3LY4A

Crystal structure of fluorophore-labeled class a -lactamase penp-e166cb in complex with penicillin g
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of fluorophore-labeled Class A -lactamase PenP-E166Cb in complex with penicillin G
rcsb
source organism Bacillus licheniformis
total genus 87
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ly4A00
5AQ9A 1JWPA 4WM9A 5DTKA 5KSHA 4UHUA 3FYZA 5E43A 4GN2A 3ZG7B 3HBRA 3HLBA 2J9OA 5HFOA 4MBKA 3VP4A 4RVAA 1YLJA 4JXWA 3NIAA 4KZBA 1PW1A 1ES2A 3GTCA 1FSYA 4JF4A 4K0WA 3HLEA 3PBSA 2OV5A 3UDFA 1K56A 3UNWA 4ID4A 2Y2NA 3G35A 3OPHA 4PM9A 4X68A 1JVJA 3E2LA 1YLZA 4X56A 4E6WA 5CGWA 3PBTA 3GR2A 4S2PA 4DE1A 4WMCD 1YLTA 1MKIA 3HLFA 3DWZA 4OPYA 4OVDA 2Y2JA 2XQZA 1YMXA 2X02A 4GOGA 1ONGA 1W79A 3MKFA 2H0TA 1DY6A 3P09A 3WS5A 4RX2A 5BOHA 1W7FA 4HBUA 2ZC3B 3VP2A 4E3KA 5A90A 1YLWA 3NBLA 1XX2A 5CHJA 3PAGA 1G6AA 2HDQA 3WWXA 1CI8A 5EVIA 3W4QA 2GDNA 4PM6A 1IKIA 3BRMA 3CZDA 3SS3A 3C4OA 3A3IA 5FQIA 2Q9MA 2Y59A 3PTEA 4WYYA 1JWZA 1SKFA 1I2WA 1NYMA 3IH9A 5FASA 5FDHA 3ZHHA 1IEMA 4IBRA 5CGXA 3LEZA 4LV2A 1IYQA 5E2FA 4X6TA 5A91A 1BLSA 3ZG5A 5L2FA 3IWQA 5GLBA 2ZQAA 4R4RA 1CEGA 2P9VB 3ZFZA 4PM7A 4JF5A 4OPQA 4XUXA 1K38A 5E2EA 3UE1A 4GDNA 3A3FA 3SS5A 4E3OA 3LO7A 4FH4A 4JXSA 1KGEA 3PBRA 1KDWA 2HDUA 3HUNA 1PZOA 3AGDA 3W8KA 5CHMA 2EX6A 1XGJA 2ZQ8A 3CG5A 3HLWA 1W8QA 2VGKA 5AQ7A 1L0GA 1PWGA 1TDLA 5E2HA 4S2IA 2ZQCA 2EXBA 4S2KA 5EOOA 4R3JA 2ZM8A 1KGGA 3MBZA 1DJBA 4GDBA 2P74A 4BLMA 2Y2LA 4DXCA 2EFUA 1ZG4A 4P85A 1XP4A 5EVLA 5G18A 3V50A 2B5RA 4KZ7A 5GL9A 2V2FF 1W8YA 3MZFA 3QNBA 3OPRA 1K57C 1S0WA 2X71A 3IF6A 4GNUA 4LCLA 4QJGA 3OPPA 1KE3A 5A93A 3UN7A 1MPLA 1MBLA 2EX9A 3G30A 4PPRA 3ISGA 3IWOA 2FFFB 4LENA 1IKGA 5FA7A 3BFEA 3N8SA 4UA7A 1SDNA 4GB7A 1ES4A 3VP0A 1TVFA 1MWTA 3A3DA 3ZVWA 5HARA 1TDGA 1BTLA 4MEZA 3O86A 4OQHA 5D3OA 1EI5A 4MBFA 2ZC5B 3MZDA 1OMEA 4KG2A 4QY6A 3GRJA 4R3BA 3HVFA 1GA0A 3NC8A 3HUOA 5HAQA 4JXVA 3Q1FA 3AGFA 3C7VA 3MXSA 2E8IA 2EX8A 1PW8A 1NYYA 3FWLA 4N1HA 1IELA 3FKWA 1HD8A 4PMAA 4DKIA 4B4XA 1H5XA 1FR6A 4QU3A 5EVIC 1Z6FA 1K55A 2Y2IA 1BLPA 1FR1A 2JBFA 4KZAA 4Y7PA 2ZQDA 3G31A 4IBXA 2ZQ9A 2I72A 2Q9NA 2EX2A 5GLDA 1M6KA 1K25A 2WZXA 3IH8A 3WRTA 1ONHA 4K91A 3IT9A 1K6SA 5EOEA 4OP5A 5FATA 5TR7A 1XA7A 3GQZA 4WZ4A 3A3JA 1S6RA 5EECA 2XDMA 4GKUA 4KZ6A 3Q82A 5F83A 4HEFA 4KZ4A 3MXRA 1K4EA 3NDEA 1BUEA 5FQKA 3Q7VA 4UAAA 3UDXA 2XK1A 5FQMA 1TEMA 2OLVA 4IEDA 3MFDA 2QMIA 4OLGA 2HP6A 2Y55A 1HVBA 2ZM0A 4WMCA 2Y91A 3DTMA 4S2MA 3IXBA 4N9LA 2JC7A 2WUQA 2EFXA 3VSLA 5EVIB 2ZQ7A 3OC2A 4R0QA 2HPBA 2J7VA 3ZDJA 2DCFA 4S2JA 2WKEA 1L2SA 3FZCA 2XFSA 4EBPA 1ZG6A 4MLLA 3IF6C 3UPNA 3ZG9B 5AQBA 2XD1A 3I7JA 3WS1A 4UA6A 3G4PA 2CC1A 3G34A 5FI2A 4S2NA 1FOFA 4C3QA 3VOYA 2WGVA 5GLCA 5EUAA 2QPNA 1GHIA 2WADA 3HREA 5FSRA 4ZJ3A 3A3EA 4MBHA 2Y2QA 4FSFA 4OQ0A 4U0TA 1E3UD 2Z2MB 5CGSA 1XPBA 3S4XA 4PM5A 2ZLYA 3W4OA 4BL2A 5F1FA 1O07A 3N8LA 5DF8A 2ZC6B 3UY6A 2BG1A 2Y2GA 1KE0A 5FAPA 3IXGA 4JF6A 1H8ZA 1N4OA 5FI6A 1JTDA 4LCMA 3C7UA 3VSKA 4IVIA 4ZDXA 5EPHA 4YINA 3LY4A 2WGWA 2ZC7A 2ZD8A 2HDSA 1W5DA 5CHUA 4BD0A 3VOZA 2WK0A 4DE2A 1BSGA 5HX9A 1ERQA 3NDGA 2A3UA 1ES5A 2UWXA 3BFDA 3GMWA 4P0MA 1DJCA 1K55C 2XH9A 3CJMA 1LL5A 3G2ZA 4PM8A 3LY3A 3WS2A 3ZG0A 5FAOA 3UDIA 3IF6B 4E3LA 4A5RA 3O87A 4GD8A 4OOLA 4X53A 5EVID 2WZZA 4ZJ2A 1FSWA 1K54A 4S2LA 3EQVA 4R23A 3V3SA 2WGIA 1KVLA 3BECA 4BD1A 4ZAMA 4U3TA 4FH2A 4RYEA 3VMAA 4EUZA 4DDSA 5DVAA 1SDEA 3BLSA 2XFTA 3PBNA 5DF9A 4OQGA 5KMWA 3C5AA 1RP5A 1GHPA 1MWRA 1BZAA 1KVMA 1BT5A 4XXRA 2OLUA 4OOYA 3M6HA 3RJUA 1ERMA 5AQAA 1WYCA 3FKVA 4WELA 3UPPA 3OCNA 3W4PA 1IYPA 3GSGA 2H0YA 3VFFA 1NY0A 3MZEA 3IQAA 4CPKA 5DTSA 4OPRA 3GVBA 4KQQA 3JYIA 1LLBA 4MNRA 1CEFA 2WAFA 3BYDA 3UO9A 2XD5A 3PAEA 5FQJA 1WYBA 4OH0A 1E4DA 3N4IA 1NRFA 3ZG8B 2Y4AA 1MXOA 5A92A 5M19A 3UPOA 1YLYA 2XF3A 4S2NC 2HP5A 5FQQA 5FAQA 4EWFA 5M18A 1Q2PA 3M6BA 2R9WA 1EROA 5M1AA 4ZJ1A 4KENB 2VGJA 4EBNA 4NETA 4QHCA 1HTZA 1K4FA 4OKPA 1PZPA 5CTMA 5CRFA 3M2KA 1O7EA 2PBYA 1DJAA 4KQOA 2C5WB 4KZ3A 5FQ9A 1IYOA 3AGEA 4OPZA 3EQUA 2Y2MA 3BFGA 5F82A 3ZCZA 3TOIA 1FCNA 4OOMA 1RGYA 4OONA 1L0EA 4XUZA 1ZKJA 1PWCA 3V5MA 2G2WA 3IHAA 3OZHA 3V39A 3IXDA 4N1XA 3HUMA 4BQMA 2OSUA 4M3KA 4D2OA 1KDSA 3S1YA 4WBGA 3IWIA 1H8YA 2A49A 2JCHA 3PBQA 3RXXA 3SH9A 3VP1A 1QMFA 4EBLA 4RX3A 4EQIA 5CECA 1XA1A 2BLSA 1K54C 3UE3A 3TSGA 3N6IA 1WE4A 5U47A 4JXGA 1MWSA 1XGIA 2PU4A 1YT4A 5GHYA 1ES3A 3SOIA 4B4ZA 1LI0A 2G2UA 5FI7A 2HDRA 4BJPA 1YLPA 3WRZA 4QD4A 3FV7A 2RL3A 5GLAA 1BULA 1K57A 3Q7ZA 1AXBA 4ZBEA 4B88A 2EXAA 5TGFA 4BL3A 1LHYA 2XGNA 2WKHA 1E3UA 4FD8A 3ZVTA 1PI5A 5F1GA 1EWZA 4Z9QA 3BFCA 1C3BA 1I5QA 2WGWB 4P6BA 4N92A 3O88A 5TFQA 1ESIA 1PWDA 3WS0A 4KZ5A 4R4SA 4EV4A 4KG5A 3RXWA 4GD6A 4OLDA 4LV1A 1Y54A 4DE0A 1RCJA 1K56D 1ZC2A 2DRWA 3M2JA 2ZM2A 3BLMA 3IXHA 3NI9A 5KZHA 4ZTKA 1VQQA 5GHXA 3V3RA 1XKZA 1PIOA 4OP8A 4C6YA 1J9MA 1SCWA 1FCMA 2XEPA 1NXYA 2WYXA 2H10A 2H5SA 3P98A 4X55A 1E25A 3IHBA 3Q07A 4IVKA 3QNCA 4KQRA 5CERA 3G32A 4OQIA 2X01A 4E3IA 4FCFA 4GZBA 5EE8A 1GHMA 2IWBA 4QB8A 1IYSA 3DWKA 5JYPA 4DRTA 5CEDA 3SH7A 4LV3A 2DNSA 5E2GA 2IWDA 1N9BA 4NK3A 1I2SA 1NJ4A 3E2KA 3N7WA 4WZ5A 3B3XA 4CJNA 4DDYA 3HL9A 1BLCA 5GHZA 2J8YA 4JKTA 4K0XA 4HESA 4QY5A 1YQSA 4E3MA 1XXMA 4C75A 2XLNA 3GV9A 2ZMAA 1VM1A 4KZ8A 1K6RA 3O3VA 1MWUA 5CTNA 3WS4A 4JPMA 1G68A 3LCEA 3VFHA 1M40A 5KSCA 2IWCA 4R1GA 3UE0A 5J8XA 1LL9A 1YM1A 4DF6A 4YFMA 4L0LA 3TG9A 2R9XA 2V1ZA 1GCEA 1U60A 2RCXA 4F94A 4Y0TA 3MKEA 1PYYA 2P9VA 3HLGA 4DE3A 2Y2HA 3N8RA 3SS4A 4KZ9A 3PBOA 3D4FA 3HLCA 1YMSA 3ZGAB 1NZOA 2FFYA 4O7DA 4X69A 4Q8IA 1KE4A 3NCKA 4BENA 2V20A 1QMEA 4JBFA 3S22A 4E3JA 1CK3A 5I94A 2Z2LB 5CXWA 3SH8A 4LV0A 1L0FA 1Q2QA 5HW3A 3ZNYA 2Y2OA 3ZNTA 1JTGA 3G2YA 3Q81A 3IF5A 4KG6A 3Q7VB 4HBTA 1BLHA 1GA9A 2C6WB 5DF7A 5IHVA 1NZUA 3CMZA 3DW0A 3OPLA 2HP9A 3NY4A 5HAPA 1HZOA 3ITAA 3BEBA 2PU2A 1SHVA 3BM6A 3QHYA 2WKIA 1PI4A 4S2OA 4U0XA 1MY8A 3OCLA 5CEBA 3HLDA 1LI9A 4H8RA 1KGFA 3C4PA 2WAEA 1CI9A 4DXBA 2Y2PA 4RA7A 5DTTA 1FCOA 1RGZA 2JE5A 4WEKA 4Y0OA 1L0DA 4UA9A 4E3NA 3BFFA 3VP3A 2J9PA 1ESUA 1ALQA 2ZC4B 4WEJA 5HL1A 2XR0A 4WZ5C 2ZJ9A 4E6XA 4JLFA 4Y0UA 5JYOA 2QZ6A 4P87A 5HAIA 2Y2KA 1JWVA 4N9KA 1FQGA 3ITBA
chains in the Genus database with same CATH superfamily
