1GSVA

Crystal structure of the p65 crystal form of photoactive yellow protein g47s mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
122
structure length
122
Chain Sequence
b'VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAESDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
molecule tags Photosynthesis
source organism Ectothiorhodospira halophila
publication title Engineering Photocycle Dynamics: Crystal Structures and Kinetics of Three Photoactive Yellow Protein Hinge-Bending Mutants
pubmed doi rcsb
total genus 34
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1gsvA00
3NHQA 1OJGA 3H82B 3UB8A 4HQAA 1P0ZA 3CWFA 4BBUA 5DKKA 4PKYG 1S4SA 1G28A 4GCZA 1F98A 5IS1A 3LUQA 3E4QA 4DJ3A 5HWVA 1NWZA 2A24B 3F1OB 2A24A 3F1OA 4GS9A 3UB6A 3LI8A 5DKLA 2OWJA 3MQQA 5HDDA 4B9OA 4DJ2A 2V0UA 3NOTC 5IU1A 5F6AA 1XJ6A 1GSWA 3F1PB 3NJAA 4H6JA 4NXFA 5J7EA 1GSVA 2PD8A 4R70A 2BASA 4K08A 5AVFA 3RTYA 3GDIA 1XFQA 1T1AA 2PHYA 4R6LA 5HSQA 3MFXA 5J4EA 1XJ2A 2OOLA 3ICYA 2VV8A 4GW9A 4XT2A 3GECA 2R78A 4KUOA 1Y28A 3MR0A 3UMDA 4M4XA 1S66L 5HWTA 2VV6A 4JGOA 2D02A 2QKPA 5EFWA 4WL9A 2B02A 1DRMA 1OTIA 3NOUC 4HJ4A 2WKPA 1N9LA 2QWSA 3A0SA 4HH3A 4HJ3A 4HNBA 4HP9A 4LLOB 4BBVA 4GHIA 3UE6A 5F69A 1S1ZA 3BY8A 3T50A 1LT0A 2EA9A 2L4RA 5DJTA 3VOLA 1OTAA 3LIFA 2PR5A 2WKQA 2PDRA 3LIBA 5F5YA 1WA9A 3HJKA 1EW0A 3A0RA 5HD3A 2V9AA 4EERA 3F1NB 2K7SA 2JN7A 3LI9A 3P7NA 1T19A 1DP9A 2WKRA 1S4RA 1S67L 2VV7A 4MN6A 3ZQ5A 4F3LB 5HWWA 2I9VA 4WF0A 3LIAA 3MJQA 1TS0A 4I38A 2L1MA 2J80A 1T1CA 2P7JA 1OTEA 1GSXA 1XJ4A 1T1BA 3BWLA 1LSXA 3LYXA 1MZUA 2GJ3A 4RQ9A 1UGUA 3CLOA 4WLAA 1UWPX 3FG8A 2ZBBA 4EEPA 1DP8A 4GHIB 1S1YA 4HHDA 4HJ6A 5HDCA 4KQDA 4JGRA 4MN5A 3HJIA 4LPZA 2JHEA 4HOIA 4R3AA 1N9OA 1ODVA 3UB7A 5KIZA 2VLGA 3MQOA 2PD7A 1XFNA 4HIAA 4HH2A 3CAXA 5G4YA 3E4OA 3EWKA 3C8CA 3LIEA 2KDKA 3VE4A 5HZHA 4NXBA 2VEAA 5TBMA 2V1BA 4WN5A 4WUJA 5HD5A 1OT6A 2V1AA 2W27A 4HY8A 3UB9A 1D7EA 3PHYA 4L9EA 2OWHA 4HP4A 4I5SA 2ZOIA 3H9WA 4I3JA 2KX6A 3F1PA 3EEHA 4I3IA 4L9FA 3RH8B 4L9GA 4EXOA 1KOUA 1LL8A 3MXQA 5J3WA 4R38A 4YWZA 4I39A 4EQ1A 1TS6A 3IS2A 4LRXC 1DP6A 2QJ5A 3NOPC 2QJ7A 4EW7A 4H6JB 2M1CA 2Z6DA 3UMEA 3A0VA 5AVEA 1OT9A 1OTBA 4E04A 4BBTA 1D06A 1TS8A 1BYWA 1LSVA 3E4PA 2W0NA 3C2WA 4GS9B 4PKYA 1LSWA 5G4ZA 1N9NA 2CMNA 3VE3A 1UWNX 2PR6A 1JNUA 2H28A 2YKHA 3LIDA 4EESA 4NXGA 2QHKA 2V0WA 3LICA 4EEUA 1X0OA 4F3LA 2YKFA 3IS2B 1TS7A 1OTDA 2ZOHA 3H7WB 5HDSA 3ULFA 4EETB 3IBRA 1VB6A 4LRZE 1OJ5A 3SW1A 3BY9A 3K3DA 4NXEA 2L0WA 4JGPA 2PYRA 4KUKA 5DJUA 3KX0X 3PYPA 1V9YA 3B33A 4XT2B 4JGQA 2HV1A 4I3AA 5F68A 3H7WA 1T18A 4LRYC 3G6OA 1P97A 2PYPA 4HI4A 3K3CA 2INWA 3FC7A 3H82A 2Z6CA 5I5LA 3D72A 5A8BA 1V9ZA 5TBMB 1F9IA 3F1NA 1XJ3A 2D01A 3OLOA
chains in the Genus database with same CATH superfamily
1FCNA 1NYYA 4X25A 3M2JA 1SKFA 5DTTA 4JF5A 2AVXA 5DKLA 3ZYTA 2OWJA 3MQQA 4DE1A 3IXDA 2PRFA 5CEBA 2EFUA 1SDEA 2J7VA 1YLTA 1TDGA 4UQIS 3S4XA 1XJ2A 3BJNA 3PAGA 1EROA 1FR1A 4K91A 4S2LA 5EFWA 1PNEA 2EWVA 3T50A 4OQHA 2PDRA 1MWUA 4MBHA 3Q7VB 1PW8A 2V9AA 5CXWA 2K7SA 1Y4OA 4E6XA 2FZ0A 1FSWA 3ZCZA 3JYIA 1ACFA 4HBTA 4EEPA 3B3XA 1M6KA 1PWDA 3EQUA 1LHYA 3FPVA 3G4PA 4YOFA 2ZL1A 4JBFA 3HL9A 4DF6A 3A3IA 2V1AA 3P09A 1MPLA 2ZLYA 2HF6A 3FKVA 4YWZA 4LRXC 4PAUA 1OT9A 5HPIA 1KE0A 4JF4A 3A3JA 3C7VA 4UEYA 3ITBA 1H0MA 3G31A 4DXBA 3RXWA 2W1RA 5DJUA 3UDXA 3OBFA 3ZDJA 5EPHA 3HLWA 2Y2OA 3G6OA 1XJ3A 3DWKA 5A93A 1P0ZA 5HL6A 2XROA 5GHXA 2Z2MB 5HWVA 5TJJA 5CGSA 3LO7A 5FASA 1EI5A 4KG5A 2WYXA 4H6JA 3KO6A 2ACGA 3PTEA 1FIKA 4HEFA 4EV4A 4CLCD 4X56A 4CLCB 4B93A 1TD5A 3B42A 2OLUA 4M4XA 1JWPA 2D02A 3ZG5A 2JKTM 3ZNYA 4R1GA 3NECA 1LT0A 3LIFA 4IUHA 1CI9A 1FQGA 1RGZA 4KZ5A 3PBTA 3HUNA 4R4RA 3V50A 5FQMA 2J80A 1XGJA 5EVLA 1KDSA 4OH0A 3DTIA 2H0TA 2VK3A 1A0KA 2E8JA 2XK1A 1I2WA 4WYYA 5HAPA 2ZQDA 4P6BA 2DRWA 2VEAA 1OT6A 1LL5A 4E3IA 1ONHA 1DP6A 3O88A 3Q7VA 5EE8A 1LSVA 2NUPC 5HFOA 5FAOA 2HDSA 4XXRA 3W4QA 2QHKA 1F2KA 2JKRM 2YKFA 1TS7A 4Y5FA 3V3RA 4X55A 1L0FA 5DFYA 4M3KA 4BL2A 3SW1A 5GLBA 4JLFA 3O87A 1L0GA 4O7DA 5I5LA 3LGOA 1SCWA 3VV4A 4Q0JA 3OOVA 2Y2GA 3E4QA 3UE1A 4P6ZS 5E2HA 3IH9A 3VFHA 2XA7M 5F6AA 1GSVA 3QHYA 3IX4A 3WWXA 2BASA 5FI6A 5HARA 3LCEA 4GDBA 1ONGA 1PWCA 1K54C 2VV8A 2NUTC 4FD8A 4KZ3A 3T1SA 1FR6A 4H8RA 3VFFA 1MC0A 5DJTA 4KG6A 3BQAA 1FCOA 5HD3A 5F5YA 1HVBA 2WK0A 1W5DA 2WKRA 5CRFA 4Y0TA 3W4PA 5EM0A 1GSXA 4II7A 1NLYA 4E3OA 4R0QA 3NULA 3UB7A 1K4FA 5L07A 1E3UD 3DTMA 4QWOA 2V1BA 2ZC7A 2LB9A 3HBRA 1TF1A 1MKIA 1K4EA 1GA0A 5GHYA 1JTDA 3FYZA 1ES4A 4QD4A 4OLGA 4ZJ1A 4BBTA 3FV7A 4B88A 1CEGA 3QP5A 5J8XA 5DF9A 2VGLM 3PBRA 3QP6A 3CITA 2WKIA 4WZ5A 2XGNA 3E2LA 3QNCA 2O0YA 2J9PA 5HAIA 3FC7A 4PM8A 4Q0IA 5M18A 3EEAA 1CK3A 5I94A 2GX5A 1K57C 1YQSA 4S2JA 5LBRA 4NK3A 3TSGA 4ME4A 3PBNA 4K0XA 4FOFA 2FFYA 2R78A 1RCJA 1YT4A 4QY5A 3BFDA 1CJFA 5E2EA 1ALQA 1SKOB 3T4TA 3Q1FA 3SS5A 3BY8A 3RXXA 3NIAA 3IF5A 5AJGA 1WA9A 1SZVA 1MWRA 5F1FA 5JYOA 4HBUA 4ZBEA 1H5XA 2HPBA 1LSXA 4P87A 1DP8A 4UHUA 2KLIA 2OAQ1 1YKDA 3N7WA 1XFNA 1ES3A 4Y15A 4UQIM 1VETB 4CPKA 4I3JA 2EX9A 5EVIB 3MKEA 3MXQA 2DNSA 3WS0A 3CI6A 3HCYA 4EBNA 1TDLA 2YKHA 