1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
4XT2B 1LSXA 3VE3A 3UMDA 4HY8A 2B02A 3T50A 4GS9B 1GSXA 2PD7A 1T19A 2VV6A 2D01A 4KUKA 1LSVA 4JGRA 3H9WA 3NOPC 1T1CA 1DRMA 2INWA 5HSQA 1LT0A 2V9AA 3VE4A 3IS2B 3LIBA 3CLOA 4HH2A 2K7SA 2OOLA 3EWKA 4GHIB 3K3DA 3H7WB 2KDKA 1XJ6A 1UWPX 4KQDA 3PHYA 1N9OA 1OT9A 5HD3A 3KX0X 3VOLA 4NXEA 4I3JA 2ZBBA 2L0WA 3CWFA 2Z6DA 5F69A 1XJ3A 1OT6A 3NJAA 4WF0A 2QKPA 1TS8A 5EFWA 3ZQ5A 1T1BA 5F6AA 5HWVA 3FG8A 1GSWA 5F5YA 2A24B 4HI4A 1JNUA 5KIZA 4MN5A 1OTEA 2JHEA 2V0WA 2GJ3A 5I5LA 2V0UA 3B33A 4EETB 4HP9A 4HP4A 4EEPA 1TS0A 2VV7A 3IBRA 5DJUA 2L4RA 4H6JA 1XFQA 2QJ5A 2QWSA 2V1AA 3ICYA 3F1OA 3MQQA 1EW0A 4BBTA 1OJ5A 4MN6A 3E4QA 2M1CA 1VB6A 5AVFA 4JGQA 2W27A 2VEAA 1OTDA 1UGUA 4EQ1A 1X0OA 3LIDA 1NWZA 3MFXA 2OWJA 3OLOA 5J3WA 3UB6A 4HJ3A 3HJKA 3BY8A 4NXFA 1F98A 4EEUA 3C8CA 1KOUA 2PDRA 4L9GA 4KUOA 5A8BA 1G28A 1XJ2A 3EEHA 3MJQA 3RTYA 1WA9A 3LUQA 3LIFA 1BYWA 4EESA 1D06A 3F1PB 3H82B 1P0ZA 2PYPA 2KX6A 4PKYG 4R38A 5J4EA 4YWZA 3UE6A 1OTBA 3E4OA 2W0NA 4NXGA 3GECA 1DP9A 1S4SA 3A0SA 4LPZA 1LL8A 2I9VA 3UMEA 1T18A 3C2WA 4R6LA 1MZUA 4F3LA 4DJ3A 1XJ4A 4JGPA 2WKPA 1ODVA 1OTIA 3PYPA 4HJ6A 5G4ZA 2OWHA 1S67L 1P97A 1S4RA 4JGOA 4LRZE 1S1ZA 2BASA 4LRYC 5TBMA 2ZOIA 3LI8A 4H6JB 3P7NA 5J7EA 1F9IA 1V9YA 2PR5A 4PKYA 2Z6CA 5HDSA 1GSVA 2JN7A 3MXQA 1N9LA 2CMNA 3F1OB 5HZHA 5DKKA 1LSWA 4XT2A 4HNBA 5HWWA 3SW1A 2D02A 4E04A 4GS9A 2V1BA 3K3CA 3LIEA 5G4YA 2QJ7A 1XFNA 3G6OA 1D7EA 2H28A 5DKLA 1DP8A 5IU1A 4B9OA 1OJGA 3IS2A 4BBUA 2ZOHA 4GHIA 2QHKA 4HIAA 4R70A 3H7WA 3FC7A 1UWNX 2WKRA 3LYXA 3A0RA 2YKFA 3LIAA 3MQOA 5HWTA 4HQAA 4WLAA 4HHDA 3F1NA 3CAXA 1S1YA 4LRXC 2PR6A 1V9ZA 3BY9A 3RH8B 4I3AA 3NOTC 2PD8A 4GW9A 2A24A 4LLOB 4L9EA 2EA9A 4GCZA 5F68A 3GDIA 4EERA 2R78A 2VLGA 1N9NA 3F1NB 4WL9A 4EW7A 4L9FA 1TS7A 2P7JA 5IS1A 3ULFA 2YKHA 1S66L 3NHQA 3UB9A 2L1MA 4F3LB 5HDDA 2VV8A 2PHYA 4M4XA 1T1AA 3D72A 3BWLA 4DJ2A 4WN5A 3NOUC 4I3IA 4NXBA 4EXOA 4WUJA 4I5SA 3A0VA 3UB8A 2WKQA 3E4PA 1OTAA 1TS6A 1DP6A 2PYRA 5HDCA 2HV1A 2J80A 5AVEA 3LICA 5TBMB 3UB7A 3HJIA 4I38A 1Y28A 3MR0A 5HD5A 4HOIA 4BBVA 4I39A 4RQ9A 4HH3A 4HJ4A 3LI9A 4K08A 3F1PA 5DJTA 3H82A 4R3AA
chains in the Genus database with same CATH superfamily
4BJPA 3VE3A 4X1MA 3T50A 3KSGA 3NY4A 2PD7A 5K5BA 2D01A 1FIKA 4DDSA 3NOPC 5U47A 1DRMA 4XUZA 1XGJA 2INWA 2JCHA 1K4EA 5F82A 3VP3A 2P08A 3QP5A 4HH2A 4C6YA 3QNCA 2ZC6B 4OH0A 3GRJA 4GHIB 3D9YA 3ZG5A 1NYYA 1FOFA 1WYCA 1XJ6A 1UWPX 1KGEA 2VX8A 1KE0A 4OKPA 1ACFA 5DF7A 3JVVA 2JKRI 1NJ4A 2Z6DA 2DMWA 1OMEA 1OT6A 3NJAA 1LHYA 5EFWA 3UY6A 3GSGA 2BG1A 1RCJA 3C5AA 2A24B 4HI4A 3HLDA 2J8YA 2XD5A 4HP4A 3T4LA 1TS0A 3BEBA 3IBRA 3UE1A 1XKZA 3NULA 2M7VA 2ZMVA 3C7VA 2W3DA 3IF6C 1KDSA 2IA2A 4FH2A 1PRQA 2QWSA 1K4FA 2J3TD 1HTZA 4WBGA 3E4QA 4Y7PA 1VB6A 4PM5A 2Q9MA 3PAEA 1H5XA 3FWLA 1X0OA 3LIDA 4X55A 3OOVA 1NWZA 3MFXA 5HAQA 3MKEA 2G7UA 4PM9A 1AWIA 1U60A 4O7DA 3V67A 3OLOA 5E43A 3UB6A 1NZOA 4HJ3A 1K56A 3IWOA 3T4OA 4NXFA 4Q0IA 2ZM2A 4EEUA 1KOUA 1PZPA 5CTMA 4KUOA 1G28A 3P98A 1J3WA 2HPBA 4KG6A 2W1TB 3VFHA 3IXBA 3VOZA 3TJZC 3A3IA 1PW8A 1G68A 2W3EA 1NRJA 2ZL1A 4Y0OA 3OPHA 1K0KA 3IH9A 4EBNA 2XD1A 3IWIA 5FQMA 2G2UA 3F1PB 1SKFA 1MPLA 2W1RA 4DE3A 2MJ6A 3WS0A 2J7VA 2C6WB 4GJ4A 4PKYG 1J9MA 3E98A 1VQQA 3Q82A 5BOHA 3DW0A 3L9KA 4R38A 3UE6A 3MSHA 4FUWA 2B95A 2WYXA 3W4QA 1OTBA 2W0NA 5FQ9A 1EROA 5AQBA 5EUAA 2P74A 1XA1A 3ZG8B 1GHMA 1SKOA 2J3WA 2I9VA 2O9BA 2ZD8A 3IQAA 1VEUB 4YFMA 2ZM0A 4JLFA 4DJ3A 2OAQ1 5HL1A 1XJ4A 1PW1A 5HX9A 3IXHA 4CQHA 3BFDA 2ZQAA 5CERA 4P0MA 3JPUA 1ODVA 3PYPA 3FPVA 3KSFA 3IBJA 3GV9A 2Z2LB 2DNSA 3BFGA 1S1ZA 2BASA 2Z2MB 3M2KA 1ES2A 4DN0A 3W4OA 4H6JB 4WELA 2ZQ8A 1JWPA 3W8KA 4PM8A 4CLCE 5HZHA 3VP2A 3N8LA 4HBUA 3HUNA 4X68A 4XT2A 5HWWA 3SW1A 5EE8A 4E04A 1RGYA 2XA7S 3BM6A 1RP5A 2X71A 2WZXA 3B3XA 2KOIA 4ESPA 4E3JA 4NG2A 4ZRRA 5CX7A 3Q7ZA 4X1LA 5F1GA 1OJGA 4E3NA 5CEBA 5M1AA 4BBUA 5FAQA 4PAUA 3HLBA 2ZC3B 2HDSA 3C4PA 1FCMA 4R70A 1KDWA 2WKRA 3PBTA 3VSLA 2YKFA 5CHUA 3LIAA 1KE4A 3OCNA 5HWTA 5A91A 1M6KA 3F1NA 4G3WA 2DCFA 1V9ZA 2Y79A 4MBKA 3QP6A 4OP8A 1O7EA 3RH8B 3IX8A 2HJ9C 3NOTC 4LLOB 3O87A 5EVIA 4L9EA 4CLCC 2EA9A 4YINA 2R78A 4UA7A 1TD5A 1N9NA 2XROA 1W63M 5E2FA 3P09A 4U0TA 1QMEA 4S2OA 5DTTA 1E3UD 1YLWA 3OCLA 1XA7A 2YKHA 2WZZA 2GZAA 3CPTA 2WKEA 3C7UA 3UB9A 3ZNYA 4UA6A 2UV0E 4IUKA 1DJAA 3IX4A 4F3LB 1CK3A 3CJMA 4R23A 1L0GA 5HDDA 4B4XA 3WS2A 4EUVA 3D72A 4K91A 4KQRA 3NI9A 4NKPA 2Y8HA 3W4PA 3E2LA 5FSRA 4I5SA 3A0VA 4FSFA 3QP2A 3LR3A 3UO9A 1OTAA 1Q2QA 1TS6A 3JYIA 4UHUA 4M3KA 2ZMFA 5AVEA 3RXWA 3KYZA 3LICA 1ZKJA 3MBZA 2WGWB 4KZ6A 4E3MA 4OPQA 3K2NA 3MFDA 4EV4A 5LBRA 5E2EA 4AFIA 4I39A 4FOFA 4WMCA 4HH3A 2JE5A 3DTMA 3IHAA 5FQQA 3SS3A 5FATA 3EQUA 4O8GA 1DJBA 1LSXA 5AQAA 3S7NA 2V1ZA 2Y2KA 3UMDA 3C30A 5MC7A 4P6BA 3LCEA 5FDHA 5JYOA 4KZ7A 4GS9B 1GSXA 4K0XA 1T19A 2ZJ9A 2EXBA 1LSVA 3TSGA 4JGRA 4JXGA 3H9WA 2JKTI 1W7FA 4WZ5C 3UB5P 2Y2JA 2GNXA 3VE4A 3IS2B 3LIBA 5CECA 1OPXA 2OOLA 4FCFA 2WK0A 1I2WA 3K3DA 1G5UA 2KDKA 2FFYA 5M19A 4KQDA 3CUEC 3PHYA 3SS5A 1ERQA 1N9OA 3VP1A 1OT9A 