3LY4A

Crystal structure of fluorophore-labeled class a -lactamase penp-e166cb in complex with penicillin g
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
b'KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of fluorophore-labeled Class A -lactamase PenP-E166Cb in complex with penicillin G
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 87
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ly4A00
1NJ4A 4ZDXA 4JF4A 5EVIB 4K0WA 4R4SA 4GNUA 2WKEA 2Z2MB 4RX3A 4GDNA 1TDGA 1MY8A 3JYIA 4MBFA 4EWFA 4HEFA 3TOIA 1FCOA 1PWGA 1XX2A 2P9VA 4BQMA 1M40A 3UPPA 2C5WB 4PM9A 1KVMA 5CECA 5DVAA 2E8IA 1BSGA 1W7FA 3C7UA 1NZOA 4KZ9A 1VQQA 1DJBA 3G30A 4M3KA 5TFQA 2ZQ7A 5AQ7A 1PI4A 2WZZA 5GLBA 4OP8A 3Q7VA 1NYYA 3G34A 4KZ4A 2IWCA 4JPMA 1GA9A 2J9PA 3PBQA 4HESA 4KZ5A 4FSFA 2EX2A 5DTTA 1YMSA 4OOMA 1YLWA 4RVAA 3UE0A 3IXDA 1YT4A 3VSKA 2HPBA 2XEPA 3BEBA 3ZG8B 1BLHA 1K57C 1KE3A 5EVLA 1RGZA 5U47A 1K4FA 1JWPA 2ZC5B 3NY4A 2Q9NA 4N1HA 3UY6A 2X02A 3TG9A 4E3JA 4U0XA 1DJCA 2QPNA 1LL9A 1FSWA 4DE2A 3B3XA 5CHMA 1EI5A 4DDSA 1I5QA 2QZ6A 5CERA 4UA9A 3O86A 4WZ5C 4Z9QA 2EXAA 4Y0OA 3P09A 4O7DA 1IKIA 1MWTA 1WE4A 2EFXA 4E6WA 1ALQA 5J8XA 4Y7PA 5FQJA 3RXWA 2ZLYA 3UE3A 1M6KA 2P9VB 3V5MA 3PBSA 4R0QA 3BFGA 1FOFA 1IELA 1YLJA 5FI2A 4Y0UA 2R9WA 4WM9A 2HP9A 5FATA 2ZC7A 3ZCZA 3NI9A 1KDSA 4GZBA 4C75A 3DW0A 3SS3A 1WYCA 2Y4AA 2UWXA 3HUNA 3SS4A 4QB8A 3IH9A 1LHYA 3LY3A 3MXRA 4NK3A 3UNWA 4X53A 4C6YA 5FQMA 4JF5A 1PWDA 5AQBA 3NIAA 3WS0A 2HDQA 2P74A 4PM8A 1KDWA 5A90A 3BFEA 3S4XA 3ZNTA 3ZGAB 5KMWA 1CEGA 5EVIA 1H5XA 1K38A 1W8YA 5FI6A 3OPPA 3NDGA 4GN2A 4GB7A 4NETA 1MXOA 4ID4A 4WZ5A 3ISGA 3W4OA 4EBPA 4MLLA 2A49A 2C6WB 1XA1A 2Y55A 4B4ZA 1GA0A 3AGFA 4KQRA 5M18A 4C3QA 4N1XA 4QD4A 4IVIA 1W8QA 2HP5A 3NC8A 4N92A 1BULA 3S1YA 4KQQA 3GRJA 2ZMAA 5KSCA 4OONA 3W4QA 4KG6A 1YLTA 4LV0A 1K6SA 1LI0A 3UDIA 5FAPA 4OPQA 2JE5A 5IHVA 2EFUA 1HVBA 1XPBA 1L0GA 1PI5A 5HAPA 4R3BA 3GTCA 1ZG4A 1ZG6A 3Q1FA 1IKGA 3WS5A 1E3UA 3DWZA 3FWLA 3M6HA 3GVBA 3HUOA 2EX8A 3FZCA 5F82A 5TGFA 4QJGA 1IYSA 5FAOA 3QHYA 1KGEA 2WUQA 3OC2A 5CTMA 5FQQA 4BL2A 1YQSA 3GR2A 2WGWA 2XD1A 2Y2OA 2RCXA 4PPRA 5HARA 5CTNA 2WZXA 4OLDA 4UHUA 1QMEA 4S2IA 2A3UA 4DXBA 5E43A 2VGJA 4PM5A 3O3VA 1RGYA 3HLGA 5E2FA 4GD8A 2RL3A 4LCLA 4K0XA 1GHIA 4BD1A 5DF9A 3IWQA 2IWDA 1XGJA 3WRZA 5CGXA 4E6XA 1PWCA 1GHPA 4KG2A 5FQ9A 4WBGA 4FCFA 2H0TA 1KGFA 1OMEA 4R4RA 4CPKA 4MBHA 5EE8A 1PZOA 1YLYA 1JWZA 2JC7A 1EROA 4OOYA 3FV7A 4XUXA 1JWVA 5A92A 2X01A 5EOEA 1C3BA 3OPRA 3EQVA 3CZDA 3G32A 4ZBEA 3UDXA 3BECA 2JBFA 2V20A 2OV5A 5EVID 2G2UA 1HTZA 1XP4A 2Y2MA 3BLSA 2DRWA 1BZAA 3LCEA 4WZ4A 3S22A 1K54C 5CGWA 1GHMA 3GSGA 1W5DA 3SOIA 2PU4A 3IXHA 2H0YA 2HP6A 4GD6A 2JCHA 3FKVA 5BOHA 4KZ8A 2Y2HA 3N7WA 2WGWB 3ZVTA 2IWBA 4BJPA 3O87A 4WMCD 4Q8IA 3IWIA 2B5RA 4U3TA 4UA7A 3LY4A 3G35A 3AGEA 4UA6A 1BLCA 2Y59A 4OKPA 3WRTA 4KZBA 5CHJA 4Y0TA 3Q82A 3VFHA 2OLVA 4DDYA 5DTKA 3MZFA 2Y2PA 1L0DA 1K4EA 4XUZA 5CEBA 3G2ZA 3HLFA 4JBFA 1CEFA 2XFSA 4KENB 3HL9A 1SCWA 1E3UD 2H5SA 4BENA 2CC1A 2WYXA 4JLFA 4HBUA 3O88A 4RYEA 2XLNA 3A3FA 2WADA 3UDFA 1TDLA 1SDEA 3LO7A 5CHUA 4DRTA 4ZAMA 3VP0A 4QY5A 4H8RA 1ESIA 4ZJ1A 4JXVA 2XD5A 3MZDA 3W4PA 3D4FA 4DF6A 3FYZA 5L2FA 2OSUA 4DE0A 1CK3A 2V2FF 2WAFA 4A5RA 4L0LA 3MBZA 3CG5A 3EQUA 1BT5A 3N8RA 3IHAA 4GDBA 4E3LA 1K54A 5A91A 3BRMA 1K25A 3NBLA 3BM6A 3C7VA 4EV4A 4OP5A 3PBTA 3VOZA 1BTLA 1TVFA 3GV9A 5FAQA 3N4IA 1O07A 4QHCA 4HBTA 1ERQA 1K57A 4ZJ3A 2Y91A 3SH9A 3VOYA 4X68A 5CEDA 5HFOA 4KZ3A 1KGGA 5JYOA 2EX9A 2ZJ9A 1CI9A 1PW8A 4LV3A 1Q2QA 2ZQAA 1LL5A 3OPLA 3ZDJA 3ZG0A 1YMXA 4OQIA 3Q7ZA 1IEMA 2Q9MA 2EX6A 2ZM2A 4E3KA 2ZQ9A 3N8LA 1JVJA 2WAEA 5DF8A 1HZOA 2Z2LB 4BLMA 2Y2KA 1RCJA 3VSLA 2EXBA 2WK0A 1E25A 2X71A 4LCMA 1MWUA 1FCNA 1NRFA 2DCFA 3HLWA 3C4OA 3FKWA 4OH0A 3MFDA 1VM1A 4EBLA 4FD8A 4JXWA 1YLZA 3HLBA 4EUZA 5CGSA 3IHBA 4N9LA 4RA7A 3MZEA 4S2JA 2XR0A 4WYYA 3IF6C 4K91A 4KG5A 3UO9A 1I2WA 1NY0A 4LENA 1N4OA 1BLPA 4EQIA 5EPHA 4WELA 3HVFA 4DKIA 1ES2A 1H8YA 3MXSA 4OOLA 1XA7A 1W79A 3VFFA 5A93A 4DE3A 1ERMA 4GKUA 3OZHA 3N6IA 1AXBA 1G68A 3AGDA 3RJUA 4OLGA 1K6RA 4IBXA 4FH4A 2ZC4B 1N9BA 2ZQDA 4KZAA 4OQGA 3BFDA 1ONGA 4R3JA 4P6BA 5JYPA 2HDRA 4EBNA 2FFYA 1E4DA 1FCMA 2I72A 4U0TA 5EECA 5HX9A 1SHVA 4LV1A 3SH8A 3RXXA 3C4PA 3I7JA 3MKFA 5G18A 4YINA 4PMAA 3ITBA 3V3SA 1NZUA 1DY6A 2Y2NA 5HAIA 4E3NA 4FH2A 4P87A 5E2GA 5HL1A 3IQAA 3PAEA 4S2KA 2WKHA 2Y2GA 1PIOA 4N9KA 2XDMA 3UE1A 1FR6A 3IT9A 5HAQA 2Y2IA 3NCKA 1J9MA 4PM6A 1CI8A 3HLEA 3OPHA 3IF6A 3HBRA 3W8KA 1IYOA 2XQZA 2ZC3B 1LI9A 4WEJA 3N8SA 3UPOA 1ESUA 2ZM8A 4JXSA 4IEDA 2Y2JA 4P0MA 4D2OA 1IYPA 5E2EA 1SDNA 4S2MA 3M2JA 4WEKA 3V39A 4JKTA 4XXRA 1IYQA 2ZQCA 2WGVA 3QNCA 2J9OA 2XGNA 1MWRA 4MNRA 5F83A 2Y2LA 4PM7A 5FQIA 4OQHA 3NDEA 2VGKA 3WS1A 1NXYA 3SH7A 3SS5A 2G2WA 1K56A 2DNSA 3G2YA 4S2NC 5KZHA 5CRFA 3ZG9B 3C5AA 4R1GA 3PBRA 1MBLA 3ITAA 4ZJ2A 2XH9A 3ZHHA 3VP2A 3ZNYA 1YLPA 1Q2PA 1BLSA 1PYYA 1K55C 4YFMA 2BG1A 1MPLA 3GMWA 3OCNA 2HDSA 5FASA 4F94A 3IH8A 4RX2A 2Y2QA 1GCEA 4JXGA 4R23A 5AQ9A 4BL3A 2WKIA 3OCLA 4KZ6A 1L2SA 5EVIC 4BD0A 3IF6B 4X69A 5DF7A 3A3JA 3LEZA 5KSHA 3P98A 5CXWA 4S2PA 4P85A 1ZC2A 1JTDA 3DWKA 1KVLA 1XKZA 4OPRA 4OVDA 1S6RA 2ZD8A 3PAGA 3GQZA 4CJNA 3HUMA 1NYMA 1DJAA 1Y54A 4B88A 3A3IA 4JF6A 1U60A 3CJMA 4X55A 3UN7A 5D3OA 2PBYA 2BLSA 2ZQ8A 3G4PA 5GL9A 5GLAA 2H10A 2V1ZA 1ES5A 2GDNA 1FSYA 1JTGA 3A3EA 4KZ7A 3Q07A 3VMAA 4S2NA 4IBRA 1EWZA 1YM1A 3E2KA 1LLBA 3Q7VB 3IXGA 3ZG7B 1PZPA 4X56A 3M6BA 1K55A 3IXBA 2XK1A 3WWXA 2XF3A 2PU2A 3G31A 3M2KA 3QNBA 3VP3A 5HW3A 3WS4A 1WYBA 3CMZA 4S2OA 5EOOA 3PBOA 2HDUA 5FSRA 4LV2A 2R9XA 1KE0A 3DTMA 3PTEA 3E2LA 5EUAA 4QU3A 3HREA 1Z6FA 5F1GA 1ZKJA 3IWOA 3VP4A 5GHXA 5M1AA 2ZC6B 3A3DA 4E3MA 1HD8A 1G6AA 5GHYA 3BYDA 2WGIA 1K56D 2OLUA 3PBNA 1XGIA 1FQGA 4UAAA 4WMCA 3HLDA 3BLMA 5DTSA 3BFCA 5GHZA 3ZFZA 4ZTKA 1RP5A 3V50A 1L0FA 4GOGA 3Q81A 1I2SA 4DXCA 4MEZA 3HLCA 3IF5A 2J8YA 4X6TA 4E3IA 1L0EA 4OPYA 1MKIA 5FQKA 4S2LA 5M19A 1QMFA 2J7VA 5GLCA 4IVKA 3V3RA 3ZVWA 3VP1A 5FI7A 4QY6A 5FDHA 1S0WA 4DE1A 1ES3A 1MWSA 1SKFA 4MBKA 4B4XA 1KE4A 1H8ZA 3MKEA 3WS2A 1O7EA 4E3OA 2QMIA 1TEMA 2XFTA 5E2HA 1ES4A 4KQOA 4OQ0A 2ZM0A 5GLDA 1FR1A 1ONHA 3BFFA 1XXMA 4OPZA 5F1FA 5TR7A 1PW1A 5AQAA 5FA7A 5I94A 2FFFB 1BUEA 3ZG5A 3TSGA 3UPNA
chains in the Genus database with same CATH superfamily