1X0OA 5TBMB 5KSHA 4GN2A 4HP4A 4R6LA 5A8BA 2JKTI 3VP4A 1XJ2A 2L4RA 3QP8A 1ES2A 3T4SA 4JF4A 3HLEA 3E2LA 1YLZA 4X56A 4JGOA 3GR2A 1YLTA 1VEUA 4OVDA 2X02A 1ONGA 1W79A 2H0TA 3P09A 5A90A 3VP2A 3NBLA 3PAGA 1G6AA 3W4QA 2Q9MA 2VV7A 3KYQA 4WYYA 2Z6DA 3IH9A 2QKPA 1IEMA 4IBRA 1IYQA 5A91A 3IWQA 4H6JB 1CEGA 3T4LA 3ZFZA 4JF5A 4E3OA 2LB9A 1KGEA 3DTEA 2EX6A 1XGJA 2ZQ8A 3CG5A 1PWGA 5E2HA 4MDZA 2ZQCA 4GDBA 3MBZA 2Y2LA 2EFUA 3UB9A 2FZ0A 5G18A 3NULA 3V50A 2OWHA 3LI8A 2V2FF 1W8YA 3MZFA 3QNBA 4LCLA 2X71A 4EETB 1S1YA 3UN7A 2EX9A 3IWOA 2EWWA 4LENA 3BFEA 4E04A 3ZVWA 4LFUA 2VX8A 3SW1A 2V9AA 4R3BA 3PXPA 5L07A 4DN0A 2AVXA 2W1TA 3EOIA 1T19A 4PMAA 1PFLA 3NHQA 4P6ZS 3B47A 4KZAA 4KQDA 2OAQ1 2ZQ9A 3RTYA 4K91A 3IT9A 2PYPA 3K3CA 4OP5A 1XA7A 4JGRA 4WZ4A 2HJEA 3MJQA 3Q82A 3F1NB 3MXRA 3NDEA 5FQKA 1BUEA 4G3WA 3C30A 4KUKA 3MQQA 2CMNA 2ZM0A 1V9ZA 2WUQA 3A0SA 5EVIB 4NKPA 2JN7A 3OC2A 2HPBA 2J7VA 3ZG9B 5AQBA 3SZTA 2XD1A 3WS1A 4UA6A 4B93A 2CC1A 5FI2A 3JVUA 4GS9A 2L1MA 2QPNA 1GHIA 5HPIA 2O9BA 2HZ5A 1E3UD 2WKQA 1XPBA 2WKPA 2ZLYA 3F1OB 3LR0A 4BMWA 3UY6A 2BG1A 1KE0A 4FTXA 5EPHA 5G4YA 2HDSA 3UE6A 1W5DA 5CHUA 2VGLS 3VE3A 4HJ4A 1ERQA 3NDGA 1UWNX 3BFDA 1LL8A 4PM8A 1Z09A 3LY3A 2V1AA 3IF6B 3EGDC 5EVID 2WZZA 3IBRA 3IX3A 3V3SA 1T1AA 1KVLA 4EERA 3IS2A 4GLQA 2O99A 1XFQA 4FH2A 2XFTA 3FC7A 3PBNA 3NOPC 3C5AA 1RP5A 1GHPA 5K5BA 1BZAA 3CI6A 1KVMA 1BT5A 3MMHA 4XXRA 4Q0IA 1S4RA 2INWA 3P01A 4YWZA 3UB5P 3MZEA 5HWWA 3GVBA 3KSGA 3JYIA 4MNRA 1CEFA 3BYDA 5FQJA 3RFBA 1WYBA 3N4IA 2Y4AA 5F68A 5A92A 3UPOA 4S2NC 3VV4A 5M1AA 2R9WA 4L9EA 2VGJA 3KSFA 3KX0X 1O7EA 1OT9A 3AGEA 2VLGA 3BFGA 1FCNA 5FEGA 1ZKJA 5IU1A 3IHAA 3IXDA 4N1XA 4D2OA 1KDSA 3F1PA 5HD5A 1LSWA 2WKRA 3IWIA 3RXXA 2GJ3A 4WUJA 3SH9A 3BW6A 2BLSA 1K54C 3TSGA 4JXGA 1MWSA 1XGIA 2PU4A 5GHYA 4B4ZA 4WN5A 1YLPA 4QD4A 3MR0A 3S7PA 1LHYA 2XGNA 4CLCC 2QHKA 2WGWB 4P6BA 3T12B 4R4SA 4F3LA 3RXWA 2VEAA 4LGWA 4WLAA 4DE0A 1K56D 3IXHA 4WF0A 1VB6A 3KSIA 2H5SA 3P98A 4X55A 1E25A 3IHBA 1TF1A 4FCFA 4GZBA 2KOIA 1IYSA 3DWKA 5JYPA 5E2GA 2ZOHA 4WZ5A 3B3XA 1BLCA 4JKTA 5J3WA 4E3MA 2ZL1B 1XXMA 1VETA 1VM1A 1D06A 3KYEA 1LL9A 3H7WB 4DF6A 4YFMA 2M7UA 3TG9A 1GCEA 4FOFA 3UB7A 1P97A 3C38A 3N8RA 3SS4A 2GX5A 3ZGAB 1LSVA 4LRXC 2B02A 2FFYA 3E4QA 3NCKA 2W1RA 4JBFA 3S22A 4E3JA 5I94A 1OTAA 5HW3A 4EESA 3ZNYA 2Y2OA 3CUEA 5FDSA 2UV0E 3ZNTA 3IF5A 4KG6A 3MFXA 1GA9A 4O01A 5DF7A 5IHVA 3CMZA 3BEBA 4GJ4A 1SHVA 3H82B 5JYOA 1PI4A 4U0XA 3E0YA 4LPZA 3BJNA 3LYXA 2L0WA 3C4PA 2WAEA 2VJWA 1CI9A 3K2NA 4RA7A 4UQIS 1FCOA 2GZAA 2JE5A 4WEKA 4Y0OA 4WEJA 3NECA 4P87A 3ITBA 5DTKA 4UHUA 3T1QB 3FYZA 3HLBA 2J9OA 3C8CA 4RVAA 3BQ8A 1PW1A 3UDFA 1FSYA 4K0WA 3UNWA 3PBSA 3CPTB 4ID4A 3L7HA 3TJZC 1CJFA 4E6WA 5CGWA 3PBTA 1JNUA 4WMCD 1OTBA 1N9OA 3DWZA 1XJ6A 1YMXA 2XQZA 1SKOB 1DY6A 1XX2A 4YOFA 3CZDA 3SS3A 3C4OA 3A3IA 5FQIA 4EUVA 1JWZA 3T4QA 1I2WA 3ZHHA 4LV2A 3QP1A 5GLBA 2JKTM 2P9VB 2K2NA 4PM7A 4OPQA 1K38A 3JPUA 4JXSA 1UGUA 1T1CA 5EM0A 1CQAA 1PZOA 3AGDA 4CQHA 3HLWA 5AQ7A 1W8QA 1G6OA 4D60A 2ZM8A 1KGGA 3EWKA 1ZG4A 1Y4OA 1XP4A 5EVLA 4Q0JA 1PNEA 4KZ7A 1NWZA 4O8GA 4GNUA 1K57C 3OPPA 1MBLA 3NOTC 4I38A 1ES4A 3VP0A 3D72A 1MWTA 4BBUA 4EQ1A 5HARA 1TDGA 1G5UA 4OQHA 3MQOA 1EI5A 4MBFA 2ZC5B 3MZDA 3LIBA 3GRJA 3HVFA 4R3AA 4BWIA 3TRCA 4JXVA 3Q1FA 3C7VA 2XRNA 1FILA 4I3JA 5EM1A 3FWLA 4DKIA 1H5XA 5EVIC 2E8JA 1Z6FA 5HD3A 3G31A 2I72A 2Q9NA 2EX2A 4HH2A 3IH8A 1K6SA 3GQZA 5EECA 2XDMA 5F83A 4KZ4A 1H3QA 4ETXA 3UDXA 1F5MA 1TEMA 2OLVA 1VEUB 3FPWA 3BQAA 2QMIA 4OLGA 1T18A 3DTMA 2PT7A 3IXBA 3R7WA 3ZDJA 1L2SA 2XFSA 3T4KA 4EBPA 2PAVP 3IF6C 3I7JA 4Z1WA 5GLCA 2WADA 2HF6A 3HREA 3A3EA 2Y2QA 4OQ0A 5CGSA 5TBMA 3W4OA 4BL2A 1O07A 3N8LA 5DF8A 1OTEA 1S1ZA 5EVEA 4JF6A 1H8ZA 1N4OA 2JHEA 3C7UA 4LCMA 4IVIA 4PKYA 3T1RA 3VSKA 2ZC7A 4DE2A 2A3UA 3WS2A 1DJCA 1K55C 2M7VA 5FAOA 4E3LA 2JKFA 4JGPA 3EQVA 4R23A 2WGIA 1ODVA 2ZOIA 5DVAA 1TS8A 3BLSA 3QP5A 4OQGA 5KMWA 4HHDA 1MKMA 1MWRA 1A0KA 2OLUA 5AQAA 4EU0A 3W4PA 1TD5A 3GSGA 3VFFA 4H6JA 2W1TB 5DKLA 1LLBA 2JKGA 2WAFA 3UO9A 1DP8A 3E98A 1F2KA 4MN5A 1YLYA 2HP5A 5FQQA 1Q2PA 1EROA 2KLIA 1XJ3A 4NETA 5L09A 1HTZA 3R4KA 3DAVA 3T4JA 5CTMA 5CRFA 3M2KA 1BYWA 4KQOA 5FQ9A 4HI4A 4OPZA 3EQUA 2Y2MA 5F82A 1F9IA 4OOMA 1RGYA 1DRMA 3C2WA 2NUPC 3OZHA 5HDDA 1H8YA 2A49A 2JCHA 3LIDA 3PBQA 3UMEA 5CECA 4FUWA 4GS9B 1WE4A 2W3HA 1OTDA 4Q0HA 1L3LA 2OWJA 2HDRA 5KIZA 4R70A 4BJPA 2VZWA 1T1BA 1BULA 1K57A 3Q7ZA 2EXAA 5TGFA 4QPRA 1WA9A 1E3UA 2I9VA 1PI5A 1PRQA 4Z9QA 5HPFA 3MQ0A 4YNRA 4AFIA 3F1NA 3WS0A 2Z6CA 1JWVA 5EV0A 4GD6A 4OLDA 4K08A 3LICA 2ZM2A 3BLMA 5KZHA 1VQQA 1XKZA 1PIOA 4OP8A 2VV8A 4NXGA 3IS2B 2H10A 3Q07A 3G32A 4OQIA 1ACFA 1GHMA 4QB8A 2IWDA 2W3FA 1NJ4A 3E2KA 3N7WA 3PR6A 4DDYA 1HLUP 3A0VA 2BTFP 4DJ2A 2XLNA 4NXEA 1YSPA 1ZTUA 1G68A 2IWCA 1MZUA 2R9XA 4MN7A 3BWLA 1OT6A 3MKEA 3EEHA 3HLGA 4ARZB 4DE3A 4JGQA 3D4FA 1S4SA 1YMSA 3ICYA 4X69A 1KE4A 4G3VA 2Z2LB 1IOUA 5FL3A 3LUQA 1L0FA 3EGXC 3LR5A 1JTGA 2V1BA 1OJ5A 3V67A 3Q7VB 4HBTA 3F1PB 3OLOA 2C6WB 3DW0A 3OPLA 2HP9A 3NY4A 5HAPA 1S66L 3TE8A 5F6AA 5F5YA 2PU2A 3QHYA 3MXQA 5HWVA 1LI9A 1EW0A 4DXBA 4UA9A 3BFFA 5F69A 3VE4A 2ZJ9A 4E6XA 1XFNA 2QZ6A 2Y2KA 1N9LA 4NXFA 1JWPA 4F3LB 2V0WA 5E43A 2O0YA 3ZG7B 4HIAA 1AWIA 2R78A 5HFOA 4MBKA 1YLJA 2QYBA 3NIAA 1K56A 2Y2NA 5IT5A 4PM9A 4X68A 1N9NA 1F98A 1ZHHB 3NJAA 3GECA 3LFVA 4DE1A 1MKIA 4GCZA 4OPYA 4GOGA 3MKFA 3WS5A 3CITA 4E3KA 5CHJA 3WWXA 2PHYA 3BRMA 3DTIA 2Y59A 1Y28A 3QP6A 1IFQA 1SKFA 3LGOA 2Q0OA 5E2FA 4X6TA 3ZG5A 5L2FA 3KYZA 2NUTC 2ZQAA 4L9GA 4X1MA 5E2EA 4HY8A 3UE1A 4WL9A 4GDNA 3SS5A 5DJTA 4FH4A 2ZMVA 3PBRA 1KDWA 2HDUA 3HUNA 3W8KA 2O9AA 5HDSA 5EOOA 2EXBA 4S2KA 5HZHA 4R3JA 1DJBA 2P74A 4DXCA 3LIEA 2PDRA 1NRJA 2YKFA 4P85A 3UB8A 3D9YA 3PYPA 1NLZA 3OPRA 1S0WA 4QJGA 3HJIA 5A93A 1MPLA 4ESPA 2FFFB 2QWSA 5FA7A 3N8SA 4UA7A 4GB7A 1TVFA 3A3DA 2PRFA 5D3OA 4LLOB 5AJGA 1OMEA 5AVEA 1GA0A 3NC8A 5HAQA 1LSXA 1NYYA 3QP2A 1IELA 3FKWA 4B4XA 3P7NA 1FR6A 1FR1A 5HL6A 3U4LP 1H0MA 2ZQDA 1K25A 2D01A 1ONHA 2HV1A 2YKHA 5TR7A 1P9WA 2V0UA 1S6RA 1KOUA 2PR6A 5FQMA 3T50A 2HP6A 4EEPA 3H82A 4WMCA 4S2MA 4N9LA 5AVFA 1TS0A 4S2JA 3MSHA 4MLLA 3CLOA 3G34A 4S2NA 4I39A 3VOYA 2WGVA 5EUAA 4I5SA 4ZJ3A 1H8MA 4FSFA 4UQIM 5HSQA 2Z2MB 2JKRM 3E4OA 2ZC6B 4EW7A 5FAPA 5J7EA 4PAUA 5FI6A 1JTDA 1DP6A 2XA7M 4YINA 2ZD8A 3VOZA 2WK0A 3CPTA 1ES5A 1UWPX 3GMWA 4ETZA 3G2ZA 3CJMA 3ZG0A 2P08A 4I3AA 1XJ4A 4A5RA 4I3IA 4GD8A 4X53A 3VOLA 4ZJ2A 1FSWA 1K54A 1OPXA 2A24A 4NG2A 1GSXA 4EUZA 1P0ZA 4HJ6A 5DF9A 4Y3IA 4CLCA 4OOYA 3RJUA 3LI9A 1WYCA 3FKVA 4WELA 3UPPA 1NY0A 3IQAA 4CPKA 5DTSA 4OPRA 2MJ6A 4GHIB 4KQQA 5EFWA 1YAXA 2XD5A 3PAEA 1STZA 3L9KA 1DP9A 1NRFA 3IBJA 1MXOA 3T4TA 3CHWP 4QWOA 2XF3A 4KUOA 5L10A 5FAQA 5M18A 4KENB 4EBNA 4QHCA 1K4FA 4II7A 4OKPA 4XT2A 1PZPA 2K7SA 5IS1A 2PBYA 1DJAA 3UMDA 3MS6A 3A0RA 1IYOA 2Y8HA 2JKRI 4Y2FA 3ZCZA 2O9CA 3TOIA 1PWCA 2G2WA 3V39A 4IHQA 4BQMA 2OSUA 3R7WB 3S1YA 4WBGA 4EEUA 4BBTA 4IJGA 1QMFA 4Y13A 4RX3A 5MC7A 4MN6A 3UE3A 2VV6A 1P9RA 3N6IA 5U47A 5C5KA 1YT4A 3SOIA 1LI0A 2G2UA 2P7JA 3WRZA 2RL3A 1AXBA 4BL3A 2WKHA 4R38A 4FD8A 3ZVTA 3LIFA 1NLYA 3ZQ5A 3BFCA 1C3BA 1I5QA 1V9YA 5TFQA 1ESIA 4DJ3A 4KZ5A 4O0PA 4KG5A 3LEQA 3W2ZA 1Y54A 3NI9A 1J3WA 2PD8A 5I5LA 3V3RA 2XEPA 4Y7PA 1CF0A 1NXYA 2WYXA 3SH7A 4KQRA 3QNCA 5DKKA 4HOIA 4DRTA 5CEDA 4LV3A 2DNSA 1N9BA 1I2SA 4CJNA 2W3DA 4HESA 2LB5A 1YQSA 4C75A 3KO6A 1K6RA 2EA9A 1MWUA 5CTNA 3WS4A 3LCEA 5HWTA 1M40A 5KSCA 4R1GA 3UE0A 5J8XA 1YM1A 2PD7A 4L0LA 2V1ZA 2QJ7A 2ZMFA 1OJGA 3OOVA 1OTIA 3PBOA 3HLCA 5CXWA 3SH8A 3UB6A 4LV0A 1Q2QA 