1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
1KOUA 2L4RA 2OOLA 4GS9B 4HOIA 2V0UA 1N9NA 1N9OA 1V9YA 2PHYA 2YKHA 3F1OB 3B33A 1S4SA 3LIBA 2WKQA 3OLOA 4L9FA 4KUKA 4EEPA 1OT6A 3H7WB 4EQ1A 1VB6A 4JGPA 3PYPA 4HHDA 3UMEA 1P97A 3F1PB 4XT2B 3E4OA 5A8BA 3UE6A 2VV7A 3NHQA 5EFWA 1F9IA 2KDKA 2VLGA 2WKPA 1G28A 3BWLA 2L0WA 3NOUC 4GW9A 3LIDA 3VE3A 1V9ZA 3VOLA 4BBVA 1NWZA 4WL9A 5J4EA 1X0OA 3MJQA 5F69A 3LIFA 1DP9A 2K7SA 3LYXA 4I5SA 4MN5A 3CAXA 4PKYA 2I9VA 4NXGA 1TS0A 2VV6A 4F3LA 1D06A 1TS6A 3PHYA 4GHIB 2M1CA 4HP9A 4GS9A 2QWSA 4EERA 3CWFA 4KQDA 4K08A 3K3DA 4NXEA 3MR0A 4HJ4A 1T18A 1XJ2A 2V1BA 3HJIA 1S67L 3UB7A 4EXOA 3FC7A 1ODVA 4BBTA 2HV1A 1DP6A 4XT2A 3K3CA 1T1AA 1OTIA 2A24B 2ZBBA 5I5LA 3ZQ5A 4LLOB 4NXBA 3MXQA 4DJ2A 5AVFA 5HWWA 5HZHA 3GECA 5HDSA 4HI4A 4HP4A 5F68A 1BYWA 4WF0A 3SW1A 3IS2B 4H6JB 4I3AA 1GSXA 4I3JA 2Z6DA 1XFQA 3LIAA 5AVEA 3F1PA 2BASA 3IS2A 5DJUA 3C8CA 3NJAA 2VEAA 2VV8A 3BY9A 3ICYA 3LIEA 1DP8A 1LL8A 4MN6A 2YKFA 5G4ZA 5J3WA 4LRYC 4RQ9A 4LPZA 3D72A 4JGOA 4I39A 3UB6A 2V1AA 3UB9A 1S1ZA 1N9LA 1OTAA 1OTBA 2KX6A 2PR6A 4HH2A 3CLOA 3H82B 3UMDA 2PD8A 3EWKA 2Z6CA 2PD7A 5F5YA 4F3LB 1OJGA 4R6LA 3H9WA 2OWHA 5HD5A 4GHIA 5J7EA 1LT0A 2CMNA 5HWTA 4B9OA 4I3IA 4JGRA 4E04A 1OT9A 3FG8A 5KIZA 3NOTC 4EETB 1UWNX 2PYPA 2PR5A 1LSVA 1JNUA 1F98A 4JGQA 1EW0A 2ZOIA 1XFNA 1S66L 4R70A 5TBMB 3UB8A 3VE4A 3G6OA 4WLAA 5F6AA 2JN7A 4WUJA 2B02A 2A24A 3H7WA 2J80A 4M4XA 4PKYG 4EEUA 5HD3A 1XJ6A 4HY8A 5HWVA 1S1YA 3H82A 3E4QA 4R3AA 1D7EA 2JHEA 2WKRA 5DKLA 2D02A 3E4PA 4HJ6A 1OJ5A 1TS7A 4HIAA 2W27A 1Y28A 5HDDA 4DJ3A 1WA9A 3T50A 1XJ3A 2W0NA 4WN5A 5IS1A 4GCZA 1S4RA 2D01A 3RTYA 3LUQA 5DKKA 2QJ5A 2INWA 3EEHA 5IU1A 3LI9A 2L1MA 3HJKA 2EA9A 3F1NB 3MFXA 4NXFA 3ULFA 1XJ4A 4EW7A 4I38A 4LRXC 3MQOA 3LI8A 3RH8B 2P7JA 5HDCA 3A0SA 3A0RA 1MZUA 2QJ7A 4BBUA 2GJ3A 2OWJA 1DRMA 2V9AA 3F1NA 4LRZE 1TS8A 5DJTA 1T1CA 3KX0X 2V0WA 5TBMA 2QHKA 1GSVA 1OTDA 2PDRA 3MQQA 3P7NA 4HJ3A 4R38A 5G4YA 2H28A 1P0ZA 1T1BA 2R78A 1OTEA 1UGUA 2QKPA 2ZOHA 3C2WA 3LICA 1GSWA 1T19A 3NOPC 4H6JA 4HNBA 4KUOA 3A0VA 4L9EA 4YWZA 5HSQA 1LSXA 1LSWA 4EESA 2PYRA 4HH3A 3F1OA 1UWPX 3IBRA 4L9GA 3BY8A 3GDIA 4HQAA
chains in the Genus database with same CATH superfamily
3FZCA 1BSGA 4Y7PA 3SH8A 3UPNA 2E8IA 3IH9A 2QYBA 1NJ4A 1P97A 1PW8A 1KGEA 3UY6A 3OPHA 3SZTA 4ETZA 4CJNA 3HLGA 4LV0A 5F69A 3ZHHA 3LYXA 3NDEA 3G35A 5FQIA 3IQAA 2Y2NA 3DWZA 4QB8A 1XXMA 1K55C 3TW8A 5E2FA 3T4SA 1M40A 1ERQA 4PM6A 2P9VA 5DTKA 4I3AA 5AVEA 1HLUP 1KVLA 3F1PA 2BASA 5KSHA 3TSGA 3T4OA 4ETXA 5G4ZA 5FQJA 4LPZA 4YOFA 4EV4A 5LBRA 5DVAA 4B4ZA 3ZCZA 5HD5A 1K25A 4Z9QA 3NBLA 3S7NA 4M3KA 3NIAA 4R23A 4GD8A 1ONHA 1GA0A 2J3WA 5FEFA 2ZC3B 4B4XA 4HIAA 4X53A 4WN5A 1FOFA 5IS1A 4KG5A 5L10A 1K0KA 5TFQA 2EX9A 3T1QB 3MFXA 1H3QA 4NXFA 4G3VA 1SDEA 3T1XA 3LEZA 3TOIA 4BBUA 5FEGA 2WAFA 1Y4OA 5HAIA 1OMEA 4OOYA 2R78A 1T1BA 4Q0IA 5FQQA 1T19A 4X69A 3KSIA 1G6AA 5CHJA 1XGJA 2OAQ1 4NKPA 4HQAA 3BRMA 5JYOA 2OOLA 1FR6A 3LCEA 2YKHA 2PHYA 5FI2A 5HD3A 5AQAA 1CQAA 3H7WB 1VB6A 4QY5A 2V2FF 1E4DA 2OSUA 2Y2MA 4JXWA 1A0KA 1IYPA 1J3WA 1YPRA 2ZC7A 2I9VA 1TS0A 1MXOA 3CWFA 2WGWB 2AVXA 3UB7A 4FD8A 1T1AA 1FCOA 5HDSA 2W3HA 3OPRA 5A90A 5L2FA 3OC2A 4BENA 3EEAA 4OPRA 3HL9A 2VV8A 4MN6A 2OLUA 1BLPA 4DRTA 3BECA 2HDQA 4F3LB 4R6LA 1NZOA 3G4PA 4OLDA 4E04A 1Q2QA 2PYPA 3QP4A 1F98A 2ZOIA 1L0GA 2ZLYA 4RVAA 4WBGA 4C6YA 4Y5FA 2EX6A 2UWXA 4X6TA 4BWIA 2QMIA 2G2WA 2JHEA 3A3EA 2D02A 2XA7M 2M7VA 2J9OA 3LUQA 1XPBA 2A49A 5M18A 2J3TC 5DTTA 3SH7A 4I38A 3ZG7B 3S7PA 4LRZE 5DFYA 5HX9A 2IWCA 2XSSA 1GSVA 3VFFA 3A0VA 2HDSA 4BL3A 5GL9A 4UQIM 4L9GA 1TF1A 1ESUA 1NXYA 1GHPA 1S4SA 4CLCD 4KENB 4CQHA 1K56A 1Q2PA 3F1PB 4N1HA 4XT2B 1YMSA 3UO9A 3BM6A 5FQMA 2FH5A 4KZBA 3I7JA 5FSRA 4Y15A 1P9RA 4Z1WA 2M1CA 2GDNA 4R0QA 4R1GA 3DTMA 2Z2MB 2V1BA 3IBJA 1KDWA 4LLOB 2ZQAA 3MXQA 4DJ2A 4DXCA 2VGJA 4E3JA 2X71A 1RP5A 2Z6DA 2A2LA 3ICYA 1KGGA 3ZFZA 3DTIA 5G18A 3IH8A 3KO6A 3KSFA 4KZ9A 5EM1A 1OTAA 2KX6A 4ZRRA 3H82B 3N4IA 4OONA 3VV4A 3H9WA 1E3UA 1NRJA 1K4EA 4WMCD 2EXBA 4MEZA 4P85A 2I72A 2GZAA 2A24A 5CECA 3M6BA 3A3FA 3E4QA 3UNWA 3O86A 3HCYA 2W27A 3FPWA 5EUAA 4Q0JA 2XFSA 1MWUA 4KZ8A 4NG2A 3V39A 5DKKA 4BL2A 3Q82A 5M1AA 1JWPA 3F1NB 1ONGA 3B42A 5A93A 3GVBA 3UDIA 5FQ9A 1CF0A 4NEED 1GHMA 2QKPA 3FV7A 1PWGA 4HNBA 2O9AA 4EESA 2PYRA 5E2EA 2Y91A 3FKWA 3IBRA 1EI5A 2ZC4B 3AGEA 3IT9A 4YNRA 4WZ5A 3B3XA 3C7VA 5HAQA 5HAPA 1FR1A 3NDGA 4BBVA 5E43A 2CC1A 1MPLA 4WMCA 4O01A 3IXDA 1LI9A 4KQOA 2FFYA 4GKUA 3BFDA 4XT2A 5HZHA 3IF6A 3GECA 3V5MA 1CJFA 2XR0A 3BLSA 4JLFA 4U0XA 1PZPA 4E3KA 4LRYC 4S2OA 4KG6A 1PI4A 1OJGA 3KYZA 3FG8A 4KZ4A 1LSVA 3Q1FA 4JGQA 3EGXC 3VE4A 2MJ6A 3MKEA 2ZD8A 4EEUA 4S2NC 3T4QA 4ID4A 1DJAA 4D2OA 2Y4AA 5GHXA 4HJ6A 2V20A 4N92A 1PWCA 2PBYA 4DDYA 1PZOA 5EPHA 4E3IA 3BQAA 4PM5A 3MXSA 2P74A 2VGLM 2PAVP 2O9CA 3TJZC 2JKRM 3LICA 3LEQA 1GSWA 3OBFA 3CG5A 3WS1A 5FASA 3R7WB 3G31A 3BEBA 1PWDA 4GS9B 3C5AA 3B33A 1ES5A 1MY8A 1XP4A 3MF0A 3NHQA 1IEMA 3DW0A 4Y0TA 4OOLA 4WL9A 2R9XA 3G2ZA 3PHYA 4MBHA 3UE1A 2Q0OA 4E3NA 4JPMA 1DP6A 3K3CA 1VQQA 