHM A;  4IUH A;  1NWZ A;  4EBL A;  2K7S A;  4YWZ A;  5HZH A;  1N4O A;  3N8L A;  4B4Z A;  1PRQ A;  4F3L B;  2ZD8 A;  2ZMV A;  4CLC C;  3CIT A;  5TBM B;  2X71 A;  2UWX A;  2EA9 A;  3O86 A;  4MNR A;  5FL3 A;  2JE5 A;  3VSL A;  4N1H A;  1FCM A;  4HH3 A;  1XKZ A;  2JN7 A;  3HLW A;  1L3L A;  3MXR A;  4Y5F A;  1OTI A;  4PHT A;  1YKD A;  2P74 A;  1BLS A;  5EVI A;  4B4X A;  3ZDJ A;  3BRM A;  5GLA A;  2ZC5 B;  3UPP A;  2E8I A;  4KZ7 A;  5CED A;  2ZC4 B;  5FAO A;  5FQK A;  1LL9 A;  3CAX A;  1FIK A;  3HLC A;  1ZHH B;  3KO6 A;  2VEA A;  2DRW A;  3V3S A;  4MCW A;  2VJW A;  2ZBB A;  4D2O A;  2A24 B;  2A49 A;  3S7Q A;  3T12 B;  4BD1 A;  5I94 A;  3M2J A;  2WGW A;  3CPT B;  4R3J A;  1NLZ A;  4LCL A;  4N9K A;  3LR3 A;  4UQI M;  4UA6 A;  1D1J A;  4LRY C;  4PKY A;  4EEP A;  2GX5 A;  4HY8 A;  4P6B A;  4ME4 A;  2I9V A;  5FDH A;  1IFQ A;  1VET B;  3JYI A;  2V0U A;  3IHB A;  4ZJ1 A;  3HLG A;  1DJC A;  4S2N A;  4X56 A;  4P6Z M;  4PM5 A;  1QMF A;  1CEG A;  3AGF A;  3FKV A;  3C4P A;  3R7W A;  1V9Z A;  3DAV A;  5HDD A;  1Z6F A;  3VP1 A;  3SS4 A;  1MWT A;  1MWU A;  4GKU A;  1NJ4 A;  5EVI B;  5AJG A;  2B5R A;  1ES5 A;  3RJU A;  4P85 A;  1XX2 A;  4GHI B;  2WGI A;  5EE8 A;  2KX6 A;  2OWH A;  4WEL A;  5GHY A;  2ZM8 A;  4EXO A;  4HI4 A;  3M6B A;  4WYY A;  3MF0 A;  1RCJ A;  4DJ3 A;  2WKH A;  4R4S A;  3N7W A;  3CLO A;  4R23 A;  1MZU A;  2Y2P A;  1N9L A;  2QJ7 A;  4OPR A;  4FSF A;  4GS9 B;  4O0P A;  1M6K A;  1N9B A;  4OON A;  4LRX C;  3CG5 A;  3T50 A;  2WGW B;  2XA7 M;  3ZVW A;  2VGL S;  4K0X A;  5FEG A;  4KUK A;  5EVL A;  4YFM A;  1IEL A;  3M2K A;  4DDS A;  3EGD C;  2R9X A;  1K55 C;  4LFU A;  3V5M A;  2IWB A;  5EPH A;  1STZ A;  5BOH A;  4PAU A;  3ZG9 B;  4EER A;  3H82 B;  4NXG A;  2O9B A;  4X25 A;  3IXH A;  3Q81 A;  1MWR A;  2D01 A;  5EVI C;  4S2L A;  5F6A A;  3ZNY A;  3PTE A;  1PI4 A;  1GHP A;  2ZOI A;  2GDN A;  5AVF A;  4MN5 A;  1GA9 A;  3CMZ A;  2ACG A;  4FD8 A;  3DTK A;  3SH7 A;  3K2N A;  2HPB A;  4KQD A;  1ZG4 A;  4RX3 A;  2QYB A;  3LEZ A;  2KLI A;  4LV3 A;  3UB7 A;  4KZ9 A;  3GEC A;  2V20 A;  3IH9 A;  2O9C A;  3KSF A;  3W4O A;  2G7U A;  3SS5 A;  2Y2H A;  3IT9 A;  1CF0 A;  1P9W A;  1P97 A;  1DJA A;  3LIB A;  4QU3 A;  3T4K A;  4PM7 A;  3F1P A;  3QP2 A;  4C6Y A;  1SCW A;  4HH2 A;  2H5S A;  3WS2 A;  1MWS A;  4OLG A;  4E3N A;  2ZQC A;  1XJ2 A;  4KZ5 A;  2I72 A;  2XFT A;  3B47 A;  4DN0 A;  1LT0 A;  5HWT A;  5KZH A;  3LUQ A;  4HOI A;  5DJT A;  3BQA A;  5L10 A;  2J7V A;  4GB7 A;  2Y2O A;  