3UB9A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with hydroxyurea bound
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
162
structure length
162
Chain Sequence
AQLMEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 58
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub9A00
5J3WA 2OOLA 1XJ4A 3MJQA 3VE3A 1EW0A 2PYRA 3T50A 2WKQA 1XJ2A 4HH3A 1F98A 3LICA 3CLOA 4I3JA 3F1PA 5EFWA 4LPZA 4YWZA 1OT9A 2W0NA 1OT6A 4HJ4A 1S1YA 5AVEA 5G4YA 5HDDA 3SW1A 2PD8A 4LLOB 5HD3A 4HI4A 3PYPA 3LIFA 3LI8A 2V1BA 2PYPA 5HSQA 2L0WA 1D06A 3IBRA 4LRYC 3NOPC 1OJGA 3MFXA 3MQOA 1XFNA 3K3CA 2H28A 3P7NA 2Z6DA 3NOUC 1T1BA 3F1OA 2OWHA 3B33A 3GECA 3K3DA 3IS2A 3PHYA 4XT2B 3UB6A 3LIAA 5HWVA 3NOTC 4JGOA 2PR6A 4LRZE 2VV7A 4HOIA 2J80A 4GHIB 2V0UA 3G6OA 1S67L 1UWNX 2I9VA 4I38A 3F1NB 1D7EA 5HZHA 1V9ZA 1G28A 4R6LA 3F1OB 2QJ5A 4BBTA 4WL9A 2KDKA 2PD7A 3MXQA 2JN7A 2QKPA 1GSXA 4GW9A 5J7EA 3BY9A 1MZUA 3KX0X 3ULFA 1TS0A 4KUOA 4R38A 4MN6A 3EWKA 1KOUA 1JNUA 4EETB 1S4RA 3H7WB 1OJ5A 2A24B 5J4EA 4MN5A 1GSVA 5IS1A 3LUQA 4H6JB 3VE4A 1X0OA 5AVFA 2D01A 5DKLA 1VB6A 1T18A 1T19A 1TS8A 5DKKA 2KX6A 1XFQA 3E4QA 2WKRA 3UB9A 3ICYA 5HDCA 2ZBBA 1DP6A 4EERA 2PHYA 2BASA 4XT2A 1OTIA 2VLGA 1OTDA 4KQDA 3LI9A 3C8CA 1P97A 2YKFA 4HJ6A 4GHIA 5HWTA 3A0VA 2R78A 4GS9B 4BBVA 3F1NA 4NXFA 4HNBA 4EXOA 4I3AA 5HWWA 5KIZA 3A0SA 4I5SA 1GSWA 4HP4A 4F3LB 4HP9A 3C2WA 2W27A 2ZOIA 4DJ3A 3LYXA 1S66L 3UB8A 3BWLA 2CMNA 4WUJA 2L1MA 4LRXC 4R3AA 3H7WA 3ZQ5A 2A24A 4M4XA 4WN5A 3RTYA 4EEPA 1N9LA 4HY8A 3MR0A 4H6JA 2JHEA 3H82B 3E4OA 4B9OA 2D02A 5F69A 2M1CA 1OTAA 2QJ7A 1UWPX 3UB7A 3MQQA 2V0WA 2PR5A 1LSVA 4I3IA 4EESA 1LL8A 1UGUA 3CWFA 4DJ2A 4WLAA 4BBUA 5TBMB 1TS6A 3A0RA 3NJAA 1OTEA 1LT0A 2PDRA 4HQAA 2OWJA 4HHDA 4NXGA 1S1ZA 5G4ZA 4HH2A 2GJ3A 1T1CA 5I5LA 1V9YA 4GS9A 3UMDA 1Y28A 3RH8B 5F68A 4E04A 5A8BA 4RQ9A 4JGPA 3GDIA 1XJ6A 1N9NA 3LIDA 4F3LA 3EEHA 1BYWA 2VV6A 1NWZA 2WKPA 5IU1A 5DJTA 2QWSA 4NXEA 2INWA 3HJIA 4HJ3A 3D72A 2P7JA 1OTBA 3NHQA 1ODVA 3BY8A 1P0ZA 1T1AA 4I39A 3UE6A 3F1PB 3LIBA 1LSXA 4PKYA 4NXBA 4R70A 4EEUA 4JGQA 3OLOA 2B02A 4EQ1A 1N9OA 4PKYG 3H82A 1DRMA 2Z6CA 3UMEA 4K08A 4GCZA 2V1AA 3VOLA 5HD5A 2L4RA 2K7SA 1TS7A 5DJUA 5F5YA 1DP9A 1WA9A 2HV1A 2VEAA 2VV8A 3FG8A 3CAXA 4L9GA 1LSWA 2YKHA 5TBMA 3E4PA 5F6AA 4EW7A 3HJKA 3H9WA 3LIEA 2V9AA 1DP8A 4L9FA 4HIAA 5HDSA 3FC7A 1F9IA 4WF0A 3IS2B 4JGRA 1XJ3A 4KUKA 1S4SA 2ZOHA 2EA9A 2QHKA 4L9EA
chains in the Genus database with same CATH superfamily
3CI6A 1N4OA 5E2GA 4AFIA 1MPLA 5FAQA 4X56A 3DTMA 3PBQA 3CPTA 1XJ2A 2P08A 1XX2A 3PBNA 3A3EA 1PZPA 4KZ7A 4PM7A 4U0TA 2W3GA 1J3WA 1KGFA 4ETXA 3N8RA 4YWZA 4H8RA 5I94A 1NLZA 4OPQA 2HDUA 5AVEA 1PYYA 2PD8A 3DAVA 3KYEA 1F5MA 3PYPA 5TFQA 1QMEA 4Y7PA 3IHBA 3OPLA 4YINA 4KG5A 1FCOA 4MNRA 4EUVA 3IHAA 1K55A 1FSWA 4X25A 4PMAA 3MQOA 4LCMA 1MXOA 3P7NA 2O0YA 2OWHA 3C5AA 2GZAA 3JVUA 1K54C 3GTCA 3UB6A 3LIAA 1YLJA 5L8MA 4UQIS 3BECA 5EV0A 2RCXA 1ESUA 5AQBA 3I7JA 2HGVA 4KZ4A 3G6OA 1S67L 2I9VA 3LY3A 1GHIA 4PHTA 1KVLA 1CI8A 2KLIA 4LCLA 3HLBA 2JKRM 4E3JA 3Q82A 1PWDA 4WL9A 4KQQA 3ZNTA 3MXQA 2QKPA 2J9OA 4OQGA 1YLTA 5EVIA 3R7WB 3PBOA 2FH5A 4R38A 1KE0A 3S7NA 3V50A 2M7UA 3H7WB 4S2IA 3G4PA 2VGLM 3M6BA 3ZG9B 5F1FA 4FSFA 1BLHA 5IS1A 1HZOA 1SKOA 4O0PA 1H8MA 2VGJA 1G5UA 2K31A 5E2HA 3IQAA 5K5BA 1C3BA 1Y4OA 3HLDA 1T18A 4HEFA 5DKKA 3VP0A 4S2NA 4ARZA 3QP6A 2ZBBA 5FEGA 3Q7ZA 4R4RA 1SHVA 4N92A 2XLNA 4Z1WA 3UB5P 1BZAA 3BFFA 1NXYA 2H0TA 5HL6A 4XT2A 2XEPA 2EFUA 4KQDA 2G7UA 3ZGAB 3N8SA 3KYZA 5FSRA 4FTXA 4XUZA 3WRTA 1P97A 3G2YA 4GHIA 3A0VA 2W1TA 1ZG4A 4UAAA 5HFOA 5L10A 4Q0HA 1YAXA 5DTTA 4I3AA 5AQ7A 4EUZA 5AQ9A 2JKRI 5KIZA 5A92A 4OP5A 4HP4A 2C5WB 3HLEA 2CC1A 1P9WA 4MDZA 2VX8A 3LYXA 2ZC4B 4R4SA 4E3OA 3UO9A 1FOFA 1FR1A 2CMNA 2QYBA 3HREA 2WUQA 1FQGA 2IWCA 3FV7A 4WUJA 5LBRA 2L1MA 2ZMFA 3AGDA 4LRXC 5IHVA 3W4QA 1KGEA 3TE8A 2A24A 4M4XA 3CITA 2MJ6A 3LEZA 1N9BA 4X6TA 3SZTA 4EWFA 2ZC3B 4H6JA 1BSGA 2JHEA 4C6YA 5DVAA 1JWPA 5F69A 3TRCA 3RXWA 1BUEA 5DFYA 2G2UA 4GDNA 4FH2A 4N9LA 2XFSA 3DW0A 4FUWA 3DWZA 2R9WA 1JWZA 2PR5A 4EESA 2ZC7A 3MBZA 3OBFA 2EWVA 5HW3A 2WGIA 2Y2LA 3T4SA 2OAP1 4CLCA 1W5DA 3NJAA 4OVDA 3EGDC 2PU2A 2V8FA 4HQAA 1YLYA 5E2FA 4OPYA 2WZZA 1J9MA 2RL3A 4HHDA 2IWBA 4K0WA 1JVJA 3Q7VA 4NXGA 5G4ZA 2XK1A 5HPFA 3OZHA 4GN2A 1V9YA 1P9RA 3OPPA 5HAPA 4QB8A 2HZ5A 4RQ9A 1PRQA 4JGPA 5FQKA 2XDMA 4S2LA 2EFXA 2JCHA 2WAEA 1NWZA 4CQHA 3LR5A 4NXEA 3QNBA 4JXGA 3MQ0A 4S2JA 1P0ZA 3MMHA 5FEFA 3OCNA 5FQJA 1L0DA 1BTLA 1T1AA 4WYYA 2Y2GA 3LIBA 1LSXA 2IA2A 4ZAMA 4JGQA 2B02A 4EQ1A 4PKYG 4P6ZM 3D4FA 1DRMA 1XP4A 1RCJA 4O01A 4EV4A 4UHUA 3S1YA 2K7SA 1SKFA 1TS7A 1K56D 3MZEA 2HDSA 1TEMA 3FG8A 4L9GA 3TG9A 2XGNA 1NRJA 1YT4A 1XPBA 3E4PA 5F6AA 4EW7A 3BLMA 3H9WA 3VP3A 3D9YA 1G68A 4NETA 4IUHA 5JYOA 4BD1A 5A93A 2Y8HA 1LI0A 1W7FA 5HDSA 1F9IA 1K6SA 1OPXA 4KQRA 4GD8A 3IS2B 3LR4A 2XROA 4KUKA 3V3RA 1S4SA 2ZM0A 1NY0A 4OKPA 4MBHA 3M2KA 3K2NA 2Y2QA 4WEJA 2A49A 3VE3A 1EW0A 5DTSA 3HUMA 4E3KA 2WKEA 3U2AA 3PR6A 1WYBA 4Y2FA 1I5QA 3WS2A 2H10A 1E3UA 2V8CA 2WKQA 4X69A 4OLGA 4KZ9A 5FA7A 4BLMA 4JLFA 5E2EA 3CLOA 