3BW6A 5MC7A 5CGSA 2J3TD 1VM1A 2P9VB 3SS3A 1EROA 3MZDA 3ZYTA 1KE0A 1DP8A 1LL8A 2XH9A 5HARA 5TJJA 3ZNYA 4I39A 3Q07A 4OOMA 2PR6A 2UV0E 3CLOA 2PT7A 1M6KA 2PD8A 2W1RA 4S2KA 3V50A 3TRCA 3VP0A 3EQVA 1Y54A 4Y0OA 3M2KA 1ZG4A 3N8RA 5AJGA 1S66L 1H8YA 4EUVA 3G6OA 5FI7A 3CITA 1PIOA 4GJ4A 3A3DA 3MFDA 4KG2A 1IFQA 4PAUA 1XJ3A 3CUEC 2D01A 1VHMA 1BLCA 5IU1A 2EXAA 3ULFA 2KLIA 4LRXC 3LI8A 5IT5A 2R9WA 1NY0A 4EUZA 5HPIA 3DTKA 3E98A 1NLZA 4UAAA 4KUOA 1LSXA 1GCEA 4X68A 5HFOA 4DMZA 4QPRA 3BY8A 3GDIA 1YKDA 4P0MA 3CUEA 3OLOA 3LIBA 4NETA 1F9IA 3NOUC 2OAP1 3LIDA 2EX8A 2K7SA 2C5WB 4CLCA 4GS9A 2HPBA 3BQ8A 3MR0A 2WK0A 1XJ2A 4BBTA 1ODVA 2WGWA 2XD1A 5DFXA 1RGZA 4U0TA 2DCFA 3GV9A 1YLWA 3GR2A 4S2JA 3IS2A 1FILA 4PM9A 3Q7VA 5J3WA 4G3KA 4JGOA 1S1ZA 1BT5A 2VA0A 1FQGA 5KZHA 5F5YA 4ZBEA 2O9BA 1KE3A 3N7WA 3CHWP 3NCKA 1PNEA 3RXWA 4WUJA 3LY3A 4PKYG 4OPYA 4Y2FA 4BLMA 4R3JA 3R7WA 1DY6A 1D1JA 2VZWA 2W3DA 4U3TA 4Q0HA 4E6XA 3HLDA 2X02A 2G2UA 3LI9A 4QY6A 3W4OA 2H10A 3RH8B 4N9LA 1IKGA 3A0SA 3JVUA 1T1CA 1TEMA 4OKPA 4BQMA 3WS0A 3W4PA 3TE8A 4S2PA 4MNRA 5AQ7A 1YSQA 4MMNA 5HWVA 2JE5A 1KOUA 4L9FA 4EQ1A 5FDHA 5A92A 3VMAA 4YINA 2VV7A 2KDKA 2JKRI 2Z2LB 3UE3A 1JWZA 3BFEA 3LIFA 4I5SA 4P6ZM 1W79A 4ZDXA 1BZAA 2BG1A 3UDFA 3HUMA 1IELA 4KQDA 4NXEA 3BLMA 1T18A 4KZAA 5FAPA 5FDSA 5CHMA 2ZQ7A 2ZBBA 3EOIA 3RJUA 1W8YA 5AQBA 5A91A 4R4SA 3T1RA 1H0MA 1E25A 3OOVA 1N9LA 3OCNA 2Y2QA 5HW3A 3V3RA 4CLCB 1L3LA 1K55A 1LT0A 3VSKA 4JGRA 3U4LP 1UWNX 2LB5A 3UB8A 2EFXA 1MWRA 2HDRA 4PMAA 4UQIS 1BULA 4QD4A 1O07A 2ZMFA 4LFUA 4X55A 4DJ3A 5FL3A 5DTSA 2ZMAA 4D60A 3M2JA 4WEJA 3ZVWA 3M6HA 1RCJA 3O3VA 4IBRA 4PM8A 3F1NA 3NY4A 2E8JA 3GSGA 4IUKA 1JVJA 2V0WA 4GD6A 5HPFA 2PDRA 3RTYA 1HZOA 3C2WA 3VSLA 2QPNA 2PBDP 2ZQ9A 1U60A 3IF5A 3SS5A 4JGPA 3T12B 1L0EA 1TDGA 1KVMA 5EFWA 5CRFA 5DF8A 1JWVA 3HUNA 2JBFA 4KZ3A 5J4EA 1IOUA 4IVKA 5F82A 3QNBA 3JPUA 1PI5A 4DF6A 4GHIB 4KZ5A 4EQIA 3FPVA 2J7VA 4NXBA 3ZGAB 5BOHA 4HP4A 3A3JA 5EVIA 3PBRA 3VP3A 4GDBA 3LIEA 3VOZA 4UA9A 3L7HA 3LR3A 3P01A 1K4FA 3QP8A 1MC0A 4II7A 1IKIA 5C5KA 3WWXA 2RCXA 5GLAA 3A3IA 2CMNA 5CTMA 4N1XA 5TBMB 2K2NA 3IX8A 2Y2HA 2B02A 1L0FA 5JYPA 1S6RA 1MWSA 3LR5A 1S1YA 2JCHA 1D7EA 4ME4A 2ZM2A 1VETB 4WZ4A 3S7OA 4C75A 1S4RA 1ZTUA 4WEKA 3SS4A 3TG9A 3E0YA 3HUOA 4MN7A 3VFHA 4E3LA 2NUPC 2ZQDA 1Z6FA 3A0RA 4ZAMA 2HP9A 2Y2OA 2QHKA 5F1FA 3MQQA 3C4OA 4R38A 2H28A 4OH0A 2X01A 5CEBA 3QHYA 4JXVA 2VK3A 4KUKA 3C7UA 3VP1A 1ES4A 4Y0UA 1JTDA 2WUQA 4GOGA 5L09A 2PRFA 4MN5A 1D06A 4PM7A 4HP9A 3HREA 4B88A 3QP6A 3ZQ5A 5IHVA 5F68A 5U47A 2WKIA 4GZBA 1XFQA 3BJNA 1STZA 2PU4A 4H8RA 3NJAA 3SH9A 2HGVA 3S22A 1H8ZA 4RQ9A 3AGFA 3HLBA 4O7DA 5FI6A 2WZXA 2W3GA 3UB6A 1OTBA 1I2SA 4MLLA 4LCMA 1ESIA 4LENA 3CPTA 1CK3A 5EE8A 2XK1A 1SDNA 1SKOA 2WKEA 3T4KA 1XFNA 4KQQA 2XGNA 1E3UD 3MMHA 3BYDA 4IVIA 4KQRA 4S2MA 4GNUA 4GB7A 2EFUA 1TVFA 5HL1A 1K6RA 1TS7A 2HJEA 2DRWA 4JF6A 1CEFA 5EECA 3EEHA 5EOOA 4BJPA 3CJMA 4PHTA 5EV0A 2OWJA 2V9AA 2Q9NA 3HLWA 3P98A 1F2KA 4WM9A 4HBTA 4IHQA 4ZTKA 3T4JA 1SKFA 3T4TA 3MBZA 1OT6A 3OZHA 3PYPA 3W8KA 4K91A 3ISGA 3UE6A 4RX3A 3Q7ZA 3IWQA 3VOLA 2ZC6B 3MJQA 1YLZA 2LB9A 1TD5A 2XF3A 3PXPA 3W2ZA 2QWSA 4UA6A 4K08A 3K3DA 3T1SA 3HLFA 3C30A 1DJBA 2HJ9C 2RL3A 5EVLA 3LR0A 2HZ5A 2HV1A 1SZVA 1ZG6A 2G7UA 1OTIA 2XDMA 2ZM8A 2J9PA 3IX4A 3PAEA 3UB5P 1XX2A 4EU0A 2V1AA 1WE4A 4PPRA 2O0YA 2EWVA 4FOFA 2Z6CA 1EWZA 1XA1A 4GLQA 1QMEA 3HBRA 3DBAA 3IXGA 4LV1A 1OT9A 2BLSA 4OQIA 4WELA 2XQZA 1ES2A 1XJ6A 2ZM0A 4HY8A 3H82A 1K56D 1OJ5A 1W5DA 1YLJA 2W3EA 1K54A 1K57A 1QMFA 1G6OA 3HJKA 4O0PA 1XJ4A 1YT4A 2Y2PA 3IX3A 4CPKA 4Y13A 1G5UA 5HL6A 2PU2A 3P7NA 1ALQA 2ZOHA 4YFMA 3QP1A 3SOIA 1Z09A 2DMWA 5FQKA 3PBOA 2Y2JA 4HHDA 1HD8A 3Q81A 1V9ZA 1X0OA 4F3LA 3C38A 1PW1A 3MSHA 4P6ZS 5DF9A 5TR7A 1WYBA 1ZKJA 3IHBA 3KSHA 3VOYA 1RGYA 1KDSA 5I5LA 3WS4A 3OPLA 1S0WA 1NYMA 4IUHA 2HF6A 3PBNA 1BYWA 3IF6B 1PFLA 3IS2B 3RFBA 4QJGA 1XA7A 4EBLA 2YKFA 3VP4A 3FYZA 4HH2A 5J8XA 1BUEA 3LO7A 4IEDA 5KIZA 4I3IA 2W1TB 1EW0A 4OQHA 2VKSA 2ZJ9A 5CGWA 3H7WA 3UPPA 1LI0A 5K5BA 1TDLA 3K2NA 3UPOA 1W63Q 2JKGA 1Y28A 3E2LA 4ARZA 4DKIA 4FCFA 4DE3A 1KGFA 4QHCA 5EVIB 5CEDA 2HDUA 4WYYA 5KSCA 1GHIA 5F83A 4GN2A 4RYEA 4HJ3A 1KE4A 4BMWA 1OTEA 3D3OA 1AWIA 4OPZA 5HSQA 1CI8A 3V3SA 4N9KA 2XD5A 4JF4A 2V0UA 1N9NA 1N9OA 4H6JA 3MQ0A 4RA7A 3MZFA 2JKTI 4L0LA 3HLEA 1ACFA 1L2SA 1SCWA 1H5XA 4JXSA 1DP9A 1YSPA 2ZL1A 4FH2A 5EVIC 2HP6A 3WS5A 1PYYA 3D4FA 2VGKA 4HJ4A 3MKFA 3KYQA 3EQUA 2XEPA 2A24B 3B47A 3GMWA 4JXGA 4I3JA 2VX8A 5E2HA 3R4KA 2OV5A 4NK3A 3WS2A 3BY9A 3GRJA 3N8SA 4UEYA 2B95A 3LFVA 3O88A 3PAGA 3D72A 1HVBA 4LV3A 3UB9A 3UMDA 4OP5A 2PD7A 1ZHHB 3PBSA 4EETB 1JNUA 1YLTA 3IXBA 2W3FA 4WLAA 4IBXA 1P9WA 2WKRA 1AXBA 1MKMA 5HDDA 2VJWA 2W0NA 4GCZA 2Y2GA 3JYIA 1K6SA 2Y79A 1YLYA 2XA7S 5I94A 3Q7VB 2P7JA 3DAVA 5DJTA 1K38A 2WADA 1P0ZA 1YAXA 4O8GA 4S2NA 3GQZA 1ERMA 4BD0A 2M7UA 3F1OA 3IHAA 4C3QA 5CX7A 4DDSA 3MZEA 3MS6A 3F1OB 3ZDJA 1YQSA 5A8BA 2WKPA 3BWLA 4P6BA 2Y55A 4RX2A 3VE3A 3CAXA 5KMWA 1BLHA 1SKOB 4BD1A 2O99A 4LGWA 3LY4A 1HTZA 1YLPA 4EXOA 4KZ7A 4K0WA 4XXRA 3UN7A 1FSYA 