4JGR A;  2JKR M;  2ZQ7 A;  1BLH A;  3PBQ A;  4WZ4 A;  2PYR A;  2QPN A;  2Z2M B;  3FZC A;  2PR5 A;  3C2W A;  5F5Y A;  3S22 A;  3VE4 A;  3LR4 A;  5DTT A;  1MKI A;  3MSH A;  1CQA A;  2OSU A;  4QPR A;  3SW1 A;  3WS4 A;  4KZ8 A;  5FSR A;  1S1Z A;  4E6W A;  1RGZ A;  1K57 C;  4HBT A;  4D60 A;  2V8C A;  5EOE A;  5EM1 A;  4MN6 A;  5GL9 A;  3D72 A;  1S1Y A;  4WF0 A;  1G28 A;  2PDR A;  1IYO A;  1SHV A;  1ERQ A;  3QP5 A;  3F1P B;  3OCN A;  3VP2 A;  3QP1 A;  5I5L A;  3PYP A;  4LLO B;  5GLB A;  2W27 A;  1Y28 A;  3BLS A;  3VP4 A;  5G4Y A;  4EES A;  5G4Z A;  5EM0 A;  1JWZ A;  3HLB A;  4GDB A;  3RFB A;  2JKT M;  4E3K A;  5HAI A;  4FOF A;  4X55 A;  3OPH A;  1PYY A;  3C5A A;  2Y2J A;  4GLQ A;  4EBN A;  2BTF P;  3BFC A;  1PWD A;  3UO9 A;  4FH4 A;  2BAS A;  4DRT A;  1F5M A;  1SKO B;  3EOI A;  5CXW A;  1UWN X;  3LFV A;  1E4D A;  5FQ9 A;  4UEY A;  1IYQ A;  2G2U A;  3T1R A;  5AQA A;  3Q1F A;  3MFD A;  1GHM A;  4ETX A;  3N4I A;  4WMC A;  3U4L P;  5LBR A;  5CRF A;  3KYQ A;  1VEU A;  3G2Z A;  1MXO A;  4PPR A;  1NY0 A;  1K56 A;  3BW6 A;  4II7 A;  3UB6 A;  5FAT A;  3BWL A;  5FQI A;  2K31 A;  5HX9 A;  2Y4A A;  5AQB A;  1BLC A;  4NXF A;  1TS0 A;  4S2J A;  3UE0 A;  1CK3 A;  1LSW A;  2J80 A;  4JPM A;  3WWX A;  3GSG A;  5HAP A;  2ZQA A;  4R70 A;  4WEK A;  1NXY A;  5DJU A;  5DF7 A;  1FR1 A;  1LHY A;  3MQ0 A;  4UQI S;  4CLC A;  2XSS A;  5DTK A;  4WEJ A;  1YT4 A;  3LIF A;  4DE2 A;  4Y3I A;  5A91 A;  2DNS A;  3NBL A;  3FG8 A;  3IXG A;  3CWF A;  3CHW P;  4RX2 A;  3HUO A;  3VFF A;  4L0L A;  4BLM A;  2Z2L B;  3FYZ A;  5E2H A;  4BBV A;  5CGS A;  1RGY A;  1YLZ A;  4E3J A;  4P6Z S;  5HL1 A;  2QHK A;  4MMN A;  2D02 A;  1XFQ A;  3T4S A;  3SZT A;  2CMN A;  3A3D A;  3HRE A;  3PHY A;  3IX8 A;  4G3V A;  3ULF A;  2IWC A;  2FZ0 A;  3P01 A;  1LL5 A;  4O8G A;  3JPU A;  3RXX A;  4GZB A;  2HGV A;  5DTS A;  4A5R A;  3V50 A;  4EWF A;  4KG2 A;  3JVU A;  4FH2 A;  4Y7P A;  2RCX A;  3H9W A;  2X01 A;  3BLM A;  3IHA A;  2EWV A;  4RVA A;  1G5U A;  2HP6 A;  3ITB A;  5TR7 A;  2KDK A;  4F3L A;  2EX9 A;  4DE0 A;  1KVL A;  4E3L A;  5EV0 A;  4GOG A;  4KG6 A;  2EWW A;  3NCK A;  2JKR I;  1XJ3 A;  1AXB A;  2EFX A;  4LV1 A;  1E25 A;  4I38 A;  3NEC A;  3UMD A;  3HVF A;  3IBJ A;  2NUT C;  5KMW A;  2XD5 A;  3E0Y A;  5EEC A;  5J8X A;  4BJP A;  3NJA A;  3C7V A;  2P7J A;  1ERO A;  4N9L A;  5GHX A;  3U2A A;  4R4R A;  2A24 A;  5HSQ A;  1K6S A;  5A92 A;  3L7H A;  1F98 A;  1FCN A;  4QWO A;  4HNB A;  3VMA A;  3GRJ A;  3CPT A;  1ES3 A;  