3LY4A

Crystal structure of fluorophore-labeled class a -lactamase penp-e166cb in complex with penicillin g
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of fluorophore-labeled Class A -lactamase PenP-E166Cb in complex with penicillin G
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 87
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ly4A00
2V20A 3HLGA 5DTTA 4KG6A 4KZ4A 4RA7A 3ZG5A 1Q2PA 4RX3A 4NETA 4UA6A 2WAFA 2ZC7A 1RGYA 1H5XA 1E3UA 5BOHA 3IWQA 4GN2A 1L2SA 4DE3A 1ESIA 4N1XA 4S2JA 2GDNA 2HP6A 5CRFA 3SS3A 2ZC5B 5FATA 1BZAA 3PBSA 2J9OA 3UPPA 4ZJ3A 3M6HA 4OPZA 3LCEA 3VP0A 1DJAA 4C3QA 1PIOA 5FI6A 2WGVA 1EROA 1DJCA 3GV9A 3OC2A 3SH9A 2DNSA 4X55A 4JPMA 4OQGA 5CGXA 5TGFA 4KENB 2EX8A 5F1FA 1KVMA 3E2LA 1ERMA 2P9VA 1MKIA 4DE0A 3OPHA 5JYOA 5CHMA 1BUEA 4WBGA 1WYCA 4FSFA 2EX2A 3BECA 2ZLYA 4K91A 1MWUA 4LV1A 3ZHHA 3A3DA 4ZTKA 1ES3A 3BYDA 2XDMA 5FASA 3VP3A 1PWDA 2HPBA 3LEZA 4KQRA 3ITAA 2WGIA 3WS5A 3SS4A 3IXGA 1LHYA 4KZBA 2Y2JA 1XPBA 4WMCA 3W4QA 4DRTA 2QMIA 5KSHA 4BD1A 5HW3A 1KVLA 1W8QA 2RCXA 2WADA 4MNRA 1W8YA 2VGJA 4N92A 4U0XA 1YLZA 1BULA 3D4FA 3M2KA 4QD4A 1H8YA 4OVDA 4S2NA 4S2OA 3ZVWA 1Z6FA 3BFEA 5GLAA 3AGEA 3UDXA 4WM9A 2Y2GA 5E43A 4R4RA 4MLLA 5FQIA 4BLMA 2DCFA 1PZOA 5CXWA 4JF4A 3HUNA 3PBQA 3VOYA 4C6YA 4DKIA 1XGJA 1K38A 2Q9NA 4FH2A 3ZFZA 4IVKA 1ES2A 1NRFA 2JBFA 1LL5A 3SS5A 2DRWA 1KDWA 1KGEA 3W8KA 3G4PA 3HLWA 1VQQA 4S2IA 5L2FA 1YMXA 1SDEA 1YT4A 3W4PA 3I7JA 2EFXA 3HL9A 3N8LA 4FD8A 3WS1A 4Y0UA 2C5WB 1ONGA 1I5QA 3LY3A 1CI9A 3PTEA 5FAPA 4R4SA 4ZJ2A 4X53A 4WZ5A 3FV7A 1CI8A 1FCOA 4WEKA 5CHUA 4Y0TA 4LCLA 1TDGA 1IYOA 1BSGA 5FQKA 2OLVA 2XD5A 5AQAA 3TSGA 2CC1A 1MY8A 4KG5A 3HUOA 3A3EA 4E3OA 4EWFA 4IBRA 1IEMA 3LO7A 5D3OA 3UDFA 3VP2A 4E3LA 1LLBA 5CERA 1HD8A 2OLUA 5EOEA 4EUZA 4EV4A 5G18A 3G30A 3P98A 3DWZA 4S2KA 4PPRA 3UN7A 2ZC6B 3RXXA 1YLPA 1ZKJA 5EUAA 1L0FA 3FZCA 4OP8A 3UY6A 2XEPA 4XUZA 5AQBA 1KE4A 1MXOA 5EVID 1GA9A 4WMCD 4OQ0A 4B4XA 3UDIA 1ZC2A 1SDNA 4LV3A 4IBXA 4N9KA 3V3RA 4RVAA 3UE3A 2FFFB 3FKWA 3OPRA 3BFCA 2XH9A 2Y2LA 1PI4A 2Y2QA 4GDNA 2RL3A 1EI5A 1TVFA 2ZD8A 1NY0A 3BFFA 1NXYA 3WS2A 4DXCA 3GMWA 5A90A 2HP5A 1JTGA 5HL1A 4MBFA 5FAQA 3BLSA 1U60A 1DJBA 1NZUA 5GLCA 1TEMA 3MZEA 2ZC3B 4WELA 3PBTA 1ZG4A 3WS4A 3PAEA 3G35A 4ZAMA 3FKVA 3VFFA 3RJUA 3ZG8B 1H8ZA 3ZDJA 4OLDA 2XQZA 3WRZA 3SH7A 3PBNA 5I94A 4JXVA 4KZ3A 4Y0OA 4EQIA 5GLBA 1KDSA 3NBLA 2ZQDA 5EPHA 3MFDA 3FWLA 2ZQ8A 4OQIA 5F83A 5FQQA 4E3IA 2WGWA 3HVFA 1ERQA 2PU2A 3CMZA 3UPOA 1JWVA 1CEFA 5E2GA 4YFMA 1TDLA 3IF6B 4L0LA 4PM6A 4PMAA 1LI9A 2G2WA 3G34A 3NI9A 4FH4A 4OKPA 2UWXA 4YINA 3C4OA 2Y2IA 1OMEA 4OPQA 1O07A 4KG2A 1PZPA 1ES5A 4EBLA 1W79A 2R9WA 4WYYA 2JE5A 3Q7VB 2HDUA 2OV5A 5KMWA 3MBZA 3Q82A 5FA7A 4QHCA 1FR1A 3OPPA 2IWCA 1Y54A 5E2HA 5EVIA 4GOGA 4BL3A 3GVBA 3VP4A 4ZDXA 3IXDA 3CZDA 5EE8A 1HTZA 3GQZA 2WKEA 2EXAA 2J8YA 1GA0A 1BLCA 3N4IA 5E2EA 5JYPA 4BQMA 3NCKA 4JF6A 1SCWA 4E3JA 5FI7A 3IF5A 3FYZA 1PI5A 5M18A 5CEBA 3Q7ZA 1IKIA 4OONA 1N9BA 2X71A 4EBPA 1KE3A 2JCHA 3MZFA 4K0WA 2ZJ9A 1MWRA 3GR2A 5EVIC 1YM1A 3C4PA 3EQVA 3V5MA 1ESUA 1I2WA 3M2JA 3VFHA 1JWZA 2J9PA 5EOOA 4DDSA 3TOIA 1QMEA 3HUMA 2Y2KA 3BFGA 2B5RA 3UPNA 3N7WA 3VMAA 4S2NC 4P87A 4JF5A 2EXBA 1YLYA 1XP4A 4LV0A 4N1HA 5DVAA 5GL9A 1L0DA 3QNBA 4UHUA 5DTSA 4GZBA 4MBKA 1E4DA 3G31A 5FQMA 4OH0A 1MWSA 5CHJA 4KZ5A 2A3UA 1CK3A 1FQGA 3PBOA 1KGGA 1FCNA 4HBUA 5FAOA 2Y2PA 2ZC4B 2ZMAA 2H10A 1K57A 4JLFA 4DXBA 5F1GA 1LI0A 1SHVA 1L0EA 3MKFA 4GB7A 3HBRA 5CEDA 2Z2MB 3MXSA 1BLHA 5HFOA 2V1ZA 4XUXA 4LENA 1ALQA 3HLCA 2A49A 1BTLA 1KE0A 4JXGA 3WWXA 4B4ZA 5U47A 5DF8A 1BT5A 2Y2MA 3IF6A 3Q07A 3VSKA 3E2KA 3IXBA 1FR6A 3MZDA 3N8SA 4HEFA 3IXHA 4R3JA 4FCFA 3VP1A 4WZ5C 1N4OA 4WZ4A 3ZCZA 3SOIA 4M3KA 3ITBA 2HP9A 3O88A 1RCJA 2FFYA 3O3VA 2X01A 2Y59A 3MKEA 1W5DA 3Q7VA 5FQ9A 4R0QA 1I2SA 4F94A 2QPNA 3ZGAB 3W4OA 2IWDA 3WRTA 3HLBA 4WEJA 4PM8A 5FQJA 1WYBA 2ZQCA 3JYIA 1ZG6A 1S6RA 1K55A 1YQSA 3UE0A 5KSCA 1K6RA 3DWKA 4C75A 2I72A 3IH9A 4OOMA 1NYYA 4OQHA 5HAPA 1M40A 4RYEA 1NJ4A 1LL9A 4P85A 4Z9QA 1FSWA 3C5AA 4GD8A 1MBLA 5KZHA 2E8IA 5CGSA 2WZZA 3PBRA 3ISGA 4UA7A 1XGIA 3N8RA 1K56D 4Y7PA 3S1YA 1PWGA 1ES4A 4QB8A 3UNWA 4DF6A 4JBFA 3A3FA 1WE4A 3O87A 1YLJA 2H0YA 4KZ7A 2WKHA 4QY5A 4ZBEA 3OZHA 3NY4A 4LV2A 4KZ9A 4N9LA 4QY6A 3BLMA 4XXRA 5HAIA 3ZNYA 3GTCA 4IEDA 4R1GA 4OPYA 2R9XA 2Y4AA 2HDRA 2WKIA 5DF7A 3BRMA 5EECA 1K6SA 1XX2A 2EX6A 3HLFA 4IVIA 2ZQ9A 2ZQ7A 4OLGA 2Y2HA 5DF9A 3UO9A 4S2PA 2XK1A 1YLTA 2XF3A 1XA1A 3NC8A 1BLPA 1PWCA 1QMFA 5J8XA 5AQ7A 3NIAA 4LCMA 1L0GA 3CG5A 2X02A 1JVJA 4MEZA 1EWZA 4DDYA 4GKUA 3WS0A 4X69A 3ZNTA 2BLSA 5CTMA 3G2ZA 5AQ9A 1IYPA 1RGZA 1XA7A 3EQUA 5HARA 4KQQA 3BEBA 4X6TA 5FI2A 2HDQA 3G32A 3PAGA 2H5SA 1M6KA 2HDSA 1HZOA 2XD1A 4GNUA 4KZ6A 4HESA 4JKTA 4GDBA 4P0MA 3S22A 3DW0A 1CEGA 5CECA 3P09A 1IYQA 4A5RA 4P6BA 2EFUA 4Q8IA 4RX2A 1YMSA 3IWOA 1IKGA 4CJNA 1XXMA 2ZM0A 3IWIA 2XFTA 5GHXA 1YLWA 2Q9MA 4NK3A 1GHMA 1HVBA 1IELA 3M6BA 4OPRA 1AXBA 2G2UA 4U0TA 1G6AA 4JXWA 3O86A 4E3NA 3IHBA 2ZM8A 3B3XA 4OOYA 1BLSA 3VOZA 4MBHA 3A3JA 3S4XA 1Q2QA 3ZG9B 5EVLA 1O7EA 5GHZA 1K56A 3QHYA 5HX9A 3SH8A 2XLNA 2Z2LB 1PYYA 3AGFA 2PU4A 3ZG7B 1FCMA 4K0XA 2C6WB 3CJMA 1K54A 2XR0A 1K4EA 1S0WA 2XGNA 3C7VA 1DY6A 2Y91A 3IQAA 3IT9A 5M19A 2P74A 5M1AA 1NYMA 1ONHA 5DTKA 2QZ6A 1VM1A 1MPLA 3OCNA 5CGWA 2VGKA 2WK0A 3QNCA 4CPKA 4DE2A 2J7VA 3BM6A 1E3UD 3TG9A 3A3IA 1K4FA 5HAQA 1GCEA 2Y2OA 1E25A 3OCLA 2WGWB 4JXSA 3UE1A 1MWTA 1K54C 3VSLA 3HLEA 4OP5A 4DE1A 3HLDA 3ZG0A 4EBNA 2P9VB 1K57C 3IH8A 4PM9A 4BD0A 3LY4A 4E3MA 4E6WA 4O7DA 4QU3A 4KQOA 1RP5A 3N6IA 4PM5A 2WYXA 1XKZA 2H0TA 4QJGA 1JTDA 3RXWA 5CTNA 4R23A 2Y55A 4BJPA 3V3SA 4PM7A 3GRJA 3IF6C 4S2MA 2Y2NA 5F82A 5TR7A 3ZVTA 5EVIB 2EX9A 4KZ8A 4S2LA 2OSUA 2PBYA 2WZXA 5FSRA 5A92A 2BG1A 3Q1FA 1K25A 3HREA 3GSGA 4X56A 4GD6A 2V2FF 4KZAA 1GHIA 4ID4A 4OOLA 3OPLA 2ZQAA 2JC7A 1PW8A 4U3TA 3DTMA 4UAAA 4BENA 4H8RA 3BFDA 5GHYA 3C7UA 3Q81A 3AGDA 5FDHA 4HBTA 3MXRA 4B88A 1J9MA 1G68A 1W7FA 4UA9A 5TFQA 3V50A 4E6XA 5A93A 1SKFA 1FSYA 1NZOA 5GLDA 5IHVA 1K55C 2IWBA 5A91A 1JWPA 3IHAA 1IYSA 4X68A 1PW1A 5E2FA 4E3KA 2XFSA 3NDEA 3V39A 3G2YA 4ZJ1A 2ZM2A 1KGFA 1C3BA 2WUQA 4BL2A 4D2OA 4R3BA 2WAEA 1GHPA 3NDGA 1FOFA