3PBQA 4HI4A 3SW1A 1MWTA 3QP2A 2H0YA 3LIAA 3CZDA 3C8CA 1MKIA 3PBTA 4EBNA 4FH4A 2K31A 3KYEA 2BTFP 1JTGA 2Y2KA 5J7EA 2VGLS 4B9OA 5CGXA 1N9BA 2ACGA 4UA7A 4R70A 3AGDA 1FSWA 5FAOA 3U2AA 3GTCA 2JN7A 3MXRA 2ZQCA 1K54C 1K57C 1FCNA 5CERA 2Q9MA 3D9YA 1N4OA 3T4LA 3T50A 4MBKA 2WZZA 4OPQA 3IWIA 2H5SA 5GLCA 3ZNTA 3VP2A 4F94A 3IXHA 2V1ZA 3FKVA 3MQOA 1L0DA 4LV2A 2Y8HA 5E2GA 4XUZA 3DWKA 2XROA 3O5YA 4YWZA 1NRFA 3CI6A 3UE0A 4ARZB 1FCMA 2WKQA 4CLCE 2EWWA 2GNXA 3E4OA 1PRQA 2B5RA 3N6IA 1NZUA 2Y2LA 4K0XA 2XRNA 3RXXA 1FIKA 3QNCA 1VEUA 4NXGA 2VV6A 1TS6A 3ZG8B 3PTEA 3NI9A 2KOIA 4KZ6A 5AVFA 1W8QA 5DF7A 4XUXA 3E2KA 4X25A 3P09A 5GHYA 4H6JB 4DE2A 2VEAA 4OLGA 3JVVA 5L07A 1NYYA 3CMZA 4ZJ2A 2ZL1B 3EWKA 4R4RA 4OVDA 3N8LA 4GHIA 4WZ5C 4UHUA 3NOTC 5EOEA 4AFIA 2QZ6A 1BLSA 3NULA 4GDNA 2J80A 4M4XA 2WGVA 2IWDA 4A5RA 5EVEA 5DKLA 3E4PA 4MBFA 5GHZA 4IJGA 2XFTA 5EVID 4QU3A 3G34A 2L1MA 3W4QA 4FUWA 2XLNA 4EW7A 5HDCA 2NUTC 3IWOA 2C6WB 1LL9A 4S2LA 2GJ3A 4QWOA 3KX0X 4R3AA 1UGUA 3ZG9B 5AQ9A 4HH3A 3NECA 3UDXA 1UWPX 5FATA 1W63M 1O7EA 1W7FA 5L8MA 2L4RA 1BTLA 3S7QA 4EEPA 3KSGA 3UMEA 5FAQA 2V8FA 1G28A 1H8MA 2H0TA 2L0WA 3BFCA 3S1YA 2W1TA 1NWZA 3OCLA 2B18A 1C3BA 4PKYA 2ZC5B 4OQGA 3HLCA 4FSFA 1YM1A 3HJIA 1S67L 5HWWA 3O87A 2EX2A 4WF0A 1LL5A 4DE1A 5M19A 5DJUA 1ES3A 4CLCC 4P87A 4B93A 3WRTA 2FFFB 2WAEA 2Y59A 3ZG0A 2OWHA 2GX5A 5HWTA 2PR5A 1MBLA 5GLBA 1IYQA 4LCLA 4FTXA 1GA9A 1OPXA 4X56A 2Y2IA 2DNSA 1NLYA 1I5QA 1LLBA 2WKHA 2A3UA 3WRZA 3DTEA 4JKTA 1CEGA 4Q8IA 1J9MA 5F1GA 3S4XA 5TGFA 1DJCA 1VETA 3BFFA 3PR6A 3IF6C 1MZUA 3LGOA 3ITAA 4DN0A 1TS8A 1OTDA 4DE0A 2P04A 3CPTB 2IA2A 5F6AA 3G30A 2IWBA 4L9EA 1G68A 2JKTM 3FWLA 4JBFA 4S2IA 4HOIA 1V9YA 1ZC2A 1XKZA 2FZ0A 4HBUA 5CHUA 5CXWA 4ZJ3A 4E3OA 2VLGA 4GW9A 5D3OA 2J8YA 4OP8A 4DXBA 4R3BA 4X1MA 4EERA 3BFGA 3ZVTA 4ZJ1A 2P08A 3NC8A 3FC7A 3ITBA 2OLVA 1F5MA 3OPPA 4MDZA 1GSXA 4E6WA 4Y3IA 5FA7A 3ZG5A 4OQ0A 3QP5A 1IYOA 1WYCA 4E3MA 4HEFA 1I2WA 2V8CA 3LR4A 4JF5A 2WGIA 1VEUB 2ZMVA 1XGIA 4G3WA 2JC7A 3EGDC 3G32A 3C4PA 4EBPA 2JKFA 3G2YA 1YMXA 4HESA 4X1LA 4MCWA 1IYSA 5CTNA 1SHVA 1WA9A 3L9KA 3HVFA 1LHYA 2QJ5A 2INWA 1CI9A 2EA9A 2HP5A 3V67A 5GLDA 2QJ7A 4Y17A 1DRMA 5TBMA 5EM0A 4ESPA 5G4YA 2WYXA 3NOPC 4EWFA 1LSWA 2ZQ8A
chains in the Genus database with same CATH topology
4GS9B 3F1OB 3B33A 4KUKA 3MF0A 2QYBA 1P97A 5A8BA 3NHQA 2WKPA 3BWLA 4ETZA 4OOLA 3VE3A 4WL9A 5F69A 3LYXA 4MN5A 3CAXA 1D06A 3PHYA 4HP9A 2O99A 3TW8A 4EXOA 3T4SA 3ZQ5A 1DP6A 3K3CA 3BW6A 5MC7A 3PBQA 4HI4A 5F68A 3SW1A 4I3AA 2J3TD 1XFQA 3BJNA 3LIAA 5AVEA 3F1PA 1STZA 2BASA 5KSHA 3ZYTA 3C8CA 3NJAA 2HGVA 3T4OA 4ETXA 1DP8A 1LL8A 5G4ZA 4RQ9A 4LPZA 3PBTA 4YOFA 5TJJA 2K31A 4I39A 2W3GA 3UB6A 4OOMA 1OTBA 2PR6A 5LBRA 3CLOA 2PT7A 2PD8A 2W1RA 3TRCA 5J7EA 2VGLS 3EQVA 5HD5A 3T4KA 4B9OA 5AJGA 4R70A 1XFNA 1S66L 4EUVA 3S7NA 3U2AA 3G6OA 2JN7A 3MMHA 2J3WA 3CITA 4GJ4A 1TS7A 4HIAA 1IFQA 2HJEA 4PAUA 3T4LA 3T50A 1XJ3A 3CUEC 4WN5A 5IS1A 2D01A 1VHMA 5IU1A 3EEHA 4BJPA 3MFXA 1H3QA 4NXFA 3ULFA 2KLIA 4LRXC 3MQOA 3LI8A 4G3VA 4PHTA 5IT5A 2OWJA 2V9AA 4BBUA 2Y8HA 5HPIA 3E98A 2XROA 1NLZA 2R78A 1T1BA 4Q0IA 3O5YA 1T19A 4KUOA 3KSIA 4YWZA 4IHQA 1LSXA 3T4JA 2OAQ1 4NKPA 4DMZA 4QPRA 3CI6A 3GDIA 3BY8A 4HQAA 4ARZB 2OOLA 1YKDA 2YKHA 2PHYA 3CUEA 5HD3A 3OLOA 3LIBA 2WKQA 3T4TA 4CLCE 1OT6A 3H7WB 1VB6A 3PYPA 2EWWA 2GNXA 3E4OA 3UE6A 1F9IA 3NOUC 2OAP1 3LIDA 3VOLA 3MJQA 2XRNA 2K7SA 4CLCA 2I9VA 4NXGA 1TS0A 2VV6A 2LB9A 1TD5A 3PXPA 1TS6A 3W2ZA 4GS9A 2QWSA 3CWFA 3BQ8A 4K08A 3K3DA 3C30A 2HJ9C 3MR0A 1XJ2A 3UB7A 2KOIA 3LR0A 4BBTA 1ODVA 2HV1A 2G7UA 1T1AA 1OTIA 5DFXA 5AVFA 5HDSA 2W3HA 4H6JB 3OC2A 3EEAA 3IS2A 2VEAA 2VV8A 4MN6A 5J3WA 3JVVA 4G3KA 4EU0A 4JGOA 2V1AA 1S1ZA 2O0YA 2EWVA 4FOFA 2VA0A 3EWKA 2Z6CA 4GLQA 5F5YA 4F3LB 4R6LA 3DBAA 2O9BA 4GHIA 4E04A 1OT9A 3NOTC 2PYPA 1F98A 2ZOIA 4AFIA 4WELA 4WUJA 4Y5FA 2J80A 4M4XA 4PKYG 4Y2FA 1XJ6A 4HY8A 4BWIA 3H82A 2JHEA 5DKLA 2D02A 2XA7M 3E4PA 3R7WA 1OJ5A 2M7VA 2VZWA 2W3EA 4IJGA 2W3DA 3LUQA 4Q0HA 1G6OA 3LI9A 2L1MA 3HJKA 2J3TC 4O0PA 1XJ4A 4EW7A 4I38A 3RH8B 5HDCA 2NUTC 3A0SA 3S7PA 2GJ3A 4LRZE 3JVUA 5DFYA 1T1CA 2XSSA 3KX0X 1GSVA 5HL6A 3P7NA 4R3AA 1UGUA 3TE8A 2ZOHA 3A0VA 4HH3A 1YSQA 4MMNA 1UWPX 4UQIM 4L9GA 5HWVA 1W63M 5L8MA 1KOUA 1TF1A 2DMWA 2L4RA 3S7QA 4L9FA 4EEPA 1S4SA 3KSGA 4CLCD 4EQ1A 3PBOA 4CQHA 4HHDA 3UMEA 3F1PB 4XT2B 2VV7A 2KDKA 1G28A 1H8MA 2L0WA 2FH5A 2W1TA 1V9ZA 2JKRI 1NWZA 1X0OA 1P9RA 3UE3A 3OCLA 2B18A 3LIFA 4I5SA 4P6ZM 4F3LA 4PKYA 3C38A 5DF9A 4P6ZS 2M1CA 4Z1WA 4FSFA 4KQDA 4NXEA 3KSHA 1T18A 3HJIA 2V1BA 1S67L 3IBJA 2ZBBA 3EOIA 5I5LA 4LLOB 4DJ2A 3MXQA 5HWWA 4IUHA 2HF6A 3PBNA 1BYWA 4WF0A 3IS2B 3RFBA 2Z6DA 2A2LA 5DJUA 3ICYA 2YKFA 4CLCC 4B93A 3KO6A 3OOVA 3KSFA 1N9LA 1OTAA 2KX6A 4HH2A 3OCNA 4ZRRA 3H82B 3VV4A 4CLCB 3H9WA 2OWHA 1LT0A 1NRJA 2GX5A 5HWTA 4I3IA 4JGRA 5KIZA 1UWNX 2W1TB 2PR5A 2LB5A 1EW0A 3UB8A 2VKSA 1OPXA 2GZAA 2A24A 3H7WA 1NLYA 4UQIS 5K5BA 3K2NA 3E4QA 2ZMFA 1W63Q 3HCYA 2W27A 3FPWA 1Y28A 4ARZA 4DJ3A 5FL3A 4Q0JA 5DKKA 4WEJA 3PR6A 3F1NB 3B42A 1MZUA 3F1NA 4DN0A 1TS8A 4IUKA 