1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
3HJIA 4B9OA 5HDSA 2ZBBA 5HD3A 1OTEA 4BBTA 2PR5A 3A0RA 4WLAA 5TBMB 3H9WA 1S4SA 4LPZA 3UMEA 2OOLA 3F1OB 1OJGA 3UE6A 3A0VA 4I38A 1D7EA 4XT2B 2QKPA 3H7WB 2L4RA 3BY9A 1UWPX 4R6LA 2VV8A 2WKQA 3NHQA 4H6JA 4EQ1A 2ZOIA 1ODVA 4GS9B 4GCZA 3P7NA 3IBRA 2VLGA 2YKHA 5HDCA 2VV7A 3SW1A 3C2WA 5IS1A 2R78A 3LIAA 4NXFA 3K3CA 2V1BA 2W0NA 2Z6CA 2V0WA 3NJAA 4HHDA 3UB6A 4GHIA 4DJ2A 2M1CA 1XJ4A 2L0WA 5DJUA 4I5SA 5F69A 1N9LA 4H6JB 3MFXA 1LSVA 1XFQA 1UGUA 2D01A 4R70A 3ICYA 1XJ6A 3MXQA 3FG8A 2OWHA 4HH3A 4HY8A 4EESA 3FC7A 3ULFA 2VV6A 5HZHA 3LICA 3CAXA 4EERA 3HJKA 4GHIB 3F1PA 3LIEA 2V1AA 3IS2A 2WKRA 1GSXA 2BASA 3NOPC 4DJ3A 3MR0A 1TS7A 2K7SA 5HSQA 3G6OA 3MJQA 2A24A 5HWVA 1OT9A 1Y28A 4PKYG 2KX6A 2V9AA 3E4OA 1OTBA 2QJ5A 1DRMA 5J4EA 3UB9A 3F1PB 2D02A 1GSVA 2ZOHA 4HOIA 3IS2B 1F9IA 1OTAA 1TS8A 1BYWA 2YKFA 3E4PA 2QHKA 4MN6A 4F3LA 1D06A 2L1MA 3UMDA 4K08A 5J3WA 3ZQ5A 3LI8A 4LRYC 3UB8A 2A24B 1S67L 4KUOA 2GJ3A 3CWFA 1EW0A 4R3AA 3OLOA 4I3IA 4EETB 3RH8B 3CLOA 1N9NA 3MQOA 3K3DA 1OTDA 1LSXA 3UB7A 4LRZE 1TS0A 4MN5A 4KQDA 4HH2A 3BY8A 1XJ2A 4EXOA 1S66L 4WF0A 1TS6A 2EA9A 4I3JA 4F3LB 3GDIA 2KDKA 4BBUA 4JGPA 4GW9A 4YWZA 3B33A 2JHEA 2PD7A 5DKLA 4BBVA 1N9OA 3VE4A 4HIAA 2INWA 4JGRA 2VEAA 5DKKA 4NXGA 4JGQA 4LLOB 3A0SA 2PHYA 1G28A 2PYRA 5G4ZA 1DP9A 4I3AA 1WA9A 1DP6A 3NOTC 1T1AA 1LSWA 1P97A 2B02A 1LT0A 2PYPA 3PYPA 2JN7A 2W27A 5AVEA 3LYXA 5DJTA 4EEPA 1OJ5A 4HP4A 3D72A 5HDDA 2I9VA 1NWZA 3H82A 2PR6A 1V9ZA 1T1BA 1S4RA 3NOUC 4WL9A 1XJ3A 5IU1A 2CMNA 4L9FA 4HNBA 3C8CA 5HWWA 3VOLA 1S1ZA 2WKPA 1P0ZA 3LUQA 4KUKA 4LRXC 3EEHA 4NXBA 1MZUA 1OT6A 1LL8A 5F5YA 4NXEA 2PDRA 1OTIA 1T19A 4JGOA 2V0UA 2QJ7A 2PD8A 4EW7A 5I5LA 3BWLA 4WUJA 3T50A 3H82B 3MQQA 4E04A 3PHYA 1S1YA 1V9YA 4I39A 4PKYA 3GECA 3LI9A 5HD5A 1F98A 3F1NA 1GSWA 4HI4A 5HWTA 1XFNA 2OWJA 4R38A 2HV1A 4RQ9A 3LIBA 4L9EA 1DP8A 4HQAA 4M4XA 4L9GA 5EFWA 1UWNX 1VB6A 3LIFA 5A8BA 4HP9A 1T18A 2QWSA 2Z6DA 5F68A 3RTYA 3KX0X 1X0OA 3E4QA 5TBMA 3EWKA 5F6AA 5KIZA 4HJ3A 3F1NB 4HJ4A 3F1OA 4EEUA 5AVFA 1T1CA 3VE3A 2J80A 4XT2A 5G4YA 3LIDA 4WN5A 2H28A 3H7WA 4HJ6A 1KOUA 5J7EA 1JNUA 4GS9A 2P7JA
chains in the Genus database with same CATH superfamily
1BUEA 4R4SA 3WWXA 5HDSA 5A93A 1YMXA 2PR5A 3A0RA 1FIKA 5GLBA 5CXWA 1D1JA 3T1SA 1SKOA 3A3FA 4WEJA 2Y2GA 2XDMA 3F1OB 2CC1A 3GR2A 3UE6A 3OPPA 3A0VA 4PM9A 3NECA 1N4OA 4OONA 3T1QB 1H8YA 4LV3A 2L4RA 4NETA 1UWPX 2WKQA 4S2OA 3PXPA 1BTLA 4IVIA 5CTMA 3B42A 4ESPA 2VGLS 4N9LA 2WYXA 3ZDJA 3S22A 2YKHA 3Q81A 2VV7A 3SW1A 4C3QA 5HAQA 4NXFA 3ITAA 5AQBA 5EVIC 3UN7A 2V1BA 2V0WA 4B93A 4BD0A 2WZXA 1TDGA 3UNWA 3LFVA 3AGDA 4DN0A 2V20A 2XA7M 2X02A 2XLNA 2JKFA 5DJUA 1E3UD 1FCOA 1MWUA 4H6JB 4QB8A 4CJNA 3FKWA 1BZAA 4UQIS 1GHMA 3KO6A 1MWRA 4EESA 5HX9A 2XRNA 3FV7A 3FC7A 2Z2LB 3ULFA 3PAGA 4X1LA 3HJKA 4B4ZA 3GRJA 4GZBA 2ZL1B 4GHIB 1YLWA 3IHBA 3LIEA 1VETB 4WM9A 3UPPA 3IWOA 2WKRA 5E2HA 5FI6A 4E3JA 1MC0A 1ZTUA 4WMCD 1GSXA 4DJ3A 3MR0A 4PM6A 2ZC4B 3CITA 5HSQA 3G6OA 5HWVA 1OT9A 4PKYG 1IYPA 2V9AA 4OKPA 2ZC7A 2RL3A 4S2IA 3N8SA 4OPRA 4KZ9A 5EE8A 1FR6A 4HESA 3HLGA 3OPLA 2QJ5A 5J4EA 2E8IA 4KZAA 2HF6A 2D02A 1O07A 3MZFA 2W3DA 2ZOHA 4HOIA 5CRFA 3IS2B 1BYWA 3ZHHA 3E4PA 3S7QA 5A90A 1M6KA 3NDGA 4MN6A 2HP9A 1EROA 3G31A 3UMDA 5J3WA 2C6WB 1NLZA 3T12B 4EQIA 2ZJ9A 3CWFA 3HLCA 3M6BA 1LL5A 4I3IA 1NXYA 4EETB 3B47A 3DWKA 3JPUA 5AQ9A 3Q1FA 5CGXA 2RCXA 1TD5A 3BFDA 1KDWA 4MN5A 4KQDA 4HH2A 4ETZA 3OPRA 1GHIA 4EXOA 3IF6A 1S66L 4WF0A 1KE3A 1K56A 3IT9A 4NEED 4F3LB 4BBUA 3K2NA 1CI9A 2ZMAA 1TVFA 2HP6A 3KSGA 4ZTKA 2HP5A 5GHYA 2AVXA 4N1HA 5DKLA 3KSHA 4BBVA 2VKSA 2ZQCA 3CZDA 4KZ4A 1PWDA 3CG5A 2XK1A 4X68A 3A3IA 5CTNA 5DKKA 5E2FA 1ES3A 5DF8A 4JGQA 1CI8A 3TRCA 2JKRM 1G28A 5FQ9A 5CHJA 2XQZA 3M2JA 4PAUA 4I3AA 1U60A 2WKIA 3NOTC 1KGFA 1KE4A 2VZWA 5KMWA 2W27A 4B4XA 5AVEA 3DAVA 4Y0UA 4WZ5C 4KG6A 1NZUA 1P9RA 4KZ7A 3IF5A 2OLVA 4GD6A 3D72A 5JYOA 3IHAA 3OOVA 1NWZA 1V9ZA 4E3KA 1SDEA 1ONGA 3NOUC 4OOYA 4L9FA 2ZC5B 4OPZA 1K56D 4HBTA 5L8MA 3VOLA 1XGJA 4JXSA 4X1MA 4D60A 2VJWA 1P0ZA 2ZC6B 3TJZC 1JWVA 3NC8A 2A2LA 3BEBA 3C4PA 1FQGA 1EI5A 4OQHA 4C75A 1ONHA 3B3XA 2PDRA 2QJ7A 5A92A 5FAOA 2X71A 3BWLA 1YT4A 4WUJA 3MQQA 3VP4A 4GDBA 4Y17A 4EBLA 2OAP1 1JTDA 3QNCA 4GNUA 2ZQDA 1V9YA 4RA7A 1OPXA 3T4JA 3GECA 2MJ6A 4DDYA 2Y79A 4EV4A 5F83A 2XSSA 3NY4A 1JTGA 1NJ4A 3A3EA 3LI9A 4FTXA 5BOHA 2P9VA 3F1NA 1GSWA 1IFQA 5EM0A 5HWTA 2HV1A 1M40A 3HL9A 4Q8IA 4HQAA 4M4XA 3P98A 4L9GA 4FSFA 4RX3A 3KYEA 5GHXA 4GOGA 4Y5FA 4WZ5A 2ZLYA 4BMWA 2QWSA 1IEMA 3BFCA 3UDFA 3KX0X 1X0OA 3NI9A 3ZG7B 3NDEA 4IVKA 3ITBA 3CPTB 2FZ0A 4P6BA 3EWKA 5F6AA 4EUZA 3SH8A 1I2SA 1K57A 2VA0A 4EBNA 3E2KA 2VK3A 3F1OA 2A3UA 4XXRA 1MBLA 2OAQ1 5MC7A 1K0KA 5FAQA 1ES2A 1K54C 5EUAA 5G4YA 4KZ8A 3BFGA 2I72A 1KOUA 4OLGA 1MKIA 2LB5A 2H10A 3Q7ZA 1MXOA 3PBOA 5HD3A 4Y0TA 1MWSA 2H5SA 4WLAA 5TBMB 3JYIA 3UMEA 2J3TD 2KLIA 4MBHA 2O99A 2GZAA 3UO9A 2HJ9C 4I38A 1PRQA 4N9KA 1PW1A 4XT2B 1XKZA 5DVAA 3IXGA 3BY9A 5CHMA 3SH9A 2XD1A 4OQIA 1RCJA 3HLEA 3HUMA 2ZM8A 4H6JA 3ZYTA 1PI5A 4GCZA 