4ZTKA 1C3BA 5FQKA 3VOLA 3I7JA 1IKGA 4I3JA 5HPFA 5L09A 5DTSA 4MCWA 3TRCA 1FSYA 1MWTA 5F69A 1BTLA 5TFQA 4WZ5A 3BFEA 2A3UA 2HDRA 1SDEA 4WM9A 1JTGA 5IT5A 1K57C 3ZQ5A 1T1BA 5F6AA 4QB8A 2XFSA 1PYYA 2WKHA 3RXXA 2V0WA 4R3JA 2H10A 2GJ3A 1P9WA 3MQ0A 2V0UA 3M2JA 5I5LA 2XF3A 4YOFA 4EETB 2B18A 3N8SA 1EWZA 5DJUA 2L4RA 3LFVA 4DF6A 1SCWA 4D60A 3CI6A 1H3QA 2QJ5A 2V1AA 3F1OA 3MQQA 4MNRA 1K6RA 4QJGA 4BBTA 2ZQ9A 1OJ5A 3KYQA 3MS6A 2M1CA 4PMAA 3U4LP 2ZC4B 5AVFA 2W27A 2VEAA 1UGUA 4IVKA 4X69A 1K55C 4X25A 3V3RA 1MXOA 2Y4AA 5GLAA 5CXWA 1LL5A 4UQIS 2OWJA 3FV7A 1JWZA 3BFCA 4JPMA 2Y2PA 3HJKA 4EUZA 3BY8A 2VGLM 3C8CA 2PDRA 5DF9A 4L9GA 3UDFA 3ZFZA 5A8BA 4S2PA 1KE3A 3MXRA 4GOGA 5HPIA 4E3LA 4GD6A 1K38A 4B93A 2UWXA 3VOYA 2JKFA 4HESA 2FH5A 4JXWA 4ZJ2A 1K55A 1LLBA 4WYYA 1BYWA 5DTKA 4B88A 3IF6B 4X6TA 2KLIA 4S2NA 1BUEA 3H82B 4L0LA 1K54A 1P0ZA 2KX6A 3FPWA 3BW6A 1ONHA 4N9KA 1MWRA 2NUPC 5L07A 3HUMA 1S4SA 5DFXA 5KMWA 4E3OA 3NDGA 4ETZA 4LV0A 1T18A 4JXSA 4Y2FA 3C2WA 2BTFP 4R6LA 4U0XA 3DTKA 1TDLA 2IWBA 1FR1A 1S6RA 4JGPA 3AGFA 5HW3A 4OOLA 4LFUA 5FI7A 5G4ZA 2OWHA 4P6ZM 4LRZE 4IEDA 4NK3A 3VP4A 1JVJA 4Z9QA 3Q7VA 4QY5A 3S7PA 2HP5A 4OQ0A 5TBMA 1IYSA 3D4FA 3NDEA 3LGOA 3GTCA 4N9LA 1V9YA 4IBXA 4X56A 3WWXA 3ZVTA 1GSVA 3MXQA 1N9LA 4EBPA 1YAXA 3UE3A 2OLUA 1LSWA 2LB5A 3VV4A 2O9AA 3IF5A 3G35A 5FAOA 2D02A 1IYOA 5G4YA 2QJ7A 1XFNA 3FKVA 2W3HA 5DKLA 3N7WA 5IU1A 1ZG4A 2HF6A 5FASA 1PFLA 3V3SA 5IHVA 4GHIA 4HIAA 2X02A 1L2SA 3UPPA 3A0RA 4Y13A 1RGZA 1YLZA 3OPLA 4WLAA 1Z09A 1W63Q 3BFFA 1PZOA 3MXSA 4JF5A 5CTNA 3R7WB 4DKIA 5A92A 2B5RA 4DRTA 2A49A 2A24A 2ZMAA 1YKDA 5F68A 1IOUA 1ZHHB 4EERA 4A5RA 5EVLA 3F1NB 4YNRA 4MBFA 1K6SA 4EW7A 1TS7A 1XX2A 1TEMA 1MKMA 1L0EA 5IS1A 4KG5A 5L8MA 3T4KA 2HZ5A 3T1RA 5EVEA 2VA0A 3MMHA 3CZDA 1TF1A 3ULFA 3NHQA 3RJUA 1WE4A 1ERMA 2L1MA 4KZ3A 2P04A 5D3OA 4OQIA 5DVAA 2QZ6A 3UPNA 4BLMA 2QYBA 1SZVA 4I3IA 4NXBA 4EXOA 4EU0A 1ESIA 2EWVA 2O9CA 1IYQA 2WKQA 3E4PA 1DP6A 3FZCA 1BLCA 2HGVA 2RL3A 3BYDA 2J80A 2EFXA 4CLCB 4IBRA 2E8IA 2Y2QA 1W79A 4RYEA 2Y55A 3MF0A 4RA7A 1SDNA 3HJIA 2JBFA 4GDBA 1KGGA 2W1TA 5AQ9A 4I38A 2VKSA 4MLLA 2WUQA 3ZVWA 5HD5A 4BBVA 2Q0OA 4OQHA 4CLCD 2EFUA 4R0QA 2Y2NA 3N8RA 4Y0UA 1FR6A 2OV5A 3F1PA 1E25A 5DJTA 1VM1A 4DXBA 3WRTA 5TJJA 3SZTA 2WADA 5FDSA 4BENA 4Q0HA 2B02A 5EVIC 5HAPA 3DWKA 3KYEA 3D3OA 4LV1A 5DFYA 4FD8A 1T1CA 3A3JA 4FH4A 3IWQA 2E8JA 2EX2A 2Y59A 4QD4A 5HSQA 1LT0A 4BD0A 1TDGA 2HJEA 4Y3IA 2K7SA 2WGIA 3NECA 3EWKA 1CI9A 4ARZB 3H7WB 1TVFA 2P9VB 4GKUA 5HD3A 3T4TA 4NXEA 1IELA 1VEUA 3LY4A 1BZAA 3A3FA 5JYPA 3OC2A 3CWFA 4QPRA 3U2AA 4O0PA 5GHZA 4WF0A 2QKPA 3G30A 1TS8A 5KSHA 4R3BA 5L10A 5HWVA 4KZ8A 3FG8A 1I5QA 1GSWA 1FSWA 5GLCA 1JNUA 2Y2IA 5KIZA 3PBNA 1VETB 1YPRA 1FCOA 3ZYTA 3G31A 3B33A 4OOYA 4HP9A 4EEPA 3IXDA 1H0MA 5KZHA 3MZDA 1VHMA 1YQSA 5CHJA 4H6JA 5AJGA 2VGKA 1XFQA 3ZHHA 1NXYA 2EXAA 3QNBA 2H0TA 4G3KA 4ZAMA 4WEKA 1BLPA 1EW0A 2PBYA 2XH9A 4Q0JA 2Y2OA 4MN6A 3OBFA 4JGQA 2XRNA 4UA9A 1OTDA 3IX3A 2HDUA 4IVIA 3C4OA 3T1QB 5GHXA 1MWSA 1K25A 5EOOA 4GZBA 3G4PA 1BSGA 5FA7A 5J3WA 1FCNA 2WKIA 3BLMA 4ZJ1A 3SH8A 5FAPA 1PIOA 4KZAA 2QPNA 5HAIA 3MJQA 3RTYA 4FTXA 2JKRM 2WGVA 3BJNA 2Y2MA 3EGDC 3UNWA 1ONGA 3LIFA 4GN2A 4ETXA 4XXRA 1CJFA 3LY3A 1P9RA 3HLEA 2WAFA 4K0WA 3HLFA 5F83A 5C5KA 1H8ZA 3BQAA 2PYPA 4P6ZS 5EOEA 1CEGA 3BECA 5TGFA 1E3UA 3B42A 4F94A 3QP1A 5J4EA 2PT7A 4OVDA 3ZCZA 4Y5FA 3ZGAB 3PAGA 4JF4A 4OLGA 4NXGA 1DP9A 4OOMA 3A0SA 4LPZA 3Q81A 2I72A 2Y2LA 1ALQA 1LL8A 3ITBA 3LR0A 5M18A 3HLWA 3AGEA 3UMEA 4E3KA 3SH9A 4KQQA 4F3LA 1GHIA 2WKPA 4P87A 3T12B 1NY0A 1OTIA 4KZ4A 4HJ6A 2FFFB 3GVBA 1HD8A 3KSHA 3UDXA 3LO7A 1ZG6A 1PI4A 2EX8A 3UN7A 2R9XA 4LGWA 4MMNA 5FEFA 1Y4OA 3LI8A 2WGWA 3P7NA 5J7EA 3GMWA 1F9IA 3CHWP 2R9WA 1ES3A 2PR5A 4E6XA 4PKYA 5HDSA 4OQGA 2JN7A 4S2NC 2CMNA 3EGXC 4KZ5A 2V20A 4KZBA 1K54C 2ZQ7A 5AQ7A 1GHPA 5KSCA 1ES5A 3Q7VB 4S2KA 1GCEA 4GS9A 2V1BA 3K3CA 3LIEA 3NBLA 5CHMA 2ACGA 2VGJA 3G6OA 2O0YA 3O5YA 5DF8A 1D7EA 3HLGA 5CGSA 4KG2A 2OSUA 1JTDA 1DP8A 4B9OA 4MBHA 3T1XA 3IS2A 2V8CA 2ZOHA 3ITAA 3E2KA 1UWNX 1L3LA 1QMFA 1L0FA 4B4ZA 1K56D 3BRMA 4DE0A 2PRFA 1PWGA 2ZL1B 1YM1A 4HQAA 4S2JA 5E2GA 2EX9A 3CAXA 4LRXC 1GA9A 3T1SA 5FQJA 4Q8IA 4BL2A 4QU3A 1L0DA 3IT9A 4I3AA 1YLTA 3T4QA 3DAVA 4GLQA 1D1JA 4GCZA 4N1XA 3G32A 4WL9A 4L9FA 3HCYA 2XK1A 5A93A 2ZM8A 3ZG7B 1YT4A 1SKOB 2G2WA 3TE8A 4N92A 2W3FA 4LENA 5HFOA 3VP0A 1WYBA 2VV8A 2PHYA 1BLSA 2O99A 4M4XA 4R4SA 2V8FA 4DE1A 3VMAA 2Q9NA 2A2LA 4DJ2A 3KO6A 4BWIA 2H0YA 4WUJA 4NEED 4BL3A 2XGNA 5CGXA 3AGDA 4DXCA 3UE0A 2XDMA 3O86A 5FQIA 3UB7A 3A3EA 1XPBA 3EOIA 3MR0A 4HOIA 3E0YA 2FZ0A 5J8XA 4HJ4A 2C5WB 2VJWA 3IF6A 4QWOA 4LCMA 1G6OA 5L2FA 2XSSA 3H82A 2CC1A 1IYPA 4XT2B 1ZTUA 2IWCA 4HY8A 1MY8A 2VV6A 5FEGA 4BMWA 4H8RA 4KUKA 3S22A 4JBFA 1AXBA 4DDYA 5TR7A 3G34A 1F5MA 4JF6A 2J3TC 2PU2A 2V9AA 3LR4A 3CLOA 1HVBA 1GA0A 5EPHA 3PR6A 1STZA 3MZFA 3FYZA 3LR5A 4MEZA 2H5SA 3CMZA 3V39A 3GR2A 3KX0X 4GD8A 4C75A 2OAP1 2ZBBA 2L0WA 5GL9A 1YMXA 3JVUA 4UQIM 4OONA 2DRWA 1XJ3A 5E2HA 3DBAA 3QP4A 1YSPA 5GLDA 4II7A 5EV0A 3MKFA 1YLPA 2ZQCA 5F5YA 