1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
source organism Ectothiorhodospira halophila
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
2K7SA 3LIDA 4I3IA 3FG8A 4R38A 1OTIA 4R70A 3KX0X 4RQ9A 4I3JA 3UE6A 5HZHA 4HIAA 5HDCA 4BBTA 1OJ5A 4WN5A 1GSXA 3IBRA 1GSVA 1N9OA 3K3DA 1DRMA 4HP9A 4F3LA 1OJGA 4NXEA 4LRZE 5I5LA 3CAXA 4EEPA 4EERA 1S66L 2W0NA 4HP4A 2GJ3A 3CWFA 1G28A 3UMDA 1TS6A 2B02A 3P7NA 1MZUA 1OTBA 3FC7A 4MN6A 2PD8A 1EW0A 5G4ZA 3HJKA 4I5SA 2L0WA 4L9EA 4F3LB 1KOUA 4R3AA 5DJTA 1JNUA 2VV6A 4HH3A 4HNBA 1VB6A 1XJ4A 1DP9A 3MFXA 4HY8A 2PYPA 2BASA 4KUOA 3A0VA 5J4EA 3GDIA 2VEAA 2JN7A 1DP6A 3NOPC 4I38A 5AVFA 3MQQA 2OWHA 1T1AA 3RH8B 1NWZA 4GHIB 4GHIA 3RTYA 2QWSA 4LLOB 2D02A 2H28A 3UB9A 1F9IA 3LIFA 4WUJA 1TS8A 2PYRA 3LI8A 1T1BA 5F68A 4KQDA 1WA9A 5HDDA 1N9NA 1P97A 3LYXA 2ZBBA 2OWJA 4I3AA 4HJ4A 1X0OA 3MQOA 5G4YA 4XT2B 4XT2A 5IS1A 3F1NA 3F1NB 3NHQA 5DKLA 2WKQA 2YKFA 4KUKA 3ICYA 5DJUA 1T1CA 2V0UA 2Z6CA 4YWZA 4L9FA 5HD5A 5TBMB 4LPZA 5TBMA 1N9LA 2INWA 1OT6A 4JGRA 4H6JA 4H6JB 2L1MA 4HH2A 3ULFA 5HDSA 2D01A 3OLOA 2Z6DA 5KIZA 1UWPX 5J7EA 4HI4A 3H9WA 3EWKA 3BY9A 4M4XA 4EQ1A 4BBVA 1UGUA 2A24A 2A24B 2KX6A 2WKPA 4MN5A 3VOLA 4EEUA 2I9VA 3LUQA 2HV1A 3PYPA 3VE4A 3UMEA 3K3CA 5HWVA 4L9GA 4JGQA 2PD7A 1S4SA 3LIAA 3LI9A 3MR0A 3E4OA 3NJAA 4LRYC 4PKYG 2QHKA 2V1BA 4EESA 4EW7A 1DP8A 5DKKA 2CMNA 3H7WA 3H7WB 3T50A 4I39A 1T18A 1D06A 2PHYA 2ZOIA 2OOLA 4B9OA 4BBUA 3F1OB 3F1OA 1XJ2A 1P0ZA 3UB8A 3A0RA 3BWLA 3UB6A 1Y28A 4HJ6A 1S1YA 4EETB 4GS9B 4GS9A 4DJ3A 5A8BA 3NOTC 2J80A 3C8CA 2VV7A 5HD3A 3LIEA 1UWNX 2L4RA 4NXGA 3IS2A 2R78A 1GSWA 1XJ6A 3IS2B 1LSXA 3CLOA 2KDKA 1V9YA 2EA9A 1OTEA 2W27A 3GECA 2WKRA 4GW9A 4PKYA 5F5YA 3ZQ5A 1TS0A 3C2WA 2VLGA 1LSVA 4GCZA 5HSQA 4LRXC 1ODVA 4HJ3A 4JGOA 5HWTA 2VV8A 1LT0A 4NXFA 3MJQA 2PDRA 4WF0A 1D7EA 2QKPA 3EEHA 1S4RA 3H82B 1F98A 1T19A 3H82A 3PHYA 4WLAA 3F1PB 3F1PA 4DJ2A 2P7JA 1S67L 2V1AA 5EFWA 1TS7A 1LL8A 3D72A 3UB7A 3SW1A 4EXOA 5J3WA 2QJ5A 3G6OA 1LSWA 3NOUC 1V9ZA 5HWWA 4R6LA 1BYWA 2QJ7A 2YKHA 5AVEA 2PR5A 1OT9A 3LICA 1OTAA 4HOIA 1S1ZA 2ZOHA 3A0SA 4NXBA 2V9AA 3VE3A 4E04A 1XJ3A 4WL9A 4HHDA 5F6AA 1XFNA 4K08A 3HJIA 2PR6A 1XFQA 3LIBA 2JHEA 4JGPA 5F69A 5IU1A 2M1CA 1OTDA 3B33A 3E4PA 4HQAA 2V0WA 3E4QA 3BY8A 3MXQA
chains in the Genus database with same CATH superfamily
2A2LA 3UE6A 4IHQA 3FPVA 4Y5FA 2PU4A 2HDRA 3WRTA 4QU3A 1AXBA 3UMDA 3P7NA 1SDNA 4IVIA 5HPIA 4KZ8A 3SS3A 1I5QA 4HH3A 5FASA 4WMCA 5JYOA 3RJUA 1FR6A 1DY6A 1KE0A 3V39A 4OOLA 2W3GA 4KUKA 1K57A 1L0FA 5EPHA 1OMEA 3HLDA 1N9LA 5CHUA 4LV0A 4HH2A 2XA7M 2ZC6B 2GX5A 3IF5A 5FQMA 3QHYA 4JBFA 1BTLA 1PWDA 3IXHA 4WYYA 5TJJA 4GN2A 4L9GA 3DTEA 5FL3A 2M7UA 2JKTM 3CITA 5KMWA 5D3OA 3IQAA 1NZOA 3F1OB 5CRFA 2Q0OA 4OLDA 3EEAA 2QYBA 3SZTA 2VGLS 3S1YA 1GA9A 2XFTA 4PKYA 5AQ9A 3C2WA 2XF3A 4Y0UA 3UE3A 4KZ9A 2PDRA 3EEHA 3PHYA 3HUNA 4UA6A 4Y15A 1I2SA 1ONGA 2WGVA 3VV4A 1ZTUA 1V9ZA 4BD1A 5HWWA 3DWZA 1YSPA 3LICA 4E04A 2IWDA 2OLVA 3ZNYA 2ZMFA 4PPRA 1IOUA 1YLTA 1YLPA 4O0PA 2X71A 3ZG7B 3GRJA 4PAUA 1HZOA 2Y79A 4X25A 5E2GA 5DVAA 4KQOA 5FQIA 4HP9A 2W1TB 2WZZA 1LI9A 3O87A 4LRZE 3E0YA 1FOFA 4KENB 2ZC3B 5EVIC 1KOUA 3SH8A 3BFFA 4OPRA 4QHCA 3C7VA 1K0KA 3RH8B 2JKRM 3TE8A 5FAOA 2E8IA 4PM5A 4S2KA 3T4OA 4JXVA 4DF6A 5FEGA 1K56D 5EUAA 1P97A 4BL2A 3UNWA 3AGEA 3ZCZA 4QJGA 3P98A 5HAQA 2PRFA 5GLCA 2WKPA 5EVEA 4FH4A 5HWVA 4RA7A 2XD1A 2A49A 5EVIB 1ZC2A 2CC1A 4O7DA 3BWLA 4G3WA 1XJ6A 1OTEA 2G2WA 3ITBA 4CLCA 3KYZA 1L2SA 4S2MA 3S7PA 4WF0A 2HDUA 1YT4A 2EX8A 2V1AA 3UB7A 2VKSA 3L9KA 3VE3A 1S1ZA 2WYXA 1IYPA 3BFEA 5HAIA 1GCEA 2JBFA 1IEMA 4R38A 1SKOB 4HIAA 1G5UA 3T4JA 4L0LA 3HLCA 1ZHHB 1K54A 3VSKA 1MZUA 4ZJ2A 3UPOA 3CPTA 1Y54A 3IF6A 3V5MA 4LV3A 4F3LA 3IX4A 2EX6A 1K57C 1VB6A 4KUOA 5F82A 3GQZA 3A0VA 5J4EA 3G4PA 4Q0IA 5TGFA 2Q9MA 1ALQA 5E2FA 1FR1A 3T4KA 3UB9A 1LLBA 5HARA 1TS8A 5FSRA 3CZDA 2RL3A 2OWJA 1X0OA 1KDSA 5DKLA 3M2JA 4WBGA 3RXWA 4KZ4A 4MMNA 5E43A 4LPZA 4E3KA 3ISGA 5GHYA 3LO7A 3ZFZA 2VGJA 4Y0TA 2JC7A 3OCNA 2ZM2A 4BMWA 4KQQA 4ETXA 1YLWA 2Y2KA 1GA0A 3PAGA 2HZ5A 3GR2A 4DXBA 3N8SA 3T1XA 4GW9A 4EQIA 3NIAA 3O3VA 3FZCA 5A90A 2Z2LB 1D7EA 1MKMA 1S67L 2Y2MA 3W2ZA 5GHXA 4CLCC 4Y3IA 2PR5A 5L8MA 5FQJA 2JHEA 2XK1A 3B33A 1ONHA 3QP2A 2K7SA 1OTIA 1S6RA 4UEYA 3KYEA 3KYQA 1OJ5A 4KG6A 2GDNA 3K3DA 3A3DA 1TEMA 1D1JA 1L0DA 3W8KA 5FQKA 2WKHA 3B42A 2UWXA 2AVXA 4OPQA 1XXMA 2J3TD 3BQAA 3GSGA 1SHVA 1JNUA 4HY8A 4NEED 4I38A 4EBLA 3OPLA 4GJ4A 4FOFA 4YINA 3IX8A 3T4QA 1SCWA 1WA9A 1NLYA 2WADA 1GHMA 2Y2QA 4P0MA 2WKQA 2V0UA 1KVLA 1CF0A 4G3KA 4GOGA 4BQMA 1W8YA 5HAPA 4H8RA 5E2EA 1RP5A 1QMEA 4G3VA 3V67A 1NYMA 4WMCD 3BFDA 3TW8A 4WZ4A 1J9MA 3C30A 2QMIA 1HTZA 3M2KA 3QP5A 1YKDA 5FAPA 5EVLA 3IS2B 4LGWA 1FCOA 3D4FA 3NECA 1BSGA 1HD8A 1TS0A 3MKFA 2WGWA 5A93A 5HWTA 3DTKA 4NXFA 3ZG0A 1J3WA 2O9CA 4K0XA 1K6RA 3D72A 1ES2A 4EUVA 4JLFA 4B88A 1OTDA 4S2NC 3BM6A 2WAEA 1ESIA 3GTCA 2ZL1A 3VSLA 4KZ3A 4KG5A 4GD8A 4GDNA 4GD6A 5IHVA 5K5BA 2C5WB 1XJ4A 4HEFA 3MFXA 3PR6A 3GDIA 1NJ4A 2H10A 3VOYA 3LI8A 3LR3A 4PM8A 5EE8A 1E3UA 2P08A 3WS4A 5EM0A 4X6TA 2Q9NA 