1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
5A8BA 3P7NA 1X0OA 3FG8A 5HWWA 2PYPA 3T50A 4KUOA 3LIFA 2PD7A 2Z6CA 3H82B 4GHIA 1OTDA 1F9IA 3EWKA 4HQAA 4PKYA 4R3AA 3VOLA 5KIZA 2OWHA 1G28A 4I5SA 2L1MA 5G4YA 4NXEA 5DJUA 3H9WA 4NXGA 2PDRA 2VEAA 2BASA 1OTIA 3LIAA 4NXBA 4M4XA 2A24B 1DRMA 4EESA 1P97A 2YKHA 4JGPA 3UMDA 4KQDA 4YWZA 3PYPA 3VE4A 1DP8A 4DJ3A 1T1BA 3MQQA 4HOIA 3K3CA 2PR5A 4R70A 2KDKA 1N9OA 3PHYA 4I3JA 1OTEA 1S1ZA 1TS8A 1LSVA 2I9VA 4RQ9A 3UB6A 1XFQA 1Y28A 1XJ2A 3C2WA 4GS9A 4PKYG 1OJ5A 4HNBA 2V0UA 4MN5A 5F69A 5J7EA 2L0WA 2J80A 3G6OA 2VLGA 4KUKA 2PR6A 2WKQA 4BBTA 4GS9B 1TS7A 2D01A 1JNUA 4HJ3A 1OTAA 4HJ4A 4I3AA 2ZOHA 4R6LA 5TBMB 1S67L 1OT9A 4WLAA 5HDDA 1N9NA 2QJ7A 5DKLA 1D06A 3LIBA 1V9ZA 2W0NA 3NOUC 1OJGA 2YKFA 4WF0A 2QWSA 2HV1A 1LT0A 1P0ZA 1XFNA 2VV6A 4EW7A 1T1AA 3LIEA 2INWA 4HP9A 1GSVA 4EQ1A 1OT6A 1VB6A 2WKRA 3NOTC 1DP6A 2QKPA 3GECA 1T18A 2B02A 2Z6DA 3HJIA 3IBRA 3MXQA 5J3WA 5F5YA 1LSXA 3F1NA 3CAXA 2OWJA 3A0RA 3CWFA 4LRXC 3KX0X 2PYRA 4HI4A 5HD3A 3H7WB 1XJ6A 3UB8A 3MJQA 1S1YA 2PHYA 4JGQA 4L9FA 4LPZA 3RH8B 3C8CA 2OOLA 3UE6A 1V9YA 3FC7A 1T1CA 2PD8A 3MQOA 3BY8A 4R38A 3A0SA 5AVFA 4B9OA 4EETB 1UWNX 2ZBBA 4JGOA 5HDCA 3F1PB 5HD5A 5DJTA 4EEPA 5HSQA 1GSWA 4XT2A 5EFWA 3NHQA 5G4ZA 3F1NB 4HH3A 5HWVA 1T19A 2M1CA 3GDIA 4JGRA 2QJ5A 3RTYA 3H82A 3UMEA 4L9GA 3ICYA 4BBUA 4NXFA 2VV7A 3LYXA 1TS6A 4HP4A 4WL9A 5AVEA 3IS2B 3MR0A 2P7JA 2L4RA 3NJAA 4BBVA 2A24A 5HDSA 3LIDA 1S4SA 4F3LA 1LSWA 2CMNA 5IS1A 3E4QA 5HWTA 3UB9A 1F98A 3ULFA 3BY9A 4H6JB 3LI9A 1UGUA 5IU1A 4EEUA 3VE3A 4GW9A 2V1BA 1TS0A 2JN7A 1OTBA 2R78A 4GHIB 4MN6A 1BYWA 3LUQA 1XJ4A 1S4RA 3F1PA 3A0VA 1NWZA 1N9LA 3D72A 4L9EA 2VV8A 5TBMA 3E4OA 1EW0A 1D7EA 1XJ3A 4H6JA 5HZHA 3F1OA 4HJ6A 3E4PA 3UB7A 2QHKA 3LICA 3OLOA 2WKPA 3SW1A 4HIAA 2D02A 4LRZE 3H7WA 3F1OB 4HHDA 1MZUA 2H28A 2W27A 5I5LA 3B33A 4EERA 2V9AA 5DKKA 1LL8A 3BWLA 1KOUA 3NOPC 5J4EA 4WN5A 1GSXA 4HH2A 1S66L 3HJKA 4K08A 4E04A 4LLOB 4XT2B 2KX6A 5F6AA 4I38A 3ZQ5A 4EXOA 3K3DA 4GCZA 4I3IA 1UWPX 2V0WA 2JHEA 3IS2A 4HY8A 1DP9A 1WA9A 3CLOA 2EA9A 3EEHA 4DJ2A 2ZOIA 2GJ3A 3MFXA 4I39A 4F3LB 5F68A 2V1AA 4WUJA 2K7SA 3LI8A 1ODVA 4LRYC
chains in the Genus database with same CATH superfamily
3S7NA 3HLDA 4G3KA 1H8MA 1Y4OA 2OSUA 2Z6CA 1F9IA 1L0EA 3M2JA 2PT7A 2OWHA 3H9WA 5DF9A 1JWZA 4HOIA 4CLCB 5EVIA 4MCWA 2HDRA 5FQIA 1OJ5A 5J7EA 4PM7A 4MDZA 4LV1A 5EVEA 1N9NA 2EFUA 4EU0A 1V9ZA 4HP9A 4LENA 5HAQA 1TVFA 3F1NA 3T1RA 3MJQA 5CRFA 4LPZA 5HL1A 1K6SA 1V9YA 2JBFA 3IF5A 2K2NA 3TG9A 1BLHA 2KLIA 3QHYA 2Y2KA 1YSPA 3BYDA 3IS2B 2L4RA 2A24A 5HX9A 4BD0A 5CTNA 1UGUA 4GW9A 3ZNTA 2JN7A 1MXOA 1K55A 3A0VA 2IA2A 4L9EA 3MSHA 4EV4A 4YOFA 3NBLA 4ESPA 2D02A 1H8ZA 1SDEA 2E8JA 4EERA 2V8CA 4DDYA 5AQ9A 5CERA 1LL8A 5CEBA 3NOPC 5J4EA 1GSXA 3OBFA 3NY4A 2GX5A 4IJGA 3A3EA 3CLOA 2O0YA 2B18A 3K2NA 2PYPA 3ZYTA 3G31A 4PM9A 2Y8HA 4NXEA 2J3TD 2PDRA 5A91A 2EX6A 3ZG0A 4MBHA 5CGXA 1DP8A 4NEED 4QPRA 4U3TA 2E8IA 3ZVTA 1N9OA 3CJMA 2VX8A 1XJ2A 2V0UA 1GA0A 4LV0A 3LO7A 2B95A 2WKQA 1JNUA 4HJ4A 1OT9A 1N9BA 5HDDA 4QJGA 5DKLA 1OMEA 1D06A 3QP4A 3MZEA 2HJEA 4PM5A 3GMWA 2QKPA 4QD4A 3DWKA 3WS4A 2H5SA 5GHZA 3A0RA 3CWFA 3PXPA 1KE3A 1IYSA 3IQAA 5DTKA 1E3UD 5HDCA 3VFFA 5CHMA 5HWVA 1XGJA 4MMNA 4BBUA 3UB5P 1TDLA 2WK0A 3NJAA 1L0GA 1M6KA 4D2OA 4DN0A 3UB9A 3VP0A 5KSCA 3T4TA 2Y2LA 4HESA 1TS0A 3MBZA 3LUQA 1NWZA 1W8QA 1K57C 4JPMA 3BM6A 2W1TA 4Q0HA 3H7WA 4MBKA 5EVLA 1BLPA 5L09A 3O88A 4EXOA 4I39A 2K7SA 1L2SA 3LEQA 5M1AA 2GNXA 3HUMA 1PYYA 2ZQ8A 4U0XA 3G34A 1W5DA 4MBFA 4X68A 1STZA 3IF6C 3LIAA 4GOGA 4O01A 3R7WA 4JBFA 3JYIA 1GHPA 3MQQA 4OP8A 4RA7A 4R70A 5MC7A 1XFQA 2J9OA 1MY8A 4CLCA 1BUEA 2FFYA 1G68A 4EUZA 4GKUA 5TBMB 3FYZA 3Q1FA 1OJGA 4ZJ1A 5HL6A 1HD8A 1OT6A 3DTKA 4IUKA 2ZC7A 3GV9A 5JYPA 4WELA 3A0SA 3VSLA 1FSWA 3B42A 1I2SA 4HH3A 1ONGA 3GDIA 3OPHA 3V39A 4L9GA 3IWOA 3CPTA 4HP4A 5AVEA 3N4IA 4Y5FA 4BBVA 4CLCD 2XR0A 4EQIA 1S0WA 4EWFA 3BY9A 4GN2A 2IWBA 2Z2LB 4KG6A 1AXBA 3F1PA 5FI7A 4E6WA 3QNBA 5CEDA 3DTEA 1MWRA 3OCLA 2XGNA 3LY4A 2WGIA 4KZ9A 4XT2B 4E3KA 4IUHA 3K3DA 4S2KA 1U60A 1IEMA 1YLTA 4WUJA 3LR3A 1E25A 3LEZA 4B88A 3H82B 4GHIA 4HQAA 4N9LA 2JC7A 3PBNA 5FATA 3BQ8A 1YLJA 1PWCA 3OPPA 4KZ6A 2DCFA 1Z6FA 5KZHA 3MZDA 5CHJA 3WRTA 5EE8A 3S7QA 1GA9A 2HP9A 3IF6A 1GSVA 3T4QA 3RH8B 3IBRA 2EX8A 2WKIA 5AQ7A 4XUZA 4ZBEA 1TD5A 4Y0TA 4UA6A 2Y2IA 2M1CA 5L8MA 2XFTA 3RTYA 2W3FA 4ZAMA 5DVAA 3HUOA 2ZL1B 1CK3A 3RFBA 3V67A 4LV2A 1YLYA 4OQHA 4YFMA 3V50A 4MEZA 2R78A 4QY6A 1XKZA 4OQIA 3D72A 1NJ4A 4OPYA 4YNRA 3BECA 3UPPA 2LB5A 3G4PA 1PW1A 5K5BA 4X56A 2O9BA 4LLOB 5M18A 1PZPA 4GDBA 1NRJA 1SKOA 4OQ0A 3ZDJA 3D9YA 1PRQA 3HCYA 3T50A 3BW6A 3CHWP 1XGIA 4K0XA 3NCKA 3T4OA 4C6YA 3VP1A 1MPLA 5GLDA 4UEYA 3LY3A 3UB6A 4OPQA 1NY0A 2P04A 2MJ6A 2D01A 5FI6A 4ETZA 2YKFA 1OPXA 2QWSA 2HV1A 1P0ZA 1DJBA 5F83A 1LSXA 2ZC5B 4FH4A 3KX0X 3UB8A 1PWGA 2JKRI 5HSQA 1ESIA 1FIKA 3NHQA 3HL9A 2C5WB 2DNSA 2XD1A 1KGGA 1YMSA 3MMHA 4G3WA 4DKIA 1ERQA 3EGDC 2KOIA 1FILA 2K31A 2ACGA 3ZVWA 1MWTA 2H10A 5HARA 1E3UA 1W63Q 2VGKA 4QU3A 4X1MA 1LLBA 1ZG6A 