chains in the Genus database with same CATH superfamily
5DTTA 4KZ4A 4RA7A 3UE6A 3MXQA 4NETA 1E3UA 4GN2A 4DE3A 3VOLA 3PBSA 2J9OA 4ZJ3A 3M6HA 4X55A 5TGFA 2BASA 5F1FA 1ERMA 3OPHA 2ZL1A 1BUEA 1WYCA 2QKPA 2ZOIA 5EV0A 4LV1A 3ZHHA 4ZTKA 5FASA 1PWDA 2Y2JA 2JKRI 2WADA 2KDKA 2P04A 1YKDA 3D4FA 3F1PA 3UMDA 4BBVA 4OVDA 3UDXA 4DJ2A 5CXWA 3HUNA 3PBQA 4DKIA 4C6YA 1OTEA 1F9IA 1NRFA 4GCZA 3B42A 3S7QA 3W8KA 1KGEA 4X25A 3G4PA 3HLWA 4S2IA 1YMXA 1SDEA 1YT4A 2EFXA 2KX6A 4FD8A 3WS1A 1ONGA 2ZMVA 5IS1A 1CI9A 1TS6A 3OBFA 3FV7A 4Y0TA 4LCLA 5HL6A 3QP5A 3NOUC 2Z6DA 3TSGA 4JGQA 2JKTI 4EWFA 5TJJA 5HZHA 3LO7A 5D3OA 4EUZA 4S2KA 3BQ8A 2KOIA 4HJ4A 2PT7A 3H7WB 3UY6A 4XUZA 1DP6A 4WMCD 4OQ0A 4B4XA 3UDIA 1ZC2A 3V3RA 4N9KA 1N9OA 1PI4A 2Y2QA 2HP5A 5HL1A 3BY9A 1NZUA 2J3TD 1TEMA 2ZC3B 3PBTA 3MMHA 1MZUA 1ZG4A 3PAEA 5F6AA 3FKVA 1PRQA 4NEED 4BBTA 3T4JA 5HWTA 3L7HA 3SH7A 4JXVA 4Y17A 4KZ3A 5C5KA 3TW8A 5F5YA 2ZQDA 5FQQA 3HVFA 4HJ6A 1TDLA 4L9GA 4PMAA 3LIEA 3LIFA 3T4KA 4II7A 3G34A 3NI9A 1EW0A 2Y2IA 1OMEA 3MR0A 4OPQA 4O01A 3C38A 5HPFA 5KMWA 3Q82A 2IWCA 4HH3A 5EVIA 4BL3A 3CZDA 2KLIA 2WKEA 2J8YA 3H7WA 1XFNA 3N4IA 5E2EA 4BQMA 4G3WA 1SCWA 3VE3A 3IF5A 4LRZE 4I38A 2JCHA 3MZFA 3EQVA 3M2JA 5G4ZA 3UB8A 5EOOA 4DDSA 3ZYTA 3HUMA 1VETA 2B5RA 3VMAA 4S2NC 1JNUA 5DVAA 2D02A 1P9RA 4LV0A 5GL9A 4UHUA 1MWSA 4HBUA 5FAOA 1SHVA 1L0EA 3MKFA 4GS9B 3HBRA 1BLHA 1ALQA 3BQAA 2A49A 3T50A 3WWXA 4JXGA 2Y2MA 3E2KA 1FR6A 3MZDA 3PYPA 4WZ5C 3ZCZA 4WZ4A 2CMNA 3LFVA 2ZBBA 3VE4A 1W5DA 1NRJA 5DKLA 4HJ3A 1DP9A 1XFQA 5KSCA 3DWKA 4C75A 2VEAA 4I3AA 1YSQA 4EERA 3EEAA 2W3EA 2W1RA 4RYEA 4Z9QA 1LL9A 4GD8A 2WZZA 3PBRA 3ISGA 5DJUA 3T1RA 5EM0A 3S1YA 4QB8A 3UNWA 1WE4A 3O87A 2WKHA 5HAIA 1NWZA 4N9LA 4KZ9A 5DFYA 3BLMA 3NJAA 2Y4AA 2GZAA 2HDRA 5DF7A 3LGOA 5DKKA 5EECA 1K6SA 2EX6A 5DF9A 3LI8A 4S2PA 1S4RA 2H28A 4MMNA 4GS9A 5AQ7A 4LCMA 1L0GA 3CG5A 2X02A 4GKUA 3NOTC 4X69A 2BLSA 5CTMA 1RGZA 1XA7A 4Y2FA 4X6TA 2HDSA 4KZ6A 4GNUA 1OJGA 4GDBA 2O9CA 4O0PA 4RX2A 4QWOA 3SZTA 3JPUA 2XFTA 3UMEA 1YLWA 3DTEA 5LBRA 3T12B 3O86A 4EXOA 3DAVA 2BTFP 1BLSA 5EVLA 5GHZA 1K56A 2XLNA 1FCMA 2L1MA 4K0XA 3VV4A 2XR0A 3IQAA 1DY6A 2L0WA 2P74A 1ONHA 5DTKA 1VM1A 1MPLA 3PHYA 2PYPA 2WK0A 3QNCA 4DE2A 3QP2A 5EM1A 3P7NA 1E25A 4JXSA 1K54C 1VB6A 3HLEA 4OP5A 4EEPA 2P9VB 4BD0A 3LY4A 2HJ9C 4E6WA 2M7UA 1DP8A 2EWVA 2LB9A 3H9WA 3KSHA 2WYXA 3BWLA 4QJGA 2FH5A 4YNRA 1F98A 1TS8A 4BJPA 4EUVA 3IF6C 5TR7A 4ETXA 2EX9A 4S2LA 3K2NA 3Q1FA 3GSGA 1GHIA 4RQ9A 2JC7A 4U3TA 4H8RA 2A2LA 5GHYA 3Q81A 3O5YA 5FDHA 3IX4A 1W7FA 5TFQA 4LRYC 1N9NA 1K55C 1T1AA 3IHAA 1IYSA 5K5BA 3G2YA 5HSQA 1KGFA 1GHPA 3LR3A 3HLGA 2W27A 4AFIA 4DJ3A 4UA6A 2JHEA 3IWQA 2ZOHA 2GDNA 3SS3A 4Y15A 2J3WA 3VP0A 1HLUP 1PIOA 2WGVA 4CLCE 5CGXA 4KENB 2EX8A 3E4OA 3E2LA 2P9VA 4DE0A 3A0VA 4FSFA 3BECA 2ZLYA 1V9ZA 1S66L 2XDMA 1T18A 4CQHA 1UGUA 3ITAA 2WGIA 3WS5A 1LHYA 4KZBA 1XPBA 4WMCA 2R78A 3T1XA 4U0XA 2VGJA 1YLZA 3M2KA 2QWSA 1H8YA 4S2NA 3BFEA 2VZWA 4R4RA 4MLLA 5FQIA 1PZOA 2O9AA 1S1YA 3BY8A 2OAQ1 2JBFA 3SS5A 2DRWA 5FEGA 4Y5FA 4Y13A 1VQQA 5AVEA 3HL9A 3N8LA 4Y0UA 1PFLA 4WL9A 4WZ5A 5A8BA 1FCOA 4WEKA 1TD5A 5FQKA 2YKHA 2CC1A 1MY8A 2XRNA 3A3EA 4E3OA 3CITA 4GHIB 5L07A 1G6OA 2OLUA 3EOIA 2ZC6B 2PDRA 1L0FA 1TS7A 3FZCA 4B93A 2XEPA 3CLOA 2IA2A 1MXOA 3U4LP 3T4TA 4E04A 3H82B 4IBXA 3MS6A 3UE3A 3BFCA 2XH9A 2Y2LA 4GDNA 3LR5A 2ZD8A 1TVFA 4MN5A 4EU0A 1NXYA 5A90A 1JTGA 5J7EA 1P97A 4GLQA 2VK3A 3WS4A 3G35A 3G6OA 1H8ZA 2V1AA 4HH2A 4Y0OA 5EPHA 3T4LA 2ZQ8A 5F83A 2PU2A 3CMZA 4NXBA 3UPOA 3IF6B 4B9OA 4PM6A 4WLAA 4FH4A 5TBMB 5AVFA 1O07A 4KG2A 1PZPA 1ES5A 1W79A 2JE5A 3Q7VB 4GHIA 5FA7A 1FR1A 3OPPA 1Y54A 4GOGA 3GVBA 4F3LB 5JYPA 4JF6A 2OWJA 5FI7A 3H82A 5CEBA 3Q7ZA 4WF0A 1N9BA 2X71A 4EBPA 1KE3A 4MDZA 1ESUA 2J9PA 3BFGA 3IX8A 3UPNA 1PNEA 4P87A 4JF5A 1XP4A 4MBKA 1E4DA 3G31A 3PR6A 4OH0A 5CHJA 1CK3A 3R7WB 1XJ4A 4GJ4A 4DXBA 4PHTA 2PBDP 1A0KA 4GB7A 2Z2MB 5F69A 2Z6CA 1BTLA 1KE0A 3PXPA 3K3DA 4B4ZA 3T1QB 5U47A 3IF6A 2ACGA 4I5SA 3N8SA 3VP1A 3MQOA 1N4OA 4M3KA 3ITBA 3RTYA 1T1BA 2Y59A 3MKEA 3Q7VA 5FQ9A 4HP9A 4CLCD 2L4RA 2QPNA 3ZGAB 3W4OA 4MCWA 2D01A 4WEJA 5FQJA 2VGLS 4F3LA 1WYBA 3JYIA 1ZG6A 1K55A 1YQSA 2P7JA 4OOMA 2WKRA 4OQHA 1M40A 1NJ4A 3C5AA 2B95A 2E8IA 1VEUB 2PR6A 2QJ5A 2I9VA 1OTDA 1CQAA 1PWGA 2K2NA 3B47A 5F68A 5L10A 4KZ7A 3NY4A 4LV2A 4QY6A 3R4KA 4R1GA 4IEDA 2R9XA 4IVIA 4OLGA 3R7WA 2ZQ9A 2ZQ7A 3QP8A 1SKOB 5KIZA 4MN6A 1BLPA 1PWCA 3NIAA 4MEZA 5EFWA 1JVJA 2GX5A 3HJIA 4DDYA 3ZNTA 5HARA 2XA7S 3CHWP 1M6KA 2XD1A 1OJ5A 4G3VA 4HESA 4JKTA 3DW0A 1CEGA 1IYQA 4A5RA 1LSWA 1YMSA 1IKGA 1S1ZA 5GHXA 4OPRA 1IELA 1XJ2A 3U2AA 4U0TA 1G6AA 4ETZA 3IHBA 2XROA 2ZM8A 3B3XA 5HD3A 3A3JA 1O7EA 3QHYA 2Z2LB 3CJMA 1VEUA 2J3TC 1K4EA 1S0WA 3LI9A 3C7VA 3IT9A 5M19A 1MKMA 5M1AA 2W3DA 1YPRA 5CGWA 3LR0A 3EEHA 2YKFA 3BM6A 1E3UD 1KOUA 3A3IA 1K4FA 1GCEA 2HV1A 2WGWB 4FTXA 3UE1A 1H3QA 1MWTA 1SKOA 5HDDA 4PM9A 4E3MA 2FZ0A 1UWNX 1JTDA 3QP6A 4NXEA 4PM7A 3V3SA 3GRJA 4S2MA 2Y2NA 4KZ8A 2OSUA 2PBYA 5A92A 5IU1A 1K25A 4X56A 2V2FF 3OPLA 2G7UA 2ZQAA 4P6ZS 1N9LA 4BENA 3BFDA 2M1CA 3C7UA 4B88A 3V50A 1SKFA 1FSYA 4BMWA 5GLDA 4H6JB 4X68A 2EWWA 1PW1A 4E3KA 5FL3A 3LIDA 4R3BA 3ZG5A 2ZC7A 4ESPA 4S2JA 5CRFA 2ZC5B 1BZAA 2NUTC 4C3QA 2INWA 3GV9A 3IBRA 3OC2A 4HOIA 2DNSA 1VHMA 3KYQA 4OQGA 5FDSA 3LEQA 1KVMA 1MKIA 5JYOA 5CHMA 4WBGA 1MWUA 2W3HA 2V8FA 3A3DA 3BYDA 3VP3A 4KQRA 5L8MA 3SS4A 3IXGA 1G5UA 4Y3IA 3W4QA 3A0SA 1KVLA 2RCXA 4MNRA 2PAVP 1F5MA 1W8YA 1BULA 3C2WA 4QD4A 2GJ3A 1Z6FA 1AWIA 1BYWA 2Q0OA 1OT6A 2Y2GA 4BLMA 4JF4A 3VOYA 4FH2A 4H6JA 5MC7A 1H0MA 1LL5A 1KDWA 3CI6A 3JVUA 3W4PA 2UV0E 4PKYA 3D9YA 2C5WB 1I5QA 3PTEA 5FAPA 4X53A 2VV8A 4DMZA 3E4QA 1CJFA 1IYOA 2XD5A 5I5LA 4KG5A 3IX3A 4I39A 4LLOB 1LT0A 3UDFA 4E3LA 1HD8A 5EOEA 2PD7A 3P98A 3DWZA 4PPRA 1YLPA 1ZKJA 5EUAA 4ARZB 4OP8A 2VGLM 1P9WA 3ICYA 4JGRA 5EVID 1GA9A 3S7OA 1LSXA 1SDNA 2FFFB 3NOPC 3OPRA 2K31A 2RL3A 1ODVA 2PRFA 3BFFA 3GMWA 4MBFA 4D60A 5GLCA 3MZEA 4WELA 4ZAMA 3VFFA 3RJUA 4OLDA 2QYBA 3B33A 3WRZA 3PBNA 5I94A 2Y8HA 4EQIA 5GLBA 1KDSA 3NBLA 