4WEJA 5EVIB 3S4XA 3OZHA 3WS4A 4MN5A 4E6WA 1OTEA 2JHEA 3NIAA 1HLUP 4X53A 1E4DA 1NYMA 4ME4A 1YLYA 4PHTA 4UAAA 2EWWA 2RCXA 2VV7A 5EVID 3DWZA 1YMSA 3PBRA 4PPRA 3DTEA 1LI0A 3HL9A 3CPTB 1LI9A 1SHVA 3ICYA 3ZNTA 1CI8A 1Q2PA 4S2MA 4NETA 3TW8A 4RX2A 2JKTM 3HBRA 3CITA 3N4IA 5FI2A 1W8YA 1YSQA 3FKWA 3QP8A 4EQ1A 3RFBA 4LCLA 3R4KA 1NLZA 1FILA 1S0WA 4HBTA 1CEFA 1KVLA 4S2LA 4QY6A 3NC8A 4RVAA 4ZBEA 3ISGA 4RX3A 1F98A 4UEYA 2WAEA 2J9OA 1XP4A 3PBOA 2OLVA 1DY6A 4CPKA 1XJ2A 4XUXA 3EEHA 5A90A 2VK3A 4IJGA 1WA9A 3LUQA 1NRFA 3WS1A 2IWDA 2AVXA 2Y2HA 1PWCA 2LB9A 2BLSA 5EM1A 1MC0A 1ESUA 4EESA 4QHCA 1FQGA 2M7UA 1D06A 3W2ZA 1IEMA 5HL6A 2XQZA 1DJCA 3R7WA 1BT5A 5CEDA 4WMCD 3EEAA 1NLYA 4ZJ3A 5EECA 4D2OA 4N1HA 4YWZA 3M6BA 1NZUA 3E4OA 1XXMA 3GECA 4IUHA 1G6AA 2Y2GA 2V2FF 3BLSA 4Y17A 1YLJA 4OPZA 2QMIA 2VGLS 1HZOA 3WS5A 1N4OA 2ZQDA 3CG5A 1MZUA 4EWFA 1I2SA 3O88A 2PAVP 5CGWA 2XEPA 4KZ9A 3T4JA 5CRFA 4OPRA 2HP9A 4IHQA 4KENB 3M6HA 1S67L 3PXPA 4BD1A 4EBLA 1P97A 3S7OA 1S4RA 2J9PA 5GHYA 3IHBA 5GLBA 4JGOA 4OPYA 1H8MA 4CLCA 3LEZA 4OLDA 3HUOA 4LRYC 3ZG0A 1MBLA 4MDZA 2ZOIA 3V5MA 4U3TA 3VFFA 3GQZA 1PI5A 2ZC5B 2XR0A 3HREA 3C38A 3TG9A 2XFTA 4CJNA 2HDQA 2Z6CA 4HEFA 3F1OB 1KGFA 5DKKA 3PBQA 5I94A 2XLNA 3PTEA 4P85A 4HNBA 1IFQA 3WRZA 1N9BA 5HARA 2GX5A 3Q07A 2EX6A 2H28A 1XGIA 4C3QA 3KSIA 1BULA 1MKIA 2GDNA 5F1FA 4GNUA 2K2NA 2QHKA 4BQMA 4ARZA 3H7WA 3FC7A 3B47A 2P9VA 4R4RA 2JC7A 3EQVA 4R1GA 3LYXA 2X01A 3MQOA 1A0KA 4EQIA 1EI5A 3SS4A 4HHDA 1ZC2A 4GDNA 3HVFA 3S1YA 1M40A 1S1YA 5EM0A 2PR6A 1MWUA 3S7QA 4DE2A 3BY9A 1LL9A 4G3VA 2K31A 4Y0TA 2PD8A 2VZWA 4GW9A 3IXGA 2XA7M 2PBDP 1VETA 4E3IA 3GDIA 3LEQA 3Q1FA 1H8YA 2VLGA 2ZLYA 5G18A 4Y15A 5FL3A 3ZDJA 3IH8A 2P7JA 3A3DA 4WZ4A 2ZC7A 3TOIA 3G2YA 3UDIA 1PWDA 1W8QA 2Y91A 3DTIA 3G2ZA 1S66L 4PM7A 4MN7A 3N6IA 3CUEA 1PNEA 3L7HA 3PBSA 5FI6A 3P01A 1IKIA 2W3GA 1CF0A 3O3VA 1Z6FA 3VSKA 4GB7A 4ID4A 1T1AA 4O01A 4LV3A 1O07A 3BWLA 2HP6A 3NCKA 4WN5A 3NOUC 2NUTC 3BQ8A 2JKGA 3HLCA 3UB8A 4JXVA 3V50A 1K57A 4DMZA 1F2KA 1JWVA 3UPOA 2PYRA 5HDCA 2HV1A 3MZEA 3OPPA 1BLHA 4OP5A 4ZDXA 5TBMB 1W5DA 1KVMA 4S2IA 3QHYA 4KQOA 4Z1WA 1Y28A 4JKTA 3OPRA 2PU4A 1CQAA 4LV2A 3T4SA 1ES4A 4RQ9A 3SH7A 3LI9A 4PM6A 3ZG9B 1Y54A 4K08A 3SOIA 4R3AA
chains in the Genus database with same CATH topology
4BJPA 4XT2B 1LSXA 5TJJA 1ZTUA 3VE3A 3S7NA 4Q0HA 4HY8A 3UMDA 3C30A 2B02A 5MC7A 3T50A 3KSGA 4GS9B 1GSXA 2PD7A 3D3OA 1T19A 2VV6A 5DFYA 5K5BA 4BMWA 2D01A 4KUKA 1LSVA 4JGRA 3H9WA 2JKTI 1F5MA 3NOPC 1T1CA 1DRMA 2INWA 5HSQA 1LT0A 2J3TC 2V9AA 3VE4A 2GNXA 3LR4A 3IS2B 3LIBA 2HJEA 2P08A 3CLOA 4HH2A 4Y3IA 2K7SA 1OPXA 2OOLA 3EWKA 4GHIB 3PR6A 3K3DA 4ARZB 3H7WB 2KDKA 1STZA 1XJ6A 1UWPX 3LR5A 4KQDA 3CUEC 3PHYA 1N9OA 1OT9A 2VX8A 5HD3A 3KX0X 3VOLA 3T4TA 4NXEA 4I3JA 5HPFA 2OAP1 2ZBBA 2L0WA 3OC2A 4MCWA 3JVVA 3JVUA 4UQIM 3TRCA 2JKRI 3CWFA 4QPRA 2Z6DA 5F69A 1XJ3A 2DMWA 3U2AA 3DBAA 4O0PA 1OT6A 3NJAA 4WF0A 1YSPA 2QKPA 5IT5A 1TS8A 4II7A 5EFWA 3ZQ5A 1T1BA 5KSHA 5F6AA 5HWVA 3FG8A 1GSWA 5F5YA 4WEJA 2A24B 4HI4A 1JNUA 5KIZA 4MN5A 1OTEA 3PBNA 2JHEA 2V0WA 2GJ3A 1P9WA 3MQ0A 2V0UA 5I5LA 3ZYTA 3B33A 4YOFA 4EETB 4HP9A 4HP4A 4EEPA 4ME4A 3T4LA 1TS0A 2B18A 4PHTA 2EWWA 2VV7A 3IBRA 1VHMA 5DJUA 2L4RA 3LFVA 5AJGA 4H6JA 2M7VA 3PBRA 1XFQA 2ZMVA 1H3QA 3CI6A 2W3DA 2QJ5A 2IA2A 2QWSA 4G3KA 2V1AA 3ICYA 3F1OA 3MQQA 4WEKA 1EW0A 2J3TD 4BBTA 4Q0JA 1OJ5A 4MN6A 3KYQA 3E4QA 3OBFA 2M1CA 1VB6A 3TW8A 5AVFA 4JGQA 2W27A 2JKTM 2XRNA 2VEAA 1OTDA 3CITA 1UGUA 4EQ1A 1YSQA 1X0OA 3RFBA 3LIDA 3R4KA 3OOVA 1NWZA 3MFXA 1NLZA 2G7UA 4UQIS 2OWJA 3V67A 3OLOA 5J3WA 3UB6A 4HJ3A 3HJKA 3T4OA 3BY8A 4NXFA 2VGLM 4Q0IA 1F98A 4EEUA 3C8CA 1KOUA 4UEYA 2PDRA 5DF9A 4L9GA 3PBOA 4KUOA 5A8BA 1G28A 5HPIA 1XJ2A 4B93A 2W1TB 3EEHA 3MJQA 3RTYA 3TJZC 2JKRM 4IJGA 1WA9A 3LUQA 3BJNA 2W3EA 2FH5A 3EGDC 1NRJA 2LB9A 3LIFA 1BYWA 4ETXA 1MC0A 4EESA 2M7UA 1D06A 3W2ZA 1P9RA 2KLIA 3F1PB 5HL6A 3H82B 2W1RA 4L0LA 2MJ6A 3R7WA 5C5KA 3BQAA 1P0ZA 2PYPA 4GJ4A 4P6ZS 2KX6A 3FPWA 3EEAA 4PKYG 3E98A 3BW6A 1NLYA 3B42A 4R38A 5J4EA 4YWZA 3UE6A 2PT7A 2NUPC 1OTBA 4Y5FA 3E4OA 2W0NA 4NXGA 3GECA 1DP9A 1S4SA 4OOMA 3A0SA 4IUHA 4LPZA 5DFXA 1LL8A 3LR0A 2J3WA 4ETZA 2I9VA 2O9BA 3UMEA 2VGLS 1T18A 3C2WA 4R6LA 4Y2FA 1MZUA 4F3LA 4DJ3A 2OAQ1 1XJ4A 4JGPA 2WKPA 4CQHA 3T4JA 1ODVA 1OTIA 4OOLA 3PYPA 4IHQA 4HJ6A 3FPVA 3KSFA 3IBJA 5G4ZA 2OWHA 1S67L 3PXPA 4P6ZM 1P97A 3S7OA 1S4RA 3KSHA 4JGOA 4LRZE 1H8MA 4CLCA 1S1ZA 2BASA 4LRYC 4MDZA 3S7PA 5TBMA 2ZOIA 4MMNA 4DN0A 3LI8A 4H6JB 4WELA 3P7NA 5J7EA 3C38A 1F9IA 1V9YA 2PR5A 4CLCE 4PKYA 2Z6CA 5HDSA 1GSVA 2JN7A 3MXQA 1N9LA 2CMNA 3EGXC 3F1OB 5HZHA 5DKKA 1YAXA 3UE3A 3PBQA 1LSWA 2LB5A 4XT2A 3VV4A 2O9AA 4HNBA 1IFQA 5HWWA 3SW1A 2D02A 4E04A 2XA7S 4GS9A 2V1BA 3K3CA 3LIEA 5G4YA 2KOIA 2GX5A 2QJ7A 1XFNA 3G6OA 2O0YA 3O5YA 2W3HA 1D7EA 2H28A 4ZRRA 3KSIA 5CX7A 5DKLA 1DP8A 5IU1A 4B9OA 2HF6A 1OJGA 3IS2A 4BBUA 2ZOHA 4PAUA 2K2NA 4GHIA 2QHKA 4HIAA 4R70A 4ARZA 3H7WA 3FC7A 1UWNX 2WKRA 3B47A 3PBTA 3EQVA 3LYXA 3A0RA 2YKFA 3LIAA 3MQOA 3OCNA 5HWTA 4HQAA 4WLAA 4HHDA 3F1NA 3CAXA 4G3WA 