1VHMA 4GDNA 2WGWB 1D7EA 4HJ6A 1BZAA 3OLOA 4P6ZM 1K56A 1ZTUA 3HJKA 4Y15A 4X25A 1TDGA 2FFFB 1DP9A 3EEHA 4PM6A 1O7EA 1ES4A 5CHUA 4ME4A 1KVLA 4R0QA 3T4JA 2ZQAA 1VM1A 1YPRA 3TRCA 3EWKA 5HAPA 2X71A 1XP4A 4DF6A 1FR1A 1TS8A 4MLLA 2PR6A 1VQQA 2ZQDA 2WAEA 3PR6A 3NOUC 3R4KA 1SZVA 2EX2A 3ZFZA 3QP8A 2B02A 2XK1A 5FQ9A 1RGZA 4DE3A 1P9RA 2PHYA 3A3FA 3LR4A 2VGLM 4R38A 4HBTA 3F1PB 1Q2QA 2HP6A 4B4XA 1T19A 4X1LA 4BL3A 3H82A 3ICYA 4WZ5C 1TS6A 1EROA 4WYYA 2NUTC 1LL5A 4A5RA 2X02A 2XEPA 1VEUB 2Y59A 2CMNA 4KZAA 3OPLA 4E3NA 4R3JA 4EBPA 3E2LA 1OTBA 4Y17A 3EQUA 3HUNA 4U0TA 2EFXA 1G6AA 2HDQA 3T4SA 2W27A 3N6IA 3KSIA 1YLPA 4WN5A 3FV7A 5FDSA 2W3HA 3BFCA 3Q81A 1K54C 5E2GA 1H8YA 4Z1WA 4RX2A 1X0OA 3FG8A 2PD7A 4Y2FA 5EM0A 1SKFA 2WZXA 4OQGA 5EECA 4WEKA 4F94A 4KZ3A 5L2FA 3VE4A 3ZGAB 3TW8A 3WWXA 1IFQA 2WKEA 4L0LA 1EWZA 4BMWA 5HW3A 2I9VA 3C4PA 3VOYA 3BRMA 2XROA 2XLNA 4CQHA 4R6LA 3E0YA 1S67L 1ALQA 4S2NA 3RXWA 1H0MA 1IYPA 2FH5A 2VV6A 3OC2A 3HLBA 2Y2JA 2J7VA 2J8YA 5GL9A 4OOMA 3UNWA 1BSGA 1W8YA 1MKIA 4P0MA 4RVAA 3ZG5A 3KYZA 3WS5A 5JYOA 3G32A 5AVFA 4GD6A 3GVBA 4Y0OA 1XA1A 5FEFA 1BTLA 5GLCA 1FQGA 3MR0A 3IWQA 3QNCA 3P01A 1CI8A 1LSWA 1KGEA 3B47A 2Y2HA 4KENB 2HP5A 2V1BA 1ERMA 5A93A 1IKIA 3V3SA 2VV8A 2GDNA 2ZQ7A 3E4OA 3HLEA 1ONHA 4LRZE 4KQQA 3VFHA 1XA7A 2XRNA 5F1FA 1K56D 5E2FA 4JF6A 3IS2A 4N9KA 1WA9A 2XD5A 3HLGA 5E2EA 3ZHHA 3GQZA 4PM8A 3IXHA 5A8BA 4LV3A 4S2JA 1HVBA 4Y3IA 3UE1A 1ZHHB 3QP1A 2W3GA 2Y4AA 5D3OA 1OTIA 5IT5A 1WYBA 3UMDA 2PBYA 4N1XA 2C6WB 1S1ZA 1LSVA 2HZ5A 3HREA 4LGWA 4PHTA 4BBTA 3DBAA 4RX3A 3OCNA 2W1TB 3A3IA 5A92A 4QY5A 3MZFA 3HJIA 2Z6DA 5DF8A 4FSFA 4B93A 1M40A 2G2WA 5FSRA 3O86A 1DJCA 5CTMA 3QP2A 4M3KA 1HTZA 3IHBA 3Q7ZA 4O8GA 4WL9A 5AQAA 5HAIA 5HDSA 1A0KA 3LIDA 4ARZB 3W2ZA 2R9XA 5HWTA 4IBXA 1N4OA 3O5YA 3FWLA 3B3XA 3FPVA 1FR6A 3A3DA 4GJ4A 3BEBA 4X6TA 1CEFA 4H6JA 2CC1A 2M7VA 2JKTI 1JVJA 4GLQA 1MZUA 1PI4A 4K08A 4KG2A 2KX6A 1VETA 4HY8A 3C38A 1FCNA 2EA9A 2GJ3A 1VETB 3BFGA 2Q0OA 4S2IA 3M6BA 2Q9NA 4BJPA 3ZG8B 5KIZA 1I5QA 4GD8A 3E2KA 3JPUA 4YWZA 4KQOA 2P08A 3PHYA 5EOOA 3G30A 4RQ9A 3BLSA 4PKYG 4MN5A 5F69A 4DXBA 4GS9B 4FOFA 3GRJA 2QYBA 3HLWA 1LT0A 2EWVA 3BJNA 4E3JA 5G18A 4EQ1A 1VB6A 1KVMA 1NLYA 2I72A 3JVVA 3U4LP 2P9VB 4L9FA 4JGQA 5EM1A 4EETB 1K0KA 1XX2A 2HJ9C 1BULA 2XDMA 1BT5A 1TF1A 1YLZA 3L9KA 1PFLA 2R9WA 3C30A 3LYXA 2ZL1A 4MNRA 2JKFA 1DJAA 3DW0A 4LFUA 1F98A 2ZC4B 5E2HA 4DE0A 3VE3A 1BYWA 2EWWA 5TGFA 3UY6A 1VEUA 4OPRA 3CZDA 3Q82A 4WMCA 2OLVA 3UPNA 2DMWA 5DKKA 2W3EA 3FKVA 2VJWA 2Q9MA 4GCZA 4I3IA 2JHEA 3KSHA 4XUXA 3I7JA 4WEJA 4DMZA 4F3LB 1ZC2A 2P9VA 3P7NA 5HWWA 3N8LA 4KUOA 4S2MA 4QB8A 5DJUA 3ZCZA 2XH9A 3CMZA 2A24B 2J3TC 1P97A 4PMAA 3WS2A 4P87A 4DJ3A 1RGYA 3T1XA 2ZM2A 2O9AA 1KDWA 3C7UA 3C2WA 4FD8A 1JWVA 3CUEC 3AGFA 3EQVA 2ZOHA 3MXSA 1PIOA 4JXGA 3NI9A 3QP5A 4E3IA 1K54A 1T1AA 2WKRA 3W4OA 3NOTC 1AWIA 1ACFA 4EBNA 3BLMA 3OZHA 4E3OA 2PYRA 3H7WB 5GLBA 3WS1A 3FC7A 2PD8A 3AGDA 4B9OA 4D60A 2HGVA 4Y0UA 3FZCA 4IEDA 2IWDA 1GSWA 1K6RA 4KZ4A 1F5MA 1KE0A 4JGRA 3UMEA 1QMEA 1G5UA 5FI2A 2WGWA 3E4QA 3UN7A 1GHIA 3CUEA 5IU1A 4GHIB 3UPOA 3LFVA 1S6RA 2RL3A 3LR5A 1XJ3A 2QPNA 5HZHA 3PBRA 1LI0A 5DTTA 1CF0A 3ISGA 1IYQA 3L7HA 1TEMA 3BWLA 4UQIS 4OKPA 1YT4A 4NETA 1W7FA 2V0WA 3IWIA 4DXCA 1YMXA 2Y2QA 4CLCC 4R3AA 2G2UA 4S2LA 5G4YA 5BOHA 1XXMA 3IBJA 4UHUA 1Z09A 5EOEA 2ZMAA 2V2FF 3LR0A 3G2ZA 2KDKA 4DE2A 1IELA 3IH8A 4QWOA 1GCEA 4ARZA 2A49A 4O7DA 5FQKA 3T1QB 1OTAA 4I3AA 1J9MA 3VP2A 1D1JA 4HBUA 3HLCA 5CGSA 4IBRA 4WZ5A 5CXWA 2PU2A 3JVUA 3SS3A 1DP6A 3S7PA 3UDXA 5HD3A 5DFXA 4N92A 3NDGA 4OLGA 4OONA 3MQOA 1T1CA 3IF6B 5L10A 5EVID 2A3UA 4GZBA 5EFWA 3Q7VB 2BLSA 3CITA 3SH9A 1CEGA 1G6OA 4JF5A 1FCOA 1ES5A 2GZAA 1NYYA 4JF4A 4UQIM 2EX9A 1MKMA 4X55A 5C5KA 4NK3A 3IT9A 1K4EA 2P7JA 4Q8IA 5FAPA 2EXAA 3PAGA 4KG5A 2XSSA 1ES2A 4HEFA 4E3MA 4MN6A 1S4RA 4N1HA 4QHCA 1N9LA 3DWZA 3VV4A 2RCXA 2WADA 3G35A 5DTSA 3IHAA 3KYQA 5I5LA 3B33A 3ZNYA 4O0PA 2Z2MB 2JKGA 2J9PA 3ZG7B 3C4OA 4BWIA 3S4XA 2H0YA 5F6AA 3PBTA 3PBSA 3S22A 3Q7VA 2XFSA 3LCEA 3NIAA 4DJ2A 2ZLYA 2JCHA 3LI8A 1QMFA 1ODVA 2VKSA 1LHYA 4PKYA 4OOYA 4AFIA 2VGJA 3IH9A 3W4PA 4NXGA 3O87A 4ZRRA 4ZDXA 1NYMA 4EESA 3UO9A 2Y2OA 3WS0A 2BTFP 1T1BA 4EW7A 3MKFA 4P6BA 3IX4A 4C75A 3G6OA 2EXBA 4HJ3A 4GB7A 2LB9A 2QJ7A 4JKTA 4Z9QA 3SS4A 3V5MA 4R1GA 4WF0A 4FH2A 4ZJ3A 4OPZA 4WBGA 4LCLA 1YM1A 1T18A 4OH0A 2UWXA 4X53A 4OLDA 2Y2NA 1S1YA 5CGWA 4H8RA 3PBOA 1PW8A 2JE5A 4XT2A 4YINA 3KO6A 3UDIA 3S7OA 2DRWA 1K55C 2QJ5A 3U2AA 4CLCE 3QP6A 5FQQA 1L0FA 2QMIA 2Y2MA 4UA9A 3NDEA 4FTXA 2HDSA 5IS1A 3VOZA 2ZMFA 3W8KA 4PPRA 4IHQA 1SCWA 1XJ4A 2FZ0A 4MN7A 1DY6A 1LL9A 2VA0A 2QHKA 2WKPA 4JXWA 1BLCA 2ZC6B 3KSFA 4HHDA 2ZD8A 4UA7A 5AQBA 3V3RA 3RXXA 1EI5A 5KSHA 4X69A 3ZQ5A 3GR2A 3MFXA 4KZ8A 2HPBA 2ZC3B 4E6XA 3LIFA 1OTDA 5FDHA 2ZQCA 3VSKA 3N7WA 1Q2PA 1NZUA 1O07A 3SS5A 5KMWA 2VK3A 4KQDA 5FEGA 4S2NC 1K38A 3RJUA 3M2KA 4II7A 2G7UA 3M6HA 2L0WA 2VLGA 3KSGA 4KUKA 1SDNA 1JTDA 3BFFA 5LBRA 3GTCA 3SZTA 3MF0A 3LIEA 5I94A 4HNBA 5J3WA 4BENA 3MXQA 1XJ6A 3C8CA 1MC0A 3UE6A 2ZM8A 3MQ0A 1PWDA 3BY8A 