2V0WA 5HPFA 1OTDA 2PDRA 2P04A 4NEED 4HJ3A 3RTYA 4BMWA 1OTEA 3C2WA 2QKPA 2IA2A 3D3OA 4HNBA 5F6AA 5HSQA 4L9EA 2O9AA 4EESA 2PYRA 2JKTM 3IBRA 4HOIA 2V0UA 1N9NA 1N9OA 1V9YA 4H6JA 3MQ0A 2FZ0A 4YNRA 4JGPA 2JKTI 5EFWA 4L0LA 2VLGA 4GW9A 4BBVA 1IOUA 5J4EA 1DP9A 1YSPA 4GHIB 4EERA 4O01A 4KQOA 2P08A 4HJ4A 3FPVA 3KYQA 3FC7A 3EQUA 4XT2A 2A24B 5HZHA 4NXBA 3B47A 3GECA 1F5MA 4HP4A 4MDZA 1GSXA 4I3JA 2VX8A 4Y3IA 3R4KA 3PBRA 3BY9A 3LIEA 4LRYC 3LFVA 4UEYA 3D72A 3LR3A 3P01A 3UB9A 1MC0A 3LR4A 4II7A 3UMDA 5C5KA 2PD7A 1OJGA 1ZHHB 2ZMVA 3KYZA 2CMNA 4G3WA 3PBSA 3FG8A 4EETB 3EGDC 1JNUA 1LSVA 4JGQA 5TBMB 2K2NA 2W3FA 3EGXC 3VE4A 4WLAA 2B02A 2MJ6A 4EEUA 3LR5A 1S1YA 4MCWA 3T4QA 1D7EA 1P9WA 2WKRA 4HJ6A 1MKMA 4ME4A 5HDDA 1WA9A 3S7OA 2VJWA 2W0NA 4GCZA 1S4RA 1ZTUA 2QJ5A 2INWA 2Y79A 4WEKA 2XA7S 3BQAA 2EA9A 3E0YA 3V67A 4MN7A 2P7JA 2VGLM 2NUPC 3A0RA 2QJ7A 1DRMA 5TBMA 5DJTA 2O9CA 2QHKA 3MQQA 5G4YA 3TJZC 4R38A 2H28A 1P0ZA 2JKRM 3LICA 1YAXA 4O8GA 1GSWA 3NOPC 3OBFA 2M7UA 1LSWA 3F1OA 5CX7A 3R7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOU A;  2L4R A;  2OOL A;  4GS9 B;  4HOI A;  2V0U A;  1N9N A;  1N9O A;  1V9Y A;  2PHY A;  2YKH A;  3F1O B;  3B33 A;  1S4S A;  3LIB A;  2WKQ A;  3OLO A;  4L9F A;  4KUK A;  4EEP A;  1OT6 A;  3H7W B;  4EQ1 A;  1VB6 A;  4JGP A;  3PYP A;  4HHD A;  3UME A;  1P97 A;  3F1P B;  4XT2 B;  3E4O A;  5A8B A;  3UE6 A;  2VV7 A;  3NHQ A;  5EFW A;  1F9I A;  2KDK A;  2VLG A;  2WKP A;  1G28 A;  3BWL A;  2L0W A;  3NOU C;  4GW9 A;  3LID A;  3VE3 A;  1V9Z A;  3VOL A;  4BBV A;  1NWZ A;  4WL9 A;  5J4E A;  1X0O A;  3MJQ A;  5F69 A;  3LIF A;  1DP9 A;  2K7S A;  3LYX A;  4I5S A;  4MN5 A;  3CAX A;  4PKY A;  2I9V A;  4NXG A;  1TS0 A;  2VV6 A;  4F3L A;  1D06 A;  1TS6 A;  3PHY A;  4GHI B;  2M1C A;  4HP9 A;  4GS9 A;  2QWS A;  4EER A;  3CWF A;  4KQD A;  4K08 A;  3K3D A;  4NXE A;  3MR0 A;  4HJ4 A;  1T18 A;  1XJ2 A;  2V1B A;  3HJI A;  1S67 L;  3UB7 A;  4EXO A;  3FC7 A;  1ODV A;  4BBT A;  2HV1 A;  1DP6 A;  4XT2 A;  3K3C A;  1T1A A;  1OTI A;  2A24 B;  2ZBB A;  5I5L A;  3ZQ5 A;  4LLO B;  4NXB A;  3MXQ A;  4DJ2 A;  5AVF A;  5HWW A;  5HZH A;  3GEC A;  5HDS A;  4HI4 A;  4HP4 A;  5F68 A;  1BYW A;  4WF0 A;  3SW1 A;  3IS2 B;  4H6J B;  4I3A A;  1GSX A;  4I3J A;  2Z6D A;  1XFQ A;  3LIA A;  5AVE A;  3F1P A;  2BAS A;  3IS2 A;  5DJU A;  3C8C A;  3NJA A;  2VEA A;  2VV8 A;  3BY9 A;  3ICY A;  3LIE A;  1DP8 A;  1LL8 A;  4MN6 A;  2YKF A;  5G4Z A;  5J3W A;  4LRY C;  4RQ9 A;  4LPZ A;  3D72 A;  4JGO A;  4I39 A;  3UB6 A;  2V1A A;  3UB9 A;  1S1Z A;  1N9L A;  1OTA A;  1OTB A;  2KX6 A;  2PR6 A;  4HH2 A;  3CLO A;  3H82 B;  3UMD A;  2PD8 A;  3EWK A;  2Z6C A;  2PD7 A;  5F5Y A;  4F3L B;  1OJG A;  4R6L A;  3H9W A;  2OWH A;  5HD5 A;  4GHI A;  5J7E A;  1LT0 A;  2CMN A;  5HWT A;  4B9O A;  4I3I A;  4JGR A;  4E04 A;  1OT9 A;  3FG8 A;  5KIZ A;  3NOT C;  4EET B;  1UWN X;  2PYP A;  2PR5 A;  1LSV A;  1JNU A;  1F98 A;  4JGQ A;  1EW0 A;  2ZOI A;  1XFN A;  1S66 L;  4R70 A;  5TBM B;  3UB8 A;  3VE4 A;  3G6O A;  4WLA A;  5F6A A;  2JN7 A;  4WUJ A;  2B02 A;  2A24 A;  3H7W A;  2J80 A;  4M4X A;  4PKY G;  4EEU A;  5HD3 A;  1XJ6 A;  4HY8 A;  5HWV A;  1S1Y A;  3H82 A;  3E4Q A;  4R3A A;  1D7E A;  2JHE A;  2WKR A;  5DKL A;  2D02 A;  3E4P A;  4HJ6 A;  1OJ5 A;  1TS7 A;  4HIA A;  2W27 A;  1Y28 A;  5HDD A;  4DJ3 A;  1WA9 A;  3T50 A;  1XJ3 A;  2W0N A;  4WN5 A;  5IS1 A;  4GCZ A;  1S4R A;  2D01 A;  3RTY A;  3LUQ A;  5DKK A;  2QJ5 A;  2INW A;  3EEH A;  5IU1 A;  3LI9 A;  2L1M A;  3HJK A;  2EA9 A;  3F1N B;  3MFX A;  4NXF A;  3ULF A;  1XJ4 A;  4EW7 A;  4I38 A;  4LRX C;  3MQO A;  3LI8 A;  3RH8 B;  2P7J A;  5HDC A;  3A0S A;  3A0R A;  1MZU A;  2QJ7 A;  4BBU A;  2GJ3 A;  2OWJ A;  1DRM A;  2V9A A;  3F1N A;  4LRZ E;  1TS8 A;  5DJT A;  1T1C A;  3KX0 X;  2V0W A;  5TBM A;  2QHK A;  1GSV A;  1OTD A;  2PDR A;  3MQQ A;  3P7N A;  4HJ3 A;  4R38 A;  5G4Y A;  2H28 A;  1P0Z A;  1T1B A;  2R78 A;  1OTE A;  1UGU A;  2QKP A;  2ZOH A;  3C2W A;  3LIC A;  1GSW A;  1T19 A;  3NOP C;  4H6J A;  4HNB A;  4KUO A;  3A0V A;  4L9E A;  4YWZ A;  5HSQ A;  1LSX A;  1LSW A;  4EES A;  2PYR A;  4HH3 A;  3F1O A;  1UWP X;  3IBR A;  4L9G A;  3BY8 A;  3GDI A;  4HQA A; 
#chains in the Genus database with same CATH topology