2VZWA 2P9VA 1CEFA 5L09A 1GA9A 2XA7M 3TOIA 3R4KA 2PT7A 3U4LP 3QP4A 4EBPA 3ZYTA 1OT9A 2W0NA 1OT6A 3A3DA 1I2WA 2XRNA 1IKIA 2WKIA 4PM5A 3W2ZA 2P74A 3SW1A 2Y2IA 2ZQ8A 4O7DA 3WRZA 2Y91A 4HI4A 3O3VA 3ZG8B 3EGXC 3LI8A 1L0GA 2L0WA 1D06A 1IFQA 1VETA 1H3QA 3CUEA 1OJGA 3NULA 3CZDA 2Z2LB 2ZL1B 1XFNA 4D2OA 2ZLYA 5GLAA 5FQ9A 1PFLA 2Z6DA 2O9BA 3T4JA 3IWIA 1QMFA 1T1BA 1CI9A 5FQIA 3FKWA 3B33A 4Y13A 1NRFA 4EBLA 3OPRA 2PBDP 5KSHA 1YSPA 2HP9A 4E6WA 3C4OA 1L0FA 5F1GA 1MWRA 3MKFA 1FCNA 1HVBA 1YLWA 4KZ3A 4ZBEA 2V0UA 3BFEA 3VV4A 4I38A 3UY6A 2HPBA 1V9ZA 1G28A 2M7VA 4PM6A 1AXBA 4QY6A 4NG2A 2KDKA 4MBKA 2JN7A 3DBAA 3LCEA 5J7EA 4G3KA 4Z9QA 3NI9A 4X55A 3EOIA 1IKGA 1K4FA 3GVBA 3ULFA 4GD6A 1JTGA 3C30A 4NEED 3G2ZA 4S2OA 5FI7A 3UPPA 1KOUA 3FYZA 2OV5A 1S4RA 1OJ5A 3KO6A 3IF6B 3T1SA 3UNWA 4PM8A 1YSQA 3IH8A 5CX7A 1HTZA 3VE4A 4B4XA 1X0OA 3MF0A 1NLYA 1OMEA 5FDSA 1MBLA 3UE1A 1HD8A 5DKLA 1VB6A 5FAPA 1T19A 4Q0JA 1M6KA 3BLSA 3UB9A 2Z2MB 5HDCA 1DP6A 3VOZA 3RFBA 3BM6A 3FZCA 2DNSA 3E2LA 1IEMA 5BOHA 3KSIA 4ETZA 3GQZA 1OTDA 5FASA 4HBTA 4PAUA 4HJ6A 3GMWA 2R78A 4ZJ2A 4LGWA 4ZTKA 1FCMA 3W4PA 4LENA 4BBVA 3F1NA 5CRFA 4MMNA 3S4XA 4I5SA 4E3LA 2WGWB 3N8LA 4Y15A 3ZNYA 3HBRA 4F3LB 5FQMA 4BL3A 1CEGA 1ESIA 4IBXA 2LB9A 3FWLA 2W3FA 2C6WB 4X53A 4OOLA 4Y3IA 1CF0A 5M19A 3DTIA 3AGEA 3C7VA 4WN5A 4P6BA 1K25A 1RGZA 4XUXA 3LFVA 4BWIA 3EQUA 3NDEA 1ES3A 4JXVA 5MC7A 2I72A 3PAEA 2VA0A 5TGFA 3NBLA 4LV3A 1JTDA 1VHMA 3UB7A 4DDYA 1Z09A 5L2FA 3T1XA 1ERMA 1IYSA 2V0WA 4DRTA 1LSVA 3PXPA 2JKFA 4JF5A 4X1MA 3T1QB 3CWFA 3G32A 4IUKA 4KZAA 4WLAA 4GLQA 5FATA 1IELA 1GA0A 3A0RA 3MFDA 1OTEA 3BW6A 1G6AA 2W3HA 5GHYA 4OPRA 3IXBA 3VFHA 2B5RA 3NY4A 2GJ3A 4MN7A 2DCFA 4MLLA 4GS9A 3UMDA 2XR0A 3QHYA 1GHPA 3RH8B 2W1RA 4E3NA 3VP2A 3SS5A 5DTKA 2A3UA 2V1ZA 1K54A 4BENA 3HCYA 3EEHA 3GRJA 1BYWA 5FI2A 5IU1A 5DJTA 5FQQA 3T4LA 3N6IA 2INWA 4S2PA 3CPTB 4HJ3A 5CEBA 3G34A 3BY8A 4QWOA 3M2JA 2WK0A 3DTKA 1DJAA 2OLVA 4DDSA 4PKYA 4NXBA 3IXGA 5AQAA 2JKTM 4R70A 3IX8A 2J3WA 3OLOA 3H82A 3O88A 4UA9A 3UMEA 4ZJ1A 4K08A 2XSSA 3ITBA 1NZOA 5HD5A 3OPHA 1KE4A 5DJUA 2XQZA 5CXWA 1WA9A 3DWKA 2PRFA 2VV8A 3CAXA 2WKHA 1K6RA 3TJZC 3HLWA 3VMAA 2YKHA 5TBMA 3SH8A 3NCKA 4Q8IA 3HJKA 4ZJ3A 4WMCD 2HF6A 1GHMA 4IJGA 1CQAA 1NYYA 2V9AA 3FC7A 3IXHA 3QP2A 1EWZA 1YMSA 5GLCA 4FD8A 3JYIA 1XJ3A 1MWUA 1IOUA 2JE5A 4EBNA 3ZFZA 2QZ6A 5FAOA 1NZUA 4MBFA 5J3WA 2OOLA 3MJQA 1DJCA 4CLCE 2ACGA 1EROA 5HARA 2Y2NA 2PYRA 4E3IA 3IF6C 1K57C 1YLPA 4YOFA 3T50A 4GNUA 4OQ0A 4DXBA 4HH3A 2ZMAA 3UPOA 3ZG0A 3L9KA 4I3JA 3F1PA 5IT5A 2Y2PA 2Y2KA 5CEDA 2OAQ1 1IYQA 2XD1A 2EX9A 5CTMA 1ONHA 3QP5A 2XA7S 3S7PA 4LPZA 5EVLA 3IBJA 2JKTI 1M40A 4DE2A 1Y54A 1S1YA 3E98A 1STZA 4YFMA 5G4YA 3UE0A 4FOFA 1VEUA 3MKEA 1TD5A 1O7EA 1SKOB 3LIFA 3T4KA 2PYPA 4O8GA 4DE1A 2W3DA 3CG5A 1LL9A 1KE3A 1YM1A 3IBRA 3NOPC 3NECA 4RA7A 4BL2A 1BLCA 3OCLA 3VSLA 2GNXA 3QNCA 2FFFB 3LR0A 5F83A 1XKZA 2H28A 4ARZB 4Q0IA 5D3OA 3NOUC 1S0WA 2WAFA 1KDWA 4OP8A 3HUNA 1K0KA 3K3DA 3OC2A 3LY4A 3A3FA 3PHYA 4XT2B 1VM1A 2HDQA 2PU4A 3E2KA 4JGOA 3C7UA 5GL9A 2PR6A 3EQVA 4LRZE 3MSHA 3VP1A 4P85A 3VOYA 3T4OA 4HESA 4N1XA 4RVAA 4R3JA 2J80A 4GHIB 3Q07A 1BULA 4KZ8A 1L3LA 2ZQCA 3VFFA 4BQMA 1AWIA 3LO7A 2W1TB 1YKDA 1UWNX 4N9KA 5GHXA 1XA1A 1D7EA 2WGVA 3CUEC 3O5YA 3F1OB 4BD0A 3QP1A 3HLCA 3LGOA 4BBTA 2OSUA 2PD7A 4EQIA 1RP5A 3LEQA 3KSFA 3MZFA 3QP8A 3E0YA 3HLGA 4KUOA 3SS4A 3IWOA 1JNUA 4EETB 4OONA 2E8IA 4DE3A 3NC8A 2A24B 5J4EA 3ZVWA 5EPHA 4MN5A 2FFYA 1DJBA 1GSVA 3CMZA 3LUQA 4QY5A 4H6JB 1I2SA 2ZMVA 4JF4A 5G18A 5AVFA 4IHQA 2D01A 1FIKA 4WZ4A 1XFQA 3E4QA 3EEAA 2BTFP 3ICYA 5DFXA 1DY6A 5M18A 4UA7A 4EERA 2B95A 1KVMA 1TF1A 2Y59A 2DMWA 3V5MA 4Y0UA 2BASA 2EX8A 3PAGA 4ID4A 5U47A 4CLCB 1ZTUA 4GDBA 3T12B 3LI9A 3C8CA 2Y55A 2YKFA 4IVKA 1MWTA 1LI9A 3C4PA 4NXFA 2NUPC 2GDNA 3S7QA 1U60A 4KG6A 1IYPA 1L2SA 2OLUA 4JBFA 3BEBA 4EXOA 5HWWA 3A0SA 2P04A 1GSWA 4HP9A 3R7WA 2ZOIA 3CHWP 3PBSA 5EVID 1Q2QA 3BQ8A 3T1RA 2EWWA 2Y2HA 3H7WA 3ZQ5A 1PWCA 3RTYA 3TW8A 2ZM8A 4EU0A 1K55C 4HY8A 4WZ5A 1LL5A 3MR0A 1E4DA 4U0XA 5EM0A 3E4OA 5CHMA 3JVVA 3Q81A 3ZG7B 3IX4A 5CECA 1Q2PA 4IVIA 1K56A 3P09A 1ES4A 3IH9A 2X02A 3FPVA 5EECA 1RGYA 3CJMA 2WADA 3V3SA 4KZBA 2VGLS 4DJ2A 2K2NA 1TS6A 5CERA 2HJEA 2PDRA 3SH7A 4B88A 1W8YA 1FR6A 1IYOA 2WYXA 3D3OA 1H5XA 4HH2A 5GLBA 1E25A 4R0QA 4S2KA 1YMXA 4IEDA 3MXSA 3B42A 1W63M 5EVIC 3KSGA 4KZ6A 4OOYA 4E04A 1JWVA 5CTNA 1XJ6A 1N9NA 2Q0OA 2VV6A 2WKPA 2Y2OA 1SDNA 1HLUP 5HPIA 2P7JA 4OPZA 1ES5A 4JXWA 5EUAA 3NIAA 3UE6A 2P9VB 4E6XA 4DXCA 3G31A 4EEUA 4S2NC 1N9OA 1GCEA 4C75A 2QPNA 4S2MA 4NKPA 2Z6CA 5EM1A 2Y4AA 5EE8A 4R3BA 2J7VA 2JBFA 2BLSA 3Q1FA 4R23A 2B18A 2L4RA 1DP9A 2XF3A 1KDSA 2VEAA 1VETB 3P98A 5KMWA 4UEYA 1FSYA 2A2LA 3MXRA 3LIEA 4CLCD 2W3EA 2ZQ9A 4L9FA 5GHZA 1SDEA 1YQSA 4B4ZA 1ZC2A 1WE4A 2Y2JA 4YNRA 3ZCZA 1L0EA 3WS5A 2ZOHA 1YPRA 4NK3A 2H5SA 4JF6A 5F82A 2QHKA 1W63Q 5HAQA 1VQQA 1XJ4A 4P0MA 2ZC5B 3BRMA 1K4EA 3GR2A 2UV0E 3UDXA 1ACFA 4MCWA 5FL3A 4F94A 2ZD8A 4WBGA 1BLPA 1F98A 3LICA 4MEZA 3NDGA 4WELA 4G3VA 4GJ4A 4HBUA 2PBYA 2J9PA 1BT5A 5EFWA 5A90A 4IBRA 2BG1A 1SCWA 4HJ4A 4K91A 2WZXA 