5HPFA 1UWNX 2W3DA 5IHVA 5G4ZA 2JKRM 2HF6A 4UAAA 5EPHA 5A90A 5FL3A 3MS6A 1ZKJA 5FAQA 4ZTKA 5EUAA 3BFEA 1MWSA 2ZQ9A 5M19A 1FOFA 4XXRA 4EUVA 2AVXA 3F1OA 2ZMVA 2Y2PA 5GHYA 1PNEA 4NG2A 2WAFA 3T4KA 4JXVA 4LCMA 1KOUA 2V1ZA 1WE4A 4I38A 1YKDA 1FSYA 1CJFA 2WKHA 4RYEA 2ZOIA 2OAQ1 4EBLA 5F68A 3D3OA 1L3LA 1I2WA 3ZG9B 4IVIA 3UE0A 4P6ZS 3VOLA 4I5SA 3MFDA 3C5AA 2VEAA 4M4XA 1BLSA 5HPIA 1DRMA 4CJNA 1KDSA 1H3QA 3MKEA 1JTGA 2PR5A 4OP5A 2OV5A 4GS9A 4Q0IA 5GHXA 2J80A 1TS7A 2XQZA 2JKTM 2WZZA 3LIBA 4K0WA 1W63M 3PBQA 3OOVA 3CPTB 3OPRA 2INWA 2NUPC 3GECA 4ETXA 1E4DA 1CQAA 5F5YA 3T12B 4HI4A 5EV0A 2W1RA 2OOLA 4GNUA 2ZBBA 3HBRA 5FQMA 1K57A 4Y7PA 5DJTA 4EEPA 3IXDA 2QZ6A 2HDUA 4NXFA 4BLMA 5HFOA 4CPKA 3N8RA 3AGEA 2X01A 1JWPA 3C7VA 1HLUP 4H6JB 1J3WA 3LI9A 1C3BA 1IYOA 4EEUA 3VP4A 4C3QA 3BQAA 5E43A 3E4PA 3EGXC 4HIAA 1RCJA 1SKOB 1NXYA 2H28A 1IKGA 2V9AA 5FQJA 1NZOA 3PAEA 4E04A 3T1SA 4OVDA 1UWPX 1KE4A 5TR7A 4ID4A 2Y55A 3WRZA 2VGLS 2PAVP 4KZ5A 5CX7A 2PU4A 1MBLA 1YAXA 1G28A 1YSQA 4S2PA 2BASA 1ES3A 3IXGA 1K25A 2M7UA 4JGPA 4R4SA 3HLFA 2Y2GA 3K3CA 4B4ZA 1FCMA 1OTEA 3CG5A 2V8FA 2PBDP 3IXBA 1NLZA 3DTIA 1K4FA 5FAOA 3CI6A 2ZM0A 4WLAA 1Y54A 2IWCA 1XFNA 2BG1A 3TE8A 2H0TA 5F82A 5J8XA 4Y13A 3CAXA 2OWJA 4LRXC 2OLUA 3TOIA 4BD1A 4KQRA 3A3JA 4OOLA 3NC8A 4DDSA 4P85A 3VMAA 1F2KA 2A2LA 2V20A 2XA7S 4WMCD 1S4SA 2UV0E 5U47A 3D4FA 4JXSA 3TJZC 3ULFA 3BFDA 3MXRA 4KZBA 3PTEA 3SH8A 4ZJ2A 1CI9A 4Q0JA 1YLWA 4DRTA 1YQSA 4JLFA 3ITAA 3UB7A 3LICA 3DAVA 3F1OB 2Y91A 4FCFA 5L07A 4S2OA 2XA7M 4HH2A 1S66L 1KGFA 1SHVA 2OAP1 1GHMA 4R4RA 3FKWA 3IX3A 1NRFA 2O9CA 4LRYC 3VP3A 4R3BA 4DE1A 3EOIA 3NULA 1HZOA 4WZ4A 2L1MA 5EVIB 4FUWA 4NXBA 3W4QA 1LI9A 2B5RA 1ESUA 3SH7A 2YKHA 3P09A 3PYPA 5TJJA 4BL2A 4I3JA 4BQMA 1ZG4A 2ZJ9A 1Y28A 5GLAA 3UDFA 1PI5A 2Y79A 3N8SA 4E3LA 3G2YA 3KYEA 5FA7A 3TSGA 2W0NA 3SOIA 1P9WA 3R7WB 2P74A 4K91A 2WGVA 4NKPA 4PAUA 3O3VA 1H5XA 4R23A 5DFYA 5CECA 4IVKA 4WM9A 1PZOA 3FPWA 3GSGA 4JGOA 5HD5A 5DF7A 3F1NB 2WUQA 3LGOA 3EEAA 4KZ7A 1XPBA 3E98A 1WYCA 2VV7A 4F3LA 5AJGA 1IOUA 1L0DA 1MWUA 5FASA 3T4LA 3S1YA 2J3WA 2XF3A 3HVFA 3ITBA 5EVIC 4G3VA 5F1GA 5TBMA 5TFQA 3Q07A 1EW0A 3UE3A 1RP5A 3P98A 3SW1A 2PRFA 3DTMA 2O99A 2VZWA 2WYXA 3NECA 2V1AA 3IX8A 1W79A
chains in the Genus database with same CATH topology
3S7NA 3HCYA 1H8MA 4G3KA 4BJPA 3T50A 3BW6A 3LIFA 2Z6CA 1OTDA 1F9IA 5KIZA 2PT7A 2OWHA 3H9WA 5DF9A 3T4OA 4KQDA 4YWZA 4KQOA 2P08A 4HOIA 4UEYA 3PHYA 4CLCB 3UB6A 4RQ9A 4II7A 2P04A 4MCWA 4PKYG 1OJ5A 4MN5A 2MJ6A 2G7UA 5F69A 2L0WA 5J7EA 2VLGA 3KSGA 4KUKA 4MDZA 4GS9B 2D01A 4FOFA 1N9NA 4ETZA 4EU0A 5LBRA 2QYBA 1V9ZA 2YKFA 1OPXA 2QWSA 3MF0A 2HV1A 1LT0A 1P0ZA 2EWVA 3BJNA 3LIEA 4HP9A 4EQ1A 1VB6A 4HNBA 1NLYA 5J3WA 3MXQA 1LSXA 3F1NA 3JVVA 3KX0X 3UB8A 1XJ6A 3MJQA 4L9FA 4JGQA 4LPZA 3C8CA 1MC0A 3UE6A 1V9YA 3MQ0A 4EETB 3BY8A 5HPFA 1UWNX 2W3DA 2JKRI 5HSQA 2K2NA 2HJ9C 3NHQA 5G4ZA 2JKRM 2KLIA 1TF1A 3MMHA 4G3WA 2HF6A 3C30A 1YSPA 3LYXA 3IS2B 2L4RA 5FL3A 2A24A 3EGDC 2KOIA 2K31A 1F98A 1UGUA 3VE3A 4GW9A 2JN7A 1BYWA 1W63Q 2EWWA 3A0VA 1VHMA 2IA2A 4L9EA 1D7EA 4EUVA 3F1OA 2ZMVA 4HJ6A 3OLOA 4YOFA 2D02A 4P6ZM 4EERA 3T4KA 2DMWA 5DKKA 1LL8A 2W3EA 1ZTUA 1KOUA 3NOPC 5J4EA 1GSXA 3OBFA 3HJKA 2VJWA 4I38A 2GX5A 4IJGA 4GCZA 1YKDA 4I3IA 2JHEA 3KSHA 1DP9A 3CLOA 3EEHA 2ZOIA 2O0YA 2OAQ1 4WEJA 4DMZA 4F3LB 5F68A 2B18A 3K2NA 3D3OA 4ME4A 3P7NA 3T4JA 5HWWA 2PYPA 4KUOA 3ZYTA 3TRCA 3EWKA 4P6ZS 2Y8HA 3VOLA 4I5SA 4NXEA 5DJUA 2J3TD 2PDRA 2VEAA 4M4XA 2A24B 5HPIA 1DRMA 2J3TC 1P97A 1H3QA 4DJ3A 1DP8A 4NEED 4QPRA 2PR5A 1N9OA 1TS8A 2O9AA 2VX8A 4GS9A 1XJ2A 3C2WA 2V0UA 4Q0IA 2J80A 3CUEC 2PR6A 2WKQA 1TS7A 1JNUA 4HJ4A 3EQVA 2ZOHA 2JKTM 1OT9A 5HDDA 5DKLA 1D06A 3LIBA 3PR6A 1W63M 3NOUC 3PBQA 3OOVA 3R4KA 2HJEA 1T1AA 2INWA 2NUPC 2WKRA 3NOTC 2QKPA 3GECA 2B02A 4ETXA 5F5YA 3A0RA 3CWFA 3PXPA 2PYRA 4HI4A 3H7WB 1P9RA 2PHYA 2W1RA 2OOLA 3LR4A 2VGLM 2PD8A 3FC7A 4R38A 4B9OA 2HGVA 2ZBBA 5HDCA 3F1PB 4EEPA 5DJTA 1GSWA 5HWVA 1T19A 1F5MA 4JGRA 3UMEA 3H82A 4MMNA 3ICYA 4BBUA 4NXFA 1TS6A 3NJAA 2NUTC 2CMNA 3E4QA 4DN0A 3UB9A 3CUEA 4H6JB 3LI9A 5IU1A 4EEUA 3T4TA 4GHIB 1TS0A 1OTBA 3LUQA 3LFVA 1NWZA 3LR5A 1XJ3A 3BQAA 3EQUA 5HZHA 3E4PA 3PBRA 2W1TA 4Q0HA 3EGXC 4HIAA 3H7WA 3T4SA 2H28A 2W27A 2V9AA 3KSIA 3BWLA 4WN5A 4UQIS 4E04A 2W3HA 4EXOA 1UWPX 2V0WA 4I39A 2K7SA 2GNXA 4Z1WA 2VGLS 1X0OA 3FG8A 2PD7A 4CLCC 4Y2FA 5CX7A 4R3AA 1YAXA 1G28A 5G4YA 3IBJA 4WEKA 1YSQA 1STZA 2BASA 3LIAA 4O01A 3R7WA 2M7UA 4JGPA 3VE4A 3TW8A 3MQQA 1IFQA 3K3CA 3LR0A 4L0LA 4BMWA 4R70A 2KDKA 1OTEA 5MC7A 2I9VA 1XFQA 4ARZA 1NLZA 4CLCA 2XROA 4CQHA 3CI6A 4R6LA 1OTAA 4I3AA 3E0YA 5TBMB 1S67L 4WLAA 1OJGA 2FH5A 2VV6A 3OC2A 5HL6A 1XFNA 3TE8A 4OOMA 3JVUA 1OT6A 1DP6A 3S7PA 3CAXA 4IUKA 2OWJA 3KYZA 4LRXC 5HD3A 5DFXA 4WELA 3MQOA 1T1CA 5AVFA 3A0SA 3B42A 5EFWA 4HH3A 3CITA 3GDIA 1G6OA 4L9GA 4OOLA 2GZAA 4UQIM 1MKMA 4HP4A 5C5KA 5AVEA 2A2LA 2P7JA 3MR0A 4Y5FA 4BBVA 4CLCD 2XA7S 1S4SA 3P01A 1LSWA 2XSSA 3TJZC 3B47A 3BY9A 3ULFA 2V1BA 4MN6A 1S4RA 3F1PA 4Q0JA 1N9LA 3VV4A 2VV8A 3E4OA 3UB7A 3LICA 4LRZE 3F1OB 