4JF4A 1UGUA 2WKEA 2XA7S 4MBFA 4HEFA 2O99A 3TOIA 2A2LA 2P04A 2P9VA 5DVAA 3BW6A 2WKQA 4KZ9A 3G30A 1DJBA 3RH8B 5FEFA 2JKGA 1STZA 2OWHA 2O0YA 2J9PA 2EX2A 1YLWA 4RVAA 1VEUA 3IXDA 3VSKA 3ZG8B 1JWPA 2X02A 4U0XA 3HJIA 1LL9A 1FSWA 2G7UA 3B3XA 4DE2A 2QZ6A 2QHKA 3O86A 3LEQA 4O7DA 1WE4A 4EU0A 5J8XA 2OAP1 2QKPA 3C38A 3QP2A 2W3EA 1Y4OA 2ZC7A 1KDSA 4C75A 4ARZB 1XJ6A 3SS4A 3IH9A 4X53A 5FQMA 3OBFA 4JF5A 4EETB 5TBMA 3UB5P 1H0MA 2HDQA 2P74A 3LI8A 3S4XA 3QP4A 5KMWA 1CEGA 1K38A 1K0KA 5FI6A 3DAVA 4YNRA 1MXOA 1DP9A 3A0SA 1XA1A 4X1MA 1GA0A 5M18A 3ZYTA 4IVIA 2A24B 1BULA 5HD3A 4OPQA 4R3BA 2L1MA 1ZG4A 3Q1FA 1IKGA 2ZL1A 3FWLA 3M6HA 3K3DA 1IYSA 5FAOA 1KGEA 4WF0A 1S1ZA 5FQQA 1YQSA 3GR2A 5HARA 3SZTA 4OLDA 4S2IA 2A3UA 4DXBA 2VGJA 3F1NB 3O3VA 3HLGA 4LCLA 3H9WA 3A0VA 3IX3A 1PWCA 3LGOA 3JVUA 4FCFA 1KGFA 3U4LP 5EE8A 2JC7A 3K2NA 4XUXA 3EQVA 3CZDA 4ZBEA 3UDXA 3R7WA 2JKTM 4QWOA 4ARZA 2Y2MA 3S22A 1IFQA 2UV0E 5CGWA 4ESPA 4PKYG 2H0YA 3FKVA 3UB7A 2IWBA 3O87A 1YPRA 4UA7A 1OTBA 3D3OA 4Y0TA 1L0DA 4XUZA 3HLFA 3HL9A 2K31A 4RYEA 3UDFA 1TDLA 2IA2A 5CHUA 5L2FA 3FYZA 3VE3A 1CK3A 4L0LA 3CPTB 4HQAA 4EESA 3PHYA 1BT5A 3N8RA 4GDBA 4YWZA 1K54A 5A91A 1K25A 4OP5A 2J80A 3PBTA 3VOZA 1TVFA 5FAQA 3N4IA 1S66L 4X68A 3V67A 4KZ3A 1KGGA 1CI9A 3LIDA 4LV3A 1Q2QA 2ZQAA 1YMXA 4JGRA 4E3KA 2ZQ9A 3MR0A 2K7SA 3MQQA 3VSLA 4G3VA 3D72A 4XT2B 4LCMA 1MWUA 3KYZA 5L8MA 3C4OA 3FKWA 1OJGA 4EBLA 3DTEA 1N9NA 3GECA 1YLZA 4EUZA 5CGSA 4H6JB 3IF6C 1BLPA 4WELA 3HVFA 1FIKA 4DKIA 1A0KA 4EEUA 1XA7A 2PAVP 1ERMA 1AXBA 1P0ZA 3RJUA 4IBXA 4FOFA 2ZC4B 2ZQDA 3LFVA 3KYQA 4EBNA 2FFYA 1E4DA 3E4OA 3RXXA 2ZMVA 3I7JA 5FEGA 3ITBA 4E3NA 1DY6A 5HAIA 4K08A 5E2GA 4CLCE 3PAEA 5F68A 1J9MA 4PM6A 4FTXA 2LB5A 3CPTA 3HLEA 1JNUA 1OT6A 5G4ZA 5J7EA 3KYEA 1LSWA 4P0MA 4IEDA 2Y2JA 5J4EA 1IYPA 1LL8A 4NXBA 3F1PA 1G5UA 2WGVA 3IS2A 2J9OA 2XGNA 1MWRA 1TD5A 3FPWA 3LR0A 5FQIA 4OQHA 3NDEA 2VX8A 3SH7A 4R38A 2YKFA 4MN7A 3E0YA 4S2NC 2XH9A 3ZHHA 2PYPA 3VP2A 1K55C 3OCNA 1HLUP 4F94A 3MS6A 4RX2A 4G3WA 4R23A 5AQ9A 2WKIA 4H6JA 5EVIC 1T19A 5DF7A 4CLCC 5HDSA 5KSHA 3P98A 2PT7A 3BJNA 1JTDA 1KVLA 4OVDA 3IBJA 1DJAA 3T4KA 3CJMA 3UN7A 1G28A 2ZQ8A 5GL9A 5I5LA 2XSSA 3RFBA 3Q07A 3E2KA 2CMNA 1XFNA 2XK1A 3WWXA 4DMZA 4NKPA 3PBOA 3KSFA 3G6OA 2R9XA 1KE0A 1EW0A 5EUAA 1HD8A 3BYDA 2WGIA 3UMDA 3E4QA 3LIBA 4UAAA 3HLDA 3BLMA 5LBRA 3B33A 3HLCA 4OPYA 1QMFA 5GLCA 4IVKA 5F69A 4P6ZS 5FDHA 2PYRA 1ES3A 1MWSA 1KE4A 4X25A 4E3OA 2QMIA 1TEMA 2W3FA 4OQ0A 1FR1A 1ONHA 1DP6A 4IJGA 5F1FA 5FL3A 4K0WA 4NXFA 4GNUA 2AVXA 3BY8A 4JGQA 4BWIA 3E4PA 4BQMA 1M40A 3NECA 3UPPA 1KVMA 3EEAA 2EWWA 2PD8A 1NZOA 4M3KA 5TFQA 3CAXA 5AQ7A 4BBUA 3BQ8A 5F5YA 4O01A 1L3LA 2IWCA 4HESA 3U2AA 4OOMA 4UEYA 3UE0A 3BEBA 1F2KA 5U47A 2ZC5B 3NY4A 2Q9NA 3UY6A 1DJCA 5HDDA 5CHMA 1EI5A 4DDSA 1I5QA 5CERA 4WZ5C 1T1AA 1DP8A 2QWSA 3P09A 1IKIA 2EFXA 1ALQA 3V5MA 2P9VB 3PBSA 1FOFA 1YSPA 5IT5A 4HIAA 2R9WA 2LB9A 3NI9A 4GZBA 3DW0A 4ZRRA 2Y4AA 2UWXA 4LFUA 1LHYA 3LY3A 4NK3A 4IUKA 4C6YA 5AQBA 2MJ6A 3WS0A 1VEUB 4GCZA 5IS1A 1IOUA 3ZNTA 2NUPC 1H5XA 5CX7A 4GN2A 4ID4A 2QJ5A 3W4OA 4EBPA 4MLLA 4Q0IA 4B4ZA 3S1YA 4KQQA 4KG6A 3MMHA 1K6SA 4LV0A 3UDIA 5IHVA 3EOIA 1HVBA 1XPBA 3MQ0A 3FC7A 3GTCA 1ZTUA 3GDIA 3HJKA 3FZCA 5F82A 5TGFA 5CTMA 4BL2A 2XD1A 5TBMB 4PPRA 3T4TA 4DJ3A 5E2FA 4BD1A 1TS0A 3WRZA 1XGJA 5FQ9A 1OMEA 4R4RA 1Z09A 1JWZA 1PNEA 1JWVA 2X01A 3OPRA 2BASA 2JBFA 2V1AA 2OV5A 5EVID 2VV6A 4WLAA 3BLSA 3EEHA 3OLOA 4WZ4A 4CLCD 2ZL1B 4NG2A 1W5DA 2D01A 3SOIA 2PU4A 2V8FA 2JCHA 1SKOA 3N7WA 4BJPA 4WMCD 1YKDA 2O9BA 5HD5A 3G35A 2GNXA 3LR4A 5EM0A 4KZBA 4LLOB 3Q82A 2OLVA 1OPXA 3LIEA 1LT0A 3MZFA 3T4LA 3KX0X 4KUKA 2PDRA 1CEFA 2XFSA 2H5SA 1E3UD 2QJ7A 2CC1A 3O88A 2XLNA 3A3FA 3LO7A 2KDKA 1OTDA 5AVEA 3VE4A 3VP0A 4H8RA 4ZJ1A 4DF6A 3MZDA 2V2FF 2WAFA 4LPZA 3R7WB 3BRMA 3NBLA 3SH9A 4Y15A 4F3LA 4HBTA 1K57A 1D7EA 5JYOA 2EX9A 1ACFA 5C5KA 4OQIA 1IEMA 2EX6A 2Z2LB 2Y2KA 4FUWA 4HHDA 2EXBA 2WK0A 1E25A 1NRFA 1FCNA 2INWA 2JKRI 4OH0A 2PRFA 4HOIA 4KUOA 3SW1A 4N9LA 5EM1A 3MZEA 2V0UA 1S4RA 4EQIA 1NLZA 1H8YA 3MXSA 4UQIM 1W79A 3VFFA 5A93A 4GKUA 4OLGA 5F6AA 4KZAA 2J3TC 1LSXA 1N9BA 1ONGA 2HDRA 4PAUA 4YINA 4P87A 5HL1A 4NXGA 1PIOA 4N9KA 2XDMA 3UE1A 5HAQA 1TS7A 3OOVA 5L07A 3IF6A 4WEJA 3N8SA 1ESUA 1OTIA 5E2EA 3V39A 1AWIA 2VV7A 5HL6A 5F83A 2VGKA 3WS1A 4GJ4A 4M4XA 2DNSA 2PR5A 4R1GA 4ZJ2A 3ITAA 3FG8A 3S7QA 3ZNYA 3MFXA 3T1XA 4HJ3A 1BLSA 1MPLA 1T1CA 2HDSA 4E04A 5FASA 2Y2QA 2B18A 2XRNA 4BL3A 3OCLA 1L2SA 5DKKA 4X69A 3A3JA 2L4RA 2VKSA 5CXWA 4S2PA 1ZC2A 3DWKA 4OPRA 1VETA 2ZD8A 3F1PB 4CJNA 3L7HA 1Y54A 3IS2B 1U60A 4LRYC 4X55A 3C8CA 4Y17A 2H10A 1JTGA 3A3EA 4S2NA 1EWZA 3IXGA 1CJFA 1PZPA 3M6BA 1K55A 5J3WA 3IXBA 3RTYA 2PU2A 1WYBA 3DTMA 3PTEA 3MJQA 4QU3A 4CLCA 1Z6FA 5F1GA 1ZKJA 3IWOA 5GHXA 4E3MA 3A3DA 1K56D 4WMCA 3ZFZA 1Y28A 4GOGA 5HZHA 3Q81A 1I2SA 3IF5A 2J8YA 3NOTC 3O5YA 5M19A 5FI7A 4QY6A 3LR3A 1SKFA 4MBKA 1H8ZA 1P97A 2OOLA 3H82B 5MC7A 2HF6A 4KQOA 5GLDA 2V0WA 4R3AA 1XXMA 4MN5A 4OPZA 5TR7A 1PW1A 1WA9A 2M1CA 5I94A 1NJ4A 2WKPA 1P9RA 4R4SA 4RX3A 4GHIB 3CUEA 1TDGA 3L9KA 1MY8A 3KSGA 1N9LA 4EWFA 2JHEA 1XX2A 1PWGA 2GJ3A 5HWTA 4PM9A 2E8IA 1W7FA 2V8CA 3LUQA 3C7UA 3T1QB 4X1LA 1PI4A 5GLBA 4OP8A 3BY9A 1NYYA 1UWNX 3G34A 4KZ4A 1GA9A 4KZ5A 2W3GA 4FSFA 2HPBA 2XEPA 1KE3A 2H28A 4RQ9A 4N1HA 4E3JA 2ZMFA 4B93A 5HWWA 2W1TA 3CWFA 1GSXA 2EXAA 4GLQA 5HPFA 2FZ0A 4Y7PA 1GSVA 2ZLYA 2V1BA 2P08A 4Y0UA 4WM9A 2HP9A 5FATA 3ZCZA 4AFIA 3HUNA 4QB8A 3H82A 2DMWA 1MZUA 3NHQA 3MXRA 1X0OA 1PWDA 3LIAA 4PKYA 1KDWA 3BFEA 2HGVA 2Q0OA 1DRMA 3KO6A 2J3TD 4GHIA 4DJ2A 4WZ5A 2C6WB 2Y55A 3AGFA 3EWKA 3W2ZA 4N1XA 4QD4A 3DTKA 1W8QA 3KSHA 2HP5A 1F9IA 2HJ9C 2ZMAA 5KSCA 3W4QA 1YLTA 2D02A 2JE5A 4LRZE 2EFUA 5A8BA 1L0GA 1PI5A 1ZG6A 3WS5A 3DWZA 4I5SA 3HUOA 2EX8A 3BWLA 4QJGA 4BBTA 2Z6DA 2WGWA 2Y2OA 2WZXA 1QMEA 5AJGA 4HP4A 5E43A 1RGYA 4GD8A 2JN7A 2RL3A 4K0XA 1TS6A 3IWQA 4E6XA 4KG2A 3LICA 4WBGA 4CPKA 1H3QA 1PZOA 4OOYA 3FV7A 5A92A 5EOEA 4Y5FA 3BECA 3P7NA 4Q0JA 2V20A 1W63M 2HJEA 1S67L 1XP4A 2DRWA 2VV8A 2W0NA 3IXHA 2HP6A 4GD6A 5BOHA 2Y2HA 3ZVTA 4QPRA 3IWIA 2B5RA 3AGEA 4OKPA 2EWVA 3VFHA 2Y2PA 1OT9A 3QP6A 1K4EA 3G2ZA 4JBFA 3NOPC 2B95A 1SCWA 1ZHHB 2NUTC 4Y2FA 4JLFA 4HBUA 2WADA 1SDEA 4DRTA 3W4PA 5AVFA 3S7NA 3FPVA 4DE0A 3MBZA 3CG5A 4E3LA 4GS9A 4CQHA 3B42A 2ZBBA 1BTLA 1SKOB 1F98A 2Y91A 2E8JA 5CEDA 5HFOA 1D1JA 1NWZA 3CHWP 1PW8A 1LL5A 3ZDJA 2VGLM 1BYWA 2Q9MA 2ZM2A 3QP8A 1JVJA 1SZVA 5DF8A 4R6LA 2X71A 3HLWA 1OTAA 2VZWA 3MFDA 1VM1A 4PHTA 3VOLA 4RA7A 4S2JA 2XR0A 3QP5A 4KG5A 2J3WA 1NY0A 2PBDP 1VB6A 5EPHA 1ES2A 2OWJA 4OOLA 3MF0A 4F3LB 1NRJA 1G68A 2W27A 3JPUA 5FDSA 4FH4A 5JYPA 1P9WA 4P6BA 4Y3IA 2I72A 4U0TA 5HX9A 3C4PA 4II7A 5G18A 5DJUA 4PMAA 4FH2A 3IQAA 5TJJA 2XROA 2Y2GA 1TF1A 1FR6A 3PYPA 2Y2IA 4NXEA 3T4QA 1LSVA 1CI8A 3OPHA 4D60A 3HBRA 3W8KA 1IYOA 3B47A 2ZC3B 4HH2A 2YKHA 3UPOA 4JXSA 4WEKA 4HH3A 4XXRA 2Y8HA 1PFLA 2ZQCA 2V9AA 2KX6A 3QNCA 2JKRM 1YAXA 1D06A 1S4SA 1NXYA 3SS5A 2O9AA 4NEED 3G2YA 5KZHA 5CRFA 3ZG9B 1MBLA 1YLPA 4JGOA 1Q2PA 1PYYA 4YFMA 2BG1A 2XA7M 3T50A 4KZ6A 1H8MA 1CF0A 3IF6B 5DFXA 5L10A 4P85A 1XKZA 4HJ4A 4BMWA 4O0PA 1S6RA 2KLIA 3PAGA 3GQZA 3NOUC 4B88A 1VHMA 2B02A 2Z6CA 3F1OA 4JF6A 3UB9A 5D3OA 2PBYA 2BLSA 2W1RA 3G4PA 4L9FA 5GLAA 2V1ZA 1ES5A 2M7UA 2GDNA 4UQIS 2JKFA 4KZ7A 4IBRA 3Q7VB 1UWPX 2VEAA 3ZG7B 4X56A 4KQDA 3CITA 3M2KA 3QNBA 3VP3A 5HW3A 3WS4A 3CMZA 5EOOA 5FSRA 4L9GA 3C30A 3E2LA 3VP4A 3TE8A 5M1AA 1G6AA 2OLUA 3PBNA 5DTSA 3BFCA 3V50A 1VETB 4MEZA 4X6TA 4ETZA 