1W63Q 1S1YA 4LRXC 2PR6A 1V9ZA 2Y79A 3S7QA 3BY9A 3R7WB 3RH8B 4G3VA 2K31A 4I3AA 3T4QA 2HJ9C 3NOTC 2PD8A 2VZWA 4GW9A 2A24A 4LLOB 4GLQA 4L9EA 4CLCC 2XA7M 1YKDA 2EA9A 4GCZA 5F68A 1IOUA 1ZHHB 3GDIA 4EERA 2R78A 1TD5A 2VLGA 1N9NA 3F1NB 4YNRA 2XROA 1W63M 5FL3A 4WL9A 4EW7A 4L9FA 1TS7A 1MKMA 2P7JA 5IS1A 3HCYA 5L8MA 3T4KA 3OCLA 2VA0A 3MMHA 1TF1A 3ULFA 2YKHA 1S66L 2GZAA 3NHQA 4MN7A 3UB9A 3TE8A 3CUEA 4IUKA 3PBSA 2L1MA 2W3FA 3P01A 2W3GA 2P04A 4F3LB 5HDDA 2VV8A 2PHYA 2O99A 4EUVA 4M4XA 1T1AA 3D72A 4O01A 3BWLA 4NKPA 2A2LA 2Y8HA 4DJ2A 4WN5A 3KO6A 3NOUC 2QYBA 4I3IA 4NXBA 4BWIA 4EXOA 2NUTC 4EU0A 3BQ8A 4WUJA 2EWVA 4I5SA 3A0VA 4NEED 2O9CA 4FSFA 3UB8A 3LR3A 2WKQA 4DMZA 3E4PA 1OTAA 1TS6A 1DP6A 2PYRA 2HGVA 5HDCA 2HV1A 2J80A 2ZMFA 5AVEA 4CLCB 3KYZA 3LICA 3MF0A 5TBMB 3HJIA 3UB7A 2W1TA 4I38A 2VKSA 3EOIA 4KQOA 4Z1WA 1Y28A 3K2NA 3MR0A 5HD5A 4HOIA 3E0YA 4BBVA 5LBRA 4CLCD 3T4SA 4AFIA 4I39A 2FZ0A 4RQ9A 4FOFA 4HH3A 4HJ4A 2VJWA 3LI9A 4K08A 1G6OA 3F1PA 2XSSA 5DJTA 3EQUA 3H82A 4O8GA 4R3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT2 B;  1LSX A;  3VE3 A;  3UMD A;  4HY8 A;  2B02 A;  3T50 A;  4GS9 B;  1GSX A;  2PD7 A;  1T19 A;  2VV6 A;  2D01 A;  4KUK A;  1LSV A;  4JGR A;  3H9W A;  3NOP C;  1T1C A;  1DRM A;  2INW A;  5HSQ A;  1LT0 A;  2V9A A;  3VE4 A;  3IS2 B;  3LIB A;  3CLO A;  4HH2 A;  2K7S A;  2OOL A;  3EWK A;  4GHI B;  3K3D A;  3H7W B;  2KDK A;  1XJ6 A;  1UWP X;  4KQD A;  3PHY A;  1N9O A;  1OT9 A;  5HD3 A;  3KX0 X;  3VOL A;  4NXE A;  4I3J A;  2ZBB A;  2L0W A;  3CWF A;  2Z6D A;  5F69 A;  1XJ3 A;  1OT6 A;  3NJA A;  4WF0 A;  2QKP A;  1TS8 A;  5EFW A;  3ZQ5 A;  1T1B A;  5F6A A;  5HWV A;  3FG8 A;  1GSW A;  5F5Y A;  2A24 B;  4HI4 A;  1JNU A;  5KIZ A;  4MN5 A;  1OTE A;  2JHE A;  2V0W A;  2GJ3 A;  5I5L A;  2V0U A;  3B33 A;  4EET B;  4HP9 A;  4HP4 A;  4EEP A;  1TS0 A;  2VV7 A;  3IBR A;  5DJU A;  2L4R A;  4H6J A;  1XFQ A;  2QJ5 A;  2QWS A;  2V1A A;  3ICY A;  3F1O A;  3MQQ A;  1EW0 A;  4BBT A;  1OJ5 A;  4MN6 A;  3E4Q A;  2M1C A;  1VB6 A;  5AVF A;  4JGQ A;  2W27 A;  2VEA A;  1OTD A;  1UGU A;  4EQ1 A;  1X0O A;  3LID A;  1NWZ A;  3MFX A;  2OWJ A;  3OLO A;  5J3W A;  3UB6 A;  4HJ3 A;  3HJK A;  3BY8 A;  4NXF A;  1F98 A;  4EEU A;  3C8C A;  1KOU A;  2PDR A;  4L9G A;  4KUO A;  5A8B A;  1G28 A;  1XJ2 A;  3EEH A;  3MJQ A;  3RTY A;  1WA9 A;  3LUQ A;  3LIF A;  1BYW A;  4EES A;  1D06 A;  3F1P B;  3H82 B;  1P0Z A;  2PYP A;  2KX6 A;  4PKY G;  4R38 A;  5J4E A;  4YWZ A;  3UE6 A;  1OTB A;  3E4O A;  2W0N A;  4NXG A;  3GEC A;  1DP9 A;  1S4S A;  3A0S A;  4LPZ A;  1LL8 A;  2I9V A;  3UME A;  1T18 A;  3C2W A;  4R6L A;  1MZU A;  4F3L A;  4DJ3 A;  1XJ4 A;  4JGP A;  2WKP A;  1ODV A;  1OTI A;  3PYP A;  4HJ6 A;  5G4Z A;  2OWH A;  1S67 L;  1P97 A;  1S4R A;  4JGO A;  4LRZ E;  1S1Z A;  2BAS A;  4LRY C;  5TBM A;  2ZOI A;  3LI8 A;  4H6J B;  3P7N A;  5J7E A;  1F9I A;  1V9Y A;  2PR5 A;  4PKY A;  2Z6C A;  5HDS A;  1GSV A;  2JN7 A;  3MXQ A;  1N9L A;  2CMN A;  3F1O B;  5HZH A;  5DKK A;  1LSW A;  4XT2 A;  4HNB A;  5HWW A;  3SW1 A;  2D02 A;  4E04 A;  4GS9 A;  2V1B A;  3K3C A;  3LIE A;  5G4Y A;  2QJ7 A;  1XFN A;  3G6O A;  1D7E A;  2H28 A;  5DKL A;  1DP8 A;  5IU1 A;  4B9O A;  1OJG A;  3IS2 A;  4BBU A;  2ZOH A;  4GHI A;  2QHK A;  4HIA A;  4R70 A;  3H7W A;  3FC7 A;  1UWN X;  2WKR A;  3LYX A;  3A0R A;  2YKF A;  3LIA A;  3MQO A;  5HWT A;  4HQA A;  4WLA A;  4HHD A;  3F1N A;  3CAX A;  1S1Y A;  4LRX C;  2PR6 A;  1V9Z A;  3BY9 A;  3RH8 B;  4I3A A;  3NOT C;  2PD8 A;  4GW9 A;  2A24 A;  4LLO B;  4L9E A;  2EA9 A;  4GCZ A;  5F68 A;  3GDI A;  4EER A;  2R78 A;  2VLG A;  1N9N A;  3F1N B;  4WL9 A;  4EW7 A;  4L9F A;  1TS7 A;  2P7J A;  5IS1 A;  3ULF A;  2YKH A;  1S66 L;  3NHQ A;  3UB9 A;  2L1M A;  4F3L B;  5HDD A;  2VV8 A;  2PHY A;  4M4X A;  1T1A A;  3D72 A;  3BWL A;  4DJ2 A;  4WN5 A;  3NOU C;  4I3I A;  4NXB A;  4EXO A;  4WUJ A;  4I5S A;  3A0V A;  3UB8 A;  2WKQ A;  3E4P A;  1OTA A;  1TS6 A;  1DP6 A;  2PYR A;  5HDC A;  2HV1 A;  2J80 A;  5AVE A;  3LIC A;  5TBM B;  3UB7 A;  3HJI A;  4I38 A;  1Y28 A;  3MR0 A;  5HD5 A;  4HOI A;  4BBV A;  4I39 A;  4RQ9 A;  4HH3 A;  4HJ4 A;  3LI9 A;  4K08 A;  3F1P A;  5DJT A;  3H82 A;  4R3A A; 
#chains in the Genus database with same CATH topology