3KYQA 5I5LA 3B33A 4O0PA 3OCLA 2XA7M 4BWIA 4HH2A 1S66L 2XRNA 4XT2B 4IUHA 5F6AA 3PBTA 3PBSA 3K3DA 2OAP1 3IS2A 1WA9A 4DJ2A 4WUJA 3LR3A 2O9CA 3LI8A 1ODVA 4LRYC 2VKSA 5A8BA 4Y3IA 3H82B 3EOIA 1ZHHB 4GHIA 4HQAA 4PKYA 4AFIA 2L1MA 3PBNA 4NXGA 2W3GA 3BQ8A 4ZRRA 4NXBA 1OTIA 5IT5A 4EESA 2YKHA 3UMDA 3PYPA 5TJJA 1T1BA 4I3JA 1S1ZA 1LSVA 4EW7A 1Y28A 3G6OA 4PHTA 4BBTA 2Y79A 4HJ3A 3DBAA 2LB9A 2QJ7A 3OCNA 2W0NA 4WF0A 1P9WA 2W1TB 3R7WB 3S7QA 1GSVA 4NKPA 4PAUA 3RH8B 3T4QA 3HJIA 3IBRA 1T18A 2Z6DA 4FSFA 5DFYA 4B93A 1S1YA 3PBOA 3FPWA 4JGOA 5HD5A 1TD5A 4XT2A 3F1NB 3KO6A 3S7OA 2M1CA 3EEAA 5L8MA 2QJ5A 3RTYA 2W3FA 3E98A 3U2AA 4CLCE 2VV7A 4O8GA 4WL9A 5HDSA 3LIDA 4ARZB 4F3LA 5AJGA 1IOUA 3W2ZA 3RFBA 3V67A 5HWTA 5IS1A 2ZMFA 3T4LA 2J3WA 3O5YA 4IHQA 4G3VA 2R78A 3FPVA 1XJ4A 4GJ4A 2FZ0A 4MN7A 3D72A 5TBMA 1EW0A 3UE3A 4H6JA 2M7VA 2JKTI 2VA0A 3SW1A 2QHKA 2WKPA 4YNRA 3KSFA 4GLQA 4HHDA 1MZUA 2LB5A 2O99A 2VZWA 5K5BA 4K08A 5KSHA 2O9BA 4LLOB 2KX6A 3ZQ5A 4HY8A 1NRJA 3C38A 2EA9A 2GJ3A 3MFXA 2V1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A8B A;  3P7N A;  1X0O A;  3FG8 A;  5HWW A;  2PYP A;  3T50 A;  4KUO A;  3LIF A;  2PD7 A;  2Z6C A;  3H82 B;  4GHI A;  1OTD A;  1F9I A;  3EWK A;  4HQA A;  4PKY A;  4R3A A;  3VOL A;  5KIZ A;  2OWH A;  1G28 A;  4I5S A;  2L1M A;  5G4Y A;  4NXE A;  5DJU A;  3H9W A;  4NXG A;  2PDR A;  2VEA A;  2BAS A;  1OTI A;  3LIA A;  4NXB A;  4M4X A;  2A24 B;  1DRM A;  4EES A;  1P97 A;  2YKH A;  4JGP A;  3UMD A;  4KQD A;  4YWZ A;  3PYP A;  3VE4 A;  1DP8 A;  4DJ3 A;  1T1B A;  3MQQ A;  4HOI A;  3K3C A;  2PR5 A;  4R70 A;  2KDK A;  1N9O A;  3PHY A;  4I3J A;  1OTE A;  1S1Z A;  1TS8 A;  1LSV A;  2I9V A;  4RQ9 A;  3UB6 A;  1XFQ A;  1Y28 A;  1XJ2 A;  3C2W A;  4GS9 A;  4PKY G;  1OJ5 A;  4HNB A;  2V0U A;  4MN5 A;  5F69 A;  5J7E A;  2L0W A;  2J80 A;  3G6O A;  2VLG A;  4KUK A;  2PR6 A;  2WKQ A;  4BBT A;  4GS9 B;  1TS7 A;  2D01 A;  1JNU A;  4HJ3 A;  1OTA A;  4HJ4 A;  4I3A A;  2ZOH A;  4R6L A;  5TBM B;  1S67 L;  1OT9 A;  4WLA A;  5HDD A;  1N9N A;  2QJ7 A;  5DKL A;  1D06 A;  3LIB A;  1V9Z A;  2W0N A;  3NOU C;  1OJG A;  2YKF A;  4WF0 A;  2QWS A;  2HV1 A;  1LT0 A;  1P0Z A;  1XFN A;  2VV6 A;  4EW7 A;  1T1A A;  3LIE A;  2INW A;  4HP9 A;  1GSV A;  4EQ1 A;  1OT6 A;  1VB6 A;  2WKR A;  3NOT C;  1DP6 A;  2QKP A;  3GEC A;  1T18 A;  2B02 A;  2Z6D A;  3HJI A;  3IBR A;  3MXQ A;  5J3W A;  5F5Y A;  1LSX A;  3F1N A;  3CAX A;  2OWJ A;  3A0R A;  3CWF A;  4LRX C;  3KX0 X;  2PYR A;  4HI4 A;  5HD3 A;  3H7W B;  1XJ6 A;  3UB8 A;  3MJQ A;  1S1Y A;  2PHY A;  4JGQ A;  4L9F A;  4LPZ A;  3RH8 B;  3C8C A;  2OOL A;  3UE6 A;  1V9Y A;  3FC7 A;  1T1C A;  2PD8 A;  3MQO A;  3BY8 A;  4R38 A;  3A0S A;  5AVF A;  4B9O A;  4EET B;  1UWN X;  2ZBB A;  4JGO A;  5HDC A;  3F1P B;  5HD5 A;  5DJT A;  4EEP A;  5HSQ A;  1GSW A;  4XT2 A;  5EFW A;  3NHQ A;  5G4Z A;  3F1N B;  4HH3 A;  5HWV A;  1T19 A;  2M1C A;  3GDI A;  4JGR A;  2QJ5 A;  3RTY A;  3H82 A;  3UME A;  4L9G A;  3ICY A;  4BBU A;  4NXF A;  2VV7 A;  3LYX A;  1TS6 A;  4HP4 A;  4WL9 A;  5AVE A;  3IS2 B;  3MR0 A;  2P7J A;  2L4R A;  3NJA A;  4BBV A;  2A24 A;  5HDS A;  3LID A;  1S4S A;  4F3L A;  1LSW A;  2CMN A;  5IS1 A;  3E4Q A;  5HWT A;  3UB9 A;  1F98 A;  3ULF A;  3BY9 A;  4H6J B;  3LI9 A;  1UGU A;  5IU1 A;  4EEU A;  3VE3 A;  4GW9 A;  2V1B A;  1TS0 A;  2JN7 A;  1OTB A;  2R78 A;  4GHI B;  4MN6 A;  1BYW A;  3LUQ A;  1XJ4 A;  1S4R A;  3F1P A;  3A0V A;  1NWZ A;  1N9L A;  3D72 A;  4L9E A;  2VV8 A;  5TBM A;  3E4O A;  1EW0 A;  1D7E A;  1XJ3 A;  4H6J A;  5HZH A;  3F1O A;  4HJ6 A;  3E4P A;  3UB7 A;  2QHK A;  3LIC A;  3OLO A;  2WKP A;  3SW1 A;  4HIA A;  2D02 A;  4LRZ E;  3H7W A;  3F1O B;  4HHD A;  1MZU A;  2H28 A;  2W27 A;  5I5L A;  3B33 A;  4EER A;  2V9A A;  5DKK A;  1LL8 A;  3BWL A;  1KOU A;  3NOP C;  5J4E A;  4WN5 A;  1GSX A;  4HH2 A;  1S66 L;  3HJK A;  4K08 A;  4E04 A;  4LLO B;  4XT2 B;  2KX6 A;  5F6A A;  4I38 A;  3ZQ5 A;  4EXO A;  3K3D A;  4GCZ A;  4I3I A;  1UWP X;  2V0W A;  2JHE A;  3IS2 A;  4HY8 A;  1DP9 A;  1WA9 A;  3CLO A;  2EA9 A;  3EEH A;  4DJ2 A;  2ZOI A;  2GJ3 A;  3MFX A;  4I39 A;  4F3L B;  5F68 A;  2V1A A;  4WUJ A;  2K7S A;  3LI8 A;  1ODV A;  4LRY C; 
#chains in the Genus database with same CATH topology