3ZHHA 5HDDA 2EXBA 3BJNA 1MKMA 1PNEA 4LLOB 5HD3A 1W8QA 5DF8A 4B93A 4CLCC 4JKTA 4X68A 4Y0OA 5TR7A 2V1BA 4KG2A 5HSQA 1TVFA 3PBRA 4LRYC 3HL9A 3WWXA 2G2WA 3BFGA 3MFXA 1H8ZA 3FKVA 2J8YA 3K3CA 1XGJA 4P6ZS 3ZDJA 3ISGA 2O99A 2Y2MA 3W4OA 1PI4A 1TDLA 1K38A 3F1OA 3GECA 3IS2A 2FZ0A 4Y17A 5HWVA 3NOTC 4UQIM 4RX3A 2VKSA 3N7WA 3KYQA 4RX2A 2VV7A 3A3IA 5KSCA 3A3JA 4HOIA 2VJWA 3UN7A 3M6HA 2ZQDA 3B47A 3V39A 3F1NB 1ZG6A 5HZHA 4JXSA 3AGFA 4R6LA 1ONGA 4XXRA 2X71A 2QJ5A 1PW8A 2QMIA 1E3UD 2ZQ7A 1MWSA 3G30A 1GSXA 5EOOA 4GW9A 4UA6A 3MZDA 2IWDA 3BY9A 1MZUA 2Q9NA 2UWXA 3KX0X 5HL1A 1TS0A 1XXMA 4OQHA 3BYDA 4PPRA 4M3KA 1H0MA 3UDIA 3WS1A 5FDHA 4MN6A 3EWKA 1PW1A 4LV1A 2JKGA 3O87A 4GKUA 3UE3A 2DRWA 1W79A 4OQIA 3JPUA 5AJGA 4OOMA 2J3TD 1ES2A 1TDGA 1KGGA 5EVIB 1WYCA 4BJPA 4CPKA 1TS8A 3KSHA 1PIOA 2KX6A 2ZL1A 2WKRA 4QHCA 5A91A 4WEKA 2H0YA 2EX2A 4Y5FA 3SS3A 5TJJA 1ZHHB 2PHYA 2KOIA 1F2KA 1OTIA 2VLGA 3MS6A 1MY8A 1FILA 4QD4A 1ALQA 3UDFA 4G3WA 5HWTA 3BFDA 4X1LA 2Q9MA 4GOGA 3W8KA 1MC0A 4GS9B 3PTEA 1PWGA 4HNBA 3T4TA 3T4QA 1A0KA 5CHJA 5J8XA 2NUTC 5KZHA 5CGXA 1YLZA 4II7A 4P87A 5DF7A 3C2WA 2W27A 2PAVP 1NJ4A 4DJ3A 2O9CA 3DTEA 1S66L 2HDRA 4QU3A 3UB8A 4BMWA 1G6OA 4D60A 4JPMA 3BWLA 3N4IA 2EX6A 2LB5A 2J3TC 2HP5A 4R3AA 4WM9A 4PM9A 2Y79A 4FH4A 2GX5A 4E3MA 3IF6A 1K57A 4DMZA 4QJGA 1O07A 4EEPA 1N9LA 2VGKA 5CGWA 1D1JA 3G35A 2R9XA 3H82B 4LV2A 4B9OA 2D02A 4LFUA 4K0XA 4KZ5A 2M1CA 1OTAA 3OOVA 2QJ7A 4GZBA 1UWPX 3VP4A 1PZOA 3UPNA 1Z6FA 5M1AA 3IXDA 4OH0A 5CGSA 1H8YA 3MQQA 4L0LA 5HX9A 4I3IA 2HP6A 3L7HA 5JYPA 1LL8A 1UGUA 3GSGA 3IT9A 1LLBA 4BBUA 1S6RA 4ZDXA 5TBMB 3BQAA 4WMCA 3B3XA 5C5KA 1LT0A 3S7OA 2OWJA 1ZKJA 4KQOA 4N1HA 2O9AA 1PI5A 3ZG5A 3HUOA 2XH9A 1S1ZA 5EVEA 1T1CA 1XGIA 3FPWA 4WZ5C 5FI6A 5I5LA 2ZJ9A 3WS0A 3LR3A 3O86A 1Y28A 3IWQA 3GV9A 3VSKA 5F68A 5CHUA 4DE0A 3SH9A 4ESPA 5A8BA 2WGWA 3GDIA 4DF6A 3LIDA 1XA7A 4F3LA 5DF9A 2V2FF 3IF5A 2XD5A 3C38A 2XFTA 3Q7VB 2QWSA 2JC7A 3HJIA 3D72A 1OTBA 3NHQA 1ODVA 2AVXA 3V67A 4Y0TA 5HAIA 4I39A 5E43A 3F1PB 3TSGA 3PBTA 4CJNA 2VK3A 4DKIA 2HJ9C 3RJUA 1BLSA 4FCFA 3P01A 5L07A 1CK3A 3IX3A 3ZVTA 3S22A 4R1GA 4A5RA 3HVFA 4GCZA 1NYMA 4LV0A 3WS4A 1VEUB 1LHYA 1EI5A 4DN0A 2V1AA 2ZC6B 3VOLA 1ERQA 2ZQAA 4QPRA 4GB7A 5F5YA 2HV1A 1CJFA 3BFCA 4C3QA 5GLDA 2X01A 1LSWA 3HLFA 1MKIA 4RYEA 2EXAA 3RXXA 3SOIA 1DP8A 1SZVA 4HIAA 2E8JA 4ZRRA 4WF0A 4JGRA 4ME4A 2V20A 4OLDA 5EOEA 4KENB 2EA9A 3ITAA 2ZM2A 4U3TA 4L9EA
chains in the Genus database with same CATH topology
3CI6A 5J3WA 1W63Q 3K2NA 4WEJA 2OOLA 1XJ4A 3MJQA 3VE3A 1EW0A 3U2AA 4AFIA 3PR6A 4CLCE 4Y2FA 2PYRA 3T50A 4MCWA 4YOFA 5FL3A 3PBQA 2WKQA 1XJ2A 2P08A 4HH3A 1F98A 3LICA 3PBNA 2W3GA 4G3VA 4WELA 4GJ4A 3CLOA 4I3JA 2VZWA 3F1PA 5IT5A 5EFWA 2OAQ1 2XA7M 4ETXA 3R4KA 2PT7A 2XA7S 3S7PA 4LPZA 3ZYTA 4YWZA 1OT9A 2W0NA 3IBJA 2JKTI 1OT6A 4HJ4A 1NLZA 1S1YA 3E98A 2XRNA 1STZA 3W2ZA 5AVEA 5G4YA 5HDDA 3SW1A 2PD8A 4FOFA 3BJNA 1MKMA 4LLOB 5HD3A 4HI4A 1F5MA 3PYPA 1TD5A 4B93A 4CLCC 3EGXC 3LIFA 3T4KA 3LI8A 2V1BA 2PYPA 4O8GA 5HSQA 2W3DA 2L0WA 1D06A 3IBRA 3PBRA 1IFQA 3NOPC 1H3QA 3CUEA 4LRYC 4EUVA 1OJGA 3OCLA 2GNXA 3MFXA 3MQOA 1XFNA 3LR0A 3K3CA 4ARZB 2H28A 4Q0IA 3P7NA 4P6ZS 2Z6DA 2O9BA 3T4JA 3NOUC 2O99A 1T1BA 2O0YA 3F1OA 2OWHA 3B33A 3GECA 3K3DA 2GZAA 3JVUA 3OC2A 3IS2A 5KSHA 2FZ0A 1YSPA 3PHYA 4XT2B 3UB6A 3LIAA 5HWVA 3NOTC 4UQIM 4JGOA 5L8MA 2PR6A 2VKSA 3KYQA 3EQVA 4LRZE 4UQIS 2VV7A 3T4OA 2J80A 4HOIA 4GHIB 2HGVA 2VJWA 2V0UA 3G6OA 1S67L 2W1TB 1YKDA 1UWNX 2I9VA 3B47A 3VV4A 4PHTA 4I38A 2KLIA 3F1NB 1D7EA 5HZHA 3CUEC 2JKRM 3O5YA 1V9ZA 1G28A 4R6LA 2M7VA 3F1OB 2QJ5A 4BBTA 4WL9A 2KDKA 2PD7A 3MXQA 2JN7A 2QKPA 1GSXA 3DBAA 4GW9A 3KSFA 5J7EA 4G3KA 3BY9A 1MZUA 3KX0X 3R7WB 3EOIA 3E0YA 3ULFA 3PBOA 1TS0A 2FH5A 4KUOA 4R38A 3C30A 4NEED 4MN6A 3S7NA 3EWKA 1KOUA 1JNUA 2M7UA 1S4RA 4EETB 3H7WB 1OJ5A 2VGLM 3KO6A 2A24B 3UE3A 4FSFA 5J4EA 4MN5A 1YSQA 1GSVA 5IS1A 3LUQA 5AJGA 5CX7A 4O0PA 4H6JB 2J3TD 4OOMA 2ZMVA 1H8MA 3VE4A 1X0OA 3MF0A 2K31A 1NLYA 5AVFA 5K5BA 4IHQA 2D01A 4BJPA 5DKLA 1VB6A 1T18A 1T19A 1TS8A 3KSHA 4Q0JA 5DKKA 2KX6A 1XFQA 3E4QA 2WKRA 3EEAA 3UB9A 4ARZA 3ICYA 5HDCA 5DFXA 4WEKA 2ZBBA 1DP6A 4EERA 3RFBA 4Y5FA 5TJJA 1TF1A 1ZHHB 4Z1WA 2PHYA 2DMWA 2KOIA 2BASA 3KSIA 4ETZA 5HL6A 4CLCB 4XT2A 1OTIA 2VLGA 1ZTUA 1OTDA 4KQDA 2G7UA 3LI9A 3C8CA 3KYZA 1P97A 2YKFA 4PAUA 4HJ6A 4GHIA 4G3WA 5HWTA 3A0VA 2R78A 2W1TA 1MC0A 4Q0HA 4GS9B 4BBVA 3F1NA 4NXFA 2NUPC 3S7QA 1YAXA 4HNBA 3T4TA 3T4QA 4EXOA 4MMNA 4I3AA 5HWWA 5KIZA 2JKRI 2NUTC 3A0SA 4I5SA 2P04A 1GSWA 4HP4A 4II7A 4F3LB 1P9WA 4HP9A 3C2WA 2W27A 4MDZA 3R7WA 2LB9A 2VX8A 2ZOIA 4DJ3A 3LYXA 2W3FA 2O9CA 1S66L 3UB8A 4BMWA 1G6OA 3BWLA 4OOLA 3PBSA 2LB5A 2CMNA 2QYBA 2J3TC 4Y3IA 4WUJA 3BQ8A 5LBRA 2L1MA 2EWWA 2ZMFA 4LRXC 4R3AA 3H7WA 2Y79A 3ZQ5A 3TE8A 2GX5A 2A24A 4M4XA 4WN5A 3RTYA 3TW8A 4DMZA 3CITA 4EEPA 1N9LA 4EU0A 2MJ6A 4HY8A 3MR0A 3LFVA 4H6JA 4BWIA 3EQUA 2JHEA 3H82B 3E4OA 5MC7A 4B9OA 3JVVA 2D02A 2VA0A 5F69A 3TRCA 2M1CA 1OTAA 3OOVA 2QJ7A 1UWPX 5DFYA 1VHMA 3UB7A 3FPVA 3MQQA 4L0LA 2V0WA 2PR5A 1LSVA 4I3IA 4EESA 3PXPA 1LL8A 1UGUA 3OBFA 2EWVA 