 4BJP A;  3VE3 A;  4X1M A;  3T50 A;  3KSG A;  3NY4 A;  2PD7 A;  5K5B A;  2D01 A;  1FIK A;  4DDS A;  3NOP C;  5U47 A;  1DRM A;  4XUZ A;  1XGJ A;  2INW A;  2JCH A;  1K4E A;  5F82 A;  3VP3 A;  2P08 A;  3QP5 A;  4HH2 A;  4C6Y A;  3QNC A;  2ZC6 B;  4OH0 A;  3GRJ A;  4GHI B;  3D9Y A;  3ZG5 A;  1NYY A;  1FOF A;  1WYC A;  1XJ6 A;  1UWP X;  1KGE A;  2VX8 A;  1KE0 A;  4OKP A;  1ACF A;  5DF7 A;  3JVV A;  2JKR I;  1NJ4 A;  2Z6D A;  2DMW A;  1OME A;  1OT6 A;  3NJA A;  1LHY A;  5EFW A;  3UY6 A;  3GSG A;  2BG1 A;  1RCJ A;  3C5A A;  2A24 B;  4HI4 A;  3HLD A;  2J8Y A;  2XD5 A;  4HP4 A;  3T4L A;  1TS0 A;  3BEB A;  3IBR A;  3UE1 A;  1XKZ A;  3NUL A;  2M7V A;  2ZMV A;  3C7V A;  2W3D A;  3IF6 C;  1KDS A;  2IA2 A;  4FH2 A;  1PRQ A;  2QWS A;  1K4F A;  2J3T D;  1HTZ A;  4WBG A;  3E4Q A;  4Y7P A;  1VB6 A;  4PM5 A;  2Q9M A;  3PAE A;  1H5X A;  3FWL A;  1X0O A;  3LID A;  4X55 A;  3OOV A;  1NWZ A;  3MFX A;  5HAQ A;  3MKE A;  2G7U A;  4PM9 A;  1AWI A;  1U60 A;  4O7D A;  3V67 A;  3OLO A;  5E43 A;  3UB6 A;  1NZO A;  4HJ3 A;  1K56 A;  3IWO A;  3T4O A;  4NXF A;  4Q0I A;  2ZM2 A;  4EEU A;  1KOU A;  1PZP A;  5CTM A;  4KUO A;  1G28 A;  3P98 A;  1J3W A;  2HPB A;  4KG6 A;  2W1T B;  3VFH A;  3IXB A;  3VOZ A;  3TJZ C;  3A3I A;  1PW8 A;  1G68 A;  2W3E A;  1NRJ A;  2ZL1 A;  4Y0O A;  3OPH A;  1K0K A;  3IH9 A;  4EBN A;  2XD1 A;  3IWI A;  5FQM A;  2G2U A;  3F1P B;  1SKF A;  1MPL A;  2W1R A;  4DE3 A;  2MJ6 A;  3WS0 A;  2J7V A;  2C6W B;  4GJ4 A;  4PKY G;  1J9M A;  3E98 A;  1VQQ A;  3Q82 A;  5BOH A;  3DW0 A;  3L9K A;  4R38 A;  3UE6 A;  3MSH A;  4FUW A;  2B95 A;  2WYX A;  3W4Q A;  1OTB A;  2W0N A;  5FQ9 A;  1ERO A;  5AQB A;  5EUA A;  2P74 A;  1XA1 A;  3ZG8 B;  1GHM A;  1SKO A;  2J3W A;  2I9V A;  2O9B A;  2ZD8 A;  3IQA A;  1VEU B;  4YFM A;  2ZM0 A;  4JLF A;  4DJ3 A;  2OAQ 1;  5HL1 A;  1XJ4 A;  1PW1 A;  5HX9 A;  3IXH A;  4CQH A;  3BFD A;  2ZQA A;  5CER A;  4P0M A;  3JPU A;  1ODV A;  3PYP A;  3FPV A;  3KSF A;  3IBJ A;  3GV9 A;  2Z2L B;  2DNS A;  3BFG A;  1S1Z A;  2BAS A;  2Z2M B;  3M2K A;  1ES2 A;  4DN0 A;  3W4O A;  4H6J B;  4WEL A;  2ZQ8 A;  1JWP A;  3W8K A;  4PM8 A;  4CLC E;  5HZH A;  3VP2 A;  3N8L A;  4HBU A;  3HUN A;  4X68 A;  4XT2 A;  5HWW A;  3SW1 A;  5EE8 A;  4E04 A;  1RGY A;  2XA7 S;  3BM6 A;  1RP5 A;  2X71 A;  2WZX A;  3B3X A;  2KOI A;  4ESP A;  4E3J A;  4NG2 A;  4ZRR A;  5CX7 A;  3Q7Z A;  4X1L A;  5F1G A;  1OJG A;  4E3N A;  5CEB A;  5M1A A;  4BBU A;  5FAQ A;  4PAU A;  3HLB A;  2ZC3 B;  2HDS A;  3C4P A;  1FCM A;  4R70 A;  1KDW A;  2WKR A;  3PBT A;  3VSL A;  2YKF A;  5CHU A;  3LIA A;  1KE4 A;  3OCN A;  5HWT A;  5A91 A;  1M6K A;  3F1N A;  4G3W A;  2DCF A;  1V9Z A;  2Y79 A;  4MBK A;  3QP6 A;  4OP8 A;  1O7E A;  3RH8 B;  3IX8 A;  2HJ9 C;  3NOT C;  4LLO B;  3O87 A;  5EVI A;  4L9E A;  4CLC C;  2EA9 A;  4YIN A;  2R78 A;  4UA7 A;  1TD5 A;  1N9N A;  2XRO A;  1W63 M;  5E2F A;  3P09 A;  4U0T A;  1QME A;  4S2O A;  5DTT A;  1E3U D;  1YLW A;  3OCL A;  1XA7 A;  2YKH A;  2WZZ A;  2GZA A;  3CPT A;  2WKE A;  3C7U A;  3UB9 A;  3ZNY A;  4UA6 A;  2UV0 E;  4IUK A;  1DJA A;  3IX4 A;  4F3L B;  1CK3 A;  3CJM A;  4R23 A;  1L0G A;  5HDD A;  4B4X A;  3WS2 A;  4EUV A;  3D72 A;  4K91 A;  4KQR A;  3NI9 A;  4NKP A;  2Y8H A;  3W4P A;  3E2L A;  5FSR A;  4I5S A;  3A0V A;  4FSF A;  3QP2 A;  3LR3 A;  3UO9 A;  1OTA A;  1Q2Q A;  1TS6 A;  3JYI A;  4UHU A;  4M3K A;  2ZMF A;  5AVE A;  3RXW A;  3KYZ A;  3LIC A;  1ZKJ A;  3MBZ A;  2WGW B;  4KZ6 A;  4E3M A;  4OPQ A;  3K2N A;  3MFD A;  4EV4 A;  5LBR A;  5E2E A;  4AFI A;  4I39 A;  4FOF A;  4WMC A;  4HH3 A;  2JE5 A;  3DTM A;  3IHA A;  5FQQ A;  3SS3 A;  5FAT A;  3EQU A;  4O8G A;  1DJB A;  1LSX A;  5AQA A;  3S7N A;  2V1Z A;  2Y2K A;  3UMD A;  3C30 A;  5MC7 A;  4P6B A;  3LCE A;  5FDH A;  5JYO A;  4KZ7 A;  4GS9 B;  1GSX A;  4K0X A;  1T19 A;  2ZJ9 A;  2EXB A;  1LSV A;  3TSG A;  4JGR A;  4JXG A;  3H9W A;  2JKT I;  1W7F A;  4WZ5 C;  3UB5 P;  2Y2J A;  2GNX A;  3VE4 A;  3IS2 B;  3LIB A;  5CEC A;  1OPX A;  2OOL A;  4FCF A;  2WK0 A;  1I2W A;  3K3D A;  1G5U A;  2KDK A;  2FFY A;  5M19 A;  4KQD A;  3CUE C;  3PHY A;  3SS5 A;  1ERQ A;  1N9O A;  3VP1 A;  1OT9 A;  4ZTK A;  1C3B A;  5FQK A;  3VOL A;  3I7J A;  1IKG A;  4I3J A;  5HPF A;  5L09 A;  5DTS A;  4MCW A;  3TRC A;  1FSY A;  1MWT A;  5F69 A;  1BTL A;  5TFQ A;  4WZ5 A;  3BFE A;  2A3U A;  2HDR A;  1SDE A;  4WM9 A;  1JTG A;  5IT5 A;  1K57 C;  3ZQ5 A;  1T1B A;  5F6A A;  4QB8 A;  2XFS A;  1PYY A;  2WKH A;  3RXX A;  2V0W A;  4R3J A;  2H10 A;  2GJ3 A;  1P9W A;  3MQ0 A;  2V0U A;  3M2J A;  5I5L A;  2XF3 A;  4YOF A;  4EET B;  2B18 A;  3N8S A;  1EWZ A;  5DJU A;  2L4R A;  3LFV A;  4DF6 A;  1SCW A;  4D60 A;  3CI6 A;  1H3Q A;  2QJ5 A;  2V1A A;  3F1O A;  3MQQ A;  4MNR A;  1K6R A;  4QJG A;  4BBT A;  2ZQ9 A;  1OJ5 A;  3KYQ A;  3MS6 A;  2M1C A;  4PMA A;  3U4L P;  2ZC4 B;  5AVF A;  2W27 A;  2VEA A;  1UGU A;  4IVK A;  4X69 A;  1K55 C;  4X25 A;  3V3R A;  1MXO A;  2Y4A A;  5GLA A;  5CXW A;  1LL5 A;  4UQI S;  2OWJ A;  3FV7 A;  1JWZ A;  3BFC A;  4JPM A;  2Y2P A;  3HJK A;  4EUZ A;  3BY8 A;  2VGL M;  3C8C A;  2PDR A;  5DF9 A;  4L9G A;  3UDF A;  3ZFZ A;  5A8B A;  4S2P A;  1KE3 A;  3MXR A;  4GOG A;  5HPI A;  4E3L A;  4GD6 A;  1K38 A;  4B93 A;  2UWX A;  3VOY A;  2JKF A;  4HES A;  2FH5 A;  4JXW A;  4ZJ2 A;  1K55 A;  1LLB A;  4WYY A;  1BYW A;  5DTK A;  4B88 A;  3IF6 B;  4X6T A;  2KLI A;  4S2N A;  1BUE A;  3H82 B;  4L0L A;  1K54 A;  1P0Z A;  2KX6 A;  3FPW A;  3BW6 A;  1ONH A;  4N9K A;  1MWR A;  2NUP C;  5L07 A;  3HUM A;  1S4S A;  5DFX A;  5KMW A;  4E3O A;  3NDG A;  4ETZ A;  4LV0 A;  1T18 A;  4JXS A;  4Y2F A;  3C2W A;  2BTF P;  4R6L A;  4U0X A;  3DTK A;  1TDL A;  2IWB A;  1FR1 A;  1S6R A;  