3MFDA 4OQIA 1SZVA 4Z1WA 1JWVA 1CEFA 3LIBA 5E2GA 4YFMA 4L0LA 1LI9A 2G2WA 4OKPA 2V8CA 3C4OA 2XA7M 3MQ0A 4NKPA 4EBLA 2R9WA 1GSWA 2HDUA 2V0WA 4ZDXA 5IT5A 3CPTB 5EE8A 3C30A 4ARZA 3GQZA 3T4QA 2EXAA 1GA0A 1D7EA 2O9BA 3S7PA 4E3JA 3FYZA 1PI5A 2VX8A 5M18A 4OONA 1IKIA 2NUPC 2JKGA 2ZJ9A 5EVIC 3C4PA 3V5MA 1I2WA 3VFHA 1JWZA 3OOVA 2V0UA 2O99A 5FQMA 4KZ5A 2A3UA 2J80A 1FQGA 1FCNA 1CF0A 2GNXA 2Y2PA 2ZC4B 2ZMAA 2H10A 4JLFA 1J3WA 5F1GA 5HFOA 2V1ZA 4XUXA 4LENA 3FG8A 3HLCA 2W3FA 4XT2B 3IBJA 5DF8A 4G3KA 3VSKA 3Q07A 2WKPA 4HEFA 3IXHA 4R3JA 4LGWA 4M4XA 1STZA 3MSHA 3LR4A 3O88A 1RCJA 2PHYA 4R0QA 1Z09A 2IWDA 3E0YA 3WRTA 4P6ZM 4PM8A 3UB7A 2VJWA 3LIAA 1K6RA 3NHQA 4EW7A 2I72A 3IH9A 4FOFA 1FSWA 4FUWA 3T1SA 2VV7A 4YWZA 1K56D 4DF6A 4JBFA 4IUHA 1YLJA 3ZNYA 3BRMA 4I3JA 1S4SA 2Y2HA 4QPRA 3UO9A 2XK1A 1YLTA 2XF3A 2WKQA 2EA9A 4UQIS 1EWZA 4XT2A 3WS0A 1IYPA 3EQUA 4DN0A 5EVEA 2HDQA 3G32A 2H5SA 1TF1A 1UWPX 5CECA 4P6BA 4Q8IA 3T4SA 1XXMA 2ZM0A 4KQDA 3IWIA 1OTIA 1GHMA 1HVBA 2G2UA 1GSVA 2JKFA 4E3NA 3D72A 4OOYA 3VOZA 1F2KA 4MBHA 1Q2QA 3KO6A 3ZQ5A 1PYYA 2C6WB 3TJZC 1K54A 3F1OB 2XGNA 2Y91A 3OCNA 2VGKA 5J3WA 2J7VA 3KSIA 4LPZA 3TG9A 3MJQA 5HAQA 2Y2OA 4NG2A 3OCLA 2B18A 3VSLA 4DE1A 4HP4A 5TBMA 1K57C 3W2ZA 3NECA 3GDIA 4O7DA 2HGVA 4KQOA 3N6IA 4PM5A 1XKZA 4R23A 4BBUA 5HWWA 5EVIB 4JGPA 2WZXA 5FSRA 3HREA 4KZAA 4ID4A 4OOLA 3DBAA 3MQQA 3AGDA 4HBTA 3MXRA 1J9MA 5HPIA 3CUEC 4UA9A 4E6XA 5A93A 3E98A 1ACFA 1NZOA 5IHVA 1JWPA 3NDEA 3V39A 2W1TB 3IS2B 2WUQA 1VETB 4R3AA 4BL2A 2WAEA 3NDGA 4EEUA 1FOFA 2V20A 3F1OA 3E4PA 4KG6A 1Q2PA 4RX3A 2WAFA 1RGYA 1H5XA 5BOHA 4PAUA 1L2SA 1ESIA 4N1XA 2HP6A 5FATA 2DMWA 5G4YA 3UPPA 1LL8A 4OPZA 3LCEA 4HI4A 1DJAA 3KSGA 5FI6A 1EROA 1DJCA 3SH9A 4JPMA 2VLGA 3DTKA 4LRXC 1V9YA 5HDSA 2OAP1 1IFQA 2EX2A 4K91A 3K3CA 1ES3A 1G28A 1OTAA 2HPBA 3LEZA 3HCYA 4CLCC 4DRTA 1K0KA 2PR5A 2QMIA 5KSHA 4BD1A 5HW3A 1W8QA 3OLOA 4N92A 4IUKA 4JGOA 4S2OA 3ZVWA 2JN7A 5GLAA 3AGEA 4WM9A 1NLZA 5E43A 1T1CA 2DCFA 1H8MA 1XGJA 1K38A 2Q9NA 3ZFZA 4IVKA 1ES2A 3FPWA 1X0OA 2VKSA 2W1TA 3DTIA 3IS2A 4ZRRA 2B02A 5L2FA 4PKYG 3I7JA 3LY3A 3NULA 4R4SA 2M7VA 4ZJ2A 3P01A 1ZHHB 3D3OA 1Y28A 3S7NA 1CI8A 5CHUA 5DJTA 4NXFA 4BWIA 1TDGA 1BSGA 4HIAA 2OLVA 5AQAA 3KX0X 3HUOA 1D1JA 4IBRA 1D06A 1IEMA 3VP2A 1LLBA 5CERA 3EWKA 4EV4A 5G18A 3G30A 3UN7A 3RXXA 2LB5A 2V9AA 3QP1A 4X1MA 5AQBA 1KE4A 3EGDC 3V67A 2HJEA 5FEFA 4LV3A 4Q0IA 4R70A 4RVAA 3FKWA 2ZMFA 1EI5A 1NY0A 3WS2A 4DXCA 3A0RA 5FAQA 4HNBA 3BLSA 1U60A 1DJBA 4KUOA 4EQ1A 3CAXA 4R6LA 1IOUA 3ZG8B 3ZDJA 3KYEA 2XQZA 4WUJA 1YAXA 3UB6A 1W63Q 3FWLA 4E3IA 4I3IA 2WGWA 1MC0A 1ERQA 2K7SA 1P0ZA 4UQIM 2PD8A 5DFXA 4HY8A 2UWXA 4YINA 2OOLA 4UEYA 3LUQA 5L09A 4WYYA 3CWFA 2OV5A 3MBZA 3JVVA 4QHCA 5E2HA 3VP4A 3IXDA 4EETB 1HTZA 3MF0A 3T4OA 1S67L 1BLCA 3EGXC 3NCKA 2V1BA 4WN5A 3TRCA 4K0WA 1MWRA 2VV6A 3GR2A 2W0NA 1YM1A 3TOIA 1QMEA 2Y2KA 3F1NB 3N7WA 2E8JA 2VA0A 2EXBA 1YLYA 3L9KA 4N1HA 1L0DA 3FC7A 3QNBA 4YOFA 5DTSA 4GZBA 1Y4OA 2A24B 3PBOA 1KGGA 2HZ5A 1K57A 2HF6A 4L9EA 1LI0A 4Q0JA 5AJGA 5CEDA 3MXSA 3HJKA 3TE8A 1BT5A 1XJ6A 1OT9A 3IXBA 4CLCB 1NLYA 4FCFA 3SOIA 4HQAA 2HP9A 2FFYA 3O3VA 2X01A 4GW9A 1GSXA 1I2SA 4F94A 3HLBA 3CUEA 4R38A 2ZQCA 1S6RA 1XJ3A 3UE0A 4KUKA 5HD5A 1NYYA 5HAPA 1WA9A 4P85A 4X1LA 3LICA 1MBLA 5KZHA 5CGSA 3BJNA 4UA7A 1XGIA 3N8RA 2Y79A 2AVXA 4Y7PA 1ES4A 3F1NA 3A3FA 2H0YA 1DRMA 4QY5A 4ZBEA 3OZHA 4XXRA 3GTCA 4OPYA 3UB9A 2A24A 2WKIA 1XX2A 3HLFA 2P08A 5CX7A 1OPXA 1XA1A 3NC8A 3SW1A 1QMFA 5J8XA 3QP4A 3G2ZA 5AQ9A 2QHKA 4KQQA 3BEBA 5FI2A 4LFUA 3PAGA 4CLCA 5J4EA 1HZOA 2JKRM 3C8CA 4HHDA 4NXGA 4P0MA 3S22A 3P09A 1L3LA 2EFUA 4EESA 3BW6A 3IWOA 4CJNA 4L9FA 2Q9MA 4NK3A 3M6BA 1AXBA 4JXWA 1W63M 3KSFA 3S4XA 3ZG9B 5HX9A 3SH8A 3AGFA 2PU4A 4MN7A 3ZG7B 1OTBA 1LSVA 4Q0HA 2PYRA 1NYMA 2QZ6A 4CPKA 2JKTM 5HWVA 4ME4A 4IJGA 3MFXA 2MJ6A 3HLDA 3ZG0A 4EBNA 3UB5P 2ZL1B 3IH8A 4QU3A 1RP5A 2H0TA 3RXWA 5CTNA 2Y55A 2XSSA 5F82A 3CPTA 2QJ7A 3ZVTA 1YSPA 1T19A 2BG1A 2W3GA 4GD6A 3GECA 3F1PB 1PW8A 3DTMA 3LYXA 2O0YA 4UAAA 1FIKA 3RH8B 4O8GA 1G68A 3ULFA 4K08A 2OWHA 2IWBA 5A91A 5E2FA 2XFSA 3RFBA 1TS0A 1FILA 4ZJ1A 2ZM2A 3KYZA 1C3BA 4D2OA 5HDCA 1ZTUA 4IHQA 3FPVA
chains in the Genus database with same CATH topology
2V20A 3HLGA 5DTTA 4KG6A 4KZ4A 4RA7A 3ZG5A 1Q2PA 4RX3A 4NETA 4UA6A 2WAFA 2ZC7A 1RGYA 1H5XA 1E3UA 5BOHA 3IWQA 4GN2A 1L2SA 4DE3A 1ESIA 4N1XA 4S2JA 2GDNA 2HP6A 5CRFA 3SS3A 2ZC5B 5FATA 1BZAA 3PBSA 2J9OA 3UPPA 4ZJ3A 3M6HA 4OPZA 3LCEA 3VP0A 1DJAA 4C3QA 1PIOA 5FI6A 2WGVA 1EROA 1DJCA 3GV9A 3OC2A 3SH9A 2DNSA 4X55A 4JPMA 4OQGA 5CGXA 5TGFA 4KENB 2EX8A 5F1FA 1KVMA 3E2LA 1ERMA 2P9VA 1MKIA 4DE0A 3OPHA 5JYOA 5CHMA 1BUEA 4WBGA 1WYCA 4FSFA 2EX2A 3BECA 2ZLYA 4K91A 1MWUA 4LV1A 3ZHHA 3A3DA 4ZTKA 1ES3A 3BYDA 2XDMA 5FASA 3VP3A 1PWDA 2HPBA 3LEZA 4KQRA 3ITAA 2WGIA 3WS5A 3SS4A 3IXGA 1LHYA 4KZBA 2Y2JA 1XPBA 4WMCA 3W4QA 4DRTA 2QMIA 5KSHA 4BD1A 5HW3A 1KVLA 1W8QA 2RCXA 2WADA 4MNRA 1W8YA 2VGJA 4N92A 4U0XA 1YLZA 1BULA 3D4FA 3M2KA 4QD4A 1H8YA 4OVDA 4S2NA 4S2OA 3ZVWA 1Z6FA 3BFEA 5GLAA 3AGEA 3UDXA 4WM9A 2Y2GA 5E43A 4R4RA 4MLLA 5FQIA 4BLMA 2DCFA 1PZOA 5CXWA 4JF4A 3HUNA 3PBQA 3VOYA 4C6YA 4DKIA 1XGJA 1K38A 2Q9NA 4FH2A 3ZFZA 4IVKA 1ES2A 1NRFA 2JBFA 1LL5A 3SS5A 2DRWA 1KDWA 1KGEA 3W8KA 3G4PA 3HLWA 1VQQA 4S2IA 5L2FA 1YMXA 1SDEA 1YT4A 3W4PA 3I7JA 2EFXA 3HL9A 3N8LA 4FD8A 3WS1A 4Y0UA 2C5WB 1ONGA 1I5QA 3LY3A 1CI9A 3PTEA 5FAPA 4R4SA 4ZJ2A 4X53A 4WZ5A 3FV7A 1CI8A 1FCOA 4WEKA 5CHUA 4Y0TA 4LCLA 1TDGA 1IYOA 1BSGA 5FQKA 2OLVA 2XD5A 5AQAA 3TSGA 2CC1A 1MY8A 4KG5A 3HUOA 3A3EA 4E3OA 4EWFA 4IBRA 1IEMA 3LO7A 5D3OA 3UDFA 3VP2A 4E3LA 1LLBA 5CERA 1HD8A 2OLUA 5EOEA 4EUZA 4EV4A 5G18A 3G30A 3P98A 3DWZA 4S2KA 4PPRA 3UN7A 2ZC6B 3RXXA 1YLPA 1ZKJA 5EUAA 1L0FA 3FZCA 4OP8A 3UY6A 2XEPA 4XUZA 5AQBA 1KE4A 1MXOA 5EVID 1GA9A 4WMCD 4OQ0A 4B4XA 3UDIA 1ZC2A 1SDNA 4LV3A 4IBXA 4N9KA 3V3RA 4RVAA 3UE3A 2FFFB 3FKWA 3OPRA 3BFCA 2XH9A 2Y2LA 1PI4A 2Y2QA 4GDNA 2RL3A 1EI5A 1TVFA 2ZD8A 1NY0A 3BFFA 1NXYA 3WS2A 4DXCA 3GMWA 5A90A 2HP5A 1JTGA 5HL1A 4MBFA 5FAQA 3BLSA 1U60A 1DJBA 1NZUA 5GLCA 1TEMA 3MZEA 2ZC3B 4WELA 3PBTA 1ZG4A 3WS4A 3PAEA 3G35A 