4P85A 1PZOA 2JKGA 1Q2PA 1IYOA 4FD8A 4MDZA 3CJMA 4H6JB 3LFVA 5AQAA 3EOIA 1MWSA 2V2FF 4EQ1A 1Z09A 5KSHA 1MWRA 2KX6A 1H0MA 3O86A 4ZBEA 4K0WA 3MF0A 3E4OA 2X01A 4I39A 4Y13A 4YNRA 1XGIA 1VM1A 1Y28A 5BOHA 3C8CA 3IXGA 5HD3A 3TJZC 3LGOA 1P9RA 4KZAA 3CLOA 4UHUA 5FDSA 2WZXA 2P9VB 3G34A 3MBZA 4X1LA 3IWOA 1L0GA 5CECA 1WYBA 4PHTA 4ZJ3A 1PFLA 3BRMA 3UDXA 2J9PA 3Q81A 3MS6A 3E4QA 5CX7A 4DMZA 5E2HA 3HL9A 4OLGA 2XR0A 1VQQA 4QB8A 4BJPA 3G30A 1GHPA 3ZVWA 5I5LA 4HP4A 4PM9A 1G28A 2B02A 2K2NA 3I7JA 1ES3A 2PD8A 3P09A 3E98A 4X68A 3VP1A 4BLMA 4S2PA 5GLDA 3PAEA 5CEDA 4AFIA 4OP5A 4QD4A 2XQZA 1MKIA 1F9IA 4R23A 3HLWA 2B18A 4JPMA 1BLHA 2W1RA 5C5KA 2DRWA 1XX2A 2ZQAA 5HD5A 1PWCA 5GHZA 3ULFA 3HCYA 3OZHA 2HP5A 2ZC4B 3C5AA 4BBVA 3JYIA 3WS5A 1L3LA 3PYPA 2ZD8A 1Q2QA 1YSQA 5DKKA 4LCMA 3PBOA 1ES4A 2O9AA 4UAAA 3HBRA 1XJ2A 1E3UD 3A0RA 4EBNA 3NDEA 3KSIA 4CLCB 3ZQ5A 3IH9A 1U60A 2EWWA 1EI5A 4PMAA 1K38A 5L09A 3Q7ZA 3F1PA 4CQHA 2J3WA 2P7JA 2XRNA 1TS7A 3UY6A 3SW1A 5DF7A 3G6OA 3UDFA 2QJ7A 2ZQ8A 4NXBA 2ZOHA 3IHAA 4FUWA 2PR6A 4D60A 4P6ZS 1H8ZA 4Z1WA 1BT5A 2FFFB 3GV9A 3LCEA 1ESUA 4II7A 3LIDA 4NXGA 3FG8A 3IXDA 3T12B 3ZNTA 1Z6FA 3HUOA 2V8CA 3N4IA 2Y55A 4CPKA 3PBRA 2ZM8A 1PI4A 1S66L 4IEDA 1H5XA 3FC7A 2HDSA 3FKVA 3ITAA 3IF6B 4F3LB 3DTIA 3ZVTA 4GNUA 2EX2A 3HLEA 3KO6A 1NWZA 1JWVA 2OV5A 3PXPA 1KDWA 1NRJA 1K4EA 4ARZB 2Y4AA 2VGLM 5G4YA 1ACFA 2VA0A 3NHQA 3TG9A 4U0TA 5U47A 4ID4A 5DJUA 5TBMB 4Z9QA 1MXOA 2P04A 3BFGA 5L2FA 1UGUA 1CI8A 3N7WA 3VE4A 4JGQA 2PD7A 5FI2A 3VP3A 1FSWA 5CTNA 1D06A 2G7UA 2PHYA 3D3OA 3UB8A 5A8BA 4DJ3A 1CEFA 4D2OA 4EESA 2VV7A 2L4RA 1LSXA 4NETA 4R4SA 1NLZA 1W8QA 4LRXC 2DMWA 2GZAA 4Y0OA 1S4RA 4ZDXA 3MMHA 3HVFA 5EFWA 3RXXA 4RYEA 3HUMA 2XFSA 4NG2A 1XJ3A 3HJIA 5GLAA 4DE0A 3ZYTA 1HVBA 4I3IA 3IWIA 4RQ9A 4MN7A 2IA2A 3JVVA 4HBTA 2E8JA 3JPUA 4GKUA 4KG2A 3Q07A 1F2KA 1H8YA 3CWFA 1XKZA 2C6WB 4S2NA 4MN6A 3OPRA 1K6SA 2HP6A 3A3JA 3CUEA 1L0EA 4ETZA 2EXAA 2Y91A 4E3JA 4P6ZM 1SDEA 4WUJA 2ZJ9A 2HP9A 3VP4A 4O8GA 1NRFA 3O88A 3BLSA 3UO9A 3MZEA 2D01A 1YLZA 3O5YA 2VX8A 4BD0A 3LI9A 3MR0A 5KSCA 3WRZA 2QHKA 3K2NA 1YLJA 3H7WA 5TR7A 4KQRA 1T18A 1CEGA 3WS0A 1GHIA 1PI5A 3QNBA 3NOTC 5FAQA 3IS2A 1GSWA 2V20A 1V9YA 3GECA 3N8RA 3LR0A 1K54C 1SZVA 1YAXA 2WGWB 1ODVA 4Y17A 5EECA 1CK3A 1YM1A 4YOFA 3EGXC 2DNSA 4MBKA 1CI9A 3NOUC 1ES5A 4HOIA 4DRTA 3UPPA 3OPPA 4HHDA 5F6AA 1DJAA 3G2ZA 4RVAA 3EQVA 3V50A 2QPNA 1TDLA 1YLYA 3WS2A 5CEBA 2ZL1B 3IBRA 1OPXA 2Y2IA 3CAXA 5DTSA 4EEPA 1PNEA 3DTMA 1G6OA 5FI7A 2GJ3A 1ZKJA 3T1SA 1NZUA 3ZHHA 4B4ZA 4L9EA 5DFYA 4R3AA 5F83A 3S22A 1T1BA 1Y4OA 4X69A 2WKEA 3SH7A 2Y2PA 3ZDJA 1IKIA 2XLNA 3W4OA 4H6JA 1PW1A 3IH8A 5HDSA 4MN5A 4EEUA 1H8MA 4WZ5C 3Q1FA 4JKTA 4KZ5A 2VGKA 2V1ZA 4JXGA 5MC7A 4DDSA 2Y2HA 1STZA 5HL6A 4HJ6A 1K56A 3VP0A 5KZHA 4WELA 2I72A 1ZG6A 1BUEA 1RGZA 5F5YA 2P9VA 4FCFA 4N1XA 3G31A 4PM6A 1BLPA 1LSVA 4RX2A 1ERMA 4HJ3A 4R3BA 1VETA 3H82B 4ME4A 3IT9A 2HDQA 4IVKA 1LL8A 3W4PA 2Y2OA 3E2LA 3AGFA 1BYWA 2JKTI 1MWUA 2J7VA 1JWPA 5F69A 1MBLA 2M1CA 4NKPA 3T4TA 2ZMVA 3MXSA 3BY8A 3MXQA 4R70A 2W3HA 4QY5A 3CUEC 4O01A 3N8LA 2FH5A 3ZG5A 1GSVA 1DRMA 3UB5P 4N9LA 2A3UA 3FYZA 2XGNA 4WEKA 3Q7VA 1M6KA 5F1GA 1FIKA 2O9BA 1W63M 2XEPA 4C3QA 2RCXA 2BASA 3NOPC 4FH2A 2X02A 5M19A 2PYRA 4Y2FA 1XPBA 3NI9A 4XT2A 1XA1A 3BW6A 3EGDC 4XUXA 3D9YA 2ZQ7A 1OT6A 5TFQA 2DCFA 2A24A 2HV1A 2UV0E 4R0QA 3NY4A 4OONA 2IWCA 3HLBA 3PBSA 1S1YA 4EETB 2W27A 3NULA 3C4PA 4R4RA 3UPNA 2EXBA 3SS4A 2ACGA 3HLGA 3F1PB 5FQQA 1RCJA 2EFUA 4EWFA 5FA7A 1M40A 2Y2NA 3SH9A 3DW0A 2HF6A 2YKHA 1EROA 5DTKA 2FZ0A 3BJNA 4MBFA 4K08A 3SOIA 3PBNA 1MWTA 3S7NA 1KGFA 4K91A 3KX0X 4U0XA 5FDHA 2JE5A 4S2LA 5CGXA 1IKGA 5DFXA 4S2OA 2J3TC 5CGWA 4ZTKA 3M6HA 2QZ6A 5AQBA 4C75A 4KZ6A 5FI6A 1TD5A 2PU2A 1DP9A 2BG1A 2PYPA 4ZRRA 2OWHA 4GB7A 2HGVA 4OVDA 5DF8A 4ARZA 4RX3A 4I3AA 4WZ5A 1DJCA 2WGIA 4OQHA 2Y2JA 3F1NB 3HREA 2EFXA 2PBYA 1MPLA 4CLCD 5JYPA 3QP8A 1E25A 1IYQA 5TBMA 3UN7A 3MXRA 2XH9A 4OOMA 3OLOA 3C7UA 2LB5A 4N9KA 4BWIA 3BQ8A 3FPWA 4PM7A 3UMEA 5HZHA 2V1BA 3T50A 2CMNA 5HFOA 1SKFA 1E4DA 4E3LA 2ZQ9A 1MC0A 1C3BA 3R7WB 4P6BA 1LL9A 3UB6A 4MNRA 3ZG9B 2JCHA 3MQ0A 3VP2A 1NYYA 2FFYA 2OSUA 5IU1A 2KDKA 1PYYA 4X53A 3G35A 2VLGA 4E3OA 5HSQA 2XD5A 3LR5A 3OCLA 3BFCA 2K31A 5M18A 5CHJA 3TSGA 4MCWA 5AVEA 3ZGAB 4DE2A 4Q8IA 4GZBA 3WWXA 1BZAA 5CGSA 4HBUA 4GDBA 1K4FA 3U2AA 3HLFA 1KGGA 2XDMA 2WUQA 4UQIS 4BBTA 2VJWA 5HW3A 1LL5A 1K55C 4EERA 3IBJA 4DE1A 1OTBA 1XA7A 4IBRA 3MFDA 4JF6A 3OC2A 4N1HA 5EOEA 1JTDA 3MQQA 4GHIA 4EBPA 1W5DA 1ZG4A 1WE4A 3LYXA 2V8FA 4U3TA 2HPBA 5FATA 1VEUA 1T1CA 2ZQDA 5EM1A 3P01A 4XUZA 4R3JA 4UA7A 4P87A 3PBTA 4M4XA 4FSFA 3LUQA 3B47A 3K3CA 4MEZA 3UDIA 3T4LA 4EW7A 3H7WB 1EWZA 5FEFA 4B9OA 5EV0A 4GS9A 4OQGA 1FILA 4DJ2A 4OP8A 2EA9A 1FQGA 4UA9A 5CHMA 3BLMA 3UE0A 3GVBA 5M1AA 3V3RA 3CI6A 2WAFA 4F94A 4WLAA 2PAVP 4JXSA 4EXOA 3BYDA 1LSWA 2EWVA 5AJGA 2HJEA 1FCNA 4JGPA 3PBQA 2ZMAA 4M3KA 1LHYA 2XROA 4I3JA 3IWQA 1BLCA 4EU0A 5HDCA 4JF4A 3A3EA 2BTFP 1OJGA 2ZC5B 1DJBA 1KE3A 3SS5A 3KSHA 4OQIA 1NXYA 2HJ9C 3DBAA 5G4ZA 2IWBA 2VV6A 4HNBA 2VK3A 5HX9A 2Y2LA 3OOVA 