3CWFA 4IUKA 2VGLS 3T4SA 4DJ2A 4WLAA 4BBUA 4GLQA 2K2NA 2OAP1 5TBMB 3BQAA 4CLCA 1TS6A 5C5KA 3A0RA 3NJAA 3EGDC 1OTEA 2HJEA 3BW6A 1LT0A 2PDRA 4HQAA 3S7OA 2OWJA 4KQOA 2W3HA 2O9AA 4HHDA 4NXGA 3D3OA 1S1ZA 5G4ZA 4HH2A 2GJ3A 1T1CA 3FPWA 4MN7A 5HPFA 5I5LA 1V9YA 3LR3A 4GS9A 1P9RA 3B42A 3UMDA 1Y28A 1W63M 3RH8B 2W1RA 5F68A 3KSGA 4E04A 5A8BA 4RQ9A 4JGPA 3GDIA 1XJ6A 1N9NA 3LIDA 3HCYA 4F3LA 3EEHA 5DF9A 1BYWA 2VV6A 1NWZA 2WKPA 5IU1A 4CQHA 3LR5A 5DJTA 3C38A 3T4LA 2QWSA 4NXEA 2INWA 3HJIA 5HPIA 3MQ0A 4HJ3A 3D72A 2P7JA 1OTBA 3NHQA 1ODVA 3V67A 3BY8A 1P0ZA 3MMHA 3OCNA 1T1AA 4I39A 3UE6A 3F1PB 3LIBA 1LSXA 3PBTA 2IA2A 4PKYA 4NXBA 2HJ9C 2JKTM 4R70A 4EEUA 2J3WA 4JGQA 3OLOA 2B02A 4EQ1A 1N9OA 4PKYG 3H82A 3P01A 4P6ZM 1DRMA 4NKPA 2Z6CA 4O01A 3UMEA 4K08A 4GCZA 4DN0A 2XSSA 2V1AA 3VOLA 2B18A 5HD5A 2L4RA 2K7SA 4QPRA 1TS7A 5DJUA 5F5YA 1DP9A 1WA9A 2HV1A 2VEAA 2VV8A 3FG8A 3CAXA 4L9GA 1LSWA 3TJZC 4UEYA 1NRJA 2YKHA 5TBMA 3E4PA 5F6AA 4EW7A 2A2LA 3HJKA 3H9WA 3LIEA 4CLCD 2HF6A 4IJGA 2W3EA 4IUHA 2V9AA 1DP8A 4L9FA 2Y8HA 4HIAA 5HDSA 3FC7A 1F9IA 4ZRRA 1OPXA 4WF0A 3IS2B 4JGRA 3LR4A 2XROA 1XJ3A 4KUKA 4ME4A 4YNRA 1IOUA 1S4SA 2ZOHA 2EA9A 2QHKA 4L9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3W A;  2OOL A;  1XJ4 A;  3MJQ A;  3VE3 A;  1EW0 A;  2PYR A;  3T50 A;  2WKQ A;  1XJ2 A;  4HH3 A;  1F98 A;  3LIC A;  3CLO A;  4I3J A;  3F1P A;  5EFW A;  4LPZ A;  4YWZ A;  1OT9 A;  2W0N A;  1OT6 A;  4HJ4 A;  1S1Y A;  5AVE A;  5G4Y A;  5HDD A;  3SW1 A;  2PD8 A;  4LLO B;  5HD3 A;  4HI4 A;  3PYP A;  3LIF A;  3LI8 A;  2V1B A;  2PYP A;  5HSQ A;  2L0W A;  1D06 A;  3IBR A;  4LRY C;  3NOP C;  1OJG A;  3MFX A;  3MQO A;  1XFN A;  3K3C A;  2H28 A;  3P7N A;  2Z6D A;  3NOU C;  1T1B A;  3F1O A;  2OWH A;  3B33 A;  3GEC A;  3K3D A;  3IS2 A;  3PHY A;  4XT2 B;  3UB6 A;  3LIA A;  5HWV A;  3NOT C;  4JGO A;  2PR6 A;  4LRZ E;  2VV7 A;  4HOI A;  2J80 A;  4GHI B;  2V0U A;  3G6O A;  1S67 L;  1UWN X;  2I9V A;  4I38 A;  3F1N B;  1D7E A;  5HZH A;  1V9Z A;  1G28 A;  4R6L A;  3F1O B;  2QJ5 A;  4BBT A;  4WL9 A;  2KDK A;  2PD7 A;  3MXQ A;  2JN7 A;  2QKP A;  1GSX A;  4GW9 A;  5J7E A;  3BY9 A;  1MZU A;  3KX0 X;  3ULF A;  1TS0 A;  4KUO A;  4R38 A;  4MN6 A;  3EWK A;  1KOU A;  1JNU A;  4EET B;  1S4R A;  3H7W B;  1OJ5 A;  2A24 B;  5J4E A;  4MN5 A;  1GSV A;  5IS1 A;  3LUQ A;  4H6J B;  3VE4 A;  1X0O A;  5AVF A;  2D01 A;  5DKL A;  1VB6 A;  1T18 A;  1T19 A;  1TS8 A;  5DKK A;  2KX6 A;  1XFQ A;  3E4Q A;  2WKR A;  3UB9 A;  3ICY A;  5HDC A;  2ZBB A;  1DP6 A;  4EER A;  2PHY A;  2BAS A;  4XT2 A;  1OTI A;  2VLG A;  1OTD A;  4KQD A;  3LI9 A;  3C8C A;  1P97 A;  2YKF A;  4HJ6 A;  4GHI A;  5HWT A;  3A0V A;  2R78 A;  4GS9 B;  4BBV A;  3F1N A;  4NXF A;  4HNB A;  4EXO A;  4I3A A;  5HWW A;  5KIZ A;  3A0S A;  4I5S A;  1GSW A;  4HP4 A;  4F3L B;  4HP9 A;  3C2W A;  2W27 A;  2ZOI A;  4DJ3 A;  3LYX A;  1S66 L;  3UB8 A;  3BWL A;  2CMN A;  4WUJ A;  2L1M A;  4LRX C;  4R3A A;  3H7W A;  3ZQ5 A;  2A24 A;  4M4X A;  4WN5 A;  3RTY A;  4EEP A;  1N9L A;  4HY8 A;  3MR0 A;  4H6J A;  2JHE A;  3H82 B;  3E4O A;  4B9O A;  2D02 A;  5F69 A;  2M1C A;  1OTA A;  2QJ7 A;  1UWP X;  3UB7 A;  3MQQ A;  2V0W A;  2PR5 A;  1LSV A;  4I3I A;  4EES A;  1LL8 A;  1UGU A;  3CWF A;  4DJ2 A;  4WLA A;  4BBU A;  5TBM B;  1TS6 A;  3A0R A;  3NJA A;  1OTE A;  1LT0 A;  2PDR A;  4HQA A;  2OWJ A;  4HHD A;  4NXG A;  1S1Z A;  5G4Z A;  4HH2 A;  2GJ3 A;  1T1C A;  5I5L A;  1V9Y A;  4GS9 A;  3UMD A;  1Y28 A;  3RH8 B;  5F68 A;  4E04 A;  5A8B A;  4RQ9 A;  4JGP A;  3GDI A;  1XJ6 A;  1N9N A;  3LID A;  4F3L A;  3EEH A;  1BYW A;  2VV6 A;  1NWZ A;  2WKP A;  5IU1 A;  5DJT A;  2QWS A;  4NXE A;  2INW A;  3HJI A;  4HJ3 A;  3D72 A;  2P7J A;  1OTB A;  3NHQ A;  1ODV A;  3BY8 A;  1P0Z A;  1T1A A;  4I39 A;  3UE6 A;  3F1P B;  3LIB A;  1LSX A;  4PKY A;  4NXB A;  4R70 A;  4EEU A;  4JGQ A;  3OLO A;  2B02 A;  4EQ1 A;  1N9O A;  4PKY G;  3H82 A;  1DRM A;  2Z6C A;  3UME A;  4K08 A;  4GCZ A;  2V1A A;  3VOL A;  5HD5 A;  2L4R A;  2K7S A;  1TS7 A;  5DJU A;  5F5Y A;  1DP9 A;  1WA9 A;  2HV1 A;  2VEA A;  2VV8 A;  3FG8 A;  3CAX A;  4L9G A;  1LSW A;  2YKH A;  5TBM A;  3E4P A;  5F6A A;  4EW7 A;  3HJK A;  3H9W A;  3LIE A;  2V9A A;  1DP8 A;  4L9F A;  4HIA A;  5HDS A;  3FC7 A;  1F9I A;  4WF0 A;  3IS2 B;  4JGR A;  1XJ3 A;  4KUK A;  1S4S A;  2ZOH A;  2EA9 A;  2QHK A;  4L9E A; 
#chains in the Genus database with same CATH topology