 3S7N A;  3HLD A;  4G3K A;  1H8M A;  1Y4O A;  2OSU A;  2Z6C A;  1F9I A;  1L0E A;  3M2J A;  2PT7 A;  2OWH A;  3H9W A;  5DF9 A;  1JWZ A;  4HOI A;  4CLC B;  5EVI A;  4MCW A;  2HDR A;  5FQI A;  1OJ5 A;  5J7E A;  4PM7 A;  4MDZ A;  4LV1 A;  5EVE A;  1N9N A;  2EFU A;  4EU0 A;  1V9Z A;  4HP9 A;  4LEN A;  5HAQ A;  1TVF A;  3F1N A;  3T1R A;  3MJQ A;  5CRF A;  4LPZ A;  5HL1 A;  1K6S A;  1V9Y A;  2JBF A;  3IF5 A;  2K2N A;  3TG9 A;  1BLH A;  2KLI A;  3QHY A;  2Y2K A;  1YSP A;  3BYD A;  3IS2 B;  2L4R A;  2A24 A;  5HX9 A;  4BD0 A;  5CTN A;  1UGU A;  4GW9 A;  3ZNT A;  2JN7 A;  1MXO A;  1K55 A;  3A0V A;  2IA2 A;  4L9E A;  3MSH A;  4EV4 A;  4YOF A;  3NBL A;  4ESP A;  2D02 A;  1H8Z A;  1SDE A;  2E8J A;  4EER A;  2V8C A;  4DDY A;  5AQ9 A;  5CER A;  1LL8 A;  5CEB A;  3NOP C;  5J4E A;  1GSX A;  3OBF A;  3NY4 A;  2GX5 A;  4IJG A;  3A3E A;  3CLO A;  2O0Y A;  2B18 A;  3K2N A;  2PYP A;  3ZYT A;  3G31 A;  4PM9 A;  2Y8H A;  4NXE A;  2J3T D;  2PDR A;  5A91 A;  2EX6 A;  3ZG0 A;  4MBH A;  5CGX A;  1DP8 A;  4NEE D;  4QPR A;  4U3T A;  2E8I A;  3ZVT A;  1N9O A;  3CJM A;  2VX8 A;  1XJ2 A;  2V0U A;  1GA0 A;  4LV0 A;  3LO7 A;  2B95 A;  2WKQ A;  1JNU A;  4HJ4 A;  1OT9 A;  1N9B A;  5HDD A;  4QJG A;  5DKL A;  1OME A;  1D06 A;  3QP4 A;  3MZE A;  2HJE A;  4PM5 A;  3GMW A;  2QKP A;  4QD4 A;  3DWK A;  3WS4 A;  2H5S A;  5GHZ A;  3A0R A;  3CWF A;  3PXP A;  1KE3 A;  1IYS A;  3IQA A;  5DTK A;  1E3U D;  5HDC A;  3VFF A;  5CHM A;  5HWV A;  1XGJ A;  4MMN A;  4BBU A;  3UB5 P;  1TDL A;  2WK0 A;  3NJA A;  1L0G A;  1M6K A;  4D2O A;  4DN0 A;  3UB9 A;  3VP0 A;  5KSC A;  3T4T A;  2Y2L A;  4HES A;  1TS0 A;  3MBZ A;  3LUQ A;  1NWZ A;  1W8Q A;  1K57 C;  4JPM A;  3BM6 A;  2W1T A;  4Q0H A;  3H7W A;  4MBK A;  5EVL A;  1BLP A;  5L09 A;  3O88 A;  4EXO A;  4I39 A;  2K7S A;  1L2S A;  3LEQ A;  5M1A A;  2GNX A;  3HUM A;  1PYY A;  2ZQ8 A;  4U0X A;  3G34 A;  1W5D A;  4MBF A;  4X68 A;  1STZ A;  3IF6 C;  3LIA A;  4GOG A;  4O01 A;  3R7W A;  4JBF A;  3JYI A;  1GHP A;  3MQQ A;  4OP8 A;  4RA7 A;  4R70 A;  5MC7 A;  1XFQ A;  2J9O A;  1MY8 A;  4CLC A;  1BUE A;  2FFY A;  1G68 A;  4EUZ A;  4GKU A;  5TBM B;  3FYZ A;  3Q1F A;  1OJG A;  4ZJ1 A;  5HL6 A;  1HD8 A;  1OT6 A;  3DTK A;  4IUK A;  2ZC7 A;  3GV9 A;  5JYP A;  4WEL A;  3A0S A;  3VSL A;  1FSW A;  3B42 A;  1I2S A;  4HH3 A;  1ONG A;  3GDI A;  3OPH A;  3V39 A;  4L9G A;  3IWO A;  3CPT A;  4HP4 A;  5AVE A;  3N4I A;  4Y5F A;  4BBV A;  4CLC D;  2XR0 A;  4EQI A;  1S0W A;  4EWF A;  3BY9 A;  4GN2 A;  2IWB A;  2Z2L B;  4KG6 A;  1AXB A;  3F1P A;  5FI7 A;  4E6W A;  3QNB A;  5CED A;  3DTE A;  1MWR A;  3OCL A;  2XGN A;  3LY4 A;  2WGI A;  4KZ9 A;  4XT2 B;  4E3K A;  4IUH A;  3K3D A;  4S2K A;  1U60 A;  1IEM A;  1YLT A;  4WUJ A;  3LR3 A;  1E25 A;  3LEZ A;  4B88 A;  3H82 B;  4GHI A;  4HQA A;  4N9L A;  2JC7 A;  3PBN A;  5FAT A;  3BQ8 A;  1YLJ A;  1PWC A;  3OPP A;  4KZ6 A;  2DCF A;  1Z6F A;  5KZH A;  3MZD A;  5CHJ A;  3WRT A;  5EE8 A;  3S7Q A;  1GA9 A;  2HP9 A;  3IF6 A;  1GSV A;  3T4Q A;  3RH8 B;  3IBR A;  2EX8 A;  2WKI A;  5AQ7 A;  4XUZ A;  4ZBE A;  1TD5 A;  4Y0T A;  4UA6 A;  2Y2I A;  2M1C A;  5L8M A;  2XFT A;  3RTY A;  2W3F A;  4ZAM A;  5DVA A;  3HUO A;  2ZL1 B;  1CK3 A;  3RFB A;  3V67 A;  4LV2 A;  1YLY A;  4OQH A;  4YFM A;  3V50 A;  4MEZ A;  2R78 A;  4QY6 A;  1XKZ A;  4OQI A;  3D72 A;  1NJ4 A;  4OPY A;  4YNR A;  3BEC A;  3UPP A;  2LB5 A;  3G4P A;  1PW1 A;  5K5B A;  4X56 A;  2O9B A;  4LLO B;  5M18 A;  1PZP A;  4GDB A;  1NRJ A;  1SKO A;  4OQ0 A;  3ZDJ A;  3D9Y A;  1PRQ A;  3HCY A;  3T50 A;  3BW6 A;  3CHW P;  1XGI A;  4K0X A;  3NCK A;  3T4O A;  4C6Y A;  3VP1 A;  1MPL A;  5GLD A;  4UEY A;  3LY3 A;  3UB6 A;  4OPQ A;  1NY0 A;  2P04 A;  2MJ6 A;  2D01 A;  5FI6 A;  4ETZ A;  2YKF A;  1OPX A;  2QWS A;  2HV1 A;  1P0Z A;  1DJB A;  5F83 A;  1LSX A;  2ZC5 B;  4FH4 A;  3KX0 X;  3UB8 A;  1PWG A;  2JKR I;  5HSQ A;  1ESI A;  1FIK A;  3NHQ A;  3HL9 A;  2C5W B;  2DNS A;  2XD1 A;  1KGG A;  1YMS A;  3MMH A;  4G3W A;  4DKI A;  1ERQ A;  3EGD C;  2KOI A;  1FIL A;  2K31 A;  2ACG A;  3ZVW A;  1MWT A;  2H10 A;  5HAR A;  1E3U A;  1W63 Q;  2VGK A;  4QU3 A;  4X1M A;  1LLB A;  1ZG6 A;  1VHM A;  4GDN A;  2WGW B;  1D7E A;  4HJ6 A;  1BZA A;  3OLO A;  4P6Z M;  1K56 A;  1ZTU A;  3HJK A;  4Y15 A;  4X25 A;  1TDG A;  2FFF B;  1DP9 A;  3EEH A;  4PM6 A;  1O7E A;  1ES4 A;  5CHU A;  4ME4 A;  1KVL A;  4R0Q A;  3T4J A;  2ZQA A;  1VM1 A;  1YPR A;  3TRC A;  3EWK A;  5HAP A;  2X71 A;  1XP4 A;  4DF6 A;  1FR1 A;  1TS8 A;  4MLL A;  2PR6 A;  1VQQ A;  2ZQD A;  2WAE A;  3PR6 A;  3NOU C;  3R4K A;  1SZV A;  2EX2 A;  3ZFZ A;  3QP8 A;  2B02 A;  2XK1 A;  5FQ9 A;  1RGZ A;  4DE3 A;  1P9R A;  2PHY A;  3A3F A;  3LR4 A;  2VGL M;  4R38 A;  4HBT A;  3F1P B;  1Q2Q A;  2HP6 A;  4B4X A;  1T19 A;  4X1L A;  4BL3 A;  3H82 A;  3ICY A;  4WZ5 C;  1TS6 A;  1ERO A;  4WYY A;  2NUT C;  1LL5 A;  4A5R A;  2X02 A;  2XEP A;  1VEU B;  2Y59 A;  2CMN A;  4KZA A;  3OPL A;  4E3N A;  4R3J A;  4EBP A;  3E2L A;  1OTB A;  4Y17 A;  3EQU A;  3HUN A;  4U0T A;  2EFX A;  1G6A A;  2HDQ A;  3T4S A;  2W27 A;  3N6I A;  3KSI A;  1YLP A;  4WN5 A;  3FV7 A;  5FDS A;  2W3H A;  3BFC A;  3Q81 A;  1K54 C;  5E2G A;  1H8Y A;  4Z1W A;  4RX2 A;  1X0O A;  3FG8 A;  2PD7 A;  4Y2F A;  5EM0 A;  1SKF A;  2WZX A;  4OQG A;  5EEC A;  4WEK A;  4F94 A;  4KZ3 A;  5L2F A;  3VE4 A;  3ZGA B;  3TW8 A;  3WWX A;  1IFQ A;  2WKE A;  4L0L A;  1EWZ A;  4BMW A;  5HW3 A;  2I9V A;  3C4P A;  3VOY A;  3BRM A;  2XRO A;  2XLN A;  4CQH A;  4R6L A;  3E0Y A;  1S67 L;  1ALQ A;  4S2N A;  3RXW A;  1H0M A;  1IYP A;  2FH5 A;  2VV6 A;  3OC2 A;  3HLB A;  2Y2J A;  2J7V A;  2J8Y A;  5GL9 A;  4OOM A;  3UNW A;  1BSG A;  1W8Y A;  1MKI A;  4P0M A;  4RVA A;  