2G2UA 1JTGA 1T1AA 3BECA 3RTYA 4OH0A 2H28A 3CMZA 3LIFA 1N9NA 2BLSA 4HJ4A 3MQOA 3MZDA 3S4XA 3IHBA 2EX9A 2YKFA 3G32A 4QY6A 4IUHA 4L9FA 3LR4A 2L1MA 1UWPX 1KGEA 5J7EA 4ESPA 3M6BA 2I9VA 3QP1A 1S4SA 3LIAA 3NJAA 3NDGA 2XSSA 2PT7A 3IF6C 2R9WA 1VHMA 2ZOIA 3PTEA 5CERA 4BBUA 2Y59A 3F1OA 1TF1A 1P0ZA 3BEBA 3LY4A 1CQAA 5GLBA 4OKPA 3LIEA 1UWNX 5F68A 4EUZA 2J8YA 3OPHA 4LV2A 5I94A 2GNXA 2H0TA 4E6WA 4KZBA 2VV8A 3DAVA 1VETB 4IUKA 3H82A 4DKIA 1T19A 2ZLYA 4EV4A 4N92A 5EOOA 1O7EA 4KZ7A 5J8XA 1BULA 4R6LA 1QMFA 2LB9A 1XFQA 5HPFA 4HQAA 4HESA 1GSXA 1N9OA 4UQIM 2W1TA 3IX3A 3KSFA 4E6XA 3C4OA 4NXEA 1XP4A 3TRCA 1O07A 1TS6A 3Q7VB 3G2YA 3HJKA 4I5SA 2L0WA 4IBXA 3AGDA 4JXWA 4OQ0A 1DP6A 2D02A 2OLUA 2ZC7A 1IFQA 1FSYA 3OBFA 3FV7A 4XT2B 2XA7S 4X1MA 4C6YA 2H5SA 1TDGA 3CG5A 1G6AA 3FWLA 4HI4A 4MLLA 2A24B 2Y2GA 3S7OA 3VOLA 2KOIA 4Q0HA 5EVIA 3VFFA 1RGYA 4B4XA 1IYSA 1YPRA 3NC8A 1FCMA 5G18A 4LV1A 2KLIA 5FQ9A 5AQ7A 1LI0A 4IJGA 4YFMA 3QP6A 1W7FA 4JGOA 4E3IA 3R4KA 3MJQA 2J9OA 4OPZA 2WKIA 3DWKA 4DE3A 5J3WA 1KVMA 4B93A 1BLSA 3QNCA 1CJFA 3T1RA 3KSGA 1YMSA 1JWZA 4WL9A 4Y7PA 3LEQA 1SKOA 4BL3A 4WN5A 1A0KA 4WM9A 5DTTA 4JF5A 3E2KA 2W0NA 4S2JA 4R1GA 3UE1A 3CPTB 3IXBA 3V3SA 2M7VA 2QWSA 3LEZA 4LLOB 4WEJA 4GLQA 3S7QA 4NK3A 4OOYA 1P9WA 5L07A 2O0YA 4KQDA 5HDDA 2JKRI 2ZBBA 3FKWA 2NUTC 5GL9A 1N4OA 3F1NA 1I2WA 1YQSA 3TOIA 4X55A 4QWOA 5LBRA 3BY9A 1S0WA 3W4QA 4LRYC 1AWIA 2OOLA 3QP4A 1PWGA 4ZAMA 3R7WA 3VMAA 5A91A 2J80A 2Z2MB 1TVFA 2R78A 4FTXA 4DXCA 3WS1A 3JVUA 5F1FA 4S2IA 3EQUA 2OAQ1 2Y8HA 1WYCA 3Q82A 2ZM0A 2W3FA 1G68A 5EVID 2QJ5A 1PIOA 3CHWP 3VOZA 2B95A 2W3DA 1NY0A 3ZG8B 3E4PA 4LFUA 1F5MA 1PRQA 4E3MA 2NUPC 3NCKA 3T1QB 4A5RA 3VFHA 1ERQA 1KE4A 2H0YA 2W3EA 1MY8A 3A3IA 3C38A 2OAP1 5CXWA 4BENA 3NBLA 2PBDP 1EW0A 5DJTA 3GMWA 5CTMA 5IS1A 2VEAA 2JN7A 3LY3A 4CJNA 5AVFA 4GHIB 3L7HA 3N6IA 5A92A 1PW8A 4LENA 2P74A 4MBHA 1HLUP 1K25A 3ICYA 1VEUB 2Z6CA 4YWZA 1W79A 2INWA 4JGRA 2Z6DA 5KIZA 5DF9A 2R9XA 3H9WA 3EWKA 4QPRA 4ZJ1A 4DDYA 2MJ6A 1PZPA 2WK0A 4PKYG 1DP8A 2JKFA 3MZFA 3B3XA 4E3NA 5L10A 4LCLA 4OPYA 3MSHA 1N9BA 4GS9B 1JVJA 2O99A 3LIBA 2WKRA 4XXRA 1IELA 4GCZA 5HL1A 1H3QA 1LT0A 3A3FA 2QKPA 1F98A 2VZWA 1W63Q 4CLCE 2B5RA 2ZQCA 3MKEA 3RFBA 4DN0A 4Q0JA 1K55A 1XGJA 1OT9A 4X56A 1OTAA 3A0SA 2V9AA 1YMXA 1XFNA 3U4LP 3T4SA 5IT5A 2V0WA
chains in the Genus database with same CATH topology
2A2LA 3UE6A 2XROA 4I3JA 4IHQA 3FPVA 4EU0A 4Y5FA 5HDCA 3IBRA 1OPXA 1OJGA 3CAXA 4EEPA 3KSHA 1G6OA 2GJ3A 3UMDA 3P7NA 2HJ9C 3DBAA 5G4ZA 5HPIA 4L9EA 5DFYA 4R3AA 5K5BA 2VV6A 4HH3A 4HNBA 1XJ4A 3MFXA 3PR6A 3OOVA 3GDIA 1T1AA 3RTYA 2H28A 3LIFA 3LI8A 1T1BA 3LR3A 1N9NA 2P08A 4HJ4A 3MQOA 4OOLA 2W3GA 2YKFA 4KUKA 4IUHA 4L9FA 4MDZA 1N9LA 3LR4A 4H6JA 3LFVA 2L1MA 2XA7M 4H6JB 4HH2A 3EOIA 5HDSA 2GX5A 1UWPX 5J7EA 5KSHA 4EQ1A 2KX6A 4MN5A 4EEUA 1H8MA 5TJJA 2I9VA 4L9GA 1S4SA 3LIAA 3MF0A 3NJAA 3E4OA 5FL3A 2XSSA 2PT7A 2M7UA 2JKTM 3CITA 4I39A 1VHMA 2ZOIA 4YNRA 4BBUA 5MC7A 3F1OB 1TF1A 3F1OA 1P0ZA 1STZA 3EEAA 5HL6A 1Y28A 4HJ6A 2QYBA 4WELA 3C8CA 5HD3A 3LIEA 1UWNX 3TJZC 5F68A 1P9RA 2VGLS 3CLOA 5F5YA 4PKYA 2GNXA 3C2WA 1LSVA 3UE3A 4HJ3A 2VV8A 2PDRA 3EEHA 4IUKA 3PHYA 3H82B 3H82A 1T19A 4ME4A 1LL8A 3VV4A 1ZTUA 1V9ZA 4PHTA 5HWWA 4R6LA 1BYWA 1YSPA 2JKTI 3LICA 4E04A 2LB9A 2ZMFA 1XFQA 1IOUA 5F69A 5HPFA 2M1CA 4HQAA 4NKPA 3T4TA 2ZMVA 3E4QA 5CX7A 4O0PA 3BY8A 3MXQA 4DMZA 4PAUA 4R70A 2Y79A 2W3HA 3CUEC 4O01A 4KQOA 2FH5A 1GSXA 4BJPA 1GSVA 1N9OA 4HP9A 1DRMA 4UQIM 2W1TB 2W1TA 3KSFA 4NXEA 4LRZE 5I5LA 3E0YA 4HP4A 3TRCA 1G28A 4WEKA 1TS6A 2B02A 2K2NA 2PD8A 2O9BA 3E98A 1W63M 3HJKA 4I5SA 2L0WA 1KOUA 4AFIA 2BASA 1DP6A 3NOPC 3RH8B 2JKRM 3TE8A 2D02A 1F9IA 1IFQA 2PYRA 2B18A 3T4OA 4Y2FA 3OBFA 1P97A 2W1RA 4XT2B 4XT2A 2XA7S 5C5KA 3BW6A 3EGDC 5HD5A 1OT6A 3ULFA 3HCYA 4HI4A 4BBVA 2A24A 2A24B 2WKPA 3S7OA 3VOLA 2HV1A 3PYPA 5HWVA 2KOIA 1YSQA 4Q0HA 5DKKA 3PBOA 2O9AA 1XJ2A 3A0RA 3BWLA 3PBSA 1S1YA 4EETB 4G3WA 2KLIA 3KSIA 1XJ6A 2W27A 1OTEA 4IJGA 4CLCB 4CLCA 3ZQ5A 3KYZA 2EWWA 4JGOA 3R4KA 3S7PA 3MJQA 4WF0A 3F1PB 3F1PA 4CQHA 2J3WA 2P7JA 2XRNA 2V1AA 1TS7A 3UB7A 3SW1A 5J3WA 4B93A 3G6OA 2VKSA 2HF6A 2QJ7A 2YKHA 3VE3A 3KSGA 1S1ZA 2ZOHA 4NXBA 2FZ0A 3BJNA 4WL9A 4K08A 2PR6A 4P6ZS 3PBNA 4Z1WA 3S7NA 4II7A 4NXGA 3LIDA 3FG8A 4R38A 3KX0X 4HIAA 4WN5A 3T4JA 4L0LA 5DFXA 3PBRA 1ZHHB 2J3TC 1S66L 2W0NA 1MZUA 3FC7A 4F3LB 4F3LA 1TD5A 1VB6A 1DP9A 4KUOA 2PYPA 3A0VA 5J4EA 4ZRRA 3KO6A 4Q0IA 2OWHA 1NWZA 2HGVA 2M7VA 2QWSA 4LLOB 4WEJA 3T4KA 3UB9A 4GLQA 3PXPA 3S7QA 1P9WA 1TS8A 1NRJA 4ARZA 2O0YA 4ARZB 4KQDA 5HDDA 2JKRI 2ZBBA 2OWJA 4I3AA 2VGLM 1X0OA 2NUTC 5G4YA 2VA0A 3F1NA 3F1NB 3NHQA 5DKLA 4CLCD 5DJUA 4MMNA 5TBMB 4LPZA 5TBMA 2P04A 4OOMA 3OLOA 2LB5A 5LBRA 3BY9A 1UGUA 4BWIA 3BQ8A 3FPWA 3OCNA 3VE4A 3UMEA 5HZHA 4BMWA 4JGQA 2PD7A 4LRYC 2V1BA 4ETXA 3T50A 2CMNA 1D06A 2G7UA 2PHYA 3D3OA 2OOLA 1MC0A 3R7WB 3R7WA 3UB8A 3UB6A 5A8BA 4DJ3A 3MQ0A 2J80A 4EESA 2VV7A 2L4RA 5IU1A 2R78A 1LSXA 2KDKA 1NLZA 4GW9A 2VLGA 5HSQA 3JVUA 4LRXC 2DMWA 3LR5A 3EQUA 3OCLA 2GZAA 2OAQ1 2K31A 1D7EA 1MKMA 1S4RA 2Y8HA 3MMHA 1S67L 