4JGP A;  3AGF A;  5HW3 A;  4OOL A;  4LFU A;  5FI7 A;  5G4Z A;  2OWH A;  4P6Z M;  4LRZ E;  4IED A;  4NK3 A;  3VP4 A;  1JVJ A;  4Z9Q A;  3Q7V A;  4QY5 A;  3S7P A;  2HP5 A;  4OQ0 A;  5TBM A;  1IYS A;  3D4F A;  3NDE A;  3LGO A;  3GTC A;  4N9L A;  1V9Y A;  4IBX A;  4X56 A;  3WWX A;  3ZVT A;  1GSV A;  3MXQ A;  1N9L A;  4EBP A;  1YAX A;  3UE3 A;  2OLU A;  1LSW A;  2LB5 A;  3VV4 A;  2O9A A;  3IF5 A;  3G35 A;  5FAO A;  2D02 A;  1IYO A;  5G4Y A;  2QJ7 A;  1XFN A;  3FKV A;  2W3H A;  5DKL A;  3N7W A;  5IU1 A;  1ZG4 A;  2HF6 A;  5FAS A;  1PFL A;  3V3S A;  5IHV A;  4GHI A;  4HIA A;  2X02 A;  1L2S A;  3UPP A;  3A0R A;  4Y13 A;  1RGZ A;  1YLZ A;  3OPL A;  4WLA A;  1Z09 A;  1W63 Q;  3BFF A;  1PZO A;  3MXS A;  4JF5 A;  5CTN A;  3R7W B;  4DKI A;  5A92 A;  2B5R A;  4DRT A;  2A49 A;  2A24 A;  2ZMA A;  1YKD A;  5F68 A;  1IOU A;  1ZHH B;  4EER A;  4A5R A;  5EVL A;  3F1N B;  4YNR A;  4MBF A;  1K6S A;  4EW7 A;  1TS7 A;  1XX2 A;  1TEM A;  1MKM A;  1L0E A;  5IS1 A;  4KG5 A;  5L8M A;  3T4K A;  2HZ5 A;  3T1R A;  5EVE A;  2VA0 A;  3MMH A;  3CZD A;  1TF1 A;  3ULF A;  3NHQ A;  3RJU A;  1WE4 A;  1ERM A;  2L1M A;  4KZ3 A;  2P04 A;  5D3O A;  4OQI A;  5DVA A;  2QZ6 A;  3UPN A;  4BLM A;  2QYB A;  1SZV A;  4I3I A;  4NXB A;  4EXO A;  4EU0 A;  1ESI A;  2EWV A;  2O9C A;  1IYQ A;  2WKQ A;  3E4P A;  1DP6 A;  3FZC A;  1BLC A;  2HGV A;  2RL3 A;  3BYD A;  2J80 A;  2EFX A;  4CLC B;  4IBR A;  2E8I A;  2Y2Q A;  1W79 A;  4RYE A;  2Y55 A;  3MF0 A;  4RA7 A;  1SDN A;  3HJI A;  2JBF A;  4GDB A;  1KGG A;  2W1T A;  5AQ9 A;  4I38 A;  2VKS A;  4MLL A;  2WUQ A;  3ZVW A;  5HD5 A;  4BBV A;  2Q0O A;  4OQH A;  4CLC D;  2EFU A;  4R0Q A;  2Y2N A;  3N8R A;  4Y0U A;  1FR6 A;  2OV5 A;  3F1P A;  1E25 A;  5DJT A;  1VM1 A;  4DXB A;  3WRT A;  5TJJ A;  3SZT A;  2WAD A;  5FDS A;  4BEN A;  4Q0H A;  2B02 A;  5EVI C;  5HAP A;  3DWK A;  3KYE A;  3D3O A;  4LV1 A;  5DFY A;  4FD8 A;  1T1C A;  3A3J A;  4FH4 A;  3IWQ A;  2E8J A;  2EX2 A;  2Y59 A;  4QD4 A;  5HSQ A;  1LT0 A;  4BD0 A;  1TDG A;  2HJE A;  4Y3I A;  2K7S A;  2WGI A;  3NEC A;  3EWK A;  1CI9 A;  4ARZ B;  3H7W B;  1TVF A;  2P9V B;  4GKU A;  5HD3 A;  3T4T A;  4NXE A;  1IEL A;  1VEU A;  3LY4 A;  1BZA A;  3A3F A;  5JYP A;  3OC2 A;  3CWF A;  4QPR A;  3U2A A;  4O0P A;  5GHZ A;  4WF0 A;  2QKP A;  3G30 A;  1TS8 A;  5KSH A;  4R3B A;  5L10 A;  5HWV A;  4KZ8 A;  3FG8 A;  1I5Q A;  1GSW A;  1FSW A;  5GLC A;  1JNU A;  2Y2I A;  5KIZ A;  3PBN A;  1VET B;  1YPR A;  1FCO A;  3ZYT A;  3G31 A;  3B33 A;  4OOY A;  4HP9 A;  4EEP A;  3IXD A;  1H0M A;  5KZH A;  3MZD A;  1VHM A;  1YQS A;  5CHJ A;  4H6J A;  5AJG A;  2VGK A;  1XFQ A;  3ZHH A;  1NXY A;  2EXA A;  3QNB A;  2H0T A;  4G3K A;  4ZAM A;  4WEK A;  1BLP A;  1EW0 A;  2PBY A;  2XH9 A;  4Q0J A;  2Y2O A;  4MN6 A;  3OBF A;  4JGQ A;  2XRN A;  4UA9 A;  1OTD A;  3IX3 A;  2HDU A;  4IVI A;  3C4O A;  3T1Q B;  5GHX A;  1MWS A;  1K25 A;  5EOO A;  4GZB A;  3G4P A;  1BSG A;  5FA7 A;  5J3W A;  1FCN A;  2WKI A;  3BLM A;  4ZJ1 A;  3SH8 A;  5FAP A;  1PIO A;  4KZA A;  2QPN A;  5HAI A;  3MJQ A;  3RTY A;  4FTX A;  2JKR M;  2WGV A;  3BJN A;  2Y2M A;  3EGD C;  3UNW A;  1ONG A;  3LIF A;  4GN2 A;  4ETX A;  4XXR A;  1CJF A;  3LY3 A;  1P9R A;  3HLE A;  2WAF A;  4K0W A;  3HLF A;  5F83 A;  5C5K A;  1H8Z A;  3BQA A;  2PYP A;  4P6Z S;  5EOE A;  1CEG A;  3BEC A;  5TGF A;  1E3U A;  3B42 A;  4F94 A;  3QP1 A;  5J4E A;  2PT7 A;  4OVD A;  3ZCZ A;  4Y5F A;  3ZGA B;  3PAG A;  4JF4 A;  4OLG A;  4NXG A;  1DP9 A;  4OOM A;  3A0S A;  4LPZ A;  3Q81 A;  2I72 A;  2Y2L A;  1ALQ A;  1LL8 A;  3ITB A;  3LR0 A;  5M18 A;  3HLW A;  3AGE A;  3UME A;  4E3K A;  3SH9 A;  4KQQ A;  4F3L A;  1GHI A;  2WKP A;  4P87 A;  3T12 B;  1NY0 A;  1OTI A;  4KZ4 A;  4HJ6 A;  2FFF B;  3GVB A;  1HD8 A;  3KSH A;  3UDX A;  3LO7 A;  1ZG6 A;  1PI4 A;  2EX8 A;  3UN7 A;  2R9X A;  4LGW A;  4MMN A;  5FEF A;  1Y4O A;  3LI8 A;  2WGW A;  3P7N A;  5J7E A;  3GMW A;  1F9I A;  3CHW P;  2R9W A;  1ES3 A;  2PR5 A;  4E6X A;  4PKY A;  5HDS A;  4OQG A;  2JN7 A;  4S2N C;  2CMN A;  3EGX C;  4KZ5 A;  2V20 A;  4KZB A;  1K54 C;  2ZQ7 A;  5AQ7 A;  1GHP A;  5KSC A;  1ES5 A;  3Q7V B;  4S2K A;  1GCE A;  4GS9 A;  2V1B A;  3K3C A;  3LIE A;  3NBL A;  5CHM A;  2ACG A;  2VGJ A;  3G6O A;  2O0Y A;  3O5Y A;  5DF8 A;  1D7E A;  3HLG A;  5CGS A;  4KG2 A;  2OSU A;  1JTD A;  1DP8 A;  4B9O A;  4MBH A;  3T1X A;  3IS2 A;  2V8C A;  2ZOH A;  3ITA A;  3E2K A;  1UWN X;  1L3L A;  1QMF A;  1L0F A;  4B4Z A;  1K56 D;  3BRM A;  4DE0 A;  2PRF A;  1PWG A;  2ZL1 B;  1YM1 A;  4HQA A;  4S2J A;  5E2G A;  2EX9 A;  3CAX A;  4LRX C;  1GA9 A;  3T1S A;  5FQJ A;  4Q8I A;  4BL2 A;  4QU3 A;  1L0D A;  3IT9 A;  4I3A A;  1YLT A;  3T4Q A;  3DAV A;  4GLQ A;  1D1J A;  4GCZ A;  4N1X A;  3G32 A;  4WL9 A;  4L9F A;  3HCY A;  2XK1 A;  5A93 A;  2ZM8 A;  3ZG7 B;  1YT4 A;  1SKO B;  2G2W A;  3TE8 A;  4N92 A;  2W3F A;  4LEN A;  5HFO A;  3VP0 A;  1WYB A;  2VV8 A;  2PHY A;  1BLS A;  2O99 A;  4M4X A;  4R4S A;  2V8F A;  