1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
3LI9A 1LSVA 1OTIA 2OOLA 2WKQA 4HJ3A 1XFNA 4R3AA 4B9OA 5AVEA 3UB9A 3VOLA 4EW7A 3GECA 1D06A 4JGPA 4KUOA 2PYRA 1MZUA 4XT2A 4LLOB 1X0OA 1OT6A 5F5YA 2L1MA 4R38A 1S66L 4BBTA 4GW9A 5F68A 5IU1A 2PR6A 3BY9A 3VE4A 5I5LA 2VV7A 3BY8A 1GSVA 5HWVA 1DP6A 3C2WA 4HJ4A 4E04A 1G28A 3PYPA 1OTAA 2WKPA 4EESA 1OTBA 4JGOA 4HP9A 2CMNA 3MFXA 4GHIB 5EFWA 2GJ3A 4KQDA 3IS2A 3P7NA 2PDRA 1S1YA 4I3AA 2ZBBA 2QJ7A 3E4QA 3MJQA 2K7SA 4GCZA 1OT9A 2WKRA 3EWKA 1LT0A 3OLOA 5DKLA 2D02A 3IBRA 3CWFA 3CLOA 2YKHA 3LIDA 1P0ZA 3E4OA 3T50A 1KOUA 3F1PB 3UB7A 4HH2A 3A0VA 3ULFA 2PD8A 4HH3A 3UB6A 1WA9A 1TS7A 3VE3A 2OWJA 3LICA 2EA9A 5HD3A 2QWSA 4HNBA 5G4ZA 2JHEA 1Y28A 1UWPX 3HJKA 2V9AA 5A8BA 4NXFA 2L0WA 3G6OA 4HHDA 2PR5A 1DRMA 2I9VA 4L9GA 2R78A 4LRXC 2QHKA 2P7JA 3KX0X 4LPZA 1LL8A 2A24B 2M1CA 2ZOHA 4HIAA 1TS0A 1TS6A 1NWZA 3F1PA 3LI8A 4BBVA 2BASA 5F6AA 2D01A 5HZHA 2QJ5A 1T19A 3IS2B 1GSWA 5IS1A 2OWHA 4EEUA 3NOUC 4K08A 4WLAA 1LSWA 2B02A 1T1AA 5HDDA 3H82A 4EERA 4I5SA 3F1OA 1OJGA 3MQOA 2Z6DA 2L4RA 3EEHA 2A24A 1GSXA 5G4YA 2KX6A 4PKYG 4F3LA 1V9YA 1F9IA 4R6LA 5AVFA 4YWZA 2PD7A 2V0WA 4MN6A 1TS8A 3LIBA 3MQQA 3NOTC 3UB8A 3LIFA 4I39A 3B33A 3GDIA 4WUJA 1XJ2A 4H6JA 3CAXA 1XJ3A 1N9OA 3FC7A 3HJIA 4LRYC 3F1NA 1S67L 1XJ4A 4L9FA 4HI4A 4EXOA 1N9NA 3ZQ5A 3UMEA 2H28A 5DKKA 1D7EA 4MN5A 1OJ5A 3PHYA 1XFQA 1N9LA 4DJ2A 2JN7A 4JGQA 4EEPA 4HY8A 1F98A 3A0SA 4L9EA 3ICYA 1LSXA 2Z6CA 1V9ZA 3UE6A 3H82B 3D72A 3F1OB 2VEAA 4I3IA 4WN5A 4EQ1A 2HV1A 1JNUA 2J80A 5TBMA 3RTYA 3NOPC 3LYXA 4F3LB 1BYWA 1DP8A 2PYPA 5J3WA 4EETB 4PKYA 1XJ6A 4NXEA 5J7EA 3K3DA 1T1CA 1OTEA 2YKFA 4HQAA 4BBUA 5KIZA 3RH8B 2V1BA 2ZOIA 5HDSA 4H6JB 3H9WA 4GS9A 4M4XA 3MXQA 3K3CA 1S4SA 3H7WA 2V1AA 1UGUA 4HP4A 1S1ZA 2VV6A 4LRZE 4R70A 2W0NA 1ODVA 3A0RA 4I38A 3F1NB 5F69A 4DJ3A 4WF0A 2INWA 3BWLA 3LUQA 3MR0A 3SW1A 3UMDA 4I3JA 1UWNX 4NXGA 1DP9A 1OTDA 5HWWA 5HD5A 1EW0A 2VV8A 1P97A 5TBMB 5J4EA 1T18A 4NXBA 4RQ9A 1VB6A 4HJ6A 4KUKA 3NJAA 2V0UA 3E4PA 5DJUA 2KDKA 5HDCA 5HSQA 1T1BA 2VLGA 3NHQA 3C8CA 3LIEA 2QKPA 4HOIA 4XT2B 4GHIA 1S4RA 2PHYA 4GS9B 2W27A 3H7WB 3LIAA 4JGRA 4WL9A 3FG8A 5DJTA 5HWTA
chains in the Genus database with same CATH superfamily
3BFFA 1L0GA 1CQAA 4EWFA 4Z1WA 4WM9A 1W8QA 4EV4A 1OTIA 2WKQA 2Q9MA 3PXPA 4R3AA 2Y2GA 1BZAA 4U0XA 5HAPA 2ZQ7A 3IHBA 1MWUA 3NY4A 4EW7A 4R4RA 5A90A 1D06A 4GB7A 3UN7A 1OMEA 2HDSA 4XT2A 2H10A 5D3OA 1OT6A 2C5WB 1W63M 2W3EA 4DE3A 2X02A 4GW9A 5F68A 1PWGA 3SS3A 1GHIA 2V8CA 4R1GA 3RFBA 3VE4A 5I5LA 5TGFA 2C6WB 1GSVA 1DP6A 3BYDA 3C2WA 4HJ4A 3S7PA 1KGFA 4E6XA 3MKFA 4B4XA 1NY0A 1G28A 5E43A 3IX3A 4X25A 3DTIA 3PBTA 1LLBA 4GJ4A 4AFIA 2FZ0A 1W5DA 1YSQA 3HLBA 3MF0A 4FH2A 2WZZA 4K91A 4GHIB 4HBUA 3AGDA 3IWIA 2ZQ9A 2WAFA 4ETZA 3VSKA 4I3AA 5LBRA 3QP2A 2K7SA 3FPWA 3WS5A 5FQ9A 2WKRA 3EWKA 1LT0A 3ITBA 1BT5A 2XDMA 3HVFA 4DN0A 2P9VA 2D02A 4KZ9A 4O01A 4LFUA 2W3FA 3PAGA 1W8YA 3LIDA 4II7A 1RGYA 4PM8A 2V1ZA 4HH2A 3LEQA 2A49A 1K25A 3S1YA 2HDRA 1Y4OA 5G4ZA 2OLUA 4ZAMA 1PZOA 2V9AA 5EVIC 4NXFA 4GDBA 2L0WA 3ITAA 2OAP1 5A91A 1ESUA 2E8JA 2PR5A 2O9BA 2I9VA 4L9GA 3W4OA 2R78A 5KSCA 5L07A 2M1CA 1ZG6A 1TS0A 1TS6A 2Q9NA 4NK3A 2Y2HA 3KYQA 2XF3A 4R4SA 3LI8A 1W63Q 2XLNA 4OPYA 4BBVA 5F6AA 1CI8A 5EOEA 3BRMA 3FPVA 4EQIA 3IS2B 1GSWA 1NRJA 4S2JA 3PBOA 4LCLA 3V5MA 3N6IA 4GD8A 2VX8A 2OAQ1 4WLAA 3U4LP 1LSWA 1T1AA 3KSIA 5HDDA 3LFVA 5CXWA 3HUOA 1YLZA 2BTFP 3R4KA 4KZ7A 4R0QA 4F3LA 2P08A 3VSLA 3LR5A 1F9IA 5JYPA 3RXWA 4WMCA 1FCOA 4OVDA 5AVFA 4YFMA 4LV3A 3HREA 4JF6A 4MN6A 1TS8A 3LIBA 3MQQA 2WKIA 3VV4A 1YKDA 1EWZA 2WGIA 1K0KA 4JBFA 4PAUA 3W8KA 3RJUA 5EUAA 3Q7VB 1GA9A 2W1TB 2K2NA 4WUJA 2MJ6A 3IBJA 4H6JA 2LB5A 3CAXA 2V20A 3MKEA 3D3OA 5HW3A 5EVIB 4RX3A 3V50A 4OKPA 4IUKA 4LRYC 3TE8A 3IXBA 1FCNA 4M3KA 4RA7A 3GMWA 1JTGA 2O9AA 3ZQ5A 2H28A 3B47A 1DJAA 3BQ8A 3IH9A 5FQKA 3WS0A 4BLMA 2ZQAA 4MN5A 1YLWA 5CHUA 3PR6A 3Q7VA 3S7OA 4L9EA 5L10A 1V9ZA 3T1SA 3UE6A 3H82B 3ZG9B 2JKRI 4GKUA 4HEFA 3NIAA 3ZVWA 1G6AA 2HP9A 4I3IA 4EQ1A 2HV1A 3VP1A 3KO6A 1BYWA 4Y15A 1SZVA 4GZBA 3C38A 3CG5A 1JWVA 2O9CA 4EETB 4WELA 1XGIA 3BQAA 5CERA 2HJ9C 4IBRA 4HQAA 4BBUA 3G30A 1BLPA 2HDQA 3HLDA 5K5BA 4G3KA 5KIZA 4NKPA 1K57A 2E8IA 2PBYA 2ZOIA 2H0TA 5GHXA 1SKFA 4M4XA 3T4QA 2R9XA 3MXQA 1S4SA 1G6OA 3UE0A 1SDNA 4GOGA 1K55A 4U0TA 1BLHA 4LRZE 2W3DA 3IXGA 4WEJA 2GX5A 4PM6A 3CHWP 2Y79A 2HDUA 4JLFA 3A0RA 4MBKA 3LR0A 4Y3IA 2Y91A 2INWA 3BWLA 4OQHA 4ZTKA 3MR0A 2XK1A 5CEBA 1JWZA 5GLAA 3BFCA 3MS6A 3SW1A 4I3JA 1I5QA 1LL9A 4UEYA 3A3EA 4P85A 1FR6A 5FEGA 3P09A 5HWWA 1TDGA 1IYSA 3V39A 1EW0A 2RCXA 2VGLS 2VV8A 5TBMB 1Q2PA 1T18A 1LI9A 3MFDA 4NXBA 4DE2A 1E3UA 4R3BA 2O0YA 1XA7A 3ZCZA 5E2HA 4OH0A 4P6ZM 1K56D 3LEZA 4PMAA 2UWXA 2Y4AA 4IVKA 4OPRA 4O0PA 2KDKA 4CQHA 5HDCA 4X68A 2GNXA 5HSQA 2ZC3B 5FAQA 2H5SA 2JCHA 1L0FA 1LL5A 2DCFA 4CLCA 1HZOA 4GS9B 3IF6B 2W27A 3LIAA 3BFEA 5FQQA 5CGXA 1PYYA 1ESIA 3LI9A 1LSVA 4S2NC 1CEFA 4G3VA 4Z9QA 4X1MA 2OOLA 4GN2A 1XFNA 1P9RA 2JE5A 1VEUB 1IEMA 4Y5FA 5DF8A 3HL9A 1NLZA 2EWVA 2VZWA 3VOLA 5HAQA 3GECA 4JGPA 3FWLA 