5EFWA 2W3FA 3W2ZA 2QJ5A 4MCWA 4CLCC 5AVEA 4Y3IA 2PR5A 2W3DA 2V0WA 1XJ3A 3HJIA 5L8MA 2JHEA 3ZYTA 3E4PA 3B33A 1F5MA 2K7SA 3U2AA 4I3IA 1OTIA 4UEYA 4RQ9A 4MN7A 2IA2A 2NUPC 3JVVA 4UQIS 4BBTA 3KYQA 1OJ5A 2VJWA 3K3DA 2W3EA 4EERA 3B42A 3IBJA 3C38A 2OAP1 3CWFA 1OTBA 4MN6A 2J3TD 1EW0A 3BQAA 3OC2A 3CUEA 5DJTA 1JNUA 4HY8A 4NEED 4ETZA 5IS1A 4I38A 2VEAA 2JN7A 5AVFA 3MQQA 4P6ZM 4GHIB 4GHIA 4GJ4A 4FOFA 4WUJA 3T4QA 1WA9A 1NLYA 3LYXA 4O8GA 2WKQA 3ICYA 1T1CA 2V0UA 2Z6CA 4YWZA 3P01A 2INWA 4G3KA 4JGRA 2D01A 2Z6DA 5KIZA 5DF9A 3H9WA 3EWKA 3O5YA 3PBTA 4M4XA 2VX8A 4QPRA 4FSFA 3LUQA 3B47A 2MJ6A 3K3CA 4G3VA 3MR0A 3LI9A 3V67A 4PKYG 3T4LA 3TW8A 2QHKA 3K2NA 4EW7A 1DP8A 3H7WA 3H7WB 1T18A 3C30A 4B9OA 4GS9B 4GS9A 3NOTC 1YKDA 2O99A 3IS2B 3IS2A 1GSWA 3LIBA 4DJ2A 1V9YA 2EA9A 3GECA 2WKRA 3LR0A 1TS0A 1YAXA 4GCZA 1ODVA 5HWTA 1H3QA 1LT0A 4NXFA 3CI6A 2QKPA 1F98A 2VZWA 4WLAA 2O9CA 1W63Q 4CLCE 4YOFA 3RFBA 3EGXC 3D72A 4DN0A 4EXOA 4EUVA 3NOUC 1LSWA 4Q0JA 1OT9A 1OTAA 4HOIA 3A0SA 2V9AA 2EWVA 5AJGA 4HHDA 5F6AA 2HJEA 1XFNA 4JGPA 3PBQA 3T4SA 1OTDA 5IT5A 3EQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7S A;  3LID A;  4I3I A;  3FG8 A;  4R38 A;  1OTI A;  4R70 A;  3KX0 X;  4RQ9 A;  4I3J A;  3UE6 A;  5HZH A;  4HIA A;  5HDC A;  4BBT A;  1OJ5 A;  4WN5 A;  1GSX A;  3IBR A;  1GSV A;  1N9O A;  3K3D A;  1DRM A;  4HP9 A;  4F3L A;  1OJG A;  4NXE A;  4LRZ E;  5I5L A;  3CAX A;  4EEP A;  4EER A;  1S66 L;  2W0N A;  4HP4 A;  2GJ3 A;  3CWF A;  1G28 A;  3UMD A;  1TS6 A;  2B02 A;  3P7N A;  1MZU A;  1OTB A;  3FC7 A;  4MN6 A;  2PD8 A;  1EW0 A;  5G4Z A;  3HJK A;  4I5S A;  2L0W A;  4L9E A;  4F3L B;  1KOU A;  4R3A A;  5DJT A;  1JNU A;  2VV6 A;  4HH3 A;  4HNB A;  1VB6 A;  1XJ4 A;  1DP9 A;  3MFX A;  4HY8 A;  2PYP A;  2BAS A;  4KUO A;  3A0V A;  5J4E A;  3GDI A;  2VEA A;  2JN7 A;  1DP6 A;  3NOP C;  4I38 A;  5AVF A;  3MQQ A;  2OWH A;  1T1A A;  3RH8 B;  1NWZ A;  4GHI B;  4GHI A;  3RTY A;  2QWS A;  4LLO B;  2D02 A;  2H28 A;  3UB9 A;  1F9I A;  3LIF A;  4WUJ A;  1TS8 A;  2PYR A;  3LI8 A;  1T1B A;  5F68 A;  4KQD A;  1WA9 A;  5HDD A;  1N9N A;  1P97 A;  3LYX A;  2ZBB A;  2OWJ A;  4I3A A;  4HJ4 A;  1X0O A;  3MQO A;  5G4Y A;  4XT2 B;  4XT2 A;  5IS1 A;  3F1N A;  3F1N B;  3NHQ A;  5DKL A;  2WKQ A;  2YKF A;  4KUK A;  3ICY A;  5DJU A;  1T1C A;  2V0U A;  2Z6C A;  4YWZ A;  4L9F A;  5HD5 A;  5TBM B;  4LPZ A;  5TBM A;  1N9L A;  2INW A;  1OT6 A;  4JGR A;  4H6J A;  4H6J B;  2L1M A;  4HH2 A;  3ULF A;  5HDS A;  2D01 A;  3OLO A;  2Z6D A;  5KIZ A;  1UWP X;  5J7E A;  4HI4 A;  3H9W A;  3EWK A;  3BY9 A;  4M4X A;  4EQ1 A;  4BBV A;  1UGU A;  2A24 A;  2A24 B;  2KX6 A;  2WKP A;  4MN5 A;  3VOL A;  4EEU A;  2I9V A;  3LUQ A;  2HV1 A;  3PYP A;  3VE4 A;  3UME A;  3K3C A;  5HWV A;  4L9G A;  4JGQ A;  2PD7 A;  1S4S A;  3LIA A;  3LI9 A;  3MR0 A;  3E4O A;  3NJA A;  4LRY C;  4PKY G;  2QHK A;  2V1B A;  4EES A;  4EW7 A;  1DP8 A;  5DKK A;  2CMN A;  3H7W A;  3H7W B;  3T50 A;  4I39 A;  1T18 A;  1D06 A;  2PHY A;  2ZOI A;  2OOL A;  4B9O A;  4BBU A;  3F1O B;  3F1O A;  1XJ2 A;  1P0Z A;  3UB8 A;  3A0R A;  3BWL A;  3UB6 A;  1Y28 A;  4HJ6 A;  1S1Y A;  4EET B;  4GS9 B;  4GS9 A;  4DJ3 A;  5A8B A;  3NOT C;  2J80 A;  3C8C A;  2VV7 A;  5HD3 A;  3LIE A;  1UWN X;  2L4R A;  4NXG A;  3IS2 A;  2R78 A;  1GSW A;  1XJ6 A;  3IS2 B;  1LSX A;  3CLO A;  2KDK A;  1V9Y A;  2EA9 A;  1OTE A;  2W27 A;  3GEC A;  2WKR A;  4GW9 A;  4PKY A;  5F5Y A;  3ZQ5 A;  1TS0 A;  3C2W A;  2VLG A;  1LSV A;  4GCZ A;  5HSQ A;  4LRX C;  1ODV A;  4HJ3 A;  4JGO A;  5HWT A;  2VV8 A;  1LT0 A;  4NXF A;  3MJQ A;  2PDR A;  4WF0 A;  1D7E A;  2QKP A;  3EEH A;  1S4R A;  3H82 B;  1F98 A;  1T19 A;  3H82 A;  3PHY A;  4WLA A;  3F1P B;  3F1P A;  4DJ2 A;  2P7J A;  1S67 L;  2V1A A;  5EFW A;  1TS7 A;  1LL8 A;  3D72 A;  3UB7 A;  3SW1 A;  4EXO A;  5J3W A;  2QJ5 A;  3G6O A;  1LSW A;  3NOU C;  1V9Z A;  5HWW A;  4R6L A;  1BYW A;  2QJ7 A;  2YKH A;  5AVE A;  2PR5 A;  1OT9 A;  3LIC A;  1OTA A;  4HOI A;  1S1Z A;  2ZOH A;  3A0S A;  4NXB A;  2V9A A;  3VE3 A;  4E04 A;  1XJ3 A;  4WL9 A;  4HHD A;  5F6A A;  1XFN A;  4K08 A;  3HJI A;  2PR6 A;  1XFQ A;  3LIB A;  2JHE A;  4JGP A;  5F69 A;  5IU1 A;  2M1C A;  1OTD A;  3B33 A;  3E4P A;  4HQA A;  2V0W A;  3E4Q A;  3BY8 A;  3MXQ A; 
#chains in the Genus database with same CATH topology