4E3IA 1MKIA 4S2LA 3IX8A 3H7WB 3ZVWA 3VP1A 1V9ZA 4DE1A 2M7VA 4B4XA 3MKEA 1O7EA 2XFTA 4Q0HA 2ZM0A 3UB6A 5AQAA 4R70A 1BUEA 3TSGA 3UPNA 4ZDXA 2VLGA 5EVIB 4CLCB 2Z2MB 4EXOA 4GDNA 2GX5A 3C2WA 3JYIA 2R78A 1FCOA 1F5MA 3T4OA 2C5WB 3TW8A 5HWVA 5CECA 4DN0A 1BSGA 1S1YA 2VA0A 1VQQA 2ZQ7A 2WZZA 3Q7VA 2HV1A 2PR6A 4JPMA 3PBQA 5DTTA 1YMSA 1YT4A 4EEPA 1BLHA 1K57C 5EVLA 1RGZA 2L0WA 1K4FA 3TG9A 2QPNA 2KOIA 2ACGA 5HSQA 3LIFA 4UA9A 4Z9QA 2I9VA 2W3DA 4Y0OA 2P7JA 2PD7A 2A24A 1MWTA 4E6WA 2W3HA 5FQJA 3RXWA 3UE3A 1M6KA 4R0QA 3EGDC 3BFGA 1IELA 1YLJA 5FI2A 3H7WA 4JGPA 1NLYA 2Y79A 3SS3A 1WYCA 3UNWA 3NIAA 4PM8A 5A90A 3ZGAB 3F1NA 5K5BA 2GZAA 3A0RA 3NULA 1W8YA 5EVIA 3TRCA 2HZ5A 3OPPA 3NDGA 4GB7A 2JKTI 4NETA 3ISGA 2A49A 2W1TB 4KQRA 3T12B 4C3QA 1V9YA 4LRXC 5DFYA 3NC8A 4N92A 3GRJA 4OONA 2WKRA 3E98A 1LI0A 5FAPA 1XFQA 1N9OA 5HAPA 4I39A 4Z1WA 1E3UA 3GVBA 3EGXC 1G6OA 3QHYA 4MMNA 2WUQA 3OC2A 2RCXA 5CTNA 4UHUA 4PM5A 1GHIA 1YSQA 5DF9A 2IWDA 2OAQ1 5CGXA 1GHPA 2H0TA 2K2NA 4ME4A 4MBHA 1YLYA 4EERA 1EROA 1C3BA 3G32A 3LI9A 4WN5A 4MDZA 2G2UA 1HTZA 3LCEA 1BZAA 1K54C 1GHMA 3GSGA 3D9YA 4KZ8A 2WGWB 4Q8IA 4U3TA 3LY4A 5L09A 4UA6A 1BLCA 2Y59A 1FILA 4I3AA 3WRTA 5CHJA 1XJ4A 4DDYA 5DTKA 3R4KA 4LGWA 5CEBA 4KENB 4BENA 4XT2A 1PRQA 2WYXA 4YOFA 3VV4A 4ZAMA 4QY5A 1ESIA 4JXVA 2XD5A 3D4FA 3DTIA 2OSUA 3ICYA 4A5RA 3EQUA 3IHAA 3BM6A 3C7VA 4EV4A 3GV9A 1O07A 4QHCA 1ERQA 4ZJ3A 3T4JA 3VOYA 4IUHA 2ZJ9A 3PR6A 3OPLA 3ZG0A 3IBRA 3Q7ZA 4EW7A 3N8LA 2WAEA 1TS8A 1HZOA 4BLMA 1RCJA 4HNBA 2DCFA 2ZOHA 4HP9A 4WUJA 4FD8A 4JXWA 4EUVA 3HLBA 3IHBA 4WYYA 4K91A 3DBAA 1I2WA 3UO9A 4LENA 1N4OA 1MKMA 2EA9A 3CUEC 4GS9B 3LR5A 4MN6A 4DE3A 2QYBA 3OZHA 3N6IA 4ETXA 3AGDA 1ODVA 1K6RA 2VK3A 4R3JA 4OQGA 3S7PA 3PXPA 1T1BA 3BFDA 1W63Q 1FCMA 5G4YA 5EECA 1SHVA 4LV1A 3MSHA 3SH8A 3MKFA 2ZOIA 3V3SA 1NZUA 2Y2NA 4IHQA 3T1RA 3CLOA 4S2KA 2WKHA 4I3JA 3P01A 3IT9A 5EV0A 3NCKA 1CQAA 3BQAA 2XQZA 1LI9A 1KOUA 3UE6A 1OTEA 2ZM8A 4D2OA 3KSIA 1SDNA 3TJZC 4S2MA 3M2JA 2VJWA 4P6ZM 1XJ2A 4JKTA 1IYQA 4GW9A 5DKLA 1GSWA 5DJTA 4MNRA 2Y2LA 4PM7A 4I38A 3HCYA 3S7OA 4HY8A 2G2WA 4HI4A 1K56A 1MC0A 4L9EA 3C5AA 3PBRA 4Y13A 2VGLS 3GMWA 3IH8A 3UB8A 1GCEA 4JXGA 4MCWA 4O8GA 3MQOA 4BD0A 3LEZA 5HDCA 1T18A 2BTFP 1J3WA 3JVVA 3ULFA 2O9CA 3HUMA 3UMEA 4B9OA 1NYMA 3A3IA 4BBVA 3K3CA 4I3IA 4WL9A 3T1SA 1OJ5A 5EVEA 1FSYA 3VMAA 1YM1A 1LLBA 5IU1A 3CI6A 2PHYA 4G3KA 2XF3A 3G31A 3ZQ5A 4S2OA 2HDUA 4LV2A 3HREA 2ZC6B 5GHYA 1XJ3A 1XGIA 1FQGA 3LYXA 5GHZA 4ZTKA 1RP5A 1L0FA 4DXCA 1L0EA 2FH5A 5FQKA 5EFWA 2J7VA 3F1OB 4EQ1A 3V3RA 3NJAA 1S0WA 5KIZA 3T4SA 3WS2A 5E2HA 1ES4A 3IX4A 4HJ6A 3BFFA 5HPIA 3QP1A 3MXQA 5FA7A 2FFFB 3ZG5A
chains in the Genus database with same CATH topology
1NJ4A 4ZDXA 4JF4A 5EVIB 4K0WA 4R4SA 4GNUA 2WKEA 2Z2MB 4RX3A 4GDNA 1TDGA 1MY8A 3JYIA 4MBFA 4EWFA 4HEFA 3TOIA 1FCOA 1PWGA 1XX2A 2P9VA 4BQMA 1M40A 3UPPA 2C5WB 4PM9A 1KVMA 5CECA 5DVAA 2E8IA 1BSGA 1W7FA 3C7UA 1NZOA 4KZ9A 1VQQA 1DJBA 3G30A 4M3KA 5TFQA 2ZQ7A 5AQ7A 1PI4A 2WZZA 5GLBA 4OP8A 3Q7VA 1NYYA 3G34A 4KZ4A 2IWCA 4JPMA 1GA9A 2J9PA 3PBQA 4HESA 4KZ5A 4FSFA 2EX2A 5DTTA 1YMSA 4OOMA 1YLWA 4RVAA 3UE0A 3IXDA 1YT4A 3VSKA 2HPBA 2XEPA 3BEBA 3ZG8B 1BLHA 1K57C 1KE3A 5EVLA 1RGZA 5U47A 1K4FA 1JWPA 2ZC5B 3NY4A 2Q9NA 4N1HA 3UY6A 2X02A 3TG9A 4E3JA 4U0XA 1DJCA 2QPNA 1LL9A 1FSWA 4DE2A 3B3XA 5CHMA 1EI5A 4DDSA 1I5QA 2QZ6A 5CERA 4UA9A 3O86A 4WZ5C 4Z9QA 2EXAA 4Y0OA 3P09A 4O7DA 1IKIA 1MWTA 1WE4A 2EFXA 4E6WA 1ALQA 5J8XA 4Y7PA 5FQJA 3RXWA 2ZLYA 3UE3A 1M6KA 2P9VB 3V5MA 3PBSA 4R0QA 3BFGA 1FOFA 1IELA 1YLJA 5FI2A 4Y0UA 2R9WA 4WM9A 2HP9A 5FATA 2ZC7A 3ZCZA 3NI9A 1KDSA 4GZBA 4C75A 3DW0A 3SS3A 1WYCA 2Y4AA 2UWXA 3HUNA 3SS4A 4QB8A 3IH9A 1LHYA 3LY3A 3MXRA 4NK3A 3UNWA 4X53A 4C6YA 5FQMA 4JF5A 1PWDA 5AQBA 3NIAA 3WS0A 2HDQA 2P74A 4PM8A 1KDWA 5A90A 3BFEA 3S4XA 3ZNTA 3ZGAB 5KMWA 1CEGA 5EVIA 1H5XA 1K38A 1W8YA 5FI6A 3OPPA 3NDGA 4GN2A 4GB7A 4NETA 1MXOA 4ID4A 4WZ5A 3ISGA 3W4OA 4EBPA 4MLLA 2A49A 2C6WB 1XA1A 2Y55A 4B4ZA 1GA0A 3AGFA 4KQRA 5M18A 4C3QA 4N1XA 4QD4A 4IVIA 1W8QA 2HP5A 3NC8A 4N92A 1BULA 3S1YA 4KQQA 3GRJA 2ZMAA 5KSCA 4OONA 3W4QA 4KG6A 1YLTA 4LV0A 1K6SA 1LI0A 3UDIA 5FAPA 4OPQA 2JE5A 5IHVA 2EFUA 1HVBA 1XPBA 1L0GA 1PI5A 5HAPA 4R3BA 3GTCA 1ZG4A 1ZG6A 3Q1FA 1IKGA 3WS5A 1E3UA 3DWZA 3FWLA 3M6HA 3GVBA 3HUOA 2EX8A 3FZCA 5F82A 5TGFA 4QJGA 1IYSA 5FAOA 3QHYA 1KGEA 2WUQA 3OC2A 5CTMA 5FQQA 4BL2A 1YQSA 3GR2A 2WGWA 2XD1A 2Y2OA 2RCXA 4PPRA 5HARA 5CTNA 2WZXA 4OLDA 4UHUA 1QMEA 4S2IA 2A3UA 4DXBA 5E43A 2VGJA 4PM5A 3O3VA 1RGYA 3HLGA 5E2FA 4GD8A 2RL3A 4LCLA 4K0XA 1GHIA 4BD1A 5DF9A 3IWQA 2IWDA 1XGJA 3WRZA 5CGXA 4E6XA 1PWCA 1GHPA 4KG2A 5FQ9A 4WBGA 4FCFA 2H0TA 1KGFA 1OMEA 4R4RA 4CPKA 4MBHA 5EE8A 1PZOA 1YLYA 1JWZA 2JC7A 1EROA 4OOYA 3FV7A 4XUXA 1JWVA 5A92A 2X01A 5EOEA 1C3BA 3OPRA 3EQVA 3CZDA 3G32A 4ZBEA 3UDXA 3BECA 2JBFA 2V20A 2OV5A 5EVID 2G2UA 1HTZA 1XP4A 2Y2MA 3BLSA 2DRWA 1BZAA 3LCEA 4WZ4A 3S22A 1K54C 5CGWA 1GHMA 3GSGA 1W5DA 3SOIA 2PU4A 3IXHA 2H0YA 2HP6A 4GD6A 2JCHA 3FKVA 5BOHA 4KZ8A 2Y2HA 3N7WA 2WGWB 3ZVTA 2IWBA 4BJPA 3O87A 4WMCD 4Q8IA 3IWIA 2B5RA 4U3TA 4UA7A 3LY4A 3G35A 3AGEA 4UA6A 1BLCA 2Y59A 4OKPA 3WRTA 4KZBA 5CHJA 4Y0TA 3Q82A 3VFHA 2OLVA 4DDYA 5DTKA 3MZFA 2Y2PA 1L0DA 1K4EA 4XUZA 5CEBA 3G2ZA 3HLFA 4JBFA 1CEFA 2XFSA 4KENB 3HL9A 1SCWA 1E3UD 2H5SA 4BENA 2CC1A 2WYXA 4JLFA 4HBUA 3O88A 4RYEA 2XLNA 3A3FA 2WADA 3UDFA 1TDLA 1SDEA 3LO7A 5CHUA 4DRTA 4ZAMA 3VP0A 4QY5A 4H8RA 1ESIA 4ZJ1A 4JXVA 2XD5A 3MZDA 3W4PA 3D4FA 4DF6A 3FYZA 5L2FA 2OSUA 4DE0A 1CK3A 2V2FF 2WAFA 4A5RA 4L0LA 3MBZA 3CG5A 3EQUA 1BT5A 3N8RA 3IHAA 4GDBA 4E3LA 1K54A 5A91A 3BRMA 1K25A 3NBLA 3BM6A 3C7VA 4EV4A 4OP5A 3PBTA 3VOZA 1BTLA 1TVFA 3GV9A 5FAQA 3N4IA 1O07A 4QHCA 4HBTA 1ERQA 1K57A 4ZJ3A 2Y91A 3SH9A 3VOYA 4X68A 5CEDA 5HFOA 4KZ3A 1KGGA 5JYOA 2EX9A 2ZJ9A 1CI9A 1PW8A 4LV3A 1Q2QA 2ZQAA 1LL5A 3OPLA 3ZDJA 3ZG0A 1YMXA 4OQIA 3Q7ZA 1IEMA 2Q9MA 2EX6A 2ZM2A 4E3KA 2ZQ9A 3N8LA 1JVJA 2WAEA 5DF8A 1HZOA 2Z2LB 4BLMA 2Y2KA 1RCJA 3VSLA 2EXBA 2WK0A 1E25A 2X71A 4LCMA 1MWUA 1FCNA 1NRFA 2DCFA 3HLWA 3C4OA 3FKWA 4OH0A 3MFDA 1VM1A 4EBLA 4FD8A 4JXWA 1YLZA 3HLBA 4EUZA 5CGSA 3IHBA 4N9LA 4RA7A 3MZEA 4S2JA 2XR0A 4WYYA 3IF6C 4K91A 4KG5A 3UO9A 1I2WA 1NY0A 4LENA 1N4OA 1BLPA 4EQIA 5EPHA 4WELA 3HVFA 4DKIA 1ES2A 1H8YA 3MXSA 4OOLA 1XA7A 1W79A 3VFFA 5A93A 4DE3A 1ERMA 4GKUA 3OZHA 3N6IA 1AXBA 1G68A 3AGDA 3RJUA 4OLGA 1K6RA 4IBXA 4FH4A 2ZC4B 1N9BA 2ZQDA 4KZAA 4OQGA 3BFDA 1ONGA 4R3JA 4P6BA 5JYPA 2HDRA 4EBNA 2FFYA 1E4DA 1FCMA 2I72A 4U0TA 5EECA 5HX9A 1SHVA 4LV1A 3SH8A 3RXXA 3C4PA 3I7JA 3MKFA 5G18A 4YINA 4PMAA 3ITBA 3V3SA 1NZUA 1DY6A 2Y2NA 5HAIA 4E3NA 4FH2A 4P87A 5E2GA 5HL1A 3IQAA 3PAEA 4S2KA 2WKHA 2Y2GA 1PIOA 4N9KA 2XDMA 3UE1A 1FR6A 3IT9A 5HAQA 2Y2IA 3NCKA 1J9MA 4PM6A 1CI8A 3HLEA 3OPHA 3IF6A 3HBRA 3W8KA 1IYOA 2XQZA 2ZC3B 1LI9A 4WEJA 3N8SA 3UPOA 1ESUA 2ZM8A 4JXSA 4IEDA 2Y2JA 4P0MA 4D2OA 1IYPA 5E2EA 1SDNA 4S2MA 