1YLYA 2ZC5B 1X0OA 5CHMA 2L1MA 5EVEA 3I7JA 4RVAA 4OP5A 2PR6A 4MDZA 5DF9A 4Y0TA 5M19A 3MZDA 5HWVA 2VGLM 4JXGA 1TD5A 4UA9A 2OLVA 1WYBA 2ZMAA 2JC7A 1VEUA 1MWSA 3QNCA 2CC1A 4MN7A 4Y0OA 4BL2A 1YLJA 4EU0A 1OTBA 5DTTA 2CMNA 4UAAA 1NZOA 3MZEA 5EFWA 3FV7A 1MKMA 3P7NA 2PDRA 3E4QA 1YPRA 3LY3A 1FILA 3ZYTA 5KZHA 3UPNA 3ZVTA 1KE3A 1RCJA 4KZ5A 1XGJA 5HARA 1ES4A 5DKLA 3T4KA 2HF6A 3IXHA 3OZHA 3IBRA 4FH4A 3CWFA 3LO7A 3T50A 4ZJ1A 3F1PB 3UB7A 2PT7A 2ZQDA 4JXSA 3WRTA 3KSFA 4HH3A 3UB6A 1W7FA 1NYMA 1TS7A 4X56A 2OWJA 3LICA 2JKRM 3HUNA 1Q2QA 2O99A 3IX8A 4S2IA 2R9WA 1Z09A 4HHDA 2Y2PA 1KDSA 2RL3A 4LPZA 1LL8A 5I94A 2A24B 2ZOHA 2PU2A 2WAEA 3F1PA 3FZCA 3T12B 1QMEA 1SDEA 2D01A 3UB5P 1XPBA 5HZHA 5EOOA 1KVLA 4WZ4A 2NUTC 5IS1A 4S2OA 3CUEA 1O7EA 4EEUA 3ZGAB 2ZMFA 4PPRA 2WKHA 3P98A 2Z2LB 4PM9A 1F2KA 4RX2A 2XSSA 4I5SA 3KYZA 1OJGA 3C5AA 2P9VB 3UE3A 1BLSA 1KDWA 3SS4A 3NBLA 2A24A 4PKYG 1L0EA 3OPPA 4EBNA 3IHAA 3DAVA 3VP3A 2QZ6A 4PHTA 5HPFA 4QY6A 3NOTC 3OPHA 1FCMA 3QHYA 1PI5A 4KZ3A 4DDYA 3UE1A 4JF4A 3PBQA 1XX2A 2JBFA 2Y2NA 3KSGA 4P6BA 4LCMA 3TRCA 1MBLA 1XA1A 2AVXA 2Y2KA 1Y54A 4C6YA 3LCEA 1XJ3A 3SZTA 4UA7A 1PW1A 1P9WA 2VA0A 4OQ0A 2Y2MA 4JKTA 2XA7S 4S2KA 2ZC7A 3F1NA 4LV0A 2DRWA 3ISGA 1XJ4A 3DBAA 3S4XA 3ZHHA 4HI4A 3DTKA 1BSGA 2Z2MB 2EX6A 4HBTA 4WZ5C 5DKKA 2W3GA 1ACFA 3N8SA 1OJ5A 1DJCA 1S6RA 3PHYA 5DF7A 4XUZA 4DJ2A 1VHMA 2JKGA 4JGQA 4EEPA 1F98A 3A0SA 3M2JA 2HP6A 4ID4A 4N1HA 3L9KA 1NJ4A 5A92A 3Q7ZA 3A3IA 4F3LB 4MEZA 3IWQA 3CMZA 3KSHA 5A93A 2PYPA 1TEMA 3OPRA 3C7VA 3JVVA 4L0LA 3L7HA 4MBFA 5TFQA 4DE1A 1XJ6A 4Q0JA 3IX4A 4GD6A 2YKFA 2ZL1A 3BFDA 3G4PA 3RH8B 3DW0A 3GSGA 4DXBA 4H6JB 4IHQA 1JVJA 4QD4A 1PI4A 4E3JA 1S1ZA 4U3TA 4R70A 1M6KA 3QP8A 4I38A 3BFGA 4D2OA 4DDSA 1ZHHB 3E98A 4Y13A 5HX9A 3A3FA 2J3TC 4PM5A 2XA7M 5GL9A 4CLCE 3B42A 3HLWA 1YT4A 4OONA 3NULA 3C4OA 4GDNA 2K31A 1DY6A 5GLCA 4ARZA 4NXGA 1DP9A 5L09A 1MKIA 1TVFA 3VP0A 1J9MA 3LGOA 5HD5A 3FYZA 5GHYA 1ZKJA 5J4EA 5DVAA 2EFUA 3N8LA 1VB6A 1ES3A 1K6SA 4HJ6A 3BEBA 3NJAA 5CRFA 5IHVA 2V0UA 3E4PA 4WMCD 5DJUA 1BTLA 1FR1A 2Y2OA 3MXSA 2ZJ9A 1CF0A 2IWCA 4LENA 3NHQA 3C8CA 3IWOA 3W2ZA 4G3WA 1GHMA 5FQJA 3VFFA 1BLCA 5FAPA 2G7UA 3HLGA 2A2LA 1W79A 2Y2JA 3FKWA 4JGRA 4WL9A 1ALQA 1TDLA 4P6ZS 4WBGA 3QNBA 5HWTA 2LB9A 3OCLA 5F1GA 1I2SA 4NETA 1H0MA 3QP6A 2X71A 4KZ8A 1KGEA 4HJ3A 4YNRA 4MNRA 5AVEA 4FUWA 3UDIA 1PIOA 3TJZC 3BJNA 4BENA 3PBRA 4ETXA 4KUOA 3IF6C 4EUZA 3WS4A 1MZUA 1IKGA 3EGXC 4E3KA 5F5YA 1YAXA 1ONGA 5CECA 3G32A 3DWKA 5AQ7A 4BBTA 5EE8A 3UPOA 5IU1A 3SH8A 2EXBA 5EVID 3BY9A 3D4FA 1K54A 4N9KA 2J3WA 3BY8A 1LI0A 4WYYA 3A3JA 4E04A 2QYBA 5F83A 3R7WB 4X55A 3ZNYA 3T1RA 5EM1A 4O7DA 5JYOA 4EESA 2PBDP 4JGOA 3M6BA 3A3DA 4HP9A 5EPHA 2VJWA 4NG2A 3MFXA 3OCNA 4CLCB 2PU4A 4KQDA 4X53A 2GDNA 2ZBBA 3T4OA 2QJ7A 3CZDA 3MJQA 1IOUA 2PRFA 1VQQA 1OT9A 2EX9A 2EX2A 3S7NA 2IWBA 4Y0UA 1YLTA 2ZQ8A 4S2LA 3R7WA 2ZM2A 5FL3A 5F82A 1WE4A 4N92A 4B4ZA 5FAOA 3Q07A 1H5XA 4Q8IA 3E4OA 3VP4A 3A0VA 2XGNA 1NYYA 2HP5A 2PD8A 2VKSA 1KVMA 4OQIA 2EA9A 4Q0IA 3WS2A 3HBRA 3CITA 3B3XA 2QMIA 4HNBA 4JPMA 4QPRA 3N8RA 4BMWA 5CGSA 4DXCA 4H8RA 1UWPX 4C75A 3DTEA 1E3UD 4KQOA 1KE4A 4E3OA 1MPLA 3OPLA 2JKFA 2ZC4B 2QHKA 2WYXA 4KG6A 2P7JA 2WGWA 2ZLYA 2W3HA 3C7UA 4N9LA 4GLQA 1KE0A 3QP1A 2BASA 2BLSA 3SH9A 1CK3A 5CEDA 2V2FF 3CUEC 2OV5A 2QJ5A 1T19A 5EV0A 3BECA 4QY5A 4IEDA 2ZM0A 4BD0A 2OWHA 1YSPA 3T4SA 3NOUC 3TOIA 4KZ4A 5HL1A 2B02A 4B93A 3M2KA 5DTKA 3F1OA 5CX7A 3N7WA 4QWOA 3MQOA 2Z6DA 1JTDA 2L4RA 2XROA 2P74A 4QU3A 3EEHA 1SKOB 5G4YA 1V9YA 2XQZA 3IXDA 4JXWA 1EROA 3OC2A 3GVBA 4OP8A 2PD7A 1SHVA 3SOIA 2HPBA 3W4PA 4OPQA 3LIFA 1STZA 1H8ZA 4KZAA 2XD5A 3Q1FA 3O88A 2M7UA 2ZC6B 3GRJA 3VMAA 3UDFA 1N9OA 1OPXA 4DKIA 3FC7A 4IJGA 1O07A 2HZ5A 1SKOA 5GLBA 2H0YA 4OOYA 1FIKA 4N1XA 1FSYA 3QP5A 5DFYA 4P87A 1NRFA 3G35A 3UMEA 5HL6A 1D7EA 1N9LA 3TG9A 4HY8A 1LSXA 2WK0A 2Z6CA 3G31A 2G2UA 4WN5A 3AGEA 4O8GA 3UY6A 2J80A 2HGVA 2PAVP 4YOFA 2GZAA 3BW6A 4Y7PA 2IA2A 3GV9A 1YLPA 5IT5A 5DFXA 1K4FA 4OQGA 2Y2IA 4S2NA 4MLLA 1AWIA 1ES2A 3K3DA 3NI9A 1T1CA 1C3BA 1BULA 5FQMA 1PRQA 3VFHA 3G34A 5HDSA 1I2WA 3H7WA 3PBNA 2P04A 4BWIA 3EGDC 4R23A 2OSUA 2V1AA 4E3LA 1UGUA 4HP4A 2VV6A 4EBPA 4IBXA 2X01A 1ODVA 3DWZA 2B95A 4NEED 1JWPA 3F1NB 1GHPA 5F69A 4WF0A 3LUQA 4R3JA 2B5RA 3O5YA 5EVLA 4XUXA 2Y8HA 3ZDJA 2DMWA 2Y55A 1GCEA 2VGKA 2Q0OA 3IF5A 4OOLA 1OTDA 1YQSA 1ZTUA 3ZG7B 1KGGA 4FD8A 1CEGA 3O86A 1G5UA 1P97A 4RQ9A 1XXMA 1HLUP 3AGFA 3EQVA 4QB8A 4Q0HA 1E4DA 1G68A 1MXOA 2BG1A 1BUEA 5E2FA 3KYEA 5DTSA 3P01A 3BLSA 3HLFA 2ZL1B 3LIEA 3UDXA 1CI9A 3ZNTA 4E3MA 4GHIA 3UNWA 1S4RA 2J9OA 2I72A 3SS5A 1YM1A 5TR7A 4IUHA 5DJTA 1PWCA 3C4PA 3E2LA 5FI6A 2ACGA 3NCKA 4S2MA 4B9OA 2DNSA 4UA6A 2W1RA 2XFSA 5E2GA 4DRTA 1K57C 1VETB 1ONHA 3UB9A 1M40A 4K0WA 3MSHA 2NUPC 4ARZB 2PYRA 3MMHA 4FSFA 4LLOB 1K55C 1NLYA 3N4IA 4K0XA 4MMNA 4R38A 1U60A 3EEAA 1S66L 1K54C 3PTEA 3O87A 1VM1A 2VV7A 4MBHA 4YINA 4BD1A 4DF6A 5CHJA 2A3UA 5TJJA 3WRZA 5G18A 3ZFZA 4P0MA 3PYPA 1PW8A 1OTAA 2WKPA 1VETA 1IYPA 5FDHA 1NZUA 1SCWA 3D9YA 3MQ0A 1ZC2A 4Y17A 3UPPA 4E3IA 2VGJA 4CJNA 