4UHUA 1IKGA 3LR3A 3IBRA 4QPRA 2IWCA 4KQRA 3Q82A 2JE5A 3GSGA 3AGEA 2G2WA 4HBUA 4E3NA 3DW0A 2V8CA 3RXWA 1KGGA 2ZL1A 4KQQA 4GHIA 2JBFA 2M1CA 1I2WA 4XUZA 1VETA 2EFUA 1XJ4A 2L0WA 2W3HA 5F69A 4KENB 1N9LA 5DTSA 5EVEA 1LSVA 4Y3IA 1XFQA 3EOIA 4Q0IA 1PYYA 2XF3A 5FI2A 2ZM2A 4R70A 5TR7A 1K4EA 4Y7PA 1K54A 3FG8A 2XROA 3SZTA 2PU2A 3C4OA 2GDNA 3CAXA 1W8YA 3TSGA 3WRTA 4S2JA 4OQ0A 1K6SA 3E2LA 4AFIA 5FASA 4NK3A 3IS2A 1C3BA 4KZ6A 1ES4A 5M1AA 5FSRA 4O8GA 1KVLA 4ZAMA 1YLZA 4QJGA 1PZPA 4Y2FA 2XFSA 1K4FA 1E3UA 2OV5A 4JLFA 1NYMA 3WS4A 3MJQA 3MSHA 3N6IA 3WS2A 4CPKA 1W79A 3HLWA 1WYCA 3V3SA 3T1RA 5FATA 1OTBA 2W1RA 3PTEA 1DRMA 4BENA 1G68A 3UB9A 3C7VA 3F1PB 1XGIA 4EUVA 1TS8A 1J9MA 3KSFA 5KZHA 4O01A 3HVFA 2IA2A 1YMSA 2C5WB 4F3LA 1D06A 5DF9A 4K08A 5F82A 3A3DA 4LRYC 4WMCA 4PM5A 2A24B 2EXAA 4KUOA 4P6ZM 2O0YA 4R3BA 5F1FA 3KSIA 4R3AA 3LR5A 1FCMA 2J9OA 4ZDXA 4GB7A 1N9NA 3QP8A 3MQOA 1LSXA 3C30A 1E25A 1SHVA 4CLCD 4LRZE 3W4QA 1CQAA 4R1GA 4QD4A 3I7JA 4E3IA 3T4TA 3UB5P 3ZCZA 5GLCA 1XJ2A 4G3WA 1S6RA 3GTCA 2EA9A 1Y4OA 3GDIA 3VV4A 4X55A 2WKHA 4HEFA 3ISGA 3V67A 2EWWA 4JF5A 3O86A 2XEPA 3NULA 5HPIA 2EX6A 4OLDA 5HL6A 5M19A 2HDQA 2DRWA 4HIAA 2INWA 1K25A 3IF6C 4MNRA 4NXGA 2W3EA 2JCHA 1I5QA 2ZM0A 2Q9NA 2PHYA 2PYRA 2VGLM 4LGWA 3IXDA 5F1GA 4BD1A 3MXSA 1DP6A 2K31A 2WAFA 5CEDA 3VSKA 1LSWA 1P97A 2PRFA 4LV2A 3PYPA 4IBRA 3BM6A 4JXVA 4MEZA 3IXBA 1RGZA 5TJJA 3T1XA 3VP3A 3QHYA 3PBNA 4DRTA 1OJ5A 3MMHA 5FDHA 3G32A 3OZHA 1H8ZA 4JKTA 3N8RA 2HPBA 2I9VA 1T1BA 2WGVA 4MCWA 4GN2A 4O7DA 1WE4A 2R9XA 1YLYA 3OPHA 1L0FA 4UQIM 4HNBA 1LI0A 4DDSA 4GLQA 4E3OA 3AGFA 3N7WA 2ZMVA 1S1ZA 3VSLA 4R0QA 4IEDA 4CLCB 3NIAA 4KUKA 2JKRI 3HLBA 3FPVA 2W3FA 2G7UA 4LRXC 3LEZA 4NXBA 3N4IA 1OT6A 2Q0OA 2DMWA 5E2GA 4MDZA 4NXEA 4OOMA 2GNXA 4BL3A 1SDNA 1XA1A 2V0UA 3T4OA 2PD8A 5DTKA 4EW7A 3BYDA 3VP0A 3QNBA 4FH4A 4E04A 3MBZA 2XR0A 3TE8A 4NKPA 4JXGA 1IYOA 1S1YA 1YM1A 1NY0A 3VP2A 4PKYA 4BJPA 3Q07A 4PHTA 1PI4A 3CPTA 3KYQA 3LR0A 4MBFA 5CGSA 4YNRA 5HD5A 4X25A 3BLMA 5EVLA 4KZ5A 1F98A 5IHVA 1WYBA 3GV9A 3BLSA 3WS0A 2OWJA 4R38A 1PWGA 3BRMA 3G2YA 1LLBA 5EFWA 2QPNA 1YLPA 5A8BA 4Z9QA 2HDRA 1MKMA 5F68A 1SCWA 3E4QA 3UE0A 1Q2QA 1W5DA 2J3TC 4LENA 5TBMA 2Y2OA 1NRFA 5KIZA 3QP6A 4HJ4A 5C5KA 1G6OA 3OCLA 4F94A 1GA9A 3VE3A 4XT2A 5GLDA 2Y2HA 3LY4A 1W63Q 1P9WA 4WEKA 2P7JA 1FR1A 5FQKA 3G30A 1K57C 1XXMA 1NRJA 3HJIA 1IKIA 5KSHA 4YINA 3ZG0A 5TFQA 4JBFA 4WELA 3BQAA 4B9OA 5FQJA 1OTEA 4IBXA 1L0GA 1BT5A 3H9WA 1S4SA 1FCNA 2OOLA 3LY3A 4JF4A 2JC7A 1OJGA 1CJFA 1MPLA 2WZZA 1DJAA 2Y8HA 4QY5A 3H7WB 4BQMA 3ZFZA 3NHQA 1ODVA 1YAXA 2LB9A 2P04A 4GS9B 1HZOA 3HCYA 2M7VA 3P7NA 4Q0JA 4H8RA 1TF1A 1G5UA 2JKTM 2WUQA 3G2ZA 2R78A 3DBAA 3LIAA 2WK0A 3TOIA 3K3CA 3T4QA 3E98A 2Y2LA 2W0NA 2QZ6A 3NJAA 3UB6A 3PBQA 2PT7A 3BQ8A 3EGXC 2Q9MA 2Y2IA 5EVIB 4I5SA 3BJNA 5EOEA 1VEUB 3MF0A 5A91A 1NZOA 1HVBA 1F2KA 3MFXA 1FSWA 1UGUA 4PM7A 2D01A 1L2SA 2VGKA 1DY6A 2J8YA 3ZG5A 3ICYA 2VX8A 2A49A 1AXBA 4HY8A 4Z1WA 1KGEA 3LO7A 3UDXA 3IBJA 2Y91A 1CEFA 3LICA 5HARA 4EERA 4CLCE 3M2KA 3F1PA 4FCFA 3MZEA 5FDSA 5EECA 3PBSA 5FQIA 3BFEA 4MN7A 3NOPC 4MMNA 4DXBA 1BULA 2G2UA 3S7PA 1ESUA 4FD8A 4WBGA 3IXHA 4ARZB 2ZC3B 2A24A 1Y28A 4S2NA 2WGWB 1ACFA 4OVDA 5DFXA 5FA7A 2WADA 4CLCC 4BL2A 3SS5A 3UDIA 3FWLA 4ZBEA 5HL1A 4P87A 4YOFA 1K38A 1KVMA 1GSVA 1QMEA 1F9IA 1OTAA 3W4OA 1S0WA 4E6WA 5HW3A 1RP5A 1CEGA 3IQAA 2L1MA 2Y2QA 5TGFA 3PBRA 3LI8A 1J3WA 3UB8A 3FPWA 1S67L 2GJ3A 1EW0A 1GHPA 5CERA 4QU3A 4OQGA 1BLHA 3HUNA 4S2KA 3TW8A 1GCEA 1K55C 1OTDA 3UPOA 3EQUA 3DTEA 5FQQA 1FOFA 5J8XA 2R9WA 1K6RA 3OC2A 3VP1A 1ZKJA 4WZ4A 3VMAA 3C7UA 2ZQAA 4I3JA 2PU4A 1OMEA 2KDKA 4LCMA 4JGPA 3V3RA 4GW9A 4Y0OA 3LEQA 5EOOA 1A0KA 4XUXA 2JHEA 4E6XA 2ZQ8A 3BFFA 1KE0A 4JPMA 3EEAA 1N9OA 4B88A 1ZHHB 3S1YA 3VE4A 4DE2A 2VEAA 1SKFA 4Y13A 3LR4A 1RGYA 5EPHA 5LBRA 3MKFA 3Q7VB 2ZQ9A 5G4ZA 2ACGA 1DJBA 1PW8A 1Y54A 4P85A 5I94A 3R7WB 4CLCA 4IHQA 1L3LA 4ID4A 4PMAA 4UA7A 2B02A 2PYPA 2JN7A 2V1ZA 4DXCA 5M18A 4P6ZS 3JVVA 2Z2MB 1CF0A 1IYSA 5HDDA 2O9BA 1YLTA 2PR6A 2UV0E 4X53A 4WL9A 5GHZA 1XJ3A 2XA7S 3DTIA 4OP8A 3QP4A 4G3VA 3C38A 3C8CA 3UY6A 3CI6A 3QP1A 4UEYA 2WKPA 1K55A 3LUQA 1XA7A 4KZBA 3O3VA 2DCFA 2M7UA 1LL8A 4KQOA 4EU0A 5F5YA 4KG5A 1T19A 3L7HA 4JGOA 3CMZA 3NCKA 1EWZA 5I5LA 4R4RA 3SOIA 3MZDA 4A5RA 3H82B 3HLDA 3FKVA 3M6HA 4OH0A 3RJUA 4EWFA 2NUTC 2Y4AA 4I39A 1ZG6A 2J3WA 4LCLA 1L0EA 4Y15A 3EGDC 4ZJ2A 4RVAA 5L10A 1MWTA 4S2MA 3VOYA 4Q0HA 4HI4A 4BWIA 4DKIA 2HGVA 4RQ9A 1F5MA 3IX3A 2B5RA 1DP8A 3BECA 1VHMA 3HREA 1HLUP 1VB6A 2W3GA 3LIFA 3WS5A 4HP9A 1HTZA 1T18A 3RXXA 5E43A 2Z6DA 2IWDA 5CGWA 3V39A 2HDUA 4PPRA 3PR6A 2Y55A 3CUEC 3FYZA 5AVFA 1YQSA 1YPRA 3ZG9B 1BLCA 2JKGA 2J80A 3W2ZA 1JWPA 3LIDA 4WN5A 2H28A 3H7WA 1H0MA 4JXWA 4E3LA 1JNUA 4GS9A 3V50A 5GL9A 2IWBA 3D9YA 2ZBBA 2Y2PA 4BBTA 5HPFA 1IOUA 4MLLA 4LPZA 1ERQA 4RYEA 1W8QA 3GQZA 3S7NA 3LCEA 2HDSA 5K5BA 5AJGA 3KYZA 2EX9A 2WKEA 1D7EA 5E2EA 3WS1A 4C6YA 5EVIA 2QKPA 4N1XA 3UE3A 1VEUA 5FAPA 2B95A 4II7A 3UPNA 1O7EA 4R6LA 2VV8A 4X56A 5CEBA 2W1TB 2ZOIA 5DFYA 4EQ1A 4OP5A 1PZOA 2PBYA 3IX4A 1E4DA 