5D3O A;  1DY6 A;  4X69 A;  2M7U A;  4OPY A;  1XGI A;  1MKM A;  4KZA A;  3IF6 B;  3FKW A;  3M6H A;  4K0W A;  1YLT A;  2L1M A;  2JCH A;  1HLU P;  3EQV A;  4HBU A;  1VET A;  3NDG A;  5KSH A;  5HD5 A;  2JKT I;  1K55 A;  2Y8H A;  4H8R A;  3HL9 A;  1BYW A;  1S0W A;  4WUJ A;  2BG1 A;  1PFL A;  4JXG A;  3PXP A;  3BY8 A;  2VV7 A;  3SH9 A;  4KZ3 A;  1K4E A;  4NEE D;  1XGJ A;  4HES A;  3FC7 A;  3ZG0 A;  1OTB A;  4EV4 A;  5KIZ A;  3BFG A;  5HAR A;  1PIO A;  1LSV A;  4GHI A;  1FSW A;  4CPK A;  1T1A A;  3ZHH A;  3GV9 A;  3V39 A;  1MPL A;  5IHV A;  4GS9 A;  1EI5 A;  3G34 A;  5HL6 A;  3UN7 A;  3IF6 C;  4KQO A;  3LCE A;  2OLV A;  3B33 A;  3O88 A;  4NK3 A;  4WLA A;  3OBF A;  4UA9 A;  2JHE A;  2VGK A;  4GNU A;  1ACF A;  4JXW A;  4R38 A;  3F1O B;  1BZA A;  1ALQ A;  3H82 A;  3VOL A;  1YLY A;  5DFY A;  1TDG A;  1KGE A;  1H8M A;  3IBR A;  1DP6 A;  4KZB A;  3K3D A;  3ZQ5 A;  1XFN A;  3ZGA B;  1S6R A;  2A2L A;  5FQM A;  3KSI A;  1C3B A;  3VOY A;  4OQI A;  2OAQ 1;  2XR0 A;  2ZLY A;  3ITA A;  3QP6 A;  1BUE A;  5MC7 A;  3NOP C;  1HTZ A;  1S66 L;  3EGX C;  2VA0 A;  4B93 A;  3HBR A;  3D3O A;  3NOU C;  4ZTK A;  3OPR A;  3FPV A;  1KE3 A;  4KUO A;  3S7P A;  3MZF A;  2ZL1 B;  3IS2 B;  1GHI A;  3OC2 A;  3DTM A;  1BT5 A;  3UDX A;  3MXQ A;  2W3H A;  1SDE A;  3TE8 A;  4RA7 A;  2ZMF A;  3E4O A;  4U0X A;  4G3W A;  3MR0 A;  3MZD A;  4JGO A;  2KOI A;  1LI0 A;  3NUL A;  4B88 A;  1YLW A;  3VP3 A;  1K57 A;  4G3K A;  5TFQ A;  3SH8 A;  4NG2 A;  2J3W A;  5J3W A;  1KOU A;  4R1G A;  3IX3 A;  3LIC A;  4QB8 A;  1L0F A;  1IYS A;  1OTE A;  3D9Y A;  4JBF A;  3F1N B;  3G4P A;  3G35 A;  5DVA A;  2HDR A;  4OQG A;  1ES2 A;  5HD3 A;  5A90 A;  1YSP A;  1MY8 A;  2HZ5 A;  2PT7 A;  3GMW A;  5A93 A;  4CJN A;  4O01 A;  3N8R A;  5KSC A;  4NXB A;  2W0N A;  1M40 A;  1FCO A;  2PAV P;  4MEZ A;  2FFF B;  4IED A;  2O9A A;  2X02 A;  4QD4 A;  4JF6 A;  2HF6 A;  4PM8 A;  3UME A;  5EFW A;  3JVV A;  4OP5 A;  1IKI A;  1E3U A;  5GHZ A;  2WZX A;  3O3V A;  4C75 A;  2WKP A;  4BQM A;  4WZ5 C;  3RH8 B;  4ZJ3 A;  1PWC A;  5CER A;  4Q8I A;  1XXM A;  4OQH A;  2PD7 A;  4HJ3 A;  2P9V B;  5L07 A;  4P0M A;  3WRZ A;  2HP5 A;  3VE3 A;  4E3M A;  3LR5 A;  3ZCZ A;  4R3B A;  3IQA A;  4DE3 A;  1DP9 A;  1G68 A;  2C5W B;  3DTI A;  3IF5 A;  4Y2F A;  1D7E A;  2XRO A;  4DKI A;  1L2S A;  3N6I A;  2OOL A;  1IYP A;  3TW8 A;  1L0E A;  4N92 A;  1YLJ A;  3B3X A;  3NC8 A;  4OH0 A;  3T4Q A;  1VQQ A;  3IWQ A;  1KVM A;  1H8Z A;  1NYY A;  3PBS A;  1DJB A;  3UB8 