3ZG5 A;  3KYZ A;  3WS5 A;  5JYO A;  3G32 A;  5AVF A;  4GD6 A;  3GVB A;  4Y0O A;  1XA1 A;  5FEF A;  1BTL A;  5GLC A;  1FQG A;  3MR0 A;  3IWQ A;  3QNC A;  3P01 A;  1CI8 A;  1LSW A;  1KGE A;  3B47 A;  2Y2H A;  4KEN B;  2HP5 A;  2V1B A;  1ERM A;  5A93 A;  1IKI A;  3V3S A;  2VV8 A;  2GDN A;  2ZQ7 A;  3E4O A;  3HLE A;  1ONH A;  4LRZ E;  4KQQ A;  3VFH A;  1XA7 A;  2XRN A;  5F1F A;  1K56 D;  5E2F A;  4JF6 A;  3IS2 A;  4N9K A;  1WA9 A;  2XD5 A;  3HLG A;  5E2E A;  3ZHH A;  3GQZ A;  4PM8 A;  3IXH A;  5A8B A;  4LV3 A;  4S2J A;  1HVB A;  4Y3I A;  3UE1 A;  1ZHH B;  3QP1 A;  2W3G A;  2Y4A A;  5D3O A;  1OTI A;  5IT5 A;  1WYB A;  3UMD A;  2PBY A;  4N1X A;  2C6W B;  1S1Z A;  1LSV A;  2HZ5 A;  3HRE A;  4LGW A;  4PHT A;  4BBT A;  3DBA A;  4RX3 A;  3OCN A;  2W1T B;  3A3I A;  5A92 A;  4QY5 A;  3MZF A;  3HJI A;  2Z6D A;  5DF8 A;  4FSF A;  4B93 A;  1M40 A;  2G2W A;  5FSR A;  3O86 A;  1DJC A;  5CTM A;  3QP2 A;  4M3K A;  1HTZ A;  3IHB A;  3Q7Z A;  4O8G A;  4WL9 A;  5AQA A;  5HAI A;  5HDS A;  1A0K A;  3LID A;  4ARZ B;  3W2Z A;  2R9X A;  5HWT A;  4IBX A;  1N4O A;  3O5Y A;  3FWL A;  3B3X A;  3FPV A;  1FR6 A;  3A3D A;  4GJ4 A;  3BEB A;  4X6T A;  1CEF A;  4H6J A;  2CC1 A;  2M7V A;  2JKT I;  1JVJ A;  4GLQ A;  1MZU A;  1PI4 A;  4K08 A;  4KG2 A;  2KX6 A;  1VET A;  4HY8 A;  3C38 A;  1FCN A;  2EA9 A;  2GJ3 A;  1VET B;  3BFG A;  2Q0O A;  4S2I A;  3M6B A;  2Q9N A;  4BJP A;  3ZG8 B;  5KIZ A;  1I5Q A;  4GD8 A;  3E2K A;  3JPU A;  4YWZ A;  4KQO A;  2P08 A;  3PHY A;  5EOO A;  3G30 A;  4RQ9 A;  3BLS A;  4PKY G;  4MN5 A;  5F69 A;  4DXB A;  4GS9 B;  4FOF A;  3GRJ A;  2QYB A;  3HLW A;  1LT0 A;  2EWV A;  3BJN A;  4E3J A;  5G18 A;  4EQ1 A;  1VB6 A;  1KVM A;  1NLY A;  2I72 A;  3JVV A;  3U4L P;  2P9V B;  4L9F A;  4JGQ A;  5EM1 A;  4EET B;  1K0K A;  1XX2 A;  2HJ9 C;  1BUL A;  2XDM A;  1BT5 A;  1TF1 A;  1YLZ A;  3L9K A;  1PFL A;  2R9W A;  3C30 A;  3LYX A;  2ZL1 A;  4MNR A;  2JKF A;  1DJA A;  3DW0 A;  4LFU A;  1F98 A;  2ZC4 B;  5E2H A;  4DE0 A;  3VE3 A;  1BYW A;  2EWW A;  5TGF A;  3UY6 A;  1VEU A;  4OPR A;  3CZD A;  3Q82 A;  4WMC A;  2OLV A;  3UPN A;  2DMW A;  5DKK A;  2W3E A;  3FKV A;  2VJW A;  2Q9M A;  4GCZ A;  4I3I A;  2JHE A;  3KSH A;  4XUX A;  3I7J A;  4WEJ A;  4DMZ A;  4F3L B;  1ZC2 A;  2P9V A;  3P7N A;  5HWW A;  3N8L A;  4KUO A;  4S2M A;  4QB8 A;  5DJU A;  3ZCZ A;  2XH9 A;  3CMZ A;  2A24 B;  2J3T C;  1P97 A;  4PMA A;  3WS2 A;  4P87 A;  4DJ3 A;  1RGY A;  3T1X A;  2ZM2 A;  2O9A A;  1KDW A;  3C7U A;  3C2W A;  4FD8 A;  1JWV A;  3CUE C;  3AGF A;  3EQV A;  2ZOH A;  3MXS A;  1PIO A;  4JXG A;  3NI9 A;  3QP5 A;  4E3I A;  1K54 A;  1T1A A;  2WKR A;  3W4O A;  3NOT C;  1AWI A;  1ACF A;  4EBN A;  3BLM A;  3OZH A;  4E3O A;  2PYR A;  3H7W B;  5GLB A;  3WS1 A;  3FC7 A;  2PD8 A;  3AGD A;  4B9O A;  4D60 A;  2HGV A;  4Y0U A;  3FZC A;  4IED A;  2IWD A;  1GSW A;  1K6R A;  4KZ4 A;  1F5M A;  1KE0 A;  4JGR A;  3UME A;  1QME A;  1G5U A;  5FI2 A;  2WGW A;  3E4Q A;  3UN7 A;  1GHI A;  3CUE A;  5IU1 A;  4GHI B;  3UPO A;  3LFV A;  1S6R A;  2RL3 A;  3LR5 A;  1XJ3 A;  2QPN A;  5HZH A;  3PBR A;  1LI0 A;  5DTT A;  1CF0 A;  3ISG A;  1IYQ A;  3L7H A;  1TEM A;  3BWL A;  4UQI S;  4OKP A;  1YT4 A;  4NET A;  1W7F A;  2V0W A;  3IWI A;  4DXC A;  1YMX A;  2Y2Q A;  4CLC C;  4R3A A;  2G2U A;  4S2L A;  5G4Y A;  5BOH A;  1XXM A;  3IBJ A;  4UHU A;  1Z09 A;  5EOE A;  2ZMA A;  2V2F F;  3LR0 A;  3G2Z A;  2KDK A;  4DE2 A;  1IEL A;  3IH8 A;  4QWO A;  1GCE A;  4ARZ A;  2A49 A;  4O7D A;  5FQK A;  3T1Q B;  1OTA A;  4I3A A;  1J9M A;  3VP2 A;  1D1J A;  4HBU A;  3HLC A;  5CGS A;  4IBR A;  4WZ5 A;  5CXW A;  2PU2 A;  3JVU A;  3SS3 A;  1DP6 A;  3S7P A;  3UDX A;  5HD3 A;  5DFX A;  4N92 A;  3NDG A;  4OLG A;  4OON A;  3MQO A;  1T1C A;  3IF6 B;  5L10 A;  5EVI D;  2A3U A;  4GZB A;  5EFW A;  3Q7V B;  2BLS A;  3CIT A;  3SH9 A;  1CEG A;  1G6O A;  4JF5 A;  1FCO A;  1ES5 A;  2GZA A;  1NYY A;  4JF4 A;  4UQI M;  2EX9 A;  1MKM A;  4X55 A;  5C5K A;  4NK3 A;  3IT9 A;  1K4E A;  2P7J A;  4Q8I A;  5FAP A;  2EXA A;  3PAG A;  4KG5 A;  2XSS A;  1ES2 A;  4HEF A;  4E3M A;  4MN6 A;  1S4R A;  4N1H A;  4QHC A;  1N9L A;  3DWZ A;  3VV4 A;  2RCX A;  2WAD A;  3G35 A;  5DTS A;  3IHA A;  3KYQ A;  5I5L A;  3B33 A;  3ZNY A;  4O0P A;  2Z2M B;  2JKG A;  2J9P A;  3ZG7 B;  3C4O A;  4BWI A;  3S4X A;  2H0Y A;  5F6A A;  3PBT A;  3PBS A;  3S22 A;  3Q7V A;  2XFS A;  3LCE A;  3NIA A;  4DJ2 A;  2ZLY A;  2JCH A;  3LI8 A;  1QMF A;  1ODV A;  2VKS A;  1LHY A;  4PKY A;  4OOY A;  4AFI A;  2VGJ A;  3IH9 A;  3W4P A;  4NXG A;  3O87 A;  4ZRR A;  4ZDX A;  1NYM A;  4EES A;  3UO9 A;  2Y2O A;  3WS0 A;  2BTF P;  1T1B A;  4EW7 A;  3MKF A;  4P6B A;  3IX4 A;  4C75 A;  3G6O A;  2EXB A;  4HJ3 A;  4GB7 A;  2LB9 A;  2QJ7 A;  4JKT A;  4Z9Q A;  3SS4 A;  3V5M A;  4R1G A;  4WF0 A;  4FH2 A;  4ZJ3 A;  4OPZ A;  4WBG A;  4LCL A;  1YM1 A;  1T18 A;  4OH0 A;  2UWX A;  4X53 A;  4OLD A;  2Y2N A;  1S1Y A;  5CGW A;  4H8R A;  3PBO A;  1PW8 A;  2JE5 A;  