4ZAMA 3FKVA 3VFFA 3RJUA 3ZG8B 1H8ZA 3ZDJA 4OLDA 2XQZA 3WRZA 3SH7A 3PBNA 5I94A 4JXVA 4KZ3A 4Y0OA 4EQIA 5GLBA 1KDSA 3NBLA 2ZQDA 5EPHA 3MFDA 3FWLA 2ZQ8A 4OQIA 5F83A 5FQQA 4E3IA 2WGWA 3HVFA 1ERQA 2PU2A 3CMZA 3UPOA 1JWVA 1CEFA 5E2GA 4YFMA 1TDLA 3IF6B 4L0LA 4PM6A 4PMAA 1LI9A 2G2WA 3G34A 3NI9A 4FH4A 4OKPA 2UWXA 4YINA 3C4OA 2Y2IA 1OMEA 4OPQA 1O07A 4KG2A 1PZPA 1ES5A 4EBLA 1W79A 2R9WA 4WYYA 2JE5A 3Q7VB 2HDUA 2OV5A 5KMWA 3MBZA 3Q82A 5FA7A 4QHCA 1FR1A 3OPPA 2IWCA 1Y54A 5E2HA 5EVIA 4GOGA 4BL3A 3GVBA 3VP4A 4ZDXA 3IXDA 3CZDA 5EE8A 1HTZA 3GQZA 2WKEA 2EXAA 2J8YA 1GA0A 1BLCA 3N4IA 5E2EA 5JYPA 4BQMA 3NCKA 4JF6A 1SCWA 4E3JA 5FI7A 3IF5A 3FYZA 1PI5A 5M18A 5CEBA 3Q7ZA 1IKIA 4OONA 1N9BA 2X71A 4EBPA 1KE3A 2JCHA 3MZFA 4K0WA 2ZJ9A 1MWRA 3GR2A 5EVIC 1YM1A 3C4PA 3EQVA 3V5MA 1ESUA 1I2WA 3M2JA 3VFHA 1JWZA 2J9PA 5EOOA 4DDSA 3TOIA 1QMEA 3HUMA 2Y2KA 3BFGA 2B5RA 3UPNA 3N7WA 3VMAA 4S2NC 4P87A 4JF5A 2EXBA 1YLYA 1XP4A 4LV0A 4N1HA 5DVAA 5GL9A 1L0DA 3QNBA 4UHUA 5DTSA 4GZBA 4MBKA 1E4DA 3G31A 5FQMA 4OH0A 1MWSA 5CHJA 4KZ5A 2A3UA 1CK3A 1FQGA 3PBOA 1KGGA 1FCNA 4HBUA 5FAOA 2Y2PA 2ZC4B 2ZMAA 2H10A 1K57A 4JLFA 4DXBA 5F1GA 1LI0A 1SHVA 1L0EA 3MKFA 4GB7A 3HBRA 5CEDA 2Z2MB 3MXSA 1BLHA 5HFOA 2V1ZA 4XUXA 4LENA 1ALQA 3HLCA 2A49A 1BTLA 1KE0A 4JXGA 3WWXA 4B4ZA 5U47A 5DF8A 1BT5A 2Y2MA 3IF6A 3Q07A 3VSKA 3E2KA 3IXBA 1FR6A 3MZDA 3N8SA 4HEFA 3IXHA 4R3JA 4FCFA 3VP1A 4WZ5C 1N4OA 4WZ4A 3ZCZA 3SOIA 4M3KA 3ITBA 2HP9A 3O88A 1RCJA 2FFYA 3O3VA 2X01A 2Y59A 3MKEA 1W5DA 3Q7VA 5FQ9A 4R0QA 1I2SA 4F94A 2QPNA 3ZGAB 3W4OA 2IWDA 3WRTA 3HLBA 4WEJA 4PM8A 5FQJA 1WYBA 2ZQCA 3JYIA 1ZG6A 1S6RA 1K55A 1YQSA 3UE0A 5KSCA 1K6RA 3DWKA 4C75A 2I72A 3IH9A 4OOMA 1NYYA 4OQHA 5HAPA 1M40A 4RYEA 1NJ4A 1LL9A 4P85A 4Z9QA 1FSWA 3C5AA 4GD8A 1MBLA 5KZHA 2E8IA 5CGSA 2WZZA 3PBRA 3ISGA 4UA7A 1XGIA 3N8RA 1K56D 4Y7PA 3S1YA 1PWGA 1ES4A 4QB8A 3UNWA 4DF6A 4JBFA 3A3FA 1WE4A 3O87A 1YLJA 2H0YA 4KZ7A 2WKHA 4QY5A 4ZBEA 3OZHA 3NY4A 4LV2A 4KZ9A 4N9LA 4QY6A 3BLMA 4XXRA 5HAIA 3ZNYA 3GTCA 4IEDA 4R1GA 4OPYA 2R9XA 2Y4AA 2HDRA 2WKIA 5DF7A 3BRMA 5EECA 1K6SA 1XX2A 2EX6A 3HLFA 4IVIA 2ZQ9A 2ZQ7A 4OLGA 2Y2HA 5DF9A 3UO9A 4S2PA 2XK1A 1YLTA 2XF3A 1XA1A 3NC8A 1BLPA 1PWCA 1QMFA 5J8XA 5AQ7A 3NIAA 4LCMA 1L0GA 3CG5A 2X02A 1JVJA 4MEZA 1EWZA 4DDYA 4GKUA 3WS0A 4X69A 3ZNTA 2BLSA 5CTMA 3G2ZA 5AQ9A 1IYPA 1RGZA 1XA7A 3EQUA 5HARA 4KQQA 3BEBA 4X6TA 5FI2A 2HDQA 3G32A 3PAGA 2H5SA 1M6KA 2HDSA 1HZOA 2XD1A 4GNUA 4KZ6A 4HESA 4JKTA 4GDBA 4P0MA 3S22A 3DW0A 1CEGA 5CECA 3P09A 1IYQA 4A5RA 4P6BA 2EFUA 4Q8IA 4RX2A 1YMSA 3IWOA 1IKGA 4CJNA 1XXMA 2ZM0A 3IWIA 2XFTA 5GHXA 1YLWA 2Q9MA 4NK3A 1GHMA 1HVBA 1IELA 3M6BA 4OPRA 1AXBA 2G2UA 4U0TA 1G6AA 4JXWA 3O86A 4E3NA 3IHBA 2ZM8A 3B3XA 4OOYA 1BLSA 3VOZA 4MBHA 3A3JA 3S4XA 1Q2QA 3ZG9B 5EVLA 1O7EA 5GHZA 1K56A 3QHYA 5HX9A 3SH8A 2XLNA 2Z2LB 1PYYA 3AGFA 2PU4A 3ZG7B 1FCMA 4K0XA 2C6WB 3CJMA 1K54A 2XR0A 1K4EA 1S0WA 2XGNA 3C7VA 1DY6A 2Y91A 3IQAA 3IT9A 5M19A 2P74A 5M1AA 1NYMA 1ONHA 5DTKA 2QZ6A 1VM1A 1MPLA 3OCNA 5CGWA 2VGKA 2WK0A 3QNCA 4CPKA 4DE2A 2J7VA 3BM6A 1E3UD 3TG9A 3A3IA 1K4FA 5HAQA 1GCEA 2Y2OA 1E25A 3OCLA 2WGWB 4JXSA 3UE1A 1MWTA 1K54C 3VSLA 3HLEA 4OP5A 4DE1A 3HLDA 3ZG0A 4EBNA 2P9VB 1K57C 3IH8A 4PM9A 4BD0A 3LY4A 4E3MA 4E6WA 4O7DA 4QU3A 4KQOA 1RP5A 3N6IA 4PM5A 2WYXA 1XKZA 2H0TA 4QJGA 1JTDA 3RXWA 5CTNA 4R23A 2Y55A 4BJPA 3V3SA 4PM7A 3GRJA 3IF6C 4S2MA 2Y2NA 5F82A 5TR7A 3ZVTA 5EVIB 2EX9A 4KZ8A 4S2LA 2OSUA 2PBYA 2WZXA 5FSRA 5A92A 2BG1A 3Q1FA 1K25A 3HREA 3GSGA 4X56A 4GD6A 2V2FF 4KZAA 1GHIA 4ID4A 4OOLA 3OPLA 2ZQAA 2JC7A 1PW8A 4U3TA 3DTMA 4UAAA 4BENA 4H8RA 3BFDA 5GHYA 3C7UA 3Q81A 3AGDA 5FDHA 4HBTA 3MXRA 4B88A 1J9MA 1G68A 1W7FA 4UA9A 5TFQA 3V50A 4E6XA 5A93A 1SKFA 1FSYA 1NZOA 5GLDA 5IHVA 1K55C 2IWBA 5A91A 1JWPA 3IHAA 1IYSA 4X68A 1PW1A 5E2FA 4E3KA 2XFSA 3NDEA 3V39A 3G2YA 4ZJ1A 2ZM2A 1KGFA 1C3BA 2WUQA 4BL2A 4D2OA 4R3BA 2WAEA 1GHPA 3NDGA 1FOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V20 A;  3HLG A;  5DTT A;  4KG6 A;  4KZ4 A;  4RA7 A;  3ZG5 A;  1Q2P A;  4RX3 A;  4NET A;  4UA6 A;  2WAF A;  2ZC7 A;  1RGY A;  1H5X A;  1E3U A;  5BOH A;  3IWQ A;  4GN2 A;  1L2S A;  4DE3 A;  1ESI A;  4N1X A;  4S2J A;  2GDN A;  2HP6 A;  5CRF A;  3SS3 A;  2ZC5 B;  5FAT A;  1BZA A;  3PBS A;  2J9O A;  3UPP A;  4ZJ3 A;  3M6H A;  4OPZ A;  3LCE A;  3VP0 A;  1DJA A;  4C3Q A;  1PIO A;  5FI6 A;  2WGV A;  1ERO A;  1DJC A;  3GV9 A;  3OC2 A;  3SH9 A;  2DNS A;  4X55 A;  4JPM A;  4OQG A;  5CGX A;  5TGF A;  4KEN B;  2EX8 A;  5F1F A;  1KVM A;  3E2L A;  1ERM A;  2P9V A;  1MKI A;  4DE0 A;  3OPH A;  5JYO A;  5CHM A;  1BUE A;  4WBG A;  1WYC A;  4FSF A;  2EX2 A;  3BEC A;  2ZLY A;  4K91 A;  1MWU A;  4LV1 A;  3ZHH A;  3A3D A;  4ZTK A;  1ES3 A;  3BYD A;  2XDM A;  5FAS A;  3VP3 A;  1PWD A;  2HPB A;  3LEZ A;  4KQR A;  3ITA A;  2WGI A;  3WS5 A;  3SS4 A;  3IXG A;  1LHY A;  4KZB A;  2Y2J A;  1XPB A;  4WMC A;  3W4Q A;  4DRT A;  2QMI A;  5KSH A;  4BD1 A;  5HW3 A;  1KVL A;  1W8Q A;  2RCX A;  2WAD A;  4MNR A;  1W8Y A;  2VGJ A;  4N92 A;  4U0X A;  1YLZ A;  1BUL A;  3D4F A;  3M2K A;  4QD4 A;  1H8Y A;  4OVD A;  4S2N A;  4S2O A;  3ZVW A;  1Z6F A;  3BFE A;  5GLA A;  3AGE A;  3UDX A;  4WM9 A;  2Y2G A;  5E43 A;  4R4R A;  4MLL A;  5FQI A;  4BLM A;  2DCF A;  1PZO A;  5CXW A;  4JF4 A;  3HUN A;  3PBQ A;  3VOY A;  4C6Y A;  4DKI A;  1XGJ A;  1K38 A;  2Q9N A;  4FH2 A;  3ZFZ A;  4IVK A;  1ES2 A;  1NRF A;  2JBF A;  1LL5 A;  3SS5 A;  2DRW A;  1KDW A;  1KGE A;  3W8K A;  3G4P A;  3HLW A;  1VQQ A;  4S2I A;  5L2F A;  1YMX A;  1SDE A;  1YT4 A;  3W4P A;  3I7J A;  2EFX A;  3HL9 A;  3N8L A;  4FD8 A;  3WS1 A;  4Y0U A;  2C5W B;  1ONG A;  1I5Q A;  3LY3 A;  1CI9 A;  3PTE A;  5FAP A;  4R4S A;  4ZJ2 A;  4X53 A;  4WZ5 A;  3FV7 A;  1CI8 A;  1FCO A;  4WEK A;  5CHU A;  4Y0T A;  4LCL A;  1TDG A;  1IYO A;  1BSG A;  5FQK A;  2OLV A;  2XD5 A;  5AQA A;  3TSG A;  2CC1 A;  1MY8 A;  4KG5 A;  3HUO A;  3A3E A;  4E3O A;  4EWF A;  4IBR A;  1IEM A;  3LO7 A;  5D3O A;  3UDF A;  3VP2 A;  4E3L A;  1LLB A;  5CER A;  1HD8 A;  2OLU A;  5EOE A;  4EUZ A;  4EV4 A;  5G18 A;  