2VK3A 1BLHA 2Y79A 5HDCA 1NZUA 3G6OA 1HZOA 3ITAA 4S2OA 3BM6A 2WKIA 3GDIA 5CEBA 3OCLA 4L9FA 5LBRA 3B42A 5DTTA 1RGZA 1L0DA 3VP3A 1ESUA 1W63M 1YKDA 5HL1A 2XR0A 4WZ5C 3RH8B 4JLFA 4Y0UA 2G7UA 1FQGA 5AQ9A 2J3TD 4WM9A 2PYRA 3HBRA 4JXWA 4KZBA 3GTCA 2OV5A 3BY9A 4P6ZM 5J4EA 3G35A 3OPHA 1JVJA 4ME4A 3ULFA 4S2PA 3HLFA 2VA0A 2Y2JA 5FEFA 4RX2A 5BOHA 1W7FA 4HBUA 2ZC3B 1YLWA 2HDQA 1CI8A 5EVIA 2GDNA 3LR3A 1IKIA 4PM6A 3CUEC 3PTEA 2B18A 1NYMA 5FASA 5FDHA 5CGXA 3LEZA 1VHMA 1BLSA 2B95A 2IA2A 4R4RA 4XUXA 4MMNA 3A3FA 3LO7A 3F1OA 5CHMA 1L0GA 2VGKA 4G3KA 1TDLA 3IX4A 4S2IA 1SZVA 4BLMA 4HP9A 3B33A 2B5RA 5GL9A 3IF6A 1KE3A 4LRZE 3G30A 4PPRA 3ISGA 2VGLM 2EWVA 1IKGA 2HGVA 1SDNA 4MEZA 3O86A 2BASA 2GNXA 4KG2A 4QY6A 3LIAA 3EEAA 3HUOA 3AGFA 3MXSA 2ACGA 2E8IA 2EX8A 1PW8A 4N1HA 4ARZA 3E4PA 1HD8A 2ZBBA 2P04A 2W3EA 4QU3A 1K55A 2Y2IA 1BLPA 2JBFA 1W63Q 4IBXA 2V8FA 5GLDA 1M6KA 2WZXA 4LRYC 3WRTA 5DJUA 3CWFA 5EOEA 5FATA 4PKYG 3A3JA 4GKUA 1G28A 4KZ6A 4HEFA 4HJ3A 1K4EA 3Q7VA 2W27A 4UAAA 5G4ZA 2XK1A 4IEDA 1TS6A 3MFDA 2Y55A 3H9WA 1MC0A 3BY8A 3PHYA 1HVBA 4X1LA 2Y91A 2JC7A 3VSLA 2EFXA 2ZQ7A 4R0QA 4MCWA 2DCFA 2WKEA 3FZCA 1ZG6A 3UPNA 2V8CA 3G4PA 4Y15A 4X25A 1FOFA 4C3QA 2H28A 5FSRA 1VETB 4MBHA 4U0TA 3S4XA 4PM5A 5F1FA 1GSVA 2OOLA 4EXOA 2DMWA 2Y2GA 5DFXA 3IXGA 4ZDXA 3LY4A 2WGWA 1BSGA 4Y5FA 5HX9A 2D02A 2UWXA 2OAP1 4P0MA 2XH9A 1LL5A 3JVVA 3UDIA 3HJKA 3O87A 4OOLA 4BBVA 4S2LA 2QJ5A 3BECA 4BD1A 4ZAMA 4U3TA 4RYEA 3VMAA 4DDSA 1SDEA 4NXBA 2J80A 1YPRA 4ZRRA 3M6HA 1ERMA 4RQ9A 3D3OA 3OCNA 1IYPA 1D1JA 2H0YA 2ZL1A 3MF0A 2W0NA 3T1SA 3H7WA 3O5YA 4OH0A 1E4DA 3ZG8B 3QP4A 5M19A 4EWFA 3M6BA 4ZJ1A 3KSHA 3K3DA 4UEYA 2C5WB 4KZ3A 4PHTA 5DFYA 4OONA 4IUHA 1L0EA 4XUZA 3V5MA 3FG8A 3HUMA 4M3KA 3VP1A 3T1XA 4EBLA 1GSWA 4EQIA 2XSSA 1XA1A 2PBDP 2XA7S 2PR5A 1ES3A 5FI7A 2FH5A 3FV7A 5GLAA 4ZBEA 4B88A 3U2AA 3DBAA 5F1GA 1EWZA 2KX6A 4CLCE 4N92A 3O88A 1PWDA 1TS7A 4EV4A 2VKSA 4LV1A 3S7OA 1RCJA 3S7QA 1ZC2A 2DRWA 3M2JA 3S7NA 4ZTKA 2W3GA 5GHXA 2A2LA 4C6YA 1J9MA 1SCWA 1FCMA 2A24B 4BD0A 5CERA 2X01A 4IVKA 4HH3A 4E3IA 5EE8A 4GW9A 4NEED 2IWBA 1K0KA 2XROA 4M4XA 3ZYTA 4NK3A 4CLCB 3HL9A 1SKOA 5GHZA 2J8YA 2J3TC 4K0XA 4QY5A 2K31A 5TJJA 3OBFA 3GV9A 2ZMAA 3DTKA 4KZ8A 3O3VA 4B9OA 5L8MA 4JPMA 3VFHA 3CAXA 4DMZA 1U60A 2RCXA 4F94A 4Y0TA 3IX8A 1PYYA 2P9VA 2Y2HA 4KZ9A 3HCYA 1NZOA 1D7EA 4XT2B 4O7DA 4Q8IA 4BENA 2V20A 1QMEA 5CX7A 1CK3A 2M1CA 4HNBA 4CLCD 3Q81A 3G2YA 3TW8A 1LT0A 2KDKA 1YSQA 4IUKA 1MY8A 3HLDA 4GHIA 4H8RA 1KGFA 4HQAA 2Y2PA 1FIKA 4E3NA 3FPVA 2J9PA 1ALQA 1S67L 2ZC4B 2J3WA 4Y17A 3LR4A 2HJ9C 5HAIA 1BTLA 4N9KA 3T4OA 3NOUC
chains in the Genus database with same CATH topology
5AQ9A 1JWPA 4WM9A 5DTKA 5KSHA 4UHUA 3FYZA 5E43A 4GN2A 3ZG7B 3HBRA 3HLBA 2J9OA 5HFOA 4MBKA 3VP4A 4RVAA 1YLJA 4JXWA 3NIAA 4KZBA 1PW1A 1ES2A 3GTCA 1FSYA 4JF4A 4K0WA 3HLEA 3PBSA 2OV5A 3UDFA 1K56A 3UNWA 4ID4A 2Y2NA 3G35A 3OPHA 4PM9A 4X68A 1JVJA 3E2LA 1YLZA 4X56A 4E6WA 5CGWA 3PBTA 3GR2A 4S2PA 4DE1A 4WMCD 1YLTA 1MKIA 3HLFA 3DWZA 4OPYA 4OVDA 2Y2JA 2XQZA 1YMXA 2X02A 4GOGA 1ONGA 1W79A 3MKFA 2H0TA 1DY6A 3P09A 3WS5A 4RX2A 5BOHA 1W7FA 4HBUA 2ZC3B 3VP2A 4E3KA 5A90A 1YLWA 3NBLA 1XX2A 5CHJA 3PAGA 1G6AA 2HDQA 3WWXA 1CI8A 5EVIA 3W4QA 2GDNA 4PM6A 1IKIA 3BRMA 3CZDA 3SS3A 3C4OA 3A3IA 5FQIA 2Q9MA 2Y59A 3PTEA 4WYYA 1JWZA 1SKFA 1I2WA 1NYMA 3IH9A 5FASA 5FDHA 3ZHHA 1IEMA 4IBRA 5CGXA 3LEZA 4LV2A 1IYQA 5E2FA 4X6TA 5A91A 1BLSA 3ZG5A 5L2FA 3IWQA 5GLBA 2ZQAA 4R4RA 1CEGA 2P9VB 3ZFZA 4PM7A 4JF5A 4OPQA 4XUXA 1K38A 5E2EA 3UE1A 4GDNA 3A3FA 3SS5A 4E3OA 3LO7A 4FH4A 4JXSA 1KGEA 3PBRA 1KDWA 2HDUA 3HUNA 1PZOA 3AGDA 3W8KA 5CHMA 2EX6A 1XGJA 2ZQ8A 3CG5A 3HLWA 1W8QA 2VGKA 5AQ7A 1L0GA 1PWGA 1TDLA 5E2HA 4S2IA 2ZQCA 2EXBA 4S2KA 5EOOA 4R3JA 2ZM8A 1KGGA 3MBZA 1DJBA 4GDBA 2P74A 4BLMA 2Y2LA 4DXCA 2EFUA 1ZG4A 4P85A 1XP4A 5EVLA 5G18A 3V50A 2B5RA 4KZ7A 5GL9A 2V2FF 1W8YA 3MZFA 3QNBA 3OPRA 1K57C 1S0WA 2X71A 3IF6A 4GNUA 4LCLA 4QJGA 3OPPA 1KE3A 5A93A 3UN7A 1MPLA 1MBLA 2EX9A 3G30A 4PPRA 3ISGA 3IWOA 2FFFB 4LENA 1IKGA 5FA7A 3BFEA 3N8SA 4UA7A 1SDNA 4GB7A 1ES4A 3VP0A 1TVFA 1MWTA 3A3DA 3ZVWA 5HARA 1TDGA 1BTLA 4MEZA 3O86A 4OQHA 5D3OA 1EI5A 4MBFA 2ZC5B 3MZDA 1OMEA 4KG2A 4QY6A 3GRJA 4R3BA 3HVFA 1GA0A 3NC8A 3HUOA 5HAQA 4JXVA 3Q1FA 3AGFA 3C7VA 3MXSA 2E8IA 2EX8A 1PW8A 1NYYA 3FWLA 4N1HA 1IELA 3FKWA 1HD8A 4PMAA 4DKIA 4B4XA 1H5XA 1FR6A 4QU3A 5EVIC 1Z6FA 1K55A 2Y2IA 1BLPA 1FR1A 2JBFA 4KZAA 4Y7PA 2ZQDA 3G31A 4IBXA 2ZQ9A 2I72A 2Q9NA 2EX2A 5GLDA 1M6KA 1K25A 2WZXA 3IH8A 3WRTA 1ONHA 4K91A 3IT9A 1K6SA 5EOEA 4OP5A 5FATA 5TR7A 1XA7A 3GQZA 4WZ4A 3A3JA 1S6RA 5EECA 2XDMA 4GKUA 4KZ6A 3Q82A 5F83A 4HEFA 4KZ4A 3MXRA 1K4EA 3NDEA 1BUEA 5FQKA 3Q7VA 4UAAA 3UDXA 2XK1A 5FQMA 1TEMA 2OLVA 4IEDA 3MFDA 2QMIA 4OLGA 2HP6A 2Y55A 1HVBA 2ZM0A 4WMCA 2Y91A 3DTMA 4S2MA 3IXBA 4N9LA 2JC7A 2WUQA 2EFXA 3VSLA 5EVIB 2ZQ7A 3OC2A 4R0QA 2HPBA 2J7VA 3ZDJA 2DCFA 4S2JA 2WKEA 1L2SA 3FZCA 2XFSA 4EBPA 1ZG6A 4MLLA 3IF6C 3UPNA 3ZG9B 5AQBA 2XD1A 3I7JA 3WS1A 4UA6A 3G4PA 2CC1A 3G34A 5FI2A 4S2NA 1FOFA 4C3QA 3VOYA 2WGVA 5GLCA 5EUAA 2QPNA 1GHIA 2WADA 3HREA 5FSRA 4ZJ3A 3A3EA 4MBHA 2Y2QA 4FSFA 4OQ0A 4U0TA 1E3UD 2Z2MB 5CGSA 1XPBA 3S4XA 4PM5A 2ZLYA 3W4OA 4BL2A 5F1FA 1O07A 3N8LA 5DF8A 2ZC6B 3UY6A 2BG1A 2Y2GA 1KE0A 5FAPA 3IXGA 4JF6A 1H8ZA 1N4OA 5FI6A 1JTDA 4LCMA 3C7UA 3VSKA 4IVIA 4ZDXA 5EPHA 4YINA 3LY4A 2WGWA 2ZC7A 2ZD8A 2HDSA 1W5DA 5CHUA 4BD0A 3VOZA 2WK0A 4DE2A 1BSGA 5HX9A 1ERQA 3NDGA 2A3UA 1ES5A 2UWXA 3BFDA 3GMWA 4P0MA 1DJCA 1K55C 2XH9A 3CJMA 1LL5A 3G2ZA 4PM8A 3LY3A 3WS2A 3ZG0A 5FAOA 3UDIA 3IF6B 4E3LA 4A5RA 3O87A 4GD8A 4OOLA 4X53A 5EVID 2WZZA 4ZJ2A 1FSWA 1K54A 4S2LA 3EQVA 4R23A 3V3SA 2WGIA 1KVLA 3BECA 4BD1A 4ZAMA 4U3TA 4FH2A 4RYEA 3VMAA 4EUZA 4DDSA 5DVAA 1SDEA 3BLSA 2XFTA 3PBNA 5DF9A 4OQGA 5KMWA 3C5AA 1RP5A 1GHPA 1MWRA 1BZAA 1KVMA 1BT5A 4XXRA 2OLUA 4OOYA 3M6HA 3RJUA 1ERMA 5AQAA 1WYCA 3FKVA 4WELA 3UPPA 3OCNA 3W4PA 1IYPA 3GSGA 2H0YA 3VFFA 1NY0A 3MZEA 3IQAA 4CPKA 5DTSA 4OPRA 3GVBA 4KQQA 3JYIA 1LLBA 4MNRA 1CEFA 2WAFA 3BYDA 3UO9A 2XD5A 3PAEA 5FQJA 1WYBA 4OH0A 1E4DA 3N4IA 1NRFA 3ZG8B 2Y4AA 1MXOA 5A92A 5M19A 3UPOA 1YLYA 2XF3A 4S2NC 2HP5A 5FQQA 5FAQA 4EWFA 5M18A 1Q2PA 3M6BA 2R9WA 1EROA 5M1AA 4ZJ1A 4KENB 2VGJA 4EBNA 4NETA 4QHCA 1HTZA 1K4FA 4OKPA 1PZPA 5CTMA 5CRFA 3M2KA 1O7EA 2PBYA 1DJAA 4KQOA 2C5WB 4KZ3A 5FQ9A 1IYOA 3AGEA 4OPZA 3EQUA 2Y2MA 3BFGA 5F82A 3ZCZA 3TOIA 1FCNA 4OOMA 1RGYA 4OONA 1L0EA 4XUZA 1ZKJA 1PWCA 3V5MA 2G2WA 3IHAA 3OZHA 3V39A 3IXDA 4N1XA 3HUMA 4BQMA 2OSUA 4M3KA 4D2OA 1KDSA 3S1YA 4WBGA 3IWIA 1H8YA 2A49A 2JCHA 3PBQA 3RXXA 3SH9A 3VP1A 1QMFA 4EBLA 4RX3A 4EQIA 5CECA 1XA1A 2BLSA 1K54C 3UE3A 3TSGA 3N6IA 1WE4A 5U47A 4JXGA 1MWSA 1XGIA 2PU4A 1YT4A 5GHYA 1ES3A 3SOIA 4B4ZA 1LI0A 2G2UA 5FI7A 2HDRA 4BJPA 1YLPA 3WRZA 4QD4A 3FV7A 2RL3A 5GLAA 1BULA 1K57A 3Q7ZA 1AXBA 4ZBEA 4B88A 2EXAA 5TGFA 4BL3A 1LHYA 2XGNA 2WKHA 1E3UA 4FD8A 3ZVTA 