A;  4YIN A;  3W8K A;  4JF4 A;  3Q82 A;  3RXW A;  1GSX A;  3OCL A;  4O7D A;  4EW7 A;  3GTC A;  2WK0 A;  4JLF A;  1WYC A;  3LIE A;  2HV1 A;  2RL3 A;  1SKO A;  3GQZ A;  1Y4O A;  3PBO A;  4FTX A;  3UPN A;  3MS6 A;  4OOL A;  3CUE A;  3ZFZ A;  3P7N A;  4I3I A;  1O07 A;  2WAF A;  1QME A;  2V9A A;  3NY4 A;  1O7E A;  1JNU A;  2WKI A;  4QY6 A;  4DDY A;  3IH8 A;  1UGU A;  4OPQ A;  3UDI A;  3HJI A;  4Y15 A;  4S2M A;  2ZM0 A;  1KDW A;  5A8B A;  2XLN A;  2ZC7 A;  4S2P A;  3S7N A;  1YQS A;  2Y2G A;  3OOV A;  3PAE A;  3CI6 A;  2ZQ8 A;  3T1Q B;  3NIA A;  5AVE A;  1T1B A;  3E2L A;  5HFO A;  4DMZ A;  1WYB A;  1OTA A;  4N1X A;  2W3E A;  1TDL A;  4OLD A;  4EUV A;  4DXC A;  1OTD A;  1XJ4 A;  5DKL A;  4ZBE A;  4UA7 A;  2WKQ A;  5F83 A;  1CEF A;  3QP8 A;  4OKP A;  2J9O A;  2VKS A;  2PU4 A;  3S7O A;  4GDN A;  4MN7 A;  4EET B;  2ZJ9 A;  1HZO A;  2L4R A;  5F1G A;  1OJ5 A;  3T4T A;  1H3Q A;  1G6O A;  1OT6 A;  3BEC A;  1NZU A;  4U3T A;  4KQR A;  3KYZ A;  1RP5 A;  4HQA A;  4GCZ A;  4HIA A;  4JXS A;  1G6A A;  4X6T A;  1FQG A;  3UB9 A;  2BLS A;  1W63 Q;  2XRN A;  2INW A;  1TS6 A;  1IOU A;  4B9O A;  2JKG A;  3C8C A;  5FI6 A;  2PD8 A;  1XP4 A;  5DF9 A;  2EX8 A;  5TGF A;  1JTG A;  2Q0O A;  2EX2 A;  3PAG A;  1IKG A;  1NYM A;  3NDE A;  4FUW A;  1DP8 A;  3HCY A;  3HLD A;  4QHC A;  4GN2 A;  3QP4 A;  2EX6 A;  2L0W A;  3S4X A;  3MBZ A;  3MKF A;  4NKP A;  3A0V A;  3CUE C;  1DRM A;  5C5K A;  2Z6D A;  4MDZ A;  2V8F A;  4BL3 A;  1LLB A;  3E4P A;  1TS7 A;  3ZG5 A;  5FAP A;  4JKT A;  2OWJ A;  4RQ9 A;  5EUA A;  2O99 A;  1S4R A;  5FQQ A;  3T4L A;  3VV4 A;  1W7F A;  4I3A A;  1KGF A;  2EXA A;  3QNC A;  3IF6 A;  1CI9 A;  4OP8 A;  4LV0 A;  1ZG6 A;  4OVD A;  3QHY A;  3FPW A;  3FWL A;  3HUM A;  3BFD A;  3GVB A;  1K54 A;  2G2W A;  1W8Q A;  1PWG A;  2Y2L A;  5CX7 A;  4EU0 A;  3W4P A;  4CQH A;  2XA7 S;  4K08 A;  3UE6 A;  5F69 A;  2Y91 A;  1GSV A;  1KDS A;  2B95 A;  5IU1 A;  3ZNT A;  4BWI A;  2C6W B;  3Q7V B;  1KE0 A;  3BY9 A;  1PZO A;  4R6L A;  3PR6 A;  4ETZ A;  2DCF A;  5IT5 A;  2XFS A;  4I3J A;  2CC1 A;  4WBG A;  4OQ0 A;  4Y13 A;  2NUP C;  4EEU A;  3BQ8 A;  3IXD A;  4DJ2 A;  1LSX A;  4BEN A;  5FA7 A;  5FAS A;  2HDU A;  4U0T A;  1ESU A;  1PW1 A;  2ZMA A;  5HW3 A;  2HP9 A;  3MJQ A;  2W1T B;  3C4O A;  2UV0 E;  1OPX A;  4Z1W A;  4I39 A;  2FH5 A;  3DTE A;  4KEN B;  4IVI A;  3OZH A;  5AQ9 A;  5CEC A;  3F1O A;  4KG5 A;  5HAQ A;  2LB5 A;  4EBP A;  4GW9 A;  3T4J A;  4PMA A;  2XEP A;  3Q7Z A;  3UPO A;  2J9P A;  3CZD