 3CI6 A;  1N4O A;  5E2G A;  4AFI A;  1MPL A;  5FAQ A;  4X56 A;  3DTM A;  3PBQ A;  3CPT A;  1XJ2 A;  2P08 A;  1XX2 A;  3PBN A;  3A3E A;  1PZP A;  4KZ7 A;  4PM7 A;  4U0T A;  2W3G A;  1J3W A;  1KGF A;  4ETX A;  3N8R A;  4YWZ A;  4H8R A;  5I94 A;  1NLZ A;  4OPQ A;  2HDU A;  5AVE A;  1PYY A;  2PD8 A;  3DAV A;  3KYE A;  1F5M A;  3PYP A;  5TFQ A;  1QME A;  4Y7P A;  3IHB A;  3OPL A;  4YIN A;  4KG5 A;  1FCO A;  4MNR A;  4EUV A;  3IHA A;  1K55 A;  1FSW A;  4X25 A;  4PMA A;  3MQO A;  4LCM A;  1MXO A;  3P7N A;  2O0Y A;  2OWH A;  3C5A A;  2GZA A;  3JVU A;  1K54 C;  3GTC A;  3UB6 A;  3LIA A;  1YLJ A;  5L8M A;  4UQI S;  3BEC A;  5EV0 A;  2RCX A;  1ESU A;  5AQB A;  3I7J A;  2HGV A;  4KZ4 A;  3G6O A;  1S67 L;  2I9V A;  3LY3 A;  1GHI A;  4PHT A;  1KVL A;  1CI8 A;  2KLI A;  4LCL A;  3HLB A;  2JKR M;  4E3J A;  3Q82 A;  1PWD A;  4WL9 A;  4KQQ A;  3ZNT A;  3MXQ A;  2QKP A;  2J9O A;  4OQG A;  1YLT A;  5EVI A;  3R7W B;  3PBO A;  2FH5 A;  4R38 A;  1KE0 A;  3S7N A;  3V50 A;  2M7U A;  3H7W B;  4S2I A;  3G4P A;  2VGL M;  3M6B A;  3ZG9 B;  5F1F A;  4FSF A;  1BLH A;  5IS1 A;  1HZO A;  1SKO A;  4O0P A;  1H8M A;  2VGJ A;  1G5U A;  2K31 A;  5E2H A;  3IQA A;  5K5B A;  1C3B A;  1Y4O A;  3HLD A;  1T18 A;  4HEF A;  5DKK A;  3VP0 A;  4S2N A;  4ARZ A;  3QP6 A;  2ZBB A;  5FEG A;  3Q7Z A;  4R4R A;  1SHV A;  4N92 A;  2XLN A;  4Z1W A;  3UB5 P;  1BZA A;  3BFF A;  1NXY A;  2H0T A;  5HL6 A;  4XT2 A;  2XEP A;  2EFU A;  4KQD A;  2G7U A;  3ZGA B;  3N8S A;  3KYZ A;  5FSR A;  4FTX A;  4XUZ A;  3WRT A;  1P97 A;  3G2Y A;  4GHI A;  3A0V A;  2W1T A;  1ZG4 A;  4UAA A;  5HFO A;  5L10 A;  4Q0H A;  1YAX A;  5DTT A;  4I3A A;  5AQ7 A;  4EUZ A;  5AQ9 A;  2JKR I;  5KIZ A;  5A92 A;  4OP5 A;  4HP4 A;  2C5W B;  3HLE A;  2CC1 A;  1P9W A;  4MDZ A;  2VX8 A;  3LYX A;  2ZC4 B;  4R4S A;  4E3O A;  3UO9 A;  1FOF A;  1FR1 A;  2CMN A;  2QYB A;  3HRE A;  2WUQ A;  1FQG A;  2IWC A;  3FV7 A;  4WUJ A;  5LBR A;  2L1M A;  2ZMF A;  3AGD A;  4LRX C;  5IHV A;  3W4Q A;  1KGE A;  3TE8 A;  2A24 A;  4M4X A;  3CIT A;  2MJ6 A;  3LEZ A;  1N9B A;  4X6T A;  3SZT A;  4EWF A;  2ZC3 B;  4H6J A;  1BSG A;  2JHE A;  4C6Y A;  5DVA A;  1JWP A;  5F69 A;  3TRC A;  3RXW A;  1BUE A;  5DFY A;  2G2U A;  4GDN A;  4FH2 A;  4N9L A;  2XFS A;  3DW0 A;  4FUW A;  3DWZ A;  2R9W A;  1JWZ A;  2PR5 A;  4EES A;  2ZC7 A;  3MBZ A;  3OBF A;  2EWV A;  5HW3 A;  2WGI A;  2Y2L A;  3T4S A;  2OAP 1;  4CLC A;  1W5D A;  3NJA A;  4OVD A;  3EGD C;  2PU2 A;  2V8F A;  4HQA A;  1YLY A;  5E2F A;  4OPY A;  2WZZ A;  1J9M A;  2RL3 A;  4HHD A;  2IWB A;  4K0W A;  1JVJ A;  3Q7V A;  4NXG A;  5G4Z A;  2XK1 A;  5HPF A;  3OZH A;  4GN2 A;  1V9Y A;  1P9R A;  3OPP A;  5HAP A;  4QB8 A;  2HZ5 A;  4RQ9 A;  1PRQ A;  4JGP A;  5FQK A;  2XDM A;  4S2L A;  2EFX A;  2JCH A;  2WAE A;  1NWZ A;  4CQH A;  3LR5 A;  4NXE A;  3QNB A;  4JXG A;  3MQ0 A;  4S2J A;  1P0Z A;  3MMH A;  5FEF A;  3OCN A;  5FQJ A;  1L0D A;  1BTL A;  1T1A A;  4WYY A;  2Y2G A;  3LIB A;  1LSX A;  2IA2 A;  4ZAM A;  4JGQ A;  2B02 A;  4EQ1 A;  4PKY G;  4P6Z M;  3D4F A;  1DRM A;  1XP4 A;  1RCJ A;  4O01 A;  4EV4 A;  4UHU A;  3S1Y A;  2K7S A;  1SKF A;  1TS7 A;  1K56 D;  3MZE A;  2HDS A;  1TEM A;  3FG8 A;  4L9G A;  3TG9 A;  2XGN A;  1NRJ A;  1YT4 A;  1XPB A;  3E4P A;  5F6A A;  4EW7 A;  3BLM A;  3H9W A;  3VP3 A;  3D9Y A;  1G68 A;  4NET A;  4IUH A;  5JYO A;  4BD1 A;  5A93 A;  2Y8H A;  1LI0 A;  1W7F A;  5HDS A;  1F9I A;  1K6S A;  1OPX A;  4KQR A;  4GD8 A;  3IS2 B;  3LR4 A;  2XRO A;  4KUK A;  3V3R A;  1S4S A;  2ZM0 A;  1NY0 A;  4OKP A;  4MBH A;  3M2K A;  3K2N A;  2Y2Q A;  4WEJ A;  2A49 A;  3VE3 A;  1EW0 A;  5DTS A;  3HUM A;  4E3K A;  2WKE A;  3U2A A;  3PR6 A;  1WYB A;  4Y2F A;  1I5Q A;  3WS2 A;  2H10 A;  1E3U A;  2V8C A;  2WKQ A;  4X69 A;  4OLG A;  4KZ9 A;  5FA7 A;  4BLM A;  4JLF A;  5E2E A;  3CLO A;  2VZW A;  2P9V A;  1CEF A;  5L09 A;  1GA9 A;  2XA7 M;  3TOI A;  3R4K A;  2PT7 A;  3U4L P;  3QP4 A;  4EBP A;  3ZYT A;  1OT9 A;  2W0N A;  1OT6 A;  3A3D A;  1I2W A;  2XRN A;  1IKI A;  2WKI A;  4PM5 A;  3W2Z A;  2P74 A;  3SW1 A;  2Y2I A;  2ZQ8 A;  4O7D A;  3WRZ A;  2Y91 A;  4HI4 A;  3O3V A;  3ZG8 B;  3EGX C;  3LI8 A;  1L0G A;  2L0W A;  1D06 A;  1IFQ A;  1VET A;  1H3Q A;  3CUE A;  1OJG A;  3NUL A;  3CZD A;  2Z2L B;  2ZL1 B;  1XFN A;  4D2O A;  2ZLY A;  5GLA A;  5FQ9 A;  1PFL A;  2Z6D A;  2O9B A;  3T4J A;  3IWI A;  1QMF A;  1T1B A;  1CI9 A;  5FQI A;  3FKW A;  3B33 A;  4Y13 A;  1NRF A;  4EBL A;  3OPR A;  2PBD P;  5KSH A;  1YSP A;  2HP9 A;  4E6W A;  3C4O A;  1L0F A;  5F1G A;  1MWR A;  3MKF A;  1FCN A;  1HVB A;  1YLW A;  4KZ3 A;  4ZBE A;  2V0U A;  3BFE A;  3VV4 A;  4I38 A;  3UY6 A;  2HPB A;  1V9Z A;  1G28 A;  2M7V A;  4PM6 A;  1AXB A;  4QY6 A;  4NG2 A;  2KDK A;  4MBK A;  2JN7 A;  3DBA A;  3LCE A;  5J7E A;  4G3K A;  4Z9Q A;  3NI9 A;  4X55 A;  3EOI A;  1IKG A;  1K4F A;  3GVB A;  3ULF A;  4GD6 A;  1JTG A;  3C30 A;  4NEE D;  3G2Z A;  4S2O A;  5FI7 A;  3UPP A;  1KOU A;  3FYZ A;  2OV5 A;  1S4R A;  1OJ5 A;  3KO6 A;  3IF6 B;  3T1S A;  3UNW A;  4PM8 A;  1YSQ A;  3IH8 A;  5CX7 A;  1HTZ A;  3VE4 A;  4B4X A;  1X0O A;  3MF0 A;  1NLY A;  1OME A;  5FDS A;  1MBL A;  3UE1 A;  1HD8 A;  5DKL A;  1VB6 A;  5FAP A;  1T19 A;  4Q0J A;  1M6K A;  3BLS A;  3UB9 A;  2Z2M B;  5HDC A;  1DP6 A;  3VOZ A;  3RFB A;  3BM6 A;  3FZC A;  2DNS A;  3E2L A;  1IEM A;  5BOH A;  3KSI A;  4ETZ A;  3GQZ A;  1OTD A;  5FAS A;  4HBT A;  4PAU A;  4HJ6 A;  3GMW A;  2R78 A;  4ZJ2 A;  4LGW A;  4ZTK A;  1FCM A;  3W4P A;  4LEN A;  4BBV A;  3F1N A;  5CRF A;  4MMN A;  3S4X A;  4I5S A;  4E3L A;  2WGW B;  3N8L A;  4Y15 A;  3ZNY A;  3HBR A;  4F3L B;  5FQM A;  4BL3 A;  1CEG A;  1ESI A;  4IBX A;  2LB9 A;  3FWL A;  2W3F A;  2C6W B;  4X53 A;  4OOL A;  4Y3I A;  1CF0 A;  5M19 A;  3DTI A;  3AGE A;  3C7V A;  4WN5 A;  4P6B A;  1K25 A;  1RGZ A;  4XUX A;  3LFV A;  4BWI A;  3EQU A;  3NDE A;  1ES3 A;  4JXV A;  5MC7 A;  2I72 A;  3PAE A;  2VA0 A;  5TGF A;  3NBL A;  4LV3 A;  1JTD A;  1VHM A;  3UB7 A;  4DDY A;  1Z09 A;  5L2F A;  3T1X A;  1ERM A;  1IYS A;  2V0W A;  4DRT A;  1LSV A;  3PXP A;  2JKF A;  4JF5 A;  4X1M A;  3T1Q B;  3CWF A;  3G32 A;  4IUK A;  4KZA A;  4WLA A;  4GLQ A;  5FAT A;  1IEL A;  1GA0 A;  3A0R A;  3MFD A;  1OTE A;  3BW6 A;  1G6A A;  2W3H A;  5GHY A;  4OPR A;  3IXB A;  3VFH A;  2B5R A;  3NY4 A;  2GJ3 A;  4MN7 A;  2DCF A;  4MLL A;  4GS9 A;  3UMD A;  2XR0 A;  3QHY A;  1GHP A;  3RH8 B;  2W1R A;  4E3N A;  3VP2 A;  3SS5 A;  5DTK A;  2A3U A;  2V1Z A;  1K54 A;  4BEN A;  3HCY A;  3EEH A;  3GRJ A;  1BYW A;  5FI2 A;  5IU1 A;  5DJT A;  5FQQ A;  3T4L A;  3N6I A;  2INW A;  4S2P A;  3CPT B;  4HJ3 A;  5CEB A;  3G34 A;  3BY8 A;  4QWO A;  3M2J A;  2WK0 A;  3DTK A;  1DJA A;  2OLV A;  4DDS A;  4PKY A;  4NXB A;  3IXG A;  5AQA A;  2JKT M;  4R70 A;  3IX8 A;  2J3W A;  3OLO A;  3H82 A;  3O88 A;  4UA9 A;  3UME A;  4ZJ1 A;  4K08 A;  2XSS A;  3ITB A;  1NZO A;  5HD5 A;  3OPH A;  1KE4 A;  5DJU A;  2XQZ A;  5CXW A;  1WA9 A;  3DWK A;  2PRF A;  2VV8 A;  3CAX A;  2WKH A;  1K6R A;  3TJZ C;  3HLW A;  3VMA A;  2YKH A;  5TBM A;  3SH8 A;  3NCK A;  4Q8I A;  3HJK A;  4ZJ3 A;  4WMC D;  2HF6 A;  1GHM A;  4IJG A;  1CQA A;  1NYY A;  2V9A A;  3FC7 A;  3IXH A;  3QP2 A;  1EWZ A;  1YMS A;  5GLC A;  4FD8 A;  3JYI A;  1XJ3 A;  1MWU A;  1IOU A;  2JE5 A;  4EBN A;  3ZFZ A;  2QZ6 A;  5FAO A;  1NZU A;  4MBF A;  5J3W A;  2OOL A;  3MJQ A;  1DJC A;  4CLC E;  2ACG A;  1ERO A;  5HAR A;  2Y2N A;  2PYR A;  4E3I A;  3IF6 C;  1K57 C;  1YLP A;  4YOF A;  3T50 A;  4GNU A;  4OQ0 A;  4DXB A;  4HH3 A;  2ZMA A;  3UPO A;  3ZG0 A;  3L9K A;  4I3J A;  3F1P A;  5IT5 A;  2Y2P A;  2Y2K A;  5CED A;  2OAQ 1;  1IYQ A;  2XD1 A;  2EX9 A;  5CTM A;  1ONH A;  3QP5 A;  2XA7 S;  3S7P A;  4LPZ A;  5EVL A;  3IBJ A;  2JKT I;  1M40 A;  4DE2 A;  1Y54 A;  1S1Y A;  3E98 A;  1STZ A;  4YFM A;  5G4Y A;  3UE0 A;  4FOF A;  1VEU A;  3MKE A;  1TD5 A;  1O7E A;  1SKO B;  3LIF A;  3T4K A;  2PYP A;  4O8G A;  4DE1 A;  2W3D A;  3CG5 A;  1LL9 A;  1KE3 A;  1YM1 A;  3IBR A;  3NOP C;  3NEC A;  4RA7 A;  4BL2 A;  1BLC A;  3OCL A;  3VSL A;  2GNX A;  3QNC A;  2FFF B;  3LR0 A;  5F83 A;  1XKZ A;  2H28 A;  4ARZ B;  4Q0I A;  5D3O A;  3NOU C;  1S0W A;  2WAF A;  1KDW A;  4OP8 A;  3HUN A;  1K0K A;  3K3D A;  3OC2 A;  3LY4 A;  3A3F A;  3PHY A;  4XT2 B;  1VM1 A;  2HDQ A;  2PU4 A;  3E2K A;  4JGO A;  3C7U A;  5GL9 A;  2PR6 A;  3EQV A;  4LRZ E;  3MSH A;  3VP1 A;  4P85 A;  3VOY A;  3T4O A;  4HES A;  4N1X A;  4RVA A;  4R3J A;  2J80 A;  4GHI B;  3Q07 A;  1BUL A;  4KZ8 A;  1L3L A;  2ZQC A;  3VFF A;  4BQM A;  1AWI A;  3LO7 A;  2W1T B;  1YKD A;  1UWN X;  4N9K A;  5GHX A;  1XA1 A;  1D7E A;  2WGV A;  3CUE C;  3O5Y A;  3F1O B;  4BD0 A;  3QP1 A;  3HLC A;  3LGO A;  4BBT A;  2OSU A;  2PD7 A;  4EQI A;  1RP5 A;  3LEQ A;  3KSF A;  3MZF A;  3QP8 A;  3E0Y A;  3HLG A;  4KUO A;  3SS4 A;  3IWO A;  1JNU A;  4EET B;  4OON A;  2E8I A;  4DE3 A;  3NC8 A;  2A24 B;  5J4E A;  3ZVW A;  5EPH A;  4MN5 A;  2FFY A;  1DJB A;  1GSV A;  3CMZ A;  3LUQ A;  4QY5 A;  4H6J B;  1I2S A;  2ZMV A;  4JF4 A;  5G18 A;  5AVF A;  4IHQ A;  2D01 A;  1FIK A;  4WZ4 A;  1XFQ A;  3E4Q A;  3EEA A;  2BTF P;  3ICY A;  5DFX A;  1DY6 A;  5M18 A;  4UA7 A;  4EER A;  2B95 A;  1KVM A;  1TF1 A;  2Y59 A;  2DMW A;  3V5M A;  4Y0U A;  2BAS A;  2EX8 A;  3PAG A;  4ID4 A;  5U47 A;  4CLC B;  1ZTU A;  4GDB A;  3T12 B;  3LI9 A;  3C8C A;  2Y55 A;  2YKF A;  4IVK A;  1MWT A;  1LI9 A;  3C4P A;  4NXF A;  2NUP C;  2GDN A;  3S7Q A;  1U60 A;  4KG6 A;  1IYP A;  1L2S A;  2OLU A;  4JBF A;  3BEB A;  4EXO A;  5HWW A;  3A0S A;  2P04 A;  1GSW A;  4HP9 A;  3R7W A;  2ZOI A;  3CHW P;  3PBS A;  5EVI D;  1Q2Q A;  3BQ8 A;  3T1R A;  2EWW A;  2Y2H A;  3H7W A;  3ZQ5 A;  1PWC A;  3RTY A;  3TW8 A;  2ZM8 A;  4EU0 A;  1K55 C;  4HY8 A;  4WZ5 A;  1LL5 A;  3MR0 A;  1E4D A;  4U0X A;  5EM0 A;  3E4O A;  5CHM A;  3JVV A;  3Q81 A;  3ZG7 B;  3IX4 A;  5CEC A;  1Q2P A;  4IVI A;  1K56 A;  3P09 A;  1ES4 A;  3IH9 A;  2X02 A;  3FPV A;  5EEC A;  1RGY A;  3CJM A;  2WAD A;  3V3S A;  4KZB A;  2VGL S;  4DJ2 A;  2K2N A;  1TS6 A;  5CER A;  2HJE A;  2PDR A;  3SH7 A;  4B88 A;  1W8Y A;  1FR6 A;  1IYO A;  2WYX A;  3D3O A;  1H5X A;  4HH2 A;  5GLB A;  1E25 A;  4R0Q A;  4S2K A;  1YMX A;  4IED A;  3MXS A;  3B42 A;  1W63 M;  5EVI C;  3KSG A;  4KZ6 A;  4OOY A;  4E04 A;  1JWV A;  5CTN A;  1XJ6 A;  1N9N A;  2Q0O A;  2VV6 A;  2WKP A;  2Y2O A;  1SDN A;  1HLU P;  5HPI A;  2P7J A;  4OPZ A;  1ES5 A;  4JXW A;  5EUA A;  3NIA A;  3UE6 A;  2P9V B;  4E6X A;  4DXC A;  3G31 A;  4EEU A;  4S2N C;  1N9O A;  1GCE A;  4C75 A;  2QPN A;  4S2M A;  4NKP A;  2Z6C A;  5EM1 A;  2Y4A A;  5EE8 A;  4R3B A;  2J7V A;  