4XT2 A;  4YIN A;  3KO6 A;  3UDI A;  3S7O A;  2DRW A;  1K55 C;  2QJ5 A;  3U2A A;  4CLC E;  3QP6 A;  5FQQ A;  1L0F A;  2QMI A;  2Y2M A;  4UA9 A;  3NDE A;  4FTX A;  2HDS A;  5IS1 A;  3VOZ A;  2ZMF A;  3W8K A;  4PPR A;  4IHQ A;  1SCW A;  1XJ4 A;  2FZ0 A;  4MN7 A;  1DY6 A;  1LL9 A;  2VA0 A;  2QHK A;  2WKP A;  4JXW A;  1BLC A;  2ZC6 B;  3KSF A;  4HHD A;  2ZD8 A;  4UA7 A;  5AQB A;  3V3R A;  3RXX A;  1EI5 A;  5KSH A;  4X69 A;  3ZQ5 A;  3GR2 A;  3MFX A;  4KZ8 A;  2HPB A;  2ZC3 B;  4E6X A;  3LIF A;  1OTD A;  5FDH A;  2ZQC A;  3VSK A;  3N7W A;  1Q2P A;  1NZU A;  1O07 A;  3SS5 A;  5KMW A;  2VK3 A;  4KQD A;  5FEG A;  4S2N C;  1K38 A;  3RJU A;  3M2K A;  4II7 A;  2G7U A;  3M6H A;  2L0W A;  2VLG A;  3KSG A;  4KUK A;  1SDN A;  1JTD A;  3BFF A;  5LBR A;  3GTC A;  3SZT A;  3MF0 A;  3LIE A;  5I94 A;  4HNB A;  5J3W A;  4BEN A;  3MXQ A;  1XJ6 A;  3C8C A;  1MC0 A;  3UE6 A;  2ZM8 A;  3MQ0 A;  1PWD A;  3BY8 A;  5HPF A;  1UWN X;  2W3D A;  5IHV A;  5G4Z A;  2JKR M;  2HF6 A;  4UAA A;  5EPH A;  5A90 A;  5FL3 A;  3MS6 A;  1ZKJ A;  5FAQ A;  4ZTK A;  5EUA A;  3BFE A;  1MWS A;  2ZQ9 A;  5M19 A;  1FOF A;  4XXR A;  4EUV A;  2AVX A;  3F1O A;  2ZMV A;  2Y2P A;  5GHY A;  1PNE A;  4NG2 A;  2WAF A;  3T4K A;  4JXV A;  4LCM A;  1KOU A;  2V1Z A;  1WE4 A;  4I38 A;  1YKD A;  1FSY A;  1CJF A;  2WKH A;  4RYE A;  2ZOI A;  2OAQ 1;  4EBL A;  5F68 A;  3D3O A;  1L3L A;  1I2W A;  3ZG9 B;  4IVI A;  3UE0 A;  4P6Z S;  3VOL A;  4I5S A;  3MFD A;  3C5A A;  2VEA A;  4M4X A;  1BLS A;  5HPI A;  1DRM A;  4CJN A;  1KDS A;  1H3Q A;  3MKE A;  1JTG A;  2PR5 A;  4OP5 A;  2OV5 A;  4GS9 A;  4Q0I A;  5GHX A;  2J80 A;  1TS7 A;  2XQZ A;  2JKT M;  2WZZ A;  3LIB A;  4K0W A;  1W63 M;  3PBQ A;  3OOV A;  3CPT B;  3OPR A;  2INW A;  2NUP C;  3GEC A;  4ETX A;  1E4D A;  1CQA A;  5F5Y A;  3T12 B;  4HI4 A;  5EV0 A;  2W1R A;  2OOL A;  4GNU A;  2ZBB A;  3HBR A;  5FQM A;  1K57 A;  4Y7P A;  5DJT A;  4EEP A;  3IXD A;  2QZ6 A;  2HDU A;  4NXF A;  4BLM A;  5HFO A;  4CPK A;  3N8R A;  3AGE A;  2X01 A;  1JWP A;  3C7V A;  1HLU P;  4H6J B;  1J3W A;  3LI9 A;  1C3B A;  1IYO A;  4EEU A;  3VP4 A;  4C3Q A;  3BQA A;  5E43 A;  3E4P A;  3EGX C;  4HIA A;  1RCJ A;  1SKO B;  1NXY A;  2H28 A;  1IKG A;  2V9A A;  5FQJ A;  1NZO A;  3PAE A;  4E04 A;  3T1S A;  4OVD A;  1UWP X;  1KE4 A;  5TR7 A;  4ID4 A;  2Y55 A;  3WRZ A;  2VGL S;  2PAV P;  4KZ5 A;  5CX7 A;  2PU4 A;  1MBL A;  1YAX A;  1G28 A;  1YSQ A;  4S2P A;  2BAS A;  1ES3 A;  3IXG A;  1K25 A;  2M7U A;  4JGP A;  4R4S A;  3HLF A;  2Y2G A;  3K3C A;  4B4Z A;  1FCM A;  1OTE A;  3CG5 A;  2V8F A;  2PBD P;  3IXB A;  1NLZ A;  3DTI A;  1K4F A;  5FAO A;  3CI6 A;  2ZM0 A;  4WLA A;  1Y54 A;  2IWC A;  1XFN A;  2BG1 A;  3TE8 A;  2H0T A;  5F82 A;  5J8X A;  4Y13 A;  3CAX A;  2OWJ A;  4LRX C;  2OLU A;  3TOI A;  4BD1 A;  4KQR A;  3A3J A;  4OOL A;  3NC8 A;  4DDS A;  4P85 A;  3VMA A;  1F2K A;  2A2L A;  2V20 A;  2XA7 S;  4WMC D;  1S4S A;  2UV0 E;  5U47 A;  3D4F A;  4JXS A;  3TJZ C;  3ULF A;  3BFD A;  3MXR A;  4KZB A;  3PTE A;  3SH8 A;  4ZJ2 A;  1CI9 A;  4Q0J A;  1YLW A;  4DRT A;  1YQS A;  4JLF A;  3ITA A;  3UB7 A;  3LIC A;  3DAV A;  3F1O B;  2Y91 A;  4FCF A;  5L07 A;  4S2O A;  2XA7 M;  4HH2 A;  1S66 L;  1KGF A;  1SHV A;  2OAP 1;  1GHM A;  4R4R A;  3FKW A;  3IX3 A;  1NRF A;  2O9C A;  4LRY C;  3VP3 A;  4R3B A;  4DE1 A;  3EOI A;  3NUL A;  1HZO A;  4WZ4 A;  2L1M A;  5EVI B;  4FUW A;  4NXB A;  3W4Q A;  1LI9 A;  2B5R A;  1ESU A;  3SH7 A;  2YKH A;  3P09 A;  3PYP A;  5TJJ A;  4BL2 A;  4I3J A;  4BQM A;  1ZG4 A;  2ZJ9 A;  1Y28 A;  5GLA A;  3UDF A;  1PI5 A;  2Y79 A;  3N8S A;  4E3L A;  3G2Y A;  3KYE A;  5FA7 A;  3TSG A;  2W0N A;  3SOI A;  1P9W A;  3R7W B;  2P74 A;  4K91 A;  2WGV A;  4NKP A;  4PAU A;  3O3V A;  1H5X A;  4R23 A;  5DFY A;  5CEC A;  4IVK A;  4WM9 A;  1PZO A;  3FPW A;  3GSG A;  4JGO A;  5HD5 A;  5DF7 A;  3F1N B;  2WUQ A;  3LGO A;  3EEA A;  4KZ7 A;  1XPB A;  3E98 A;  1WYC A;  2VV7 A;  4F3L A;  5AJG A;  1IOU A;  1L0D A;  1MWU A;  5FAS A;  3T4L A;  3S1Y A;  2J3W A;  2XF3 A;  3HVF A;  3ITB A;  5EVI C;  4G3V A;  5F1G A;  5TBM A;  5TFQ A;  3Q07 A;  1EW0 A;  3UE3 A;  1RP5 A;  3P98 A;  3SW1 A;  2PRF A;  3DTM A;  2O99 A;  2VZW A;  2WYX A;  3NEC A;  2V1A A;  3IX8 A;  1W79 A; 
#chains in the Genus database with same CATH homology