4JF5A 2GJ3A 3IS2A 1S1YA 2ZD8A 3Q81A 3ZG5A 2JKTI 2IWDA 4ME4A 3IQAA 4GCZA 2FH5A 1H3QA 4UQIS 5FASA 4B88A 1YMXA 2WGVA 3OLOA 1FQGA 4FCFA 4ZJ2A 4X69A 5J8XA 5FSRA 4CLCC 4OOMA 3CLOA 2YKHA 1CJFA 1S0WA 1P0ZA 1HVBA 1KOUA 2XRNA 1L0DA 3CI6A 1IKIA 1QMFA 4KENB 5HFOA 3ULFA 1WA9A 3VE3A 4FTXA 1L2SA 4QJGA 5HD3A 2QWSA 4CPKA 3BM6A 2JHEA 4OLGA 4X6TA 2EXAA 4WZ5A 1N4OA 1Y28A 3HJKA 3CPTB 5A8BA 2W1TA 2J8YA 2V8FA 4BJPA 3GR2A 2KLIA 3G6OA 3V67A 1WYCA 1DRMA 5EVIA 4LRXC 3KX0X 3UO9A 1K38A 4LV2A 3JPUA 1H8MA 4HIAA 4QHCA 1PFLA 3IT9A 1NWZA 4FOFA 3RXXA 5GHZA 2WZXA 4KZ6A 5GLDA 1Z6FA 4S2PA 2G2WA 3IH8A 1LHYA 5FQIA 4GNUA 3HCYA 3BLMA 1IYQA 1TF1A 4K08A 3CPTA 4C3QA 3PBSA 5C5KA 3H82A 4EERA 3O3VA 1HD8A 4EBLA 3EQUA 3M6HA 4UQIM 4ZJ3A 4E6WA 1GSXA 3HLEA 2KX6A 5CGWA 1K56A 4R6LA 5EM0A 3JVUA 4YWZA 3W4QA 3G2ZA 3LY4A 2V0WA 2FFFB 3ZG0A 2QPNA 4JXVA 1MWRA 3UB8A 5EECA 3GQZA 1EI5A 3TSGA 3JYIA 1K6RA 2B18A 4I39A 3B33A 5AJGA 3VOZA 5E2EA 3GDIA 3OBFA 3Q82A 3VOYA 2Y2QA 1XJ2A 5FI7A 4LV1A 4DMZA 1D1JA 3HJIA 4ESPA 3EOIA 2WGWB 5AQAA 2WKEA 1PNEA 5AQ9A 1HTZA 5U47A 3V3RA 1NXYA 1S67L 2J3TD 1GA0A 4L9FA 2KOIA 3QP4A 3WS1A 2XEPA 4EXOA 1FSWA 3U2AA 1N9NA 1IYOA 4WEKA 2UV0E 1F5MA 3DTMA 4DE0A 1XFQA 1PZPA 3MXRA 2JN7A 1H8YA 3ICYA 1RGZA 2J7VA 5MC7A 4MCWA 3D72A 4KQQA 3F1OB 5BOHA 3T1XA 1IFQA 2VEAA 2EWWA 3OOVA 1JNUA 5TBMA 3RTYA 3NOPC 3LYXA 3ZG8B 1ZG4A 3SH7A 5L2FA 2M7VA 4ZDXA 1DP8A 5L8MA 1IELA 3G2YA 3V3SA 2ZMVA 4KQRA 1A0KA 5CTMA 3T4TA 1N9BA 2ZM8A 2WADA 4CLCD 2HJEA 4LGWA 5J3WA 3HLCA 3PAEA 2Y2LA 2FFYA 4PKYA 5M1AA 4NXEA 5J7EA 2EFXA 3LR3A 1OTEA 1FOFA 3C30A 3NDEA 4ZRRA 1PWDA 2V1BA 3E2KA 5FDSA 3WWXA 3NC8A 3H9WA 4GS9A 4ZBEA 3IF6A 3NECA 3K3CA 2XFTA 3T1QB 3T4LA 4D60A 2W0NA 4EUVA 2EX8A 4HESA 3S7QA 5FI2A 1E25A 1XP4A 2ZQCA 4DJ3A 1DJBA 2VK3A 4KG2A 5FATA 1MY8A 1RP5A 1XKZA 3MZFA 1YMSA 1J3WA 3UMDA 1UWNX 4KG5A 5HAIA 2JKTM 3NDGA 5AQBA 4F94A 5FEFA 3K2NA 5F1FA 4E3NA 4XXRA 3FKVA 1L3LA 2XD1A 2WUQA 4IVIA 5FA7A 1ERMA 3VP2A 1ES5A 1ERQA 4KUKA 3LR4A 4PM7A 3T4JA 1AXBA 2J9PA 5HPIA 4A5RA 1T1BA 1MWTA 4KZBA 2VLGA 4OLDA 4Y2FA 3TW8A 4OPZA 2XR0A 3MBZA 4BQMA 5CTNA 2Y59A 2QKPA 5KSHA 1K4EA 3E0YA 4HOIA 4BL3A 5KMWA 4XT2B 5M18A 3HUMA 3GTCA 3CJMA 2PHYA 4RYEA 1MC0A 4X1LA 3H7WB 4UHUA 3FG8A 2XH9A 3S22A
chains in the Genus database with same CATH topology
2LB9A 3OCLA 3LI9A 1LSVA 4Z1WA 4G3VA 1OTIA 2OOLA 2WKQA 4HJ3A 1XFNA 3PXPA 4R3AA 1P9RA 4YNRA 4B9OA 5AVEA 3TJZC 2W1RA 3BJNA 4Y5FA 1NLZA 2EWVA 3UB9A 2VZWA 3VOLA 3PBRA 4ETXA 4EW7A 2NUPC 3GECA 1D06A 4JGPA 4ARZB 4KUOA 2PYRA 1MZUA 3MMHA 4FSFA 4LLOB 4XT2A 3EGXC 1NLYA 1X0OA 1OT6A 5F5YA 1YAXA 2L1MA 4MMNA 4R38A 3EEAA 1W63M 1S66L 2W3EA 4BBTA 4GW9A 5F68A 5IU1A 2PR6A 3BY9A 3RFBA 4MDZA 3VE4A 5DF9A 5I5LA 2VV7A 2J3WA 3BY8A 1GSVA 5HWVA 1DP6A 3C2WA 4HJ4A 3S7PA 5TJJA 2VGLM 1TD5A 4E04A 2QYBA 1G28A 3R7WB 3PBTA 4GJ4A 3PYPA 4AFIA 1OTAA 2FZ0A 2WKPA 4MN7A 4EESA 4EU0A 1OTBA 4JGOA 4HP9A 2VJWA 2CMNA 3MFXA 1YSQA 3MF0A 3OCNA 3MQ0A 4CLCB 4GHIB 5EFWA 2GJ3A 4KQDA 3IS2A 1MKMA 3P7NA 2PDRA 1S1YA 4ETZA 4I3AA 2ZBBA 5LBRA 3T4OA 2QJ7A 3E4QA 2JKTI 3MJQA 2K7SA 4ME4A 1IOUA 3FPWA 3ZYTA 4GCZA 2FH5A 1H3QA 1OT9A 2WKRA 3S7NA 3EWKA 4UQIS 3R7WA 1LT0A 3OLOA 5DKLA 4DN0A 5FL3A 3T4KA 2HF6A 2D02A 3IBRA 4O01A 3CWFA 4OOMA 3CLOA 4CLCC 2W3FA 2YKHA 3LIDA 1P0ZA 3E4OA 4II7A 3T50A 1KOUA 2XRNA 3F1PB 3UB7A 3CI6A 2PT7A 4HH2A 3A0VA 3ULFA 2PD8A 3KSFA 2VKSA 4HH3A 3UB6A 1WA9A 1TS7A 3VE3A 2OWJA 3LICA 2EA9A 4Q0IA 2JKRM 3CITA 5HD3A 2QWSA 4HNBA 5G4ZA 4QPRA 4BMWA 2JHEA 2O99A 1Y28A 1UWPX 3HJKA 2V9AA 5A8BA 2W1TA 4BJPA 4NXFA 2KLIA 2L0WA 2OAP1 3G6OA 4KQOA 4HHDA 3V67A 2PR5A 1DRMA 2I9VA 2O9BA 4L9GA 2R78A 4LRXC 2QHKA 2P7JA 3KX0X 4LPZA 1LL8A 1H8MA 2A24B 2M1CA 2ZOHA 4HIAA 1TS0A 2W3HA 1TS6A 1NWZA 3F1PA 4GLQA 4FOFA 3KYQA 3LI8A 1W63Q 4BBVA 2BASA 5F6AA 2D01A 3CUEC 5HZHA 3FPVA 2QJ5A 1T19A 3IS2B 1GSWA 2NUTC 1NRJA 5IS1A 3HCYA 3PBOA 3CUEA 2OWHA 1YSPA 3T4SA 4EEUA 1TF1A 3NOUC 4K08A 2VX8A 2ZMFA 2OAQ1 4WLAA 1LSWA 2B02A 1T1AA 3PBSA 5C5KA 3KSIA 5HDDA 3H82A 3LFVA 4B93A 4EERA 2XSSA 4I5SA 3F1OA 3KYZA 5CX7A 1OJGA 3MQOA 2Z6DA 2L4RA 3R4KA 2XROA 3UE3A 3EQUA 3EEHA 2A24A 4UQIM 1GSXA 5G4YA 2KX6A 4PKYG 4F3LA 1V9YA 2P08A 3LR5A 1F9IA 4R6LA 3OC2A 5AVFA 3JVUA 4YWZA 2PD7A 4PHTA 2V0WA 4MN6A 1TS8A 5HPFA 3LIBA 3MQQA 3NOTC 3VV4A 1YKDA 3UB8A 3LIFA 4PAUA 1STZA 2B18A 4I39A 3B33A 3PBQA 5AJGA 3KSGA 3GDIA 3TRCA 2W1TB 2K2NA 3OBFA 2M7UA 4WUJA 2MJ6A 1XJ2A 3IBJA 4H6JA 2LB5A 3CAXA 4DMZA 3D3OA 1XJ3A 1OPXA 1N9OA 3FC7A 1P9WA 4IJGA 3HJIA 4IUKA 2VA0A 4LRYC 3EOIA 3TE8A 2XA7S 3F1NA 5DFYA 1S67L 1XJ4A 3DBAA 2J3TD 4L9FA 2KOIA 4HI4A 4EXOA 3U2AA 1N9NA 2O9AA 4WEKA 3UMEA 3ZQ5A 1F5MA 2H28A 3B47A 3BQ8A 5HL6A 5DKKA 1D7EA 2W3GA 4MN5A 1OJ5A 3PHYA 1XFQA 1N9LA 4DJ2A 1VHMA 2JN7A 3PR6A 3S7OA 4JGQA 4EEPA 4HY8A 1F98A 3A0SA 4L9EA 3ICYA 1LSXA 2Z6CA 1V9ZA 3UE6A 5MC7A 3H82B 4MCWA 3D72A 2JKRI 3F1OB 1IFQA 2VEAA 4I3IA 4WN5A 2EWWA 4EQ1A 4O8GA 3OOVA 2HV1A 1JNUA 3KO6A 2J80A 5TBMA 2HGVA 3RTYA 3NOPC 3LYXA 4YOFA 4F3LB 1BYWA 2GZAA 3BW6A 2IA2A 3KSHA 2M7VA 1DP8A 5L8MA 5IT5A 2PYPA 5DFXA 2ZMVA 3C38A 3T4TA 3JVVA 4L0LA 