2JBF A;  2BLS A;  3Q1F A;  4R23 A;  2B18 A;  2L4R A;  1DP9 A;  2XF3 A;  1KDS A;  2VEA A;  1VET B;  3P98 A;  5KMW A;  4UEY A;  1FSY A;  2A2L A;  3MXR A;  3LIE A;  4CLC D;  2W3E A;  2ZQ9 A;  4L9F A;  5GHZ A;  1SDE A;  1YQS A;  4B4Z A;  1ZC2 A;  1WE4 A;  2Y2J A;  4YNR A;  3ZCZ A;  1L0E A;  3WS5 A;  2ZOH A;  1YPR A;  4NK3 A;  2H5S A;  4JF6 A;  5F82 A;  2QHK A;  1W63 Q;  5HAQ A;  1VQQ A;  1XJ4 A;  4P0M A;  2ZC5 B;  3BRM A;  1K4E A;  3GR2 A;  2UV0 E;  3UDX A;  1ACF A;  4MCW A;  5FL3 A;  4F94 A;  2ZD8 A;  4WBG A;  1BLP A;  1F98 A;  3LIC A;  4MEZ A;  3NDG A;  4WEL A;  4G3V A;  4GJ4 A;  4HBU A;  2PBY A;  2J9P A;  1BT5 A;  5EFW A;  5A90 A;  4IBR A;  2BG1 A;  1SCW A;  4HJ4 A;  4K91 A;  2WZX A;  3ZHH A;  5HDD A;  2EXB A;  3BJN A;  1MKM A;  1PNE A;  4LLO B;  5HD3 A;  1W8Q A;  5DF8 A;  4B93 A;  4CLC C;  4JKT A;  4X68 A;  4Y0O A;  5TR7 A;  2V1B A;  4KG2 A;  5HSQ A;  1TVF A;  3PBR A;  4LRY C;  3HL9 A;  3WWX A;  2G2W A;  3BFG A;  3MFX A;  1H8Z A;  3FKV A;  2J8Y A;  3K3C A;  1XGJ A;  4P6Z S;  3ZDJ A;  3ISG A;  2O99 A;  2Y2M A;  3W4O A;  1PI4 A;  1TDL A;  1K38 A;  3F1O A;  3GEC A;  3IS2 A;  2FZ0 A;  4Y17 A;  5HWV A;  3NOT C;  4UQI M;  4RX3 A;  2VKS A;  3N7W A;  3KYQ A;  4RX2 A;  2VV7 A;  3A3I A;  5KSC A;  3A3J A;  4HOI A;  2VJW A;  3UN7 A;  3M6H A;  2ZQD A;  3B47 A;  3V39 A;  3F1N B;  1ZG6 A;  5HZH A;  4JXS A;  3AGF A;  4R6L A;  1ONG A;  4XXR A;  2X71 A;  2QJ5 A;  1PW8 A;  2QMI A;  1E3U D;  2ZQ7 A;  1MWS A;  3G30 A;  1GSX A;  5EOO A;  4GW9 A;  4UA6 A;  3MZD A;  2IWD A;  3BY9 A;  1MZU A;  2Q9N A;  2UWX A;  3KX0 X;  5HL1 A;  1TS0 A;  1XXM A;  4OQH A;  3BYD A;  4PPR A;  4M3K A;  1H0M A;  3UDI A;  3WS1 A;  5FDH A;  4MN6 A;  3EWK A;  1PW1 A;  4LV1 A;  2JKG A;  3O87 A;  4GKU A;  3UE3 A;  2DRW A;  1W79 A;  4OQI A;  3JPU A;  5AJG A;  4OOM A;  2J3T D;  1ES2 A;  1TDG A;  1KGG A;  5EVI B;  1WYC A;  4BJP A;  4CPK A;  1TS8 A;  3KSH A;  1PIO A;  2KX6 A;  2ZL1 A;  2WKR A;  4QHC A;  5A91 A;  4WEK A;  2H0Y A;  2EX2 A;  4Y5F A;  3SS3 A;  5TJJ A;  1ZHH B;  2PHY A;  2KOI A;  1F2K A;  1OTI A;  2VLG A;  3MS6 A;  1MY8 A;  1FIL A;  4QD4 A;  1ALQ A;  3UDF A;  4G3W A;  5HWT A;  3BFD A;  4X1L A;  2Q9M A;  4GOG A;  3W8K A;  1MC0 A;  4GS9 B;  3PTE A;  1PWG A;  4HNB A;  3T4T A;  3T4Q A;  1A0K A;  5CHJ A;  5J8X A;  2NUT C;  5KZH A;  5CGX A;  1YLZ A;  4II7 A;  4P87 A;  5DF7 A;  3C2W A;  2W27 A;  2PAV P;  1NJ4 A;  4DJ3 A;  2O9C A;  3DTE A;  1S66 L;  2HDR A;  4QU3 A;  3UB8 A;  4BMW A;  1G6O A;  4D60 A;  4JPM A;  3BWL A;  3N4I A;  2EX6 A;  2LB5 A;  2J3T C;  2HP5 A;  4R3A A;  4WM9 A;  4PM9 A;  2Y79 A;  4FH4 A;  2GX5 A;  4E3M A;  3IF6 A;  1K57 A;  4DMZ A;  4QJG A;  1O07 A;  4EEP A;  1N9L A;  2VGK A;  5CGW A;  1D1J A;  3G35 A;  2R9X A;  3H82 B;  4LV2 A;  4B9O A;  2D02 A;  4LFU A;  4K0X A;  4KZ5 A;  2M1C A;  1OTA A;  3OOV A;  2QJ7 A;  4GZB A;  1UWP X;  3VP4 A;  1PZO A;  3UPN A;  1Z6F A;  5M1A A;  3IXD A;  4OH0 A;  5CGS A;  1H8Y A;  3MQQ A;  4L0L A;  5HX9 A;  4I3I A;  2HP6 A;  3L7H A;  5JYP A;  1LL8 A;  1UGU A;  3GSG A;  3IT9 A;  1LLB A;  4BBU A;  1S6R A;  4ZDX A;  5TBM B;  3BQA A;  4WMC A;  3B3X A;  5C5K A;  1LT0 A;  3S7O A;  2OWJ A;  1ZKJ A;  4KQO A;  4N1H A;  2O9A A;  1PI5 A;  3ZG5 A;  3HUO A;  2XH9 A;  1S1Z A;  5EVE A;  1T1C A;  1XGI A;  3FPW A;  4WZ5 C;  5FI6 A;  5I5L A;  2ZJ9 A;  3WS0 A;  3LR3 A;  3O86 A;  1Y28 A;  3IWQ A;  3GV9 A;  3VSK A;  5F68 A;  5CHU A;  4DE0 A;  3SH9 A;  4ESP A;  5A8B A;  2WGW A;  3GDI A;  4DF6 A;  3LID A;  1XA7 A;  4F3L A;  5DF9 A;  2V2F F;  3IF5 A;  2XD5 A;  3C38 A;  2XFT A;  3Q7V B;  2QWS A;  2JC7 A;  3HJI A;  3D72 A;  1OTB A;  3NHQ A;  1ODV A;  2AVX A;  3V67 A;  4Y0T A;  5HAI A;  4I39 A;  5E43 A;  3F1P B;  3TSG A;  3PBT A;  4CJN A;  2VK3 A;  4DKI A;  2HJ9 C;  3RJU A;  1BLS A;  4FCF A;  3P01 A;  5L07 A;  1CK3 A;  3IX3 A;  3ZVT A;  3S22 A;  4R1G A;  4A5R A;  3HVF A;  4GCZ A;  1NYM A;  4LV0 A;  3WS4 A;  1VEU B;  1LHY A;  1EI5 A;  4DN0 A;  2V1A A;  2ZC6 B;  3VOL A;  1ERQ A;  2ZQA A;  4QPR A;  4GB7 A;  5F5Y A;  2HV1 A;  1CJF A;  3BFC A;  4C3Q A;  5GLD A;  2X01 A;  1LSW A;  3HLF A;  1MKI A;  4RYE A;  2EXA A;  3RXX A;  3SOI A;  1DP8 A;  1SZV A;  4HIA A;  2E8J A;  4ZRR A;  4WF0 A;  4JGR A;  4ME4 A;  2V20 A;  4OLD A;  5EOE A;  4KEN B;  2EA9 A;  3ITA A;  2ZM2 A;  4U3T A;  4L9E A; 
#chains in the Genus database with same CATH homology