3G30 A;  3P98 A;  3DWZ A;  4S2K A;  4PPR A;  3UN7 A;  2ZC6 B;  3RXX A;  1YLP A;  1ZKJ A;  5EUA A;  1L0F A;  3FZC A;  4OP8 A;  3UY6 A;  2XEP A;  4XUZ A;  5AQB A;  1KE4 A;  1MXO A;  5EVI D;  1GA9 A;  4WMC D;  4OQ0 A;  4B4X A;  3UDI A;  1ZC2 A;  1SDN A;  4LV3 A;  4IBX A;  4N9K A;  3V3R A;  4RVA A;  3UE3 A;  2FFF B;  3FKW A;  3OPR A;  3BFC A;  2XH9 A;  2Y2L A;  1PI4 A;  2Y2Q A;  4GDN A;  2RL3 A;  1EI5 A;  1TVF A;  2ZD8 A;  1NY0 A;  3BFF A;  1NXY A;  3WS2 A;  4DXC A;  3GMW A;  5A90 A;  2HP5 A;  1JTG A;  5HL1 A;  4MBF A;  5FAQ A;  3BLS A;  1U60 A;  1DJB A;  1NZU A;  5GLC A;  1TEM A;  3MZE A;  2ZC3 B;  4WEL A;  3PBT A;  1ZG4 A;  3WS4 A;  3PAE A;  3G35 A;  4ZAM A;  3FKV A;  3VFF A;  3RJU A;  3ZG8 B;  1H8Z A;  3ZDJ A;  4OLD A;  2XQZ A;  3WRZ A;  3SH7 A;  3PBN A;  5I94 A;  4JXV A;  4KZ3 A;  4Y0O A;  4EQI A;  5GLB A;  1KDS A;  3NBL A;  2ZQD A;  5EPH A;  3MFD A;  3FWL A;  2ZQ8 A;  4OQI A;  5F83 A;  5FQQ A;  4E3I A;  2WGW A;  3HVF A;  1ERQ A;  2PU2 A;  3CMZ A;  3UPO A;  1JWV A;  1CEF A;  5E2G A;  4YFM A;  1TDL A;  3IF6 B;  4L0L A;  4PM6 A;  4PMA A;  1LI9 A;  2G2W A;  3G34 A;  3NI9 A;  4FH4 A;  4OKP A;  2UWX A;  4YIN A;  3C4O A;  2Y2I A;  1OME A;  4OPQ A;  1O07 A;  4KG2 A;  1PZP A;  1ES5 A;  4EBL A;  1W79 A;  2R9W A;  4WYY A;  2JE5 A;  3Q7V B;  2HDU A;  2OV5 A;  5KMW A;  3MBZ A;  3Q82 A;  5FA7 A;  4QHC A;  1FR1 A;  3OPP A;  2IWC A;  1Y54 A;  5E2H A;  5EVI A;  4GOG A;  4BL3 A;  3GVB A;  3VP4 A;  4ZDX A;  3IXD A;  3CZD A;  5EE8 A;  1HTZ A;  3GQZ A;  2WKE A;  2EXA A;  2J8Y A;  1GA0 A;  1BLC A;  3N4I A;  5E2E A;  5JYP A;  4BQM A;  3NCK A;  4JF6 A;  1SCW A;  4E3J A;  5FI7 A;  3IF5 A;  3FYZ A;  1PI5 A;  5M18 A;  5CEB A;  3Q7Z A;  1IKI A;  4OON A;  1N9B A;  2X71 A;  4EBP A;  1KE3 A;  2JCH A;  3MZF A;  4K0W A;  2ZJ9 A;  1MWR A;  3GR2 A;  5EVI C;  1YM1 A;  3C4P A;  3EQV A;  3V5M A;  1ESU A;  1I2W A;  3M2J A;  3VFH A;  1JWZ A;  2J9P A;  5EOO A;  4DDS A;  3TOI A;  1QME A;  3HUM A;  2Y2K A;  3BFG A;  2B5R A;  3UPN A;  3N7W A;  3VMA A;  4S2N C;  4P87 A;  4JF5 A;  2EXB A;  1YLY A;  1XP4 A;  4LV0 A;  4N1H A;  5DVA A;  5GL9 A;  1L0D A;  3QNB A;  4UHU A;  5DTS A;  4GZB A;  4MBK A;  1E4D A;  3G31 A;  5FQM A;  4OH0 A;  1MWS A;  5CHJ A;  4KZ5 A;  2A3U A;  1CK3 A;  1FQG A;  3PBO A;  1KGG A;  1FCN A;  4HBU A;  5FAO A;  2Y2P A;  2ZC4 B;  2ZMA A;  2H10 A;  1K57 A;  4JLF A;  4DXB A;  5F1G A;  1LI0 A;  1SHV A;  1L0E A;  3MKF A;  4GB7 A;  3HBR A;  5CED A;  2Z2M B;  3MXS A;  1BLH A;  5HFO A;  2V1Z A;  4XUX A;  4LEN A;  1ALQ A;  3HLC A;  2A49 A;  1BTL A;  1KE0 A;  4JXG A;  3WWX A;  4B4Z A;  5U47 A;  5DF8 A;  1BT5 A;  2Y2M A;  3IF6 A;  3Q07 A;  3VSK A;  3E2K A;  3IXB A;  1FR6 A;  3MZD A;  3N8S A;  4HEF A;  3IXH A;  4R3J A;  4FCF A;  3VP1 A;  4WZ5 C;  1N4O A;  4WZ4 A;  3ZCZ A;  3SOI A;  4M3K A;  3ITB A;  2HP9 A;  3O88 A;  1RCJ A;  2FFY A;  3O3V A;  2X01 A;  2Y59 A;  3MKE A;  1W5D A;  3Q7V A;  5FQ9 A;  4R0Q A;  1I2S A;  4F94 A;  2QPN A;  3ZGA B;  3W4O A;  2IWD A;  3WRT A;  3HLB A;  4WEJ A;  4PM8 A;  5FQJ A;  1WYB A;  2ZQC A;  3JYI A;  1ZG6 A;  1S6R A;  1K55 A;  1YQS A;  3UE0 A;  5KSC A;  1K6R A;  3DWK A;  4C75 A;  2I72 A;  3IH9 A;  4OOM A;  1NYY A;  4OQH A;  5HAP A;  1M40 A;  4RYE A;  1NJ4 A;  1LL9 A;  4P85 A;  4Z9Q A;  1FSW A;  3C5A A;  4GD8 A;  1MBL A;  5KZH A;  2E8I A;  5CGS A;  2WZZ A;  3PBR A;  3ISG A;  4UA7 A;  1XGI A;  3N8R A;  1K56 D;  4Y7P A;  3S1Y A;  1PWG A;  1ES4 A;  4QB8 A;  3UNW A;  4DF6 A;  4JBF A;  3A3F A;  1WE4 A;  3O87 A;  1YLJ A;  2H0Y A;  4KZ7 A;  2WKH A;  4QY5 A;  4ZBE A;  3OZH A;  3NY4 A;  4LV2 A;  4KZ9 A;  4N9L A;  4QY6 A;  3BLM A;  4XXR A;  5HAI A;  3ZNY A;  3GTC A;  4IED A;  4R1G A;  4OPY A;  2R9X A;  2Y4A A;  2HDR A;  2WKI A;  5DF7 A;  3BRM A;  5EEC A;  1K6S A;  1XX2 A;  2EX6 A;  3HLF A;  4IVI A;  2ZQ9 A;  2ZQ7 A;  4OLG A;  2Y2H A;  5DF9 A;  3UO9 A;  4S2P A;  2XK1 A;  1YLT A;  2XF3 A;  1XA1 A;  3NC8 A;  1BLP A;  1PWC A;  1QMF A;  5J8X A;  5AQ7 A;  3NIA A;  4LCM A;  1L0G A;  3CG5 A;  2X02 A;  1JVJ A;  4MEZ A;  1EWZ A;  4DDY A;  4GKU A;  3WS0 A;  4X69 A;  3ZNT A;  2BLS A;  5CTM A;  3G2Z A;  5AQ9 A;  1IYP A;  1RGZ A;  1XA7 A;  3EQU A;  5HAR A;  4KQQ A;  3BEB A;  4X6T A;  5FI2 A;  2HDQ A;  3G32 A;  3PAG A;  2H5S A;  1M6K A;  2HDS A;  1HZO A;  2XD1 A;  4GNU A;  4KZ6 A;  4HES A;  4JKT A;  4GDB A;  4P0M A;  3S22 A;  3DW0 A;  1CEG A;  5CEC A;  3P09 A;  1IYQ A;  4A5R A;  4P6B A;  2EFU A;  4Q8I A;  4RX2 A;  1YMS A;  3IWO A;  1IKG A;  4CJN A;  1XXM A;  2ZM0 A;  3IWI A;  2XFT A;  5GHX A;  1YLW A;  2Q9M A;  4NK3 A;  1GHM A;  1HVB A;  1IEL A;  3M6B A;  4OPR A;  1AXB A;  2G2U A;  4U0T A;  1G6A A;  4JXW A;  3O86 A;  4E3N A;  3IHB A;  2ZM8 A;  3B3X A;  4OOY A;  1BLS A;  3VOZ A;  4MBH A;  3A3J A;  3S4X A;  1Q2Q A;  3ZG9 B;  5EVL A;  1O7E A;  5GHZ A;  1K56 A;  3QHY A;  5HX9 A;  3SH8 A;  2XLN A;  2Z2L B;  1PYY A;  3AGF A;  2PU4 A;  3ZG7 B;  1FCM A;  4K0X A;  2C6W B;  3CJM A;  1K54 A;  2XR0 A;  1K4E A;  1S0W A;  2XGN A;  3C7V A;  1DY6 A;  2Y91 A;  3IQA A;  3IT9 A;  5M19 A;  2P74 A;  5M1A A;  1NYM A;  1ONH A;  5DTK A;  2QZ6 A;  1VM1 A;  1MPL A;  3OCN A;  5CGW A;  2VGK A;  2WK0 A;  3QNC A;  4CPK A;  4DE2 A;  2J7V A;  3BM6 A;  1E3U D;  3TG9 A;  3A3I A;  1K4F A;  5HAQ A;  1GCE A;  2Y2O A;  1E25 A;  3OCL A;  2WGW B;  4JXS A;  3UE1 A;  1MWT A;  1K54 C;  3VSL A;  3HLE A;  4OP5 A;  4DE1 A;  3HLD A;  3ZG0 A;  4EBN A;  2P9V B;  1K57 C;  3IH8 A;  4PM9 A;  4BD0 A;  3LY4 A;  4E3M A;  4E6W A;  4O7D A;  4QU3 A;  4KQO A;  1RP5 A;  3N6I A;  4PM5 A;  2WYX A;  1XKZ A;  2H0T A;  4QJG A;  1JTD A;  3RXW A;  5CTN A;  4R23 A;  2Y55 A;  4BJP A;  3V3S A;  4PM7 A;  3GRJ A;  3IF6 C;  4S2M A;  2Y2N A;  5F82 A;  5TR7 A;  3ZVT A;  5EVI B;  2EX9 A;  4KZ8 A;  4S2L A;  2OSU A;  2PBY A;  2WZX A;  5FSR A;  5A92 A;  2BG1 A;  3Q1F A;  1K25 A;  3HRE A;  3GSG A;  4X56 A;  4GD6 A;  2V2F F;  4KZA A;  1GHI A;  4ID4 A;  4OOL A;  3OPL A;  2ZQA A;  2JC7 A;  1PW8 A;  4U3T A;  3DTM A;  4UAA A;  4BEN A;  4H8R A;  3BFD A;  5GHY A;  3C7U A;  3Q81 A;  3AGD A;  5FDH A;  4HBT A;  3MXR A;  4B88 A;  1J9M A;  1G68 A;  1W7F A;  4UA9 A;  5TFQ A;  3V50 A;  4E6X A;  5A93 A;  1SKF A;  1FSY A;  1NZO A;  5GLD A;  5IHV A;  1K55 C;  2IWB A;  5A91 A;  1JWP A;  3IHA A;  1IYS A;  4X68 A;  1PW1 A;  5E2F A;  4E3K A;  2XFS A;  3NDE A;  3V39 A;  3G2Y A;  4ZJ1 A;  2ZM2 A;  1KGF A;  1C3B A;  2WUQ A;  4BL2 A;  4D2O A;  4R3B A;  2WAE A;  1GHP A;  3NDG A;  1FOF A; 