4DE1 A;  3VMA A;  2Q9N A;  2A2L A;  4DJ2 A;  3KO6 A;  4BWI A;  2H0Y A;  4WUJ A;  4NEE D;  4BL3 A;  2XGN A;  5CGX A;  3AGD A;  4DXC A;  3UE0 A;  2XDM A;  3O86 A;  5FQI A;  3UB7 A;  3A3E A;  1XPB A;  3EOI A;  3MR0 A;  4HOI A;  3E0Y A;  2FZ0 A;  5J8X A;  4HJ4 A;  2C5W B;  2VJW A;  3IF6 A;  4QWO A;  4LCM A;  1G6O A;  5L2F A;  2XSS A;  3H82 A;  2CC1 A;  1IYP A;  4XT2 B;  1ZTU A;  2IWC A;  4HY8 A;  1MY8 A;  2VV6 A;  5FEG A;  4BMW A;  4H8R A;  4KUK A;  3S22 A;  4JBF A;  1AXB A;  4DDY A;  5TR7 A;  3G34 A;  1F5M A;  4JF6 A;  2J3T C;  2PU2 A;  2V9A A;  3LR4 A;  3CLO A;  1HVB A;  1GA0 A;  5EPH A;  3PR6 A;  1STZ A;  3MZF A;  3FYZ A;  3LR5 A;  4MEZ A;  2H5S A;  3CMZ A;  3V39 A;  3GR2 A;  3KX0 X;  4GD8 A;  4C75 A;  2OAP 1;  2ZBB A;  2L0W A;  5GL9 A;  1YMX A;  3JVU A;  4UQI M;  4OON A;  2DRW A;  1XJ3 A;  5E2H A;  3DBA A;  3QP4 A;  1YSP A;  5GLD A;  4II7 A;  5EV0 A;  3MKF A;  1YLP A;  2ZQC A;  5F5Y A;  4WEJ A;  5EVI B;  3S4X A;  3OZH A;  3WS4 A;  4MN5 A;  4E6W A;  1OTE A;  2JHE A;  3NIA A;  1HLU P;  4X53 A;  1E4D A;  1NYM A;  4ME4 A;  1YLY A;  4PHT A;  4UAA A;  2EWW A;  2RCX A;  2VV7 A;  5EVI D;  3DWZ A;  1YMS A;  3PBR A;  4PPR A;  3DTE A;  1LI0 A;  3HL9 A;  3CPT B;  1LI9 A;  1SHV A;  3ICY A;  3ZNT A;  1CI8 A;  1Q2P A;  4S2M A;  4NET A;  3TW8 A;  4RX2 A;  2JKT M;  3HBR A;  3CIT A;  3N4I A;  5FI2 A;  1W8Y A;  1YSQ A;  3FKW A;  3QP8 A;  4EQ1 A;  3RFB A;  4LCL A;  3R4K A;  1NLZ A;  1FIL A;  1S0W A;  4HBT A;  1CEF A;  1KVL A;  4S2L A;  4QY6 A;  3NC8 A;  4RVA A;  4ZBE A;  3ISG A;  4RX3 A;  1F98 A;  4UEY A;  2WAE A;  2J9O A;  1XP4 A;  3PBO A;  2OLV A;  1DY6 A;  4CPK A;  1XJ2 A;  4XUX A;  3EEH A;  5A90 A;  2VK3 A;  4IJG A;  1WA9 A;  3LUQ A;  1NRF A;  3WS1 A;  2IWD A;  2AVX A;  2Y2H A;  1PWC A;  2LB9 A;  2BLS A;  5EM1 A;  1MC0 A;  1ESU A;  4EES A;  4QHC A;  1FQG A;  2M7U A;  1D06 A;  3W2Z A;  1IEM A;  5HL6 A;  2XQZ A;  1DJC A;  3R7W A;  1BT5 A;  5CED A;  4WMC D;  3EEA A;  1NLY A;  4ZJ3 A;  5EEC A;  4D2O A;  4N1H A;  4YWZ A;  3M6B A;  1NZU A;  3E4O A;  1XXM A;  3GEC A;  4IUH A;  1G6A A;  2Y2G A;  2V2F F;  3BLS A;  4Y17 A;  1YLJ A;  4OPZ A;  2QMI A;  2VGL S;  1HZO A;  3WS5 A;  1N4O A;  2ZQD A;  3CG5 A;  1MZU A;  4EWF A;  1I2S A;  3O88 A;  2PAV P;  5CGW A;  2XEP A;  4KZ9 A;  3T4J A;  5CRF A;  4OPR A;  2HP9 A;  4IHQ A;  4KEN B;  3M6H A;  1S67 L;  3PXP A;  4BD1 A;  4EBL A;  1P97 A;  3S7O A;  1S4R A;  2J9P A;  5GHY A;  3IHB A;  5GLB A;  4JGO A;  4OPY A;  1H8M A;  4CLC A;  3LEZ A;  4OLD A;  3HUO A;  4LRY C;  3ZG0 A;  1MBL A;  4MDZ A;  2ZOI A;  3V5M A;  4U3T A;  3VFF A;  3GQZ A;  1PI5 A;  2ZC5 B;  2XR0 A;  3HRE A;  3C38 A;  3TG9 A;  2XFT A;  4CJN A;  2HDQ A;  2Z6C A;  4HEF A;  3F1O B;  1KGF A;  5DKK A;  3PBQ A;  5I94 A;  2XLN A;  3PTE A;  4P85 A;  4HNB A;  1IFQ A;  3WRZ A;  1N9B A;  5HAR A;  2GX5 A;  3Q07 A;  2EX6 A;  2H28 A;  1XGI A;  4C3Q A;  3KSI A;  1BUL A;  1MKI A;  2GDN A;  5F1F A;  4GNU A;  2K2N A;  2QHK A;  4BQM A;  4ARZ A;  3H7W A;  3FC7 A;  3B47 A;  2P9V A;  4R4R A;  2JC7 A;  3EQV A;  4R1G A;  3LYX A;  2X01 A;  3MQO A;  1A0K A;  4EQI A;  1EI5 A;  3SS4 A;  4HHD A;  1ZC2 A;  4GDN A;  3HVF A;  3S1Y A;  1M40 A;  1S1Y A;  5EM0 A;  2PR6 A;  1MWU A;  3S7Q A;  4DE2 A;  3BY9 A;  1LL9 A;  4G3V A;  2K31 A;  4Y0T A;  2PD8 A;  2VZW A;  4GW9 A;  3IXG A;  2XA7 M;  2PBD P;  1VET A;  4E3I A;  3GDI A;  3LEQ A;  3Q1F A;  1H8Y A;  2VLG A;  2ZLY A;  5G18 A;  4Y15 A;  5FL3 A;  3ZDJ A;  3IH8 A;  2P7J A;  3A3D A;  4WZ4 A;  2ZC7 A;  3TOI A;  3G2Y A;  3UDI A;  1PWD A;  1W8Q A;  2Y91 A;  3DTI A;  3G2Z A;  1S66 L;  4PM7 A;  4MN7 A;  3N6I A;  3CUE A;  1PNE A;  3L7H A;  3PBS A;  5FI6 A;  3P01 A;  1IKI A;  2W3G A;  1CF0 A;  3O3V A;  1Z6F A;  3VSK A;  4GB7 A;  4ID4 A;  1T1A A;  4O01 A;  4LV3 A;  1O07 A;  3BWL A;  2HP6 A;  3NCK A;  4WN5 A;  3NOU C;  2NUT C;  3BQ8 A;  2JKG A;  3HLC A;  3UB8 A;  4JXV A;  3V50 A;  1K57 A;  4DMZ A;  1F2K A;  1JWV A;  3UPO A;  2PYR A;  5HDC A;  2HV1 A;  3MZE A;  3OPP A;  1BLH A;  4OP5 A;  4ZDX A;  5TBM B;  1W5D A;  1KVM A;  4S2I A;  3QHY A;  4KQO A;  4Z1W A;  1Y28 A;  4JKT A;  3OPR A;  2PU4 A;  1CQA A;  4LV2 A;  3T4S A;  1ES4 A;  4RQ9 A;  3SH7 A;  3LI9 A;  4PM6 A;  3ZG9 B;  1Y54 A;  4K08 A;  3SOI A;  4R3A A; 
#chains in the Genus database with same CATH homology