3M2JA 4WEKA 3V39A 4JKTA 4XXRA 1IYQA 2ZQCA 2WGVA 3QNCA 2J9OA 2XGNA 1MWRA 4MNRA 5F83A 2Y2LA 4PM7A 5FQIA 4OQHA 3NDEA 2VGKA 3WS1A 1NXYA 3SH7A 3SS5A 2G2WA 1K56A 2DNSA 3G2YA 4S2NC 5KZHA 5CRFA 3ZG9B 3C5AA 4R1GA 3PBRA 1MBLA 3ITAA 4ZJ2A 2XH9A 3ZHHA 3VP2A 3ZNYA 1YLPA 1Q2PA 1BLSA 1PYYA 1K55C 4YFMA 2BG1A 1MPLA 3GMWA 3OCNA 2HDSA 5FASA 4F94A 3IH8A 4RX2A 2Y2QA 1GCEA 4JXGA 4R23A 5AQ9A 4BL3A 2WKIA 3OCLA 4KZ6A 1L2SA 5EVIC 4BD0A 3IF6B 4X69A 5DF7A 3A3JA 3LEZA 5KSHA 3P98A 5CXWA 4S2PA 4P85A 1ZC2A 1JTDA 3DWKA 1KVLA 1XKZA 4OPRA 4OVDA 1S6RA 2ZD8A 3PAGA 3GQZA 4CJNA 3HUMA 1NYMA 1DJAA 1Y54A 4B88A 3A3IA 4JF6A 1U60A 3CJMA 4X55A 3UN7A 5D3OA 2PBYA 2BLSA 2ZQ8A 3G4PA 5GL9A 5GLAA 2H10A 2V1ZA 1ES5A 2GDNA 1FSYA 1JTGA 3A3EA 4KZ7A 3Q07A 3VMAA 4S2NA 4IBRA 1EWZA 1YM1A 3E2KA 1LLBA 3Q7VB 3IXGA 3ZG7B 1PZPA 4X56A 3M6BA 1K55A 3IXBA 2XK1A 3WWXA 2XF3A 2PU2A 3G31A 3M2KA 3QNBA 3VP3A 5HW3A 3WS4A 1WYBA 3CMZA 4S2OA 5EOOA 3PBOA 2HDUA 5FSRA 4LV2A 2R9XA 1KE0A 3DTMA 3PTEA 3E2LA 5EUAA 4QU3A 3HREA 1Z6FA 5F1GA 1ZKJA 3IWOA 3VP4A 5GHXA 5M1AA 2ZC6B 3A3DA 4E3MA 1HD8A 1G6AA 5GHYA 3BYDA 2WGIA 1K56D 2OLUA 3PBNA 1XGIA 1FQGA 4UAAA 4WMCA 3HLDA 3BLMA 5DTSA 3BFCA 5GHZA 3ZFZA 4ZTKA 1RP5A 3V50A 1L0FA 4GOGA 3Q81A 1I2SA 4DXCA 4MEZA 3HLCA 3IF5A 2J8YA 4X6TA 4E3IA 1L0EA 4OPYA 1MKIA 5FQKA 4S2LA 5M19A 1QMFA 2J7VA 5GLCA 4IVKA 3V3RA 3ZVWA 3VP1A 5FI7A 4QY6A 5FDHA 1S0WA 4DE1A 1ES3A 1MWSA 1SKFA 4MBKA 4B4XA 1KE4A 1H8ZA 3MKEA 3WS2A 1O7EA 4E3OA 2QMIA 1TEMA 2XFTA 5E2HA 1ES4A 4KQOA 4OQ0A 2ZM0A 5GLDA 1FR1A 1ONHA 3BFFA 1XXMA 4OPZA 5F1FA 5TR7A 1PW1A 5AQAA 5FA7A 5I94A 2FFFB 1BUEA 3ZG5A 3TSGA 3UPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ4 A;  4ZDX A;  4JF4 A;  5EVI B;  4K0W A;  4R4S A;  4GNU A;  2WKE A;  2Z2M B;  4RX3 A;  4GDN A;  1TDG A;  1MY8 A;  3JYI A;  4MBF A;  4EWF A;  4HEF A;  3TOI A;  1FCO A;  1PWG A;  1XX2 A;  2P9V A;  4BQM A;  1M40 A;  3UPP A;  2C5W B;  4PM9 A;  1KVM A;  5CEC A;  5DVA A;  2E8I A;  1BSG A;  1W7F A;  3C7U A;  1NZO A;  4KZ9 A;  1VQQ A;  1DJB A;  3G30 A;  4M3K A;  5TFQ A;  2ZQ7 A;  5AQ7 A;  1PI4 A;  2WZZ A;  5GLB A;  4OP8 A;  3Q7V A;  1NYY A;  3G34 A;  4KZ4 A;  2IWC A;  4JPM A;  1GA9 A;  2J9P A;  3PBQ A;  4HES A;  4KZ5 A;  4FSF A;  2EX2 A;  5DTT A;  1YMS A;  4OOM A;  1YLW A;  4RVA A;  3UE0 A;  3IXD A;  1YT4 A;  3VSK A;  2HPB A;  2XEP A;  3BEB A;  3ZG8 B;  1BLH A;  1K57 C;  1KE3 A;  5EVL A;  1RGZ A;  5U47 A;  1K4F A;  1JWP A;  2ZC5 B;  3NY4 A;  2Q9N A;  4N1H A;  3UY6 A;  2X02 A;  3TG9 A;  4E3J A;  4U0X A;  1DJC A;  2QPN A;  1LL9 A;  1FSW A;  4DE2 A;  3B3X A;  5CHM A;  1EI5 A;  4DDS A;  1I5Q A;  2QZ6 A;  5CER A;  4UA9 A;  3O86 A;  4WZ5 C;  4Z9Q A;  2EXA A;  4Y0O A;  3P09 A;  4O7D A;  1IKI A;  1MWT A;  1WE4 A;  2EFX A;  4E6W A;  1ALQ A;  5J8X A;  4Y7P A;  5FQJ A;  3RXW A;  2ZLY A;  3UE3 A;  1M6K A;  2P9V B;  3V5M A;  3PBS A;  4R0Q A;  3BFG A;  1FOF A;  1IEL A;  1YLJ A;  5FI2 A;  4Y0U A;  2R9W A;  4WM9 A;  2HP9 A;  5FAT A;  2ZC7 A;  3ZCZ A;  3NI9 A;  1KDS A;  4GZB A;  4C75 A;  3DW0 A;  3SS3 A;  1WYC A;  2Y4A A;  2UWX A;  3HUN A;  3SS4 A;  4QB8 A;  3IH9 A;  1LHY A;  3LY3 A;  3MXR A;  4NK3 A;  3UNW A;  4X53 A;  4C6Y A;  5FQM A;  4JF5 A;  1PWD A;  5AQB A;  3NIA A;  3WS0 A;  2HDQ A;  2P74 A;  4PM8 A;  1KDW A;  5A90 A;  3BFE A;  3S4X A;  3ZNT A;  3ZGA B;  5KMW A;  1CEG A;  5EVI A;  1H5X A;  1K38 A;  1W8Y A;  5FI6 A;  3OPP A;  3NDG A;  4GN2 A;  4GB7 A;  4NET A;  1MXO A;  4ID4 A;  4WZ5 A;  3ISG A;  3W4O A;  4EBP A;  4MLL A;  2A49 A;  2C6W B;  1XA1 A;  2Y55 A;  4B4Z A;  1GA0 A;  3AGF A;  4KQR A;  5M18 A;  4C3Q A;  4N1X A;  4QD4 A;  4IVI A;  1W8Q A;  2HP5 A;  3NC8 A;  4N92 A;  1BUL A;  3S1Y A;  4KQQ A;  3GRJ A;  2ZMA A;  5KSC A;  4OON A;  3W4Q A;  4KG6 A;  1YLT A;  4LV0 A;  1K6S A;  1LI0 A;  3UDI A;  5FAP A;  4OPQ A;  2JE5 A;  5IHV A;  2EFU A;  1HVB A;  1XPB A;  1L0G A;  1PI5 A;  5HAP A;  4R3B A;  3GTC A;  1ZG4 A;  1ZG6 A;  3Q1F A;  1IKG A;  3WS5 A;  1E3U A;  3DWZ A;  3FWL A;  3M6H A;  3GVB A;  3HUO A;  2EX8 A;  3FZC A;  5F82 A;  5TGF A;  4QJG A;  1IYS A;  5FAO A;  3QHY A;  1KGE A;  2WUQ A;  3OC2 A;  5CTM A;  5FQQ A;  4BL2 A;  1YQS A;  3GR2 A;  2WGW A;  2XD1 A;  2Y2O A;  2RCX A;  4PPR A;  5HAR A;  5CTN A;  2WZX A;  4OLD A;  4UHU A;  1QME A;  4S2I A;  2A3U A;  4DXB A;  5E43 A;  2VGJ A;  4PM5 A;  3O3V A;  1RGY A;  3HLG A;  5E2F A;  4GD8 A;  2RL3 A;  4LCL A;  4K0X A;  1GHI A;  4BD1 A;  5DF9 A;  3IWQ A;  2IWD A;  1XGJ A;  3WRZ A;  5CGX A;  4E6X A;  1PWC A;  1GHP A;  4KG2 A;  5FQ9 A;  4WBG A;  4FCF A;  2H0T A;  1KGF A;  1OME A;  4R4R A;  4CPK A;  4MBH A;  5EE8 A;  1PZO A;  1YLY A;  1JWZ A;  2JC7 A;  1ERO A;  4OOY A;  3FV7 A;  4XUX A;  1JWV A;  5A92 A;  2X01 A;  5EOE A;  1C3B A;  3OPR A;  3EQV A;  3CZD A;  3G32 A;  4ZBE A;  3UDX A;  3BEC A;  2JBF A;  2V20 A;  2OV5 A;  5EVI D;  2G2U A;  1HTZ A;  1XP4 A;  2Y2M A;  3BLS A;  2DRW A;  1BZA A;  3LCE A;  4WZ4 A;  3S22 A;  1K54 C;  5CGW A;  1GHM A;  3GSG A;  1W5D A;  3SOI A;  2PU4 A;  3IXH A;  2H0Y A;  2HP6 A;  4GD6 A;  2JCH A;  3FKV A;  5BOH A;  4KZ8 A;  2Y2H A;  3N7W A;  2WGW B;  3ZVT A;  2IWB A;  4BJP A;  3O87 A;  4WMC D;  4Q8I A;  3IWI A;  2B5R A;  4U3T A;  4UA7 A;  3LY4 A;  3G35 A;  3AGE A;  4UA6 A;  1BLC A;  2Y59 A;  4OKP A;  3WRT A;  4KZB A;  5CHJ A;  4Y0T A;  3Q82 A;  3VFH A;  2OLV A;  4DDY A;  5DTK A;  3MZF A;  2Y2P A;  1L0D A;  1K4E A;  4XUZ A;  5CEB A;  3G2Z A;  3HLF A;  4JBF A;  1CEF A;  2XFS A;  4KEN B;  3HL9 A;  1SCW A;  1E3U D;  2H5S A;  4BEN A;  2CC1 A;  2WYX A;  4JLF A;  4HBU A;  3O88 A;  4RYE A;  2XLN A;  3A3F A;  2WAD A;  3UDF A;  1TDL A;  1SDE A;  3LO7 A;  5CHU A;  4DRT A;  4ZAM A;  3VP0 A;  4QY5 A;  4H8R A;  1ESI A;  4ZJ1 A;  4JXV A;  2XD5 A;  3MZD A;  3W4P A;  3D4F A;  4DF6 A;  3FYZ A;  5L2F A;  2OSU A;  4DE0 A;  1CK3 A;  2V2F F;  2WAF A;  4A5R A;  4L0L A;  3MBZ A;  3CG5 A;  3EQU A;  1BT5 A;  3N8R A;  3IHA A;  4GDB A;  4E3L A;  1K54 A;  5A91 A;  3BRM A;  1K25 A;  3NBL A;  3BM6 A;  3C7V A;  4EV4 A;  4OP5 A;  3PBT A;  3VOZ A;  1BTL A;  1TVF A;  3GV9 A;  5FAQ A;  3N4I A;  1O07 A;  4QHC A;  4HBT A;  1ERQ A;  1K57 A;  4ZJ3 A;  2Y91 A;  3SH9 A;  3VOY A;  4X68 A;  5CED A;  5HFO A;  4KZ3 A;  1KGG A;  5JYO A;  2EX9 A;  2ZJ9 A;  1CI9 A;  1PW8 A;  4LV3 A;  1Q2Q A;  2ZQA A;  1LL5 A;  3OPL A;  3ZDJ A;  3ZG0 A;  1YMX A;  4OQI A;  3Q7Z A;  1IEM A;  2Q9M A;  2EX6 A;  2ZM2 A;  4E3K A;  2ZQ9 A;  3N8L A;  1JVJ A;  2WAE A;  5DF8 A;  1HZO A;  2Z2L B;  4BLM A;  2Y2K A;  1RCJ A;  3VSL A;  2EXB A;  2WK0 A;  1E25 A;  2X71 A;  4LCM A;  1MWU A;  1FCN A;  1NRF A;  2DCF A;  3HLW A;  3C4O A;  3FKW A;  4OH0 A;  3MFD A;  1VM1 A;  4EBL A;  4FD8 A;  4JXW A;  1YLZ A;  3HLB A;  4EUZ A;  5CGS A;  3IHB A;  4N9L A;  4RA7 A;  3MZE A;  4S2J A;  2XR0 A;  4WYY A;  3IF6 C;  4K91 A;  4KG5 A;  3UO9 A;  1I2W A;  