 2A2L A;  3UE6 A;  4IHQ A;  3FPV A;  4Y5F A;  2PU4 A;  2HDR A;  3WRT A;  4QU3 A;  1AXB A;  3UMD A;  3P7N A;  1SDN A;  4IVI A;  5HPI A;  4KZ8 A;  3SS3 A;  1I5Q A;  4HH3 A;  5FAS A;  4WMC A;  5JYO A;  3RJU A;  1FR6 A;  1DY6 A;  1KE0 A;  3V39 A;  4OOL A;  2W3G A;  4KUK A;  1K57 A;  1L0F A;  5EPH A;  1OME A;  3HLD A;  1N9L A;  5CHU A;  4LV0 A;  4HH2 A;  2XA7 M;  2ZC6 B;  2GX5 A;  3IF5 A;  5FQM A;  3QHY A;  4JBF A;  1BTL A;  1PWD A;  3IXH A;  4WYY A;  5TJJ A;  4GN2 A;  4L9G A;  3DTE A;  5FL3 A;  2M7U A;  2JKT M;  3CIT A;  5KMW A;  5D3O A;  3IQA A;  1NZO A;  3F1O B;  5CRF A;  2Q0O A;  4OLD A;  3EEA A;  2QYB A;  3SZT A;  2VGL S;  3S1Y A;  1GA9 A;  2XFT A;  4PKY A;  5AQ9 A;  3C2W A;  2XF3 A;  4Y0U A;  3UE3 A;  4KZ9 A;  2PDR A;  3EEH A;  3PHY A;  3HUN A;  4UA6 A;  4Y15 A;  1I2S A;  1ONG A;  2WGV A;  3VV4 A;  1ZTU A;  1V9Z A;  4BD1 A;  5HWW A;  3DWZ A;  1YSP A;  3LIC A;  4E04 A;  2IWD A;  2OLV A;  3ZNY A;  2ZMF A;  4PPR A;  1IOU A;  1YLT A;  1YLP A;  4O0P A;  2X71 A;  3ZG7 B;  3GRJ A;  4PAU A;  1HZO A;  2Y79 A;  4X25 A;  5E2G A;  5DVA A;  4KQO A;  5FQI A;  4HP9 A;  2W1T B;  2WZZ A;  1LI9 A;  3O87 A;  4LRZ E;  3E0Y A;  1FOF A;  4KEN B;  2ZC3 B;  5EVI C;  1KOU A;  3SH8 A;  3BFF A;  4OPR A;  4QHC A;  3C7V A;  1K0K A;  3RH8 B;  2JKR M;  3TE8 A;  5FAO A;  2E8I A;  4PM5 A;  4S2K A;  3T4O A;  4JXV A;  4DF6 A;  5FEG A;  1K56 D;  5EUA A;  1P97 A;  4BL2 A;  3UNW A;  3AGE A;  3ZCZ A;  4QJG A;  3P98 A;  5HAQ A;  2PRF A;  5GLC A;  2WKP A;  5EVE A;  4FH4 A;  5HWV A;  4RA7 A;  2XD1 A;  2A49 A;  5EVI B;  1ZC2 A;  2CC1 A;  4O7D A;  3BWL A;  4G3W A;  1XJ6 A;  1OTE A;  2G2W A;  3ITB A;  4CLC A;  3KYZ A;  1L2S A;  4S2M A;  3S7P A;  4WF0 A;  2HDU A;  1YT4 A;  2EX8 A;  2V1A A;  3UB7 A;  2VKS A;  3L9K A;  3VE3 A;  1S1Z A;  2WYX A;  1IYP A;  3BFE A;  5HAI A;  1GCE A;  2JBF A;  1IEM A;  4R38 A;  1SKO B;  4HIA A;  1G5U A;  3T4J A;  4L0L A;  3HLC A;  1ZHH B;  1K54 A;  3VSK A;  1MZU A;  4ZJ2 A;  3UPO A;  3CPT A;  1Y54 A;  3IF6 A;  3V5M A;  4LV3 A;  4F3L A;  3IX4 A;  2EX6 A;  1K57 C;  1VB6 A;  4KUO A;  5F82 A;  3GQZ A;  3A0V A;  5J4E A;  3G4P A;  4Q0I A;  5TGF A;  2Q9M A;  1ALQ A;  5E2F A;  1FR1 A;  3T4K A;  3UB9 A;  1LLB A;  5HAR A;  1TS8 A;  5FSR A;  3CZD A;  2RL3 A;  2OWJ A;  1X0O A;  1KDS A;  5DKL A;  3M2J A;  4WBG A;  3RXW A;  4KZ4 A;  4MMN A;  5E43 A;  4LPZ A;  4E3K A;  3ISG A;  5GHY A;  3LO7 A;  3ZFZ A;  2VGJ A;  4Y0T A;  2JC7 A;  3OCN A;  2ZM2 A;  4BMW A;  4KQQ A;  4ETX A;  1YLW A;  2Y2K A;  1GA0 A;  3PAG A;  2HZ5 A;  3GR2 A;  4DXB A;  3N8S A;  3T1X A;  4GW9 A;  4EQI A;  3NIA A;  3O3V A;  3FZC A;  5A90 A;  2Z2L B;  1D7E A;  1MKM A;  1S67 L;  2Y2M A;  3W2Z A;  5GHX A;  4CLC C;  4Y3I A;  2PR5 A;  5L8M A;  5FQJ A;  2JHE A;  2XK1 A;  3B33 A;  1ONH A;  3QP2 A;  2K7S A;  1OTI A;  1S6R A;  4UEY A;  3KYE A;  3KYQ A;  1OJ5 A;  4KG6 A;  2GDN A;  3K3D A;  3A3D A;  1TEM A;  1D1J A;  1L0D A;  3W8K A;  5FQK A;  2WKH A;  3B42 A;  2UWX A;  2AVX A;  4OPQ A;  1XXM A;  2J3T D;  3BQA A;  3GSG A;  1SHV A;  1JNU A;  4HY8 A;  4NEE D;  4I38 A;  4EBL A;  3OPL A;  4GJ4 A;  4FOF A;  4YIN A;  3IX8 A;  3T4Q A;  1SCW A;  1WA9 A;  1NLY A;  2WAD A;  1GHM A;  2Y2Q A;  4P0M A;  2WKQ A;  2V0U A;  1KVL A;  1CF0 A;  4G3K A;  4GOG A;  4BQM A;  1W8Y A;  5HAP A;  4H8R A;  5E2E A;  1RP5 A;  1QME A;  4G3V A;  3V67 A;  1NYM A;  4WMC D;  3BFD A;  3TW8 A;  4WZ4 A;  1J9M A;  3C30 A;  2QMI A;  1HTZ A;  3M2K A;  3QP5 A;  1YKD A;  5FAP A;  5EVL A;  3IS2 B;  4LGW A;  1FCO A;  3D4F A;  3NEC A;  1BSG A;  1HD8 A;  1TS0 A;  3MKF A;  2WGW A;  5A93 A;  5HWT A;  3DTK A;  4NXF A;  3ZG0 A;  1J3W A;  2O9C A;  4K0X A;  1K6R A;  3D72 A;  1ES2 A;  4EUV A;  4JLF A;  4B88 A;  1OTD A;  4S2N C;  3BM6 A;  2WAE A;  1ESI A;  3GTC A;  2ZL1 A;  3VSL A;  4KZ3 A;  4KG5 A;  4GD8 A;  4GDN A;  4GD6 A;  5IHV A;  5K5B A;  2C5W B;  1XJ4 A;  4HEF A;  3MFX A;  3PR6 A;  3GDI A;  1NJ4 A;  2H10 A;  3VOY A;  3LI8 A;  3LR3 A;  4PM8 A;  5EE8 A;  1E3U A;  2P08 A;  3WS4 A;  5EM0 A;  4X6T A;  2Q9N A;  4P85 A;  1PZO A;  2JKG A;  1Q2P A;  1IYO A;  4FD8 A;  4MDZ A;  3CJM A;  4H6J B;  3LFV A;  5AQA A;  3EOI A;  1MWS A;  2V2F F;  4EQ1 A;  1Z09 A;  5KSH A;  1MWR A;  2KX6 A;  1H0M A;  3O86 A;  4ZBE A;  4K0W A;  3MF0 A;  3E4O A;  2X01 A;  4I39 A;  4Y13 A;  4YNR A;  1XGI A;  1VM1 A;  1Y28 A;  5BOH A;  3C8C A;  3IXG A;  5HD3 A;  3TJZ C;  3LGO A;  1P9R A;  4KZA A;  3CLO A;  4UHU A;  5FDS A;  2WZX A;  2P9V B;  3G34 A;  3MBZ A;  4X1L A;  3IWO A;  1L0G A;  5CEC A;  1WYB A;  4PHT A;  4ZJ3 A;  1PFL A;  3BRM A;  3UDX A;  2J9P A;  3Q81 A;  3MS6 A;  3E4Q A;  5CX7 A;  4DMZ A;  5E2H A;  3HL9 A;  4OLG A;  2XR0 A;  1VQQ A;  4QB8 A;  4BJP A;  3G30 A;  1GHP A;  3ZVW A;  5I5L A;  4HP4 A;  4PM9 A;  1G28 A;  2B02 A;  2K2N A;  3I7J A;  1ES3 A;  2PD8 A;  3P09 A;  3E98 A;  4X68 A;  3VP1 A;  4BLM A;  4S2P A;  5GLD A;  3PAE A;  5CED A;  4AFI A;  4OP5 A;  4QD4 A;  2XQZ A;  1MKI A;  1F9I A;  4R23 A;  3HLW A;  2B18 A;  4JPM A;  1BLH A;  2W1R A;  5C5K A;  2DRW A;  1XX2 A;  2ZQA A;  5HD5 A;  1PWC A;  5GHZ A;  3ULF A;  3HCY A;  3OZH A;  2HP5 A;  2ZC4 B;  3C5A A;  4BBV A;  3JYI A;  3WS5 A;  1L3L A;  3PYP A;  2ZD8 A;  1Q2Q A;  1YSQ A;  5DKK A;  4LCM A;  3PBO A;  1ES4 A;  2O9A A;  4UAA A;  3HBR A;  1XJ2 A;  1E3U D;  3A0R A;  4EBN A;  3NDE A;  3KSI A;  4CLC B;  3ZQ5 A;  3IH9 A;  1U60 A;  2EWW A;  1EI5 A;  4PMA A;  1K38 A;  5L09 A;  3Q7Z A;  3F1P A;  4CQH A;  2J3W A;  2P7J A;  2XRN A;  1TS7 A;  3UY6 A;  3SW1 A;  5DF7 A;  3G6O A;  3UDF A;  2QJ7 A;  2ZQ8 A;  4NXB A;  2ZOH A;  3IHA A;  4FUW A;  2PR6 A;  4D60 A;  4P6Z S;  1H8Z A;  4Z1W A;  1BT5 A;  2FFF B;  3GV9 A;  3LCE A;  1ESU A;  