 4BJP A;  4XT2 B;  1LSX A;  5TJJ A;  1ZTU A;  3VE3 A;  3S7N A;  4Q0H A;  4HY8 A;  3UMD A;  3C30 A;  2B02 A;  5MC7 A;  3T50 A;  3KSG A;  4GS9 B;  1GSX A;  2PD7 A;  3D3O A;  1T19 A;  2VV6 A;  5DFY A;  5K5B A;  4BMW A;  2D01 A;  4KUK A;  1LSV A;  4JGR A;  3H9W A;  2JKT I;  1F5M A;  3NOP C;  1T1C A;  1DRM A;  2INW A;  5HSQ A;  1LT0 A;  2J3T C;  2V9A A;  3VE4 A;  2GNX A;  3LR4 A;  3IS2 B;  3LIB A;  2HJE A;  2P08 A;  3CLO A;  4HH2 A;  4Y3I A;  2K7S A;  1OPX A;  2OOL A;  3EWK A;  4GHI B;  3PR6 A;  3K3D A;  4ARZ B;  3H7W B;  2KDK A;  1STZ A;  1XJ6 A;  1UWP X;  3LR5 A;  4KQD A;  3CUE C;  3PHY A;  1N9O A;  1OT9 A;  2VX8 A;  5HD3 A;  3KX0 X;  3VOL A;  3T4T A;  4NXE A;  4I3J A;  5HPF A;  2OAP 1;  2ZBB A;  2L0W A;  3OC2 A;  4MCW A;  3JVV A;  3JVU A;  4UQI M;  3TRC A;  2JKR I;  3CWF A;  4QPR A;  2Z6D A;  5F69 A;  1XJ3 A;  2DMW A;  3U2A A;  3DBA A;  4O0P A;  1OT6 A;  3NJA A;  4WF0 A;  1YSP A;  2QKP A;  5IT5 A;  1TS8 A;  4II7 A;  5EFW A;  3ZQ5 A;  1T1B A;  5KSH A;  5F6A A;  5HWV A;  3FG8 A;  1GSW A;  5F5Y A;  4WEJ A;  2A24 B;  4HI4 A;  1JNU A;  5KIZ A;  4MN5 A;  1OTE A;  3PBN A;  2JHE A;  2V0W A;  2GJ3 A;  1P9W A;  3MQ0 A;  2V0U A;  5I5L A;  3ZYT A;  3B33 A;  4YOF A;  4EET B;  4HP9 A;  4HP4 A;  4EEP A;  4ME4 A;  3T4L A;  1TS0 A;  2B18 A;  4PHT A;  2EWW A;  2VV7 A;  3IBR A;  1VHM A;  5DJU A;  2L4R A;  3LFV A;  5AJG A;  4H6J A;  2M7V A;  3PBR A;  1XFQ A;  2ZMV A;  1H3Q A;  3CI6 A;  2W3D A;  2QJ5 A;  2IA2 A;  2QWS A;  4G3K A;  2V1A A;  3ICY A;  3F1O A;  3MQQ A;  4WEK A;  1EW0 A;  2J3T D;  4BBT A;  4Q0J A;  1OJ5 A;  4MN6 A;  3KYQ A;  3E4Q A;  3OBF A;  2M1C A;  1VB6 A;  3TW8 A;  5AVF A;  4JGQ A;  2W27 A;  2JKT M;  2XRN A;  2VEA A;  1OTD A;  3CIT A;  1UGU A;  4EQ1 A;  1YSQ A;  1X0O A;  3RFB A;  3LID A;  3R4K A;  3OOV A;  1NWZ A;  3MFX A;  1NLZ A;  2G7U A;  4UQI S;  2OWJ A;  3V67 A;  3OLO A;  5J3W A;  3UB6 A;  4HJ3 A;  3HJK A;  3T4O A;  3BY8 A;  4NXF A;  2VGL M;  4Q0I A;  1F98 A;  4EEU A;  3C8C A;  1KOU A;  4UEY A;  2PDR A;  5DF9 A;  4L9G A;  3PBO A;  4KUO A;  5A8B A;  1G28 A;  5HPI A;  1XJ2 A;  4B93 A;  2W1T B;  3EEH A;  3MJQ A;  3RTY A;  3TJZ C;  2JKR M;  4IJG A;  1WA9 A;  3LUQ A;  3BJN A;  2W3E A;  2FH5 A;  3EGD C;  1NRJ A;  2LB9 A;  3LIF A;  1BYW A;  4ETX A;  1MC0 A;  4EES A;  2M7U A;  1D06 A;  3W2Z A;  1P9R A;  2KLI A;  3F1P B;  5HL6 A;  3H82 B;  2W1R A;  4L0L A;  2MJ6 A;  3R7W A;  5C5K A;  3BQA A;  1P0Z A;  2PYP A;  4GJ4 A;  4P6Z S;  2KX6 A;  3FPW A;  3EEA A;  4PKY G;  3E98 A;  3BW6 A;  1NLY A;  3B42 A;  4R38 A;  5J4E A;  4YWZ A;  3UE6 A;  2PT7 A;  2NUP C;  1OTB A;  4Y5F A;  3E4O A;  2W0N A;  4NXG A;  3GEC A;  1DP9 A;  1S4S A;  4OOM A;  3A0S A;  4IUH A;  4LPZ A;  5DFX A;  1LL8 A;  3LR0 A;  2J3W A;  4ETZ A;  2I9V A;  2O9B A;  3UME A;  2VGL S;  1T18 A;  3C2W A;  4R6L A;  4Y2F A;  1MZU A;  4F3L A;  4DJ3 A;  2OAQ 1;  1XJ4 A;  4JGP A;  2WKP A;  4CQH A;  3T4J A;  1ODV A;  1OTI A;  4OOL A;  3PYP A;  4IHQ A;  4HJ6 A;  3FPV A;  3KSF A;  3IBJ A;  5G4Z A;  2OWH A;  1S67 L;  3PXP A;  4P6Z M;  1P97 A;  3S7O A;  1S4R A;  3KSH A;  4JGO A;  4LRZ E;  1H8M A;  4CLC A;  1S1Z A;  2BAS A;  4LRY C;  4MDZ A;  3S7P A;  5TBM A;  2ZOI A;  4MMN A;  4DN0 A;  3LI8 A;  4H6J B;  4WEL A;  3P7N A;  5J7E A;  3C38 A;  1F9I A;  1V9Y A;  2PR5 A;  4CLC E;  4PKY A;  2Z6C A;  5HDS A;  1GSV A;  2JN7 A;  3MXQ A;  1N9L A;  2CMN A;  3EGX C;  3F1O B;  5HZH A;  5DKK A;  1YAX A;  3UE3 A;  3PBQ A;  1LSW A;  2LB5 A;  4XT2 A;  3VV4 A;  2O9A A;  4HNB A;  1IFQ A;  5HWW A;  3SW1 A;  2D02 A;  4E04 A;  2XA7 S;  4GS9 A;  2V1B A;  3K3C A;  3LIE A;  5G4Y A;  2KOI A;  2GX5 A;  2QJ7 A;  1XFN A;  3G6O A;  2O0Y A;  3O5Y A;  2W3H A;  1D7E A;  2H28 A;  4ZRR A;  3KSI A;  5CX7 A;  5DKL A;  1DP8 A;  5IU1 A;  4B9O A;  2HF6 A;  1OJG A;  3IS2 A;  4BBU A;  2ZOH A;  4PAU A;  2K2N A;  4GHI A;  2QHK A;  4HIA A;  4R70 A;  4ARZ A;  3H7W A;  3FC7 A;  1UWN X;  2WKR A;  3B47 A;  3PBT A;  3EQV A;  3LYX A;  3A0R A;  2YKF A;  3LIA A;  3MQO A;  3OCN A;  5HWT A;  4HQA A;  4WLA A;  4HHD A;  3F1N A;  3CAX A;  4G3W A;  1W63 Q;  1S1Y A;  4LRX C;  2PR6 A;  1V9Z A;  2Y79 A;  3S7Q A;  3BY9 A;  3R7W B;  3RH8 B;  4G3V A;  2K31 A;  4I3A A;  3T4Q A;  2HJ9 C;  3NOT C;  2PD8 A;  2VZW A;  4GW9 A;  2A24 A;  4LLO B;  4GLQ A;  4L9E A;  4CLC C;  2XA7 M;  1YKD A;  2EA9 A;  4GCZ A;  5F68 A;  1IOU A;  1ZHH B;  3GDI A;  4EER A;  2R78 A;  1TD5 A;  2VLG A;  1N9N A;  3F1N B;  4YNR A;  2XRO A;  1W63 M;  5FL3 A;  4WL9 A;  4EW7 A;  4L9F A;  1TS7 A;  1MKM A;  2P7J A;  5IS1 A;  3HCY A;  5L8M A;  3T4K A;  3OCL A;  2VA0 A;  3MMH A;  1TF1 A;  3ULF A;  2YKH A;  1S66 L;  2GZA A;  3NHQ A;  4MN7 A;  3UB9 A;  3TE8 A;  3CUE A;  4IUK A;  3PBS A;  2L1M A;  2W3F A;  3P01 A;  2W3G A;  2P04 A;  4F3L B;  5HDD A;  2VV8 A;  2PHY A;  2O99 A;  4EUV A;  4M4X A;  1T1A A;  3D72 A;  4O01 A;  3BWL A;  4NKP A;  2A2L A;  2Y8H A;  4DJ2 A;  4WN5 A;  3KO6 A;  3NOU C;  2QYB A;  4I3I A;  4NXB A;  4BWI A;  4EXO A;  2NUT C;  4EU0 A;  3BQ8 A;  4WUJ A;  2EWV A;  4I5S A;  3A0V A;  4NEE D;  2O9C A;  4FSF A;  3UB8 A;  3LR3 A;  2WKQ A;  4DMZ A;  3E4P A;  1OTA A;  1TS6 A;  1DP6 A;  2PYR A;  2HGV A;  5HDC A;  2HV1 A;  2J80 A;  2ZMF A;  5AVE A;  4CLC B;  3KYZ A;  3LIC A;  3MF0 A;  5TBM B;  3HJI A;  3UB7 A;  2W1T A;  4I38 A;  2VKS A;  3EOI A;  4KQO A;  4Z1W A;  1Y28 A;  3K2N A;  3MR0 A;  5HD5 A;  4HOI A;  3E0Y A;  4BBV A;  5LBR A;  4CLC D;  3T4S A;  4AFI A;  4I39 A;  2FZ0 A;  4RQ9 A;  4FOF A;  4HH3 A;  4HJ4 A;  2VJW A;  3LI9 A;  4K08 A;  1G6O A;  3F1P A;  2XSS A;  5DJT A;  3EQU A;  3H82 A;  4O8G A;  4R3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...