1NY0 A;  4LEN A;  1N4O A;  1BLP A;  4EQI A;  5EPH A;  4WEL A;  3HVF A;  4DKI A;  1ES2 A;  1H8Y A;  3MXS A;  4OOL A;  1XA7 A;  1W79 A;  3VFF A;  5A93 A;  4DE3 A;  1ERM A;  4GKU A;  3OZH A;  3N6I A;  1AXB A;  1G68 A;  3AGD A;  3RJU A;  4OLG A;  1K6R A;  4IBX A;  4FH4 A;  2ZC4 B;  1N9B A;  2ZQD A;  4KZA A;  4OQG A;  3BFD A;  1ONG A;  4R3J A;  4P6B A;  5JYP A;  2HDR A;  4EBN A;  2FFY A;  1E4D A;  1FCM A;  2I72 A;  4U0T A;  5EEC A;  5HX9 A;  1SHV A;  4LV1 A;  3SH8 A;  3RXX A;  3C4P A;  3I7J A;  3MKF A;  5G18 A;  4YIN A;  4PMA A;  3ITB A;  3V3S A;  1NZU A;  1DY6 A;  2Y2N A;  5HAI A;  4E3N A;  4FH2 A;  4P87 A;  5E2G A;  5HL1 A;  3IQA A;  3PAE A;  4S2K A;  2WKH A;  2Y2G A;  1PIO A;  4N9K A;  2XDM A;  3UE1 A;  1FR6 A;  3IT9 A;  5HAQ A;  2Y2I A;  3NCK A;  1J9M A;  4PM6 A;  1CI8 A;  3HLE A;  3OPH A;  3IF6 A;  3HBR A;  3W8K A;  1IYO A;  2XQZ A;  2ZC3 B;  1LI9 A;  4WEJ A;  3N8S A;  3UPO A;  1ESU A;  2ZM8 A;  4JXS A;  4IED A;  2Y2J A;  4P0M A;  4D2O A;  1IYP A;  5E2E A;  1SDN A;  4S2M A;  3M2J A;  4WEK A;  3V39 A;  4JKT A;  4XXR A;  1IYQ A;  2ZQC A;  2WGV A;  3QNC A;  2J9O A;  2XGN A;  1MWR A;  4MNR A;  5F83 A;  2Y2L A;  4PM7 A;  5FQI A;  4OQH A;  3NDE A;  2VGK A;  3WS1 A;  1NXY A;  3SH7 A;  3SS5 A;  2G2W A;  1K56 A;  2DNS A;  3G2Y A;  4S2N C;  5KZH A;  5CRF A;  3ZG9 B;  3C5A A;  4R1G A;  3PBR A;  1MBL A;  3ITA A;  4ZJ2 A;  2XH9 A;  3ZHH A;  3VP2 A;  3ZNY A;  1YLP A;  1Q2P A;  1BLS A;  1PYY A;  1K55 C;  4YFM A;  2BG1 A;  1MPL A;  3GMW A;  3OCN A;  2HDS A;  5FAS A;  4F94 A;  3IH8 A;  4RX2 A;  2Y2Q A;  1GCE A;  4JXG A;  4R23 A;  5AQ9 A;  4BL3 A;  2WKI A;  3OCL A;  4KZ6 A;  1L2S A;  5EVI C;  4BD0 A;  3IF6 B;  4X69 A;  5DF7 A;  3A3J A;  3LEZ A;  5KSH A;  3P98 A;  5CXW A;  4S2P A;  4P85 A;  1ZC2 A;  1JTD A;  3DWK A;  1KVL A;  1XKZ A;  4OPR A;  4OVD A;  1S6R A;  2ZD8 A;  3PAG A;  3GQZ A;  4CJN A;  3HUM A;  1NYM A;  1DJA A;  1Y54 A;  4B88 A;  3A3I A;  4JF6 A;  1U60 A;  3CJM A;  4X55 A;  3UN7 A;  5D3O A;  2PBY A;  2BLS A;  2ZQ8 A;  3G4P A;  5GL9 A;  5GLA A;  2H10 A;  2V1Z A;  1ES5 A;  2GDN A;  1FSY A;  1JTG A;  3A3E A;  4KZ7 A;  3Q07 A;  3VMA A;  4S2N A;  4IBR A;  1EWZ A;  1YM1 A;  3E2K A;  1LLB A;  3Q7V B;  3IXG A;  3ZG7 B;  1PZP A;  4X56 A;  3M6B A;  1K55 A;  3IXB A;  2XK1 A;  3WWX A;  2XF3 A;  2PU2 A;  3G31 A;  3M2K A;  3QNB A;  3VP3 A;  5HW3 A;  3WS4 A;  1WYB A;  3CMZ A;  4S2O A;  5EOO A;  3PBO A;  2HDU A;  5FSR A;  4LV2 A;  2R9X A;  1KE0 A;  3DTM A;  3PTE A;  3E2L A;  5EUA A;  4QU3 A;  3HRE A;  1Z6F A;  5F1G A;  1ZKJ A;  3IWO A;  3VP4 A;  5GHX A;  5M1A A;  2ZC6 B;  3A3D A;  4E3M A;  1HD8 A;  1G6A A;  5GHY A;  3BYD A;  2WGI A;  1K56 D;  2OLU A;  3PBN A;  1XGI A;  1FQG A;  4UAA A;  4WMC A;  3HLD A;  3BLM A;  5DTS A;  3BFC A;  5GHZ A;  3ZFZ A;  4ZTK A;  1RP5 A;  3V50 A;  1L0F A;  4GOG A;  3Q81 A;  1I2S A;  4DXC A;  4MEZ A;  3HLC A;  3IF5 A;  2J8Y A;  4X6T A;  4E3I A;  1L0E A;  4OPY A;  1MKI A;  5FQK A;  4S2L A;  5M19 A;  1QMF A;  2J7V A;  5GLC A;  4IVK A;  3V3R A;  3ZVW A;  3VP1 A;  5FI7 A;  4QY6 A;  5FDH A;  1S0W A;  4DE1 A;  1ES3 A;  1MWS A;  1SKF A;  4MBK A;  4B4X A;  1KE4 A;  1H8Z A;  3MKE A;  3WS2 A;  1O7E A;  4E3O A;  2QMI A;  1TEM A;  2XFT A;  5E2H A;  1ES4 A;  4KQO A;  4OQ0 A;  2ZM0 A;  5GLD A;  1FR1 A;  1ONH A;  3BFF A;  1XXM A;  4OPZ A;  5F1F A;  5TR7 A;  1PW1 A;  5AQA A;  5FA7 A;  5I94 A;  2FFF B;  1BUE A;  3ZG5 A;  3TSG A;  3UPN A; 
#chains in the Genus database with same CATH topology
 4JF4 A;  1UGU A;  2WKE A;  2XA7 S;  4MBF A;  4HEF A;  2O99 A;  3TOI A;  2A2L A;  2P04 A;  2P9V A;  5DVA A;  3BW6 A;  2WKQ A;  4KZ9 A;  3G30 A;  1DJB A;  3RH8 B;  5FEF A;  2JKG A;  1STZ A;  2OWH A;  2O0Y A;  2J9P A;  2EX2 A;  1YLW A;  4RVA A;  1VEU A;  3IXD A;  3VSK A;  3ZG8 B;  1JWP A;  2X02 A;  4U0X A;  3HJI A;  1LL9 A;  1FSW A;  2G7U A;  3B3X A;  4DE2 A;  2QZ6 A;  2QHK A;  3O86 A;  3LEQ A;  4O7D A;  1WE4 A;  4EU0 A;  5J8X A;  2OAP 1;  2QKP A;  3C38 A;  3QP2 A;  2W3E A;  1Y4O A;  2ZC7 A;  1KDS A;  4C75 A;  4ARZ B;  1XJ6 A;  3SS4 A;  3IH9 A;  4X53 A;  5FQM A;  3OBF A;  4JF5 A;  4EET B;  5TBM A;  3UB5 P;  1H0M A;  2HDQ A;  2P74 A;  3LI8 A;  3S4X A;  3QP4 A;  5KMW A;  1CEG A;  1K38 A;  1K0K A;  5FI6 A;  3DAV A;  4YNR A;  1MXO A;  1DP9 A;  3A0S A;  1XA1 A;  4X1M A;  1GA0 A;  5M18 A;  3ZYT A;  4IVI A;  2A24 B;  1BUL A;  5HD3 A;  4OPQ A;  4R3B A;  2L1M A;  1ZG4 A;  3Q1F A;  1IKG A;  2ZL1 A;  3FWL A;  3M6H A;  3K3D A;  1IYS A;  5FAO A;  1KGE A;  4WF0 A;  1S1Z A;  5FQQ A;  1YQS A;  3GR2 A;  5HAR A;  3SZT A;  4OLD A;  4S2I A;  2A3U A;  4DXB A;  2VGJ A;  3F1N B;  3O3V A;  3HLG A;  4LCL A;  3H9W A;  3A0V A;  3IX3 A;  1PWC A;  3LGO A;  3JVU A;  4FCF A;  1KGF A;  3U4L P;  5EE8 A;  2JC7 A;  3K2N A;  4XUX A;  3EQV A;  3CZD A;  4ZBE A;  3UDX A;  3R7W A;  2JKT M;  4QWO A;  4ARZ A;  2Y2M A;  3S22 A;  1IFQ A;  2UV0 E;  5CGW A;  4ESP A;  4PKY G;  2H0Y A;  3FKV A;  3UB7 A;  2IWB A;  3O87 A;  1YPR A;  4UA7 A;  1OTB A;  3D3O A;  4Y0T A;  1L0D A;  4XUZ A;  3HLF A;  3HL9 A;  2K31 A;  4RYE A;  3UDF A;  1TDL A;  2IA2 A;  5CHU A;  5L2F A;  3FYZ A;  3VE3 A;  1CK3 A;  4L0L A;  3CPT B;  4HQA A;  4EES A;  3PHY A;  1BT5 A;  3N8R A;  4GDB A;  4YWZ A;  1K54 A;  5A91 A;  1K25 A;  4OP5 A;  2J80 A;  3PBT A;  3VOZ A;  1TVF A;  5FAQ A;  3N4I A;  1S66 L;  4X68 A;  3V67 A;  4KZ3 A;  1KGG A;  1CI9 A;  3LID A;  4LV3 A;  1Q2Q A;  2ZQA A;  1YMX A;  4JGR A;  4E3K A;  2ZQ9 A;  3MR0 A;  2K7S A;  3MQQ A;  3VSL A;  4G3V A;  3D72 A;  4XT2 B;  4LCM A;  1MWU A;  3KYZ A;  5L8M A;  3C4O A;  3FKW A;  1OJG A;  4EBL A;  3DTE A;  1N9N A;  3GEC A;  1YLZ A;  4EUZ A;  5CGS A;  4H6J B;  3IF6 C;  1BLP A;  4WEL A;  3HVF A;  1FIK A;  4DKI A;  1A0K A;  4EEU A;  1XA7 A;  2PAV P;  1ERM A;  1AXB A;  1P0Z A;  3RJU A;  4IBX A;  4FOF A;  2ZC4 B;  2ZQD A;  3LFV A;  3KYQ A;  4EBN A;  2FFY A;  1E4D A;  3E4O A;  3RXX A;  2ZMV A;  3I7J A;  5FEG A;  3ITB A;  4E3N A;  1DY6 A;  5HAI A;  4K08 A;  5E2G A;  4CLC E;  3PAE A;  5F68 A;  1J9M A;  4PM6 A;  4FTX A;  2LB5 A;  3CPT A;  3HLE A;  1JNU A;  1OT6 A;  5G4Z A;  5J7E A;  3KYE A;  1LSW A;  4P0M A;  4IED A;  2Y2J A;  5J4E A;  1IYP A;  1LL8 A;  4NXB A;  3F1P A;  1G5U A;  2WGV A;  3IS2 A;  2J9O A;  2XGN A;  1MWR A;  1TD5 A;  3FPW A;  3LR0 A;  5FQI A;  4OQH A;  3NDE A;  2VX8 A;  3SH7 A;  4R38 A;  2YKF A;  4MN7 A;  3E0Y A;  4S2N C;  2XH9 A;  3ZHH A;  2PYP A;  3VP2 A;  1K55 C;  3OCN A;  1HLU P;  4F94 A;  3MS6 A;  4RX2 A;  4G3W A;  4R23 A;  5AQ9 A;  2WKI A;  4H6J A;  5EVI C;  1T19 A;  5DF7 A;  4CLC C;  5HDS A;  5KSH A;  3P98 A;  2PT7 A;  3BJN A;  1JTD A;  1KVL A;  4OVD A;  3IBJ A;  1DJA A;  3T4K A;  3CJM A;  3UN7 A;  1G28 A;  2ZQ8 A;  5GL9 A;  5I5L A;  2XSS A;  3RFB A;  3Q07 A;  3E2K A;  2CMN A;  1XFN A;  2XK1 A;  