 3S7N A;  3HCY A;  1H8M A;  4G3K A;  4BJP A;  3T50 A;  3BW6 A;  3LIF A;  2Z6C A;  1OTD A;  1F9I A;  5KIZ A;  2PT7 A;  2OWH A;  3H9W A;  5DF9 A;  3T4O A;  4KQD A;  4YWZ A;  4KQO A;  2P08 A;  4HOI A;  4UEY A;  3PHY A;  4CLC B;  3UB6 A;  4RQ9 A;  4II7 A;  2P04 A;  4MCW A;  4PKY G;  1OJ5 A;  4MN5 A;  2MJ6 A;  2G7U A;  5F69 A;  2L0W A;  5J7E A;  2VLG A;  3KSG A;  4KUK A;  4MDZ A;  4GS9 B;  2D01 A;  4FOF A;  1N9N A;  4ETZ A;  4EU0 A;  5LBR A;  2QYB A;  1V9Z A;  2YKF A;  1OPX A;  2QWS A;  3MF0 A;  2HV1 A;  1LT0 A;  1P0Z A;  2EWV A;  3BJN A;  3LIE A;  4HP9 A;  4EQ1 A;  1VB6 A;  4HNB A;  1NLY A;  5J3W A;  3MXQ A;  1LSX A;  3F1N A;  3JVV A;  3KX0 X;  3UB8 A;  1XJ6 A;  3MJQ A;  4L9F A;  4JGQ A;  4LPZ A;  3C8C A;  1MC0 A;  3UE6 A;  1V9Y A;  3MQ0 A;  4EET B;  3BY8 A;  5HPF A;  1UWN X;  2W3D A;  2JKR I;  5HSQ A;  2K2N A;  2HJ9 C;  3NHQ A;  5G4Z A;  2JKR M;  2KLI A;  1TF1 A;  3MMH A;  4G3W A;  2HF6 A;  3C30 A;  1YSP A;  3LYX A;  3IS2 B;  2L4R A;  5FL3 A;  2A24 A;  3EGD C;  2KOI A;  2K31 A;  1F98 A;  1UGU A;  3VE3 A;  4GW9 A;  2JN7 A;  1BYW A;  1W63 Q;  2EWW A;  3A0V A;  1VHM A;  2IA2 A;  4L9E A;  1D7E A;  4EUV A;  3F1O A;  2ZMV A;  4HJ6 A;  3OLO A;  4YOF A;  2D02 A;  4P6Z M;  4EER A;  3T4K A;  2DMW A;  5DKK A;  1LL8 A;  2W3E A;  1ZTU A;  1KOU A;  3NOP C;  5J4E A;  1GSX A;  3OBF A;  3HJK A;  2VJW A;  4I38 A;  2GX5 A;  4IJG A;  4GCZ A;  1YKD A;  4I3I A;  2JHE A;  3KSH A;  1DP9 A;  3CLO A;  3EEH A;  2ZOI A;  2O0Y A;  2OAQ 1;  4WEJ A;  4DMZ A;  4F3L B;  5F68 A;  2B18 A;  3K2N A;  3D3O A;  4ME4 A;  3P7N A;  3T4J A;  5HWW A;  2PYP A;  4KUO A;  3ZYT A;  3TRC A;  3EWK A;  4P6Z S;  2Y8H A;  3VOL A;  4I5S A;  4NXE A;  5DJU A;  2J3T D;  2PDR A;  2VEA A;  4M4X A;  2A24 B;  5HPI A;  1DRM A;  2J3T C;  1P97 A;  1H3Q A;  4DJ3 A;  1DP8 A;  4NEE D;  4QPR A;  2PR5 A;  1N9O A;  1TS8 A;  2O9A A;  2VX8 A;  4GS9 A;  1XJ2 A;  3C2W A;  2V0U A;  4Q0I A;  2J80 A;  3CUE C;  2PR6 A;  2WKQ A;  1TS7 A;  1JNU A;  4HJ4 A;  3EQV A;  2ZOH A;  2JKT M;  1OT9 A;  5HDD A;  5DKL A;  1D06 A;  3LIB A;  3PR6 A;  1W63 M;  3NOU C;  3PBQ A;  3OOV A;  3R4K A;  2HJE A;  1T1A A;  2INW A;  2NUP C;  2WKR A;  3NOT C;  2QKP A;  3GEC A;  2B02 A;  4ETX A;  5F5Y A;  3A0R A;  3CWF A;  3PXP A;  2PYR A;  4HI4 A;  3H7W B;  1P9R A;  2PHY A;  2W1R A;  2OOL A;  3LR4 A;  2VGL M;  2PD8 A;  3FC7 A;  4R38 A;  4B9O A;  2HGV A;  2ZBB A;  5HDC A;  3F1P B;  4EEP A;  5DJT A;  1GSW A;  5HWV A;  1T19 A;  1F5M A;  4JGR A;  3UME A;  3H82 A;  4MMN A;  3ICY A;  4BBU A;  4NXF A;  1TS6 A;  3NJA A;  2NUT C;  2CMN A;  3E4Q A;  4DN0 A;  3UB9 A;  3CUE A;  4H6J B;  3LI9 A;  5IU1 A;  4EEU A;  3T4T A;  4GHI B;  1TS0 A;  1OTB A;  3LUQ A;  3LFV A;  1NWZ A;  3LR5 A;  1XJ3 A;  3BQA A;  3EQU A;  5HZH A;  3E4P A;  3PBR A;  2W1T A;  4Q0H A;  3EGX C;  4HIA A;  3H7W A;  3T4S A;  2H28 A;  2W27 A;  2V9A A;  3KSI A;  3BWL A;  4WN5 A;  4UQI S;  4E04 A;  2W3H A;  4EXO A;  1UWP X;  2V0W A;  4I39 A;  2K7S A;  2GNX A;  4Z1W A;  2VGL S;  1X0O A;  3FG8 A;  2PD7 A;  4CLC C;  4Y2F A;  5CX7 A;  4R3A A;  1YAX A;  1G28 A;  5G4Y A;  3IBJ A;  4WEK A;  1YSQ A;  1STZ A;  2BAS A;  3LIA A;  4O01 A;  3R7W A;  2M7U A;  4JGP A;  3VE4 A;  3TW8 A;  3MQQ A;  1IFQ A;  3K3C A;  3LR0 A;  4L0L A;  4BMW A;  4R70 A;  2KDK A;  1OTE A;  5MC7 A;  2I9V A;  1XFQ A;  4ARZ A;  1NLZ A;  4CLC A;  2XRO A;  4CQH A;  3CI6 A;  4R6L A;  1OTA A;  4I3A A;  3E0Y A;  5TBM B;  1S67 L;  4WLA A;  1OJG A;  2FH5 A;  2VV6 A;  3OC2 A;  5HL6 A;  1XFN A;  3TE8 A;  4OOM A;  3JVU A;  1OT6 A;  1DP6 A;  3S7P A;  3CAX A;  4IUK A;  2OWJ A;  3KYZ A;  4LRX C;  5HD3 A;  5DFX A;  4WEL A;  3MQO A;  1T1C A;  5AVF A;  3A0S A;  3B42 A;  5EFW A;  4HH3 A;  3CIT A;  3GDI A;  1G6O A;  4L9G A;  4OOL A;  2GZA A;  4UQI M;  1MKM A;  4HP4 A;  5C5K A;  5AVE A;  2A2L A;  2P7J A;  3MR0 A;  4Y5F A;  4BBV A;  4CLC D;  2XA7 S;  1S4S A;  3P01 A;  1LSW A;  2XSS A;  3TJZ C;  3B47 A;  3BY9 A;  3ULF A;  2V1B A;  4MN6 A;  1S4R A;  3F1P A;  4Q0J A;  1N9L A;  3VV4 A;  2VV8 A;  3E4O A;  3UB7 A;  3LIC A;  4LRZ E;  3F1O B;  3KYQ A;  5I5L A;  3B33 A;  4O0P A;  3OCL A;  2XA7 M;  4BWI A;  4HH2 A;  1S66 L;  2XRN A;  4XT2 B;  4IUH A;  5F6A A;  3PBT A;  3PBS A;  3K3D A;  2OAP 1;  3IS2 A;  1WA9 A;  4DJ2 A;  4WUJ A;  3LR3 A;  2O9C A;  3LI8 A;  1ODV A;  4LRY C;  2VKS A;  5A8B A;  4Y3I A;  3H82 B;  3EOI A;  1ZHH B;  4GHI A;  4HQA A;  4PKY A;  4AFI A;  2L1M A;  3PBN A;  4NXG A;  2W3G A;  3BQ8 A;  4ZRR A;  4NXB A;  1OTI A;  5IT5 A;  4EES A;  2YKH A;  3UMD A;  3PYP A;  5TJJ A;  1T1B A;  4I3J A;  1S1Z A;  1LSV A;  4EW7 A;  1Y28 A;  3G6O A;  4PHT A;  4BBT A;  2Y79 A;  4HJ3 A;  3DBA A;  2LB9 A;  2QJ7 A;  3OCN A;  2W0N A;  4WF0 A;  1P9W A;  2W1T B;  3R7W B;  3S7Q A;  1GSV A;  4NKP A;  4PAU A;  3RH8 B;  3T4Q A;  3HJI A;  3IBR A;  1T18 A;  2Z6D A;  4FSF A;  5DFY A;  4B93 A;  1S1Y A;  3PBO A;  3FPW A;  4JGO A;  5HD5 A;  1TD5 A;  4XT2 A;  3F1N B;  3KO6 A;  3S7O A;  2M1C A;  3EEA A;  5L8M A;  2QJ5 A;  3RTY A;  2W3F A;  3E98 A;  3U2A A;  4CLC E;  2VV7 A;  4O8G A;  4WL9 A;  5HDS A;  3LID A;  4ARZ B;  4F3L A;  5AJG A;  1IOU A;  3W2Z A;  3RFB A;  3V67 A;  5HWT A;  5IS1 A;  2ZMF A;  3T4L A;  2J3W A;  3O5Y A;  4IHQ A;  4G3V A;  2R78 A;  3FPV A;  1XJ4 A;  4GJ4 A;  2FZ0 A;  4MN7 A;  3D72 A;  5TBM A;  1EW0 A;  3UE3 A;  4H6J A;  2M7V A;  2JKT I;  2VA0 A;  3SW1 A;  2QHK A;  2WKP A;  4YNR A;  3KSF A;  4GLQ A;  4HHD A;  1MZU A;  2LB5 A;  2O99 A;  2VZW A;  5K5B A;  4K08 A;  5KSH A;  2O9B A;  4LLO B;  2KX6 A;  3ZQ5 A;  4HY8 A;  1NRJ A;  3C38 A;  2EA9 A;  2GJ3 A;  3MFX A;  2V1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...