2O9CA 4CLCD 2HJEA 5J3WA 4EETB 4WELA 4PKYA 1XJ6A 3BQAA 4Q0JA 4NXEA 5J7EA 3K3DA 1T1CA 3LR3A 2HJ9C 1OTEA 2YKFA 3C30A 4HQAA 4BBUA 4ZRRA 5K5BA 4G3KA 5KIZA 4NKPA 3RH8B 2V1BA 2ZOIA 5HDSA 4H6JB 3H9WA 4GS9A 4IHQA 4M4XA 3T4QA 3MXQA 3K3CA 1S4SA 3H7WA 3PBNA 3T4LA 1G6OA 2P04A 4BWIA 3EGDC 2V1AA 1UGUA 4HP4A 1S1ZA 2VV6A 4LRZE 4R70A 2W0NA 4EUVA 2W3DA 4WEJA 2GX5A 1ODVA 2Y79A 3A0RA 3S7QA 4I38A 4NEED 3LR0A 3F1NB 4Y3IA 1ZHHB 3E98A 5F69A 4DJ3A 4WF0A 2INWA 3BWLA 3LUQA 2J3TC 2XA7M 3MR0A 4CLCE 3B42A 3O5YA 2K31A 2Y8HA 3SW1A 3UMDA 4I3JA 1UWNX 2DMWA 4ARZA 4NXGA 2JKTM 4UEYA 1DP9A 3K2NA 4OOLA 1OTDA 5HWWA 1ZTUA 5HD5A 1EW0A 2VGLS 2VV8A 1P97A 5TBMB 5J4EA 1T18A 4NXBA 4RQ9A 2O0YA 3EQVA 1VB6A 4Q0HA 4HJ6A 4P6ZM 4KUKA 3NJAA 3LR4A 2V0UA 3E4PA 4O0PA 2KDKA 5DJUA 3T4JA 4CQHA 5HPIA 5HDCA 2GNXA 5HSQA 1T1BA 2VLGA 3NHQA 3C8CA 3P01A 3W2ZA 4Y2FA 3TW8A 4G3WA 3LIEA 2QKPA 5KSHA 4CLCA 3E0YA 4HOIA 2G7UA 4XT2B 4GHIA 1S4RA 2A2LA 2PHYA 1MC0A 4GS9B 2W27A 3H7WB 3LIAA 4JGRA 4WL9A 4IUHA 4P6ZS 3FG8A 5DJTA 5HWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI9 A;  1LSV A;  1OTI A;  2OOL A;  2WKQ A;  4HJ3 A;  1XFN A;  4R3A A;  4B9O A;  5AVE A;  3UB9 A;  3VOL A;  4EW7 A;  3GEC A;  1D06 A;  4JGP A;  4KUO A;  2PYR A;  1MZU A;  4XT2 A;  4LLO B;  1X0O A;  1OT6 A;  5F5Y A;  2L1M A;  4R38 A;  1S66 L;  4BBT A;  4GW9 A;  5F68 A;  5IU1 A;  2PR6 A;  3BY9 A;  3VE4 A;  5I5L A;  2VV7 A;  3BY8 A;  1GSV A;  5HWV A;  1DP6 A;  3C2W A;  4HJ4 A;  4E04 A;  1G28 A;  3PYP A;  1OTA A;  2WKP A;  4EES A;  1OTB A;  4JGO A;  4HP9 A;  2CMN A;  3MFX A;  4GHI B;  5EFW A;  2GJ3 A;  4KQD A;  3IS2 A;  3P7N A;  2PDR A;  1S1Y A;  4I3A A;  2ZBB A;  2QJ7 A;  3E4Q A;  3MJQ A;  2K7S A;  4GCZ A;  1OT9 A;  2WKR A;  3EWK A;  1LT0 A;  3OLO A;  5DKL A;  2D02 A;  3IBR A;  3CWF A;  3CLO A;  2YKH A;  3LID A;  1P0Z A;  3E4O A;  3T50 A;  1KOU A;  3F1P B;  3UB7 A;  4HH2 A;  3A0V A;  3ULF A;  2PD8 A;  4HH3 A;  3UB6 A;  1WA9 A;  1TS7 A;  3VE3 A;  2OWJ A;  3LIC A;  2EA9 A;  5HD3 A;  2QWS A;  4HNB A;  5G4Z A;  2JHE A;  1Y28 A;  1UWP X;  3HJK A;  2V9A A;  5A8B A;  4NXF A;  2L0W A;  3G6O A;  4HHD A;  2PR5 A;  1DRM A;  2I9V A;  4L9G A;  2R78 A;  4LRX C;  2QHK A;  2P7J A;  3KX0 X;  4LPZ A;  1LL8 A;  2A24 B;  2M1C A;  2ZOH A;  4HIA A;  1TS0 A;  1TS6 A;  1NWZ A;  3F1P A;  3LI8 A;  4BBV A;  2BAS A;  5F6A A;  2D01 A;  5HZH A;  2QJ5 A;  1T19 A;  3IS2 B;  1GSW A;  5IS1 A;  2OWH A;  4EEU A;  3NOU C;  4K08 A;  4WLA A;  1LSW A;  2B02 A;  1T1A A;  5HDD A;  3H82 A;  4EER A;  4I5S A;  3F1O A;  1OJG A;  3MQO A;  2Z6D A;  2L4R A;  3EEH A;  2A24 A;  1GSX A;  5G4Y A;  2KX6 A;  4PKY G;  4F3L A;  1V9Y A;  1F9I A;  4R6L A;  5AVF A;  4YWZ A;  2PD7 A;  2V0W A;  4MN6 A;  1TS8 A;  3LIB A;  3MQQ A;  3NOT C;  3UB8 A;  3LIF A;  4I39 A;  3B33 A;  3GDI A;  4WUJ A;  1XJ2 A;  4H6J A;  3CAX A;  1XJ3 A;  1N9O A;  3FC7 A;  3HJI A;  4LRY C;  3F1N A;  1S67 L;  1XJ4 A;  4L9F A;  4HI4 A;  4EXO A;  1N9N A;  3ZQ5 A;  3UME A;  2H28 A;  5DKK A;  1D7E A;  4MN5 A;  1OJ5 A;  3PHY A;  1XFQ A;  1N9L A;  4DJ2 A;  2JN7 A;  4JGQ A;  4EEP A;  4HY8 A;  1F98 A;  3A0S A;  4L9E A;  3ICY A;  1LSX A;  2Z6C A;  1V9Z A;  3UE6 A;  3H82 B;  3D72 A;  3F1O B;  2VEA A;  4I3I A;  4WN5 A;  4EQ1 A;  2HV1 A;  1JNU A;  2J80 A;  5TBM A;  3RTY A;  3NOP C;  3LYX A;  4F3L B;  1BYW A;  1DP8 A;  2PYP A;  5J3W A;  4EET B;  4PKY A;  1XJ6 A;  4NXE A;  5J7E A;  3K3D A;  1T1C A;  1OTE A;  2YKF A;  4HQA A;  4BBU A;  5KIZ A;  3RH8 B;  2V1B A;  2ZOI A;  5HDS A;  4H6J B;  3H9W A;  4GS9 A;  4M4X A;  3MXQ A;  3K3C A;  1S4S A;  3H7W A;  2V1A A;  1UGU A;  4HP4 A;  1S1Z A;  2VV6 A;  4LRZ E;  4R70 A;  2W0N A;  1ODV A;  3A0R A;  4I38 A;  3F1N B;  5F69 A;  4DJ3 A;  4WF0 A;  2INW A;  3BWL A;  3LUQ A;  3MR0 A;  3SW1 A;  3UMD A;  4I3J A;  1UWN X;  4NXG A;  1DP9 A;  1OTD A;  5HWW A;  5HD5 A;  1EW0 A;  2VV8 A;  1P97 A;  5TBM B;  5J4E A;  1T18 A;  4NXB A;  4RQ9 A;  1VB6 A;  4HJ6 A;  4KUK A;  3NJA A;  2V0U A;  3E4P A;  5DJU A;  2KDK A;  5HDC A;  5HSQ A;  1T1B A;  2VLG A;  3NHQ A;  3C8C A;  3LIE A;  2QKP A;  4HOI A;  4XT2 B;  4GHI A;  1S4R A;  2PHY A;  4GS9 B;  2W27 A;  3H7W B;  3LIA A;  4JGR A;  4WL9 A;  3FG8 A;  5DJT A;  5HWT A; 
#chains in the Genus database with same CATH topology