A;  4JGQ A;  1D06 A;  1W63 M;  1JWV A;  3UB5 P;  4Y0T A;  3E2K A;  3NI9 A;  4Y0O A;  3DWZ A;  3G30 A;  1K0K A;  3DWK A;  4UHU A;  3O87 A;  1AWI A;  1SKF A;  5F68 A;  2PBY A;  5CEB A;  2XH9 A;  5FI7 A;  3UY6 A;  4HJ6 A;  2JBF A;  3BYD A;  5GLD A;  3R4K A;  5F82 A;  2VGJ A;  4ESP A;  4LEN A;  1BTL A;  4LCM A;  5F1F A;  3GDI A;  3A3E A;  3UE3 A;  2K2N A;  2J3T D;  2ZQ9 A;  1VB6 A;  1Q2P A;  2ZL1 A;  1TS8 A;  3IS2 A;  5E2F A;  4I5S A;  4XUX A;  3LIA A;  3DBA A;  4Q0I A;  3B42 A;  5DKK A;  4Z9Q A;  2QWS A;  3ZG8 B;  1EWZ A;  3UDF A;  3HJK A;  2ZQD A;  1K54 C;  1NRJ A;  2WZZ A;  2R78 A;  1X0O A;  3LI8 A;  3VSK A;  3LID A;  4BL2 A;  3MQO A;  1CJF A;  2A3U A;  3VFH A;  5AQ7 A;  2PBD P;  2V1Z A;  4BMW A;  4WZ5 A;  3NOT C;  5HDC A;  3QNB A;  5J7E A;  3P98 A;  3NHQ A;  3OPL A;  2WAE A;  3BEB A;  1SZV A;  4Y0U A;  4L9F A;  1HD8 A;  4GD6 A;  4WMC D;  4MBF A;  2M1C A;  3F1N A;  2E8J A;  3E4Q A;  3D4F A;  2EFU A;  3MKE A;  3WS1 A;  1LL8 A;  1ZTU A;  1K56 D;  1MC0 A;  1PI5 A;  3VP0 A;  1I5Q A;  2O0Y A;  3TSG A;  3N8S A;  4QJG A;  5FI2 A;  4OOM A;  3E98 A;  3TG9 A;  2Y79 A;  5G18 A;  2LB9 A;  2WKE A;  4MBH A;  4JF5 A;  3EQU A;  1CI8 A;  5JYO A;  2VZW A;  2GZA A;  5E2G A;  4CLC D;  3A3I A;  3WRT A;  2VV6 A;  2GJ3 A;  4H6J A;  2XF3 A;  2P04 A;  5L2F A;  2HJE A;  1N9N A;  4ZAM A;  2XDM A;  1JTD A;  2B02 A;  3C7U A;  4Y17 A;  5M1A A;  1OT9 A;  3T1X A;  2P9V A;  4XUZ A;  2R9W A;  4LRZ E;  1L0D A;  4R3A A;  2H0T A;  2QMI A;  1OJG A;  3IWI A;  4EQI A;  2XD1 A;  2VX8 A;  5EVE A;  1K38 A;  1ONG A;  4ARZ A;  1ERM A;  4DE1 A;  1P0Z A;  1XPB A;  1PNE A;  4IUK A;  2YKH A;  1YPR A;  3A3F A;  1Y54 A;  3G6O A;  3A0R A;  4IJG A;  4X68 A;  2H28 A;  3LI9 A;  3LY3 A;  1A0K A;  4GJ4 A;  3W2Z A;  1TVF A;  3R7W B;  2H0Y A;  3LO7 A;  1P9R A;  5HDS A;  3HLE A;  2V1B A;  2Y2Q A;  3EWK A;  1J9M A;  3A0S A;  1YM1 A;  4R0Q A;  2QZ6 A;  5E43 A;  4M4X A;  4H6J B;  1BSG A;  2HJ9 C;  2WYX A;  2OAP 1;  4HEF A;  3V3R A;  3WS5 A;  5GLC A;  2XQZ A;  4L9E A;  4IVK A;  4HP9 A;  3MFX A;  2QKP A;  4KZ6 A;  3KX0 X;  1ZC2 A;  3G31 A;  4HP4 A;  2B18 A;  3CJM A;  2VV8 A;  3KSH A;  2DMW A;  4L9G A;  1W79 A;  5L8M A;  1FR6 A;  1LI9 A;  2Y55 A;  1YMX A;  1Q2Q A;  1H8Y A;  1ZKJ A;  1NLY A;  2Y2N A;  4S2N C;  4ARZ B;  4P87 A;  3I7J A;  2OV5 A;  1ESI A;  1K6R A;  3IX4 A;  2EXB A;  2JKF A;  4X53 A;  5K5B A;  4RYE A;  5EOO A;  5HPF A;  5CHJ A;  1GA0 A;  1YMS A;  4S2I A;  5L09 A;  3BFF A;  3TJZ C;  4XXR A;  2V0W A;  