#chains in the Genus database with same CATH topology
 5DTT A;  4KZ4 A;  4RA7 A;  3UE6 A;  3MXQ A;  4NET A;  1E3U A;  4GN2 A;  4DE3 A;  3VOL A;  3PBS A;  2J9O A;  4ZJ3 A;  3M6H A;  4X55 A;  5TGF A;  2BAS A;  5F1F A;  1ERM A;  3OPH A;  2ZL1 A;  1BUE A;  1WYC A;  2QKP A;  2ZOI A;  5EV0 A;  4LV1 A;  3ZHH A;  4ZTK A;  5FAS A;  1PWD A;  2Y2J A;  2JKR I;  2WAD A;  2KDK A;  2P04 A;  1YKD A;  3D4F A;  3F1P A;  3UMD A;  4BBV A;  4OVD A;  3UDX A;  4DJ2 A;  5CXW A;  3HUN A;  3PBQ A;  4DKI A;  4C6Y A;  1OTE A;  1F9I A;  1NRF A;  4GCZ A;  3B42 A;  3S7Q A;  3W8K A;  1KGE A;  4X25 A;  3G4P A;  3HLW A;  4S2I A;  1YMX A;  1SDE A;  1YT4 A;  2EFX A;  2KX6 A;  4FD8 A;  3WS1 A;  1ONG A;  2ZMV A;  5IS1 A;  1CI9 A;  1TS6 A;  3OBF A;  3FV7 A;  4Y0T A;  4LCL A;  5HL6 A;  3QP5 A;  3NOU C;  2Z6D A;  3TSG A;  4JGQ A;  2JKT I;  4EWF A;  5TJJ A;  5HZH A;  3LO7 A;  5D3O A;  4EUZ A;  4S2K A;  3BQ8 A;  2KOI A;  4HJ4 A;  2PT7 A;  3H7W B;  3UY6 A;  4XUZ A;  1DP6 A;  4WMC D;  4OQ0 A;  4B4X A;  3UDI A;  1ZC2 A;  3V3R A;  4N9K A;  1N9O A;  1PI4 A;  2Y2Q A;  2HP5 A;  5HL1 A;  3BY9 A;  1NZU A;  2J3T D;  1TEM A;  2ZC3 B;  3PBT A;  3MMH A;  1MZU A;  1ZG4 A;  3PAE A;  5F6A A;  3FKV A;  1PRQ A;  4NEE D;  4BBT A;  3T4J A;  5HWT A;  3L7H A;  3SH7 A;  4JXV A;  4Y17 A;  4KZ3 A;  5C5K A;  3TW8 A;  5F5Y A;  2ZQD A;  5FQQ A;  3HVF A;  4HJ6 A;  1TDL A;  4L9G A;  4PMA A;  3LIE A;  3LIF A;  3T4K A;  4II7 A;  3G34 A;  3NI9 A;  1EW0 A;  2Y2I A;  1OME A;  3MR0 A;  4OPQ A;  4O01 A;  3C38 A;  5HPF A;  5KMW A;  3Q82 A;  2IWC A;  4HH3 A;  5EVI A;  4BL3 A;  3CZD A;  2KLI A;  2WKE A;  2J8Y A;  3H7W A;  1XFN A;  3N4I A;  5E2E A;  4BQM A;  4G3W A;  1SCW A;  3VE3 A;  3IF5 A;  4LRZ E;  4I38 A;  2JCH A;  3MZF A;  3EQV A;  3M2J A;  5G4Z A;  3UB8 A;  5EOO A;  4DDS A;  3ZYT A;  3HUM A;  1VET A;  2B5R A;  3VMA A;  4S2N C;  1JNU A;  5DVA A;  2D02 A;  1P9R A;  4LV0 A;  5GL9 A;  4UHU A;  1MWS A;  4HBU A;  5FAO A;  1SHV A;  1L0E A;  3MKF A;  4GS9 B;  3HBR A;  1BLH A;  1ALQ A;  3BQA A;  2A49 A;  3T50 A;  3WWX A;  4JXG A;  2Y2M A;  3E2K A;  1FR6 A;  3MZD A;  3PYP A;  4WZ5 C;  3ZCZ A;  4WZ4 A;  2CMN A;  3LFV A;  2ZBB A;  3VE4 A;  1W5D A;  1NRJ A;  5DKL A;  4HJ3 A;  1DP9 A;  1XFQ A;  5KSC A;  3DWK A;  4C75 A;  2VEA A;  4I3A A;  1YSQ A;  4EER A;  3EEA A;  2W3E A;  2W1R A;  4RYE A;  4Z9Q A;  1LL9 A;  4GD8 A;  2WZZ A;  3PBR A;  3ISG A;  5DJU A;  3T1R A;  5EM0 A;  3S1Y A;  4QB8 A;  3UNW A;  1WE4 A;  3O87 A;  2WKH A;  5HAI A;  1NWZ A;  4N9L A;  4KZ9 A;  5DFY A;  3BLM A;  3NJA A;  2Y4A A;  2GZA A;  2HDR A;  5DF7 A;  3LGO A;  5DKK A;  5EEC A;  1K6S A;  2EX6 A;  5DF9 A;  3LI8 A;  4S2P A;  1S4R A;  2H28 A;  4MMN A;  4GS9 A;  5AQ7 A;  4LCM A;  1L0G A;  3CG5 A;  2X02 A;  4GKU A;  3NOT C;  4X69 A;  2BLS A;  5CTM A;  1RGZ A;  1XA7 A;  4Y2F A;  4X6T A;  2HDS A;  4KZ6 A;  4GNU A;  1OJG A;  4GDB A;  2O9C A;  4O0P A;  4RX2 A;  4QWO A;  3SZT A;  3JPU A;  2XFT A;  3UME A;  1YLW A;  3DTE A;  5LBR A;  3T12 B;  3O86 A;  4EXO A;  3DAV A;  2BTF P;  1BLS A;  5EVL A;  5GHZ A;  1K56 A;  2XLN A;  1FCM A;  2L1M A;  4K0X A;  3VV4 A;  2XR0 A;  3IQA A;  1DY6 A;  2L0W A;  2P74 A;  1ONH A;  5DTK A;  1VM1 A;  1MPL A;  3PHY A;  2PYP A;  2WK0 A;  3QNC A;  4DE2 A;  3QP2 A;  5EM1 A;  3P7N A;  1E25 A;  4JXS A;  1K54 C;  1VB6 A;  3HLE A;  4OP5 A;  4EEP A;  2P9V B;  4BD0 A;  3LY4 A;  2HJ9 C;  4E6W A;  2M7U A;  1DP8 A;  2EWV A;  2LB9 A;  3H9W A;  3KSH A;  2WYX A;  3BWL A;  4QJG A;  2FH5 A;  4YNR A;  1F98 A;  1TS8 A;  4BJP A;  4EUV A;  3IF6 C;  5TR7 A;  4ETX A;  2EX9 A;  4S2L A;  3K2N A;  3Q1F A;  3GSG A;  1GHI A;  4RQ9 A;  2JC7 A;  4U3T A;  4H8R A;  2A2L A;  5GHY A;  3Q81 A;  3O5Y A;  5FDH A;  3IX4 A;  1W7F A;  5TFQ A;  4LRY C;  1N9N A;  1K55 C;  1T1A A;  3IHA A;  1IYS A;  5K5B A;  3G2Y A;  5HSQ A;  1KGF A;  1GHP A;  3LR3 A;  3HLG A;  2W27 A;  4AFI A;  4DJ3 A;  4UA6 A;  2JHE A;  3IWQ A;  2ZOH A;  2GDN A;  3SS3 A;  4Y15 A;  2J3W A;  3VP0 A;  1HLU P;  1PIO A;  2WGV A;  4CLC E;  5CGX A;  4KEN B;  2EX8 A;  3E4O A;  3E2L A;  2P9V A;  4DE0 A;  3A0V A;  4FSF A;  3BEC A;  2ZLY A;  1V9Z A;  1S66 L;  2XDM A;  1T18 A;  4CQH A;  1UGU A;  3ITA A;  2WGI A;  3WS5 A;  1LHY A;  4KZB A;  1XPB A;  4WMC A;  2R78 A;  3T1X A;  4U0X A;  2VGJ A;  1YLZ A;  3M2K A;  2QWS A;  1H8Y A;  4S2N A;  3BFE A;  2VZW A;  4R4R A;  4MLL A;  5FQI A;  1PZO A;  2O9A A;  1S1Y A;  3BY8 A;  2OAQ 1;  2JBF A;  3SS5 A;  2DRW A;  5FEG A;  4Y5F A;  4Y13 A;  1VQQ A;  5AVE A;  3HL9 A;  3N8L A;  4Y0U A;  1PFL A;  4WL9 A;  4WZ5 A;  5A8B A;  1FCO A;  4WEK A;  1TD5 A;  5FQK A;  2YKH A;  2CC1 A;  1MY8 A;  2XRN A;  3A3E A;  4E3O A;  3CIT A;  4GHI B;  5L07 A;  1G6O A;  2OLU A;  3EOI A;  2ZC6 B;  2PDR A;  1L0F A;  1TS7 A;  3FZC A;  4B93 A;  2XEP A;  3CLO A;  2IA2 A;  1MXO A;  3U4L P;  3T4T A;  4E04 A;  3H82 B;  4IBX A;  3MS6 A;  3UE3 A;  3BFC A;  2XH9 A;  2Y2L A;  4GDN A;  3LR5 A;  2ZD8 A;  1TVF A;  4MN5 A;  4EU0 A;  1NXY A;  5A90 A;  1JTG A;  5J7E A;  1P97 A;  4GLQ A;  2VK3 A;  3WS4 A;  3G35 A;  3G6O A;  1H8Z A;  2V1A A;  4HH2 A;  4Y0O A;  5EPH A;  3T4L A;  2ZQ8 A;  5F83 A;  2PU2 A;  3CMZ A;  4NXB A;  3UPO A;  3IF6 B;  4B9O A;  4PM6 A;  4WLA A;  4FH4 A;  5TBM B;  5AVF A;  1O07 A;  4KG2 A;  1PZP A;  1ES5 A;  1W79 A;  2JE5 A;  3Q7V B;  4GHI A;  5FA7 A;  1FR1 A;  3OPP A;  1Y54 A;  4GOG A;  3GVB A;  4F3L B;  5JYP A;  4JF6 A;  2OWJ A;  5FI7 A;  3H82 A;  5CEB A;  3Q7Z A;  4WF0 A;  1N9B A;  2X71 A;  4EBP A;  1KE3 A;  4MDZ A;  1ESU A;  2J9P A;  3BFG A;  3IX8 A;  3UPN A;  1PNE A;  4P87 A;  4JF5 A;  1XP4 