 3FZC A;  1BSG A;  4Y7P A;  3SH8 A;  3UPN A;  2E8I A;  3IH9 A;  2QYB A;  1NJ4 A;  1P97 A;  1PW8 A;  1KGE A;  3UY6 A;  3OPH A;  3SZT A;  4ETZ A;  4CJN A;  3HLG A;  4LV0 A;  5F69 A;  3ZHH A;  3LYX A;  3NDE A;  3G35 A;  5FQI A;  3IQA A;  2Y2N A;  3DWZ A;  4QB8 A;  1XXM A;  1K55 C;  3TW8 A;  5E2F A;  3T4S A;  1M40 A;  1ERQ A;  4PM6 A;  2P9V A;  5DTK A;  4I3A A;  5AVE A;  1HLU P;  1KVL A;  3F1P A;  2BAS A;  5KSH A;  3TSG A;  3T4O A;  4ETX A;  5G4Z A;  5FQJ A;  4LPZ A;  4YOF A;  4EV4 A;  5LBR A;  5DVA A;  4B4Z A;  3ZCZ A;  5HD5 A;  1K25 A;  4Z9Q A;  3NBL A;  3S7N A;  4M3K A;  3NIA A;  4R23 A;  4GD8 A;  1ONH A;  1GA0 A;  2J3W A;  5FEF A;  2ZC3 B;  4B4X A;  4HIA A;  4X53 A;  4WN5 A;  1FOF A;  5IS1 A;  4KG5 A;  5L10 A;  1K0K A;  5TFQ A;  2EX9 A;  3T1Q B;  3MFX A;  1H3Q A;  4NXF A;  4G3V A;  1SDE A;  3T1X A;  3LEZ A;  3TOI A;  4BBU A;  5FEG A;  2WAF A;  1Y4O A;  5HAI A;  1OME A;  4OOY A;  2R78 A;  1T1B A;  4Q0I A;  5FQQ A;  1T19 A;  4X69 A;  3KSI A;  1G6A A;  5CHJ A;  1XGJ A;  2OAQ 1;  4NKP A;  4HQA A;  3BRM A;  5JYO A;  2OOL A;  1FR6 A;  3LCE A;  2YKH A;  2PHY A;  5FI2 A;  5HD3 A;  5AQA A;  1CQA A;  3H7W B;  1VB6 A;  4QY5 A;  2V2F F;  1E4D A;  2OSU A;  2Y2M A;  4JXW A;  1A0K A;  1IYP A;  1J3W A;  1YPR A;  2ZC7 A;  2I9V A;  1TS0 A;  1MXO A;  3CWF A;  2WGW B;  2AVX A;  3UB7 A;  4FD8 A;  1T1A A;  1FCO A;  5HDS A;  2W3H A;  3OPR A;  5A90 A;  5L2F A;  3OC2 A;  4BEN A;  3EEA A;  4OPR A;  3HL9 A;  2VV8 A;  4MN6 A;  2OLU A;  1BLP A;  4DRT A;  3BEC A;  2HDQ A;  4F3L B;  4R6L A;  1NZO A;  3G4P A;  4OLD A;  4E04 A;  1Q2Q A;  2PYP A;  3QP4 A;  1F98 A;  2ZOI A;  1L0G A;  2ZLY A;  4RVA A;  4WBG A;  4C6Y A;  4Y5F A;  2EX6 A;  2UWX A;  4X6T A;  4BWI A;  2QMI A;  2G2W A;  2JHE A;  3A3E A;  2D02 A;  2XA7 M;  2M7V A;  2J9O A;  3LUQ A;  1XPB A;  2A49 A;  5M18 A;  2J3T C;  5DTT A;  3SH7 A;  4I38 A;  3ZG7 B;  3S7P A;  4LRZ E;  5DFY A;  5HX9 A;  2IWC A;  2XSS A;  1GSV A;  3VFF A;  3A0V A;  2HDS A;  4BL3 A;  5GL9 A;  4UQI M;  4L9G A;  1TF1 A;  1ESU A;  1NXY A;  1GHP A;  1S4S A;  4CLC D;  4KEN B;  4CQH A;  1K56 A;  1Q2P A;  3F1P B;  4N1H A;  4XT2 B;  1YMS A;  3UO9 A;  3BM6 A;  5FQM A;  2FH5 A;  4KZB A;  3I7J A;  5FSR A;  4Y15 A;  1P9R A;  4Z1W A;  2M1C A;  2GDN A;  4R0Q A;  4R1G A;  3DTM A;  2Z2M B;  2V1B A;  3IBJ A;  1KDW A;  4LLO B;  2ZQA A;  3MXQ A;  4DJ2 A;  4DXC A;  2VGJ A;  4E3J A;  2X71 A;  1RP5 A;  2Z6D A;  2A2L A;  3ICY A;  1KGG A;  3ZFZ A;  3DTI A;  5G18 A;  3IH8 A;  3KO6 A;  3KSF A;  4KZ9 A;  5EM1 A;  1OTA A;  2KX6 A;  4ZRR A;  3H82 B;  3N4I A;  4OON A;  3VV4 A;  3H9W A;  1E3U A;  1NRJ A;  1K4E A;  4WMC D;  2EXB A;  4MEZ A;  4P85 A;  2I72 A;  2GZA A;  2A24 A;  5CEC A;  3M6B A;  3A3F A;  3E4Q A;  3UNW A;  3O86 A;  3HCY A;  2W27 A;  3FPW A;  5EUA A;  4Q0J A;  2XFS A;  1MWU A;  4KZ8 A;  4NG2 A;  3V39 A;  5DKK A;  4BL2 A;  3Q82 A;  5M1A A;  1JWP A;  3F1N B;  1ONG A;  3B42 A;  5A93 A;  3GVB A;  3UDI A;  5FQ9 A;  1CF0 A;  4NEE D;  1GHM A;  2QKP A;  3FV7 A;  1PWG A;  4HNB A;  2O9A A;  4EES A;  2PYR A;  5E2E A;  2Y91 A;  3FKW A;  3IBR A;  1EI5 A;  2ZC4 B;  3AGE A;  3IT9 A;  4YNR A;  4WZ5 A;  3B3X A;  3C7V A;  5HAQ A;  5HAP A;  1FR1 A;  3NDG A;  4BBV A;  5E43 A;  2CC1 A;  1MPL A;  4WMC A;  4O01 A;  3IXD A;  1LI9 A;  4KQO A;  2FFY A;  4GKU A;  3BFD A;  4XT2 A;  5HZH A;  3IF6 A;  3GEC A;  3V5M A;  1CJF A;  2XR0 A;  3BLS A;  4JLF A;  4U0X A;  1PZP A;  4E3K A;  4LRY C;  4S2O A;  4KG6 A;  1PI4 A;  1OJG A;  3KYZ A;  3FG8 A;  4KZ4 A;  1LSV A;  3Q1F A;  4JGQ A;  3EGX C;  3VE4 A;  2MJ6 A;  3MKE A;  2ZD8 A;  4EEU A;  4S2N C;  3T4Q A;  4ID4 A;  1DJA A;  4D2O A;  2Y4A A;  5GHX A;  4HJ6 A;  2V20 A;  4N92 A;  1PWC A;  2PBY A;  4DDY A;  1PZO A;  5EPH A;  4E3I A;  3BQA A;  4PM5 A;  3MXS A;  2P74 A;  2VGL M;  2PAV P;  2O9C A;  3TJZ C;  2JKR M;  3LIC A;  3LEQ A;  1GSW A;  3OBF A;  3CG5 A;  3WS1 A;  5FAS A;  3R7W B;  3G31 A;  3BEB A;  1PWD A;  4GS9 B;  3C5A A;  3B33 A;  1ES5 A;  1MY8 A;  1XP4 A;  3MF0 A;  3NHQ A;  1IEM A;  3DW0 A;  4Y0T A;  4OOL A;  4WL9 A;  2R9X A;  3G2Z A;  3PHY A;  4MBH A;  3UE1 A;  2Q0O A;  4E3N A;  4JPM A;  1DP6 A;  3K3C A;  1VQQ A;  3BW6 A;  5MC7 A;  5CGS A;  2J3T D;  1VM1 A;  2P9V B;  3SS3 A;  1ERO A;  3MZD A;  3ZYT A;  1KE0 A;  1DP8 A;  1LL8 A;  2XH9 A;  5HAR A;  5TJJ A;  3ZNY A;  4I39 A;  3Q07 A;  4OOM A;  2PR6 A;  2UV0 E;  3CLO A;  2PT7 A;  1M6K A;  2PD8 A;  2W1R A;  4S2K A;  3V50 A;  3TRC A;  3VP0 A;  3EQV A;  1Y54 A;  4Y0O A;  3M2K A;  1ZG4 A;  3N8R A;  5AJG A;  1S66 L;  1H8Y A;  4EUV A;  3G6O A;  5FI7 A;  3CIT A;  1PIO A;  4GJ4 A;  3A3D A;  3MFD A;  4KG2 A;  1IFQ A;  4PAU A;  1XJ3 A;  3CUE C;  2D01 A;  1VHM A;  1BLC A;  5IU1 A;  2EXA A;  3ULF A;  2KLI A;  4LRX C;  3LI8 A;  5IT5 A;  2R9W A;  1NY0 A;  4EUZ A;  5HPI A;  3DTK A;  3E98 A;  1NLZ A;  4UAA A;  4KUO A;  1LSX A;  1GCE A;  4X68 A;  5HFO A;  4DMZ A;  4QPR A;  3BY8 A;  3GDI A;  1YKD A;  4P0M A;  3CUE A;  3OLO A;  3LIB A;  4NET A;  1F9I A;  3NOU C;  2OAP 1;  3LID A;  2EX8 A;  2K7S A;  2C5W B;  4CLC A;  4GS9 A;  2HPB A;  3BQ8 A;  3MR0 A;  2WK0 A;  1XJ2 A;  4BBT A;  1ODV A;  2WGW A;  2XD1 A;  5DFX A;  1RGZ A;  4U0T A;  2DCF A;  3GV9 A;  1YLW A;  3GR2 A;  4S2J A;  3IS2 A;  1FIL A;  4PM9 A;  3Q7V A;  5J3W A;  4G3K A;  4JGO A;  1S1Z A;  1BT5 A;  2VA0 A;  1FQG A;  5KZH A;  5F5Y A;  4ZBE A;  2O9B A;  1KE3 A;  3N7W A;  3CHW P;  3NCK A;  1PNE A;  3RXW A;  4WUJ A;  3LY3 A;  4PKY G;  4OPY A;  4Y2F A;  4BLM A;  4R3J A;  3R7W A;  1DY6 A;  1D1J A;  2VZW A;  2W3D A;  4U3T A;  4Q0H A;  4E6X A;  3HLD A;  2X02 A;  2G2U A;  3LI9 A;  4QY6 A;  3W4O A;  2H10 A;  3RH8 B;  4N9L A;  1IKG A;  3A0S A;  3JVU A;  1T1C A;  1TEM A;  4OKP A;  4BQM A;  