 3BFF A;  1L0G A;  1CQA A;  4EWF A;  4Z1W A;  4WM9 A;  1W8Q A;  4EV4 A;  1OTI A;  2WKQ A;  2Q9M A;  3PXP A;  4R3A A;  2Y2G A;  1BZA A;  4U0X A;  5HAP A;  2ZQ7 A;  3IHB A;  1MWU A;  3NY4 A;  4EW7 A;  4R4R A;  5A90 A;  1D06 A;  4GB7 A;  3UN7 A;  1OME A;  2HDS A;  4XT2 A;  2H10 A;  5D3O A;  1OT6 A;  2C5W B;  1W63 M;  2W3E A;  4DE3 A;  2X02 A;  4GW9 A;  5F68 A;  1PWG A;  3SS3 A;  1GHI A;  2V8C A;  4R1G A;  3RFB A;  3VE4 A;  5I5L A;  5TGF A;  2C6W B;  1GSV A;  1DP6 A;  3BYD A;  3C2W A;  4HJ4 A;  3S7P A;  1KGF A;  4E6X A;  3MKF A;  4B4X A;  1NY0 A;  1G28 A;  5E43 A;  3IX3 A;  4X25 A;  3DTI A;  3PBT A;  1LLB A;  4GJ4 A;  4AFI A;  2FZ0 A;  1W5D A;  1YSQ A;  3HLB A;  3MF0 A;  4FH2 A;  2WZZ A;  4K91 A;  4GHI B;  4HBU A;  3AGD A;  3IWI A;  2ZQ9 A;  2WAF A;  4ETZ A;  3VSK A;  4I3A A;  5LBR A;  3QP2 A;  2K7S A;  3FPW A;  3WS5 A;  5FQ9 A;  2WKR A;  3EWK A;  1LT0 A;  3ITB A;  1BT5 A;  2XDM A;  3HVF A;  4DN0 A;  2P9V A;  2D02 A;  4KZ9 A;  4O01 A;  4LFU A;  2W3F A;  3PAG A;  1W8Y A;  3LID A;  4II7 A;  1RGY A;  4PM8 A;  2V1Z A;  4HH2 A;  3LEQ A;  2A49 A;  1K25 A;  3S1Y A;  2HDR A;  1Y4O A;  5G4Z A;  2OLU A;  4ZAM A;  1PZO A;  2V9A A;  5EVI C;  4NXF A;  4GDB A;  2L0W A;  3ITA A;  2OAP 1;  5A91 A;  1ESU A;  2E8J A;  2PR5 A;  2O9B A;  2I9V A;  4L9G A;  3W4O A;  2R78 A;  5KSC A;  5L07 A;  2M1C A;  1ZG6 A;  1TS0 A;  1TS6 A;  2Q9N A;  4NK3 A;  2Y2H A;  3KYQ A;  2XF3 A;  4R4S A;  3LI8 A;  1W63 Q;  2XLN A;  4OPY A;  4BBV A;  5F6A A;  1CI8 A;  5EOE A;  3BRM A;  3FPV A;  4EQI A;  3IS2 B;  1GSW A;  1NRJ A;  4S2J A;  3PBO A;  4LCL A;  3V5M A;  3N6I A;  4GD8 A;  2VX8 A;  2OAQ 1;  4WLA A;  3U4L P;  1LSW A;  1T1A A;  3KSI A;  5HDD A;  3LFV A;  5CXW A;  3HUO A;  1YLZ A;  2BTF P;  3R4K A;  4KZ7 A;  4R0Q A;  4F3L A;  2P08 A;  3VSL A;  3LR5 A;  1F9I A;  5JYP A;  3RXW A;  4WMC A;  1FCO A;  4OVD A;  5AVF A;  4YFM A;  4LV3 A;  3HRE A;  4JF6 A;  4MN6 A;  1TS8 A;  3LIB A;  3MQQ A;  2WKI A;  3VV4 A;  1YKD A;  1EWZ A;  2WGI A;  1K0K A;  4JBF A;  4PAU A;  3W8K A;  3RJU A;  5EUA A;  3Q7V B;  1GA9 A;  2W1T B;  2K2N A;  4WUJ A;  2MJ6 A;  3IBJ A;  4H6J A;  2LB5 A;  3CAX A;  2V20 A;  3MKE A;  3D3O A;  5HW3 A;  5EVI B;  4RX3 A;  3V50 A;  4OKP A;  4IUK A;  4LRY C;  3TE8 A;  3IXB A;  1FCN A;  4M3K A;  4RA7 A;  3GMW A;  1JTG A;  2O9A A;  3ZQ5 A;  2H28 A;  3B47 A;  1DJA A;  3BQ8 A;  3IH9 A;  5FQK A;  3WS0 A;  4BLM A;  2ZQA A;  4MN5 A;  1YLW A;  5CHU A;  3PR6 A;  3Q7V A;  3S7O A;  4L9E A;  5L10 A;  1V9Z A;  3T1S A;  3UE6 A;  3H82 B;  3ZG9 B;  2JKR I;  4GKU A;  4HEF A;  3NIA A;  3ZVW A;  1G6A A;  2HP9 A;  4I3I A;  4EQ1 A;  2HV1 A;  3VP1 A;  3KO6 A;  1BYW A;  4Y15 A;  1SZV A;  4GZB A;  3C38 A;  3CG5 A;  1JWV A;  2O9C A;  4EET B;  4WEL A;  1XGI A;  3BQA A;  5CER A;  2HJ9 C;  4IBR A;  4HQA A;  4BBU A;  3G30 A;  1BLP A;  2HDQ A;  3HLD A;  5K5B A;  4G3K A;  5KIZ A;  4NKP A;  1K57 A;  2E8I A;  2PBY A;  2ZOI A;  2H0T A;  5GHX A;  1SKF A;  4M4X A;  3T4Q A;  2R9X A;  3MXQ A;  1S4S A;  1G6O A;  3UE0 A;  1SDN A;  4GOG A;  1K55 A;  4U0T A;  1BLH A;  4LRZ E;  2W3D A;  3IXG A;  4WEJ A;  2GX5 A;  4PM6 A;  3CHW P;  2Y79 A;  2HDU A;  4JLF A;  3A0R A;  4MBK A;  3LR0 A;  4Y3I A;  2Y91 A;  2INW A;  3BWL A;  4OQH A;  4ZTK A;  3MR0 A;  2XK1 A;  5CEB A;  1JWZ A;  5GLA A;  3BFC A;  3MS6 A;  3SW1 A;  4I3J A;  1I5Q A;  1LL9 A;  4UEY A;  3A3E A;  4P85 A;  1FR6 A;  5FEG A;  3P09 A;  5HWW A;  1TDG A;  1IYS A;  3V39 A;  1EW0 A;  2RCX A;  2VGL S;  2VV8 A;  5TBM B;  1Q2P A;  1T18 A;  1LI9 A;  3MFD A;  4NXB A;  4DE2 A;  1E3U A;  4R3B A;  2O0Y A;  1XA7 A;  3ZCZ A;  5E2H A;  4OH0 A;  4P6Z M;  1K56 D;  3LEZ A;  4PMA A;  2UWX A;  2Y4A A;  4IVK A;  4OPR A;  4O0P A;  2KDK A;  4CQH A;  5HDC A;  4X68 A;  2GNX A;  5HSQ A;  2ZC3 B;  5FAQ A;  2H5S A;  2JCH A;  1L0F A;  1LL5 A;  2DCF A;  4CLC A;  1HZO A;  4GS9 B;  3IF6 B;  2W27 A;  3LIA A;  3BFE A;  5FQQ A;  5CGX A;  1PYY A;  1ESI A;  3LI9 A;  1LSV A;  4S2N C;  1CEF A;  4G3V A;  4Z9Q A;  4X1M A;  2OOL A;  4GN2 A;  1XFN A;  1P9R A;  2JE5 A;  1VEU B;  1IEM A;  4Y5F A;  5DF8 A;  3HL9 A;  1NLZ A;  2EWV A;  2VZW A;  3VOL A;  5HAQ A;  3GEC A;  4JGP A;  3FWL A;  1YLY A;  2ZC5 B;  1X0O A;  5CHM A;  2L1M A;  5EVE A;  3I7J A;  4RVA A;  4OP5 A;  2PR6 A;  4MDZ A;  5DF9 A;  4Y0T A;  5M19 A;  3MZD A;  5HWV A;  2VGL M;  4JXG A;  1TD5 A;  4UA9 A;  2OLV A;  1WYB A;  2ZMA A;  2JC7 A;  1VEU A;  1MWS A;  3QNC A;  2CC1 A;  4MN7 A;  4Y0O A;  4BL2 A;  1YLJ A;  4EU0 A;  1OTB A;  5DTT A;  2CMN A;  4UAA A;  1NZO A;  3MZE A;  5EFW A;  3FV7 A;  1MKM A;  3P7N A;  2PDR A;  3E4Q A;  1YPR A;  3LY3 A;  1FIL A;  3ZYT A;  5KZH A;  3UPN A;  3ZVT A;  1KE3 A;  1RCJ A;  4KZ5 A;  1XGJ A;  5HAR A;  1ES4 A;  5DKL A;  3T4K A;  2HF6 A;  3IXH A;  3OZH A;  3IBR A;  4FH4 A;  3CWF A;  3LO7 A;  3T50 A;  4ZJ1 A;  3F1P B;  3UB7 A;  2PT7 A;  2ZQD A;  4JXS A;  3WRT A;  3KSF A;  4HH3 A;  3UB6 A;  1W7F A;  1NYM A;  1TS7 A;  4X56 A;  2OWJ A;  3LIC A;  2JKR M;  3HUN A;  1Q2Q A;  2O99 A;  3IX8 A;  4S2I A;  2R9W A;  1Z09 A;  4HHD A;  2Y2P A;  1KDS A;  2RL3 A;  4LPZ A;  1LL8 A;  5I94 A;  2A24 B;  2ZOH A;  2PU2 A;  2WAE A;  3F1P A;  3FZC A;  3T12 B;  1QME A;  1SDE A;  2D01 A;  3UB5 P;  1XPB A;  5HZH A;  5EOO A;  1KVL A;  4WZ4 A;  2NUT C;  5IS1 A;  4S2O A;  3CUE A;  1O7E A;  4EEU A;  3ZGA B;  2ZMF A;  4PPR A;  2WKH A;  3P98 A;  2Z2L B;  4PM9 A;  1F2K A;  4RX2 A;  2XSS A;  4I5S A;  3KYZ A;  1OJG A;  3C5A A;  2P9V B;  3UE3 A;  1BLS A;  1KDW A;  3SS4 A;  3NBL A;  2A24 A;  4PKY G;  1L0E A;  3OPP A;  4EBN A;  3IHA A;  3DAV A;  3VP3 A;  2QZ6 A;  4PHT A;  5HPF A;  4QY6 A;  3NOT C;  3OPH A;  1FCM A;  3QHY A;  1PI5 A;  4KZ3 A;  4DDY A;  3UE1 A;  4JF4 A;  3PBQ A;  1XX2 A;  