1PI5A 5F1GA 1EWZA 4Z9QA 3BFCA 1C3BA 1I5QA 2WGWB 4P6BA 4N92A 3O88A 5TFQA 1ESIA 1PWDA 3WS0A 4KZ5A 4R4SA 4EV4A 4KG5A 3RXWA 4GD6A 4OLDA 4LV1A 1Y54A 4DE0A 1RCJA 1K56D 1ZC2A 2DRWA 3M2JA 2ZM2A 3BLMA 3IXHA 3NI9A 5KZHA 4ZTKA 1VQQA 5GHXA 3V3RA 1XKZA 1PIOA 4OP8A 4C6YA 1J9MA 1SCWA 1FCMA 2XEPA 1NXYA 2WYXA 2H10A 2H5SA 3P98A 4X55A 1E25A 3IHBA 3Q07A 4IVKA 3QNCA 4KQRA 5CERA 3G32A 4OQIA 2X01A 4E3IA 4FCFA 4GZBA 5EE8A 1GHMA 2IWBA 4QB8A 1IYSA 3DWKA 5JYPA 4DRTA 5CEDA 3SH7A 4LV3A 2DNSA 5E2GA 2IWDA 1N9BA 4NK3A 1I2SA 1NJ4A 3E2KA 3N7WA 4WZ5A 3B3XA 4CJNA 4DDYA 3HL9A 1BLCA 5GHZA 2J8YA 4JKTA 4K0XA 4HESA 4QY5A 1YQSA 4E3MA 1XXMA 4C75A 2XLNA 3GV9A 2ZMAA 1VM1A 4KZ8A 1K6RA 3O3VA 1MWUA 5CTNA 3WS4A 4JPMA 1G68A 3LCEA 3VFHA 1M40A 5KSCA 2IWCA 4R1GA 3UE0A 5J8XA 1LL9A 1YM1A 4DF6A 4YFMA 4L0LA 3TG9A 2R9XA 2V1ZA 1GCEA 1U60A 2RCXA 4F94A 4Y0TA 3MKEA 1PYYA 2P9VA 3HLGA 4DE3A 2Y2HA 3N8RA 3SS4A 4KZ9A 3PBOA 3D4FA 3HLCA 1YMSA 3ZGAB 1NZOA 2FFYA 4O7DA 4X69A 4Q8IA 1KE4A 3NCKA 4BENA 2V20A 1QMEA 4JBFA 3S22A 4E3JA 1CK3A 5I94A 2Z2LB 5CXWA 3SH8A 4LV0A 1L0FA 1Q2QA 5HW3A 3ZNYA 2Y2OA 3ZNTA 1JTGA 3G2YA 3Q81A 3IF5A 4KG6A 3Q7VB 4HBTA 1BLHA 1GA9A 2C6WB 5DF7A 5IHVA 1NZUA 3CMZA 3DW0A 3OPLA 2HP9A 3NY4A 5HAPA 1HZOA 3ITAA 3BEBA 2PU2A 1SHVA 3BM6A 3QHYA 2WKIA 1PI4A 4S2OA 4U0XA 1MY8A 3OCLA 5CEBA 3HLDA 1LI9A 4H8RA 1KGFA 3C4PA 2WAEA 1CI9A 4DXBA 2Y2PA 4RA7A 5DTTA 1FCOA 1RGZA 2JE5A 4WEKA 4Y0OA 1L0DA 4UA9A 4E3NA 3BFFA 3VP3A 2J9PA 1ESUA 1ALQA 2ZC4B 4WEJA 5HL1A 2XR0A 4WZ5C 2ZJ9A 4E6XA 4JLFA 4Y0UA 5JYOA 2QZ6A 4P87A 5HAIA 2Y2KA 1JWVA 4N9KA 1FQGA 3ITBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ9 A;  1JWP A;  4WM9 A;  5DTK A;  5KSH A;  4UHU A;  3FYZ A;  5E43 A;  4GN2 A;  3ZG7 B;  3HBR A;  3HLB A;  2J9O A;  5HFO A;  4MBK A;  3VP4 A;  4RVA A;  1YLJ A;  4JXW A;  3NIA A;  4KZB A;  1PW1 A;  1ES2 A;  3GTC A;  1FSY A;  4JF4 A;  4K0W A;  3HLE A;  3PBS A;  2OV5 A;  3UDF A;  1K56 A;  3UNW A;  4ID4 A;  2Y2N A;  3G35 A;  3OPH A;  4PM9 A;  4X68 A;  1JVJ A;  3E2L A;  1YLZ A;  4X56 A;  4E6W A;  5CGW A;  3PBT A;  3GR2 A;  4S2P A;  4DE1 A;  4WMC D;  1YLT A;  1MKI A;  3HLF A;  3DWZ A;  4OPY A;  4OVD A;  2Y2J A;  2XQZ A;  1YMX A;  2X02 A;  4GOG A;  1ONG A;  1W79 A;  3MKF A;  2H0T A;  1DY6 A;  3P09 A;  3WS5 A;  4RX2 A;  5BOH A;  1W7F A;  4HBU A;  2ZC3 B;  3VP2 A;  4E3K A;  5A90 A;  1YLW A;  3NBL A;  1XX2 A;  5CHJ A;  3PAG A;  1G6A A;  2HDQ A;  3WWX A;  1CI8 A;  5EVI A;  3W4Q A;  2GDN A;  4PM6 A;  1IKI A;  3BRM A;  3CZD A;  3SS3 A;  3C4O A;  3A3I A;  5FQI A;  2Q9M A;  2Y59 A;  3PTE A;  4WYY A;  1JWZ A;  1SKF A;  1I2W A;  1NYM A;  3IH9 A;  5FAS A;  5FDH A;  3ZHH A;  1IEM A;  4IBR A;  5CGX A;  3LEZ A;  4LV2 A;  1IYQ A;  5E2F A;  4X6T A;  5A91 A;  1BLS A;  3ZG5 A;  5L2F A;  3IWQ A;  5GLB A;  2ZQA A;  4R4R A;  1CEG A;  2P9V B;  3ZFZ A;  4PM7 A;  4JF5 A;  4OPQ A;  4XUX A;  1K38 A;  5E2E A;  3UE1 A;  4GDN A;  3A3F A;  3SS5 A;  4E3O A;  3LO7 A;  4FH4 A;  4JXS A;  1KGE A;  3PBR A;  1KDW A;  2HDU A;  3HUN A;  1PZO A;  3AGD A;  3W8K A;  5CHM A;  2EX6 A;  1XGJ A;  2ZQ8 A;  3CG5 A;  3HLW A;  1W8Q A;  2VGK A;  5AQ7 A;  1L0G A;  1PWG A;  1TDL A;  5E2H A;  4S2I A;  2ZQC A;  2EXB A;  4S2K A;  5EOO A;  4R3J A;  2ZM8 A;  1KGG A;  3MBZ A;  1DJB A;  4GDB A;  2P74 A;  4BLM A;  2Y2L A;  4DXC A;  2EFU A;  1ZG4 A;  4P85 A;  1XP4 A;  5EVL A;  5G18 A;  3V50 A;  2B5R A;  4KZ7 A;  5GL9 A;  2V2F F;  1W8Y A;  3MZF A;  3QNB A;  3OPR A;  1K57 C;  1S0W A;  2X71 A;  3IF6 A;  4GNU A;  4LCL A;  4QJG A;  3OPP A;  1KE3 A;  5A93 A;  3UN7 A;  1MPL A;  1MBL A;  2EX9 A;  3G30 A;  4PPR A;  3ISG A;  3IWO A;  2FFF B;  4LEN A;  1IKG A;  5FA7 A;  3BFE A;  3N8S A;  4UA7 A;  1SDN A;  4GB7 A;  1ES4 A;  3VP0 A;  1TVF A;  1MWT A;  3A3D A;  3ZVW A;  5HAR A;  1TDG A;  1BTL A;  4MEZ A;  3O86 A;  4OQH A;  5D3O A;  1EI5 A;  4MBF A;  2ZC5 B;  3MZD A;  1OME A;  4KG2 A;  4QY6 A;  3GRJ A;  4R3B A;  3HVF A;  1GA0 A;  3NC8 A;  3HUO A;  5HAQ A;  4JXV A;  3Q1F A;  3AGF A;  3C7V A;  3MXS A;  2E8I A;  2EX8 A;  1PW8 A;  1NYY A;  3FWL A;  4N1H A;  1IEL A;  3FKW A;  1HD8 A;  4PMA A;  4DKI A;  4B4X A;  1H5X A;  1FR6 A;  4QU3 A;  5EVI C;  1Z6F A;  1K55 A;  2Y2I A;  1BLP A;  1FR1 A;  2JBF A;  4KZA A;  4Y7P A;  2ZQD A;  3G31 A;  4IBX A;  2ZQ9 A;  2I72 A;  2Q9N A;  2EX2 A;  5GLD A;  1M6K A;  1K25 A;  2WZX A;  3IH8 A;  3WRT A;  1ONH A;  4K91 A;  3IT9 A;  1K6S A;  5EOE A;  4OP5 A;  5FAT A;  5TR7 A;  1XA7 A;  3GQZ A;  4WZ4 A;  3A3J A;  1S6R A;  5EEC A;  2XDM A;  4GKU A;  4KZ6 A;  3Q82 A;  5F83 A;  4HEF A;  4KZ4 A;  3MXR A;  1K4E A;  3NDE A;  1BUE A;  5FQK A;  3Q7V A;  4UAA A;  3UDX A;  2XK1 A;  5FQM A;  1TEM A;  2OLV A;  4IED A;  3MFD A;  2QMI A;  4OLG A;  2HP6 A;  2Y55 A;  1HVB A;  2ZM0 A;  4WMC A;  2Y91 A;  3DTM A;  4S2M A;  3IXB A;  4N9L A;  2JC7 A;  2WUQ A;  2EFX A;  3VSL A;  5EVI B;  2ZQ7 A;  3OC2 A;  4R0Q A;  2HPB A;  2J7V A;  3ZDJ A;  2DCF A;  4S2J A;  2WKE A;  1L2S A;  3FZC A;  2XFS A;  4EBP A;  1ZG6 A;  4MLL A;  3IF6 C;  3UPN A;  3ZG9 B;  5AQB A;  2XD1 A;  3I7J A;  3WS1 A;  4UA6 A;  3G4P A;  2CC1 A;  3G34 A;  5FI2 A;  4S2N A;  1FOF A;  4C3Q A;  3VOY A;  2WGV A;  5GLC A;  5EUA A;  2QPN A;  1GHI A;  2WAD A;  3HRE A;  5FSR A;  4ZJ3 A;  3A3E A;  4MBH A;  2Y2Q A;  4FSF A;  4OQ0 A;  4U0T A;  1E3U D;  2Z2M B;  5CGS A;  1XPB A;  3S4X A;  4PM5 A;  2ZLY A;  3W4O A;  4BL2 A;  5F1F A;  1O07 A;  3N8L A;  5DF8 A;  2ZC6 B;  3UY6 A;  2BG1 A;  2Y2G A;  1KE0 A;  5FAP A;  3IXG A;  4JF6 A;  1H8Z A;  1N4O A;  5FI6 A;  1JTD A;  4LCM A;  3C7U A;  3VSK A;  4IVI A;  4ZDX A;  5EPH A;  4YIN A;  3LY4 A;  2WGW A;  2ZC7 A;  2ZD8 A;  2HDS A;  1W5D A;  5CHU A;  4BD0 A;  3VOZ A;  2WK0 A;  4DE2 A;  1BSG A;  5HX9 A;  1ERQ A;  3NDG A;  2A3U A;  1ES5 A;  2UWX A;  3BFD A;  3GMW A;  4P0M A;  1DJC A;  1K55 C;  2XH9 A;  3CJM A;  1LL5 A;  3G2Z A;  4PM8 A;  3LY3 A;  3WS2 A;  3ZG0 A;  5FAO A;  3UDI A;  3IF6 B;  4E3L A;  4A5R A;  3O87 A;  4GD8 A;  4OOL A;  4X53 A;  5EVI D;  2WZZ A;  4ZJ2 A;  1FSW A;  1K54 A;  4S2L A;  3EQV A;  4R23 A;  3V3S A;  2WGI A;  1KVL A;  3BEC A;  4BD1 A;  4ZAM A;  4U3T A;  4FH2 A;  4RYE A;  3VMA A;  4EUZ A;  4DDS A;  5DVA A;  1SDE A;  3BLS A;  2XFT A;  3PBN A;  5DF9 A;  4OQG A;  5KMW A;  3C5A A;  1RP5 A;  1GHP A;  1MWR A;  1BZA A;  1KVM A;  1BT5 A;  4XXR A;  2OLU A;  4OOY A;  3M6H A;  3RJU A;  1ERM A;  5AQA A;  1WYC A;  3FKV A;  4WEL A;  3UPP A;  3OCN A;  3W4P A;  1IYP A;  3GSG A;  2H0Y A;  3VFF A;  1NY0 A;  3MZE A;  3IQA A;  4CPK A;  5DTS A;  4OPR A;  3GVB A;  4KQQ A;  3JYI A;  1LLB A;  4MNR A;  1CEF A;  2WAF A;  3BYD A;  3UO9 A;  2XD5 A;  3PAE A;  5FQJ A;  1WYB A;  4OH0 A;  1E4D A;  3N4I A;  1NRF A;  3ZG8 B;  2Y4A A;  1MXO A;  5A92 A;  5M19 A;  3UPO A;  1YLY A;  2XF3 A;  4S2N C;  2HP5 A;  5FQQ A;  5FAQ A;  4EWF A;  5M18 A;  