3WS0 A;  3W4P A;  3TE8 A;  4S2P A;  4MNR A;  5AQ7 A;  1YSQ A;  4MMN A;  5HWV A;  2JE5 A;  1KOU A;  4L9F A;  4EQ1 A;  5FDH A;  5A92 A;  3VMA A;  4YIN A;  2VV7 A;  2KDK A;  2JKR I;  2Z2L B;  3UE3 A;  1JWZ A;  3BFE A;  3LIF A;  4I5S A;  4P6Z M;  1W79 A;  4ZDX A;  1BZA A;  2BG1 A;  3UDF A;  3HUM A;  1IEL A;  4KQD A;  4NXE A;  3BLM A;  1T18 A;  4KZA A;  5FAP A;  5FDS A;  5CHM A;  2ZQ7 A;  2ZBB A;  3EOI A;  3RJU A;  1W8Y A;  5AQB A;  5A91 A;  4R4S A;  3T1R A;  1H0M A;  1E25 A;  3OOV A;  1N9L A;  3OCN A;  2Y2Q A;  5HW3 A;  3V3R A;  4CLC B;  1L3L A;  1K55 A;  1LT0 A;  3VSK A;  4JGR A;  3U4L P;  1UWN X;  2LB5 A;  3UB8 A;  2EFX A;  1MWR A;  2HDR A;  4PMA A;  4UQI S;  1BUL A;  4QD4 A;  1O07 A;  2ZMF A;  4LFU A;  4X55 A;  4DJ3 A;  5FL3 A;  5DTS A;  2ZMA A;  4D60 A;  3M2J A;  4WEJ A;  3ZVW A;  3M6H A;  1RCJ A;  3O3V A;  4IBR A;  4PM8 A;  3F1N A;  3NY4 A;  2E8J A;  3GSG A;  4IUK A;  1JVJ A;  2V0W A;  4GD6 A;  5HPF A;  2PDR A;  3RTY A;  1HZO A;  3C2W A;  3VSL A;  2QPN A;  2PBD P;  2ZQ9 A;  1U60 A;  3IF5 A;  3SS5 A;  4JGP A;  3T12 B;  1L0E A;  1TDG A;  1KVM A;  5EFW A;  5CRF A;  5DF8 A;  1JWV A;  3HUN A;  2JBF A;  4KZ3 A;  5J4E A;  1IOU A;  4IVK A;  5F82 A;  3QNB A;  3JPU A;  1PI5 A;  4DF6 A;  4GHI B;  4KZ5 A;  4EQI A;  3FPV A;  2J7V A;  4NXB A;  3ZGA B;  5BOH A;  4HP4 A;  3A3J A;  5EVI A;  3PBR A;  3VP3 A;  4GDB A;  3LIE A;  3VOZ A;  4UA9 A;  3L7H A;  3LR3 A;  3P01 A;  1K4F A;  3QP8 A;  1MC0 A;  4II7 A;  1IKI A;  5C5K A;  3WWX A;  2RCX A;  5GLA A;  3A3I A;  2CMN A;  5CTM A;  4N1X A;  5TBM B;  2K2N A;  3IX8 A;  2Y2H A;  2B02 A;  1L0F A;  5JYP A;  1S6R A;  1MWS A;  3LR5 A;  1S1Y A;  2JCH A;  1D7E A;  4ME4 A;  2ZM2 A;  1VET B;  4WZ4 A;  3S7O A;  4C75 A;  1S4R A;  1ZTU A;  4WEK A;  3SS4 A;  3TG9 A;  3E0Y A;  3HUO A;  4MN7 A;  3VFH A;  4E3L A;  2NUP C;  2ZQD A;  1Z6F A;  3A0R A;  4ZAM A;  2HP9 A;  2Y2O A;  2QHK A;  5F1F A;  3MQQ A;  3C4O A;  4R38 A;  2H28 A;  4OH0 A;  2X01 A;  5CEB A;  3QHY A;  4JXV A;  2VK3 A;  4KUK A;  3C7U A;  3VP1 A;  1ES4 A;  4Y0U A;  1JTD A;  2WUQ A;  4GOG A;  5L09 A;  2PRF A;  4MN5 A;  1D06 A;  4PM7 A;  4HP9 A;  3HRE A;  4B88 A;  3QP6 A;  3ZQ5 A;  5IHV A;  5F68 A;  5U47 A;  2WKI A;  4GZB A;  1XFQ A;  3BJN A;  1STZ A;  2PU4 A;  4H8R A;  3NJA A;  3SH9 A;  2HGV A;  3S22 A;  1H8Z A;  4RQ9 A;  3AGF A;  3HLB A;  4O7D A;  5FI6 A;  2WZX A;  2W3G A;  3UB6 A;  1OTB A;  1I2S A;  4MLL A;  4LCM A;  1ESI A;  4LEN A;  3CPT A;  1CK3 A;  5EE8 A;  2XK1 A;  1SDN A;  1SKO A;  2WKE A;  3T4K A;  1XFN A;  4KQQ A;  2XGN A;  1E3U D;  3MMH A;  3BYD A;  4IVI A;  4KQR A;  4S2M A;  4GNU A;  4GB7 A;  2EFU A;  1TVF A;  5HL1 A;  1K6R A;  1TS7 A;  2HJE A;  2DRW A;  4JF6 A;  1CEF A;  5EEC A;  3EEH A;  5EOO A;  4BJP A;  3CJM A;  4PHT A;  5EV0 A;  2OWJ A;  2V9A A;  2Q9N A;  3HLW A;  3P98 A;  1F2K A;  4WM9 A;  4HBT A;  4IHQ A;  4ZTK A;  3T4J A;  1SKF A;  3T4T A;  3MBZ A;  1OT6 A;  3OZH A;  3PYP A;  3W8K A;  4K91 A;  3ISG A;  3UE6 A;  4RX3 A;  3Q7Z A;  3IWQ A;  3VOL A;  2ZC6 B;  3MJQ A;  1YLZ A;  2LB9 A;  1TD5 A;  2XF3 A;  3PXP A;  3W2Z A;  2QWS A;  4UA6 A;  4K08 A;  3K3D A;  3T1S A;  3HLF A;  3C30 A;  1DJB A;  2HJ9 C;  2RL3 A;  5EVL A;  3LR0 A;  2HZ5 A;  2HV1 A;  1SZV A;  1ZG6 A;  2G7U A;  1OTI A;  2XDM A;  2ZM8 A;  2J9P A;  3IX4 A;  3PAE A;  3UB5 P;  1XX2 A;  4EU0 A;  2V1A A;  1WE4 A;  4PPR A;  2O0Y A;  2EWV A;  4FOF A;  2Z6C A;  1EWZ A;  1XA1 A;  4GLQ A;  1QME A;  3HBR A;  3DBA A;  3IXG A;  4LV1 A;  1OT9 A;  2BLS A;  4OQI A;  4WEL A;  2XQZ A;  1ES2 A;  1XJ6 A;  2ZM0 A;  4HY8 A;  3H82 A;  1K56 D;  1OJ5 A;  1W5D A;  1YLJ A;  2W3E A;  1K54 A;  1K57 A;  1QMF A;  1G6O A;  3HJK A;  4O0P A;  1XJ4 A;  1YT4 A;  2Y2P A;  3IX3 A;  4CPK A;  4Y13 A;  1G5U A;  5HL6 A;  2PU2 A;  3P7N A;  1ALQ A;  2ZOH A;  4YFM A;  3QP1 A;  3SOI A;  1Z09 A;  2DMW A;  5FQK A;  3PBO A;  2Y2J A;  4HHD A;  1HD8 A;  3Q81 A;  1V9Z A;  1X0O A;  4F3L A;  3C38 A;  1PW1 A;  3MSH A;  4P6Z S;  5DF9 A;  5TR7 A;  1WYB A;  1ZKJ A;  3IHB A;  3KSH A;  3VOY A;  1RGY A;  1KDS A;  5I5L A;  3WS4 A;  3OPL A;  1S0W A;  1NYM A;  4IUH A;  2HF6 A;  3PBN A;  1BYW A;  3IF6 B;  1PFL A;  3IS2 B;  3RFB A;  4QJG A;  1XA7 A;  4EBL A;  2YKF A;  3VP4 A;  3FYZ A;  4HH2 A;  5J8X A;  1BUE A;  3LO7 A;  4IED A;  5KIZ A;  4I3I A;  2W1T B;  1EW0 A;  4OQH A;  2VKS A;  2ZJ9 A;  5CGW A;  3H7W A;  3UPP A;  1LI0 A;  5K5B A;  1TDL A;  3K2N A;  3UPO A;  1W63 Q;  2JKG A;  1Y28 A;  3E2L A;  4ARZ A;  4DKI A;  4FCF A;  4DE3 A;  1KGF A;  4QHC A;  5EVI B;  5CED A;  2HDU A;  4WYY A;  5KSC A;  1GHI A;  5F83 A;  4GN2 A;  4RYE A;  4HJ3 A;  1KE4 A;  4BMW A;  1OTE A;  3D3O A;  1AWI A;  4OPZ A;  5HSQ A;  1CI8 A;  3V3S A;  4N9K A;  2XD5 A;  4JF4 A;  2V0U A;  1N9N A;  1N9O A;  4H6J A;  3MQ0 A;  4RA7 A;  3MZF A;  2JKT I;  4L0L A;  3HLE A;  1ACF A;  1L2S A;  1SCW A;  1H5X A;  4JXS A;  1DP9 A;  1YSP A;  2ZL1 A;  4FH2 A;  5EVI C;  2HP6 A;  3WS5 A;  1PYY A;  3D4F A;  2VGK A;  4HJ4 A;  3MKF A;  