2JBF A;  2Y2N A;  3KSG A;  4P6B A;  4LCM A;  3TRC A;  1MBL A;  1XA1 A;  2AVX A;  2Y2K A;  1Y54 A;  4C6Y A;  3LCE A;  1XJ3 A;  3SZT A;  4UA7 A;  1PW1 A;  1P9W A;  2VA0 A;  4OQ0 A;  2Y2M A;  4JKT A;  2XA7 S;  4S2K A;  2ZC7 A;  3F1N A;  4LV0 A;  2DRW A;  3ISG A;  1XJ4 A;  3DBA A;  3S4X A;  3ZHH A;  4HI4 A;  3DTK A;  1BSG A;  2Z2M B;  2EX6 A;  4HBT A;  4WZ5 C;  5DKK A;  2W3G A;  1ACF A;  3N8S A;  1OJ5 A;  1DJC A;  1S6R A;  3PHY A;  5DF7 A;  4XUZ A;  4DJ2 A;  1VHM A;  2JKG A;  4JGQ A;  4EEP A;  1F98 A;  3A0S A;  3M2J A;  2HP6 A;  4ID4 A;  4N1H A;  3L9K A;  1NJ4 A;  5A92 A;  3Q7Z A;  3A3I A;  4F3L B;  4MEZ A;  3IWQ A;  3CMZ A;  3KSH A;  5A93 A;  2PYP A;  1TEM A;  3OPR A;  3C7V A;  3JVV A;  4L0L A;  3L7H A;  4MBF A;  5TFQ A;  4DE1 A;  1XJ6 A;  4Q0J A;  3IX4 A;  4GD6 A;  2YKF A;  2ZL1 A;  3BFD A;  3G4P A;  3RH8 B;  3DW0 A;  3GSG A;  4DXB A;  4H6J B;  4IHQ A;  1JVJ A;  4QD4 A;  1PI4 A;  4E3J A;  1S1Z A;  4U3T A;  4R70 A;  1M6K A;  3QP8 A;  4I38 A;  3BFG A;  4D2O A;  4DDS A;  1ZHH B;  3E98 A;  4Y13 A;  5HX9 A;  3A3F A;  2J3T C;  4PM5 A;  2XA7 M;  5GL9 A;  4CLC E;  3B42 A;  3HLW A;  1YT4 A;  4OON A;  3NUL A;  3C4O A;  4GDN A;  2K31 A;  1DY6 A;  5GLC A;  4ARZ A;  4NXG A;  1DP9 A;  5L09 A;  1MKI A;  1TVF A;  3VP0 A;  1J9M A;  3LGO A;  5HD5 A;  3FYZ A;  5GHY A;  1ZKJ A;  5J4E A;  5DVA A;  2EFU A;  3N8L A;  1VB6 A;  1ES3 A;  1K6S A;  4HJ6 A;  3BEB A;  3NJA A;  5CRF A;  5IHV A;  2V0U A;  3E4P A;  4WMC D;  5DJU A;  1BTL A;  1FR1 A;  2Y2O A;  3MXS A;  2ZJ9 A;  1CF0 A;  2IWC A;  4LEN A;  3NHQ A;  3C8C A;  3IWO A;  3W2Z A;  4G3W A;  1GHM A;  5FQJ A;  3VFF A;  1BLC A;  5FAP A;  2G7U A;  3HLG A;  2A2L A;  1W79 A;  2Y2J A;  3FKW A;  4JGR A;  4WL9 A;  1ALQ A;  1TDL A;  4P6Z S;  4WBG A;  3QNB A;  5HWT A;  2LB9 A;  3OCL A;  5F1G A;  1I2S A;  4NET A;  1H0M A;  3QP6 A;  2X71 A;  4KZ8 A;  1KGE A;  4HJ3 A;  4YNR A;  4MNR A;  5AVE A;  4FUW A;  3UDI A;  1PIO A;  3TJZ C;  3BJN A;  4BEN A;  3PBR A;  4ETX A;  4KUO A;  3IF6 C;  4EUZ A;  3WS4 A;  1MZU A;  1IKG A;  3EGX C;  4E3K A;  5F5Y A;  1YAX A;  1ONG A;  5CEC A;  3G32 A;  3DWK A;  5AQ7 A;  4BBT A;  5EE8 A;  3UPO A;  5IU1 A;  3SH8 A;  2EXB A;  5EVI D;  3BY9 A;  3D4F A;  1K54 A;  4N9K A;  2J3W A;  3BY8 A;  1LI0 A;  4WYY A;  3A3J A;  4E04 A;  2QYB A;  5F83 A;  3R7W B;  4X55 A;  3ZNY A;  3T1R A;  5EM1 A;  4O7D A;  5JYO A;  4EES A;  2PBD P;  4JGO A;  3M6B A;  3A3D A;  4HP9 A;  5EPH A;  2VJW A;  4NG2 A;  3MFX A;  3OCN A;  4CLC B;  2PU4 A;  4KQD A;  4X53 A;  2GDN A;  2ZBB A;  3T4O A;  2QJ7 A;  3CZD A;  3MJQ A;  1IOU A;  2PRF A;  1VQQ A;  1OT9 A;  2EX9 A;  2EX2 A;  3S7N A;  2IWB A;  4Y0U A;  1YLT A;  2ZQ8 A;  4S2L A;  3R7W A;  2ZM2 A;  5FL3 A;  5F82 A;  1WE4 A;  4N92 A;  4B4Z A;  5FAO A;  3Q07 A;  1H5X A;  4Q8I A;  3E4O A;  3VP4 A;  3A0V A;  2XGN A;  1NYY A;  2HP5 A;  2PD8 A;  2VKS A;  1KVM A;  4OQI A;  2EA9 A;  4Q0I A;  3WS2 A;  3HBR A;  3CIT A;  3B3X A;  2QMI A;  4HNB A;  4JPM A;  4QPR A;  3N8R A;  4BMW A;  5CGS A;  4DXC A;  4H8R A;  1UWP X;  4C75 A;  3DTE A;  1E3U D;  4KQO A;  1KE4 A;  4E3O A;  1MPL A;  3OPL A;  2JKF A;  2ZC4 B;  2QHK A;  2WYX A;  4KG6 A;  2P7J A;  2WGW A;  2ZLY A;  2W3H A;  3C7U A;  4N9L A;  4GLQ A;  1KE0 A;  3QP1 A;  2BAS A;  2BLS A;  3SH9 A;  1CK3 A;  5CED A;  2V2F F;  3CUE C;  2OV5 A;  2QJ5 A;  1T19 A;  5EV0 A;  3BEC A;  4QY5 A;  4IED A;  2ZM0 A;  4BD0 A;  2OWH A;  1YSP A;  3T4S A;  3NOU C;  3TOI A;  4KZ4 A;  5HL1 A;  2B02 A;  4B93 A;  3M2K A;  5DTK A;  3F1O A;  5CX7 A;  3N7W A;  4QWO A;  3MQO A;  2Z6D A;  1JTD A;  2L4R A;  2XRO A;  2P74 A;  4QU3 A;  3EEH A;  1SKO B;  5G4Y A;  1V9Y A;  2XQZ A;  3IXD A;  4JXW A;  1ERO A;  3OC2 A;  3GVB A;  4OP8 A;  2PD7 A;  1SHV A;  3SOI A;  2HPB A;  3W4P A;  4OPQ A;  3LIF A;  1STZ A;  1H8Z A;  4KZA A;  2XD5 A;  3Q1F A;  3O88 A;  2M7U A;  2ZC6 B;  3GRJ A;  3VMA A;  3UDF A;  1N9O A;  1OPX A;  4DKI A;  3FC7 A;  4IJG A;  1O07 A;  2HZ5 A;  1SKO A;  5GLB A;  2H0Y A;  4OOY A;  1FIK A;  4N1X A;  1FSY A;  3QP5 A;  5DFY A;  4P87 A;  1NRF A;  3G35 A;  3UME A;  5HL6 A;  1D7E A;  1N9L A;  3TG9 A;  4HY8 A;  1LSX A;  2WK0 A;  2Z6C A;  3G31 A;  2G2U A;  4WN5 A;  3AGE A;  4O8G A;  3UY6 A;  2J80 A;  2HGV A;  2PAV P;  4YOF A;  2GZA A;  3BW6 A;  4Y7P A;  2IA2 A;  3GV9 A;  1YLP A;  5IT5 A;  5DFX A;  1K4F A;  4OQG A;  2Y2I A;  4S2N A;  4MLL A;  1AWI A;  1ES2 A;  3K3D A;  3NI9 A;  1T1C A;  1C3B A;  1BUL A;  5FQM A;  1PRQ A;  3VFH A;  3G34 A;  5HDS A;  1I2W A;  3H7W A;  3PBN A;  2P04 A;  4BWI A;  3EGD C;  4R23 A;  2OSU A;  2V1A A;  4E3L A;  1UGU A;  4HP4 A;  2VV6 A;  4EBP A;  4IBX A;  2X01 A;  1ODV A;  3DWZ A;  2B95 A;  4NEE D;  1JWP A;  3F1N B;  1GHP A;  5F69 A;  4WF0 A;  3LUQ A;  4R3J A;  2B5R A;  3O5Y A;  5EVL A;  4XUX A;  2Y8H A;  3ZDJ A;  2DMW A;  2Y55 A;  1GCE A;  2VGK A;  2Q0O A;  3IF5 A;  4OOL A;  1OTD A;  1YQS A;  1ZTU A;  3ZG7 B;  1KGG A;  4FD8 A;  1CEG A;  3O86 A;  1G5U A;  1P97 A;  4RQ9 A;  1XXM A;  1HLU P;  