1Q2P A;  3M6B A;  2R9W A;  1ERO A;  5M1A A;  4ZJ1 A;  4KEN B;  2VGJ A;  4EBN A;  4NET A;  4QHC A;  1HTZ A;  1K4F A;  4OKP A;  1PZP A;  5CTM A;  5CRF A;  3M2K A;  1O7E A;  2PBY A;  1DJA A;  4KQO A;  2C5W B;  4KZ3 A;  5FQ9 A;  1IYO A;  3AGE A;  4OPZ A;  3EQU A;  2Y2M A;  3BFG A;  5F82 A;  3ZCZ A;  3TOI A;  1FCN A;  4OOM A;  1RGY A;  4OON A;  1L0E A;  4XUZ A;  1ZKJ A;  1PWC A;  3V5M A;  2G2W A;  3IHA A;  3OZH A;  3V39 A;  3IXD A;  4N1X A;  3HUM A;  4BQM A;  2OSU A;  4M3K A;  4D2O A;  1KDS A;  3S1Y A;  4WBG A;  3IWI A;  1H8Y A;  2A49 A;  2JCH A;  3PBQ A;  3RXX A;  3SH9 A;  3VP1 A;  1QMF A;  4EBL A;  4RX3 A;  4EQI A;  5CEC A;  1XA1 A;  2BLS A;  1K54 C;  3UE3 A;  3TSG A;  3N6I A;  1WE4 A;  5U47 A;  4JXG A;  1MWS A;  1XGI A;  2PU4 A;  1YT4 A;  5GHY A;  1ES3 A;  3SOI A;  4B4Z A;  1LI0 A;  2G2U A;  5FI7 A;  2HDR A;  4BJP A;  1YLP A;  3WRZ A;  4QD4 A;  3FV7 A;  2RL3 A;  5GLA A;  1BUL A;  1K57 A;  3Q7Z A;  1AXB A;  4ZBE A;  4B88 A;  2EXA A;  5TGF A;  4BL3 A;  1LHY A;  2XGN A;  2WKH A;  1E3U A;  4FD8 A;  3ZVT A;  1PI5 A;  5F1G A;  1EWZ A;  4Z9Q A;  3BFC A;  1C3B A;  1I5Q A;  2WGW B;  4P6B A;  4N92 A;  3O88 A;  5TFQ A;  1ESI A;  1PWD A;  3WS0 A;  4KZ5 A;  4R4S A;  4EV4 A;  4KG5 A;  3RXW A;  4GD6 A;  4OLD A;  4LV1 A;  1Y54 A;  4DE0 A;  1RCJ A;  1K56 D;  1ZC2 A;  2DRW A;  3M2J A;  2ZM2 A;  3BLM A;  3IXH A;  3NI9 A;  5KZH A;  4ZTK A;  1VQQ A;  5GHX A;  3V3R A;  1XKZ A;  1PIO A;  4OP8 A;  4C6Y A;  1J9M A;  1SCW A;  1FCM A;  2XEP A;  1NXY A;  2WYX A;  2H10 A;  2H5S A;  3P98 A;  4X55 A;  1E25 A;  3IHB A;  3Q07 A;  4IVK A;  3QNC A;  4KQR A;  5CER A;  3G32 A;  4OQI A;  2X01 A;  4E3I A;  4FCF A;  4GZB A;  5EE8 A;  1GHM A;  2IWB A;  4QB8 A;  1IYS A;  3DWK A;  5JYP A;  4DRT A;  5CED A;  3SH7 A;  4LV3 A;  2DNS A;  5E2G A;  2IWD A;  1N9B A;  4NK3 A;  1I2S A;  1NJ4 A;  3E2K A;  3N7W A;  4WZ5 A;  3B3X A;  4CJN A;  4DDY A;  3HL9 A;  1BLC A;  5GHZ A;  2J8Y A;  4JKT A;  4K0X A;  4HES A;  4QY5 A;  1YQS A;  4E3M A;  1XXM A;  4C75 A;  2XLN A;  3GV9 A;  2ZMA A;  1VM1 A;  4KZ8 A;  1K6R A;  3O3V A;  1MWU A;  5CTN A;  3WS4 A;  4JPM A;  1G68 A;  3LCE A;  3VFH A;  1M40 A;  5KSC A;  2IWC A;  4R1G A;  3UE0 A;  5J8X A;  1LL9 A;  1YM1 A;  4DF6 A;  4YFM A;  4L0L A;  3TG9 A;  2R9X A;  2V1Z A;  1GCE A;  1U60 A;  2RCX A;  4F94 A;  4Y0T A;  3MKE A;  1PYY A;  2P9V A;  3HLG A;  4DE3 A;  2Y2H A;  3N8R A;  3SS4 A;  4KZ9 A;  3PBO A;  3D4F A;  3HLC A;  1YMS A;  3ZGA B;  1NZO A;  2FFY A;  4O7D A;  4X69 A;  4Q8I A;  1KE4 A;  3NCK A;  4BEN A;  2V20 A;  1QME A;  4JBF A;  3S22 A;  4E3J A;  1CK3 A;  5I94 A;  2Z2L B;  5CXW A;  3SH8 A;  4LV0 A;  1L0F A;  1Q2Q A;  5HW3 A;  3ZNY A;  2Y2O A;  3ZNT A;  1JTG A;  3G2Y A;  3Q81 A;  3IF5 A;  4KG6 A;  3Q7V B;  4HBT A;  1BLH A;  1GA9 A;  2C6W B;  5DF7 A;  5IHV A;  1NZU A;  3CMZ A;  3DW0 A;  3OPL A;  2HP9 A;  3NY4 A;  5HAP A;  1HZO A;  3ITA A;  3BEB A;  2PU2 A;  1SHV A;  3BM6 A;  3QHY A;  2WKI A;  1PI4 A;  4S2O A;  4U0X A;  1MY8 A;  3OCL A;  5CEB A;  3HLD A;  1LI9 A;  4H8R A;  1KGF A;  3C4P A;  2WAE A;  1CI9 A;  4DXB A;  2Y2P A;  4RA7 A;  5DTT A;  1FCO A;  1RGZ A;  2JE5 A;  4WEK A;  4Y0O A;  1L0D A;  4UA9 A;  4E3N A;  3BFF A;  3VP3 A;  2J9P A;  1ESU A;  1ALQ A;  2ZC4 B;  4WEJ A;  5HL1 A;  2XR0 A;  4WZ5 C;  2ZJ9 A;  4E6X A;  4JLF A;  4Y0U A;  5JYO A;  2QZ6 A;  4P87 A;  5HAI A;  2Y2K A;  1JWV A;  4N9K A;  1FQG A;  3ITB A; 
#chains in the Genus database with same CATH topology
 1X0O A;  5TBM B;  5KSH A;  4GN2 A;  4HP4 A;  4R6L A;  5A8B A;  2JKT I;  3VP4 A;  1XJ2 A;  2L4R A;  3QP8 A;  1ES2 A;  3T4S A;  4JF4 A;  3HLE A;  3E2L A;  1YLZ A;  4X56 A;  4JGO A;  3GR2 A;  1YLT A;  1VEU A;  4OVD A;  2X02 A;  1ONG A;  1W79 A;  2H0T A;  3P09 A;  5A90 A;  3VP2 A;  3NBL A;  3PAG A;  1G6A A;  3W4Q A;  2Q9M A;  2VV7 A;  3KYQ A;  4WYY A;  2Z6D A;  3IH9 A;  2QKP A;  1IEM A;  4IBR A;  1IYQ A;  5A91 A;  3IWQ A;  4H6J B;  1CEG A;  3T4L A;  3ZFZ A;  4JF5 A;  4E3O A;  2LB9 A;  1KGE A;  3DTE A;  2EX6 A;  1XGJ A;  2ZQ8 A;  3CG5 A;  1PWG A;  5E2H A;  4MDZ A;  2ZQC A;  4GDB A;  3MBZ A;  2Y2L A;  2EFU A;  3UB9 A;  2FZ0 A;  5G18 A;  3NUL A;  3V50 A;  2OWH A;  3LI8 A;  2V2F F;  1W8Y A;  3MZF A;  3QNB A;  4LCL A;  2X71 A;  4EET B;  1S1Y A;  3UN7 A;  2EX9 A;  3IWO A;  2EWW A;  4LEN A;  3BFE A;  4E04 A;  3ZVW A;  4LFU A;  2VX8 A;  3SW1 A;  2V9A A;  4R3B A;  3PXP A;  5L07 A;  4DN0 A;  2AVX A;  2W1T A;  3EOI A;  1T19 A;  4PMA A;  1PFL A;  3NHQ A;  4P6Z S;  3B47 A;  4KZA A;  4KQD A;  2OAQ 1;  2ZQ9 A;  3RTY A;  4K91 A;  3IT9 A;  2PYP A;  3K3C A;  4OP5 A;  1XA7 A;  4JGR A;  4WZ4 A;  2HJE A;  3MJQ A;  3Q82 A;  3F1N B;  3MXR A;  3NDE A;  5FQK A;  1BUE A;  4G3W A;  3C30 A;  4KUK A;  3MQQ A;  2CMN A;  2ZM0 A;  1V9Z A;  2WUQ A;  3A0S A;  5EVI B;  4NKP A;  2JN7 A;  3OC2 A;  2HPB A;  2J7V A;  3ZG9 B;  5AQB A;  3SZT A;  2XD1 A;  3WS1 A;  4UA6 A;  4B93 A;  2CC1 A;  5FI2 A;  3JVU A;  4GS9 A;  2L1M A;  2QPN A;  1GHI A;  5HPI A;  2O9B A;  2HZ5 A;  1E3U D;  2WKQ A;  1XPB A;  2WKP A;  2ZLY A;  3F1O B;  3LR0 A;  4BMW A;  3UY6 A;  2BG1 A;  1KE0 A;  4FTX A;  5EPH A;  5G4Y A;  2HDS A;  3UE6 A;  1W5D A;  5CHU A;  2VGL S;  3VE3 A;  4HJ4 A;  1ERQ A;  3NDG A;  1UWN X;  3BFD A;  1LL8 A;  4PM8 A;  1Z09 A;  3LY3 A;  2V1A A;  3IF6 B;  3EGD C;  5EVI D;  2WZZ A;  3IBR A;  3IX3 A;  3V3S A;  1T1A A;  1KVL A;  4EER A;  3IS2 A;  4GLQ A;  2O99 A;  1XFQ A;  4FH2 A;  2XFT A;  3FC7 A;  3PBN A;  3NOP C;  3C5A A;  1RP5 A;  1GHP A;  5K5B A;  1BZA A;  3CI6 A;  1KVM A;  1BT5 A;  3MMH A;  4XXR A;  4Q0I A;  1S4R A;  2INW A;  3P01 A;  4YWZ A;  3UB5 P;  3MZE A;  5HWW A;  3GVB A;  3KSG A;  3JYI A;  4MNR A;  1CEF A;  3BYD A;  5FQJ A;  3RFB A;  1WYB A;  3N4I A;  2Y4A A;  5F68 A;  5A92 A;  3UPO A;  4S2N C;  3VV4 A;  5M1A A;  2R9W A;  4L9E A;  2VGJ A;  3KSF A;  3KX0 X;  1O7E A;  1OT9 A;  3AGE A;  2VLG A;  3BFG A;  1FCN A;  5FEG A;  1ZKJ A;  5IU1 A;  3IHA A;  3IXD A;  4N1X A;  4D2O A;  1KDS A;  3F1P A;  5HD5 A;  1LSW A;  2WKR A;  3IWI A;  3RXX A;  2GJ3 A;  4WUJ A;  3SH9 A;  3BW6 A;  2BLS A;  1K54 C;  3TSG A;  4JXG A;  1MWS A;  1XGI A;  2PU4 A;  5GHY A;  4B4Z A;  4WN5 A;  1YLP A;  4QD4 A;  3MR0 A;  3S7P A;  1LHY A;  2XGN A;  4CLC C;  2QHK A;  2WGW B;  4P6B A;  3T12 B;  4R4S A;  4F3L A;  3RXW A;  2VEA A;  4LGW A;  4WLA A;  4DE0 A;  1K56 D;  3IXH A;  4WF0 A;  1VB6 A;  3KSI A;  2H5S A;  3P98 A;  4X55 A;  1E25 A;  3IHB A;  1TF1 A;  4FCF A;  4GZB A;  2KOI A;  1IYS A;  3DWK A;  5JYP A;  5E2G A;  2ZOH A;  4WZ5 A;  3B3X A;  1BLC A;  4JKT A;  5J3W A;  4E3M A;  2ZL1 B;  1XXM A;  1VET A;  1VM1 A;  1D06 A;  3KYE A;  1LL9 A;  3H7W B;  4DF6 A;  4YFM A;  2M7U A;  3TG9 A;  1GCE A;  4FOF A;  3UB7 A;  1P97 A;  3C38 A;  3N8R A;  3SS4 A;  2GX5 A;  3ZGA B;  1LSV A;  4LRX C;  2B02 