4II7 A;  3LID A;  4NXG A;  3FG8 A;  3IXD A;  3T12 B;  3ZNT A;  1Z6F A;  3HUO A;  2V8C A;  3N4I A;  2Y55 A;  4CPK A;  3PBR A;  2ZM8 A;  1PI4 A;  1S66 L;  4IED A;  1H5X A;  3FC7 A;  2HDS A;  3FKV A;  3ITA A;  3IF6 B;  4F3L B;  3DTI A;  3ZVT A;  4GNU A;  2EX2 A;  3HLE A;  3KO6 A;  1NWZ A;  1JWV A;  2OV5 A;  3PXP A;  1KDW A;  1NRJ A;  1K4E A;  4ARZ B;  2Y4A A;  2VGL M;  5G4Y A;  1ACF A;  2VA0 A;  3NHQ A;  3TG9 A;  4U0T A;  5U47 A;  4ID4 A;  5DJU A;  5TBM B;  4Z9Q A;  1MXO A;  2P04 A;  3BFG A;  5L2F A;  1UGU A;  1CI8 A;  3N7W A;  3VE4 A;  4JGQ A;  2PD7 A;  5FI2 A;  3VP3 A;  1FSW A;  5CTN A;  1D06 A;  2G7U A;  2PHY A;  3D3O A;  3UB8 A;  5A8B A;  4DJ3 A;  1CEF A;  4D2O A;  4EES A;  2VV7 A;  2L4R A;  1LSX A;  4NET A;  4R4S A;  1NLZ A;  1W8Q A;  4LRX C;  2DMW A;  2GZA A;  4Y0O A;  1S4R A;  4ZDX A;  3MMH A;  3HVF A;  5EFW A;  3RXX A;  4RYE A;  3HUM A;  2XFS A;  4NG2 A;  1XJ3 A;  3HJI A;  5GLA A;  4DE0 A;  3ZYT A;  1HVB A;  4I3I A;  3IWI A;  4RQ9 A;  4MN7 A;  2IA2 A;  3JVV A;  4HBT A;  2E8J A;  3JPU A;  4GKU A;  4KG2 A;  3Q07 A;  1F2K A;  1H8Y A;  3CWF A;  1XKZ A;  2C6W B;  4S2N A;  4MN6 A;  3OPR A;  1K6S A;  2HP6 A;  3A3J A;  3CUE A;  1L0E A;  4ETZ A;  2EXA A;  2Y91 A;  4E3J A;  4P6Z M;  1SDE A;  4WUJ A;  2ZJ9 A;  2HP9 A;  3VP4 A;  4O8G A;  1NRF A;  3O88 A;  3BLS A;  3UO9 A;  3MZE A;  2D01 A;  1YLZ A;  3O5Y A;  2VX8 A;  4BD0 A;  3LI9 A;  3MR0 A;  5KSC A;  3WRZ A;  2QHK A;  3K2N A;  1YLJ A;  3H7W A;  5TR7 A;  4KQR A;  1T18 A;  1CEG A;  3WS0 A;  1GHI A;  1PI5 A;  3QNB A;  3NOT C;  5FAQ A;  3IS2 A;  1GSW A;  2V20 A;  1V9Y A;  3GEC A;  3N8R A;  3LR0 A;  1K54 C;  1SZV A;  1YAX A;  2WGW B;  1ODV A;  4Y17 A;  5EEC A;  1CK3 A;  1YM1 A;  4YOF A;  3EGX C;  2DNS A;  4MBK A;  1CI9 A;  3NOU C;  1ES5 A;  4HOI A;  4DRT A;  3UPP A;  3OPP A;  4HHD A;  5F6A A;  1DJA A;  3G2Z A;  4RVA A;  3EQV A;  3V50 A;  2QPN A;  1TDL A;  1YLY A;  3WS2 A;  5CEB A;  2ZL1 B;  3IBR A;  1OPX A;  2Y2I A;  3CAX A;  5DTS A;  4EEP A;  1PNE A;  3DTM A;  1G6O A;  5FI7 A;  2GJ3 A;  1ZKJ A;  3T1S A;  1NZU A;  3ZHH A;  4B4Z A;  4L9E A;  5DFY A;  4R3A A;  5F83 A;  3S22 A;  1T1B A;  1Y4O A;  4X69 A;  2WKE A;  3SH7 A;  2Y2P A;  3ZDJ A;  1IKI A;  2XLN A;  3W4O A;  4H6J A;  1PW1 A;  3IH8 A;  5HDS A;  4MN5 A;  4EEU A;  1H8M A;  4WZ5 C;  3Q1F A;  4JKT A;  4KZ5 A;  2VGK A;  2V1Z A;  4JXG A;  5MC7 A;  4DDS A;  2Y2H A;  1STZ A;  5HL6 A;  4HJ6 A;  1K56 A;  3VP0 A;  5KZH A;  4WEL A;  2I72 A;  1ZG6 A;  1BUE A;  1RGZ A;  5F5Y A;  2P9V A;  4FCF A;  4N1X A;  3G31 A;  4PM6 A;  1BLP A;  1LSV A;  4RX2 A;  1ERM A;  4HJ3 A;  4R3B A;  1VET A;  3H82 B;  4ME4 A;  3IT9 A;  2HDQ A;  4IVK A;  1LL8 A;  3W4P A;  2Y2O A;  3E2L A;  3AGF A;  1BYW A;  2JKT I;  1MWU A;  2J7V A;  1JWP A;  5F69 A;  1MBL A;  2M1C A;  4NKP A;  3T4T A;  2ZMV A;  3MXS A;  3BY8 A;  3MXQ A;  4R70 A;  2W3H A;  4QY5 A;  3CUE C;  4O01 A;  3N8L A;  2FH5 A;  3ZG5 A;  1GSV A;  1DRM A;  3UB5 P;  4N9L A;  2A3U A;  3FYZ A;  2XGN A;  4WEK A;  3Q7V A;  1M6K A;  5F1G A;  1FIK A;  2O9B A;  1W63 M;  2XEP A;  4C3Q A;  2RCX A;  2BAS A;  3NOP C;  4FH2 A;  2X02 A;  5M19 A;  2PYR A;  4Y2F A;  1XPB A;  3NI9 A;  4XT2 A;  1XA1 A;  3BW6 A;  3EGD C;  4XUX A;  3D9Y A;  2ZQ7 A;  1OT6 A;  5TFQ A;  2DCF A;  2A24 A;  2HV1 A;  2UV0 E;  4R0Q A;  3NY4 A;  4OON A;  2IWC A;  3HLB A;  3PBS A;  1S1Y A;  4EET B;  2W27 A;  3NUL A;  3C4P A;  4R4R A;  3UPN A;  2EXB A;  3SS4 A;  2ACG A;  3HLG A;  3F1P B;  5FQQ A;  1RCJ A;  2EFU A;  4EWF A;  5FA7 A;  1M40 A;  2Y2N A;  3SH9 A;  3DW0 A;  2HF6 A;  2YKH A;  1ERO A;  5DTK A;  2FZ0 A;  3BJN A;  4MBF A;  4K08 A;  3SOI A;  3PBN A;  1MWT A;  3S7N A;  1KGF A;  4K91 A;  3KX0 X;  4U0X A;  5FDH A;  2JE5 A;  4S2L A;  5CGX A;  1IKG A;  5DFX A;  4S2O A;  2J3T C;  5CGW A;  4ZTK A;  3M6H A;  2QZ6 A;  5AQB A;  4C75 A;  4KZ6 A;  5FI6 A;  1TD5 A;  2PU2 A;  1DP9 A;  2BG1 A;  2PYP A;  4ZRR A;  2OWH A;  4GB7 A;  2HGV A;  4OVD A;  5DF8 A;  4ARZ A;  4RX3 A;  4I3A A;  4WZ5 A;  1DJC A;  2WGI A;  4OQH A;  2Y2J A;  3F1N B;  3HRE A;  2EFX A;  2PBY A;  1MPL A;  4CLC D;  5JYP A;  3QP8 A;  1E25 A;  1IYQ A;  5TBM A;  3UN7 A;  3MXR A;  2XH9 A;  4OOM A;  3OLO A;  3C7U A;  2LB5 A;  4N9K A;  4BWI A;  3BQ8 A;  3FPW A;  4PM7 A;  3UME A;  5HZH A;  2V1B A;  3T50 A;  2CMN A;  5HFO A;  1SKF A;  1E4D A;  4E3L A;  2ZQ9 A;  1MC0 A;  1C3B A;  3R7W B;  4P6B A;  1LL9 A;  3UB6 A;  4MNR A;  3ZG9 B;  2JCH A;  3MQ0 A;  3VP2 A;  1NYY A;  2FFY A;  2OSU A;  5IU1 A;  2KDK A;  1PYY A;  4X53 A;  3G35 A;  2VLG A;  4E3O A;  5HSQ A;  2XD5 A;  3LR5 A;  3OCL A;  3BFC A;  2K31 A;  5M18 A;  5CHJ A;  3TSG A;  4MCW A;  5AVE A;  3ZGA B;  4DE2 A;  4Q8I A;  4GZB A;  3WWX A;  1BZA A;  5CGS A;  4HBU A;  4GDB A;  1K4F A;  3U2A A;  3HLF A;  1KGG A;  2XDM A;  2WUQ A;  4UQI S;  4BBT A;  2VJW A;  5HW3 A;  1LL5 A;  1K55 C;  4EER A;  3IBJ A;  4DE1 A;  1OTB A;  1XA7 A;  4IBR A;  3MFD A;  4JF6 A;  3OC2 A;  4N1H A;  5EOE A;  1JTD A;  3MQQ A;  4GHI A;  4EBP A;  