4X6TA 4FH2A 4QPRA 1OTDA 1W8YA 2XFSA 1FCMA 1VQQA 2ZMAA 5DTSA 5CERA 1T18A 2VGJA 4Y3IA 3BECA 5A92A 1V9ZA 2B18A 2WZZA 3LI8A 1LI0A 5CHUA 2X02A 4N1XA 4KQRA 5G18A 3LUQA 1RP5A 3N8LA 3NOTC 4OP8A 5CHJA 4FCFA 2PD8A 3ZNTA 2BG1A 5CHMA 2DMWA 3Q81A 4GNUA 3VP3A 1PFLA 3NC8A 5HWTA 3C38A 2WKPA 1N9LA 4HH3A 4AFIA 2EA9A 4OPYA 2XQZA 4ETZA 3DTEA 1CI8A 1JVJA 2Y2MA 3QP4A 3SOIA 1T1BA 3DBAA 1NXYA 5GL9A 3LYXA 1CF0A 2Q9NA 3AGEA 4HHDA 2JHEA 3JVUA 5M19A 3NI9A 4KZ9A 4C6YA 1ERQA 5KSCA 2OWHA 3K2NA 2XA7S 2WZXA 5M1AA 1SKOA 4NG2A 3W4OA 2ZC3B 4P6ZM 1ZKJA 2Y8HA 4QB8A 1E4DA 5FEFA 5FDHA 4GB7A 2R9XA 4EETB 2QPNA 3IBRA 2O9AA 4BWIA 2H5SA 4KUKA 3S7PA 5FAPA 4DN0A 1LI9A 4OQ0A 5A8BA 2HDUA 4QU3A 4IBXA 1G28A 5EOOA 2HDQA 4DJ3A 1YLYA 2IA2A 3F1OA 3RJUA 4Y0OA 1PWGA 4EBLA 5HDDA 3WS1A 1GSWA 4JXSA 4MLLA 3C4OA 3IXBA 1KE4A 2Y2KA 1Q2PA 3KYQA 3BLSA 3RTYA 5E43A 3MFXA 3G2YA 2A2LA 4Y17A 3UMDA 3PR6A 3UDIA 3JPUA 4DE3A 1IYOA 1H8YA 1MWTA 3CHWP 4GHIA 2BLSA 4EQIA 2XH9A 1ERMA 4EERA 4OQGA 3EGDC 5HWWA 3ZFZA 5IHVA 3T4QA 4BD0A 3IXHA 1MZUA 2GJ3A 4WLAA 4BL3A 1ODVA 1HZOA 4RX3A 2QYBA 3WRTA 3UO9A 2ZQ7A 3IF6C 1PIOA 4L9GA 5EVID 5CGWA 2J3TC 4I39A 1DJCA 1QMEA 5CTMA 1PW1A 2M1CA 4E04A 5DFXA 1D06A 1BLHA 2CMNA 3BFFA 4EEUA 3HUOA 3MBZA 3V3SA 3M6BA 3FKWA 3ULFA 3B47A 5C5KA 1L0DA 3G34A 3L9KA 3VOYA 4GOGA 3WS5A 3LEZA 3UB5P 2OV5A 3H82A 4PHTA 4CLCA 5FSRA 4BBUA 3A3EA 3N6IA 2V2FF 3VMAA 5HX9A 1W63Q 3N4IA 2W1TA 1ES5A 1XXMA 3ZVTA 2VZWA 5JYPA 3CUEC 4K08A 5J4EA 2Q9MA 2VV6A 1LLBA 4MEZA 4HJ4A 3IWIA 4HJ3A 4WMCA 2JKFA 3A0SA 4NKPA 1K56D 4MBKA 2Y59A 4S2IA 5FI7A 2B5RA 4BLMA 4RA7A 3ZG7B 4WZ5C 2M7VA 4KZAA 3KYZA 3BLMA 3CLOA 1UWPX 3HJIA 4Q0HA 4OONA 5GLCA 5FI2A 2O9BA 3E4OA 5L2FA 5CX7A 1PYYA 2ZC5B 2W27A 1XA1A 2K31A 3TG9A 1D7EA 3U4LP 3RH8B 3R7WB 2MJ6A 4L9FA 1SHVA 2CC1A 3S7QA 1WYCA 3TOIA 3NOPC 3IX3A 1YPRA 5G4ZA 3C30A 2E8IA 4OKPA 5HDSA 1GA9A 1XA7A 5FQQA 3K3DA 4GD6A 4BENA 3FPWA 3GV9A 2WGWA 5FAQA 3MKFA 1NRJA 3T1QB 1VHMA 2J9OA 2ZC6B 1GHIA 4HQAA 3V39A 2V8CA 5IS1A 4DRTA 2A24A 1Z09A 3SH7A 3SZTA 3NJAA 2VGLS 4CQHA 1P9RA 2V8FA 1YLWA 3KSIA 3U2AA 2WADA 4EU0A 5TR7A 4EUZA 1W79A 2WGWB 1D1JA 4G3WA 2Y2IA 3SS4A 2ZL1B 3GVBA 2QKPA 4U3TA 4WL9A 3E98A 3D3OA 2IWBA 3S1YA 1K54A 4BBVA 3N8SA 4LLOB 4EBPA 2J8YA 4GLQA 2L4RA 3IBJA 4ARZB 1O7EA 3EOIA 3TRCA 1EWZA 1T19A 1DP9A 3OCNA 3LIAA 3MJQA 3Q7ZA 3BFCA 1T1CA 1GHMA 1H3QA 2R9WA 2Y2NA 3TE8A 4OLDA 2PD7A 3OPHA 1BSGA 4KZ8A 4A5RA 1IYQA 2P9VA 4NXBA 3UB9A 5HD5A 4HY8A 4I3IA 2UWXA 3EEHA 3SH8A 1KOUA 2ZQAA 1JTGA 2QJ7A 4UA6A 5DVAA 4OOMA 5EUAA 1TS8A 1UWNX 3WS2A 2V0WA 4MBFA 1X0OA 1VB6A 1OJ5A 2L0WA 2H0YA 4XT2B 4WELA 3CJMA 4I3AA 3A3DA 1E3UA 1IKIA 1S0WA 3ZG8B 3DWZA 3NHQA 1S4SA 4WBGA 2JE5A 3CPTB 5J7EA 1W8QA 3C4PA 4Z9QA 3UPNA 3HLEA 2FFFB 5AVFA 2O99A 3VP4A 3HLDA 5K5BA 2W3DA 1FOFA 3P01A 3NOUC 3UPOA 1G68A 4HP9A 4PM5A 1M40A 4MCWA 3ZVWA 3F1NB 2JN7A 4F3LB 1K57A 2P7JA 1NJ4A 4E3KA 3LR3A 4R3BA 3R4KA 4IBRA 1W7FA 1PRQA 2GZAA 4X1LA 1RGYA 4CLCC 5TGFA 5A90A 2ZOIA 3UB6A 4O0PA 2PT7A 4GZBA 3M6HA 5J3WA 3IS2A 3T12B 2K2NA 4S2NC 5AVEA 2XR0A 1GCEA 5EVIC 5D3OA 3E4PA 3VE4A 3C2WA 5FQIA 2PR6A 4E6WA 5CTNA 4EWFA 1XP4A 3IS2B 3H7WB 3IWQA 2C6WB 2P04A 2PAVP 2VX8A 1IYPA 4S2NA 4Y2FA 4E3MA 1K25A 3IQAA 4C3QA 3QP8A 5EV0A 4HI4A 2INWA 4KQOA 4JXWA 5DKKA 1XX2A 2FH5A 4FSFA 3UE0A 3CZDA 4LCMA 4XUZA 3MS6A 4S2MA 3IF6B 4FH4A 4OOYA 2Y91A 3OPLA 3LR4A 5HSQA 4OOLA 2X71A 1G6OA 3ZG9B 3PBSA 4N1HA 3VE3A 2VJWA 4Z1WA 4HNBA 2HJ9C 4ZTKA 2ZD8A 4ZDXA 1S1ZA 3IHBA 5AQ9A 2Y2JA 3BW6A 2PR5A 2C5WB 2WUQA 4X1MA 4UAAA 3LI9A 1N9BA 4B4ZA 2H10A 1S67L 2VV7A 1NYMA 2I9VA 1YLZA 3UN7A 4O01A 1CEFA 4RQ9A 5F83A 4MN5A 3FZCA 5HAQA 3A3FA 3CG5A 2ZQ8A 4P85A 1E25A 2XFTA 2KDKA 3Q82A 2XEPA 3KYEA 1SDNA 3CUEA 3ZHHA 2Z6DA 3G32A 1YSQA 4LFUA 2Q0OA 2WAEA 3GTCA 2JBFA 4PKYA 3VP2A 1N9NA 3RFBA 1JNUA 2H28A 4OPRA 3HLGA 2W3FA 1ZG6A 4X69A 2J3WA 3IXGA 1VETA 3S7NA 1YMSA 2WAFA 1S6RA 2PBDP 1P97A 3OZHA 5KSHA 5GHZA 1IOUA 4PMAA 1NZUA 4N9KA 2VKSA 1J9MA 1XPBA 4JF6A 2JKGA 2W3EA 4LV3A 4DJ2A 2V0UA 3T4JA 3VOZA 3F1PB 2HDRA 4JKTA 4R70A 1PI5A 3S7OA 2HGVA 1YAXA 4Q8IA 3WS4A 1BLSA 1HLUP 4IVIA 1YLPA 3ICYA 4GW9A 3GECA 1OMEA 4DDYA 1DRMA 1KE3A 2A49A 4D60A 3EGXC 3KSFA 1HD8A 2B95A 4KG2A 2JCHA 1FILA 3BFEA 3EQVA 3MZDA 3P7NA 3LY3A 2EX6A 3BM6A 1XJ4A 4DXCA 4ETXA 3DAVA 2XD1A 4GHIB 5HDCA 5HPFA 4EUVA 1N9OA 3MQOA 3GR2A 4FUWA 2HP9A 3QP1A 3BFGA 3PHYA 4HP4A 4GDNA 4I5SA 3H9WA 2KX6A 3F1PA 2Y4AA 4Y7PA 3M2KA 1Y54A 3MF0A 4K0WA 3V5MA 4EQ1A 4P0MA 4ZJ2A 1VEUA 3GSGA 4DKIA 3IH8A 4XUXA 4E3JA 1MKMA 1NRFA 4F3LA 4PM6A 1JWZA 4RYEA 1QMFA 2IWDA 3NDGA 4NXEA 2PYRA 5KZHA 3KX0X 4WM9A 1ZG4A 3Q07A 2QZ6A 3MZEA 2WGIA 3MFDA 3OPPA 1K6SA 1H8ZA 1P9WA 1L0EA 4UA7A 2JKTI 4GCZA 3HLCA 2KOIA 5AQAA 3BQ8A 2O9CA 4B9OA 1XJ6A 1O07A 4BJPA 3GDIA 1XFQA 4WZ4A 3NDEA 2OOLA 1G6AA 5FEGA 1S66L 5E2FA 2VA0A 1K38A 3S22A 4QJGA 1AWIA 2UV0E 5DTKA 5KMWA 4DMZA 4WEJA 3LIBA 4S2KA 4MN6A 1S4RA 1Q2QA 2RL3A 4I38A 4MN7A 2EXAA 1OTEA 4HESA 5DF7A 1S1YA 4OQIA 3ITAA 4KQDA 4LPZA 2Y2QA 2GDNA 2VLGA 3VSKA 5HZHA 4LGWA 5F1GA 5TBMA 4S2PA 4KENB 4EXOA 2EFXA 3ISGA 3QNBA 3BEBA 1OTBA 5FQJA 1BYWA 1LSWA 4G3VA 4NXGA 2ZMVA 4LRZE 5AQBA 5HL1A 4JGPA 4IVKA 1CQAA 4JGQA 3H7WA 