A;  2FFY A;  3E4Q A;  3NCK A;  2W1R A;  4JBF A;  3S22 A;  4E3J A;  5I94 A;  1OTA A;  5HW3 A;  4EES A;  3ZNY A;  2Y2O A;  3CUE A;  5FDS A;  2UV0 E;  3ZNT A;  3IF5 A;  4KG6 A;  3MFX A;  1GA9 A;  4O01 A;  5DF7 A;  5IHV A;  3CMZ A;  3BEB A;  4GJ4 A;  1SHV A;  3H82 B;  5JYO A;  1PI4 A;  4U0X A;  3E0Y A;  4LPZ A;  3BJN A;  3LYX A;  2L0W A;  3C4P A;  2WAE A;  2VJW A;  1CI9 A;  3K2N A;  4RA7 A;  4UQI S;  1FCO A;  2GZA A;  2JE5 A;  4WEK A;  4Y0O A;  4WEJ A;  3NEC A;  4P87 A;  3ITB A;  5DTK A;  4UHU A;  3T1Q B;  3FYZ A;  3HLB A;  2J9O A;  3C8C A;  4RVA A;  3BQ8 A;  1PW1 A;  3UDF A;  1FSY A;  4K0W A;  3UNW A;  3PBS A;  3CPT B;  4ID4 A;  3L7H A;  3TJZ C;  1CJF A;  4E6W A;  5CGW A;  3PBT A;  1JNU A;  4WMC D;  1OTB A;  1N9O A;  3DWZ A;  1XJ6 A;  1YMX A;  2XQZ A;  1SKO B;  1DY6 A;  1XX2 A;  4YOF A;  3CZD A;  3SS3 A;  3C4O A;  3A3I A;  5FQI A;  4EUV A;  1JWZ A;  3T4Q A;  1I2W A;  3ZHH A;  4LV2 A;  3QP1 A;  5GLB A;  2JKT M;  2P9V B;  2K2N A;  4PM7 A;  4OPQ A;  1K38 A;  3JPU A;  4JXS A;  1UGU A;  1T1C A;  5EM0 A;  1CQA A;  1PZO A;  3AGD A;  4CQH A;  3HLW A;  5AQ7 A;  1W8Q A;  1G6O A;  4D60 A;  2ZM8 A;  1KGG A;  3EWK A;  1ZG4 A;  1Y4O A;  1XP4 A;  5EVL A;  4Q0J A;  1PNE A;  4KZ7 A;  1NWZ A;  4O8G A;  4GNU A;  1K57 C;  3OPP A;  1MBL A;  3NOT C;  4I38 A;  1ES4 A;  3VP0 A;  3D72 A;  1MWT A;  4BBU A;  4EQ1 A;  5HAR A;  1TDG A;  1G5U A;  4OQH A;  3MQO A;  1EI5 A;  4MBF A;  2ZC5 B;  3MZD A;  3LIB A;  3GRJ A;  3HVF A;  4R3A A;  4BWI A;  3TRC A;  4JXV A;  3Q1F A;  3C7V A;  2XRN A;  1FIL A;  4I3J A;  5EM1 A;  3FWL A;  4DKI A;  1H5X A;  5EVI C;  2E8J A;  1Z6F A;  5HD3 A;  3G31 A;  2I72 A;  2Q9N A;  2EX2 A;  4HH2 A;  3IH8 A;  1K6S A;  3GQZ A;  5EEC A;  2XDM A;  5F83 A;  4KZ4 A;  1H3Q A;  4ETX A;  3UDX A;  1F5M A;  1TEM A;  2OLV A;  1VEU B;  3FPW A;  3BQA A;  2QMI A;  4OLG A;  1T18 A;  3DTM A;  2PT7 A;  3IXB A;  3R7W A;  3ZDJ A;  1L2S A;  2XFS A;  3T4K A;  4EBP A;  2PAV P;  3IF6 C;  3I7J A;  4Z1W A;  5GLC A;  2WAD A;  2HF6 A;  3HRE A;  3A3E A;  2Y2Q A;  4OQ0 A;  5CGS A;  5TBM A;  3W4O A;  4BL2 A;  1O07 A;  3N8L A;  5DF8 A;  1OTE A;  1S1Z A;  5EVE A;  4JF6 A;  1H8Z A;  1N4O A;  2JHE A;  3C7U A;  4LCM A;  4IVI A;  4PKY A;  3T1R A;  3VSK A;  2ZC7 A;  4DE2 A;  2A3U A;  3WS2 A;  1DJC A;  1K55 C;  2M7V A;  5FAO A;  4E3L A;  2JKF A;  4JGP A;  3EQV A;  4R23 A;  2WGI A;  1ODV A;  2ZOI A;  5DVA A;  1TS8 A;  3BLS A;  3QP5 A;  4OQG A;  5KMW A;  4HHD A;  1MKM A;  1MWR A;  1A0K A;  2OLU A;  5AQA A;  4EU0 A;  3W4P A;  1TD5 A;  3GSG A;  3VFF A;  4H6J A;  2W1T B;  5DKL A;  1LLB A;  2JKG A;  2WAF A;  3UO9 A;  1DP8 A;  3E98 A;  1F2K A;  4MN5 A;  1YLY A;  2HP5 A;  5FQQ A;  1Q2P A;  1ERO A;  2KLI A;  1XJ3 A;  4NET A;  5L09 A;  1HTZ A;  3R4K A;  3DAV A;  3T4J A;  5CTM A;  5CRF A;  3M2K A;  1BYW A;  4KQO A;  5FQ9 A;  4HI4 A;  4OPZ A;  3EQU A;  2Y2M A;  5F82 A;  1F9I A;  4OOM A;  1RGY A;  1DRM A;  3C2W A;  2NUP C;  3OZH A;  5HDD A;  1H8Y A;  2A49 A;  2JCH A;  3LID A;  3PBQ A;  3UME A;  5CEC A;  4FUW A;  4GS9 B;  1WE4 A;  2W3H A;  1OTD A;  4Q0H A;  1L3L A;  2OWJ A;  2HDR A;  5KIZ A;  4R70 A;  4BJP A;  2VZW A;  1T1B A;  1BUL A;  1K57 A;  3Q7Z A;  2EXA A;  5TGF A;  4QPR A;  1WA9 A;  1E3U A;  2I9V A;  1PI5 A;  1PRQ A;  4Z9Q A;  5HPF A;  3MQ0 A;  4YNR A;  4AFI A;  3F1N A;  3WS0 A;  2Z6C A;  1JWV A;  5EV0 A;  4GD6 A;  4OLD A;  4K08 A;  3LIC A;  2ZM2 A;  3BLM A;  5KZH A;  1VQQ A;  1XKZ A;  1PIO A;  4OP8 A;  2VV8 A;  4NXG A;  3IS2 B;  2H10 A;  3Q07 A;  3G32 A;  4OQI A;  1ACF A;  1GHM A;  4QB8 A;  2IWD A;  2W3F A;  1NJ4 A;  3E2K A;  3N7W A;  3PR6 A;  4DDY A;  1HLU P;  3A0V A;  2BTF P;  4DJ2 A;  2XLN A;  4NXE A;  1YSP A;  1ZTU A;  1G68 A;  2IWC A;  1MZU A;  2R9X A;  4MN7 A;  3BWL A;  1OT6 A;  3MKE A;  3EEH A;  3HLG A;  4ARZ B;  4DE3 A;  4JGQ A;  3D4F A;  1S4S A;  1YMS A;  3ICY A;  4X69 A;  1KE4 A;  4G3V A;  2Z2L B;  1IOU A;  5FL3 A;  3LUQ A;  1L0F A;  3EGX C;  3LR5 A;  1JTG A;  2V1B A;  1OJ5 A;  3V67 A;  3Q7V B;  4HBT A;  3F1P B;  3OLO A;  2C6W B;  3DW0 A;  3OPL A;  2HP9 A;  3NY4 A;  5HAP A;  1S66 L;  3TE8 A;  5F6A A;  5F5Y A;  2PU2 A;  3QHY A;  3MXQ A;  5HWV A;  1LI9 A;  1EW0 A;  4DXB A;  4UA9 A;  3BFF A;  5F69 A;  3VE4 A;  2ZJ9 A;  4E6X A;  1XFN A;  2QZ6 A;  2Y2K A;  1N9L A;  4NXF A;  1JWP A;  4F3L B;  2V0W A;  5E43 A;  2O0Y A;  3ZG7 B;  4HIA A;  1AWI A;  2R78 A;  5HFO A;  4MBK A;  1YLJ A;  2QYB A;  3NIA A;  1K56 A;  2Y2N A;  5IT5 A;  4PM9 A;  4X68 A;  1N9N A;  1F98 A;  1ZHH B;  3NJA A;  3GEC A;  3LFV A;  4DE1 A;  1MKI A;  4GCZ A;  4OPY A;  4GOG A;  3MKF A;  3WS5 A;  3CIT A;  4E3K A;  5CHJ A;  3WWX A;  2PHY A;  3BRM A;  3DTI A;  2Y59 A;  1Y28 A;  3QP6 A;  1IFQ A;  1SKF A;  3LGO A;  2Q0O A;  5E2F A;  4X6T A;  3ZG5 A;  5L2F A;  3KYZ A;  2NUT C;  2ZQA A;  4L9G A;  4X1M A;  5E2E A;  4HY8 A;  3UE1 A;  4WL9 A;  4GDN A;  3SS5 A;  5DJT A;  4FH4 A;  2ZMV A;  3PBR A;  1KDW A;  2HDU A;  3HUN A;  3W8K A;  2O9A A;  5HDS A;  5EOO A;  2EXB A;  4S2K A;  5HZH A;  4R3J A;  1DJB A;  2P74 A;  4DXC A;  3LIE A;  2PDR A;  1NRJ A;  2YKF A;  4P85 A;  3UB8 A;  3D9Y A;  3PYP A;  1NLZ A;  3OPR A;  1S0W A;  4QJG A;  3HJI A;  5A93 A;  1MPL A;  4ESP A;  2FFF B;  2QWS A;  5FA7 A;  3N8S A;  4UA7 A;  4GB7 A;  1TVF A;  3A3D A;  2PRF A;  5D3O A;  4LLO B;  5AJG A;  1OME A;  5AVE A;  1GA0 A;  3NC8 A;  5HAQ A;  1LSX A;  1NYY A;  3QP2 A;  1IEL A;  3FKW A;  4B4X A;  3P7N A;  1FR6 A;  1FR1 A;  5HL6 A;  3U4L P;  1H0M A;  2ZQD A;  1K25 A;  2D01 A;  1ONH A;  2HV1 A;  2YKH A;  5TR7 A;  1P9W A;  2V0U A;  1S6R A;  1KOU A;  2PR6 A;  5FQM A;  3T50 A;  2HP6 A;  4EEP A;  3H82 A;  4WMC A;  4S2M A;  4N9L A;  5AVF A;  1TS0 A;  4S2J A;  3MSH A;  4MLL A;  3CLO A;  3G34 A;  4S2N A;  4I39 A;  3VOY A;  2WGV A;  5EUA A;  4I5S A;  4ZJ3 A;  1H8M A;  4FSF A;  4UQI M;  5HSQ A;  2Z2M B;  2JKR M;  3E4O A;  2ZC6 B;  4EW7 A;  5FAP A;  5J7E A;  4PAU A;  5FI6 A;  1JTD A;  1DP6 A;  2XA7 M;  4YIN A;  2ZD8 A;  3VOZ A;  2WK0 A;  3CPT A;  1ES5 A;  1UWP X;  3GMW A;  4ETZ A;  3G2Z A;  3CJM A;  3ZG0 A;  2P08 A;  4I3A A;  1XJ4 A;  4A5R A;  4I3I A;  4GD8 A;  4X53 A;  3VOL A;  4ZJ2 A;  1FSW A;  1K54 A;  1OPX A;  2A24 A;  4NG2 A;  1GSX A;  4EUZ A;  1P0Z A;  4HJ6 A;  5DF9 A;  4Y3I A;  4CLC A;  4OOY A;  3RJU A;  3LI9 A;  1WYC A;  3FKV A;  4WEL A;  3UPP A;  1NY0 A;  3IQA A;  4CPK A;  5DTS A;  4OPR A;  2MJ6 A;  4GHI B;  4KQQ A;  5EFW A;  1YAX A;  2XD5 A;  3PAE A;  1STZ A;  3L9K A;  1DP9 A;  1NRF A;  3IBJ A;  1MXO A;  3T4T A;  3CHW P;  4QWO A;  2XF3 A;  4KUO A;  5L10 A;  5FAQ A;  5M18 A;  4KEN B;  4EBN A;  4QHC A;  1K4F A;  4II7 A;  4OKP A;  4XT2 A;  1PZP A;  2K7S A;  5IS1 A;  2PBY A;  1DJA A;  3UMD A;  3MS6 A;  3A0R A;  1IYO A;  2Y8H A;  2JKR I;  4Y2F A;  3ZCZ A;  2O9C A;  3TOI A;  1PWC A;  