2VLGA 3PAEA 5HDCA 2HJEA 5FQMA 3C2WA 5IS1A 3G34A 3D4FA 4DF6A 2Z6CA 2PBDP 1SKOB 5FL3A 1BLPA 4HHDA 4DJ2A 3EQVA 4ETXA 5DTTA 2J7VA 4DE1A 2H0YA 4G3KA 2X01A 3MS6A 3SS4A 3W4PA 3FZCA 4NG2A 4FUWA 1ZG4A 1ESIA 3CUEA 3U2AA 4ZRRA 4D2OA 4ARZA 1XJ6A 3MXQA 2OWHA 3T4KA 4HH3A 4UA6A 3O5YA 3DTMA 1FILA 2WGWA 4ZJ1A 4LFUA 2VV6A 3PBTA 5D3OA 5HZHA 2XH9A 4DE0A 5AQAA 3IWQA 4E3MA 2JKTI 2EX2A 4QWOA 5EVID 3L9KA 3CHWP 1QMFA 1L0DA 2FFYA 5G18A 4X69A 2V1AA 2P08A 1Z6FA 3T4SA 3DWZA 3QP5A 4RX2A 2BASA 2B18A 4OPYA 3S7OA 1TS7A 2K7SA 3U4LP 4JF6A 1NLYA 4BLMA 2BG1A 2KX6A 5JYPA 3E4OA 3ZNYA 1H8MA 3HBRA 2WGIA 2VGJA 4GKUA 1H3QA 3QP2A 4FH2A 3MFDA 3TG9A 4N92A 1ERMA 1GA0A 5CECA 3G4PA 1BLSA 2YKFA 4K0XA 3N8LA 2Y2NA 2H0TA 4S2NC 3SH7A 1ZC2A 3NBLA 2QHKA 3IH9A 3VFFA 3MQ0A 2ZMFA 3ZQ5A 4M3KA 2XD5A 1TDLA 1YSQA 2O9CA 2O9AA 3OLOA 3RH8B 2Y59A 3CLOA 3K3DA 2E8JA 5EV0A 4KG2A 3UB7A 1YSPA 1Z09A 1N9BA 2PAVP 2P74A 3Q7VA 4IUHA 1TS0A 3ZGAB 3BY8A 5CX7A 2V2FF 3IX8A 4GDNA 2EXBA 4U3TA 1TS6A 3R7WA 1MY8A 3O87A 1W63M 3GMWA 4YFMA 4YWZA 3B33A 2EFXA 2PD7A 4KZ3A 1SZVA 2FH5A 4JGRA 3R4KA 4QY6A 2GX5A 1JWZA 2J9PA 5L09A 5HFOA 1DJCA 4LLOB 3VFHA 2XGNA 2FFFB 2DNSA 4U0XA 1KDSA 3A0SA 3ZNTA 2EWVA 1DP9A 4S2LA 4DE3A 4DMZA 1WA9A 3IF6B 2Y2MA 4FOFA 1T1AA 1LT0A 1YKDA 3T4LA 2UWXA 3VOZA 3ZG8B 3LYXA 5DJTA 4WYYA 4ME4A 1NYYA 2QMIA 3BW6A 4EEPA 5AQ7A 4HP4A 4X6TA 4EBPA 5L2FA 4OPQA 1LHYA 4LV1A 5EM1A 3IWIA 3H82A 3OCNA 1PNEA 4U0TA 1S4RA 5IU1A 2CMNA 2BLSA 4QHCA 5HWWA 5FI7A 3OBFA 1XX2A 3JVUA 3V5MA 2HZ5A 5IT5A 3HLFA 3EEHA 1STZA 3HUOA 4P0MA 1MZUA 3G35A 3W8KA 1CK3A 3WRZA 5FEFA 1OTIA 3S4XA 4R23A 3GVBA 5L07A 2QYBA 1ES5A 3MKEA 5GLAA 1VQQA 3T50A 4O0PA 1H5XA 1YLJA 3PHYA 5KSCA 2K2NA 3A3JA 4CQHA 4K0WA 3CJMA 5FEGA 1XP4A 3ZVTA 4UA9A 2V8FA 3O88A 3C5AA 1G6AA 1BSGA 1TEMA 2EX8A 2ZQ7A 2Y2KA 4LV0A 2OSUA 3DTKA 1AWIA 1XFNA 1Q2PA 1PWCA 2BTFP 3MXRA 1PFLA 3LIBA 4S2PA 2Y2JA 4L9EA 4OOLA 3P01A 1UWNX 3P09A 4GD8A 5HAPA 5U47A 1IELA 5CHUA 3D3OA 4PM8A 4UAAA 5HAIA 3ZVWA 3RFBA 3RTYA 5DF7A 1PIOA 3LGOA 1IYQA 4MBKA 1VM1A 2XFTA 4L0LA 2P9VB 4HJ3A 3F1NB 4R3JA 4IUKA 2KOIA 4EEUA 2OLUA 1JVJA 1ALQA 1LL9A 1T1CA 4K91A 3E0YA 4IJGA 4ZJ3A 2WAEA 3SS3A 2NUPC 1LI9A 1FSYA 1W7FA 4GJ4A 4HJ6A 3UE1A 1XPBA 1HD8A 2W1TA 5J7EA 3IH8A 2ZD8A
chains in the Genus database with same CATH topology
2LB5A 1NRJA 3HJIA 5KSHA 4WELA 3BQAA 4B9OA 5HDSA 2ZBBA 3PBOA 5HD3A 1OTEA 4BBTA 2PR5A 5HPFA 1IOUA 3A0RA 4WLAA 5TBMB 3H9WA 1S4SA 4LPZA 3UMEA 2OOLA 2J3TD 3S7NA 4WEJA 3F1OB 1OJGA 3UE6A 2KLIA 3A0VA 5K5BA 2O99A 5AJGA 2GZAA 2HJ9C 4I38A 3KYZA 1D7EA 2Y8HA 4XT2B 2QKPA 3UE3A 3H7WB 2L4RA 3BY9A 4II7A 1UWPX 4R6LA 2VV8A 2WKQA 3NHQA 4H6JA 3PXPA 3ZYTA 2W1TB 2ZOIA 5DFYA 4EQ1A 1ODVA 1YAXA 2LB9A 2P04A 4GCZA 4GS9B 2M7VA 3HCYA 3P7NA 3LR3A 3B42A 3IBRA 2VGLS 4Q0JA 4QPRA 2VLGA 2YKHA 5HDCA 1TF1A 2HJEA 2VV7A 3SW1A 3C2WA 2JKTM 5IS1A 2R78A 3DBAA 3LIAA 4NXFA 3K3CA 2V1BA 3E98A 3T4QA 2W0NA 2Z6CA 2V0WA 5FL3A 4B93A 3NJAA 4HHDA 3UB6A 3LFVA 3PBQA 2PT7A 4GHIA 3BQ8A 3EGXC 4DJ2A 3EQVA 4DN0A 4ETXA 2M1CA 2XA7M 1XJ4A 2L0WA 2W3HA 4G3KA 5DJUA 4I5SA 3BJNA 5F69A 1N9LA 3MF0A 4H6JB 3MFXA 1LSVA 3CUEA 4Y3IA 1XFQA 3EOIA 1UGUA 4Q0IA 4UQIS 2D01A 3U2AA 4R70A 4ZRRA 3ICYA 2VX8A 3KO6A 4ARZA 1XJ6A 3MXQA 3FG8A 2OWHA 3T4KA 4HH3A 4HY8A 3O5YA 4Z1WA 4EESA 2XRNA 3IBJA 2XROA 3FC7A 3ULFA 2VV6A 3PBTA 5HZHA 3LICA 3CAXA 4EERA 4CLCE 3HJKA 2JKTI 4GHIB 3F1PA 4AFIA 3LIEA 2V1AA 3IS2A 3PBSA 2P08A 3T4SA 2WKRA 1MC0A 4O8GA 1ZTUA 1GSXA 2BASA 4MN7A 2B18A 3NOPC 4MMNA 4DJ3A 3MR0A 3S7PA 3S7OA 4Y2FA 3CITA 1TS7A 2K7SA 5HSQA 3G6OA 3MJQA 1NLYA 4ARZB 2A24A 5HWVA 1OT9A 1Y28A 4PKYG 2KX6A 2V9AA 3E4OA 1H8MA 5DFXA 1H3QA 4CLCC 1OTBA 2W1RA 2QJ5A 1DRMA 5J4EA 3UB9A 3F1PB 4YOFA 2HF6A 4EUVA 2D02A 2W3DA 1GSVA 2ZOHA 4HOIA 3IS2B 1F9IA 1OTAA 1TS8A 1BYWA 2YKFA 3E4PA 3S7QA 3KSFA 4O01A 2IA2A 2QHKA 4MN6A 4F3LA 1D06A 2L1MA 5DF9A 3UMDA 3MQ0A 2ZMFA 4K08A 5J3WA 3ZQ5A 3PBRA 3LI8A 4LRYC 1NLZA 1YSQA 3UB8A 2A24B 2O9CA 2O9AA 3FPWA 1S67L 4KUOA 4P6ZM 2GJ3A 2O0YA 1EW0A 3CWFA 3KSIA 4R3AA 3LR5A 3OLOA 4I3IA 4EETB 3RH8B 3B47A 3TW8A 3CLOA 1N9NA 3MQOA 3K3DA 1OTDA 1LSXA 3EQUA 3UB7A 1YSPA 3C30A 4CLCD 1TD5A 4LRZE 4IUHA 1TS0A 4MN5A 4KQDA 3OC2A 3T4TA 4HH2A 4ETZA 3BY8A 5CX7A 1XJ2A 4EXOA 1S66L 4G3WA 4WF0A 1TS6A 3R7WA 2EA9A 4I3JA 4NEED 4F3LB 3GDIA 2KDKA 4BBUA 3VV4A 4JGPA 3K2NA 1W63M 4GW9A 4YWZA 3KSGA 3V67A 2EWWA 3B33A 2JHEA 2PD7A 5HPIA 5DKLA 3EEAA 3KSHA 5HL6A 4BBVA 1N9OA 2VKSA 1ZHHB 3VE4A 4HIAA 2FH5A 2INWA 4JGRA 3R4KA 2VEAA 2GX5A 3LR4A 5DKKA 4NXGA 4JGQA 2W3EA 4LLOB 5LBRA 3TRCA 3A0SA 2JKRM 1G28A 2PHYA 2PYRA 2EWVA 2VGLM 5G4ZA 1DP9A 4PAUA 4I3AA 4DMZA 1WA9A 3R7WB 4CLCA 4IHQA 1DP6A 2K31A 3NOTC 4FOFA 1T1AA 2VZWA 1LSWA 1P97A 1LT0A 1YKDA 2B02A 2PYPA 3T4LA 3PYPA 2JN7A 2W27A 5AVEA 5TJJA 4P6ZS 3LYXA 5DJTA 4ME4A 3PBNA 3BW6A 1OJ5A 4EEPA 1P9RA 3MMHA 4HP4A 3JVVA 3D72A 3OOVA 5HDDA 2I9VA 1NWZA 2O9BA 2PR6A 1V9ZA 3H82A 3OCNA 1T1BA 4MCWA 1S4RA 3NOUC 4WL9A 1XJ3A 2XA7S 5IU1A 2CMNA 4L9FA 4G3VA 4UQIM 3C38A 4HNBA 3C8CA 3CI6A 5L8MA 3VOLA 5HWWA 4GLQA 2VJWA 1S1ZA 2ZMVA 4UEYA 2WKPA 3OBFA 1P0ZA 4CLCB 3TJZC 