4NETA 1TEMA 2EXBA 2W3GA 4OPZA 3K3CA 1ESUA 1K55A 5FQKA 1K0KA 4RVAA 2G2UA 2EX2A 2ZJ9A 3CWFA 4YNRA 3BRMA 4R3JA 4PKYG 1NWZA 3T4LA 2WKEA 2Y2HA 1NZOA 2G7UA 3ZGAB 4GN2A 3PBOA 1YM1A 1T1AA 3IWOA 5FL3A 1C3BA 3HVFA 3O3VA 4KUOA 1Y28A 2A3UA 4DDSA 3JVVA 4CLCE 2XD5A 3DW0A 2IWCA 2WKQA 1EW0A 4MDZA 4WF0A 4LCLA 2P74A 4ZRRA 1VM1A 1MY8A 3VP0A 4GJ4A 2ZQ9A 1U60A 4ZJ3A 2GNXA 4JPMA 3CAXA 3MXSA 4R4SA 3MSHA 3UNWA 3G30A 1TS6A 2QJ5A 4BQMA 2X01A 3DTKA 2XRNA 4Y13A 3IX8A 3UDFA 1BLCA 1IKGA 5HW3A 3G35A 2I72A 4MMNA 1PZPA 1L3LA 1J3WA 4O8GA 3ZG0A 2HV1A 3C7UA 4LRYC 2WKHA 4KZ7A 3T4KA 2PYPA 5TBMB 3BYDA 3GMWA 3F1NA 5MC7A 3MQ0A 4QHCA 2D01A 4KZ6A 3GQZA 2PBYA 1F98A 2Y55A 3F1OB 1KGEA 2J3TD 3HLFA 5IU1A 3IHAA 1ZHHB 1NLZA 1G5UA 5EVEA 2QMIA 4R6LA 2PHYA 5L8MA 3R7WA 3VP1A 2XSSA 3UE3A 2VGKA 4ESPA 4D2OA 4OPQA 3MR0A 4KZ4A 4ID4A 3LY4A 1XGIA 1KGGA 4WEKA 2M7UA 1HTZA 2RCXA 5FDSA 3TW8A 4U0TA 2JKRI 1TS0A 3FWLA 5CECA 4S2OA 1UGUA 3NBLA 3LR0A 3KSHA 3NCKA 5L10A 4UA9A 4JGRA 4E3NA 4LV0A 4MNRA 2Z2LB 5KIZA 4HIAA 4YFMA 4HH2A 4N9LA 3LIEA 3UY6A 1MXOA 1PZOA 2HZ5A 1NY0A 3SH9A 4L9EA 1LL8A 4R38A 3L7HA 3C5AA 1ESIA 4GS9B 3VSLA 2ZOHA 4WMCD 1WE4A 3TJZC 4X53A 3LEQA 1K56A 1BUEA 1V9YA 3B33A 2P9VB 1BULA 1IFQA 3HLBA 2Z6CA 5EOEA 3N8RA 1F9IA 3H82B 3UB8A 2ZM0A 3T1XA 2HP6A 4ARZA 1VEUB 3E2KA 2ZMFA 4GS9A 2BTFP 1ZC2A 1H8MA 3MZFA 4NEED 3MMHA 2G2WA 3IF6A 1BZAA 2V1ZA 1ZTUA 3OC2A 1OPXA 2HP5A 2V20A 2Y2LA 3CMZA 2W3HA 2XDMA 4U0XA 1IELA 5FATA 4XT2A 1DY6A 4LV1A 1BT5A 5EECA 2WGVA 5AQ7A 2XF3A 2QWSA 1JWVA 3P98A 4PM7A 1FSYA 3UPPA 5F69A 4C75A 3VOLA 3V67A 4BMWA 5GLDA 5L09A 3A0RA 1BLPA 4KQQA 1WYBA 2ZQCA 1LL9A 4N92A 1I5QA 3BWLA 5EVIA 5EM1A 3PXPA 2ZBBA 2ZM8A 4FTXA 5E2GA 3QP2A 3O5YA 1I2SA 4DE2A 4R3AA 4GKUA 4RX2A 1YSPA 1XKZA 3C8CA 2Y2PA 5CEDA 4WN5A 4F94A 4GD8A 2ZM2A 2Y79A 3D4FA 2W1TB 1KDWA 1N4OA 4EW7A 4H6JB 5DF8A 3UMEA 3A0VA 4G3KA 4ZAMA 1DJBA 5FA7A 4LV2A 4B4XA 3OCLA 5CGXA 3LICA 4LENA 1KGFA 2LB5A 3MXRA 3WRZA 1STZA 4X68A 3O86A 1IYSA 3T1RA 2EX8A 1K55C 3PYPA 4IJGA 5F68A 1Z6FA 3D72A 4KZBA 1PI4A 3OLOA 1OJGA 2PU2A 3OPRA 1AXBA 3HREA 2A24B 4JXVA 3AGDA 1MWSA 4DE0A 2OSUA 4NXFA 3KSGA 3IT9A 1K6RA 3SS3A 3W2ZA 1W63M 5IT5A 4PM9A 2OLVA 4Y0UA 4L0LA 4JGOA 2B02A 1OTIA 3W8KA 1MBLA 3UE6A 4OVDA 4CJNA 1OTAA 5U47A 4IHQA 3HJKA 2PU4A 3ZQ5A 3T4OA 5A91A 2L1MA 2OAP1 2ZC4B 3GRJA 3G2ZA 3FG8A 1GHPA 5FQ9A 1KVMA 4HJ6A 4HOIA 5BOHA 5G4YA 3EWKA 1BTLA 4QY6A 4WUJA 1IEMA 2JC7A 1TVFA 3LFVA 3T4SA 3E0YA 2P08A 3PAEA 5F82A 3CPTA 3PBQA 4E3LA 2DCFA 4OP5A 1YLJA 1KVLA 3NY4A 4PPRA 2W0NA 2EWWA 4EESA 3LIDA 1F5MA 1YMXA 2HJEA 3HUMA 4R23A 1L2SA 3I7JA 3LR5A 3BY9A 4BD1A 3D9YA 3AGFA 4IUKA 5TFQA 5GLAA 2XLNA 1DJAA 4JXGA 4YINA 1ES2A 4IEDA
chains in the Genus database with same CATH topology
3NHQA 3CWFA 4YNRA 4PKYG 1S4SA 3LUQA 1NWZA 3T4LA 5DKLA 3ZYTA 2OWJA 3MQQA 3NOTC 5J7EA 2G7UA 2PD8A 3PBOA 2DMWA 4UQIS 5AVFA 1T1AA 2O99A 5FL3A 1XJ2A 3BJNA 4KUOA 1Y28A 5K5BA 2W3DA 5HWTA 3C38A 5EFWA 3P01A 3JVVA 3NOUC 2WKPA 1N9LA 4HH3A 4HP9A 4AFIA 4CLCE 2EWVA 3T50A 2EA9A 2WKQA 4MCWA 2PDRA 4ETZA 1EW0A 2V9AA 3F1NB 2K7SA 2JN7A 4MDZA 4F3LB 2FZ0A 4WF0A 2P7JA 1T1BA 3DBAA 3LYXA 3LR3A 4ZRRA 3R4KA 4EEPA 4HHDA 2GZAA 4GJ4A 3EQUA 2JHEA 3FPVA 3JVUA 4YOFA 2GNXA 3CAXA 2V1AA 4CLCC 2OWHA 2ZOIA 3UB6A 4O0PA 2PT7A 3K2NA 2XA7S 2HF6A 5J3WA 4YWZA 1TS6A 3IS2A 4LRXC 2QJ5A 4P6ZM 2K2NA 2XRNA 2Y8HA 5AVEA 4PAUA 1OT9A 5HPIA 3E4PA 3VE4A 4UEYA 3C2WA 2PR6A 3IS2B 3H7WB 4EETB 4MMNA 3IBRA 2O9AA 2P04A 4BWIA 2VX8A 4KUKA 2W1RA 5DJUA 4Y2FA 3OBFA 4O8GA 3S7PA 4DN0A 2HV1A 4LRYC 3G6OA 3T4KA 2PYPA 4HI4A 2INWA 5A8BA 5TBMB 3F1NA 1XJ3A 3MQ0A 5MC7A 2D01A 1P0ZA 4KQOA 5HL6A 2XROA 5DKKA 1G28A 2FH5A 1F98A 4FSFA 4DJ3A 5HWVA 5TJJA 2IA2A 3F1OB 3F1OA 5HDDA 2J3TD 5IU1A 1GSWA 4H6JA 1ZHHB 1NLZA 3KYQA 3KO6A 3RTYA 3LR4A 4R6LA 2PHYA 5L8MA 5HSQA 3R7WA 3MFXA 2XSSA 3UE3A 4CLCD 2A2LA 4CLCB 4OOLA 4B93A 3UMDA 3MR0A 1TD5A 3B42A 1G6OA 4M4XA 3PR6A 2D02A 2JKTM 3PBSA 3VE3A 2VJWA 4Z1WA 4HNBA 2HJ9C 4GHIA 1S1ZA 4WEKA 1LT0A 3BW6A 3LIFA 2PR5A 2M7UA 4IUHA 4EERA 3PBTA 3LI9A 1S67L 2VV7A 3EGDC 3TW8A 5HWWA 2JKRI 2I9VA 1TS0A 2J80A 3T4QA 4O01A 1MZUA 2GJ3A 4RQ9A 1UGUA 4WLAA 3LR0A 3KSHA 4JGRA 4MN5A 1ODVA 5KIZA 4HIAA 4HH2A 3LIEA 2KDKA 2VEAA 1OT6A 2QYBA 4L9EA 4L9GA 1LL8A 4R38A 2J3TC 4I39A 1DP6A 3CUEA 2M1CA 2Z6DA 1YSQA 4E04A 5DFXA 1D06A 1LSVA 4GS9B 4PKYA 1N9NA 2CMNA 2NUPC 3RFBA 1JNUA 2H28A 2QHKA 4EEUA 2JKRM 2YKFA 1TS7A 2ZOHA 4Y5FA 3ULFA 3B47A 2W3FA 3TJZC 5C5KA 5DFYA 3SW1A 2J3WA 3S7NA 1V9YA 3B33A 1IFQA 1P97A 5I5LA 3H82A 2Z6CA 5KSHA 3VV4A 1F9IA 4PHTA 4CLCA 3H82B 4Q0JA 3UB8A 1IOUA 4BBUA 3OOVA 4ARZA 2VKSA 3E4QA 4P6ZS 2W3EA 2ZMFA 4GS9A 1W63Q 1H8MA 2W1TA 4NEED 3MMHA 2V0UA 3T4JA 4DJ2A 2XA7M 5F6AA 3F1PB 2VZWA 1GSVA 1ZTUA 3OC2A 4R70A 2BASA 3CUEC 3S7OA 4K08A 2HGVA 1YAXA 1OPXA 2W3HA 5J4EA 3ICYA 2VV8A 4GW9A 4XT2A 3GECA 2NUTC 2VV6A 1DRMA 4HJ4A 4HJ3A 2QWSA 3A0SA 4NKPA 5F69A 3EGXC 3KSFA 1MC0A 3VOLA 5DJTA 3BQAA 3V67A 4BMWA 5HD3A 3EQVA 5F5YA 3A0RA 3P7NA 2WKRA 2M7VA 1XJ4A 1GSXA 4II7A 4ETXA 1NLYA 3BWLA 3KYZA 3CLOA 1UWPX 3PXPA 2ZBBA 4GHIB 3O5YA 5HDCA 5HPFA 3HJIA 4Q0HA 4EUVA 4R3AA 1N9OA 3UB7A 3MQOA 1YSPA 2O9BA 3E4OA 3C8CA 2V1BA 