2G2W A;  3V39 A;  4IHQ A;  4BQM A;  2OSU A;  3R7W B;  3S1Y A;  4WBG A;  4EEU A;  4BBT A;  4IJG A;  1QMF A;  4Y13 A;  4RX3 A;  5MC7 A;  4MN6 A;  3UE3 A;  2VV6 A;  1P9R A;  3N6I A;  5U47 A;  5C5K A;  1YT4 A;  3SOI A;  1LI0 A;  2G2U A;  2P7J A;  3WRZ A;  2RL3 A;  1AXB A;  4BL3 A;  2WKH A;  4R38 A;  4FD8 A;  3ZVT A;  3LIF A;  1NLY A;  3ZQ5 A;  3BFC A;  1C3B A;  1I5Q A;  1V9Y A;  5TFQ A;  1ESI A;  4DJ3 A;  4KZ5 A;  4O0P A;  4KG5 A;  3LEQ A;  3W2Z A;  1Y54 A;  3NI9 A;  1J3W A;  2PD8 A;  5I5L A;  3V3R A;  2XEP A;  4Y7P A;  1CF0 A;  1NXY A;  2WYX A;  3SH7 A;  4KQR A;  3QNC A;  5DKK A;  4HOI A;  4DRT A;  5CED A;  4LV3 A;  2DNS A;  1N9B A;  1I2S A;  4CJN A;  2W3D A;  4HES A;  2LB5 A;  1YQS A;  4C75 A;  3KO6 A;  1K6R A;  2EA9 A;  1MWU A;  5CTN A;  3WS4 A;  3LCE A;  5HWT A;  1M40 A;  5KSC A;  4R1G A;  3UE0 A;  5J8X A;  1YM1 A;  2PD7 A;  4L0L A;  2V1Z A;  2QJ7 A;  2ZMF A;  1OJG A;  3OOV A;  1OTI A;  3PBO A;  3HLC A;  5CXW A;  3SH8 A;  3UB6 A;  4LV0 A;  1Q2Q A;  2VK3 A;  1BLH A;  2Y79 A;  5HDC A;  1NZU A;  3G6O A;  1HZO A;  3ITA A;  4S2O A;  3BM6 A;  2WKI A;  3GDI A;  5CEB A;  3OCL A;  4L9F A;  5LBR A;  3B42 A;  5DTT A;  1RGZ A;  1L0D A;  3VP3 A;  1ESU A;  1W63 M;  1YKD A;  5HL1 A;  2XR0 A;  4WZ5 C;  3RH8 B;  4JLF A;  4Y0U A;  2G7U A;  1FQG A;  5AQ9 A;  2J3T D;  4WM9 A;  2PYR A;  3HBR A;  4JXW A;  4KZB A;  3GTC A;  2OV5 A;  3BY9 A;  4P6Z M;  5J4E A;  3G35 A;  3OPH A;  1JVJ A;  4ME4 A;  3ULF A;  4S2P A;  3HLF A;  2VA0 A;  2Y2J A;  5FEF A;  4RX2 A;  5BOH A;  1W7F A;  4HBU A;  2ZC3 B;  1YLW A;  2HDQ A;  1CI8 A;  5EVI A;  2GDN A;  3LR3 A;  1IKI A;  4PM6 A;  3CUE C;  3PTE A;  2B18 A;  1NYM A;  5FAS A;  5FDH A;  5CGX A;  3LEZ A;  1VHM A;  1BLS A;  2B95 A;  2IA2 A;  4R4R A;  4XUX A;  4MMN A;  3A3F A;  3LO7 A;  3F1O A;  5CHM A;  1L0G A;  2VGK A;  4G3K A;  1TDL A;  3IX4 A;  4S2I A;  1SZV A;  4BLM A;  4HP9 A;  3B33 A;  2B5R A;  5GL9 A;  3IF6 A;  1KE3 A;  4LRZ E;  3G30 A;  4PPR A;  3ISG A;  2VGL M;  2EWV A;  1IKG A;  2HGV A;  1SDN A;  4MEZ A;  3O86 A;  2BAS A;  2GNX A;  4KG2 A;  4QY6 A;  3LIA A;  3EEA A;  3HUO A;  3AGF A;  3MXS A;  2ACG A;  2E8I A;  2EX8 A;  1PW8 A;  4N1H A;  4ARZ A;  3E4P A;  1HD8 A;  2ZBB A;  2P04 A;  2W3E A;  4QU3 A;  1K55 A;  2Y2I A;  1BLP A;  2JBF A;  1W63 Q;  4IBX A;  2V8F A;  5GLD A;  1M6K A;  2WZX A;  4LRY C;  3WRT A;  5DJU A;  3CWF A;  5EOE A;  5FAT A;  4PKY G;  3A3J A;  4GKU A;  1G28 A;  4KZ6 A;  4HEF A;  4HJ3 A;  1K4E A;  3Q7V A;  2W27 A;  4UAA A;  5G4Z A;  2XK1 A;  4IED A;  1TS6 A;  3MFD A;  2Y55 A;  3H9W A;  1MC0 A;  3BY8 A;  3PHY A;  1HVB A;  4X1L A;  2Y91 A;  2JC7 A;  3VSL A;  2EFX A;  2ZQ7 A;  4R0Q A;  4MCW A;  2DCF A;  2WKE A;  3FZC A;  1ZG6 A;  3UPN A;  2V8C A;  3G4P A;  4Y15 A;  4X25 A;  1FOF A;  4C3Q A;  2H28 A;  5FSR A;  1VET B;  4MBH A;  4U0T A;  3S4X A;  4PM5 A;  5F1F A;  1GSV A;  2OOL A;  4EXO A;  2DMW A;  2Y2G A;  5DFX A;  3IXG A;  4ZDX A;  3LY4 A;  2WGW A;  1BSG A;  4Y5F A;  5HX9 A;  2D02 A;  2UWX A;  2OAP 1;  4P0M A;  2XH9 A;  1LL5 A;  3JVV A;  3UDI A;  3HJK A;  3O87 A;  4OOL A;  4BBV A;  4S2L A;  2QJ5 A;  3BEC A;  4BD1 A;  4ZAM A;  4U3T A;  4RYE A;  3VMA A;  4DDS A;  1SDE A;  4NXB A;  2J80 A;  1YPR A;  4ZRR A;  3M6H A;  1ERM A;  4RQ9 A;  3D3O A;  3OCN A;  1IYP A;  1D1J A;  2H0Y A;  2ZL1 A;  3MF0 A;  2W0N A;  3T1S A;  3H7W A;  3O5Y A;  4OH0 A;  1E4D A;  3ZG8 B;  3QP4 A;  5M19 A;  4EWF A;  3M6B A;  4ZJ1 A;  3KSH A;  3K3D A;  4UEY A;  2C5W B;  4KZ3 A;  4PHT A;  5DFY A;  4OON A;  4IUH A;  1L0E A;  4XUZ A;  3V5M A;  3FG8 A;  3HUM A;  4M3K A;  3VP1 A;  3T1X A;  4EBL A;  1GSW A;  4EQI A;  2XSS A;  1XA1 A;  2PBD P;  2XA7 S;  2PR5 A;  1ES3 A;  5FI7 A;  2FH5 A;  3FV7 A;  5GLA A;  4ZBE A;  4B88 A;  3U2A A;  3DBA A;  5F1G A;  1EWZ A;  2KX6 A;  4CLC E;  4N92 A;  3O88 A;  1PWD A;  1TS7 A;  4EV4 A;  2VKS A;  4LV1 A;  3S7O A;  1RCJ A;  3S7Q A;  1ZC2 A;  2DRW A;  3M2J A;  3S7N A;  4ZTK A;  2W3G A;  5GHX A;  2A2L A;  4C6Y A;  1J9M A;  1SCW A;  1FCM A;  2A24 B;  4BD0 A;  5CER A;  2X01 A;  4IVK A;  4HH3 A;  4E3I A;  5EE8 A;  4GW9 A;  4NEE D;  2IWB A;  1K0K A;  2XRO A;  4M4X A;  3ZYT A;  4NK3 A;  4CLC B;  3HL9 A;  1SKO A;  5GHZ A;  2J8Y A;  2J3T C;  4K0X A;  4QY5 A;  2K31 A;  5TJJ A;  3OBF A;  3GV9 A;  2ZMA A;  3DTK A;  4KZ8 A;  3O3V A;  4B9O A;  5L8M A;  4JPM A;  3VFH A;  3CAX A;  4DMZ A;  1U60 A;  2RCX A;  4F94 A;  4Y0T A;  3IX8 A;  1PYY A;  2P9V A;  2Y2H A;  4KZ9 A;  3HCY A;  1NZO A;  1D7E A;  4XT2 B;  4O7D A;  4Q8I A;  4BEN A;  2V20 A;  1QME A;  5CX7 A;  1CK3 A;  2M1C A;  4HNB A;  4CLC D;  3Q81 A;  3G2Y A;  3TW8 A;  1LT0 A;  2KDK A;  1YSQ A;  4IUK A;  1MY8 A;  3HLD A;  4GHI A;  4H8R A;  1KGF A;  4HQA A;  2Y2P A;  1FIK A;  4E3N A;  3FPV A;  2J9P A;  1ALQ A;  1S67 L;  2ZC4 B;  2J3W A;  4Y17 A;  3LR4 A;  2HJ9 C;  5HAI A;  1BTL A;  4N9K A;  3T4O A;  3NOU C; 
#chains in the Genus database with same CATH homology
 5AQ9 A;  1JWP A;  4WM9 A;  5DTK A;  5KSH A;  4UHU A;  3FYZ A;  5E43 A;  4GN2 A;  3ZG7 B;  3HBR A;  3HLB A;  2J9O A;  5HFO A;  4MBK A;  3VP4 A;  4RVA A;  1YLJ A;  4JXW A;  3NIA A;  4KZB A;  1PW1 A;  1ES2 A;  3GTC A;  1FSY A;  4JF4 A;  4K0W A;  3HLE A;  3PBS A;  2OV5 A;  3UDF A;  1K56 A;  3UNW A;  4ID4 A;  2Y2N A;  3G35 A;  3OPH A;  4PM9 A;  4X68 A;  1JVJ A;  3E2L A;  1YLZ A;  4X56 A;  4E6W A;  5CGW A;  3PBT A;  3GR2 A;  4S2P A;  4DE1 A;  4WMC D;  1YLT A;  1MKI A;  3HLF A;  3DWZ A;  4OPY A;  4OVD A;  2Y2J A;  2XQZ A;  1YMX A;  2X02 A;  4GOG A;  1ONG A;  1W79 A;  3MKF A;  2H0T A;  1DY6 A;  3P09 A;  3WS5 A;  4RX2 A;  5BOH A;  1W7F A;  4HBU A;  2ZC3 B;  3VP2 A;  4E3K A;  5A90 A;  1YLW A;  3NBL A;  1XX2 A;  5CHJ A;  3PAG A;  1G6A A;  2HDQ A;  3WWX A;  1CI8 A;  5EVI A;  3W4Q A;  2GDN A;  4PM6 A;  1IKI A;  3BRM A;  3CZD A;  3SS3 A;  3C4O A;  3A3I A;  5FQI A;  2Q9M A;  2Y59 A;  3PTE A;  4WYY A;  1JWZ A;  1SKF A;  1I2W A;  1NYM A;  3IH9 A;  5FAS A;  5FDH A;  3ZHH A;  1IEM A;  4IBR A;  5CGX A;  3LEZ A;  4LV2 A;  1IYQ A;  5E2F A;  4X6T A;  5A91 A;  1BLS A;  3ZG5 A;  5L2F A;  3IWQ A;  5GLB A;  2ZQA A;  4R4R A;  1CEG A;  2P9V B;  3ZFZ A;  4PM7 A;  4JF5 A;  4OPQ A;  4XUX A;  1K38 A;  5E2E A;  3UE1 A;  4GDN A;  3A3F A;  3SS5 A;  4E3O A;  3LO7 A;  4FH4 A;  4JXS A;  1KGE A;  3PBR A;  1KDW A;  2HDU A;  3HUN A;  1PZO A;  3AGD A;  3W8K A;  5CHM A;  2EX6 A;  1XGJ A;  2ZQ8 A;  3CG5 A;  3HLW A;  1W8Q A;  2VGK A;  5AQ7 A;  1L0G A;  1PWG A;  1TDL A;  5E2H A;  4S2I A;  2ZQC A;  2EXB A;  4S2K A;  5EOO A;  4R3J A;  2ZM8 A;  1KGG A;  3MBZ A;  1DJB A;  4GDB A;  2P74 A;  4BLM A;  2Y2L A;  4DXC A;  2EFU A;  1ZG4 A;  4P85 A;  1XP4 A;  5EVL A;  5G18 A;  3V50 A;  2B5R A;  4KZ7 A;  5GL9 A;  2V2F F;  1W8Y A;  3MZF A;  3QNB A;  3OPR A;  1K57 C;  1S0W A;  2X71 A;  3IF6 A;  