3WWX A;  4DMZ A;  4NKP A;  3PBO A;  3KSF A;  3G6O A;  2R9X A;  1KE0 A;  1EW0 A;  5EUA A;  1HD8 A;  3BYD A;  2WGI A;  3UMD A;  3E4Q A;  3LIB A;  4UAA A;  3HLD A;  3BLM A;  5LBR A;  3B33 A;  3HLC A;  4OPY A;  1QMF A;  5GLC A;  4IVK A;  5F69 A;  4P6Z S;  5FDH A;  2PYR A;  1ES3 A;  1MWS A;  1KE4 A;  4X25 A;  4E3O A;  2QMI A;  1TEM A;  2W3F A;  4OQ0 A;  1FR1 A;  1ONH A;  1DP6 A;  4IJG A;  5F1F A;  5FL3 A;  4K0W A;  4NXF A;  4GNU A;  2AVX A;  3BY8 A;  4JGQ A;  4BWI A;  3E4P A;  4BQM A;  1M40 A;  3NEC A;  3UPP A;  1KVM A;  3EEA A;  2EWW A;  2PD8 A;  1NZO A;  4M3K A;  5TFQ A;  3CAX A;  5AQ7 A;  4BBU A;  3BQ8 A;  5F5Y A;  4O01 A;  1L3L A;  2IWC A;  4HES A;  3U2A A;  4OOM A;  4UEY A;  3UE0 A;  3BEB A;  1F2K A;  5U47 A;  2ZC5 B;  3NY4 A;  2Q9N A;  3UY6 A;  1DJC A;  5HDD A;  5CHM A;  1EI5 A;  4DDS A;  1I5Q A;  5CER A;  4WZ5 C;  1T1A A;  1DP8 A;  2QWS A;  3P09 A;  1IKI A;  2EFX A;  1ALQ A;  3V5M A;  2P9V B;  3PBS A;  1FOF A;  1YSP A;  5IT5 A;  4HIA A;  2R9W A;  2LB9 A;  3NI9 A;  4GZB A;  3DW0 A;  4ZRR A;  2Y4A A;  2UWX A;  4LFU A;  1LHY A;  3LY3 A;  4NK3 A;  4IUK A;  4C6Y A;  5AQB A;  2MJ6 A;  3WS0 A;  1VEU B;  4GCZ A;  5IS1 A;  1IOU A;  3ZNT A;  2NUP C;  1H5X A;  5CX7 A;  4GN2 A;  4ID4 A;  2QJ5 A;  3W4O A;  4EBP A;  4MLL A;  4Q0I A;  4B4Z A;  3S1Y A;  4KQQ A;  4KG6 A;  3MMH A;  1K6S A;  4LV0 A;  3UDI A;  5IHV A;  3EOI A;  1HVB A;  1XPB A;  3MQ0 A;  3FC7 A;  3GTC A;  1ZTU A;  3GDI A;  3HJK A;  3FZC A;  5F82 A;  5TGF A;  5CTM A;  4BL2 A;  2XD1 A;  5TBM B;  4PPR A;  3T4T A;  4DJ3 A;  5E2F A;  4BD1 A;  1TS0 A;  3WRZ A;  1XGJ A;  5FQ9 A;  1OME A;  4R4R A;  1Z09 A;  1JWZ A;  1PNE A;  1JWV A;  2X01 A;  3OPR A;  2BAS A;  2JBF A;  2V1A A;  2OV5 A;  5EVI D;  2VV6 A;  4WLA A;  3BLS A;  3EEH A;  3OLO A;  4WZ4 A;  4CLC D;  2ZL1 B;  4NG2 A;  1W5D A;  2D01 A;  3SOI A;  2PU4 A;  2V8F A;  2JCH A;  1SKO A;  3N7W A;  4BJP A;  4WMC D;  1YKD A;  2O9B A;  5HD5 A;  3G35 A;  2GNX A;  3LR4 A;  5EM0 A;  4KZB A;  4LLO B;  3Q82 A;  2OLV A;  1OPX A;  3LIE A;  1LT0 A;  3MZF A;  3T4L A;  3KX0 X;  4KUK A;  2PDR A;  1CEF A;  2XFS A;  2H5S A;  1E3U D;  2QJ7 A;  2CC1 A;  3O88 A;  2XLN A;  3A3F A;  3LO7 A;  2KDK A;  1OTD A;  5AVE A;  3VE4 A;  3VP0 A;  4H8R A;  4ZJ1 A;  4DF6 A;  3MZD A;  2V2F F;  2WAF A;  4LPZ A;  3R7W B;  3BRM A;  3NBL A;  3SH9 A;  4Y15 A;  4F3L A;  4HBT A;  1K57 A;  1D7E A;  5JYO A;  2EX9 A;  1ACF A;  5C5K A;  4OQI A;  1IEM A;  2EX6 A;  2Z2L B;  2Y2K A;  4FUW A;  4HHD A;  2EXB A;  2WK0 A;  1E25 A;  1NRF A;  1FCN A;  2INW A;  2JKR I;  4OH0 A;  2PRF A;  4HOI A;  4KUO A;  3SW1 A;  4N9L A;  5EM1 A;  3MZE A;  2V0U A;  1S4R A;  4EQI A;  1NLZ A;  1H8Y A;  3MXS A;  4UQI M;  1W79 A;  3VFF A;  5A93 A;  4GKU A;  4OLG A;  5F6A A;  4KZA A;  2J3T C;  1LSX A;  1N9B A;  1ONG A;  2HDR A;  4PAU A;  4YIN A;  4P87 A;  5HL1 A;  4NXG A;  1PIO A;  4N9K A;  2XDM A;  3UE1 A;  5HAQ A;  1TS7 A;  3OOV A;  5L07 A;  3IF6 A;  4WEJ A;  3N8S A;  1ESU A;  1OTI A;  5E2E A;  3V39 A;  1AWI A;  2VV7 A;  5HL6 A;  5F83 A;  2VGK A;  3WS1 A;  4GJ4 A;  4M4X A;  2DNS A;  2PR5 A;  4R1G A;  4ZJ2 A;  3ITA A;  3FG8 A;  3S7Q A;  3ZNY A;  3MFX A;  3T1X A;  4HJ3 A;  1BLS A;  1MPL A;  1T1C A;  2HDS A;  4E04 A;  5FAS A;  2Y2Q A;  2B18 A;  2XRN A;  4BL3 A;  3OCL A;  1L2S A;  5DKK A;  4X69 A;  3A3J A;  2L4R A;  2VKS A;  5CXW A;  4S2P A;  1ZC2 A;  3DWK A;  4OPR A;  1VET A;  2ZD8 A;  3F1P B;  4CJN A;  3L7H A;  1Y54 A;  3IS2 B;  1U60 A;  4LRY C;  4X55 A;  3C8C A;  4Y17 A;  2H10 A;  1JTG A;  3A3E A;  4S2N A;  1EWZ A;  3IXG A;  1CJF A;  1PZP A;  3M6B A;  1K55 A;  5J3W A;  3IXB A;  3RTY A;  2PU2 A;  1WYB A;  3DTM A;  3PTE A;  3MJQ A;  4QU3 A;  4CLC A;  1Z6F A;  5F1G A;  1ZKJ A;  3IWO A;  5GHX A;  4E3M A;  3A3D A;  1K56 D;  4WMC A;  3ZFZ A;  1Y28 A;  4GOG A;  5HZH A;  3Q81 A;  1I2S A;  3IF5 A;  2J8Y A;  3NOT C;  3O5Y A;  5M19 A;  5FI7 A;  4QY6 A;  3LR3 A;  1SKF A;  4MBK A;  1H8Z A;  1P97 A;  2OOL A;  3H82 B;  5MC7 A;  2HF6 A;  4KQO A;  5GLD A;  2V0W A;  4R3A A;  1XXM A;  4MN5 A;  4OPZ A;  5TR7 A;  1PW1 A;  1WA9 A;  2M1C A;  5I94 A;  1NJ4 A;  2WKP A;  1P9R A;  4R4S A;  4RX3 A;  4GHI B;  3CUE A;  1TDG A;  3L9K A;  1MY8 A;  3KSG A;  1N9L A;  4EWF A;  2JHE A;  1XX2 A;  1PWG A;  2GJ3 A;  5HWT A;  4PM9 A;  2E8I A;  1W7F A;  2V8C A;  3LUQ A;  3C7U A;  3T1Q B;  4X1L A;  1PI4 A;  5GLB A;  4OP8 A;  3BY9 A;  1NYY A;  1UWN X;  3G34 A;  4KZ4 A;  1GA9 A;  4KZ5 A;  2W3G A;  4FSF A;  2HPB A;  2XEP A;  1KE3 A;  2H28 A;  4RQ9 A;  4N1H A;  4E3J A;  2ZMF A;  4B93 A;  5HWW A;  2W1T A;  3CWF A;  1GSX A;  2EXA A;  4GLQ A;  5HPF A;  2FZ0 A;  4Y7P A;  1GSV A;  2ZLY A;  2V1B A;  2P08 A;  4Y0U A;  4WM9 A;  2HP9 A;  5FAT A;  3ZCZ A;  4AFI A;  3HUN A;  4QB8 A;  3H82 A;  2DMW A;  1MZU A;  3NHQ A;  3MXR A;  1X0O A;  1PWD A;  3LIA A;  4PKY A;  1KDW A;  3BFE A;  2HGV A;  2Q0O A;  1DRM A;  3KO6 A;  2J3T D;  4GHI A;  4DJ2 A;  4WZ5 A;  2C6W B;  2Y55 A;  3AGF A;  3EWK A;  3W2Z A;  4N1X A;  4QD4 A;  3DTK A;  1W8Q A;  3KSH A;  2HP5 A;  1F9I A;  2HJ9 C;  2ZMA A;  5KSC A;  3W4Q A;  1YLT A;  2D02 A;  2JE5 A;  4LRZ E;  2EFU A;  5A8B A;  1L0G A;  1PI5 A;  1ZG6 A;  3WS5 A;  3DWZ A;  4I5S A;  3HUO A;  2EX8 A;  3BWL A;  4QJG A;  4BBT A;  2Z6D A;  2WGW A;  2Y2O A;  2WZX A;  1QME A;  5AJG A;  4HP4 A;  5E43 A;  1RGY A;  4GD8 A;  2JN7 A;  2RL3 A;  4K0X A;  1TS6 A;  3IWQ A;  4E6X A;  4KG2 A;  3LIC A;  4WBG A;  4CPK A;  1H3Q A;  1PZO A;  4OOY A;  3FV7 A;  5A92 A;  5EOE A;  4Y5F A;  3BEC A;  3P7N A;  4Q0J A;  2V20 A;  1W63 M;  2HJE A;  1S67 L;  1XP4 A;  2DRW A;  2VV8 A;  2W0N A;  3IXH A;  2HP6 A;  4GD6 A;  5BOH A;  2Y2H A;  3ZVT A;  4QPR A;  3IWI A;  2B5R A;  3AGE A;  4OKP A;  2EWV A;  3VFH A;  2Y2P A;  1OT9 A;  3QP6 A;  1K4E A;  3G2Z A;  4JBF A;  3NOP C;  2B95 A;  1SCW A;  1ZHH B;  2NUT C;  4Y2F A;  4JLF A;  4HBU A;  2WAD A;  1SDE A;  4DRT A;  3W4P A;  5AVF A;  3S7N A;  3FPV A;  4DE0 A;  3MBZ A;  3CG5 A;  4E3L A;  4GS9 A;  4CQH A;  3B42 A;  2ZBB A;  1BTL A;  1SKO B;  1F98 A;  2Y91 A;  2E8J A;  5CED A;  5HFO A;  1D1J A;  1NWZ A;  3CHW P;  1PW8 A;  1LL5 A;  3ZDJ A;  2VGL M;  1BYW A;  2Q9M A;  2ZM2 A;  3QP8 A;  1JVJ A;  1SZV A;  5DF8 A;  4R6L A;  2X71 A;  3HLW A;  1OTA A;  2VZW A;  3MFD A;  1VM1 A;  4PHT A;  3VOL A;  4RA7 A;  4S2J A;  2XR0 A;  3QP5 A;  4KG5 A;  2J3W A;  1NY0 A;  2PBD P;  1VB6 A;  5EPH A;  1ES2 A;  2OWJ A;  4OOL A;  3MF0 A;  4F3L B;  1NRJ A;  1G68 A;  2W27 A;  3JPU A;  5FDS A;  4FH4 A;  5JYP A;  1P9W A;  4P6B A;  4Y3I A;  2I72 A;  4U0T A;  5HX9 A;  3C4P A;  4II7 A;  5G18 A;  5DJU A;  4PMA A;  4FH2 A;  3IQA A;  5TJJ A;  2XRO A;  2Y2G A;  1TF1 A;  1FR6 A;  3PYP A;  2Y2I A;  4NXE A;  3T4Q A;  1LSV A;  1CI8 A;  3OPH A;  4D60 A;  3HBR A;  3W8K A;  1IYO A;  3B47 A;  2ZC3 B;  4HH2 A;  2YKH