4XT2 A;  5E2E A;  1K25 A;  1KE4 A;  2V2F F;  3OLO A;  1GCE A;  4ID4 A;  2MJ6 A;  4E6X A;  1W8Y A;  2ZC6 B;  3KYE A;  2WKR A;  5CTM A;  5EVI D;  1EW0 A;  4JGP A;  1FIL A;  4EQ1 A;  3BM6 A;  4NET A;  3O5Y A;  4PKY G;  3KSG A;  4S2O A;  1S4S A;  4FCF A;  2ZC3 B;  4AFI A;  4LV2 A;  3IXB A;  5CTN A;  3MXS A;  1W5D A;  1T18 A;  5FDS A;  5HPI A;  3TOI A;  3S1Y A;  1I2S A;  3T4O A;  5HWW A;  3LY4 A;  3MMH A;  4Q0J A;  5J4E A;  4KQQ A;  1ODV A;  5U47 A;  4ZJ2 A;  3LYX A;  3G32 A;  4EUZ A;  4HHD A;  3SOI A;  1XJ6 A;  4E04 A;  1HVB A;  4XT2 B;  2VGL M;  1J3W A;  1FSY A;  2VK3 A;  3OPP A;  2Y59 A;  3UE1 A;  1KGG A;  3EEH A;  2WAD A;  2PYP A;  3BFE A;  2GNX A;  1WA9 A;  1F2K A;  2PHY A;  2YKF A;  4CLC E;  2Y2K A;  4OOY A;  5IS1 A;  1YSQ A;  4E3I A;  3VOZ A;  4M3K A;  4DXB A;  2ZM2 A;  3HLF A;  2Q9N A;  2WGV A;  4PM6 A;  3ZG7 B;  3P09 A;  3GR2 A;  4QY5 A;  3PBR A;  4K91 A;  1FOF A;  2WUQ A;  4WN5 A;  1V9Y A;  3TRC A;  1PZP A;  4S2K A;  4BBT A;  3AGD A;  3W4Q A;  1GSW A;  3MZE A;  1OME A;  1N9O A;  2PU2 A;  1SDN A;  4LGW A;  3BJN A;  3PBT A;  1ES4 A;  1NRF A;  3RTY A;  1U60 A;  3Q7V A;  1BLP A;  1JWP A;  2FFY A;  3SS3 A;  2QJ5 A;  1I2W A;  3C38 A;  4ZDX A;  1WE4 A;  5CGX A;  5FQJ A;  1NZO A;  2HDS A;  3ICY A;  5DFX A;  1PW8 A;  1JVJ A;  2Y2M A;  4BD0 A;  2HDQ A;  3A3J A;  3C30 A;  3K3C A;  2JC7 A;  4MBK A;  2IWD A;  4YOF A;  2W3G A;  2W1T A;  5M18 A;  1H0M A;  2W3D A;  3H7W A;  2Z6C A;  2P08 A;  1L0G A;  2J8Y A;  4OPZ A;  3G2Y A;  4WL9 A;  1TF1 A;  1H5X A;  5M19 A;  3LEQ A;  2XK1 A;  4UAA A;  2XGN A;  4X1M A;  1IEM A;  3LGO A;  2Q9M A;  4Q0H A;  1E3U D;  1K4F A;  4IBX A;  2PRF A;  2OLU A;  1XA7 A;  3UNW A;  1ONH A;  2W1R A;  3L9K A;  4PM9 A;  1VEU B;  4IHQ A;  3V67 A;  2V1A A;  1F9I A;  2H10 A;  4HJ4 A;  5CHU A;  5DF8 A; 
#chains in the Genus database with same CATH homology
 2J3T C;  3LI8 A;  2HF6 A;  4FOF A;  5HWV A;  3LID A;  2IA2 A;  3MQO A;  3UME A;  5EFW A;  3MQQ A;  3JVV A;  4BMW A;  3NOT C;  5HDC A;  4ZRR A;  4YNR A;  5TBM A;  5J7E A;  3NHQ A;  2WKP A;  1T19 A;  1UWP X;  4GLQ A;  3RH8 B;  4L9F A;  1TD5 A;  1YAX A;  4NXE A;  2PR6 A;  2M1C A;  3F1N A;  2PD7 A;  4HJ3 A;  4BBU A;  3E4Q A;  2BAS A;  4CLC B;  3LR0 A;  3EEA A;  1LL8 A;  1ZTU A;  2VLG A;  1F5M A;  1MC0 A;  3EOI A;  3VE3 A;  2O0Y A;  1UWN X;  3LFV A;  4UEY A;  3LR5 A;  4ETX A;  1DP9 A;  4OOM A;  3E98 A;  4Y2F A;  3PBN A;  1D7E A;  3H7W B;  2Y79 A;  5LBR A;  2LB9 A;  2XRO A;  3KYQ A;  2ZOH A;  2OOL A;  