3KYQ A;  3EQU A;  2XEP A;  2A24 B;  3B47 A;  3GMW A;  4JXG A;  4I3J A;  2VX8 A;  5E2H A;  3R4K A;  2OV5 A;  4NK3 A;  3WS2 A;  3BY9 A;  3GRJ A;  3N8S A;  4UEY A;  2B95 A;  3LFV A;  3O88 A;  3PAG A;  3D72 A;  1HVB A;  4LV3 A;  3UB9 A;  3UMD A;  4OP5 A;  2PD7 A;  1ZHH B;  3PBS A;  4EET B;  1JNU A;  1YLT A;  3IXB A;  2W3F A;  4WLA A;  4IBX A;  1P9W A;  2WKR A;  1AXB A;  1MKM A;  5HDD A;  2VJW A;  2W0N A;  4GCZ A;  2Y2G A;  3JYI A;  1K6S A;  2Y79 A;  1YLY A;  2XA7 S;  5I94 A;  3Q7V B;  2P7J A;  3DAV A;  5DJT A;  1K38 A;  2WAD A;  1P0Z A;  1YAX A;  4O8G A;  4S2N A;  3GQZ A;  1ERM A;  4BD0 A;  2M7U A;  3F1O A;  3IHA A;  4C3Q A;  5CX7 A;  4DDS A;  3MZE A;  3MS6 A;  3F1O B;  3ZDJ A;  1YQS A;  5A8B A;  2WKP A;  3BWL A;  4P6B A;  2Y55 A;  4RX2 A;  3VE3 A;  3CAX A;  5KMW A;  1BLH A;  1SKO B;  4BD1 A;  2O99 A;  4LGW A;  3LY4 A;  1HTZ A;  1YLP A;  4EXO A;  4KZ7 A;  4K0W A;  4XXR A;  3UN7 A;  1FSY A;  3PBQ A;  4HI4 A;  3SW1 A;  1MWT A;  3QP2 A;  2H0Y A;  3LIA A;  3CZD A;  3C8C A;  1MKI A;  3PBT A;  4EBN A;  4FH4 A;  2K31 A;  3KYE A;  2BTF P;  1JTG A;  2Y2K A;  5J7E A;  2VGL S;  4B9O A;  5CGX A;  1N9B A;  2ACG A;  4UA7 A;  4R70 A;  3AGD A;  1FSW A;  5FAO A;  3U2A A;  3GTC A;  2JN7 A;  3MXR A;  2ZQC A;  1K54 C;  1K57 C;  1FCN A;  5CER A;  2Q9M A;  3D9Y A;  1N4O A;  3T4L A;  3T50 A;  4MBK A;  2WZZ A;  4OPQ A;  3IWI A;  2H5S A;  5GLC A;  3ZNT A;  3VP2 A;  4F94 A;  3IXH A;  2V1Z A;  3FKV A;  3MQO A;  1L0D A;  4LV2 A;  2Y8H A;  5E2G A;  4XUZ A;  3DWK A;  2XRO A;  3O5Y A;  4YWZ A;  1NRF A;  3CI6 A;  3UE0 A;  4ARZ B;  1FCM A;  2WKQ A;  4CLC E;  2EWW A;  2GNX A;  3E4O A;  1PRQ A;  2B5R A;  3N6I A;  1NZU A;  2Y2L A;  4K0X A;  2XRN A;  3RXX A;  1FIK A;  3QNC A;  1VEU A;  4NXG A;  2VV6 A;  1TS6 A;  3ZG8 B;  3PTE A;  3NI9 A;  2KOI A;  4KZ6 A;  5AVF A;  1W8Q A;  5DF7 A;  4XUX A;  3E2K A;  4X25 A;  3P09 A;  5GHY A;  4H6J B;  4DE2 A;  2VEA A;  4OLG A;  3JVV A;  5L07 A;  1NYY A;  3CMZ A;  4ZJ2 A;  2ZL1 B;  3EWK A;  4R4R A;  4OVD A;  3N8L A;  4GHI A;  4WZ5 C;  4UHU A;  3NOT C;  5EOE A;  4AFI A;  2QZ6 A;  1BLS A;  3NUL A;  4GDN A;  2J80 A;  4M4X A;  2WGV A;  2IWD A;  4A5R A;  5EVE A;  5DKL A;  3E4P A;  4MBF A;  5GHZ A;  4IJG A;  2XFT A;  5EVI D;  4QU3 A;  3G34 A;  2L1M A;  3W4Q A;  4FUW A;  2XLN A;  4EW7 A;  5HDC A;  2NUT C;  3IWO A;  2C6W B;  1LL9 A;  4S2L A;  2GJ3 A;  4QWO A;  3KX0 X;  4R3A A;  1UGU A;  3ZG9 B;  5AQ9 A;  4HH3 A;  3NEC A;  3UDX A;  1UWP X;  5FAT A;  1W63 M;  1O7E A;  1W7F A;  5L8M A;  2L4R A;  1BTL A;  3S7Q A;  4EEP A;  3KSG A;  3UME A;  5FAQ A;  2V8F A;  1G28 A;  1H8M A;  2H0T A;  2L0W A;  3BFC A;  3S1Y A;  2W1T A;  1NWZ A;  3OCL A;  2B18 A;  1C3B A;  4PKY A;  2ZC5 B;  4OQG A;  3HLC A;  4FSF A;  1YM1 A;  3HJI A;  1S67 L;  5HWW A;  3O87 A;  2EX2 A;  4WF0 A;  1LL5 A;  4DE1 A;  5M19 A;  5DJU A;  1ES3 A;  4CLC C;  4P87 A;  4B93 A;  3WRT A;  2FFF B;  2WAE A;  2Y59 A;  3ZG0 A;  2OWH A;  2GX5 A;  5HWT A;  2PR5 A;  1MBL A;  5GLB A;  1IYQ A;  4LCL A;  4FTX A;  1GA9 A;  1OPX A;  4X56 A;  2Y2I A;  2DNS A;  1NLY A;  1I5Q A;  1LLB A;  2WKH A;  2A3U A;  3WRZ A;  3DTE A;  4JKT A;  1CEG A;  4Q8I A;  1J9M A;  5F1G A;  3S4X A;  5TGF A;  1DJC A;  1VET A;  3BFF A;  3PR6 A;  3IF6 C;  1MZU A;  3LGO A;  3ITA A;  4DN0 A;  1TS8 A;  1OTD A;  4DE0 A;  2P04 A;  3CPT B;  2IA2 A;  5F6A A;  3G30 A;  2IWB A;  4L9E A;  1G68 A;  2JKT M;  3FWL A;  4JBF A;  4S2I A;  4HOI A;  1V9Y A;  1ZC2 A;  1XKZ A;  2FZ0 A;  4HBU A;  5CHU A;  5CXW A;  4ZJ3 A;  4E3O A;  2VLG A;  4GW9 A;  5D3O A;  2J8Y A;  4OP8 A;  4DXB A;  4R3B A;  4X1M A;  4EER A;  3BFG A;  3ZVT A;  4ZJ1 A;  2P08 A;  3NC8 A;  3FC7 A;  3ITB A;  2OLV A;  1F5M A;  3OPP A;  4MDZ A;  1GSX A;  4E6W A;  4Y3I A;  5FA7 A;  3ZG5 A;  4OQ0 A;  3QP5 A;  1IYO A;  1WYC A;  4E3M A;  4HEF A;  1I2W A;  2V8C A;  3LR4 A;  4JF5 A;  2WGI A;  1VEU B;  2ZMV A;  1XGI A;  4G3W A;  2JC7 A;  3EGD C;  3G32 A;  3C4P A;  4EBP A;  2JKF A;  3G2Y A;  1YMX A;  4HES A;  4X1L A;  4MCW A;  1IYS A;  5CTN A;  1SHV A;  1WA9 A;  3L9K A;  3HVF A;  1LHY A;  2QJ5 A;  2INW A;  1CI9 A;  2EA9 A;  2HP5 A;  3V67 A;  5GLD A;  2QJ7 A;  4Y17 A;  1DRM A;  5TBM A;  5EM0 A;  4ESP A;  5G4Y A;  2WYX A;  3NOP C;  4EWF A;  1LSW A;  2ZQ8 A; 
#chains in the Genus database with same CATH homology