4WN5A 5CX7A 2LB9A 2W27A 2K31A 1D7EA 1TF1A 3PHYA 4HP4A 4I5SA 3H9WA 2Y79A 2KX6A 2MJ6A 3F1PA 4L9FA 3R7WB 3RH8B 3S7QA 2W1TB 3MF0A 4EQ1A 3NOPC 4EW7A 4H6JB 3UMEA 3A0VA 4BBTA 4G3KA 5G4ZA 3C30A 3OCLA 1MKMA 3LICA 4F3LA 2LB5A 5DF9A 2VGLM 1STZA 3PBRA 5HDSA 3K3DA 4NXEA 3CITA 2PYRA 3FPWA 3KX0X 3PYPA 4IJGA 5F68A 2O0YA 1NRJA 3FC7A 3D72A 1VHMA 4Q0IA 3OLOA 1OJGA 3EEAA 4HQAA 1P9WA 2JKTI 4GCZA 2GX5A 5IS1A 2A24B 2A24A 2KOIA 3BQ8A 2O9CA 5LBRA 4B9OA 1XJ6A 3NJAA 4NXFA 2VGLS 3KSGA 4CQHA 1P9RA 4BJPA 4ME4A 3PBNA 3GDIA 1XFQA 3KSIA 3U2AA 3W2ZA 4EU0A 2OOLA 1W63M 4FOFA 5IT5A 4G3WA 2R78A 4L0LA 1S66L 4JGOA 2QKPA 2VA0A 4WL9A 3E98A 2B02A 3D3OA 1OTIA 4BBVA 4LLOB 3T4TA 4GLQA 3UE6A 3BY8A 2L4RA 3IBJA 4ARZB 1OTAA 3EOIA 4DMZA 5AJGA 4IHQA 4WEJA 3LIBA 1WA9A 3HJKA 3TRCA 1T19A 1DP9A 4MN6A 1S4RA 3ZQ5A 3OCNA 3T4OA 3LIAA 3MJQA 4I38A 4MN7A 2L1MA 1T1CA 2OAP1 1OTEA 1LSXA 1H3QA 3FG8A 1DP8A 1S1YA 4HJ6A 4KQDA 2KLIA 4LPZA 2OAQ1 1YKDA 3TE8A 4HOIA 2VLGA 2PD7A 1XFNA 5G4YA 3EWKA 5HZHA 4NXBA 5TBMA 3UB9A 4UQIM 4WUJA 5HD5A 4HY8A 4I3IA 4I3JA 3LFVA 4EXOA 3EEHA 1KOUA 3MXQA 3T4SA 3E0YA 2P08A 2QJ7A 3PBQA 3CI6A 1OTBA 4OOMA 3HCYA 1TS8A 1BYWA 2W0NA 2EWWA 1LSWA 1UWNX 2YKHA 4G3VA 4EESA 3LIDA 4NXGA 2V0WA 1F5MA 1X0OA 2ZMVA 4QPRA 1OTDA 2HJEA 1VB6A 4LRZE 1OJ5A 3LR5A 3BY9A 2L0WA 4JGPA 4XT2B 4JGQA 4WELA 4IUKA 4I3AA 3H7WA 1T18A 2W3GA 4Y3IA 3K3CA 1V9ZA 2B18A 3LI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHQ A;  1OJG A;  3H82 B;  3UB8 A;  4HQA A;  1P0Z A;  3CWF A;  4BBU A;  5DKK A;  4PKY G;  1S4S A;  1G28 A;  4GCZ A;  1F98 A;  5IS1 A;  3LUQ A;  3E4Q A;  4DJ3 A;  5HWV A;  1NWZ A;  2A24 B;  3F1O B;  2A24 A;  3F1O A;  4GS9 A;  3UB6 A;  3LI8 A;  5DKL A;  2OWJ A;  3MQQ A;  5HDD A;  4B9O A;  4DJ2 A;  2V0U A;  3NOT C;  5IU1 A;  5F6A A;  1XJ6 A;  1GSW A;  3F1P B;  3NJA A;  4H6J A;  4NXF A;  5J7E A;  1GSV A;  2PD8 A;  4R70 A;  2BAS A;  4K08 A;  5AVF A;  3RTY A;  3GDI A;  1XFQ A;  1T1A A;  2PHY A;  4R6L A;  5HSQ A;  3MFX A;  5J4E A;  1XJ2 A;  2OOL A;  3ICY A;  2VV8 A;  4GW9 A;  4XT2 A;  3GEC A;  2R78 A;  4KUO A;  1Y28 A;  3MR0 A;  3UMD A;  4M4X A;  1S66 L;  5HWT A;  2VV6 A;  4JGO A;  2D02 A;  2QKP A;  5EFW A;  4WL9 A;  2B02 A;  1DRM A;  1OTI A;  3NOU C;  4HJ4 A;  2WKP A;  1N9L A;  2QWS A;  3A0S A;  4HH3 A;  4HJ3 A;  4HNB A;  4HP9 A;  4LLO B;  4BBV A;  4GHI A;  3UE6 A;  5F69 A;  1S1Z A;  3BY8 A;  3T50 A;  1LT0 A;  2EA9 A;  2L4R A;  5DJT A;  3VOL A;  1OTA A;  3LIF A;  2PR5 A;  2WKQ A;  2PDR A;  3LIB A;  5F5Y A;  1WA9 A;  3HJK A;  1EW0 A;  3A0R A;  5HD3 A;  2V9A A;  4EER A;  3F1N B;  2K7S A;  2JN7 A;  3LI9 A;  3P7N A;  1T19 A;  1DP9 A;  2WKR A;  1S4R A;  1S67 L;  2VV7 A;  4MN6 A;  3ZQ5 A;  4F3L B;  5HWW A;  2I9V A;  4WF0 A;  3LIA A;  3MJQ A;  1TS0 A;  4I38 A;  2L1M A;  2J80 A;  1T1C A;  2P7J A;  1OTE A;  1GSX A;  1XJ4 A;  1T1B A;  3BWL A;  1LSX A;  3LYX A;  1MZU A;  2GJ3 A;  4RQ9 A;  1UGU A;  3CLO A;  4WLA A;  1UWP X;  3FG8 A;  2ZBB A;  4EEP A;  1DP8 A;  4GHI B;  1S1Y A;  4HHD A;  4HJ6 A;  5HDC A;  4KQD A;  4JGR A;  4MN5 A;  3HJI A;  4LPZ A;  2JHE A;  4HOI A;  4R3A A;  1N9O A;  1ODV A;  3UB7 A;  5KIZ A;  2VLG A;  3MQO A;  2PD7 A;  1XFN A;  4HIA A;  4HH2 A;  3CAX A;  5G4Y A;  3E4O A;  3EWK A;  3C8C A;  3LIE A;  2KDK A;  3VE4 A;  5HZH A;  4NXB A;  2VEA A;  5TBM A;  2V1B A;  4WN5 A;  4WUJ A;  5HD5 A;  1OT6 A;  2V1A A;  2W27 A;  4HY8 A;  3UB9 A;  1D7E A;  3PHY A;  4L9E A;  2OWH A;  4HP4 A;  4I5S A;  2ZOI A;  3H9W A;  4I3J A;  2KX6 A;  3F1P A;  3EEH A;  4I3I A;  4L9F A;  3RH8 B;  4L9G A;  4EXO A;  1KOU A;  1LL8 A;  3MXQ A;  5J3W A;  4R38 A;  4YWZ A;  4I39 A;  4EQ1 A;  1TS6 A;  3IS2 A;  4LRX C;  1DP6 A;  2QJ5 A;  3NOP C;  2QJ7 A;  4EW7 A;  4H6J B;  2M1C A;  2Z6D A;  3UME A;  3A0V A;  5AVE A;  1OT9 A;  1OTB A;  4E04 A;  4BBT A;  1D06 A;  1TS8 A;  1BYW A;  1LSV A;  3E4P A;  2W0N A;  3C2W A;  4GS9 B;  4PKY A;  1LSW A;  5G4Z A;  1N9N A;  2CMN A;  3VE3 A;  1UWN X;  2PR6 A;  1JNU A;  2H28 A;  2YKH A;  3LID A;  4EES A;  4NXG A;  2QHK A;  2V0W A;  3LIC A;  4EEU A;  1X0O A;  4F3L A;  2YKF A;  3IS2 B;  1TS7 A;  1OTD A;  2ZOH A;  3H7W B;  5HDS A;  3ULF A;  4EET B;  3IBR A;  1VB6 A;  4LRZ E;  1OJ5 A;  3SW1 A;  3BY9 A;  3K3D A;  4NXE A;  2L0W A;  4JGP A;  2PYR A;  4KUK A;  5DJU A;  3KX0 X;  3PYP A;  1V9Y A;  3B33 A;  4XT2 B;  4JGQ A;  2HV1 A;  4I3A A;  5F68 A;  3H7W A;  1T18 A;  4LRY C;  3G6O A;  1P97 A;  2PYP A;  4HI4 A;  3K3C A;  2INW A;  3FC7 A;  3H82 A;  2Z6C A;  5I5L A;  3D72 A;  5A8B A;  1V9Z A;  5TBM B;  1F9I A;  3F1N A;  1XJ3 A;  2D01 A;  3OLO A; 
#chains in the Genus database with same CATH topology