3LUQA 3JVUA 4KUKA 2JKRI 3FPVA 2W3FA 2A2LA 2G7UA 4LRXC 5IT5A 2M7UA 3EEHA 4NXBA 1STZA 1MZUA 1OT6A 1LL8A 2DMWA 4KQOA 4EU0A 4MDZA 5F5YA 4NXEA 4OOMA 2PDRA 1OTIA 2GNXA 1T19A 4JGOA 2V0UA 2QJ7A 3T4OA 2PD8A 2QYBA 4EW7A 5I5LA 3BWLA 4WUJA 3T50A 3H82B 4O0PA 3MQQA 4E04A 3PHYA 2K2NA 3TE8A 4NKPA 2OAP1 2NUTC 4CQHA 1S1YA 1V9YA 4I39A 3T4JA 1OPXA 4PKYA 2J3WA 3GECA 4BJPA 2MJ6A 2Y79A 4PHTA 2XSSA 3EGDC 3KYQA 3LR0A 3LI9A 4YNRA 5HD5A 1F98A 3F1NA 1GSWA 4Q0HA 1IFQA 4HI4A 5HWTA 1XFNA 4BWIA 2OWJA 4R38A 2HGVA 2HV1A 4RQ9A 3LIBA 1F5MA 4L9EA 1DP8A 1VHMA 4HQAA 4M4XA 4OOLA 3P01A 4L9GA 1UWNX 4FSFA 5EFWA 1VB6A 2W3GA 3LIFA 5A8BA 4HP9A 3D3OA 4Y5FA 4BMWA 1T18A 2QWSA 1MKMA 2Z6DA 5F68A 3RFBA 3RTYA 3KX0X 1X0OA 3E4QA 2J3TC 2FZ0A 5TBMA 3EWKA 5F6AA 4L0LA 2VA0A 5KIZA 4HJ3A 3F1NB 3PR6A 4HJ4A 4IUKA 3CUEC 2KOIA 5C5KA 3F1OA 4EEUA 5AVFA 1G6OA 3OCLA 1T1CA 2OAQ1 3E0YA 4IJGA 5MC7A 3VE3A 2J80A 3W2ZA 4XT2A 5G4YA 3LIDA 4WN5A 2H28A 3H7WA 2NUPC 4GJ4A 4HJ6A 1W63Q 1P9WA 1KOUA 2W1TA 5J7EA 4WEKA 1JNUA 4GS9A 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJI A;  4B9O A;  5HDS A;  2ZBB A;  5HD3 A;  1OTE A;  4BBT A;  2PR5 A;  3A0R A;  4WLA A;  5TBM B;  3H9W A;  1S4S A;  4LPZ A;  3UME A;  2OOL A;  3F1O B;  1OJG A;  3UE6 A;  3A0V A;  4I38 A;  1D7E A;  4XT2 B;  2QKP A;  3H7W B;  2L4R A;  3BY9 A;  1UWP X;  4R6L A;  2VV8 A;  2WKQ A;  3NHQ A;  4H6J A;  4EQ1 A;  2ZOI A;  1ODV A;  4GS9 B;  4GCZ A;  3P7N A;  3IBR A;  2VLG A;  2YKH A;  5HDC A;  2VV7 A;  3SW1 A;  3C2W A;  5IS1 A;  2R78 A;  3LIA A;  4NXF A;  3K3C A;  2V1B A;  2W0N A;  2Z6C A;  2V0W A;  3NJA A;  4HHD A;  3UB6 A;  4GHI A;  4DJ2 A;  2M1C A;  1XJ4 A;  2L0W A;  5DJU A;  4I5S A;  5F69 A;  1N9L A;  4H6J B;  3MFX A;  1LSV A;  1XFQ A;  1UGU A;  2D01 A;  4R70 A;  3ICY A;  1XJ6 A;  3MXQ A;  3FG8 A;  2OWH A;  4HH3 A;  4HY8 A;  4EES A;  3FC7 A;  3ULF A;  2VV6 A;  5HZH A;  3LIC A;  3CAX A;  4EER A;  3HJK A;  4GHI B;  3F1P A;  3LIE A;  2V1A A;  3IS2 A;  2WKR A;  1GSX A;  2BAS A;  3NOP C;  4DJ3 A;  3MR0 A;  1TS7 A;  2K7S A;  5HSQ A;  3G6O A;  3MJQ A;  2A24 A;  5HWV A;  1OT9 A;  1Y28 A;  4PKY G;  2KX6 A;  2V9A A;  3E4O A;  1OTB A;  2QJ5 A;  1DRM A;  5J4E A;  3UB9 A;  3F1P B;  2D02 A;  1GSV A;  2ZOH A;  4HOI A;  3IS2 B;  1F9I A;  1OTA A;  1TS8 A;  1BYW A;  2YKF A;  3E4P A;  2QHK A;  4MN6 A;  4F3L A;  1D06 A;  2L1M A;  3UMD A;  4K08 A;  5J3W A;  3ZQ5 A;  3LI8 A;  4LRY C;  3UB8 A;  2A24 B;  1S67 L;  4KUO A;  2GJ3 A;  3CWF A;  1EW0 A;  4R3A A;  3OLO A;  4I3I A;  4EET B;  3RH8 B;  3CLO A;  1N9N A;  3MQO A;  3K3D A;  1OTD A;  1LSX A;  3UB7 A;  4LRZ E;  1TS0 A;  4MN5 A;  4KQD A;  4HH2 A;  3BY8 A;  1XJ2 A;  4EXO A;  1S66 L;  4WF0 A;  1TS6 A;  2EA9 A;  4I3J A;  4F3L B;  3GDI A;  2KDK A;  4BBU A;  4JGP A;  4GW9 A;  4YWZ A;  3B33 A;  2JHE A;  2PD7 A;  5DKL A;  4BBV A;  1N9O A;  3VE4 A;  4HIA A;  2INW A;  4JGR A;  2VEA A;  5DKK A;  4NXG A;  4JGQ A;  4LLO B;  3A0S A;  2PHY A;  1G28 A;  2PYR A;  5G4Z A;  1DP9 A;  4I3A A;  1WA9 A;  1DP6 A;  3NOT C;  1T1A A;  1LSW A;  1P97 A;  2B02 A;  1LT0 A;  2PYP A;  3PYP A;  2JN7 A;  2W27 A;  5AVE A;  3LYX A;  5DJT A;  4EEP A;  1OJ5 A;  4HP4 A;  3D72 A;  5HDD A;  2I9V A;  1NWZ A;  3H82 A;  2PR6 A;  1V9Z A;  1T1B A;  1S4R A;  3NOU C;  4WL9 A;  1XJ3 A;  5IU1 A;  2CMN A;  4L9F A;  4HNB A;  3C8C A;  5HWW A;  3VOL A;  1S1Z A;  2WKP A;  1P0Z A;  3LUQ A;  4KUK A;  4LRX C;  3EEH A;  4NXB A;  1MZU A;  1OT6 A;  1LL8 A;  5F5Y A;  4NXE A;  2PDR A;  1OTI A;  1T19 A;  4JGO A;  2V0U A;  2QJ7 A;  2PD8 A;  4EW7 A;  5I5L A;  3BWL A;  4WUJ A;  3T50 A;  3H82 B;  3MQQ A;  4E04 A;  3PHY A;  1S1Y A;  1V9Y A;  4I39 A;  4PKY A;  3GEC A;  3LI9 A;  5HD5 A;  1F98 A;  3F1N A;  1GSW A;  4HI4 A;  5HWT A;  1XFN A;  2OWJ A;  4R38 A;  2HV1 A;  4RQ9 A;  3LIB A;  4L9E A;  1DP8 A;  4HQA A;  4M4X A;  4L9G A;  5EFW A;  1UWN X;  1VB6 A;  3LIF A;  5A8B A;  4HP9 A;  1T18 A;  2QWS A;  2Z6D A;  5F68 A;  3RTY A;  3KX0 X;  1X0O A;  3E4Q A;  5TBM A;  3EWK A;  5F6A A;  5KIZ A;  4HJ3 A;  3F1N B;  4HJ4 A;  3F1O A;  4EEU A;  5AVF A;  1T1C A;  3VE3 A;  2J80 A;  4XT2 A;  5G4Y A;  3LID A;  4WN5 A;  2H28 A;  3H7W A;  4HJ6 A;  1KOU A;  5J7E A;  1JNU A;  4GS9 A;  2P7J A; 
#chains in the Genus database with same CATH topology
 1BUE A;  4R4S A;  3WWX A;  5HDS A;  5A93 A;  1YMX A;  2PR5 A;  3A0R A;  1FIK A;  5GLB A;  5CXW A;  1D1J A;  3T1S A;  1SKO A;  3A3F A;  4WEJ A;  2Y2G A;  2XDM A;  3F1O B;  2CC1 A;  3GR2 A;  3UE6 A;  3OPP A;  3A0V A;  4PM9 A;  3NEC A;  1N4O A;  4OON A;  3T1Q B;  1H8Y A;  4LV3 A;  2L4R A;  4NET A;  1UWP X;  2WKQ A;  4S2O A;  3PXP A;  1BTL A;  4IVI A;  5CTM A;  3B42 A;  4ESP A;  2VGL S;  4N9L A;  2WYX A;  3ZDJ A;  3S22 A;  2YKH A;  3Q81 A;  2VV7 A;  3SW1 A;  4C3Q A;  5HAQ A;  4NXF A;  3ITA A;  5AQB A;  5EVI C;  3UN7 A;  2V1B A;  2V0W A;  4B93 A;  4BD0 A;  2WZX A;  1TDG A;  3UNW A;  3LFV A;  3AGD A;  4DN0 A;  2V20 A;  2XA7 M;  2X02 A;  2XLN A;  2JKF A;  5DJU A;  1E3U D;  1FCO A;  1MWU A;  4H6J B;  4QB8 A;  4CJN A;  3FKW A;  1BZA A;  4UQI S;  1GHM A;  3KO6 A;  1MWR A;  4EES A;  5HX9 A;  2XRN A;  3FV7 A;  3FC7 A;  2Z2L B;  3ULF A;  3PAG A;  4X1L A;  3HJK A;  4B4Z A;  3GRJ A;  4GZB A;  2ZL1 B;  4GHI B;  1YLW A;  3IHB A;  3LIE A;  1VET B;  4WM9 A;  3UPP A;  3IWO A;  2WKR A;  5E2H A;  5FI6 A;  4E3J A;  1MC0 A;  1ZTU A;  4WMC D;  1GSX A;  4DJ3 A;  3MR0 A;  4PM6 A;  2ZC4 B;  3CIT A;  5HSQ A;  3G6O A;  5HWV A;  1OT9 A;  4PKY G;  1IYP A;  2V9A A;  4OKP A;  2ZC7 A;  2RL3 A;  4S2I A;  3N8S A;  4OPR A;  4KZ9 A;  5EE8 A;  1FR6 A;  4HES A;  3HLG A;  3OPL A;  2QJ5 A;  5J4E A;  2E8I A;  4KZA A;  2HF6 A;  2D02 A;  1O07 A;  3MZF A;  2W3D A;  2ZOH A;  4HOI A;  5CRF A;  3IS2 B;  1BYW A;  3ZHH A;  3E4P A;  3S7Q A;  5A90 A;  1M6K A;  3NDG A;  4MN6 A;  2HP9 A;  1ERO A;  3G31 A;  3UMD A;  5J3W A;  2C6W B;  1NLZ A;  3T12 B;  4EQI A;  2ZJ9 A;  3CWF A;  3HLC A;  3M6B A;  1LL5 A;  4I3I A;  1NXY A;  4EET B;  3B47 A;  3DWK A;  3JPU A;  5AQ9 A;  3Q1F A;  5CGX A;  2RCX A;  1TD5 A;  3BFD A;  1KDW A;  4MN5 A;  4KQD A;  4HH2 A;  4ETZ A;  3OPR A;  1GHI A;  4EXO A;  3IF6 A;  1S66 L;  4WF0 A;  1KE3 A;  1K56 A;  3IT9 A;  4NEE D;  4F3L B;  4BBU A;  3K2N A;  1CI9 A;  2ZMA A;  1TVF A;  2HP6 A;  3KSG A;  4ZTK A;  2HP5 A;  5GHY A;  2AVX A;  4N1H A;  5DKL A;  3KSH A;  4BBV A;  2VKS A;  2ZQC A;  3CZD A;  4KZ4 A;  1PWD A;  3CG5 A;  2XK1 A;  4X68 A;  3A3I A;  5CTN A;  5DKK A;  5E2F A;  1ES3 A;  5DF8 A;  4JGQ A;  1CI8 A;  3TRC A;  2JKR M;  1G28 A;  5FQ9 A;  5CHJ A;  2XQZ A;  3M2J A;  4PAU A;  4I3A A;  1U60 A;  2WKI A;  3NOT C;  1KGF A;  1KE4 A;  2VZW A;  5KMW A;  2W27 A;  4B4X A;  5AVE A;  3DAV A;  4Y0U A;  4WZ5 C;  4KG6 A;  1NZU A;  1P9R A;  4KZ7 A;  3IF5 A;  2OLV A;  4GD6 A;  3D72 A;  5JYO A;  3IHA A;  3OOV A;  1NWZ A;  1V9Z A;  4E3K A;  1SDE A;  1ONG A;  3NOU C;  4OOY A;  4L9F A;  2ZC5 B;  4OPZ A;  1K56 D;  4HBT A;  5L8M A;  3VOL A;  1XGJ A;  4JXS A;  4X1M A;  4D60 A;  2VJW A;  1P0Z A;  2ZC6 B;  3TJZ C;  1JWV A;  3NC8 A;  2A2L A;  3BEB A;  3C4P A;  1FQG A;  1EI5 A;  4OQH A;  4C75 A;  1ONH A;  3B3X A;  2PDR A;  2QJ7 A;  5A92 A;  5FAO A;  2X71 A;  3BWL A;  1YT4 A;  4WUJ A;  3MQQ A;  3VP4 A;  4GDB A;  4Y17 A;  4EBL A;  2OAP 1;  1JTD A;  3QNC A;  4GNU A;  2ZQD A;  1V9Y A;  4RA7 A;  1OPX A;  3T4J A;  3GEC A;  2MJ6 A;  4DDY A;  2Y79 A;  4EV4 A;  5F83 A;  2XSS A;  3NY4 A;  1JTG A;  1NJ4 A;  3A3E A;  3LI9 A;  4FTX A;  5BOH A;  2P9V A;  3F1N A;  1GSW A;  1IFQ A;  5EM0 A;  5HWT A;  2HV1 A;  1M40 A;  3HL9 A;  4Q8I A;  4HQA A;  4M4X A;  3P98 A;  4L9G A;  4FSF A;  4RX3 A;  3KYE A;  5GHX A;  4GOG A;  4Y5F A;  4WZ5 A;  2ZLY A;  4BMW A;  2QWS A;  1IEM A;  3BFC A;  3UDF A;  3KX0 X;  1X0O A;  3NI9 A;  3ZG7 B;  3NDE A;  4IVK A;  3ITB A;  3CPT B;  2FZ0 A;  4P6B A;  3EWK A;  5F6A A;  4EUZ A;  3SH8 A;  1I2S A;  1K57 A;  2VA0 A;  4EBN A;  3E2K A;  2VK3 A;  3F1O A;  2A3U A;  4XXR A;  1MBL A;  2OAQ 1;  5MC7 A;  1K0K A;  5FAQ A;  1ES2 A;  1K54 C;  5EUA A;  5G4Y A;  4KZ8 A;  3BFG A;  2I72 A;  1KOU A;  4OLG A;  1MKI A;  2LB5 A;  2H10 A;  3Q7Z A;  1MXO A;  3PBO A;  5HD3 A;  4Y0T A;  1MWS A;  2H5S A;  4WLA A;  5TBM B;  3JYI A;  3UME A;  2J3T D;  2KLI A;  4MBH A;  2O99 A;  2GZA A;  3UO9 A;  2HJ9 C;  4I38 A;  1PRQ A;  4N9K A;  1PW1 A;  4XT2 B;  1XKZ A;  5DVA A;  3IXG A;  3BY9 A;  5CHM A;  3SH9 A;  2XD1 A;  4OQI A;  1RCJ A;  3HLE A;  3HUM A;  2ZM8 A;  4H6J A;  3ZYT A;  1PI5 A;  4GCZ A;  4UHU A;  1IKG A;  3LR3 A;  3IBR A;  4QPR A;  2IWC A;  4KQR A;  3Q82 A;  2JE5 A;  3GSG A;  3AGE A;  2G2W A;  4HBU A;  4E3N A;  3DW0 A;  2V8C A;  3RXW A;  1KGG A;  2ZL1 A;  4KQQ A;  4GHI A;  2JBF A;  2M1C A;  1I2W A;  4XUZ A;  1VET A;  2EFU A;  1XJ4 A;  2L0W A;  2W3H A;  5F69 A;  4KEN B;  1N9L A;  5DTS A;  5EVE A;  1LSV A;  4Y3I A;  1XFQ A;  3EOI A;  4Q0I A;  1PYY A;  2XF3 A;  5FI2 A;  2ZM2 A;  4R70 A;  5TR7 A;  1K4E A;  4Y7P A;  1K54 A;  3FG8 A;  2XRO A;  3SZT A;  2PU2 A;  3C4O A;  2GDN A;  3CAX A;  1W8Y A;  3TSG A;  3WRT A;  4S2J A;  4OQ0 A;  1K6S A;  3E2L A;  4AFI A;  5FAS A;  4NK3 A;  3IS2 A;  1C3B A;  4KZ6 A;  1ES4 A;  5M1A A;  5FSR A;  4O8G A;  1KVL A;  4ZAM A;  1YLZ A;  4QJG A;  1PZP A;  4Y2F A;  2XFS A;  1K4F A;  1E3U A;  2OV5 A;  4JLF A;  1NYM A;  3WS4 A;  3MJQ A;  3MSH A;  3N6I A;  3WS2 A;  4CPK A;  1W79 A;  3HLW A;  1WYC A;  3V3S A;  3T1R A;  5FAT A;  1OTB A;  2W1R A;  3PTE A;  1DRM A;  4BEN A;  1G68 A;  3UB9 A;  3C7V A;  3F1P B;  1XGI A;  4EUV A;  1TS8 A;  1J9M A;  3KSF A;  5KZH A;  4O01 A;  3HVF A;  2IA2 A;  1YMS A;  2C5W B;  4F3L A;  1D06 A;  5DF9 A;  4K08 A;  5F82 A;  3A3D A;  4LRY C;  4WMC A;  4PM5 A;  2A24 B;  2EXA A;  4KUO A;  4P6Z M;  2O0Y A;  4R3B A;  5F1F A;  3KSI A;  4R3A A;  3LR5 A;  1FCM A;  2J9O A;  4ZDX A;  4GB7 A;  1N9N A;  3QP8 A;  3MQO A;  1LSX A;  3C30 A;  1E25 A;  1SHV A;  4CLC D;  4LRZ E;  3W4Q A;  1CQA A;  4R1G A;  4QD4 A;  3I7J A;  4E3I A;  3T4T A;  3UB5 P;  3ZCZ A;  5GLC A;  1XJ2 A;  4G3W A;  1S6R A;  3GTC A;  2EA9 