3AGF A;  3EQV A;  4QB8 A;  4Q0H A;  1E4D A;  1G68 A;  1MXO A;  2BG1 A;  1BUE A;  5E2F A;  3KYE A;  5DTS A;  3P01 A;  3BLS A;  3HLF A;  2ZL1 B;  3LIE A;  3UDX A;  1CI9 A;  3ZNT A;  4E3M A;  4GHI A;  3UNW A;  1S4R A;  2J9O A;  2I72 A;  3SS5 A;  1YM1 A;  5TR7 A;  4IUH A;  5DJT A;  1PWC A;  3C4P A;  3E2L A;  5FI6 A;  2ACG A;  3NCK A;  4S2M A;  4B9O A;  2DNS A;  4UA6 A;  2W1R A;  2XFS A;  5E2G A;  4DRT A;  1K57 C;  1VET B;  1ONH A;  3UB9 A;  1M40 A;  4K0W A;  3MSH A;  2NUP C;  4ARZ B;  2PYR A;  3MMH A;  4FSF A;  4LLO B;  1K55 C;  1NLY A;  3N4I A;  4K0X A;  4MMN A;  4R38 A;  1U60 A;  3EEA A;  1S66 L;  1K54 C;  3PTE A;  3O87 A;  1VM1 A;  2VV7 A;  4MBH A;  4YIN A;  4BD1 A;  4DF6 A;  5CHJ A;  2A3U A;  5TJJ A;  3WRZ A;  5G18 A;  3ZFZ A;  4P0M A;  3PYP A;  1PW8 A;  1OTA A;  2WKP A;  1VET A;  1IYP A;  5FDH A;  1NZU A;  1SCW A;  3D9Y A;  3MQ0 A;  1ZC2 A;  4Y17 A;  3UPP A;  4E3I A;  2VGJ A;  4CJN A;  4JF5 A;  2GJ3 A;  3IS2 A;  1S1Y A;  2ZD8 A;  3Q81 A;  3ZG5 A;  2JKT I;  2IWD A;  4ME4 A;  3IQA A;  4GCZ A;  2FH5 A;  1H3Q A;  4UQI S;  5FAS A;  4B88 A;  1YMX A;  2WGV A;  3OLO A;  1FQG A;  4FCF A;  4ZJ2 A;  4X69 A;  5J8X A;  5FSR A;  4CLC C;  4OOM A;  3CLO A;  2YKH A;  1CJF A;  1S0W A;  1P0Z A;  1HVB A;  1KOU A;  2XRN A;  1L0D A;  3CI6 A;  1IKI A;  1QMF A;  4KEN B;  5HFO A;  3ULF A;  1WA9 A;  3VE3 A;  4FTX A;  1L2S A;  4QJG A;  5HD3 A;  2QWS A;  4CPK A;  3BM6 A;  2JHE A;  4OLG A;  4X6T A;  2EXA A;  4WZ5 A;  1N4O A;  1Y28 A;  3HJK A;  3CPT B;  5A8B A;  2W1T A;  2J8Y A;  2V8F A;  4BJP A;  3GR2 A;  2KLI A;  3G6O A;  3V67 A;  1WYC A;  1DRM A;  5EVI A;  4LRX C;  3KX0 X;  3UO9 A;  1K38 A;  4LV2 A;  3JPU A;  1H8M A;  4HIA A;  4QHC A;  1PFL A;  3IT9 A;  1NWZ A;  4FOF A;  3RXX A;  5GHZ A;  2WZX A;  4KZ6 A;  5GLD A;  1Z6F A;  4S2P A;  2G2W A;  3IH8 A;  1LHY A;  5FQI A;  4GNU A;  3HCY A;  3BLM A;  1IYQ A;  1TF1 A;  4K08 A;  3CPT A;  4C3Q A;  3PBS A;  5C5K A;  3H82 A;  4EER A;  3O3V A;  1HD8 A;  4EBL A;  3EQU A;  3M6H A;  4UQI M;  4ZJ3 A;  4E6W A;  1GSX A;  3HLE A;  2KX6 A;  5CGW A;  1K56 A;  4R6L A;  5EM0 A;  3JVU A;  4YWZ A;  3W4Q A;  3G2Z A;  3LY4 A;  2V0W A;  2FFF B;  3ZG0 A;  2QPN A;  4JXV A;  1MWR A;  3UB8 A;  5EEC A;  3GQZ A;  1EI5 A;  3TSG A;  3JYI A;  1K6R A;  2B18 A;  4I39 A;  3B33 A;  5AJG A;  3VOZ A;  5E2E A;  3GDI A;  3OBF A;  3Q82 A;  3VOY A;  2Y2Q A;  1XJ2 A;  5FI7 A;  4LV1 A;  4DMZ A;  1D1J A;  3HJI A;  4ESP A;  3EOI A;  2WGW B;  5AQA A;  2WKE A;  1PNE A;  5AQ9 A;  1HTZ A;  5U47 A;  3V3R A;  1NXY A;  1S67 L;  2J3T D;  1GA0 A;  4L9F A;  2KOI A;  3QP4 A;  3WS1 A;  2XEP A;  4EXO A;  1FSW A;  3U2A A;  1N9N A;  1IYO A;  4WEK A;  2UV0 E;  1F5M A;  3DTM A;  4DE0 A;  1XFQ A;  1PZP A;  3MXR A;  2JN7 A;  1H8Y A;  3ICY A;  1RGZ A;  2J7V A;  5MC7 A;  4MCW A;  3D72 A;  4KQQ A;  3F1O B;  5BOH A;  3T1X A;  1IFQ A;  2VEA A;  2EWW A;  3OOV A;  1JNU A;  5TBM A;  3RTY A;  3NOP C;  3LYX A;  3ZG8 B;  1ZG4 A;  3SH7 A;  5L2F A;  2M7V A;  4ZDX A;  1DP8 A;  5L8M A;  1IEL A;  3G2Y A;  3V3S A;  2ZMV A;  4KQR A;  1A0K A;  5CTM A;  3T4T A;  1N9B A;  2ZM8 A;  2WAD A;  4CLC D;  2HJE A;  4LGW A;  5J3W A;  3HLC A;  3PAE A;  2Y2L A;  2FFY A;  4PKY A;  5M1A A;  4NXE A;  5J7E A;  2EFX A;  3LR3 A;  1OTE A;  1FOF A;  3C30 A;  3NDE A;  4ZRR A;  1PWD A;  2V1B A;  3E2K A;  5FDS A;  3WWX A;  3NC8 A;  3H9W A;  4GS9 A;  4ZBE A;  3IF6 A;  3NEC A;  3K3C A;  2XFT A;  3T1Q B;  3T4L A;  4D60 A;  2W0N A;  4EUV A;  2EX8 A;  4HES A;  3S7Q A;  5FI2 A;  1E25 A;  1XP4 A;  2ZQC A;  4DJ3 A;  1DJB A;  2VK3 A;  4KG2 A;  5FAT A;  1MY8 A;  1RP5 A;  1XKZ A;  3MZF A;  1YMS A;  1J3W A;  3UMD A;  1UWN X;  4KG5 A;  5HAI A;  2JKT M;  3NDG A;  5AQB A;  4F94 A;  5FEF A;  3K2N A;  5F1F A;  4E3N A;  4XXR A;  3FKV A;  1L3L A;  2XD1 A;  2WUQ A;  4IVI A;  5FA7 A;  1ERM A;  3VP2 A;  1ES5 A;  1ERQ A;  4KUK A;  3LR4 A;  4PM7 A;  3T4J A;  1AXB A;  2J9P A;  5HPI A;  4A5R A;  1T1B A;  1MWT A;  4KZB A;  2VLG A;  4OLD A;  4Y2F A;  3TW8 A;  4OPZ A;  2XR0 A;  3MBZ A;  4BQM A;  5CTN A;  2Y59 A;  2QKP A;  5KSH A;  1K4E A;  3E0Y A;  4HOI A;  4BL3 A;  5KMW A;  4XT2 B;  5M18 A;  3HUM A;  3GTC A;  3CJM A;  2PHY A;  4RYE A;  1MC0 A;  4X1L A;  3H7W B;  4UHU A;  3FG8 A;  2XH9 A;  3S22 A; 
#chains in the Genus database with same CATH homology