2M7V A;  3TW8 A;  3BW6 A;  4II7 A;  3EQU A;  3UB6 A;  2VZW A;  2GZA A;  1T1C A;  4CLC D;  3BWL A;  2K31 A;  3T4Q A;  2VV6 A;  2GJ3 A;  4H6J A;  5TJJ A;  4LPZ A;  4NXF A;  1TS0 A;  3PBS A;  2W3F A;  2P04 A;  3UB8 A;  1S67 L;  2HJE A;  1LSW A;  1N9N A;  2J80 A;  2B02 A;  1GSX A;  4R70 A;  3ZYT A;  3OCL A;  4WEK A;  4EW7 A;  1OT9 A;  1VHM A;  5DJU A;  4IUH A;  3MQ0 A;  1NWZ A;  4UQI S;  2K7S A;  4YWZ A;  2XSS A;  4CLC A;  5HZH A;  3LIE A;  2HV1 A;  4LRZ E;  4WEJ A;  4F3L B;  4R3A A;  3LIF A;  3PBO A;  2ZMV A;  4CLC C;  3CIT A;  5TBM B;  1OJG A;  2EA9 A;  4Y3I A;  5FL3 A;  4OOL A;  2VX8 A;  3CUE A;  3FG8 A;  3CWF A;  4ARZ A;  3P7N A;  4I3I A;  4HH3 A;  2JN7 A;  4L0L A;  1P0Z A;  2V9A A;  4BBV A;  4IUK A;  4Y5F A;  2YKH A;  1OTI A;  4PHT A;  4P6Z S;  1JNU A;  1YKD A;  2QHK A;  3G6O A;  2D02 A;  4MMN A;  1XFQ A;  3T4S A;  1UGU A;  3A0R A;  4IJG A;  2H28 A;  3LI9 A;  3HJI A;  2CMN A;  3PHY A;  4G3V A;  3ULF A;  3CAX A;  5A8B A;  2FZ0 A;  3P01 A;  4GJ4 A;  3W2Z A;  4O8G A;  1ZHH B;  3KO6 A;  2VEA A;  3R7W B;  4MCW A;  1P9R A;  3S7N A;  2VJW A;  5HDS A;  2HGV A;  2V1B A;  3EWK A;  3A0S A;  3OOV A;  2ZBB A;  3JVU A;  2A24 B;  3CI6 A;  3S7Q A;  3H9W A;  2EWV A;  1NLZ A;  5AVE A;  1T1B A;  4M4X A;  4H6J B;  3LR3 A;  2KDK A;  4DMZ A;  4F3L A;  2HJ9 C;  4UQI M;  2OAP 1;  2EWW A;  1OTA A;  4LRY C;  4PKY A;  4EEP A;  4L9E A;  2GX5 A;  2JKR I;  1XJ3 A;  4HP9 A;  3MFX A;  4HY8 A;  2W3E A;  2QKP A;  3KX0 X;  4ME4 A;  2I9V A;  4I38 A;  4HP4 A;  3UMD A;  1IFQ A;  4EUV A;  2B18 A;  3KSH A;  1OTD A;  1XJ4 A;  2DMW A;  2VV8 A;  4L9G A;  3IBJ A;  5DKL A;  2WKQ A;  2NUT C;  2V0U A;  5L8M A;  2VKS A;  3E0Y A;  3S7O A;  4MN7 A;  4P6Z M;  4EET B;  1NLY A;  4BJP A;  4ARZ B;  3NJA A;  2L4R A;  1OJ5 A;  2P7J A;  3T4T A;  1H3Q A;  1G6O A;  3R7W A;  5K5B A;  1V9Z A;  5HDD A;  3U2A A;  1OT6 A;  5HPF A;  5AJG A;  2A24 A;  5HSQ A;  3KYZ A;  1F98 A;  4HNB A;  4HQA A;  4GCZ A;  4HIA A;  4GHI B;  2KX6 A;  2OWH A;  4WEL A;  3TJZ C;  4EXO A;  4HI4 A;  3UB9 A;  2V0W A;  4XT2 A;  3MF0 A;  2M7U A;  4DJ3 A;  1W63 Q;  2XRN A;  2INW A;  1MKM A;  1TS6 A;  3CLO A;  1MZU A;  3OLO A;  1IOU A;  1N9L A;  2QJ7 A;  4B9O A;  2MJ6 A;  4FSF A;  4GS9 B;  3C8C A;  4O0P A;  2PD8 A;  2L1M A;  4LRX C;  5DF9 A;  3EQV A;  3T50 A;  2XA7 M;  2VGL S;  5KSH A;  2WKR A;  5HD5 A;  2JKT I;  4KUK A;  2Y8H A;  1EW0 A;  1DP8 A;  3HCY A;  4JGP A;  1BYW A;  4EQ1 A;  3EGD C;  2L0W A;  4WUJ A;  3O5Y A;  4PKY G;  3KSG A;  1STZ A;  4NKP A;  1S4S A;  3A0V A;  3CUE C;  1DRM A;  5C5K A;  2Z6D A;  4PAU A;  3PXP A;  4MDZ A;  4EER A;  3BY8 A;  3H82 B;  4AFI A;  2VV7 A;  4NEE D;  4NXG A;  3E4P A;  1TS7 A;  3FC7 A;  2O9B A;  2OWJ A;  4RQ9 A;  1OTB A;  2O99 A;  1S4R A;  3T4L A;  5KIZ A;  2D01 A;  3VV4 A;  4I3A A;  1LSV A;  1T18 A;  4GHI A;  5HPI A;  3T4O A;  5HWW A;  1T1A A;  5F6A A;  3MMH A;  4Q0J A;  5J4E A;  1ODV A;  4GS9 A;  3LYX A;  2ZOI A;  4HHD A;  1XJ6 A;  5HL6 A;  4E04 A;  4KQO A;  5AVF A;  3FPW A;  4MN5 A;  3B33 A;  4WLA A;  4XT2 B;  3OBF A;  2VGL M;  2JHE A;  3K2N A;  5CX7 A;  4EU0 A;  4KQD A;  4CQH A;  2QYB A;  2XA7 S;  4R38 A;  4K08 A;  3F1O B;  3UE6 A;  3EEH A;  5F69 A;  2PYP A;  2KLI A;  2GNX A;  1WA9 A;  3UB7 A;  1GSV A;  3H82 A;  5IU1 A;  3VOL A;  4BWI A;  2PHY A;  5DFY A;  3GEC A;  2YKF A;  1H8M A;  4CLC E;  3IBR A;  5IS1 A;  2O9C A;  3KSF A;  1DP6 A;  1YSQ A;  2G7U A;  3BY9 A;  3K3D A;  3ZQ5 A;  4R6L A;  3PR6 A;  1XFN A;  4ETZ A;  2A2L A;  5IT5 A;  3KSI A;  1P9W A;  1P97 A;  4I3J A;  3LIB A;  3T4K A;  2OAQ 1;  3F1P A;  2NUP C;  4EEU A;  3BQ8 A;  5MC7 A;  3NOP C;  4DJ2 A;  1LSX A;  1S66 L;  3EGX C;  2VA0 A;  4HH2 A;  3PBR A;  4B93 A;  3D3O A;  3NOU C;  4WN5 A;  3MJQ A;  2W1T B;  1V9Y A;  3TRC A;  1OPX A;  4Z1W A;  3FPV A;  4I39 A;  1XJ2 A;  2FH5 A;  4BBT A;  3B47 A;  4DN0 A;  1GSW A;  1LT0 A;  5HWT A;  3LUQ A;  4KUO A;  4HOI A;  3S7P A;  3IS2 B;  1N9O A;  3OC2 A;  5DJT A;  3BQA A;  3F1O A;  3MXQ A;  4JGR A;  3BJN A;  2LB5 A;  3PBT A;  2W3H A;  2JKR M;  3RTY A;  3TE8 A;  4GW9 A;  3T4J A;  3PBQ A;  2PYR A;  2ZMF A;  3E4O A;  2PR5 A;  4JGQ A;  1D06 A;  4G3W A;  1W63 M;  2QJ5 A;  3C38 A;  3C2W A;  5F5Y A;  3VE4 A;  3LR4 A;  3MR0 A;  4JGO A;  2KOI A;  4QPR A;  3SW1 A;  3ICY A;  4G3K A;  5DFX A;  2J3W A;  1S1Z A;  5J3W A;  1KOU A;  5F68 A;  3LIC A;  4HJ6 A;  4MN6 A;  3C30 A;  3K3C A;  3R4K A;  1OTE A;  3D72 A;  1S1Y A;  4YOF A;  2W3G A;  4WF0 A;  2W1T A;  3GDI A;  1G28 A;  3F1N B;  2W3D A;  3UE3 A;  2K2N A;  2PDR A;  3H7W A;  2J3T D;  2Z6C A;  2P08 A;  1VB6 A;  3F1P B;  3OCN A;  5I5L A;  4WL9 A;  1TF1 A;  3PYP A;  3IS2 A;  1TS8 A;  4LLO B;  5HD3 A;  1YSP A;  2W27 A;  1Y28 A;  4I5S A;  2PT7 A;  5G4Y A;  3LIA A;  4Q0H A;  4EES A;  3DBA A;  4O01 A;  4Q0I A;  5G4Z A;  3B42 A;  5DKK A;  2QWS A;  4NXB A;  2W0N A;  2W1R A;  3HJK A;  1NRJ A;  4IHQ A;  3RFB A;  3V67 A;  2V1A A;  1F9I A;  4HJ4 A;  2R78 A;  1X0O A;  2JKT M;  2O9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...