 3CI6 A;  5J3W A;  1W63 Q;  3K2N A;  4WEJ A;  2OOL A;  1XJ4 A;  3MJQ A;  3VE3 A;  1EW0 A;  3U2A A;  4AFI A;  3PR6 A;  4CLC E;  4Y2F A;  2PYR A;  3T50 A;  4MCW A;  4YOF A;  5FL3 A;  3PBQ A;  2WKQ A;  1XJ2 A;  2P08 A;  4HH3 A;  1F98 A;  3LIC A;  3PBN A;  2W3G A;  4G3V A;  4WEL A;  4GJ4 A;  3CLO A;  4I3J A;  2VZW A;  3F1P A;  5IT5 A;  5EFW A;  2OAQ 1;  2XA7 M;  4ETX A;  3R4K A;  2PT7 A;  2XA7 S;  3S7P A;  4LPZ A;  3ZYT A;  4YWZ A;  1OT9 A;  2W0N A;  3IBJ A;  2JKT I;  1OT6 A;  4HJ4 A;  1NLZ A;  1S1Y A;  3E98 A;  2XRN A;  1STZ A;  3W2Z A;  5AVE A;  5G4Y A;  5HDD A;  3SW1 A;  2PD8 A;  4FOF A;  3BJN A;  1MKM A;  4LLO B;  5HD3 A;  4HI4 A;  1F5M A;  3PYP A;  1TD5 A;  4B93 A;  4CLC C;  3EGX C;  3LIF A;  3T4K A;  3LI8 A;  2V1B A;  2PYP A;  4O8G A;  5HSQ A;  2W3D A;  2L0W A;  1D06 A;  3IBR A;  3PBR A;  1IFQ A;  3NOP C;  1H3Q A;  3CUE A;  4LRY C;  4EUV A;  1OJG A;  3OCL A;  2GNX A;  3MFX A;  3MQO A;  1XFN A;  3LR0 A;  3K3C A;  4ARZ B;  2H28 A;  4Q0I A;  3P7N A;  4P6Z S;  2Z6D A;  2O9B A;  3T4J A;  3NOU C;  2O99 A;  1T1B A;  2O0Y A;  3F1O A;  2OWH A;  3B33 A;  3GEC A;  3K3D A;  2GZA A;  3JVU A;  3OC2 A;  3IS2 A;  5KSH A;  2FZ0 A;  1YSP A;  3PHY A;  4XT2 B;  3UB6 A;  3LIA A;  5HWV A;  3NOT C;  4UQI M;  4JGO A;  5L8M A;  2PR6 A;  2VKS A;  3KYQ A;  3EQV A;  4LRZ E;  4UQI S;  2VV7 A;  3T4O A;  2J80 A;  4HOI A;  4GHI B;  2HGV A;  2VJW A;  2V0U A;  3G6O A;  1S67 L;  2W1T B;  1YKD A;  1UWN X;  2I9V A;  3B47 A;  3VV4 A;  4PHT A;  4I38 A;  2KLI A;  3F1N B;  1D7E A;  5HZH A;  3CUE C;  2JKR M;  3O5Y A;  1V9Z A;  1G28 A;  4R6L A;  2M7V A;  3F1O B;  2QJ5 A;  4BBT A;  4WL9 A;  2KDK A;  2PD7 A;  3MXQ A;  2JN7 A;  2QKP A;  1GSX A;  3DBA A;  4GW9 A;  3KSF A;  5J7E A;  4G3K A;  3BY9 A;  1MZU A;  3KX0 X;  3R7W B;  3EOI A;  3E0Y A;  3ULF A;  3PBO A;  1TS0 A;  2FH5 A;  4KUO A;  4R38 A;  3C30 A;  4NEE D;  4MN6 A;  3S7N A;  3EWK A;  1KOU A;  1JNU A;  2M7U A;  1S4R A;  4EET B;  3H7W B;  1OJ5 A;  2VGL M;  3KO6 A;  2A24 B;  3UE3 A;  4FSF A;  5J4E A;  4MN5 A;  1YSQ A;  1GSV A;  5IS1 A;  3LUQ A;  5AJG A;  5CX7 A;  4O0P A;  4H6J B;  2J3T D;  4OOM A;  2ZMV A;  1H8M A;  3VE4 A;  1X0O A;  3MF0 A;  2K31 A;  1NLY A;  5AVF A;  5K5B A;  4IHQ A;  2D01 A;  4BJP A;  5DKL A;  1VB6 A;  1T18 A;  1T19 A;  1TS8 A;  3KSH A;  4Q0J A;  5DKK A;  2KX6 A;  1XFQ A;  3E4Q A;  2WKR A;  3EEA A;  3UB9 A;  4ARZ A;  3ICY A;  5HDC A;  5DFX A;  4WEK A;  2ZBB A;  1DP6 A;  4EER A;  3RFB A;  4Y5F A;  5TJJ A;  1TF1 A;  1ZHH B;  4Z1W A;  2PHY A;  2DMW A;  2KOI A;  2BAS A;  3KSI A;  4ETZ A;  5HL6 A;  4CLC B;  4XT2 A;  1OTI A;  2VLG A;  1ZTU A;  1OTD A;  4KQD A;  2G7U A;  3LI9 A;  3C8C A;  3KYZ A;  1P97 A;  2YKF A;  4PAU A;  4HJ6 A;  4GHI A;  4G3W A;  5HWT A;  3A0V A;  2R78 A;  2W1T A;  1MC0 A;  4Q0H A;  4GS9 B;  4BBV A;  3F1N A;  4NXF A;  2NUP C;  3S7Q A;  1YAX A;  4HNB A;  3T4T A;  3T4Q A;  4EXO A;  4MMN A;  4I3A A;  5HWW A;  5KIZ A;  2JKR I;  2NUT C;  3A0S A;  4I5S A;  2P04 A;  1GSW A;  4HP4 A;  4II7 A;  4F3L B;  1P9W A;  4HP9 A;  3C2W A;  2W27 A;  4MDZ A;  3R7W A;  2LB9 A;  2VX8 A;  2ZOI A;  4DJ3 A;  3LYX A;  2W3F A;  2O9C A;  1S66 L;  3UB8 A;  4BMW A;  1G6O A;  3BWL A;  4OOL A;  3PBS A;  2LB5 A;  2CMN A;  2QYB A;  2J3T C;  4Y3I A;  4WUJ A;  3BQ8 A;  5LBR A;  2L1M A;  2EWW A;  2ZMF A;  4LRX C;  4R3A A;  3H7W A;  2Y79 A;  3ZQ5 A;  3TE8 A;  2GX5 A;  2A24 A;  4M4X A;  4WN5 A;  3RTY A;  3TW8 A;  4DMZ A;  3CIT A;  4EEP A;  1N9L A;  4EU0 A;  2MJ6 A;  4HY8 A;  3MR0 A;  3LFV A;  4H6J A;  4BWI A;  3EQU A;  2JHE A;  3H82 B;  3E4O A;  5MC7 A;  4B9O A;  3JVV A;  2D02 A;  2VA0 A;  5F69 A;  3TRC A;  2M1C A;  1OTA A;  3OOV A;  2QJ7 A;  1UWP X;  5DFY A;  1VHM A;  3UB7 A;  3FPV A;  3MQQ A;  4L0L A;  2V0W A;  2PR5 A;  1LSV A;  4I3I A;  4EES A;  3PXP A;  1LL8 A;  1UGU A;  3OBF A;  2EWV A;  3CWF A;  4IUK A;  2VGL S;  3T4S A;  4DJ2 A;  4WLA A;  4BBU A;  4GLQ A;  2K2N A;  2OAP 1;  5TBM B;  3BQA A;  4CLC A;  1TS6 A;  5C5K A;  3A0R A;  3NJA A;  3EGD C;  1OTE A;  2HJE A;  3BW6 A;  1LT0 A;  2PDR A;  4HQA A;  3S7O A;  2OWJ A;  4KQO A;  2W3H A;  2O9A A;  4HHD A;  4NXG A;  3D3O A;  1S1Z A;  5G4Z A;  4HH2 A;  2GJ3 A;  1T1C A;  3FPW A;  4MN7 A;  5HPF A;  5I5L A;  1V9Y A;  3LR3 A;  4GS9 A;  1P9R A;  3B42 A;  3UMD A;  1Y28 A;  1W63 M;  3RH8 B;  2W1R A;  5F68 A;  3KSG A;  4E04 A;  5A8B A;  4RQ9 A;  4JGP A;  3GDI A;  1XJ6 A;  1N9N A;  3LID A;  3HCY A;  4F3L A;  3EEH A;  5DF9 A;  1BYW A;  2VV6 A;  1NWZ A;  2WKP A;  5IU1 A;  4CQH A;  3LR5 A;  5DJT A;  3C38 A;  3T4L A;  2QWS A;  4NXE A;  2INW A;  3HJI A;  5HPI A;  3MQ0 A;  4HJ3 A;  3D72 A;  2P7J A;  1OTB A;  3NHQ A;  1ODV A;  3V67 A;  3BY8 A;  1P0Z A;  3MMH A;  3OCN A;  1T1A A;  4I39 A;  3UE6 A;  3F1P B;  3LIB A;  1LSX A;  3PBT A;  2IA2 A;  4PKY A;  4NXB A;  2HJ9 C;  2JKT M;  4R70 A;  4EEU A;  2J3W A;  4JGQ A;  3OLO A;  2B02 A;  4EQ1 A;  1N9O A;  4PKY G;  3H82 A;  3P01 A;  4P6Z M;  1DRM A;  4NKP A;  2Z6C A;  4O01 A;  3UME A;  4K08 A;  4GCZ A;  4DN0 A;  2XSS A;  2V1A A;  3VOL A;  2B18 A;  5HD5 A;  2L4R A;  2K7S A;  4QPR A;  1TS7 A;  5DJU A;  5F5Y A;  1DP9 A;  1WA9 A;  2HV1 A;  2VEA A;  2VV8 A;  3FG8 A;  3CAX A;  4L9G A;  1LSW A;  3TJZ C;  4UEY A;  1NRJ A;  2YKH A;  5TBM A;  3E4P A;  5F6A A;  4EW7 A;  2A2L A;  3HJK A;  3H9W A;  3LIE A;  4CLC D;  2HF6 A;  4IJG A;  2W3E A;  4IUH A;  2V9A A;  1DP8 A;  4L9F A;  2Y8H A;  4HIA A;  5HDS A;  3FC7 A;  1F9I A;  4ZRR A;  1OPX A;  4WF0 A;  3IS2 B;  4JGR A;  3LR4 A;  2XRO A;  1XJ3 A;  4KUK A;  4ME4 A;  4YNR A;  1IOU A;  1S4S A;  2ZOH A;  2EA9 A;  2QHK A;  4L9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...