 1FCN A;  1NYY A;  4X25 A;  3M2J A;  1SKF A;  5DTT A;  4JF5 A;  2AVX A;  5DKL A;  3ZYT A;  2OWJ A;  3MQQ A;  4DE1 A;  3IXD A;  2PRF A;  5CEB A;  2EFU A;  1SDE A;  2J7V A;  1YLT A;  1TDG A;  4UQI S;  3S4X A;  1XJ2 A;  3BJN A;  3PAG A;  1ERO A;  1FR1 A;  4K91 A;  4S2L A;  5EFW A;  1PNE A;  2EWV A;  3T50 A;  4OQH A;  2PDR A;  1MWU A;  4MBH A;  3Q7V B;  1PW8 A;  2V9A A;  5CXW A;  2K7S A;  1Y4O A;  4E6X A;  2FZ0 A;  1FSW A;  3ZCZ A;  3JYI A;  1ACF A;  4HBT A;  4EEP A;  3B3X A;  1M6K A;  1PWD A;  3EQU A;  1LHY A;  3FPV A;  3G4P A;  4YOF A;  2ZL1 A;  4JBF A;  3HL9 A;  4DF6 A;  3A3I A;  2V1A A;  3P09 A;  1MPL A;  2ZLY A;  2HF6 A;  3FKV A;  4YWZ A;  4LRX C;  4PAU A;  1OT9 A;  5HPI A;  1KE0 A;  4JF4 A;  3A3J A;  3C7V A;  4UEY A;  3ITB A;  1H0M A;  3G31 A;  4DXB A;  3RXW A;  2W1R A;  5DJU A;  3UDX A;  3OBF A;  3ZDJ A;  5EPH A;  3HLW A;  2Y2O A;  3G6O A;  1XJ3 A;  3DWK A;  5A93 A;  1P0Z A;  5HL6 A;  2XRO A;  5GHX A;  2Z2M B;  5HWV A;  5TJJ A;  5CGS A;  3LO7 A;  5FAS A;  1EI5 A;  4KG5 A;  2WYX A;  4H6J A;  3KO6 A;  2ACG A;  3PTE A;  1FIK A;  4HEF A;  4EV4 A;  4CLC D;  4X56 A;  4CLC B;  4B93 A;  1TD5 A;  3B42 A;  2OLU A;  4M4X A;  1JWP A;  2D02 A;  3ZG5 A;  2JKT M;  3ZNY A;  4R1G A;  3NEC A;  1LT0 A;  3LIF A;  4IUH A;  1CI9 A;  1FQG A;  1RGZ A;  4KZ5 A;  3PBT A;  3HUN A;  4R4R A;  3V50 A;  5FQM A;  2J80 A;  1XGJ A;  5EVL A;  1KDS A;  4OH0 A;  3DTI A;  2H0T A;  2VK3 A;  1A0K A;  2E8J A;  2XK1 A;  1I2W A;  4WYY A;  5HAP A;  2ZQD A;  4P6B A;  2DRW A;  2VEA A;  1OT6 A;  1LL5 A;  4E3I A;  1ONH A;  1DP6 A;  3O88 A;  3Q7V A;  5EE8 A;  1LSV A;  2NUP C;  5HFO A;  5FAO A;  2HDS A;  4XXR A;  3W4Q A;  2QHK A;  1F2K A;  2JKR M;  2YKF A;  1TS7 A;  4Y5F A;  3V3R A;  4X55 A;  1L0F A;  5DFY A;  4M3K A;  4BL2 A;  3SW1 A;  5GLB A;  4JLF A;  3O87 A;  1L0G A;  4O7D A;  5I5L A;  3LGO A;  1SCW A;  3VV4 A;  4Q0J A;  3OOV A;  2Y2G A;  3E4Q A;  3UE1 A;  4P6Z S;  5E2H A;  3IH9 A;  3VFH A;  2XA7 M;  5F6A A;  1GSV A;  3QHY A;  3IX4 A;  3WWX A;  2BAS A;  5FI6 A;  5HAR A;  3LCE A;  4GDB A;  1ONG A;  1PWC A;  1K54 C;  2VV8 A;  2NUT C;  4FD8 A;  4KZ3 A;  3T1S A;  1FR6 A;  4H8R A;  3VFF A;  1MC0 A;  5DJT A;  4KG6 A;  3BQA A;  1FCO A;  5HD3 A;  5F5Y A;  1HVB A;  2WK0 A;  1W5D A;  2WKR A;  5CRF A;  4Y0T A;  3W4P A;  5EM0 A;  1GSX A;  4II7 A;  1NLY A;  4E3O A;  4R0Q A;  3NUL A;  3UB7 A;  1K4F A;  5L07 A;  1E3U D;  3DTM A;  4QWO A;  2V1B A;  2ZC7 A;  2LB9 A;  3HBR A;  1TF1 A;  1MKI A;  1K4E A;  1GA0 A;  5GHY A;  1JTD A;  3FYZ A;  1ES4 A;  4QD4 A;  4OLG A;  4ZJ1 A;  4BBT A;  3FV7 A;  4B88 A;  1CEG A;  3QP5 A;  5J8X A;  5DF9 A;  2VGL M;  3PBR A;  3QP6 A;  3CIT A;  2WKI A;  4WZ5 A;  2XGN A;  3E2L A;  3QNC A;  2O0Y A;  2J9P A;  5HAI A;  3FC7 A;  4PM8 A;  4Q0I A;  5M18 A;  3EEA A;  1CK3 A;  5I94 A;  2GX5 A;  1K57 C;  1YQS A;  4S2J A;  5LBR A;  4NK3 A;  3TSG A;  4ME4 A;  3PBN A;  4K0X A;  4FOF A;  2FFY A;  2R78 A;  1RCJ A;  1YT4 A;  4QY5 A;  3BFD A;  1CJF A;  5E2E A;  1ALQ A;  1SKO B;  3T4T A;  3Q1F A;  3SS5 A;  3BY8 A;  3RXX A;  3NIA A;  3IF5 A;  5AJG A;  1WA9 A;  1SZV A;  1MWR A;  5F1F A;  5JYO A;  4HBU A;  4ZBE A;  1H5X A;  2HPB A;  1LSX A;  4P87 A;  1DP8 A;  4UHU A;  2KLI A;  2OAQ 1;  1YKD A;  3N7W A;  1XFN A;  1ES3 A;  4Y15 A;  4UQI M;  1VET B;  4CPK A;  4I3J A;  2EX9 A;  5EVI B;  3MKE A;  3MXQ A;  2DNS A;  3WS0 A;  3CI6 A;  3HCY A;  4EBN A;  1TDL A;  2YKH A;  4X6T A;  4FH2 A;  4QPR A;  1OTD A;  1W8Y A;  2XFS A;  1FCM A;  1VQQ A;  2ZMA A;  5DTS A;  5CER A;  1T18 A;  2VGJ A;  4Y3I A;  3BEC A;  5A92 A;  1V9Z A;  2B18 A;  2WZZ A;  3LI8 A;  1LI0 A;  5CHU A;  2X02 A;  4N1X A;  4KQR A;  5G18 A;  3LUQ A;  1RP5 A;  3N8L A;  3NOT C;  4OP8 A;  5CHJ A;  4FCF A;  2PD8 A;  3ZNT A;  2BG1 A;  5CHM A;  2DMW A;  3Q81 A;  4GNU A;  3VP3 A;  1PFL A;  3NC8 A;  5HWT A;  3C38 A;  2WKP A;  1N9L A;  4HH3 A;  4AFI A;  2EA9 A;  4OPY A;  2XQZ A;  4ETZ A;  3DTE A;  1CI8 A;  1JVJ A;  2Y2M A;  3QP4 A;  3SOI A;  1T1B A;  3DBA A;  1NXY A;  5GL9 A;  3LYX A;  1CF0 A;  2Q9N A;  3AGE A;  4HHD A;  2JHE A;  3JVU A;  5M19 A;  3NI9 A;  4KZ9 A;  4C6Y A;  1ERQ A;  5KSC A;  2OWH A;  3K2N A;  2XA7 S;  2WZX A;  5M1A A;  1SKO A;  4NG2 A;  3W4O A;  2ZC3 B;  4P6Z M;  1ZKJ A;  2Y8H A;  4QB8 A;  1E4D A;  5FEF A;  5FDH A;  4GB7 A;  2R9X A;  4EET B;  2QPN A;  3IBR A;  2O9A A;  4BWI A;  2H5S A;  4KUK A;  3S7P A;  5FAP A;  4DN0 A;  1LI9 A;  4OQ0 A;  5A8B A;  2HDU A;  4QU3 A;  4IBX A;  1G28 A;  5EOO A;  2HDQ A;  4DJ3 A;  1YLY A;  2IA2 A;  3F1O A;  3RJU A;  4Y0O A;  1PWG A;  4EBL A;  5HDD A;  3WS1 A;  1GSW A;  4JXS A;  4MLL A;  3C4O A;  3IXB A;  1KE4 A;  2Y2K A;  1Q2P A;  3KYQ A;  3BLS A;  3RTY A;  5E43 A;  3MFX A;  3G2Y A;  2A2L A;  4Y17 A;  3UMD A;  3PR6 A;  3UDI A;  3JPU A;  4DE3 A;  1IYO A;  1H8Y A;  1MWT A;  3CHW P;  4GHI A;  2BLS A;  4EQI A;  2XH9 A;  1ERM A;  4EER A;  4OQG A;  3EGD C;  5HWW A;  3ZFZ A;  5IHV A;  3T4Q A;  4BD0 A;  3IXH A;  1MZU A;  2GJ3 A;  4WLA A;  4BL3 A;  1ODV A;  1HZO A;  4RX3 A;  2QYB A;  3WRT A;  3UO9 A;  2ZQ7 A;  3IF6 C;  1PIO A;  4L9G A;  5EVI D;  5CGW A;  2J3T C;  4I39 A;  1DJC A;  1QME A;  5CTM A;  1PW1 A;  2M1C A;  4E04 A;  5DFX A;  1D06 A;  1BLH A;  2CMN A;  3BFF A;  4EEU A;  3HUO A;  3MBZ A;  3V3S A;  3M6B A;  3FKW A;  3ULF A;  3B47 A;  5C5K A;  1L0D A;  3G34 A;  3L9K A;  3VOY A;  4GOG A;  3WS5 A;  3LEZ A;  3UB5 P;  2OV5 A;  3H82 A;  4PHT A;  4CLC A;  5FSR A;  4BBU A;  3A3E A;  3N6I A;  2V2F F;  3VMA A;  5HX9 A;  1W63 Q;  3N4I