 4GS9 B;  3F1O B;  3B33 A;  4KUK A;  3MF0 A;  2QYB A;  1P97 A;  5A8B A;  3NHQ A;  2WKP A;  3BWL A;  4ETZ A;  4OOL A;  3VE3 A;  4WL9 A;  5F69 A;  3LYX A;  4MN5 A;  3CAX A;  1D06 A;  3PHY A;  4HP9 A;  2O99 A;  3TW8 A;  4EXO A;  3T4S A;  3ZQ5 A;  1DP6 A;  3K3C A;  3BW6 A;  5MC7 A;  3PBQ A;  4HI4 A;  5F68 A;  3SW1 A;  4I3A A;  2J3T D;  1XFQ A;  3BJN A;  3LIA A;  5AVE A;  3F1P A;  1STZ A;  2BAS A;  5KSH A;  3ZYT A;  3C8C A;  3NJA A;  2HGV A;  3T4O A;  4ETX A;  1DP8 A;  1LL8 A;  5G4Z A;  4RQ9 A;  4LPZ A;  3PBT A;  4YOF A;  5TJJ A;  2K31 A;  4I39 A;  2W3G A;  3UB6 A;  4OOM A;  1OTB A;  2PR6 A;  5LBR A;  3CLO A;  2PT7 A;  2PD8 A;  2W1R A;  3TRC A;  5J7E A;  2VGL S;  3EQV A;  5HD5 A;  3T4K A;  4B9O A;  5AJG A;  4R70 A;  1XFN A;  1S66 L;  4EUV A;  3S7N A;  3U2A A;  3G6O A;  2JN7 A;  3MMH A;  2J3W A;  3CIT A;  4GJ4 A;  1TS7 A;  4HIA A;  1IFQ A;  2HJE A;  4PAU A;  3T4L A;  3T50 A;  1XJ3 A;  3CUE C;  4WN5 A;  5IS1 A;  2D01 A;  1VHM A;  5IU1 A;  3EEH A;  4BJP A;  3MFX A;  1H3Q A;  4NXF A;  3ULF A;  2KLI A;  4LRX C;  3MQO A;  3LI8 A;  4G3V A;  4PHT A;  5IT5 A;  2OWJ A;  2V9A A;  4BBU A;  2Y8H A;  5HPI A;  3E98 A;  2XRO A;  1NLZ A;  2R78 A;  1T1B A;  4Q0I A;  3O5Y A;  1T19 A;  4KUO A;  3KSI A;  4YWZ A;  4IHQ A;  1LSX A;  3T4J A;  2OAQ 1;  4NKP A;  4DMZ A;  4QPR A;  3CI6 A;  3GDI A;  3BY8 A;  4HQA A;  4ARZ B;  2OOL A;  1YKD A;  2YKH A;  2PHY A;  3CUE A;  5HD3 A;  3OLO A;  3LIB A;  2WKQ A;  3T4T A;  4CLC E;  1OT6 A;  3H7W B;  1VB6 A;  3PYP A;  2EWW A;  2GNX A;  3E4O A;  3UE6 A;  1F9I A;  3NOU C;  2OAP 1;  3LID A;  3VOL A;  3MJQ A;  2XRN A;  2K7S A;  4CLC A;  2I9V A;  4NXG A;  1TS0 A;  2VV6 A;  2LB9 A;  1TD5 A;  3PXP A;  1TS6 A;  3W2Z A;  4GS9 A;  2QWS A;  3CWF A;  3BQ8 A;  4K08 A;  3K3D A;  3C30 A;  2HJ9 C;  3MR0 A;  1XJ2 A;  3UB7 A;  2KOI A;  3LR0 A;  4BBT A;  1ODV A;  2HV1 A;  2G7U A;  1T1A A;  1OTI A;  5DFX A;  5AVF A;  5HDS A;  2W3H A;  4H6J B;  3OC2 A;  3EEA A;  3IS2 A;  2VEA A;  2VV8 A;  4MN6 A;  5J3W A;  3JVV A;  4G3K A;  4EU0 A;  4JGO A;  2V1A A;  1S1Z A;  2O0Y A;  2EWV A;  4FOF A;  2VA0 A;  3EWK A;  2Z6C A;  4GLQ A;  5F5Y A;  4F3L B;  4R6L A;  3DBA A;  2O9B A;  4GHI A;  4E04 A;  1OT9 A;  3NOT C;  2PYP A;  1F98 A;  2ZOI A;  4AFI A;  4WEL A;  4WUJ A;  4Y5F A;  2J80 A;  4M4X A;  4PKY G;  4Y2F A;  1XJ6 A;  4HY8 A;  4BWI A;  3H82 A;  2JHE A;  5DKL A;  2D02 A;  2XA7 M;  3E4P A;  3R7W A;  1OJ5 A;  2M7V A;  2VZW A;  2W3E A;  4IJG A;  2W3D A;  3LUQ A;  4Q0H A;  1G6O A;  3LI9 A;  2L1M A;  3HJK A;  2J3T C;  4O0P A;  1XJ4 A;  4EW7 A;  4I38 A;  3RH8 B;  5HDC A;  2NUT C;  3A0S A;  3S7P A;  2GJ3 A;  4LRZ E;  3JVU A;  5DFY A;  1T1C A;  2XSS A;  3KX0 X;  1GSV A;  5HL6 A;  3P7N A;  4R3A A;  1UGU A;  3TE8 A;  2ZOH A;  3A0V A;  4HH3 A;  1YSQ A;  4MMN A;  1UWP X;  4UQI M;  4L9G A;  5HWV A;  1W63 M;  5L8M A;  1KOU A;  1TF1 A;  2DMW A;  2L4R A;  3S7Q A;  4L9F A;  4EEP A;  1S4S A;  3KSG A;  4CLC D;  4EQ1 A;  3PBO A;  4CQH A;  4HHD A;  3UME A;  3F1P B;  4XT2 B;  2VV7 A;  2KDK A;  1G28 A;  1H8M A;  2L0W A;  2FH5 A;  2W1T A;  1V9Z A;  2JKR I;  1NWZ A;  1X0O A;  1P9R A;  3UE3 A;  3OCL A;  2B18 A;  3LIF A;  4I5S A;  4P6Z M;  4F3L A;  4PKY A;  3C38 A;  5DF9 A;  4P6Z S;  2M1C A;  4Z1W A;  4FSF A;  4KQD A;  4NXE A;  3KSH A;  1T18 A;  3HJI A;  2V1B A;  1S67 L;  3IBJ A;  2ZBB A;  3EOI A;  5I5L A;  4LLO B;  4DJ2 A;  3MXQ A;  5HWW A;  4IUH A;  2HF6 A;  3PBN A;  1BYW A;  4WF0 A;  3IS2 B;  3RFB A;  2Z6D A;  2A2L A;  5DJU A;  3ICY A;  2YKF A;  4CLC C;  4B93 A;  3KO6 A;  3OOV A;  3KSF A;  1N9L A;  1OTA A;  2KX6 A;  4HH2 A;  3OCN A;  4ZRR A;  3H82 B;  3VV4 A;  4CLC B;  3H9W A;  2OWH A;  1LT0 A;  1NRJ A;  2GX5 A;  5HWT A;  4I3I A;  4JGR A;  5KIZ A;  1UWN X;  2W1T B;  2PR5 A;  2LB5 A;  1EW0 A;  3UB8 A;  2VKS A;  1OPX A;  2GZA A;  2A24 A;  3H7W A;  1NLY A;  4UQI S;  5K5B A;  3K2N A;  3E4Q A;  2ZMF A;  1W63 Q;  3HCY A;  2W27 A;  3FPW A;  1Y28 A;  4ARZ A;  4DJ3 A;  5FL3 A;  4Q0J A;  5DKK A;  4WEJ A;  3PR6 A;  3F1N B;  3B42 A;  1MZU A;  3F1N A;  4DN0 A;  1TS8 A;  4IUK A;  2V0W A;  5HPF A;  1OTD A;  2PDR A;  2P04 A;  4NEE D;  4HJ3 A;  3RTY A;  4BMW A;  1OTE A;  3C2W A;  2QKP A;  2IA2 A;  3D3O A;  4HNB A;  5F6A A;  5HSQ A;  4L9E A;  2O9A A;  4EES A;  2PYR A;  2JKT M;  3IBR A;  4HOI A;  2V0U A;  1N9N A;  1N9O A;  1V9Y A;  4H6J A;  3MQ0 A;  2FZ0 A;  4YNR A;  4JGP A;  2JKT I;  5EFW A;  4L0L A;  2VLG A;  4GW9 A;  4BBV A;  1IOU A;  5J4E A;  1DP9 A;  1YSP A;  4GHI B;  4EER A;  4O01 A;  4KQO A;  2P08 A;  4HJ4 A;  3FPV A;  3KYQ A;  3FC7 A;  3EQU A;  4XT2 A;  2A24 B;  5HZH A;  4NXB A;  3B47 A;  3GEC A;  1F5M A;  4HP4 A;  4MDZ A;  1GSX A;  4I3J A;  2VX8 A;  4Y3I A;  3R4K A;  3PBR A;  3BY9 A;  3LIE A;  4LRY C;  3LFV A;  4UEY A;  3D72 A;  3LR3 A;  3P01 A;  3UB9 A;  1MC0 A;  3LR4 A;  4II7 A;  3UMD A;  5C5K A;  2PD7 A;  1OJG A;  1ZHH B;  2ZMV A;  3KYZ A;  2CMN A;  4G3W A;  3PBS A;  3FG8 A;  4EET B;  3EGD C;  1JNU A;  1LSV A;  4JGQ A;  5TBM B;  2K2N A;  2W3F A;  3EGX C;  3VE4 A;  4WLA A;  2B02 A;  2MJ6 A;  4EEU A;  3LR5 A;  1S1Y A;  4MCW A;  3T4Q A;  1D7E A;  1P9W A;  2WKR A;  4HJ6 A;  1MKM A;  4ME4 A;  5HDD A;  1WA9 A;  3S7O A;  2VJW A;  2W0N A;  4GCZ A;  1S4R A;  1ZTU A;  2QJ5 A;  2INW A;  2Y79 A;  4WEK A;  2XA7 S;  3BQA A;  2EA9 A;  3E0Y A;  3V67 A;  4MN7 A;  2P7J A;  2VGL M;  2NUP C;  3A0R A;  2QJ7 A;  1DRM A;  5TBM A;  5DJT A;  2O9C A;  2QHK A;  3MQQ A;  5G4Y A;  3TJZ C;  4R38 A;  2H28 A;  1P0Z A;  2JKR M;  3LIC A;  1YAX A;  4O8G A;  1GSW A;  3NOP C;  3OBF A;  2M7U A;  1LSW A;  3F1O A;  5CX7 A;  3R7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...