1W5D A;  1ZG4 A;  1WE4 A;  3LYX A;  2V8F A;  4U3T A;  2HPB A;  5FAT A;  1VEU A;  1T1C A;  2ZQD A;  5EM1 A;  3P01 A;  4XUZ A;  4R3J A;  4UA7 A;  4P87 A;  3PBT A;  4M4X A;  4FSF A;  3LUQ A;  3B47 A;  3K3C A;  4MEZ A;  3UDI A;  3T4L A;  4EW7 A;  3H7W B;  1EWZ A;  5FEF A;  4B9O A;  5EV0 A;  4GS9 A;  4OQG A;  1FIL A;  4DJ2 A;  4OP8 A;  2EA9 A;  1FQG A;  4UA9 A;  5CHM A;  3BLM A;  3UE0 A;  3GVB A;  5M1A A;  3V3R A;  3CI6 A;  2WAF A;  4F94 A;  4WLA A;  2PAV P;  4JXS A;  4EXO A;  3BYD A;  1LSW A;  2EWV A;  5AJG A;  2HJE A;  1FCN A;  4JGP A;  3PBQ A;  2ZMA A;  4M3K A;  1LHY A;  2XRO A;  4I3J A;  3IWQ A;  1BLC A;  4EU0 A;  5HDC A;  4JF4 A;  3A3E A;  2BTF P;  1OJG A;  2ZC5 B;  1DJB A;  1KE3 A;  3SS5 A;  3KSH A;  4OQI A;  1NXY A;  2HJ9 C;  3DBA A;  5G4Z A;  2IWB A;  2VV6 A;  4HNB A;  2VK3 A;  5HX9 A;  2Y2L A;  3OOV A;  2G2U A;  1JTG A;  1T1A A;  3BEC A;  3RTY A;  4OH0 A;  2H28 A;  3CMZ A;  3LIF A;  1N9N A;  2BLS A;  4HJ4 A;  3MQO A;  3MZD A;  3S4X A;  3IHB A;  2EX9 A;  2YKF A;  3G32 A;  4QY6 A;  4IUH A;  4L9F A;  3LR4 A;  2L1M A;  1UWP X;  1KGE A;  5J7E A;  4ESP A;  3M6B A;  2I9V A;  3QP1 A;  1S4S A;  3LIA A;  3NJA A;  3NDG A;  2XSS A;  2PT7 A;  3IF6 C;  2R9W A;  1VHM A;  2ZOI A;  3PTE A;  5CER A;  4BBU A;  2Y59 A;  3F1O A;  1TF1 A;  1P0Z A;  3BEB A;  3LY4 A;  1CQA A;  5GLB A;  4OKP A;  3LIE A;  1UWN X;  5F68 A;  4EUZ A;  2J8Y A;  3OPH A;  4LV2 A;  5I94 A;  2GNX A;  2H0T A;  4E6W A;  4KZB A;  2VV8 A;  3DAV A;  1VET B;  4IUK A;  3H82 A;  4DKI A;  1T19 A;  2ZLY A;  4EV4 A;  4N92 A;  5EOO A;  1O7E A;  4KZ7 A;  5J8X A;  1BUL A;  4R6L A;  1QMF A;  2LB9 A;  1XFQ A;  5HPF A;  4HQA A;  4HES A;  1GSX A;  1N9O A;  4UQI M;  2W1T A;  3IX3 A;  3KSF A;  4E6X A;  3C4O A;  4NXE A;  1XP4 A;  3TRC A;  1O07 A;  1TS6 A;  3Q7V B;  3G2Y A;  3HJK A;  4I5S A;  2L0W A;  4IBX A;  3AGD A;  4JXW A;  4OQ0 A;  1DP6 A;  2D02 A;  2OLU A;  2ZC7 A;  1IFQ A;  1FSY A;  3OBF A;  3FV7 A;  4XT2 B;  2XA7 S;  4X1M A;  4C6Y A;  2H5S A;  1TDG A;  3CG5 A;  1G6A A;  3FWL A;  4HI4 A;  4MLL A;  2A24 B;  2Y2G A;  3S7O A;  3VOL A;  2KOI A;  4Q0H A;  5EVI A;  3VFF A;  1RGY A;  4B4X A;  1IYS A;  1YPR A;  3NC8 A;  1FCM A;  5G18 A;  4LV1 A;  2KLI A;  5FQ9 A;  5AQ7 A;  1LI0 A;  4IJG A;  4YFM A;  3QP6 A;  1W7F A;  4JGO A;  4E3I A;  3R4K A;  3MJQ A;  2J9O A;  4OPZ A;  2WKI A;  3DWK A;  4DE3 A;  5J3W A;  1KVM A;  4B93 A;  1BLS A;  3QNC A;  1CJF A;  3T1R A;  3KSG A;  1YMS A;  1JWZ A;  4WL9 A;  4Y7P A;  3LEQ A;  1SKO A;  4BL3 A;  4WN5 A;  1A0K A;  4WM9 A;  5DTT A;  4JF5 A;  3E2K A;  2W0N A;  4S2J A;  4R1G A;  3UE1 A;  3CPT B;  3IXB A;  3V3S A;  2M7V A;  2QWS A;  3LEZ A;  4LLO B;  4WEJ A;  4GLQ A;  3S7Q A;  4NK3 A;  4OOY A;  1P9W A;  5L07 A;  2O0Y A;  4KQD A;  5HDD A;  2JKR I;  2ZBB A;  3FKW A;  2NUT C;  5GL9 A;  1N4O A;  3F1N A;  1I2W A;  1YQS A;  3TOI A;  4X55 A;  4QWO A;  5LBR A;  3BY9 A;  1S0W A;  3W4Q A;  4LRY C;  1AWI A;  2OOL A;  3QP4 A;  1PWG A;  4ZAM A;  3R7W A;  3VMA A;  5A91 A;  2J80 A;  2Z2M B;  1TVF A;  2R78 A;  4FTX A;  4DXC A;  3WS1 A;  3JVU A;  5F1F A;  4S2I A;  3EQU A;  2OAQ 1;  2Y8H A;  1WYC A;  3Q82 A;  2ZM0 A;  2W3F A;  1G68 A;  5EVI D;  2QJ5 A;  1PIO A;  3CHW P;  3VOZ A;  2B95 A;  2W3D A;  1NY0 A;  3ZG8 B;  3E4P A;  4LFU A;  1F5M A;  1PRQ A;  4E3M A;  2NUP C;  3NCK A;  3T1Q B;  4A5R A;  3VFH A;  1ERQ A;  1KE4 A;  2H0Y A;  2W3E A;  1MY8 A;  3A3I A;  3C38 A;  2OAP 1;  5CXW A;  4BEN A;  3NBL A;  2PBD P;  1EW0 A;  5DJT A;  3GMW A;  5CTM A;  5IS1 A;  2VEA A;  2JN7 A;  3LY3 A;  4CJN A;  5AVF A;  4GHI B;  3L7H A;  3N6I A;  5A92 A;  1PW8 A;  4LEN A;  2P74 A;  4MBH A;  1HLU P;  1K25 A;  3ICY A;  1VEU B;  2Z6C A;  4YWZ A;  1W79 A;  2INW A;  4JGR A;  2Z6D A;  5KIZ A;  5DF9 A;  2R9X A;  3H9W A;  3EWK A;  4QPR A;  4ZJ1 A;  4DDY A;  2MJ6 A;  1PZP A;  2WK0 A;  4PKY G;  1DP8 A;  2JKF A;  3MZF A;  3B3X A;  4E3N A;  5L10 A;  4LCL A;  4OPY A;  3MSH A;  1N9B A;  4GS9 B;  1JVJ A;  2O99 A;  3LIB A;  2WKR A;  4XXR A;  1IEL A;  4GCZ A;  5HL1 A;  1H3Q A;  1LT0 A;  3A3F A;  2QKP A;  1F98 A;  2VZW A;  1W63 Q;  4CLC E;  2B5R A;  2ZQC A;  3MKE A;  3RFB A;  4DN0 A;  4Q0J A;  1K55 A;  1XGJ A;  1OT9 A;  4X56 A;  1OTA A;  3A0S A;  2V9A A;  1YMX A;  1XFN A;  3U4L P;  3T4S A;  5IT5 A;  2V0W A; 
#chains in the Genus database with same CATH homology