A;  2W1T A;  1ES5 A;  1XXM A;  3ZVT A;  2VZW A;  5JYP A;  3CUE C;  4K08 A;  5J4E A;  2Q9M A;  2VV6 A;  1LLB A;  4MEZ A;  4HJ4 A;  3IWI A;  4HJ3 A;  4WMC A;  2JKF A;  3A0S A;  4NKP A;  1K56 D;  4MBK A;  2Y59 A;  4S2I A;  5FI7 A;  2B5R A;  4BLM A;  4RA7 A;  3ZG7 B;  4WZ5 C;  2M7V A;  4KZA A;  3KYZ A;  3BLM A;  3CLO A;  1UWP X;  3HJI A;  4Q0H A;  4OON A;  5GLC A;  5FI2 A;  2O9B A;  3E4O A;  5L2F A;  5CX7 A;  1PYY A;  2ZC5 B;  2W27 A;  1XA1 A;  2K31 A;  3TG9 A;  1D7E A;  3U4L P;  3RH8 B;  3R7W B;  2MJ6 A;  4L9F A;  1SHV A;  2CC1 A;  3S7Q A;  1WYC A;  3TOI A;  3NOP C;  3IX3 A;  1YPR A;  5G4Z A;  3C30 A;  2E8I A;  4OKP A;  5HDS A;  1GA9 A;  1XA7 A;  5FQQ A;  3K3D A;  4GD6 A;  4BEN A;  3FPW A;  3GV9 A;  2WGW A;  5FAQ A;  3MKF A;  1NRJ A;  3T1Q B;  1VHM A;  2J9O A;  2ZC6 B;  1GHI A;  4HQA A;  3V39 A;  2V8C A;  5IS1 A;  4DRT A;  2A24 A;  1Z09 A;  3SH7 A;  3SZT A;  3NJA A;  2VGL S;  4CQH A;  1P9R A;  2V8F A;  1YLW A;  3KSI A;  3U2A A;  2WAD A;  4EU0 A;  5TR7 A;  4EUZ A;  1W79 A;  2WGW B;  1D1J A;  4G3W A;  2Y2I A;  3SS4 A;  2ZL1 B;  3GVB A;  2QKP A;  4U3T A;  4WL9 A;  3E98 A;  3D3O A;  2IWB A;  3S1Y A;  1K54 A;  4BBV A;  3N8S A;  4LLO B;  4EBP A;  2J8Y A;  4GLQ A;  2L4R A;  3IBJ A;  4ARZ B;  1O7E A;  3EOI A;  3TRC A;  1EWZ A;  1T19 A;  1DP9 A;  3OCN A;  3LIA A;  3MJQ A;  3Q7Z A;  3BFC A;  1T1C A;  1GHM A;  1H3Q A;  2R9W A;  2Y2N A;  3TE8 A;  4OLD A;  2PD7 A;  3OPH A;  1BSG A;  4KZ8 A;  4A5R A;  1IYQ A;  2P9V A;  4NXB A;  3UB9 A;  5HD5 A;  4HY8 A;  4I3I A;  2UWX A;  3EEH A;  3SH8 A;  1KOU A;  2ZQA A;  1JTG A;  2QJ7 A;  4UA6 A;  5DVA A;  4OOM A;  5EUA A;  1TS8 A;  1UWN X;  3WS2 A;  2V0W A;  4MBF A;  1X0O A;  1VB6 A;  1OJ5 A;  2L0W A;  2H0Y A;  4XT2 B;  4WEL A;  3CJM A;  4I3A A;  3A3D A;  1E3U A;  1IKI A;  1S0W A;  3ZG8 B;  3DWZ A;  3NHQ A;  1S4S A;  4WBG A;  2JE5 A;  3CPT B;  5J7E A;  1W8Q A;  3C4P A;  4Z9Q A;  3UPN A;  3HLE A;  2FFF B;  5AVF A;  2O99 A;  3VP4 A;  3HLD A;  5K5B A;  2W3D A;  1FOF A;  3P01 A;  3NOU C;  3UPO A;  1G68 A;  4HP9 A;  4PM5 A;  1M40 A;  4MCW A;  3ZVW A;  3F1N B;  2JN7 A;  4F3L B;  1K57 A;  2P7J A;  1NJ4 A;  4E3K A;  3LR3 A;  4R3B A;  3R4K A;  4IBR A;  1W7F A;  1PRQ A;  2GZA A;  4X1L A;  1RGY A;  4CLC C;  5TGF A;  5A90 A;  2ZOI A;  3UB6 A;  4O0P A;  2PT7 A;  4GZB A;  3M6H A;  5J3W A;  3IS2 A;  3T12 B;  2K2N A;  4S2N C;  5AVE A;  2XR0 A;  1GCE A;  5EVI C;  5D3O A;  3E4P A;  3VE4 A;  3C2W A;  5FQI A;  2PR6 A;  4E6W A;  5CTN A;  4EWF A;  1XP4 A;  3IS2 B;  3H7W B;  3IWQ A;  2C6W B;  2P04 A;  2PAV P;  2VX8 A;  1IYP A;  4S2N A;  4Y2F A;  4E3M A;  1K25 A;  3IQA A;  4C3Q A;  3QP8 A;  5EV0 A;  4HI4 A;  2INW A;  4KQO A;  4JXW A;  5DKK A;  1XX2 A;  2FH5 A;  4FSF A;  3UE0 A;  3CZD A;  4LCM A;  4XUZ A;  3MS6 A;  4S2M A;  3IF6 B;  4FH4 A;  4OOY A;  2Y91 A;  3OPL A;  3LR4 A;  5HSQ A;  4OOL A;  2X71 A;  1G6O A;  3ZG9 B;  3PBS A;  4N1H A;  3VE3 A;  2VJW A;  4Z1W A;  4HNB A;  2HJ9 C;  4ZTK A;  2ZD8 A;  4ZDX A;  1S1Z A;  3IHB A;  5AQ9 A;  2Y2J A;  3BW6 A;  2PR5 A;  2C5W B;  2WUQ A;  4X1M A;  4UAA A;  3LI9 A;  1N9B A;  4B4Z A;  2H10 A;  1S67 L;  2VV7 A;  1NYM A;  2I9V A;  1YLZ A;  3UN7 A;  4O01 A;  1CEF A;  4RQ9 A;  5F83 A;  4MN5 A;  3FZC A;  5HAQ A;  3A3F A;  3CG5 A;  2ZQ8 A;  4P85 A;  1E25 A;  2XFT A;  2KDK A;  3Q82 A;  2XEP A;  3KYE A;  1SDN A;  3CUE A;  3ZHH A;  2Z6D A;  3G32 A;  1YSQ A;  4LFU A;  2Q0O A;  2WAE A;  3GTC A;  2JBF A;  4PKY A;  3VP2 A;  1N9N A;  3RFB A;  1JNU A;  2H28 A;  4OPR A;  3HLG A;  2W3F A;  1ZG6 A;  4X69 A;  2J3W A;  3IXG A;  1VET A;  3S7N A;  1YMS A;  2WAF A;  1S6R A;  2PBD P;  1P97 A;  3OZH A;  5KSH A;  5GHZ A;  1IOU A;  4PMA A;  1NZU A;  4N9K A;  2VKS A;  1J9M A;  1XPB A;  4JF6 A;  2JKG A;  2W3E A;  4LV3 A;  4DJ2 A;  2V0U A;  3T4J A;  3VOZ A;  3F1P B;  2HDR A;  4JKT A;  4R70 A;  1PI5 A;  3S7O A;  2HGV A;  1YAX A;  4Q8I A;  3WS4 A;  1BLS A;  1HLU P;  4IVI A;  1YLP A;  3ICY A;  4GW9 A;  3GEC A;  1OME A;  4DDY A;  1DRM A;  1KE3 A;  2A49 A;  4D60 A;  3EGX C;  3KSF A;  1HD8 A;  2B95 A;  4KG2 A;  2JCH A;  1FIL A;  3BFE A;  3EQV A;  3MZD A;  3P7N A;  3LY3 A;  2EX6 A;  3BM6 A;  1XJ4 A;  4DXC A;  4ETX A;  3DAV A;  2XD1 A;  4GHI B;  5HDC A;  5HPF A;  4EUV A;  1N9O A;  3MQO A;  3GR2 A;  4FUW A;  2HP9 A;  3QP1 A;  3BFG A;  3PHY A;  4HP4 A;  4GDN A;  4I5S A;  3H9W A;  2KX6 A;  3F1P A;  2Y4A A;  4Y7P A;  3M2K A;  1Y54 A;  3MF0 A;  4K0W A;  3V5M A;  4EQ1 A;  4P0M A;  4ZJ2 A;  1VEU A;  3GSG A;  4DKI A;  3IH8 A;  4XUX A;  4E3J A;  1MKM A;  1NRF A;  4F3L A;  4PM6 A;  1JWZ A;  4RYE A;  1QMF A;  2IWD A;  3NDG A;  4NXE A;  2PYR A;  5KZH A;  3KX0 X;  4WM9 A;  1ZG4 A;  3Q07 A;  2QZ6 A;  3MZE A;  2WGI A;  3MFD A;  3OPP A;  1K6S A;  1H8Z A;  1P9W A;  1L0E A;  4UA7 A;  2JKT I;  4GCZ A;  3HLC A;  2KOI A;  5AQA A;  3BQ8 A;  2O9C A;  4B9O A;  1XJ6 A;  1O07 A;  4BJP A;  3GDI A;  1XFQ A;  4WZ4 A;  3NDE A;  2OOL A;  1G6A A;  5FEG A;  1S66 L;  5E2F A;  2VA0 A;  1K38 A;  3S22 A;  4QJG A;  1AWI A;  2UV0 E;  5DTK A;  5KMW A;  4DMZ A;  4WEJ A;  3LIB A;  4S2K A;  4MN6 A;  1S4R A;  1Q2Q A;  2RL3 A;  4I38 A;  4MN7 A;  2EXA A;  1OTE A;  4HES A;  5DF7 A;  1S1Y A;  4OQI A;  3ITA A;  4KQD A;  4LPZ A;  2Y2Q A;  2GDN A;  2VLG A;  3VSK A;  5HZH A;  4LGW A;  5F1G A;  5TBM A;  4S2P A;  4KEN B;  4EXO A;  2EFX A;  3ISG A;  3QNB A;  3BEB A;  1OTB A;  5FQJ A;  1BYW A;  1LSW A;  4G3V A;  4NXG A;  2ZMV A;  4LRZ E;  5AQB A;  5HL1 A;  4JGP A;  4IVK A;  1CQA A;  4JGQ A;  3H7W A;  4NET A;  1TEM A;  2EXB A;  2W3G A;  4OPZ A;  3K3C A;  1ESU A;  1K55 A;  5FQK A;  1K0K A;  4RVA A;  2G2U A;  2EX2 A;  2ZJ9 A;  3CWF A;  4YNR A;  3BRM A;  4R3J A;  4PKY G;  1NWZ A;  3T4L A;  2WKE A;  2Y2H A;  1NZO A;  2G7U A;  3ZGA B;  4GN2 A;  3PBO A;  1YM1 A;  1T1A A;  3IWO A;  5FL3 A;  1C3B A;  3HVF A;  3O3V A;  4KUO A;  1Y28 A;  2A3U A;  4DDS A;  3JVV A;  4CLC E;  2XD5 A;  3DW0 A;  2IWC A;  2WKQ A;  1EW0 A;  4MDZ A;  4WF0 A;  4LCL A;  2P74 A;  4ZRR A;  1VM1 A;  1MY8 A;  3VP0 A;  4GJ4 A;  2ZQ9 A;  1U60 A;  4ZJ3 A;  2GNX A;  4JPM A;  3CAX A;  3MXS A;  4R4S A;  3MSH A;  3UNW A;  3G30 A;  1TS6 A;  2QJ5 A;  4BQM A;  2X01 A;  3DTK A;  2XRN A;  4Y13 A;  3IX8 A;  3UDF A;  1BLC A;  1IKG A;  5HW3 A;  3G35 A;  2I72 A;  4MMN A;  1PZP A;  1L3L A;  1J3W A;  4O8G A;  3ZG0 A;  2HV1 A;  3C7U A;  4LRY C;  2WKH A;  4KZ7 A;  3T4K A;  2PYP A;  5TBM B;  3BYD A;  3GMW A;  3F1N A;  5MC7 A;  3MQ0 A;  4QHC A;  2D01 A;  4KZ6 A;  3GQZ A;  2PBY A;  1F98 A;  2Y55 A;  3F1O B;  1KGE A;  2J3T D;  3HLF A;  5IU1 A;  3IHA A;  1ZHH B;  1NLZ A;  1G5U A;  5EVE A;  2QMI A;  4R6L A;  2PHY A;  5L8M A;  3R7W A;  3VP1 A;  2XSS A;  3UE3 A;  2VGK A;  4ESP A;  4D2O A;  4OPQ A;  3MR0 A;  4KZ4 A;  4ID4 A;  3LY4 A;  1XGI A;  1KGG A;  4WEK A;  2M7U A;  1HTZ A;  2RCX A;  5FDS A;  3TW8 A;  4U0T A;  2JKR I;  1TS0 A;  3FWL A;  5CEC A;  4S2O A;  1UGU A;  3NBL A;  3LR0 A;  3KSH A;  3NCK A;  5L10 A;  4UA9 A;  4JGR A;  4E3N A;  4LV0 A;  4MNR A;  2Z2L B;  5KIZ A;  4HIA A;  4YFM A;  4HH2 A;  4N9L A;  3LIE A;  3UY6 A;  1MXO A;  1PZO A;  2HZ5 A;  1NY0 A;  3SH9 A;  4L9E A;  1LL8 A;  4R38 A;  3L7H A;  3C5A A;  1ESI A;  4GS9 B;  3VSL A;  2ZOH A;  4WMC D;  1WE4 A;  3TJZ C;  4X53 A;  3LEQ A;  1K56 A;  1BUE A;  1V9Y A;  3B33 A;  2P9V B;  1BUL A;  1IFQ A;  3HLB A;  2Z6C A;  5EOE A;  3N8R A;  1F9I A;  3H82 B;  3UB8 A;  2ZM0 A;  3T1X A;  2HP6 A;  4ARZ A;  1VEU B;  3E2K A;  2ZMF A;  4GS9 A;  2BTF P;  1ZC2 A;  1H8M A;  3MZF A;  4NEE D;  3MMH A;  2G2W A;  3IF6 A;  1BZA A;  2V1Z A;  1ZTU A;  3OC2 A;  1OPX A;  2HP5 A;  2V20 A;  2Y2L A;  3CMZ A;  2W3H A;  2XDM A;  4U0X A;  1IEL A;  5FAT A;  4XT2 A;  1DY6 A;  4LV1 A;  1BT5 A;  5EEC A;  2WGV A;  5AQ7 A;  2XF3 A;  2QWS A;  1JWV A;  3P98 A;  4PM7 A;  1FSY A;  3UPP A;  5F69 A;  4C75 A;  3VOL A;  3V67 A;  4BMW A;  5GLD A;  5L09 A;  3A0R A;  1BLP A;  4KQQ A;  1WYB A;  2ZQC A;  1LL9 A;  4N92 A;  1I5Q A;  3BWL A;  5EVI A;  5EM1 A;  3PXP A;  2ZBB A;  2ZM8 A;  4FTX A;  5E2G A;  3QP2 A;  3O5Y A;  1I2S A;  4DE2 A;  4R3A A;  4GKU A;  4RX2 A;  1YSP A;  1XKZ A;  3C8C A;  2Y2P A;  5CED A;  4WN5 A;  4F94 A;  4GD8 A;  2ZM2 A;  2Y79 A;  3D4F A;  2W1T B;  1KDW A;  1N4O A;  4EW7 A;  4H6J B;  5DF8 A;  3UME A;  3A0V A;  4G3K A;  4ZAM A;  1DJB A;  5FA7 A;  4LV2 A;  4B4X A;  3OCL A;  5CGX A;  3LIC A;  4LEN A;  1KGF A;  2LB5 A;  3MXR A;  3WRZ A;  1STZ A;  4X68 A;  3O86 A;  1IYS A;  3T1R A;  2EX8 A;  1K55 C;  3PYP A;  4IJG A;  5F68 A;  1Z6F A;  3D72 A;  4KZB A;  1PI4 A;  3OLO A;  1OJG A;  2PU2 A;  3OPR A;  1AXB A;  3HRE A;  2A24 B;  4JXV A;  3AGD A;  1MWS A;  4DE0 A;  2OSU A;  4NXF A;  3KSG A;  3IT9 A;  1K6R A;  3SS3 A;  3W2Z A;  1W63 M;  5IT5 A;  4PM9 A;  2OLV A;  4Y0U A;  4L0L A;  4JGO A;  2B02 A;  1OTI A;  3W8K A;  1MBL A;  3UE6 A;  4OVD A;  4CJN A;  1OTA A;  5U47 A;  4IHQ A;  3HJK A;  2PU4 A;  3ZQ5 A;  3T4O A;  5A91 A;  2L1M A;  2OAP 1;  2ZC4 B;  3GRJ A;  3G2Z A;  3FG8 A;  1GHP A;  5FQ9 A;  1KVM A;  4HJ6 A;  4HOI A;  5BOH A;  5G4Y A;  3EWK A;  1BTL A;  4QY6 A;  4WUJ A;  1IEM A;  2JC7 A;  1TVF A;  3LFV A;  3T4S A;  3E0Y A;  2P08 A;  3PAE A;  5F82 A;  3CPT A;  3PBQ A;  4E3L A;  2DCF A;  4OP5 A;  1YLJ A;  1KVL A;  3NY4 A;  4PPR A;  2W0N A;  2EWW A;  4EES A;  3LID A;  1F5M A;  1YMX A;  2HJE A;  3HUM A;  4R23 A;  1L2S A;  3I7J A;  3LR5 A;  3BY9 A;  4BD1 A;  3D9Y A;  3AGF A;  4IUK A;  5TFQ A;  5GLA A;  2XLN A;  1DJA A;  4JXG A;  4YIN A;  1ES2 A;  4IED A; 
#chains in the Genus database with same CATH homology