A;  4MBK A;  1E4D A;  3G31 A;  3PR6 A;  4OH0 A;  5CHJ A;  1CK3 A;  3R7W B;  1XJ4 A;  4GJ4 A;  4DXB A;  4PHT A;  2PBD P;  1A0K A;  4GB7 A;  2Z2M B;  5F69 A;  2Z6C A;  1BTL A;  1KE0 A;  3PXP A;  3K3D A;  4B4Z A;  3T1Q B;  5U47 A;  3IF6 A;  2ACG A;  4I5S A;  3N8S A;  3VP1 A;  3MQO A;  1N4O A;  4M3K A;  3ITB A;  3RTY A;  1T1B A;  2Y59 A;  3MKE A;  3Q7V A;  5FQ9 A;  4HP9 A;  4CLC D;  2L4R A;  2QPN A;  3ZGA B;  3W4O A;  4MCW A;  2D01 A;  4WEJ A;  5FQJ A;  2VGL S;  4F3L A;  1WYB A;  3JYI A;  1ZG6 A;  1K55 A;  1YQS A;  2P7J A;  4OOM A;  2WKR A;  4OQH A;  1M40 A;  1NJ4 A;  3C5A A;  2B95 A;  2E8I A;  1VEU B;  2PR6 A;  2QJ5 A;  2I9V A;  1OTD A;  1CQA A;  1PWG A;  2K2N A;  3B47 A;  5F68 A;  5L10 A;  4KZ7 A;  3NY4 A;  4LV2 A;  4QY6 A;  3R4K A;  4R1G A;  4IED A;  2R9X A;  4IVI A;  4OLG A;  3R7W A;  2ZQ9 A;  2ZQ7 A;  3QP8 A;  1SKO B;  5KIZ A;  4MN6 A;  1BLP A;  1PWC A;  3NIA A;  4MEZ A;  5EFW A;  1JVJ A;  2GX5 A;  3HJI A;  4DDY A;  3ZNT A;  5HAR A;  2XA7 S;  3CHW P;  1M6K A;  2XD1 A;  1OJ5 A;  4G3V A;  4HES A;  4JKT A;  3DW0 A;  1CEG A;  1IYQ A;  4A5R A;  1LSW A;  1YMS A;  1IKG A;  1S1Z A;  5GHX A;  4OPR A;  1IEL A;  1XJ2 A;  3U2A A;  4U0T A;  1G6A A;  4ETZ A;  3IHB A;  2XRO A;  2ZM8 A;  3B3X A;  5HD3 A;  3A3J A;  1O7E A;  3QHY A;  2Z2L B;  3CJM A;  1VEU A;  2J3T C;  1K4E A;  1S0W A;  3LI9 A;  3C7V A;  3IT9 A;  5M19 A;  1MKM A;  5M1A A;  2W3D A;  1YPR A;  5CGW A;  3LR0 A;  3EEH A;  2YKF A;  3BM6 A;  1E3U D;  1KOU A;  3A3I A;  1K4F A;  1GCE A;  2HV1 A;  2WGW B;  4FTX A;  3UE1 A;  1H3Q A;  1MWT A;  1SKO A;  5HDD A;  4PM9 A;  4E3M A;  2FZ0 A;  1UWN X;  1JTD A;  3QP6 A;  4NXE A;  4PM7 A;  3V3S A;  3GRJ A;  4S2M A;  2Y2N A;  4KZ8 A;  2OSU A;  2PBY A;  5A92 A;  5IU1 A;  1K25 A;  4X56 A;  2V2F F;  3OPL A;  2G7U A;  2ZQA A;  4P6Z S;  1N9L A;  4BEN A;  3BFD A;  2M1C A;  3C7U A;  4B88 A;  3V50 A;  1SKF A;  1FSY A;  4BMW A;  5GLD A;  4H6J B;  4X68 A;  2EWW A;  1PW1 A;  4E3K A;  5FL3 A;  3LID A;  4R3B A;  3ZG5 A;  2ZC7 A;  4ESP A;  4S2J A;  5CRF A;  2ZC5 B;  1BZA A;  2NUT C;  4C3Q A;  2INW A;  3GV9 A;  3IBR A;  3OC2 A;  4HOI A;  2DNS A;  1VHM A;  3KYQ A;  4OQG A;  5FDS A;  3LEQ A;  1KVM A;  1MKI A;  5JYO A;  5CHM A;  4WBG A;  1MWU A;  2W3H A;  2V8F A;  3A3D A;  3BYD A;  3VP3 A;  4KQR A;  5L8M A;  3SS4 A;  3IXG A;  1G5U A;  4Y3I A;  3W4Q A;  3A0S A;  1KVL A;  2RCX A;  4MNR A;  2PAV P;  1F5M A;  1W8Y A;  1BUL A;  3C2W A;  4QD4 A;  2GJ3 A;  1Z6F A;  1AWI A;  1BYW A;  2Q0O A;  1OT6 A;  2Y2G A;  4BLM A;  4JF4 A;  3VOY A;  4FH2 A;  4H6J A;  5MC7 A;  1H0M A;  1LL5 A;  1KDW A;  3CI6 A;  3JVU A;  3W4P A;  2UV0 E;  4PKY A;  3D9Y A;  2C5W B;  1I5Q A;  3PTE A;  5FAP A;  4X53 A;  2VV8 A;  4DMZ A;  3E4Q A;  1CJF A;  1IYO A;  2XD5 A;  5I5L A;  4KG5 A;  3IX3 A;  4I39 A;  4LLO B;  1LT0 A;  3UDF A;  4E3L A;  1HD8 A;  5EOE A;  2PD7 A;  3P98 A;  3DWZ A;  4PPR A;  1YLP A;  1ZKJ A;  5EUA A;  4ARZ B;  4OP8 A;  2VGL M;  1P9W A;  3ICY A;  4JGR A;  5EVI D;  1GA9 A;  3S7O A;  1LSX A;  1SDN A;  2FFF B;  3NOP C;  3OPR A;  2K31 A;  2RL3 A;  1ODV A;  2PRF A;  3BFF A;  3GMW A;  4MBF A;  4D60 A;  5GLC A;  3MZE A;  4WEL A;  4ZAM A;  3VFF A;  3RJU A;  4OLD A;  2QYB A;  3B33 A;  3WRZ A;  3PBN A;  5I94 A;  2Y8H A;  4EQI A;  5GLB A;  1KDS A;  3NBL A;  3MFD A;  4OQI A;  1SZV A;  4Z1W A;  1JWV A;  1CEF A;  3LIB A;  5E2G A;  4YFM A;  4L0L A;  1LI9 A;  2G2W A;  4OKP A;  2V8C A;  3C4O A;  2XA7 M;  3MQ0 A;  4NKP A;  4EBL A;  2R9W A;  1GSW A;  2HDU A;  2V0W A;  4ZDX A;  5IT5 A;  3CPT B;  5EE8 A;  3C30 A;  4ARZ A;  3GQZ A;  3T4Q A;  2EXA A;  1GA0 A;  1D7E A;  2O9B A;  3S7P A;  4E3J A;  3FYZ A;  1PI5 A;  2VX8 A;  5M18 A;  4OON A;  1IKI A;  2NUP C;  2JKG A;  2ZJ9 A;  5EVI C;  3C4P A;  3V5M A;  1I2W A;  3VFH A;  1JWZ A;  3OOV A;  2V0U A;  2O99 A;  5FQM A;  4KZ5 A;  2A3U A;  2J80 A;  1FQG A;  1FCN A;  1CF0 A;  2GNX A;  2Y2P A;  2ZC4 B;  2ZMA A;  2H10 A;  4JLF A;  1J3W A;  5F1G A;  5HFO A;  2V1Z A;  4XUX A;  4LEN A;  3FG8 A;  3HLC A;  2W3F A;  4XT2 B;  3IBJ A;  5DF8 A;  4G3K A;  3VSK A;  3Q07 A;  2WKP A;  4HEF A;  3IXH A;  4R3J A;  4LGW A;  4M4X A;  1STZ A;  3MSH A;  3LR4 A;  3O88 A;  1RCJ A;  2PHY A;  4R0Q A;  1Z09 A;  2IWD A;  3E0Y A;  3WRT A;  4P6Z M;  4PM8 A;  3UB7 A;  2VJW A;  3LIA A;  1K6R A;  3NHQ A;  4EW7 A;  2I72 A;  3IH9 A;  4FOF A;  1FSW A;  4FUW A;  3T1S A;  2VV7 A;  4YWZ A;  1K56 D;  4DF6 A;  4JBF A;  4IUH A;  1YLJ A;  3ZNY A;  3BRM A;  4I3J A;  1S4S A;  2Y2H A;  4QPR A;  3UO9 A;  2XK1 A;  1YLT A;  2XF3 A;  2WKQ A;  2EA9 A;  4UQI S;  1EWZ A;  4XT2 A;  3WS0 A;  1IYP A;  3EQU A;  4DN0 A;  5EVE A;  2HDQ A;  3G32 A;  2H5S A;  1TF1 A;  1UWP X;  5CEC A;  4P6B A;  4Q8I A;  3T4S A;  1XXM A;  2ZM0 A;  4KQD A;  3IWI A;  1OTI A;  1GHM A;  1HVB A;  2G2U A;  1GSV A;  2JKF A;  4E3N A;  3D72 A;  4OOY A;  3VOZ A;  1F2K A;  4MBH A;  1Q2Q A;  3KO6 A;  3ZQ5 A;  1PYY A;  2C6W B;  3TJZ C;  1K54 A;  3F1O B;  2XGN A;  2Y91 A;  3OCN A;  2VGK A;  5J3W A;  2J7V A;  3KSI A;  4LPZ A;  3TG9 A;  3MJQ A;  5HAQ A;  2Y2O A;  4NG2 A;  3OCL A;  2B18 A;  3VSL A;  4DE1 A;  4HP4 A;  5TBM A;  1K57 C;  3W2Z A;  3NEC A;  3GDI A;  4O7D A;  2HGV A;  4KQO A;  3N6I A;  4PM5 A;  1XKZ A;  4R23 A;  4BBU A;  5HWW A;  5EVI B;  4JGP A;  2WZX A;  5FSR A;  3HRE A;  4KZA A;  4ID4 A;  4OOL A;  3DBA A;  3MQQ A;  3AGD A;  4HBT A;  3MXR A;  1J9M A;  5HPI A;  3CUE C;  4UA9 A;  4E6X A;  5A93 A;  3E98 A;  1ACF A;  1NZO A;  5IHV A;  1JWP A;  3NDE A;  3V39 A;  2W1T B;  3IS2 B;  2WUQ A;  1VET B;  4R3A A;  4BL2 A;  2WAE A;  3NDG A;  4EEU A;  1FOF A;  2V20 A;  3F1O A;  3E4P A;  4KG6 A;  1Q2P A;  4RX3 A;  2WAF A;  1RGY A;  1H5X A;  5BOH A;  4PAU A;  1L2S A;  1ESI A;  4N1X A;  2HP6 A;  5FAT A;  2DMW A;  5G4Y A;  3UPP A;  1LL8 A;  4OPZ A;  3LCE A;  4HI4 A;  1DJA A;  3KSG A;  5FI6 A;  1ERO A;  1DJC A;  3SH9 A;  4JPM A;  2VLG A;  3DTK A;  4LRX C;  1V9Y A;  5HDS A;  2OAP 1;  1IFQ A;  2EX2 A;  4K91 A;  3K3C A;  1ES3 A;  1G28 A;  1OTA A;  2HPB A;  3LEZ A;  3HCY A;  