A;  3UPO A;  4JXS A;  4WEK A;  4HH3 A;  4XXR A;  2Y8H A;  1PFL A;  2ZQC A;  2V9A A;  2KX6 A;  3QNC A;  2JKR M;  1YAX A;  1D06 A;  1S4S A;  1NXY A;  3SS5 A;  2O9A A;  4NEE D;  3G2Y A;  5KZH A;  5CRF A;  3ZG9 B;  1MBL A;  1YLP A;  4JGO A;  1Q2P A;  1PYY A;  4YFM A;  2BG1 A;  2XA7 M;  3T50 A;  4KZ6 A;  1H8M A;  1CF0 A;  3IF6 B;  5DFX A;  5L10 A;  4P85 A;  1XKZ A;  4HJ4 A;  4BMW A;  4O0P A;  1S6R A;  2KLI A;  3PAG A;  3GQZ A;  3NOU C;  4B88 A;  1VHM A;  2B02 A;  2Z6C A;  3F1O A;  4JF6 A;  3UB9 A;  5D3O A;  2PBY A;  2BLS A;  2W1R A;  3G4P A;  4L9F A;  5GLA A;  2V1Z A;  1ES5 A;  2M7U A;  2GDN A;  4UQI S;  2JKF A;  4KZ7 A;  4IBR A;  3Q7V B;  1UWP X;  2VEA A;  3ZG7 B;  4X56 A;  4KQD A;  3CIT A;  3M2K A;  3QNB A;  3VP3 A;  5HW3 A;  3WS4 A;  3CMZ A;  5EOO A;  5FSR A;  4L9G A;  3C30 A;  3E2L A;  3VP4 A;  3TE8 A;  5M1A A;  1G6A A;  2OLU A;  3PBN A;  5DTS A;  3BFC A;  3V50 A;  1VET B;  4MEZ A;  4X6T A;  4ETZ A;  4E3I A;  1MKI A;  4S2L A;  3IX8 A;  3H7W B;  3ZVW A;  3VP1 A;  1V9Z A;  4DE1 A;  2M7V A;  4B4X A;  3MKE A;  1O7E A;  2XFT A;  4Q0H A;  2ZM0 A;  3UB6 A;  5AQA A;  4R70 A;  1BUE A;  3TSG A;  3UPN A;  4ZDX A;  2VLG A;  5EVI B;  4CLC B;  2Z2M B;  4EXO A;  4GDN A;  2GX5 A;  3C2W A;  3JYI A;  2R78 A;  1FCO A;  1F5M A;  3T4O A;  2C5W B;  3TW8 A;  5HWV A;  5CEC A;  4DN0 A;  1BSG A;  1S1Y A;  2VA0 A;  1VQQ A;  2ZQ7 A;  2WZZ A;  3Q7V A;  2HV1 A;  2PR6 A;  4JPM A;  3PBQ A;  5DTT A;  1YMS A;  1YT4 A;  4EEP A;  1BLH A;  1K57 C;  5EVL A;  1RGZ A;  2L0W A;  1K4F A;  3TG9 A;  2QPN A;  2KOI A;  2ACG A;  5HSQ A;  3LIF A;  4UA9 A;  4Z9Q A;  2I9V A;  2W3D A;  4Y0O A;  2P7J A;  2PD7 A;  2A24 A;  1MWT A;  4E6W A;  2W3H A;  5FQJ A;  3RXW A;  3UE3 A;  1M6K A;  4R0Q A;  3EGD C;  3BFG A;  1IEL A;  1YLJ A;  5FI2 A;  3H7W A;  4JGP A;  1NLY A;  2Y79 A;  3SS3 A;  1WYC A;  3UNW A;  3NIA A;  4PM8 A;  5A90 A;  3ZGA B;  3F1N A;  5K5B A;  2GZA A;  3A0R A;  3NUL A;  1W8Y A;  5EVI A;  3TRC A;  2HZ5 A;  3OPP A;  3NDG A;  4GB7 A;  2JKT I;  4NET A;  3ISG A;  2A49 A;  2W1T B;  4KQR A;  3T12 B;  4C3Q A;  1V9Y A;  4LRX C;  5DFY A;  3NC8 A;  4N92 A;  3GRJ A;  4OON A;  2WKR A;  3E98 A;  1LI0 A;  5FAP A;  1XFQ A;  1N9O A;  5HAP A;  4I39 A;  4Z1W A;  1E3U A;  3GVB A;  3EGX C;  1G6O A;  3QHY A;  4MMN A;  2WUQ A;  3OC2 A;  2RCX A;  5CTN A;  4UHU A;  4PM5 A;  1GHI A;  1YSQ A;  5DF9 A;  2IWD A;  2OAQ 1;  5CGX A;  1GHP A;  2H0T A;  2K2N A;  4ME4 A;  4MBH A;  1YLY A;  4EER A;  1ERO A;  1C3B A;  3G32 A;  3LI9 A;  4WN5 A;  4MDZ A;  2G2U A;  1HTZ A;  3LCE A;  1BZA A;  1K54 C;  1GHM A;  3GSG A;  3D9Y A;  4KZ8 A;  2WGW B;  4Q8I A;  4U3T A;  3LY4 A;  5L09 A;  4UA6 A;  1BLC A;  2Y59 A;  1FIL A;  4I3A A;  3WRT A;  5CHJ A;  1XJ4 A;  4DDY A;  5DTK A;  3R4K A;  4LGW A;  5CEB A;  4KEN B;  4BEN A;  4XT2 A;  1PRQ A;  2WYX A;  4YOF A;  3VV4 A;  4ZAM A;  4QY5 A;  1ESI A;  4JXV A;  2XD5 A;  3D4F A;  3DTI A;  2OSU A;  3ICY A;  4A5R A;  3EQU A;  3IHA A;  3BM6 A;  3C7V A;  4EV4 A;  3GV9 A;  1O07 A;  4QHC A;  1ERQ A;  4ZJ3 A;  3T4J A;  3VOY A;  4IUH A;  2ZJ9 A;  3PR6 A;  3OPL A;  3ZG0 A;  3IBR A;  3Q7Z A;  4EW7 A;  3N8L A;  2WAE A;  1TS8 A;  1HZO A;  4BLM A;  1RCJ A;  4HNB A;  2DCF A;  2ZOH A;  4HP9 A;  4WUJ A;  4FD8 A;  4JXW A;  4EUV A;  3HLB A;  3IHB A;  4WYY A;  4K91 A;  3DBA A;  1I2W A;  3UO9 A;  4LEN A;  1N4O A;  1MKM A;  2EA9 A;  3CUE C;  4GS9 B;  3LR5 A;  4MN6 A;  4DE3 A;  2QYB A;  3OZH A;  3N6I A;  4ETX A;  3AGD A;  1ODV A;  1K6R A;  2VK3 A;  4R3J A;  4OQG A;  3S7P A;  3PXP A;  1T1B A;  3BFD A;  1W63 Q;  1FCM A;  5G4Y A;  5EEC A;  1SHV A;  4LV1 A;  3MSH A;  3SH8 A;  3MKF A;  2ZOI A;  3V3S A;  1NZU A;  2Y2N A;  4IHQ A;  3T1R A;  3CLO A;  4S2K A;  2WKH A;  4I3J A;  3P01 A;  3IT9 A;  5EV0 A;  3NCK A;  1CQA A;  3BQA A;  2XQZ A;  1LI9 A;  1KOU A;  3UE6 A;  1OTE A;  2ZM8 A;  4D2O A;  3KSI A;  1SDN A;  3TJZ C;  4S2M A;  3M2J A;  2VJW A;  4P6Z M;  1XJ2 A;  4JKT A;  1IYQ A;  4GW9 A;  5DKL A;  1GSW A;  5DJT A;  4MNR A;  2Y2L A;  4PM7 A;  4I38 A;  3HCY A;  3S7O A;  4HY8 A;  2G2W A;  4HI4 A;  1K56 A;  1MC0 A;  4L9E A;  3C5A A;  3PBR A;  4Y13 A;  2VGL S;  3GMW A;  3IH8 A;  3UB8 A;  1GCE A;  4JXG A;  4MCW A;  4O8G A;  3MQO A;  4BD0 A;  3LEZ A;  5HDC A;  1T18 A;  2BTF P;  1J3W A;  3JVV A;  3ULF A;  2O9C A;  3HUM A;  3UME A;  4B9O A;  1NYM A;  3A3I A;  4BBV A;  3K3C A;  4I3I A;  4WL9 A;  3T1S A;  1OJ5 A;  5EVE A;  1FSY A;  3VMA A;  1YM1 A;  1LLB A;  5IU1 A;  3CI6 A;  2PHY A;  4G3K A;  2XF3 A;  3G31 A;  3ZQ5 A;  4S2O A;  2HDU A;  4LV2 A;  3HRE A;  2ZC6 B;  5GHY A;  1XJ3 A;  1XGI A;  1FQG A;  3LYX A;  5GHZ A;  4ZTK A;  1RP5 A;  1L0F A;  4DXC A;  1L0E A;  2FH5 A;  5FQK A;  5EFW A;  2J7V A;  3F1O B;  4EQ1 A;  3V3R A;  3NJA A;  1S0W A;  5KIZ A;  3T4S A;  3WS2 A;  5E2H A;  1ES4 A;  3IX4 A;  4HJ6 A;  3BFF A;  5HPI A;  3QP1 A;  3MXQ A;  5FA7 A;  2FFF B;  3ZG5 A; 
#chains in the Genus database with same CATH homology
 1NJ4 A;  4ZDX A;  4JF4 A;  5EVI B;  4K0W A;  4R4S A;  4GNU A;  2WKE A;  2Z2M B;  4RX3 A;  4GDN A;  1TDG A;  1MY8 A;  3JYI A;  4MBF A;  4EWF A;  4HEF A;  3TOI A;  1FCO A;  1PWG A;  1XX2 A;  2P9V A;  4BQM A;  1M40 A;  3UPP A;  2C5W B;  4PM9 A;  1KVM A;  5CEC A;  5DVA A;  2E8I A;  1BSG A;  1W7F A;  3C7U A;  1NZO A;  4KZ9 A;  1VQQ A;  1DJB A;  3G30 A;  4M3K A;  5TFQ A;  2ZQ7 A;  5AQ7 A;  1PI4 A;  2WZZ A;  5GLB A;  4OP8 A;  3Q7V A;  1NYY A;  3G34 A;  4KZ4 A;  2IWC A;  4JPM A;  1GA9 A;  2J9P A;  3PBQ A;  4HES A;  4KZ5 A;  4FSF A;  2EX2 A;  5DTT A;  1YMS A;  4OOM A;  1YLW A;  4RVA A;  3UE0 A;  3IXD A;  1YT4 A;  3VSK A;  2HPB A;  2XEP A;  3BEB A;  3ZG8 B;  1BLH A;  1K57 C;  1KE3 A;  5EVL A;  1RGZ A;  5U47 A;  1K4F A;  1JWP A;  2ZC5 B;  3NY4 A;  2Q9N A;  4N1H A;  3UY6 A;  2X02 A;  3TG9 A;  4E3J A;  4U0X A;  1DJC A;  2QPN A;  1LL9 A;  1FSW A;  4DE2 A;  3B3X A;  5CHM A;  1EI5 A;  4DDS A;  1I5Q A;  2QZ6 A;  5CER A;  4UA9 A;  3O86 A;  4WZ5 C;  4Z9Q A;  2EXA A;  4Y0O A;  3P09 A;  4O7D A;  1IKI A;  1MWT A;  1WE4 A;  2EFX A;  4E6W A;  1ALQ A;  5J8X A;  4Y7P A;  5FQJ A;  3RXW A;  2ZLY A;  3UE3 A;  1M6K A;  2P9V B;  3V5M A;  3PBS A;  4R0Q A;  3BFG A;  1FOF A;  1IEL A;  1YLJ A;  5FI2 A;  4Y0U A;  2R9W A;  4WM9 A;  2HP9 A;  5FAT A;  2ZC7 A;  3ZCZ A;  3NI9 A;  1KDS A;  4GZB A;  4C75 A;  3DW0 A;  3SS3 A;  1WYC A;  2Y4A A;  2UWX A;  3HUN A;  3SS4 A;  4QB8 A;  3IH9 A;  1LHY A;  3LY3 A;  3MXR A;  4NK3 A;  3UNW A;  4X53 A;  4C6Y A;  5FQM A;  4JF5 A;  1PWD A;  5AQB A;  3NIA A;  3WS0 A;  2HDQ A;  2P74 A;  4PM8 A;  1KDW A;  5A90 A;  3BFE A;  3S4X A;  3ZNT A;  3ZGA B;  5KMW A;  1CEG A;  5EVI A;  1H5X A;  1K38 A;  1W8Y A;  5FI6 A;  3OPP A;  3NDG A;  4GN2 A;  4GB7 A;  4NET A;  1MXO A;  4ID4 A;  4WZ5 A;  3ISG A;  3W4O A;  4EBP A;  4MLL A;  2A49 A;  2C6W B;  1XA1 