A;  1Y4O A;  3GDI A;  3VV4 A;  4X55 A;  2WKH A;  4HEF A;  3ISG A;  3V67 A;  2EWW A;  4JF5 A;  3O86 A;  2XEP A;  3NUL A;  5HPI A;  2EX6 A;  4OLD A;  5HL6 A;  5M19 A;  2HDQ A;  2DRW A;  4HIA A;  2INW A;  1K25 A;  3IF6 C;  4MNR A;  4NXG A;  2W3E A;  2JCH A;  1I5Q A;  2ZM0 A;  2Q9N A;  2PHY A;  2PYR A;  2VGL M;  4LGW A;  3IXD A;  5F1G A;  4BD1 A;  3MXS A;  1DP6 A;  2K31 A;  2WAF A;  5CED A;  3VSK A;  1LSW A;  1P97 A;  2PRF A;  4LV2 A;  3PYP A;  4IBR A;  3BM6 A;  4JXV A;  4MEZ A;  3IXB A;  1RGZ A;  5TJJ A;  3T1X A;  3VP3 A;  3QHY A;  3PBN A;  4DRT A;  1OJ5 A;  3MMH A;  5FDH A;  3G32 A;  3OZH A;  1H8Z A;  4JKT A;  3N8R A;  2HPB A;  2I9V A;  1T1B A;  2WGV A;  4MCW A;  4GN2 A;  4O7D A;  1WE4 A;  2R9X A;  1YLY A;  3OPH A;  1L0F A;  4UQI M;  4HNB A;  1LI0 A;  4DDS A;  4GLQ A;  4E3O A;  3AGF A;  3N7W A;  2ZMV A;  1S1Z A;  3VSL A;  4R0Q A;  4IED A;  4CLC B;  3NIA A;  4KUK A;  2JKR I;  3HLB A;  3FPV A;  2W3F A;  2G7U A;  4LRX C;  3LEZ A;  4NXB A;  3N4I A;  1OT6 A;  2Q0O A;  2DMW A;  5E2G A;  4MDZ A;  4NXE A;  4OOM A;  2GNX A;  4BL3 A;  1SDN A;  1XA1 A;  2V0U A;  3T4O A;  2PD8 A;  5DTK A;  4EW7 A;  3BYD A;  3VP0 A;  3QNB A;  4FH4 A;  4E04 A;  3MBZ A;  2XR0 A;  3TE8 A;  4NKP A;  4JXG A;  1IYO A;  1S1Y A;  1YM1 A;  1NY0 A;  3VP2 A;  4PKY A;  4BJP A;  3Q07 A;  4PHT A;  1PI4 A;  3CPT A;  3KYQ A;  3LR0 A;  4MBF A;  5CGS A;  4YNR A;  5HD5 A;  4X25 A;  3BLM A;  5EVL A;  4KZ5 A;  1F98 A;  5IHV A;  1WYB A;  3GV9 A;  3BLS A;  3WS0 A;  2OWJ A;  4R38 A;  1PWG A;  3BRM A;  3G2Y A;  1LLB A;  5EFW A;  2QPN A;  1YLP A;  5A8B A;  4Z9Q A;  2HDR A;  1MKM A;  5F68 A;  1SCW A;  3E4Q A;  3UE0 A;  1Q2Q A;  1W5D A;  2J3T C;  4LEN A;  5TBM A;  2Y2O A;  1NRF A;  5KIZ A;  3QP6 A;  4HJ4 A;  5C5K A;  1G6O A;  3OCL A;  4F94 A;  1GA9 A;  3VE3 A;  4XT2 A;  5GLD A;  2Y2H A;  3LY4 A;  1W63 Q;  1P9W A;  4WEK A;  2P7J A;  1FR1 A;  5FQK A;  3G30 A;  1K57 C;  1XXM A;  1NRJ A;  3HJI A;  1IKI A;  5KSH A;  4YIN A;  3ZG0 A;  5TFQ A;  4JBF A;  4WEL A;  3BQA A;  4B9O A;  5FQJ A;  1OTE A;  4IBX A;  1L0G A;  1BT5 A;  3H9W A;  1S4S A;  1FCN A;  2OOL A;  3LY3 A;  4JF4 A;  2JC7 A;  1OJG A;  1CJF A;  1MPL A;  2WZZ A;  1DJA A;  2Y8H A;  4QY5 A;  3H7W B;  4BQM A;  3ZFZ A;  3NHQ A;  1ODV A;  1YAX A;  2LB9 A;  2P04 A;  4GS9 B;  1HZO A;  3HCY A;  2M7V A;  3P7N A;  4Q0J A;  4H8R A;  1TF1 A;  1G5U A;  2JKT M;  2WUQ A;  3G2Z A;  2R78 A;  3DBA A;  3LIA A;  2WK0 A;  3TOI A;  3K3C A;  3T4Q A;  3E98 A;  2Y2L A;  2W0N A;  2QZ6 A;  3NJA A;  3UB6 A;  3PBQ A;  2PT7 A;  3BQ8 A;  3EGX C;  2Q9M A;  2Y2I A;  5EVI B;  4I5S A;  3BJN A;  5EOE A;  1VEU B;  3MF0 A;  5A91 A;  1NZO A;  1HVB A;  1F2K A;  3MFX A;  1FSW A;  1UGU A;  4PM7 A;  2D01 A;  1L2S A;  2VGK A;  1DY6 A;  2J8Y A;  3ZG5 A;  3ICY A;  2VX8 A;  2A49 A;  1AXB A;  4HY8 A;  4Z1W A;  1KGE A;  3LO7 A;  3UDX A;  3IBJ A;  2Y91 A;  1CEF A;  3LIC A;  5HAR A;  4EER A;  4CLC E;  3M2K A;  3F1P A;  4FCF A;  3MZE A;  5FDS A;  5EEC A;  3PBS A;  5FQI A;  3BFE A;  4MN7 A;  3NOP C;  4MMN A;  4DXB A;  1BUL A;  2G2U A;  3S7P A;  1ESU A;  4FD8 A;  4WBG A;  3IXH A;  4ARZ B;  2ZC3 B;  2A24 A;  1Y28 A;  4S2N A;  2WGW B;  1ACF A;  4OVD A;  5DFX A;  5FA7 A;  2WAD A;  4CLC C;  4BL2 A;  3SS5 A;  3UDI A;  3FWL A;  4ZBE A;  5HL1 A;  4P87 A;  4YOF A;  1K38 A;  1KVM A;  1GSV A;  1QME A;  1F9I A;  1OTA A;  3W4O A;  1S0W A;  4E6W A;  5HW3 A;  1RP5 A;  1CEG A;  3IQA A;  2L1M A;  2Y2Q A;  5TGF A;  3PBR A;  3LI8 A;  1J3W A;  3UB8 A;  3FPW A;  1S67 L;  2GJ3 A;  1EW0 A;  1GHP A;  5CER A;  4QU3 A;  4OQG A;  1BLH A;  3HUN A;  4S2K A;  3TW8 A;  1GCE A;  1K55 C;  1OTD A;  3UPO A;  3EQU A;  3DTE A;  5FQQ A;  1FOF A;  5J8X A;  2R9W A;  1K6R A;  3OC2 A;  3VP1 A;  1ZKJ A;  4WZ4 A;  3VMA A;  3C7U A;  2ZQA A;  4I3J A;  2PU4 A;  1OME A;  2KDK A;  4LCM A;  4JGP A;  3V3R A;  4GW9 A;  4Y0O A;  3LEQ A;  5EOO A;  1A0K A;  4XUX A;  2JHE A;  4E6X A;  2ZQ8 A;  3BFF A;  1KE0 A;  4JPM A;  3EEA A;  1N9O A;  4B88 A;  1ZHH B;  3S1Y A;  3VE4 A;  4DE2 A;  2VEA A;  1SKF A;  4Y13 A;  3LR4 A;  1RGY A;  5EPH A;  5LBR A;  3MKF A;  3Q7V B;  2ZQ9 A;  5G4Z A;  2ACG A;  1DJB A;  1PW8 A;  1Y54 A;  4P85 A;  5I94 A;  3R7W B;  4CLC A;  4IHQ A;  1L3L A;  4ID4 A;  4PMA A;  4UA7 A;  2B02 A;  2PYP A;  2JN7 A;  2V1Z A;  4DXC A;  5M18 A;  4P6Z S;  3JVV A;  2Z2M B;  1CF0 A;  1IYS A;  5HDD A;  2O9B A;  1YLT A;  2PR6 A;  2UV0 E;  4X53 A;  4WL9 A;  5GHZ A;  1XJ3 A;  2XA7 S;  3DTI A;  4OP8 A;  3QP4 A;  4G3V A;  3C38 A;  3C8C A;  3UY6 A;  3CI6 A;  3QP1 A;  4UEY A;  2WKP A;  1K55 A;  3LUQ A;  1XA7 A;  4KZB A;  3O3V A;  2DCF A;  2M7U A;  1LL8 A;  4KQO A;  4EU0 A;  5F5Y A;  4KG5 A;  1T19 A;  3L7H A;  4JGO A;  3CMZ A;  3NCK A;  1EWZ A;  5I5L A;  4R4R A;  3SOI A;  3MZD A;  4A5R A;  3H82 B;  3HLD A;  3FKV A;  3M6H A;  4OH0 A;  3RJU A;  4EWF A;  2NUT C;  2Y4A A;  4I39 A;  1ZG6 A;  2J3W A;  4LCL A;  1L0E A;  4Y15 A;  3EGD C;  4ZJ2 A;  4RVA A;  5L10 A;  1MWT A;  4S2M A;  3VOY A;  4Q0H