 3NHQ A;  3CWF A;  4YNR A;  4PKY G;  1S4S A;  3LUQ A;  1NWZ A;  3T4L A;  5DKL A;  3ZYT A;  2OWJ A;  3MQQ A;  3NOT C;  5J7E A;  2G7U A;  2PD8 A;  3PBO A;  2DMW A;  4UQI S;  5AVF A;  1T1A A;  2O99 A;  5FL3 A;  1XJ2 A;  3BJN A;  4KUO A;  1Y28 A;  5K5B A;  2W3D A;  5HWT A;  3C38 A;  5EFW A;  3P01 A;  3JVV A;  3NOU C;  2WKP A;  1N9L A;  4HH3 A;  4HP9 A;  4AFI A;  4CLC E;  2EWV A;  3T50 A;  2EA9 A;  2WKQ A;  4MCW A;  2PDR A;  4ETZ A;  1EW0 A;  2V9A A;  3F1N B;  2K7S A;  2JN7 A;  4MDZ A;  4F3L B;  2FZ0 A;  4WF0 A;  2P7J A;  1T1B A;  3DBA A;  3LYX A;  3LR3 A;  4ZRR A;  3R4K A;  4EEP A;  4HHD A;  2GZA A;  4GJ4 A;  3EQU A;  2JHE A;  3FPV A;  3JVU A;  4YOF A;  2GNX A;  3CAX A;  2V1A A;  4CLC C;  2OWH A;  2ZOI A;  3UB6 A;  4O0P A;  2PT7 A;  3K2N A;  2XA7 S;  2HF6 A;  5J3W A;  4YWZ A;  1TS6 A;  3IS2 A;  4LRX C;  2QJ5 A;  4P6Z M;  2K2N A;  2XRN A;  2Y8H A;  5AVE A;  4PAU A;  1OT9 A;  5HPI A;  3E4P A;  3VE4 A;  4UEY A;  3C2W A;  2PR6 A;  3IS2 B;  3H7W B;  4EET B;  4MMN A;  3IBR A;  2O9A A;  2P04 A;  4BWI A;  2VX8 A;  4KUK A;  2W1R A;  5DJU A;  4Y2F A;  3OBF A;  4O8G A;  3S7P A;  4DN0 A;  2HV1 A;  4LRY C;  3G6O A;  3T4K A;  2PYP A;  4HI4 A;  2INW A;  5A8B A;  5TBM B;  3F1N A;  1XJ3 A;  3MQ0 A;  5MC7 A;  2D01 A;  1P0Z A;  4KQO A;  5HL6 A;  2XRO A;  5DKK A;  1G28 A;  2FH5 A;  1F98 A;  4FSF A;  4DJ3 A;  5HWV A;  5TJJ A;  2IA2 A;  3F1O B;  3F1O A;  5HDD A;  2J3T D;  5IU1 A;  1GSW A;  4H6J A;  1ZHH B;  1NLZ A;  3KYQ A;  3KO6 A;  3RTY A;  3LR4 A;  4R6L A;  2PHY A;  5L8M A;  5HSQ A;  3R7W A;  3MFX A;  2XSS A;  3UE3 A;  4CLC D;  2A2L A;  4CLC B;  4OOL A;  4B93 A;  3UMD A;  3MR0 A;  1TD5 A;  3B42 A;  1G6O A;  4M4X A;  3PR6 A;  2D02 A;  2JKT M;  3PBS A;  3VE3 A;  2VJW A;  4Z1W A;  4HNB A;  2HJ9 C;  4GHI A;  1S1Z A;  4WEK A;  1LT0 A;  3BW6 A;  3LIF A;  2PR5 A;  2M7U A;  4IUH A;  4EER A;  3PBT A;  3LI9 A;  1S67 L;  2VV7 A;  3EGD C;  3TW8 A;  5HWW A;  2JKR I;  2I9V A;  1TS0 A;  2J80 A;  3T4Q A;  4O01 A;  1MZU A;  2GJ3 A;  4RQ9 A;  1UGU A;  4WLA A;  3LR0 A;  3KSH A;  4JGR A;  4MN5 A;  1ODV A;  5KIZ A;  4HIA A;  4HH2 A;  3LIE A;  2KDK A;  2VEA A;  1OT6 A;  2QYB A;  4L9E A;  4L9G A;  1LL8 A;  4R38 A;  2J3T C;  4I39 A;  1DP6 A;  3CUE A;  2M1C A;  2Z6D A;  1YSQ A;  4E04 A;  5DFX A;  1D06 A;  1LSV A;  4GS9 B;  4PKY A;  1N9N A;  2CMN A;  2NUP C;  3RFB A;  1JNU A;  2H28 A;  2QHK A;  4EEU A;  2JKR M;  2YKF A;  1TS7 A;  2ZOH A;  4Y5F A;  3ULF A;  3B47 A;  2W3F A;  3TJZ C;  5C5K A;  5DFY A;  3SW1 A;  2J3W A;  3S7N A;  1V9Y A;  3B33 A;  1IFQ A;  1P97 A;  5I5L A;  3H82 A;  2Z6C A;  5KSH A;  3VV4 A;  1F9I A;  4PHT A;  4CLC A;  3H82 B;  4Q0J A;  3UB8 A;  1IOU A;  4BBU A;  3OOV A;  4ARZ A;  2VKS A;  3E4Q A;  4P6Z S;  2W3E A;  2ZMF A;  4GS9 A;  1W63 Q;  1H8M A;  2W1T A;  4NEE D;  3MMH A;  2V0U A;  3T4J A;  4DJ2 A;  2XA7 M;  5F6A A;  3F1P B;  2VZW A;  1GSV A;  1ZTU A;  3OC2 A;  4R70 A;  2BAS A;  3CUE C;  3S7O A;  4K08 A;  2HGV A;  1YAX A;  1OPX A;  2W3H A;  5J4E A;  3ICY A;  2VV8 A;  4GW9 A;  4XT2 A;  3GEC A;  2NUT C;  2VV6 A;  1DRM A;  4HJ4 A;  4HJ3 A;  2QWS A;  3A0S A;  4NKP A;  5F69 A;  3EGX C;  3KSF A;  1MC0 A;  3VOL A;  5DJT A;  3BQA A;  3V67 A;  4BMW A;  5HD3 A;  3EQV A;  5F5Y A;  3A0R A;  3P7N A;  2WKR A;  2M7V A;  1XJ4 A;  1GSX A;  4II7 A;  4ETX A;  1NLY A;  3BWL A;  3KYZ A;  3CLO A;  1UWP X;  3PXP A;  2ZBB A;  4GHI B;  3O5Y A;  5HDC A;  5HPF A;  3HJI A;  4Q0H A;  4EUV A;  4R3A A;  1N9O A;  3UB7 A;  3MQO A;  1YSP A;  2O9B A;  3E4O A;  3C8C A;  2V1B A;  4WN5 A;  5CX7 A;  2LB9 A;  2W27 A;  2K31 A;  1D7E A;  1TF1 A;  3PHY A;  4HP4 A;  4I5S A;  3H9W A;  2Y79 A;  2KX6 A;  2MJ6 A;  3F1P A;  4L9F A;  3R7W B;  3RH8 B;  3S7Q A;  2W1T B;  3MF0 A;  4EQ1 A;  3NOP C;  4EW7 A;  4H6J B;  3UME A;  3A0V A;  4BBT A;  4G3K A;  5G4Z A;  3C30 A;  3OCL A;  1MKM A;  3LIC A;  4F3L A;  2LB5 A;  5DF9 A;  2VGL M;  1STZ A;  3PBR A;  5HDS A;  3K3D A;  4NXE A;  3CIT A;  2PYR A;  3FPW A;  3KX0 X;  3PYP A;  4IJG A;  5F68 A;  2O0Y A;  1NRJ A;  3FC7 A;  3D72 A;  1VHM A;  4Q0I A;  3OLO A;  1OJG A;  3EEA A;  4HQA A;  1P9W A;  2JKT I;  4GCZ A;  2GX5 A;  5IS1 A;  2A24 B;  2A24 A;  2KOI A;  3BQ8 A;  2O9C A;  5LBR A;  4B9O A;  1XJ6 A;  3NJA A;  4NXF A;  2VGL S;  3KSG A;  4CQH A;  1P9R A;  4BJP A;  4ME4 A;  3PBN A;  3GDI A;  1XFQ A;  3KSI A;  3U2A A;  3W2Z A;  4EU0 A;  2OOL A;  1W63 M;  4FOF A;  5IT5 A;  4G3W A;  2R78 A;  4L0L A;  1S66 L;  4JGO A;  2QKP A;  2VA0 A;  4WL9 A;  3E98 A;  2B02 A;  3D3O A;  1OTI A;  4BBV A;  4LLO B;  3T4T A;  4GLQ A;  3UE6 A;  3BY8 A;  2L4R A;  3IBJ A;  4ARZ B;  1OTA A;  3EOI A;  4DMZ A;  5AJG A;  4IHQ A;  4WEJ A;  3LIB A;  1WA9 A;  3HJK A;  3TRC A;  1T19 A;  1DP9 A;  4MN6 A;  1S4R A;  3ZQ5 A;  3OCN A;  3T4O A;  3LIA A;  3MJQ A;  4I38 A;  4MN7 A;  2L1M A;  1T1C A;  2OAP 1;  1OTE A;  1LSX A;  1H3Q A;  3FG8 A;  1DP8 A;  1S1Y A;  4HJ6 A;  4KQD A;  2KLI A;  4LPZ A;  2OAQ 1;  1YKD A;  3TE8 A;  4HOI A;  2VLG A;  2PD7 A;  1XFN A;  5G4Y A;  3EWK A;  5HZH A;  4NXB A;  5TBM A;  3UB9 A;  4UQI M;  4WUJ A;  5HD5 A;  4HY8 A;  4I3I A;  4I3J A;  3LFV A;  4EXO A;  3EEH A;  1KOU A;  3MXQ A;  3T4S A;  3E0Y A;  2P08 A;  2QJ7 A;  3PBQ A;  3CI6 A;  1OTB A;  4OOM A;  3HCY A;  1TS8 A;  1BYW A;  2W0N A;  2EWW A;  1LSW A;  1UWN X;  2YKH A;  4G3V A;  4EES A;  3LID A;  4NXG A;  2V0W A;  1F5M A;  1X0O A;  2ZMV A;  4QPR A;  1OTD A;  2HJE A;  1VB6 A;  4LRZ E;  1OJ5 A;  3LR5 A;  3BY9 A;  2L0W A;  4JGP A;  4XT2 B;  4JGQ A;  4WEL A;  4IUK A;  4I3A A;  3H7W A;  1T18 A;  2W3G A;  4Y3I A;  3K3C A;  1V9Z A;  2B18 A;  3LI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...