A;  2Y55 A;  4B4Z A;  1GA0 A;  3AGF A;  4KQR A;  5M18 A;  4C3Q A;  4N1X A;  4QD4 A;  4IVI A;  1W8Q A;  2HP5 A;  3NC8 A;  4N92 A;  1BUL A;  3S1Y A;  4KQQ A;  3GRJ A;  2ZMA A;  5KSC A;  4OON A;  3W4Q A;  4KG6 A;  1YLT A;  4LV0 A;  1K6S A;  1LI0 A;  3UDI A;  5FAP A;  4OPQ A;  2JE5 A;  5IHV A;  2EFU A;  1HVB A;  1XPB A;  1L0G A;  1PI5 A;  5HAP A;  4R3B A;  3GTC A;  1ZG4 A;  1ZG6 A;  3Q1F A;  1IKG A;  3WS5 A;  1E3U A;  3DWZ A;  3FWL A;  3M6H A;  3GVB A;  3HUO A;  2EX8 A;  3FZC A;  5F82 A;  5TGF A;  4QJG A;  1IYS A;  5FAO A;  3QHY A;  1KGE A;  2WUQ A;  3OC2 A;  5CTM A;  5FQQ A;  4BL2 A;  1YQS A;  3GR2 A;  2WGW A;  2XD1 A;  2Y2O A;  2RCX A;  4PPR A;  5HAR A;  5CTN A;  2WZX A;  4OLD A;  4UHU A;  1QME A;  4S2I A;  2A3U A;  4DXB A;  5E43 A;  2VGJ A;  4PM5 A;  3O3V A;  1RGY A;  3HLG A;  5E2F A;  4GD8 A;  2RL3 A;  4LCL A;  4K0X A;  1GHI A;  4BD1 A;  5DF9 A;  3IWQ A;  2IWD A;  1XGJ A;  3WRZ A;  5CGX A;  4E6X A;  1PWC A;  1GHP A;  4KG2 A;  5FQ9 A;  4WBG A;  4FCF A;  2H0T A;  1KGF A;  1OME A;  4R4R A;  4CPK A;  4MBH A;  5EE8 A;  1PZO A;  1YLY A;  1JWZ A;  2JC7 A;  1ERO A;  4OOY A;  3FV7 A;  4XUX A;  1JWV A;  5A92 A;  2X01 A;  5EOE A;  1C3B A;  3OPR A;  3EQV A;  3CZD A;  3G32 A;  4ZBE A;  3UDX A;  3BEC A;  2JBF A;  2V20 A;  2OV5 A;  5EVI D;  2G2U A;  1HTZ A;  1XP4 A;  2Y2M A;  3BLS A;  2DRW A;  1BZA A;  3LCE A;  4WZ4 A;  3S22 A;  1K54 C;  5CGW A;  1GHM A;  3GSG A;  1W5D A;  3SOI A;  2PU4 A;  3IXH A;  2H0Y A;  2HP6 A;  4GD6 A;  2JCH A;  3FKV A;  5BOH A;  4KZ8 A;  2Y2H A;  3N7W A;  2WGW B;  3ZVT A;  2IWB A;  4BJP A;  3O87 A;  4WMC D;  4Q8I A;  3IWI A;  2B5R A;  4U3T A;  4UA7 A;  3LY4 A;  3G35 A;  3AGE A;  4UA6 A;  1BLC A;  2Y59 A;  4OKP A;  3WRT A;  4KZB A;  5CHJ A;  4Y0T A;  3Q82 A;  3VFH A;  2OLV A;  4DDY A;  5DTK A;  3MZF A;  2Y2P A;  1L0D A;  1K4E A;  4XUZ A;  5CEB A;  3G2Z A;  3HLF A;  4JBF A;  1CEF A;  2XFS A;  4KEN B;  3HL9 A;  1SCW A;  1E3U D;  2H5S A;  4BEN A;  2CC1 A;  2WYX A;  4JLF A;  4HBU A;  3O88 A;  4RYE A;  2XLN A;  3A3F A;  2WAD A;  3UDF A;  1TDL A;  1SDE A;  3LO7 A;  5CHU A;  4DRT A;  4ZAM A;  3VP0 A;  4QY5 A;  4H8R A;  1ESI A;  4ZJ1 A;  4JXV A;  2XD5 A;  3MZD A;  3W4P A;  3D4F A;  4DF6 A;  3FYZ A;  5L2F A;  2OSU A;  4DE0 A;  1CK3 A;  2V2F F;  2WAF A;  4A5R A;  4L0L A;  3MBZ A;  3CG5 A;  3EQU A;  1BT5 A;  3N8R A;  3IHA A;  4GDB A;  4E3L A;  1K54 A;  5A91 A;  3BRM A;  1K25 A;  3NBL A;  3BM6 A;  3C7V A;  4EV4 A;  4OP5 A;  3PBT A;  3VOZ A;  1BTL A;  1TVF A;  3GV9 A;  5FAQ A;  3N4I A;  1O07 A;  4QHC A;  4HBT A;  1ERQ A;  1K57 A;  4ZJ3 A;  2Y91 A;  3SH9 A;  3VOY A;  4X68 A;  5CED A;  5HFO A;  4KZ3 A;  1KGG A;  5JYO A;  2EX9 A;  2ZJ9 A;  1CI9 A;  1PW8 A;  4LV3 A;  1Q2Q A;  2ZQA A;  1LL5 A;  3OPL A;  3ZDJ A;  3ZG0 A;  1YMX A;  4OQI A;  3Q7Z A;  1IEM A;  2Q9M A;  2EX6 A;  2ZM2 A;  4E3K A;  2ZQ9 A;  3N8L A;  1JVJ A;  2WAE A;  5DF8 A;  1HZO A;  2Z2L B;  4BLM A;  2Y2K A;  1RCJ A;  3VSL A;  2EXB A;  2WK0 A;  1E25 A;  2X71 A;  4LCM A;  1MWU A;  1FCN A;  1NRF A;  2DCF A;  3HLW A;  3C4O A;  3FKW A;  4OH0 A;  3MFD A;  1VM1 A;  4EBL A;  4FD8 A;  4JXW A;  1YLZ A;  3HLB A;  4EUZ A;  5CGS A;  3IHB A;  4N9L A;  4RA7 A;  3MZE A;  4S2J A;  2XR0 A;  4WYY A;  3IF6 C;  4K91 A;  4KG5 A;  3UO9 A;  1I2W A;  1NY0 A;  4LEN A;  1N4O A;  1BLP A;  4EQI A;  5EPH A;  4WEL A;  3HVF A;  4DKI A;  1ES2 A;  1H8Y A;  3MXS A;  4OOL A;  1XA7 A;  1W79 A;  3VFF A;  5A93 A;  4DE3 A;  1ERM A;  4GKU A;  3OZH A;  3N6I A;  1AXB A;  1G68 A;  3AGD A;  3RJU A;  4OLG A;  1K6R A;  4IBX A;  4FH4 A;  2ZC4 B;  1N9B A;  2ZQD A;  4KZA A;  4OQG A;  3BFD A;  1ONG A;  4R3J A;  4P6B A;  5JYP A;  2HDR A;  4EBN A;  2FFY A;  1E4D A;  1FCM A;  2I72 A;  4U0T A;  5EEC A;  5HX9 A;  1SHV A;  4LV1 A;  3SH8 A;  3RXX A;  3C4P A;  3I7J A;  3MKF A;  5G18 A;  4YIN A;  4PMA A;  3ITB A;  3V3S A;  1NZU A;  1DY6 A;  2Y2N A;  5HAI A;  4E3N A;  4FH2 A;  4P87 A;  5E2G A;  5HL1 A;  3IQA A;  3PAE A;  4S2K A;  2WKH A;  2Y2G A;  1PIO A;  4N9K A;  2XDM A;  3UE1 A;  1FR6 A;  3IT9 A;  5HAQ A;  2Y2I A;  3NCK A;  1J9M A;  4PM6 A;  1CI8 A;  3HLE A;  3OPH A;  3IF6 A;  3HBR A;  3W8K A;  1IYO A;  2XQZ A;  2ZC3 B;  1LI9 A;  4WEJ A;  3N8S A;  3UPO A;  1ESU A;  2ZM8 A;  4JXS A;  4IED A;  2Y2J A;  4P0M A;  4D2O A;  1IYP A;  5E2E A;  1SDN A;  4S2M A;  3M2J A;  4WEK A;  3V39 A;  4JKT A;  4XXR A;  1IYQ A;  2ZQC A;  2WGV A;  3QNC A;  2J9O A;  2XGN A;  1MWR A;  4MNR A;  5F83 A;  2Y2L A;  4PM7 A;  5FQI A;  4OQH A;  3NDE A;  2VGK A;  3WS1 A;  1NXY A;  3SH7 A;  3SS5 A;  2G2W A;  1K56 A;  2DNS A;  3G2Y A;  4S2N C;  5KZH A;  5CRF A;  3ZG9 B;  3C5A A;  4R1G A;  3PBR A;  1MBL A;  3ITA A;  4ZJ2 A;  2XH9 A;  3ZHH A;  3VP2 A;  3ZNY A;  1YLP A;  1Q2P A;  1BLS A;  1PYY A;  1K55 C;  4YFM A;  2BG1 A;  1MPL A;  3GMW A;  3OCN A;  2HDS A;  5FAS A;  4F94 A;  3IH8 A;  4RX2 A;  2Y2Q A;  1GCE A;  4JXG A;  4R23 A;  5AQ9 A;  4BL3 A;  2WKI A;  3OCL A;  4KZ6 A;  1L2S A;  5EVI C;  4BD0 A;  3IF6 B;  4X69 A;  5DF7 A;  3A3J A;  3LEZ A;  5KSH A;  3P98 A;  5CXW A;  4S2P A;  4P85 A;  1ZC2 A;  1JTD A;  3DWK A;  1KVL A;  1XKZ A;  4OPR A;  4OVD A;  1S6R A;  2ZD8 A;  3PAG A;  3GQZ A;  4CJN A;  3HUM A;  1NYM A;  1DJA A;  1Y54 A;  4B88 A;  3A3I A;  4JF6 A;  1U60 A;  3CJM A;  4X55 A;  3UN7 A;  5D3O A;  2PBY A;  2BLS A;  2ZQ8 A;  3G4P A;  5GL9 A;  5GLA A;  2H10 A;  2V1Z A;  1ES5 A;  2GDN A;  1FSY A;  1JTG A;  3A3E A;  4KZ7 A;  3Q07 A;  3VMA A;  4S2N A;  4IBR A;  1EWZ A;  1YM1 A;  3E2K A;  1LLB A;  3Q7V B;  3IXG A;  3ZG7 B;  1PZP A;  4X56 A;  3M6B A;  1K55 A;  3IXB A;  2XK1 A;  3WWX A;  2XF3 A;  2PU2 A;  3G31 A;  3M2K A;  3QNB A;  3VP3 A;  5HW3 A;  3WS4 A;  1WYB A;  3CMZ A;  4S2O A;  5EOO A;  3PBO A;  2HDU A;  5FSR A;  4LV2 A;  2R9X A;  1KE0 A;  3DTM A;  3PTE A;  3E2L A;  5EUA A;  4QU3 A;  3HRE A;  1Z6F A;  5F1G A;  1ZKJ A;  3IWO A;  3VP4 A;  5GHX A;  5M1A A;  2ZC6 B;  3A3D A;  4E3M A;  1HD8 A;  1G6A A;  5GHY A;  3BYD A;  2WGI A;  1K56 D;  2OLU A;  3PBN A;  1XGI A;  1FQG A;  4UAA A;  4WMC A;  3HLD A;  3BLM A;  5DTS A;  3BFC A;  5GHZ A;  3ZFZ A;  4ZTK A;  1RP5 A;  3V50 A;  1L0F A;  4GOG A;  3Q81 A;  1I2S A;  4DXC A;  4MEZ A;  3HLC A;  3IF5 A;  2J8Y A;  4X6T A;  4E3I A;  1L0E A;  4OPY A;  1MKI A;  5FQK A;  4S2L A;  5M19 A;  1QMF A;  2J7V A;  5GLC A;  4IVK A;  3V3R A;  3ZVW A;  3VP1 A;  5FI7 A;  4QY6 A;  5FDH A;  1S0W A;  4DE1 A;  1ES3 A;  1MWS A;  1SKF A;  4MBK A;  4B4X A;  1KE4 A;  1H8Z A;  3MKE A;  3WS2 A;  1O7E A;  4E3O A;  2QMI A;  1TEM A;  2XFT A;  5E2H A;  1ES4 A;  4KQO A;  4OQ0 A;  2ZM0 A;  5GLD A;  1FR1 A;  1ONH A;  3BFF A;  1XXM A;  4OPZ A;  5F1F A;  5TR7 A;  1PW1 A;  5AQA A;  5FA7 A;  5I94 A;  2FFF B;  1BUE A;  3ZG5 A;  3TSG A;  3UPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...