A;  4HI4 A;  4BWI A;  4DKI A;  2HGV A;  4RQ9 A;  1F5M A;  3IX3 A;  2B5R A;  1DP8 A;  3BEC A;  1VHM A;  3HRE A;  1HLU P;  1VB6 A;  2W3G A;  3LIF A;  3WS5 A;  4HP9 A;  1HTZ A;  1T18 A;  3RXX A;  5E43 A;  2Z6D A;  2IWD A;  5CGW A;  3V39 A;  2HDU A;  4PPR A;  3PR6 A;  2Y55 A;  3CUE C;  3FYZ A;  5AVF A;  1YQS A;  1YPR A;  3ZG9 B;  1BLC A;  2JKG A;  2J80 A;  3W2Z A;  1JWP A;  3LID A;  4WN5 A;  2H28 A;  3H7W A;  1H0M A;  4JXW A;  4E3L A;  1JNU A;  4GS9 A;  3V50 A;  5GL9 A;  2IWB A;  3D9Y A;  2ZBB A;  2Y2P A;  4BBT A;  5HPF A;  1IOU A;  4MLL A;  4LPZ A;  1ERQ A;  4RYE A;  1W8Q A;  3GQZ A;  3S7N A;  3LCE A;  2HDS A;  5K5B A;  5AJG A;  3KYZ A;  2EX9 A;  2WKE A;  1D7E A;  5E2E A;  3WS1 A;  4C6Y A;  5EVI A;  2QKP A;  4N1X A;  3UE3 A;  1VEU A;  5FAP A;  2B95 A;  4II7 A;  3UPN A;  1O7E A;  4R6L A;  2VV8 A;  4X56 A;  5CEB A;  2W1T B;  2ZOI A;  5DFY A;  4EQ1 A;  4OP5 A;  1PZO A;  2PBY A;  3IX4 A;  1E4D A;  2VLG A;  3PAE A;  5HDC A;  2HJE A;  5FQM A;  3C2W A;  5IS1 A;  3G34 A;  3D4F A;  4DF6 A;  2Z6C A;  2PBD P;  1SKO B;  5FL3 A;  1BLP A;  4HHD A;  4DJ2 A;  3EQV A;  4ETX A;  5DTT A;  2J7V A;  4DE1 A;  2H0Y A;  4G3K A;  2X01 A;  3MS6 A;  3SS4 A;  3W4P A;  3FZC A;  4NG2 A;  4FUW A;  1ZG4 A;  1ESI A;  3CUE A;  3U2A A;  4ZRR A;  4D2O A;  4ARZ A;  1XJ6 A;  3MXQ A;  2OWH A;  3T4K A;  4HH3 A;  4UA6 A;  3O5Y A;  3DTM A;  1FIL A;  2WGW A;  4ZJ1 A;  4LFU A;  2VV6 A;  3PBT A;  5D3O A;  5HZH A;  2XH9 A;  4DE0 A;  5AQA A;  3IWQ A;  4E3M A;  2JKT I;  2EX2 A;  4QWO A;  5EVI D;  3L9K A;  3CHW P;  1QMF A;  1L0D A;  2FFY A;  5G18 A;  4X69 A;  2V1A A;  2P08 A;  1Z6F A;  3T4S A;  3DWZ A;  3QP5 A;  4RX2 A;  2BAS A;  2B18 A;  4OPY A;  3S7O A;  1TS7 A;  2K7S A;  3U4L P;  4JF6 A;  1NLY A;  4BLM A;  2BG1 A;  2KX6 A;  5JYP A;  3E4O A;  3ZNY A;  1H8M A;  3HBR A;  2WGI A;  2VGJ A;  4GKU A;  1H3Q A;  3QP2 A;  4FH2 A;  3MFD A;  3TG9 A;  4N92 A;  1ERM A;  1GA0 A;  5CEC A;  3G4P A;  1BLS A;  2YKF A;  4K0X A;  3N8L A;  2Y2N A;  2H0T A;  4S2N C;  3SH7 A;  1ZC2 A;  3NBL A;  2QHK A;  3IH9 A;  3VFF A;  3MQ0 A;  2ZMF A;  3ZQ5 A;  4M3K A;  2XD5 A;  1TDL A;  1YSQ A;  2O9C A;  2O9A A;  3OLO A;  3RH8 B;  2Y59 A;  3CLO A;  3K3D A;  2E8J A;  5EV0 A;  4KG2 A;  3UB7 A;  1YSP A;  1Z09 A;  1N9B A;  2PAV P;  2P74 A;  3Q7V A;  4IUH A;  1TS0 A;  3ZGA B;  3BY8 A;  5CX7 A;  2V2F F;  3IX8 A;  4GDN A;  2EXB A;  4U3T A;  1TS6 A;  3R7W A;  1MY8 A;  3O87 A;  1W63 M;  3GMW A;  4YFM A;  4YWZ A;  3B33 A;  2EFX A;  2PD7 A;  4KZ3 A;  1SZV A;  2FH5 A;  4JGR A;  3R4K A;  4QY6 A;  2GX5 A;  1JWZ A;  2J9P A;  5L09 A;  5HFO A;  1DJC A;  4LLO B;  3VFH A;  2XGN A;  2FFF B;  2DNS A;  4U0X A;  1KDS A;  3A0S A;  3ZNT A;  2EWV A;  1DP9 A;  4S2L A;  4DE3 A;  4DMZ A;  1WA9 A;  3IF6 B;  2Y2M A;  4FOF A;  1T1A A;  1LT0 A;  1YKD A;  3T4L A;  2UWX A;  3VOZ A;  3ZG8 B;  3LYX A;  5DJT A;  4WYY A;  4ME4 A;  1NYY A;  2QMI A;  3BW6 A;  4EEP A;  5AQ7 A;  4HP4 A;  4X6T A;  4EBP A;  5L2F A;  4OPQ A;  1LHY A;  4LV1 A;  5EM1 A;  3IWI A;  3H82 A;  3OCN A;  1PNE A;  4U0T A;  1S4R A;  5IU1 A;  2CMN A;  2BLS A;  4QHC A;  5HWW A;  5FI7 A;  3OBF A;  1XX2 A;  3JVU A;  3V5M A;  2HZ5 A;  5IT5 A;  3HLF A;  3EEH A;  1STZ A;  3HUO A;  4P0M A;  1MZU A;  3G35 A;  3W8K A;  1CK3 A;  3WRZ A;  5FEF A;  1OTI A;  3S4X A;  4R23 A;  3GVB A;  5L07 A;  2QYB A;  1ES5 A;  3MKE A;  5GLA A;  1VQQ A;  3T50 A;  4O0P A;  1H5X A;  1YLJ A;  3PHY A;  5KSC A;  2K2N A;  3A3J A;  4CQH A;  4K0W A;  3CJM A;  5FEG A;  1XP4 A;  3ZVT A;  4UA9 A;  2V8F A;  3O88 A;  3C5A A;  1G6A A;  1BSG A;  1TEM A;  2EX8 A;  2ZQ7 A;  2Y2K A;  4LV0 A;  2OSU A;  3DTK A;  1AWI A;  1XFN A;  1Q2P A;  1PWC A;  2BTF P;  3MXR A;  1PFL A;  3LIB A;  4S2P A;  2Y2J A;  4L9E A;  4OOL A;  3P01 A;  1UWN X;  3P09 A;  4GD8 A;  5HAP A;  5U47 A;  1IEL A;  5CHU A;  3D3O A;  4PM8 A;  4UAA A;  5HAI A;  3ZVW A;  3RFB A;  3RTY A;  5DF7 A;  1PIO A;  3LGO A;  1IYQ A;  4MBK A;  1VM1 A;  2XFT A;  4L0L A;  2P9V B;  4HJ3 A;  3F1N B;  4R3J A;  4IUK A;  2KOI A;  4EEU A;  2OLU A;  1JVJ A;  1ALQ A;  1LL9 A;  1T1C A;  4K91 A;  3E0Y A;  4IJG A;  4ZJ3 A;  2WAE A;  3SS3 A;  2NUP C;  1LI9 A;  1FSY A;  1W7F A;  4GJ4 A;  4HJ6 A;  3UE1 A;  1XPB A;  1HD8 A;  2W1T A;  5J7E A;  3IH8 A;  2ZD8 A; 
#chains in the Genus database with same CATH homology