 2A2L A;  3UE6 A;  2XRO A;  4I3J A;  4IHQ A;  3FPV A;  4EU0 A;  4Y5F A;  5HDC A;  3IBR A;  1OPX A;  1OJG A;  3CAX A;  4EEP A;  3KSH A;  1G6O A;  2GJ3 A;  3UMD A;  3P7N A;  2HJ9 C;  3DBA A;  5G4Z A;  5HPI A;  4L9E A;  5DFY A;  4R3A A;  5K5B A;  2VV6 A;  4HH3 A;  4HNB A;  1XJ4 A;  3MFX A;  3PR6 A;  3OOV A;  3GDI A;  1T1A A;  3RTY A;  2H28 A;  3LIF A;  3LI8 A;  1T1B A;  3LR3 A;  1N9N A;  2P08 A;  4HJ4 A;  3MQO A;  4OOL A;  2W3G A;  2YKF A;  4KUK A;  4IUH A;  4L9F A;  4MDZ A;  1N9L A;  3LR4 A;  4H6J A;  3LFV A;  2L1M A;  2XA7 M;  4H6J B;  4HH2 A;  3EOI A;  5HDS A;  2GX5 A;  1UWP X;  5J7E A;  5KSH A;  4EQ1 A;  2KX6 A;  4MN5 A;  4EEU A;  1H8M A;  5TJJ A;  2I9V A;  4L9G A;  1S4S A;  3LIA A;  3MF0 A;  3NJA A;  3E4O A;  5FL3 A;  2XSS A;  2PT7 A;  2M7U A;  2JKT M;  3CIT A;  4I39 A;  1VHM A;  2ZOI A;  4YNR A;  4BBU A;  5MC7 A;  3F1O B;  1TF1 A;  3F1O A;  1P0Z A;  1STZ A;  3EEA A;  5HL6 A;  1Y28 A;  4HJ6 A;  2QYB A;  4WEL A;  3C8C A;  5HD3 A;  3LIE A;  1UWN X;  3TJZ C;  5F68 A;  1P9R A;  2VGL S;  3CLO A;  5F5Y A;  4PKY A;  2GNX A;  3C2W A;  1LSV A;  3UE3 A;  4HJ3 A;  2VV8 A;  2PDR A;  3EEH A;  4IUK A;  3PHY A;  3H82 B;  3H82 A;  1T19 A;  4ME4 A;  1LL8 A;  3VV4 A;  1ZTU A;  1V9Z A;  4PHT A;  5HWW A;  4R6L A;  1BYW A;  1YSP A;  2JKT I;  3LIC A;  4E04 A;  2LB9 A;  2ZMF A;  1XFQ A;  1IOU A;  5F69 A;  5HPF A;  2M1C A;  4HQA A;  4NKP A;  3T4T A;  2ZMV A;  3E4Q A;  5CX7 A;  4O0P A;  3BY8 A;  3MXQ A;  4DMZ A;  4PAU A;  4R70 A;  2Y79 A;  2W3H A;  3CUE C;  4O01 A;  4KQO A;  2FH5 A;  1GSX A;  4BJP A;  1GSV A;  1N9O A;  4HP9 A;  1DRM A;  4UQI M;  2W1T B;  2W1T A;  3KSF A;  4NXE A;  4LRZ E;  5I5L A;  3E0Y A;  4HP4 A;  3TRC A;  1G28 A;  4WEK A;  1TS6 A;  2B02 A;  2K2N A;  2PD8 A;  2O9B A;  3E98 A;  1W63 M;  3HJK A;  4I5S A;  2L0W A;  1KOU A;  4AFI A;  2BAS A;  1DP6 A;  3NOP C;  3RH8 B;  2JKR M;  3TE8 A;  2D02 A;  1F9I A;  1IFQ A;  2PYR A;  2B18 A;  3T4O A;  4Y2F A;  3OBF A;  1P97 A;  2W1R A;  4XT2 B;  4XT2 A;  2XA7 S;  5C5K A;  3BW6 A;  3EGD C;  5HD5 A;  1OT6 A;  3ULF A;  3HCY A;  4HI4 A;  4BBV A;  2A24 A;  2A24 B;  2WKP A;  3S7O A;  3VOL A;  2HV1 A;  3PYP A;  5HWV A;  2KOI A;  1YSQ A;  4Q0H A;  5DKK A;  3PBO A;  2O9A A;  1XJ2 A;  3A0R A;  3BWL A;  3PBS A;  1S1Y A;  4EET B;  4G3W A;  2KLI A;  3KSI A;  1XJ6 A;  2W27 A;  1OTE A;  4IJG A;  4CLC B;  4CLC A;  3ZQ5 A;  3KYZ A;  2EWW A;  4JGO A;  3R4K A;  3S7P A;  3MJQ A;  4WF0 A;  3F1P B;  3F1P A;  4CQH A;  2J3W A;  2P7J A;  2XRN A;  2V1A A;  1TS7 A;  3UB7 A;  3SW1 A;  5J3W A;  4B93 A;  3G6O A;  2VKS A;  2HF6 A;  2QJ7 A;  2YKH A;  3VE3 A;  3KSG A;  1S1Z A;  2ZOH A;  4NXB A;  2FZ0 A;  3BJN A;  4WL9 A;  4K08 A;  2PR6 A;  4P6Z S;  3PBN A;  4Z1W A;  3S7N A;  4II7 A;  4NXG A;  3LID A;  3FG8 A;  4R38 A;  3KX0 X;  4HIA A;  4WN5 A;  3T4J A;  4L0L A;  5DFX A;  3PBR A;  1ZHH B;  2J3T C;  1S66 L;  2W0N A;  1MZU A;  3FC7 A;  4F3L B;  4F3L A;  1TD5 A;  1VB6 A;  1DP9 A;  4KUO A;  2PYP A;  3A0V A;  5J4E A;  4ZRR A;  3KO6 A;  4Q0I A;  2OWH A;  1NWZ A;  2HGV A;  2M7V A;  2QWS A;  4LLO B;  4WEJ A;  3T4K A;  3UB9 A;  4GLQ A;  3PXP A;  3S7Q A;  1P9W A;  1TS8 A;  1NRJ A;  4ARZ A;  2O0Y A;  4ARZ B;  4KQD A;  5HDD A;  2JKR I;  2ZBB A;  2OWJ A;  4I3A A;  2VGL M;  1X0O A;  2NUT C;  5G4Y A;  2VA0 A;  3F1N A;  3F1N B;  3NHQ A;  5DKL A;  4CLC D;  5DJU A;  4MMN A;  5TBM B;  4LPZ A;  5TBM A;  2P04 A;  4OOM A;  3OLO A;  2LB5 A;  5LBR A;  3BY9 A;  1UGU A;  4BWI A;  3BQ8 A;  3FPW A;  3OCN A;  3VE4 A;  3UME A;  5HZH A;  4BMW A;  4JGQ A;  2PD7 A;  4LRY C;  2V1B A;  4ETX A;  3T50 A;  2CMN A;  1D06 A;  2G7U A;  2PHY A;  3D3O A;  2OOL A;  1MC0 A;  3R7W B;  3R7W A;  3UB8 A;  3UB6 A;  5A8B A;  4DJ3 A;  3MQ0 A;  2J80 A;  4EES A;  2VV7 A;  2L4R A;  5IU1 A;  2R78 A;  1LSX A;  2KDK A;  1NLZ A;  4GW9 A;  2VLG A;  5HSQ A;  3JVU A;  4LRX C;  2DMW A;  3LR5 A;  3EQU A;  3OCL A;  2GZA A;  2OAQ 1;  2K31 A;  1D7E A;  1MKM A;  1S4R A;  2Y8H A;  3MMH A;  1S67 L;  5EFW A;  2W3F A;  3W2Z A;  2QJ5 A;  4MCW A;  4CLC C;  5AVE A;  4Y3I A;  2PR5 A;  2W3D A;  2V0W A;  1XJ3 A;  3HJI A;  5L8M A;  2JHE A;  3ZYT A;  3E4P A;  3B33 A;  1F5M A;  2K7S A;  3U2A A;  4I3I A;  1OTI A;  4UEY A;  4RQ9 A;  4MN7 A;  2IA2 A;  2NUP C;  3JVV A;  4UQI S;  4BBT A;  3KYQ A;  1OJ5 A;  2VJW A;  3K3D A;  2W3E A;  4EER A;  3B42 A;  3IBJ A;  3C38 A;  2OAP 1;  3CWF A;  1OTB A;  4MN6 A;  2J3T D;  1EW0 A;  3BQA A;  3OC2 A;  3CUE A;  5DJT A;  1JNU A;  4HY8 A;  4NEE D;  4ETZ A;  5IS1 A;  4I38 A;  2VEA A;  2JN7 A;  5AVF A;  3MQQ A;  4P6Z M;  4GHI B;  4GHI A;  4GJ4 A;  4FOF A;  4WUJ A;  3T4Q A;  1WA9 A;  1NLY A;  3LYX A;  4O8G A;  2WKQ A;  3ICY A;  1T1C A;  2V0U A;  2Z6C A;  4YWZ A;  3P01 A;  2INW A;  4G3K A;  4JGR A;  2D01 A;  2Z6D A;  5KIZ A;  5DF9 A;  3H9W A;  3EWK A;  3O5Y A;  3PBT A;  4M4X A;  2VX8 A;  4QPR A;  4FSF A;  3LUQ A;  3B47 A;  2MJ6 A;  3K3C A;  4G3V A;  3MR0 A;  3LI9 A;  3V67 A;  4PKY G;  3T4L A;  3TW8 A;  2QHK A;  3K2N A;  4EW7 A;  1DP8 A;  3H7W A;  3H7W B;  1T18 A;  3C30 A;  4B9O A;  4GS9 B;  4GS9 A;  3NOT C;  1YKD A;  2O99 A;  3IS2 B;  3IS2 A;  1GSW A;  3LIB A;  4DJ2 A;  1V9Y A;  2EA9 A;  3GEC A;  2WKR A;  3LR0 A;  1TS0 A;  1YAX A;  4GCZ A;  1ODV A;  5HWT A;  1H3Q A;  1LT0 A;  4NXF A;  3CI6 A;  2QKP A;  1F98 A;  2VZW A;  4WLA A;  2O9C A;  1W63 Q;  4CLC E;  4YOF A;  3RFB A;  3EGX C;  3D72 A;  4DN0 A;  4EXO A;  4EUV A;  3NOU C;  1LSW A;  4Q0J A;  1OT9 A;  1OTA A;  4HOI A;  3A0S A;  2V9A A;  2EWV A;  5AJG A;  4HHD A;  5F6A A;  2HJE A;  1XFN A;  4JGP A;  3PBQ A;  3T4S A;  1OTD A;  5IT5 A;  3EQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...