4GNU A;  4LCL A;  4QJG A;  3OPP A;  1KE3 A;  5A93 A;  3UN7 A;  1MPL A;  1MBL A;  2EX9 A;  3G30 A;  4PPR A;  3ISG A;  3IWO A;  2FFF B;  4LEN A;  1IKG A;  5FA7 A;  3BFE A;  3N8S A;  4UA7 A;  1SDN A;  4GB7 A;  1ES4 A;  3VP0 A;  1TVF A;  1MWT A;  3A3D A;  3ZVW A;  5HAR A;  1TDG A;  1BTL A;  4MEZ A;  3O86 A;  4OQH A;  5D3O A;  1EI5 A;  4MBF A;  2ZC5 B;  3MZD A;  1OME A;  4KG2 A;  4QY6 A;  3GRJ A;  4R3B A;  3HVF A;  1GA0 A;  3NC8 A;  3HUO A;  5HAQ A;  4JXV A;  3Q1F A;  3AGF A;  3C7V A;  3MXS A;  2E8I A;  2EX8 A;  1PW8 A;  1NYY A;  3FWL A;  4N1H A;  1IEL A;  3FKW A;  1HD8 A;  4PMA A;  4DKI A;  4B4X A;  1H5X A;  1FR6 A;  4QU3 A;  5EVI C;  1Z6F A;  1K55 A;  2Y2I A;  1BLP A;  1FR1 A;  2JBF A;  4KZA A;  4Y7P A;  2ZQD A;  3G31 A;  4IBX A;  2ZQ9 A;  2I72 A;  2Q9N A;  2EX2 A;  5GLD A;  1M6K A;  1K25 A;  2WZX A;  3IH8 A;  3WRT A;  1ONH A;  4K91 A;  3IT9 A;  1K6S A;  5EOE A;  4OP5 A;  5FAT A;  5TR7 A;  1XA7 A;  3GQZ A;  4WZ4 A;  3A3J A;  1S6R A;  5EEC A;  2XDM A;  4GKU A;  4KZ6 A;  3Q82 A;  5F83 A;  4HEF A;  4KZ4 A;  3MXR A;  1K4E A;  3NDE A;  1BUE A;  5FQK A;  3Q7V A;  4UAA A;  3UDX A;  2XK1 A;  5FQM A;  1TEM A;  2OLV A;  4IED A;  3MFD A;  2QMI A;  4OLG A;  2HP6 A;  2Y55 A;  1HVB A;  2ZM0 A;  4WMC A;  2Y91 A;  3DTM A;  4S2M A;  3IXB A;  4N9L A;  2JC7 A;  2WUQ A;  2EFX A;  3VSL A;  5EVI B;  2ZQ7 A;  3OC2 A;  4R0Q A;  2HPB A;  2J7V A;  3ZDJ A;  2DCF A;  4S2J A;  2WKE A;  1L2S A;  3FZC A;  2XFS A;  4EBP A;  1ZG6 A;  4MLL A;  3IF6 C;  3UPN A;  3ZG9 B;  5AQB A;  2XD1 A;  3I7J A;  3WS1 A;  4UA6 A;  3G4P A;  2CC1 A;  3G34 A;  5FI2 A;  4S2N A;  1FOF A;  4C3Q A;  3VOY A;  2WGV A;  5GLC A;  5EUA A;  2QPN A;  1GHI A;  2WAD A;  3HRE A;  5FSR A;  4ZJ3 A;  3A3E A;  4MBH A;  2Y2Q A;  4FSF A;  4OQ0 A;  4U0T A;  1E3U D;  2Z2M B;  5CGS A;  1XPB A;  3S4X A;  4PM5 A;  2ZLY A;  3W4O A;  4BL2 A;  5F1F A;  1O07 A;  3N8L A;  5DF8 A;  2ZC6 B;  3UY6 A;  2BG1 A;  2Y2G A;  1KE0 A;  5FAP A;  3IXG A;  4JF6 A;  1H8Z A;  1N4O A;  5FI6 A;  1JTD A;  4LCM A;  3C7U A;  3VSK A;  4IVI A;  4ZDX A;  5EPH A;  4YIN A;  3LY4 A;  2WGW A;  2ZC7 A;  2ZD8 A;  2HDS A;  1W5D A;  5CHU A;  4BD0 A;  3VOZ A;  2WK0 A;  4DE2 A;  1BSG A;  5HX9 A;  1ERQ A;  3NDG A;  2A3U A;  1ES5 A;  2UWX A;  3BFD A;  3GMW A;  4P0M A;  1DJC A;  1K55 C;  2XH9 A;  3CJM A;  1LL5 A;  3G2Z A;  4PM8 A;  3LY3 A;  3WS2 A;  3ZG0 A;  5FAO A;  3UDI A;  3IF6 B;  4E3L A;  4A5R A;  3O87 A;  4GD8 A;  4OOL A;  4X53 A;  5EVI D;  2WZZ A;  4ZJ2 A;  1FSW A;  1K54 A;  4S2L A;  3EQV A;  4R23 A;  3V3S A;  2WGI A;  1KVL A;  3BEC A;  4BD1 A;  4ZAM A;  4U3T A;  4FH2 A;  4RYE A;  3VMA A;  4EUZ A;  4DDS A;  5DVA A;  1SDE A;  3BLS A;  2XFT A;  3PBN A;  5DF9 A;  4OQG A;  5KMW A;  3C5A A;  1RP5 A;  1GHP A;  1MWR A;  1BZA A;  1KVM A;  1BT5 A;  4XXR A;  2OLU A;  4OOY A;  3M6H A;  3RJU A;  1ERM A;  5AQA A;  1WYC A;  3FKV A;  4WEL A;  3UPP A;  3OCN A;  3W4P A;  1IYP A;  3GSG A;  2H0Y A;  3VFF A;  1NY0 A;  3MZE A;  3IQA A;  4CPK A;  5DTS A;  4OPR A;  3GVB A;  4KQQ A;  3JYI A;  1LLB A;  4MNR A;  1CEF A;  2WAF A;  3BYD A;  3UO9 A;  2XD5 A;  3PAE A;  5FQJ A;  1WYB A;  4OH0 A;  1E4D A;  3N4I A;  1NRF A;  3ZG8 B;  2Y4A A;  1MXO A;  5A92 A;  5M19 A;  3UPO A;  1YLY A;  2XF3 A;  4S2N C;  2HP5 A;  5FQQ A;  5FAQ A;  4EWF A;  5M18 A;  1Q2P A;  3M6B A;  2R9W A;  1ERO A;  5M1A A;  4ZJ1 A;  4KEN B;  2VGJ A;  4EBN A;  4NET A;  4QHC A;  1HTZ A;  1K4F A;  4OKP A;  1PZP A;  5CTM A;  5CRF A;  3M2K A;  1O7E A;  2PBY A;  1DJA A;  4KQO A;  2C5W B;  4KZ3 A;  5FQ9 A;  1IYO A;  3AGE A;  4OPZ A;  3EQU A;  2Y2M A;  3BFG A;  5F82 A;  3ZCZ A;  3TOI A;  1FCN A;  4OOM A;  1RGY A;  4OON A;  1L0E A;  4XUZ A;  1ZKJ A;  1PWC A;  3V5M A;  2G2W A;  3IHA A;  3OZH A;  3V39 A;  3IXD A;  4N1X A;  3HUM A;  4BQM A;  2OSU A;  4M3K A;  4D2O A;  1KDS A;  3S1Y A;  4WBG A;  3IWI A;  1H8Y A;  2A49 A;  2JCH A;  3PBQ A;  3RXX A;  3SH9 A;  3VP1 A;  1QMF A;  4EBL A;  4RX3 A;  4EQI A;  5CEC A;  1XA1 A;  2BLS A;  1K54 C;  3UE3 A;  3TSG A;  3N6I A;  1WE4 A;  5U47 A;  4JXG A;  1MWS A;  1XGI A;  2PU4 A;  1YT4 A;  5GHY A;  1ES3 A;  3SOI A;  4B4Z A;  1LI0 A;  2G2U A;  5FI7 A;  2HDR A;  4BJP A;  1YLP A;  3WRZ A;  4QD4 A;  3FV7 A;  2RL3 A;  5GLA A;  1BUL A;  1K57 A;  3Q7Z A;  1AXB A;  4ZBE A;  4B88 A;  2EXA A;  5TGF A;  4BL3 A;  1LHY A;  2XGN A;  2WKH A;  1E3U A;  4FD8 A;  3ZVT A;  1PI5 A;  5F1G A;  1EWZ A;  4Z9Q A;  3BFC A;  1C3B A;  1I5Q A;  2WGW B;  4P6B A;  4N92 A;  3O88 A;  5TFQ A;  1ESI A;  1PWD A;  3WS0 A;  4KZ5 A;  4R4S A;  4EV4 A;  4KG5 A;  3RXW A;  4GD6 A;  4OLD A;  4LV1 A;  1Y54 A;  4DE0 A;  1RCJ A;  1K56 D;  1ZC2 A;  2DRW A;  3M2J A;  2ZM2 A;  3BLM A;  3IXH A;  3NI9 A;  5KZH A;  4ZTK A;  1VQQ A;  5GHX A;  3V3R A;  1XKZ A;  1PIO A;  4OP8 A;  4C6Y A;  1J9M A;  1SCW A;  1FCM A;  2XEP A;  1NXY A;  2WYX A;  2H10 A;  2H5S A;  3P98 A;  4X55 A;  1E25 A;  3IHB A;  3Q07 A;  4IVK A;  3QNC A;  4KQR A;  5CER A;  3G32 A;  4OQI A;  2X01 A;  4E3I A;  4FCF A;  4GZB A;  5EE8 A;  1GHM A;  2IWB A;  4QB8 A;  1IYS A;  3DWK A;  5JYP A;  4DRT A;  5CED A;  3SH7 A;  4LV3 A;  2DNS A;  5E2G A;  2IWD A;  1N9B A;  4NK3 A;  1I2S A;  1NJ4 A;  3E2K A;  3N7W A;  4WZ5 A;  3B3X A;  4CJN A;  4DDY A;  3HL9 A;  1BLC A;  5GHZ A;  2J8Y A;  4JKT A;  4K0X A;  4HES A;  4QY5 A;  1YQS A;  4E3M A;  1XXM A;  4C75 A;  2XLN A;  3GV9 A;  2ZMA A;  1VM1 A;  4KZ8 A;  1K6R A;  3O3V A;  1MWU A;  5CTN A;  3WS4 A;  4JPM A;  1G68 A;  3LCE A;  3VFH A;  1M40 A;  5KSC A;  2IWC A;  4R1G A;  3UE0 A;  5J8X A;  1LL9 A;  1YM1 A;  4DF6 A;  4YFM A;  4L0L A;  3TG9 A;  2R9X A;  2V1Z A;  1GCE A;  1U60 A;  2RCX A;  4F94 A;  4Y0T A;  3MKE A;  1PYY A;  2P9V A;  3HLG A;  4DE3 A;  2Y2H A;  3N8R A;  3SS4 A;  4KZ9 A;  3PBO A;  3D4F A;  3HLC A;  1YMS A;  3ZGA B;  1NZO A;  2FFY A;  4O7D A;  4X69 A;  4Q8I A;  1KE4 A;  3NCK A;  4BEN A;  2V20 A;  1QME A;  4JBF A;  3S22 A;  4E3J A;  1CK3 A;  5I94 A;  2Z2L B;  5CXW A;  3SH8 A;  4LV0 A;  1L0F A;  1Q2Q A;  5HW3 A;  3ZNY A;  2Y2O A;  3ZNT A;  1JTG A;  3G2Y A;  3Q81 A;  3IF5 A;  4KG6 A;  3Q7V B;  4HBT A;  1BLH A;  1GA9 A;  2C6W B;  5DF7 A;  5IHV A;  1NZU A;  3CMZ A;  3DW0 A;  3OPL A;  2HP9 A;  3NY4 A;  5HAP A;  1HZO A;  3ITA A;  3BEB A;  2PU2 A;  1SHV A;  3BM6 A;  3QHY A;  2WKI A;  1PI4 A;  4S2O A;  4U0X A;  1MY8 A;  3OCL A;  5CEB A;  3HLD A;  1LI9 A;  4H8R A;  1KGF A;  3C4P A;  2WAE A;  1CI9 A;  4DXB A;  2Y2P A;  4RA7 A;  5DTT A;  1FCO A;  1RGZ A;  2JE5 A;  4WEK A;  4Y0O A;  1L0D A;  4UA9 A;  4E3N A;  3BFF A;  3VP3 A;  2J9P A;  1ESU A;  1ALQ A;  2ZC4 B;  4WEJ A;  5HL1 A;  2XR0 A;  4WZ5 C;  2ZJ9 A;  4E6X A;  4JLF A;  4Y0U A;  5JYO A;  2QZ6 A;  4P87 A;  5HAI A;  2Y2K A;  1JWV A;  4N9K A;  1FQG A;  3ITB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...