 2LB5 A;  1NRJ A;  3HJI A;  5KSH A;  4WEL A;  3BQA A;  4B9O A;  5HDS A;  2ZBB A;  3PBO A;  5HD3 A;  1OTE A;  4BBT A;  2PR5 A;  5HPF A;  1IOU A;  3A0R A;  4WLA A;  5TBM B;  3H9W A;  1S4S A;  4LPZ A;  3UME A;  2OOL A;  2J3T D;  3S7N A;  4WEJ A;  3F1O B;  1OJG A;  3UE6 A;  2KLI A;  3A0V A;  5K5B A;  2O99 A;  5AJG A;  2GZA A;  2HJ9 C;  4I38 A;  3KYZ A;  1D7E A;  2Y8H A;  4XT2 B;  2QKP A;  3UE3 A;  3H7W B;  2L4R A;  3BY9 A;  4II7 A;  1UWP X;  4R6L A;  2VV8 A;  2WKQ A;  3NHQ A;  4H6J A;  3PXP A;  3ZYT A;  2W1T B;  2ZOI A;  5DFY A;  4EQ1 A;  1ODV A;  1YAX A;  2LB9 A;  2P04 A;  4GCZ A;  4GS9 B;  2M7V A;  3HCY A;  3P7N A;  3LR3 A;  3B42 A;  3IBR A;  2VGL S;  4Q0J A;  4QPR A;  2VLG A;  2YKH A;  5HDC A;  1TF1 A;  2HJE A;  2VV7 A;  3SW1 A;  3C2W A;  2JKT M;  5IS1 A;  2R78 A;  3DBA A;  3LIA A;  4NXF A;  3K3C A;  2V1B A;  3E98 A;  3T4Q A;  2W0N A;  2Z6C A;  2V0W A;  5FL3 A;  4B93 A;  3NJA A;  4HHD A;  3UB6 A;  3LFV A;  3PBQ A;  2PT7 A;  4GHI A;  3BQ8 A;  3EGX C;  4DJ2 A;  3EQV A;  4DN0 A;  4ETX A;  2M1C A;  2XA7 M;  1XJ4 A;  2L0W A;  2W3H A;  4G3K A;  5DJU A;  4I5S A;  3BJN A;  5F69 A;  1N9L A;  3MF0 A;  4H6J B;  3MFX A;  1LSV A;  3CUE A;  4Y3I A;  1XFQ A;  3EOI A;  1UGU A;  4Q0I A;  4UQI S;  2D01 A;  3U2A A;  4R70 A;  4ZRR A;  3ICY A;  2VX8 A;  3KO6 A;  4ARZ A;  1XJ6 A;  3MXQ A;  3FG8 A;  2OWH A;  3T4K A;  4HH3 A;  4HY8 A;  3O5Y A;  4Z1W A;  4EES A;  2XRN A;  3IBJ A;  2XRO A;  3FC7 A;  3ULF A;  2VV6 A;  3PBT A;  5HZH A;  3LIC A;  3CAX A;  4EER A;  4CLC E;  3HJK A;  2JKT I;  4GHI B;  3F1P A;  4AFI A;  3LIE A;  2V1A A;  3IS2 A;  3PBS A;  2P08 A;  3T4S A;  2WKR A;  1MC0 A;  4O8G A;  1ZTU A;  1GSX A;  2BAS A;  4MN7 A;  2B18 A;  3NOP C;  4MMN A;  4DJ3 A;  3MR0 A;  3S7P A;  3S7O A;  4Y2F A;  3CIT A;  1TS7 A;  2K7S A;  5HSQ A;  3G6O A;  3MJQ A;  1NLY A;  4ARZ B;  2A24 A;  5HWV A;  1OT9 A;  1Y28 A;  4PKY G;  2KX6 A;  2V9A A;  3E4O A;  1H8M A;  5DFX A;  1H3Q A;  4CLC C;  1OTB A;  2W1R A;  2QJ5 A;  1DRM A;  5J4E A;  3UB9 A;  3F1P B;  4YOF A;  2HF6 A;  4EUV A;  2D02 A;  2W3D A;  1GSV A;  2ZOH A;  4HOI A;  3IS2 B;  1F9I A;  1OTA A;  1TS8 A;  1BYW A;  2YKF A;  3E4P A;  3S7Q A;  3KSF A;  4O01 A;  2IA2 A;  2QHK A;  4MN6 A;  4F3L A;  1D06 A;  2L1M A;  5DF9 A;  3UMD A;  3MQ0 A;  2ZMF A;  4K08 A;  5J3W A;  3ZQ5 A;  3PBR A;  3LI8 A;  4LRY C;  1NLZ A;  1YSQ A;  3UB8 A;  2A24 B;  2O9C A;  2O9A A;  3FPW A;  1S67 L;  4KUO A;  4P6Z M;  2GJ3 A;  2O0Y A;  1EW0 A;  3CWF A;  3KSI A;  4R3A A;  3LR5 A;  3OLO A;  4I3I A;  4EET B;  3RH8 B;  3B47 A;  3TW8 A;  3CLO A;  1N9N A;  3MQO A;  3K3D A;  1OTD A;  1LSX A;  3EQU A;  3UB7 A;  1YSP A;  3C30 A;  4CLC D;  1TD5 A;  4LRZ E;  4IUH A;  1TS0 A;  4MN5 A;  4KQD A;  3OC2 A;  3T4T A;  4HH2 A;  4ETZ A;  3BY8 A;  5CX7 A;  1XJ2 A;  4EXO A;  1S66 L;  4G3W A;  4WF0 A;  1TS6 A;  3R7W A;  2EA9 A;  4I3J A;  4NEE D;  4F3L B;  3GDI A;  2KDK A;  4BBU A;  3VV4 A;  4JGP A;  3K2N A;  1W63 M;  4GW9 A;  4YWZ A;  3KSG A;  3V67 A;  2EWW A;  3B33 A;  2JHE A;  2PD7 A;  5HPI A;  5DKL A;  3EEA A;  3KSH A;  5HL6 A;  4BBV A;  1N9O A;  2VKS A;  1ZHH B;  3VE4 A;  4HIA A;  2FH5 A;  2INW A;  4JGR A;  3R4K A;  2VEA A;  2GX5 A;  3LR4 A;  5DKK A;  4NXG A;  4JGQ A;  2W3E A;  4LLO B;  5LBR A;  3TRC A;  3A0S A;  2JKR M;  1G28 A;  2PHY A;  2PYR A;  2EWV A;  2VGL M;  5G4Z A;  1DP9 A;  4PAU A;  4I3A A;  4DMZ A;  1WA9 A;  3R7W B;  4CLC A;  4IHQ A;  1DP6 A;  2K31 A;  3NOT C;  4FOF A;  1T1A A;  2VZW A;  1LSW A;  1P97 A;  1LT0 A;  1YKD A;  2B02 A;  2PYP A;  3T4L A;  3PYP A;  2JN7 A;  2W27 A;  5AVE A;  5TJJ A;  4P6Z S;  3LYX A;  5DJT A;  4ME4 A;  3PBN A;  3BW6 A;  1OJ5 A;  4EEP A;  1P9R A;  3MMH A;  4HP4 A;  3JVV A;  3D72 A;  3OOV A;  5HDD A;  2I9V A;  1NWZ A;  2O9B A;  2PR6 A;  1V9Z A;  3H82 A;  3OCN A;  1T1B A;  4MCW A;  1S4R A;  3NOU C;  4WL9 A;  1XJ3 A;  2XA7 S;  5IU1 A;  2CMN A;  4L9F A;  4G3V A;  4UQI M;  3C38 A;  4HNB A;  3C8C A;  3CI6 A;  5L8M A;  3VOL A;  5HWW A;  4GLQ A;  2VJW A;  1S1Z A;  2ZMV A;  4UEY A;  2WKP A;  3OBF A;  1P0Z A;  4CLC B;  3TJZ C;  3LUQ A;  3JVU A;  4KUK A;  2JKR I;  3FPV A;  2W3F A;  2A2L A;  2G7U A;  4LRX C;  5IT5 A;  2M7U A;  3EEH A;  4NXB A;  1STZ A;  1MZU A;  1OT6 A;  1LL8 A;  2DMW A;  4KQO A;  4EU0 A;  4MDZ A;  5F5Y A;  4NXE A;  4OOM A;  2PDR A;  1OTI A;  2GNX A;  1T19 A;  4JGO A;  2V0U A;  2QJ7 A;  3T4O A;  2PD8 A;  2QYB A;  4EW7 A;  5I5L A;  3BWL A;  4WUJ A;  3T50 A;  3H82 B;  4O0P A;  3MQQ A;  4E04 A;  3PHY A;  2K2N A;  3TE8 A;  4NKP A;  2OAP 1;  2NUT C;  4CQH A;  1S1Y A;  1V9Y A;  4I39 A;  3T4J A;  1OPX A;  4PKY A;  2J3W A;  3GEC A;  4BJP A;  2MJ6 A;  2Y79 A;  4PHT A;  2XSS A;  3EGD C;  3KYQ A;  3LR0 A;  3LI9 A;  4YNR A;  5HD5 A;  1F98 A;  3F1N A;  1GSW A;  4Q0H A;  1IFQ A;  4HI4 A;  5HWT A;  1XFN A;  4BWI A;  2OWJ A;  4R38 A;  2HGV A;  2HV1 A;  4RQ9 A;  3LIB A;  1F5M A;  4L9E A;  1DP8 A;  1VHM A;  4HQA A;  4M4X A;  4OOL A;  3P01 A;  4L9G A;  1UWN X;  4FSF A;  5EFW A;  1VB6 A;  2W3G A;  3LIF A;  5A8B A;  4HP9 A;  3D3O A;  4Y5F A;  4BMW A;  1T18 A;  2QWS A;  1MKM A;  2Z6D A;  5F68 A;  3RFB A;  3RTY A;  3KX0 X;  1X0O A;  3E4Q A;  2J3T C;  2FZ0 A;  5TBM A;  3EWK A;  5F6A A;  4L0L A;  2VA0 A;  5KIZ A;  4HJ3 A;  3F1N B;  3PR6 A;  4HJ4 A;  4IUK A;  3CUE C;  2KOI A;  5C5K A;  3F1O A;  4EEU A;  5AVF A;  1G6O A;  3OCL A;  1T1C A;  2OAQ 1;  3E0Y A;  4IJG A;  5MC7 A;  3VE3 A;  2J80 A;  3W2Z A;  4XT2 A;  5G4Y A;  3LID A;  4WN5 A;  2H28 A;  3H7W A;  2NUP C;  4GJ4 A;  4HJ6 A;  1W63 Q;  1P9W A;  1KOU A;  2W1T A;  5J7E A;  4WEK A;  1JNU A;  4GS9 A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...