 2LB9 A;  3OCL A;  3LI9 A;  1LSV A;  4Z1W A;  4G3V A;  1OTI A;  2OOL A;  2WKQ A;  4HJ3 A;  1XFN A;  3PXP A;  4R3A A;  1P9R A;  4YNR A;  4B9O A;  5AVE A;  3TJZ C;  2W1R A;  3BJN A;  4Y5F A;  1NLZ A;  2EWV A;  3UB9 A;  2VZW A;  3VOL A;  3PBR A;  4ETX A;  4EW7 A;  2NUP C;  3GEC A;  1D06 A;  4JGP A;  4ARZ B;  4KUO A;  2PYR A;  1MZU A;  3MMH A;  4FSF A;  4LLO B;  4XT2 A;  3EGX C;  1NLY A;  1X0O A;  1OT6 A;  5F5Y A;  1YAX A;  2L1M A;  4MMN A;  4R38 A;  3EEA A;  1W63 M;  1S66 L;  2W3E A;  4BBT A;  4GW9 A;  5F68 A;  5IU1 A;  2PR6 A;  3BY9 A;  3RFB A;  4MDZ A;  3VE4 A;  5DF9 A;  5I5L A;  2VV7 A;  2J3W A;  3BY8 A;  1GSV A;  5HWV A;  1DP6 A;  3C2W A;  4HJ4 A;  3S7P A;  5TJJ A;  2VGL M;  1TD5 A;  4E04 A;  2QYB A;  1G28 A;  3R7W B;  3PBT A;  4GJ4 A;  3PYP A;  4AFI A;  1OTA A;  2FZ0 A;  2WKP A;  4MN7 A;  4EES A;  4EU0 A;  1OTB A;  4JGO A;  4HP9 A;  2VJW A;  2CMN A;  3MFX A;  1YSQ A;  3MF0 A;  3OCN A;  3MQ0 A;  4CLC B;  4GHI B;  5EFW A;  2GJ3 A;  4KQD A;  3IS2 A;  1MKM A;  3P7N A;  2PDR A;  1S1Y A;  4ETZ A;  4I3A A;  2ZBB A;  5LBR A;  3T4O A;  2QJ7 A;  3E4Q A;  2JKT I;  3MJQ A;  2K7S A;  4ME4 A;  1IOU A;  3FPW A;  3ZYT A;  4GCZ A;  2FH5 A;  1H3Q A;  1OT9 A;  2WKR A;  3S7N A;  3EWK A;  4UQI S;  3R7W A;  1LT0 A;  3OLO A;  5DKL A;  4DN0 A;  5FL3 A;  3T4K A;  2HF6 A;  2D02 A;  3IBR A;  4O01 A;  3CWF A;  4OOM A;  3CLO A;  4CLC C;  2W3F A;  2YKH A;  3LID A;  1P0Z A;  3E4O A;  4II7 A;  3T50 A;  1KOU A;  2XRN A;  3F1P B;  3UB7 A;  3CI6 A;  2PT7 A;  4HH2 A;  3A0V A;  3ULF A;  2PD8 A;  3KSF A;  2VKS A;  4HH3 A;  3UB6 A;  1WA9 A;  1TS7 A;  3VE3 A;  2OWJ A;  3LIC A;  2EA9 A;  4Q0I A;  2JKR M;  3CIT A;  5HD3 A;  2QWS A;  4HNB A;  5G4Z A;  4QPR A;  4BMW A;  2JHE A;  2O99 A;  1Y28 A;  1UWP X;  3HJK A;  2V9A A;  5A8B A;  2W1T A;  4BJP A;  4NXF A;  2KLI A;  2L0W A;  2OAP 1;  3G6O A;  4KQO A;  4HHD A;  3V67 A;  2PR5 A;  1DRM A;  2I9V A;  2O9B A;  4L9G A;  2R78 A;  4LRX C;  2QHK A;  2P7J A;  3KX0 X;  4LPZ A;  1LL8 A;  1H8M A;  2A24 B;  2M1C A;  2ZOH A;  4HIA A;  1TS0 A;  2W3H A;  1TS6 A;  1NWZ A;  3F1P A;  4GLQ A;  4FOF A;  3KYQ A;  3LI8 A;  1W63 Q;  4BBV A;  2BAS A;  5F6A A;  2D01 A;  3CUE C;  5HZH A;  3FPV A;  2QJ5 A;  1T19 A;  3IS2 B;  1GSW A;  2NUT C;  1NRJ A;  5IS1 A;  3HCY A;  3PBO A;  3CUE A;  2OWH A;  1YSP A;  3T4S A;  4EEU A;  1TF1 A;  3NOU C;  4K08 A;  2VX8 A;  2ZMF A;  2OAQ 1;  4WLA A;  1LSW A;  2B02 A;  1T1A A;  3PBS A;  5C5K A;  3KSI A;  5HDD A;  3H82 A;  3LFV A;  4B93 A;  4EER A;  2XSS A;  4I5S A;  3F1O A;  3KYZ A;  5CX7 A;  1OJG A;  3MQO A;  2Z6D A;  2L4R A;  3R4K A;  2XRO A;  3UE3 A;  3EQU A;  3EEH A;  2A24 A;  4UQI M;  1GSX A;  5G4Y A;  2KX6 A;  4PKY G;  4F3L A;  1V9Y A;  2P08 A;  3LR5 A;  1F9I A;  4R6L A;  3OC2 A;  5AVF A;  3JVU A;  4YWZ A;  2PD7 A;  4PHT A;  2V0W A;  4MN6 A;  1TS8 A;  5HPF A;  3LIB A;  3MQQ A;  3NOT C;  3VV4 A;  1YKD A;  3UB8 A;  3LIF A;  4PAU A;  1STZ A;  2B18 A;  4I39 A;  3B33 A;  3PBQ A;  5AJG A;  3KSG A;  3GDI A;  3TRC A;  2W1T B;  2K2N A;  3OBF A;  2M7U A;  4WUJ A;  2MJ6 A;  1XJ2 A;  3IBJ A;  4H6J A;  2LB5 A;  3CAX A;  4DMZ A;  3D3O A;  1XJ3 A;  1OPX A;  1N9O A;  3FC7 A;  1P9W A;  4IJG A;  3HJI A;  4IUK A;  2VA0 A;  4LRY C;  3EOI A;  3TE8 A;  2XA7 S;  3F1N A;  5DFY A;  1S67 L;  1XJ4 A;  3DBA A;  2J3T D;  4L9F A;  2KOI A;  4HI4 A;  4EXO A;  3U2A A;  1N9N A;  2O9A A;  4WEK A;  3UME A;  3ZQ5 A;  1F5M A;  2H28 A;  3B47 A;  3BQ8 A;  5HL6 A;  5DKK A;  1D7E A;  2W3G A;  4MN5 A;  1OJ5 A;  3PHY A;  1XFQ A;  1N9L A;  4DJ2 A;  1VHM A;  2JN7 A;  3PR6 A;  3S7O A;  4JGQ A;  4EEP A;  4HY8 A;  1F98 A;  3A0S A;  4L9E A;  3ICY A;  1LSX A;  2Z6C A;  1V9Z A;  3UE6 A;  5MC7 A;  3H82 B;  4MCW A;  3D72 A;  2JKR I;  3F1O B;  1IFQ A;  2VEA A;  4I3I A;  4WN5 A;  2EWW A;  4EQ1 A;  4O8G A;  3OOV A;  2HV1 A;  1JNU A;  3KO6 A;  2J80 A;  5TBM A;  2HGV A;  3RTY A;  3NOP C;  3LYX A;  4YOF A;  4F3L B;  1BYW A;  2GZA A;  3BW6 A;  2IA2 A;  3KSH A;  2M7V A;  1DP8 A;  5L8M A;  5IT5 A;  2PYP A;  5DFX A;  2ZMV A;  3C38 A;  3T4T A;  3JVV A;  4L0L A;  2O9C A;  4CLC D;  2HJE A;  5J3W A;  4EET B;  4WEL A;  4PKY A;  1XJ6 A;  3BQA A;  4Q0J A;  4NXE A;  5J7E A;  3K3D A;  1T1C A;  3LR3 A;  2HJ9 C;  1OTE A;  2YKF A;  3C30 A;  4HQA A;  4BBU A;  4ZRR A;  5K5B A;  4G3K A;  5KIZ A;  4NKP A;  3RH8 B;  2V1B A;  2ZOI A;  5HDS A;  4H6J B;  3H9W A;  4GS9 A;  4IHQ A;  4M4X A;  3T4Q A;  3MXQ A;  3K3C A;  1S4S A;  3H7W A;  3PBN A;  3T4L A;  1G6O A;  2P04 A;  4BWI A;  3EGD C;  2V1A A;  1UGU A;  4HP4 A;  1S1Z A;  2VV6 A;  4LRZ E;  4R70 A;  2W0N A;  4EUV A;  2W3D A;  4WEJ A;  2GX5 A;  1ODV A;  2Y79 A;  3A0R A;  3S7Q A;  4I38 A;  4NEE D;  3LR0 A;  3F1N B;  4Y3I A;  1ZHH B;  3E98 A;  5F69 A;  4DJ3 A;  4WF0 A;  2INW A;  3BWL A;  3LUQ A;  2J3T C;  2XA7 M;  3MR0 A;  4CLC E;  3B42 A;  3O5Y A;  2K31 A;  2Y8H A;  3SW1 A;  3UMD A;  4I3J A;  1UWN X;  2DMW A;  4ARZ A;  4NXG A;  2JKT M;  4UEY A;  1DP9 A;  3K2N A;  4OOL A;  1OTD A;  5HWW A;  1ZTU A;  5HD5 A;  1EW0 A;  2VGL S;  2VV8 A;  1P97 A;  5TBM B;  5J4E A;  1T18 A;  4NXB A;  4RQ9 A;  2O0Y A;  3EQV A;  1VB6 A;  4Q0H A;  4HJ6 A;  4P6Z M;  4KUK A;  3NJA A;  3LR4 A;  2V0U A;  3E4P A;  4O0P A;  2KDK A;  5DJU A;  3T4J A;  4CQH A;  5HPI A;  5HDC A;  2GNX A;  5HSQ A;  1T1B A;  2VLG A;  3NHQ A;  3C8C A;  3P01 A;  3W2Z A;  4Y2F A;  3TW8 A;  4G3W A;  3LIE A;  2QKP A;  5KSH A;  4CLC A;  3E0Y A;  4HOI A;  2G7U A;  4XT2 B;  4GHI A;  1S4R A;  2A2L A;  2PHY A;  1MC0 A;  4GS9 B;  2W27 A;  3H7W B;  3LIA A;  4JGR A;  4WL9 A;  4IUH A;  4P6Z S;  3FG8 A;  5DJT A;  5HWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...