4CLC C;  4DRT A;  1K0K A;  2PR5 A;  2QMI A;  5KSH A;  4BD1 A;  5HW3 A;  1W8Q A;  3OLO A;  4N92 A;  4IUK A;  4JGO A;  4S2O A;  3ZVW A;  2JN7 A;  5GLA A;  3AGE A;  4WM9 A;  1NLZ A;  5E43 A;  1T1C A;  2DCF A;  1H8M A;  1XGJ A;  1K38 A;  2Q9N A;  3ZFZ A;  4IVK A;  1ES2 A;  3FPW A;  1X0O A;  2VKS A;  2W1T A;  3DTI A;  3IS2 A;  4ZRR A;  2B02 A;  5L2F A;  4PKY G;  3I7J A;  3LY3 A;  3NUL A;  4R4S A;  2M7V A;  4ZJ2 A;  3P01 A;  1ZHH B;  3D3O A;  1Y28 A;  3S7N A;  1CI8 A;  5CHU A;  5DJT A;  4NXF A;  4BWI A;  1TDG A;  1BSG A;  4HIA A;  2OLV A;  5AQA A;  3KX0 X;  3HUO A;  1D1J A;  4IBR A;  1D06 A;  1IEM A;  3VP2 A;  1LLB A;  5CER A;  3EWK A;  4EV4 A;  5G18 A;  3G30 A;  3UN7 A;  3RXX A;  2LB5 A;  2V9A A;  3QP1 A;  4X1M A;  5AQB A;  1KE4 A;  3EGD C;  3V67 A;  2HJE A;  5FEF A;  4LV3 A;  4Q0I A;  4R70 A;  4RVA A;  3FKW A;  2ZMF A;  1EI5 A;  1NY0 A;  3WS2 A;  4DXC A;  3A0R A;  5FAQ A;  4HNB A;  3BLS A;  1U60 A;  1DJB A;  4KUO A;  4EQ1 A;  3CAX A;  4R6L A;  1IOU A;  3ZG8 B;  3ZDJ A;  3KYE A;  2XQZ A;  4WUJ A;  1YAX A;  3UB6 A;  1W63 Q;  3FWL A;  4E3I A;  4I3I A;  2WGW A;  1MC0 A;  1ERQ A;  2K7S A;  1P0Z A;  4UQI M;  2PD8 A;  5DFX A;  4HY8 A;  2UWX A;  4YIN A;  2OOL A;  4UEY A;  3LUQ A;  5L09 A;  4WYY A;  3CWF A;  2OV5 A;  3MBZ A;  3JVV A;  4QHC A;  5E2H A;  3VP4 A;  3IXD A;  4EET B;  1HTZ A;  3MF0 A;  3T4O A;  1S67 L;  1BLC A;  3EGX C;  3NCK A;  2V1B A;  4WN5 A;  3TRC A;  4K0W A;  1MWR A;  2VV6 A;  3GR2 A;  2W0N A;  1YM1 A;  3TOI A;  1QME A;  2Y2K A;  3F1N B;  3N7W A;  2E8J A;  2VA0 A;  2EXB A;  1YLY A;  3L9K A;  4N1H A;  1L0D A;  3FC7 A;  3QNB A;  4YOF A;  5DTS A;  4GZB A;  1Y4O A;  2A24 B;  3PBO A;  1KGG A;  2HZ5 A;  1K57 A;  2HF6 A;  4L9E A;  1LI0 A;  4Q0J A;  5AJG A;  5CED A;  3MXS A;  3HJK A;  3TE8 A;  1BT5 A;  1XJ6 A;  1OT9 A;  3IXB A;  4CLC B;  1NLY A;  4FCF A;  3SOI A;  4HQA A;  2HP9 A;  2FFY A;  3O3V A;  2X01 A;  4GW9 A;  1GSX A;  1I2S A;  4F94 A;  3HLB A;  3CUE A;  4R38 A;  2ZQC A;  1S6R A;  1XJ3 A;  3UE0 A;  4KUK A;  5HD5 A;  1NYY A;  5HAP A;  1WA9 A;  4P85 A;  4X1L A;  3LIC A;  1MBL A;  5KZH A;  5CGS A;  3BJN A;  4UA7 A;  1XGI A;  3N8R A;  2Y79 A;  2AVX A;  4Y7P A;  1ES4 A;  3F1N A;  3A3F A;  2H0Y A;  1DRM A;  4QY5 A;  4ZBE A;  3OZH A;  4XXR A;  3GTC A;  4OPY A;  3UB9 A;  2A24 A;  2WKI A;  1XX2 A;  3HLF A;  2P08 A;  5CX7 A;  1OPX A;  1XA1 A;  3NC8 A;  3SW1 A;  1QMF A;  5J8X A;  3QP4 A;  3G2Z A;  5AQ9 A;  2QHK A;  4KQQ A;  3BEB A;  5FI2 A;  4LFU A;  3PAG A;  4CLC A;  5J4E A;  1HZO A;  2JKR M;  3C8C A;  4HHD A;  4NXG A;  4P0M A;  3S22 A;  3P09 A;  1L3L A;  2EFU A;  4EES A;  3BW6 A;  3IWO A;  4CJN A;  4L9F A;  2Q9M A;  4NK3 A;  3M6B A;  1AXB A;  4JXW A;  1W63 M;  3KSF A;  3S4X A;  3ZG9 B;  5HX9 A;  3SH8 A;  3AGF A;  2PU4 A;  4MN7 A;  3ZG7 B;  1OTB A;  1LSV A;  4Q0H A;  2PYR A;  1NYM A;  2QZ6 A;  4CPK A;  2JKT M;  5HWV A;  4ME4 A;  4IJG A;  3MFX A;  2MJ6 A;  3HLD A;  3ZG0 A;  4EBN A;  3UB5 P;  2ZL1 B;  3IH8 A;  4QU3 A;  1RP5 A;  2H0T A;  3RXW A;  5CTN A;  2Y55 A;  2XSS A;  5F82 A;  3CPT A;  2QJ7 A;  3ZVT A;  1YSP A;  1T19 A;  2BG1 A;  2W3G A;  4GD6 A;  3GEC A;  3F1P B;  1PW8 A;  3DTM A;  3LYX A;  2O0Y A;  4UAA A;  1FIK A;  3RH8 B;  4O8G A;  1G68 A;  3ULF A;  4K08 A;  2OWH A;  2IWB A;  5A91 A;  5E2F A;  2XFS A;  3RFB A;  1TS0 A;  1FIL A;  4ZJ1 A;  2ZM2 A;  3KYZ A;  1C3B A;  4D2O A;  5HDC A;  1ZTU A;  4IHQ A;  3FPV A; 
#chains in the Genus database with same CATH homology
 2V20 A;  3HLG A;  5DTT A;  4KG6 A;  4KZ4 A;  4RA7 A;  3ZG5 A;  1Q2P A;  4RX3 A;  4NET A;  4UA6 A;  2WAF A;  2ZC7 A;  1RGY A;  1H5X A;  1E3U A;  5BOH A;  3IWQ A;  4GN2 A;  1L2S A;  4DE3 A;  1ESI A;  4N1X A;  4S2J A;  2GDN A;  2HP6 A;  5CRF A;  3SS3 A;  2ZC5 B;  5FAT A;  1BZA A;  3PBS A;  2J9O A;  3UPP A;  4ZJ3 A;  3M6H A;  4OPZ A;  3LCE A;  3VP0 A;  1DJA A;  4C3Q A;  1PIO A;  5FI6 A;  2WGV A;  1ERO A;  1DJC A;  3GV9 A;  3OC2 A;  3SH9 A;  2DNS A;  4X55 A;  4JPM A;  4OQG A;  5CGX A;  5TGF A;  4KEN B;  2EX8 A;  5F1F A;  1KVM A;  3E2L A;  1ERM A;  2P9V A;  1MKI A;  4DE0 A;  3OPH A;  5JYO A;  5CHM A;  1BUE A;  4WBG A;  1WYC A;  4FSF A;  2EX2 A;  3BEC A;  2ZLY A;  4K91 A;  1MWU A;  4LV1 A;  3ZHH A;  3A3D A;  4ZTK A;  1ES3 A;  3BYD A;  2XDM A;  5FAS A;  3VP3 A;  1PWD A;  2HPB A;  3LEZ A;  4KQR A;  3ITA A;  2WGI A;  3WS5 A;  3SS4 A;  3IXG A;  1LHY A;  4KZB A;  2Y2J A;  1XPB A;  4WMC A;  3W4Q A;  4DRT A;  2QMI A;  5KSH A;  4BD1 A;  5HW3 A;  1KVL A;  1W8Q A;  2RCX A;  2WAD A;  4MNR A;  1W8Y A;  2VGJ A;  4N92 A;  4U0X A;  1YLZ A;  1BUL A;  3D4F A;  3M2K A;  4QD4 A;  1H8Y A;  4OVD A;  4S2N A;  4S2O A;  3ZVW A;  1Z6F A;  3BFE A;  5GLA A;  3AGE A;  3UDX A;  4WM9 A;  2Y2G A;  5E43 A;  4R4R A;  4MLL A;  5FQI A;  4BLM A;  2DCF A;  1PZO A;  5CXW A;  4JF4 A;  3HUN A;  3PBQ A;  3VOY A;  4C6Y A;  4DKI A;  1XGJ A;  1K38 A;  2Q9N A;  4FH2 A;  3ZFZ A;  4IVK A;  1ES2 A;  1NRF A;  2JBF A;  1LL5 A;  3SS5 A;  2DRW A;  1KDW A;  1KGE A;  3W8K A;  3G4P A;  3HLW A;  1VQQ A;  4S2I A;  5L2F A;  1YMX A;  1SDE A;  1YT4 A;  3W4P A;  3I7J A;  2EFX A;  3HL9 A;  3N8L A;  4FD8 A;  3WS1 A;  4Y0U A;  2C5W B;  1ONG A;  1I5Q A;  3LY3 A;  1CI9 A;  3PTE A;  5FAP A;  4R4S A;  4ZJ2 A;  4X53 A;  4WZ5 A;  3FV7 A;  1CI8 A;  1FCO A;  4WEK A;  5CHU A;  4Y0T A;  4LCL A;  1TDG A;  1IYO A;  1BSG A;  5FQK A;  2OLV A;  2XD5 A;  5AQA A;  3TSG A;  2CC1 A;  1MY8 A;  4KG5 A;  3HUO A;  3A3E A;  4E3O A;  4EWF A;  4IBR A;  1IEM A;  3LO7 A;  5D3O A;  3UDF A;  3VP2 A;  4E3L A;  1LLB A;  5CER A;  1HD8 A;  2OLU A;  5EOE A;  4EUZ A;  4EV4 A;  5G18 A;  3G30 A;  3P98 A;  3DWZ A;  4S2K A;  4PPR A;  3UN7 A;  2ZC6 B;  3RXX A;  1YLP A;  1ZKJ A;  5EUA A;  1L0F A;  3FZC A;  4OP8 A;  3UY6 A;  2XEP A;  4XUZ A;  5AQB A;  1KE4 A;  1MXO A;  5EVI D;  1GA9 A;  4WMC D;  4OQ0 A;  4B4X A;  3UDI A;  1ZC2 A;  1SDN A;  4LV3 A;  4IBX A;  4N9K A;  3V3R A;  4RVA A;  3UE3 A;  2FFF B;  3FKW A;  3OPR A;  3BFC A;  2XH9 A;  2Y2L A;  1PI4 A;  2Y2Q A;  4GDN A;  2RL3 A;  1EI5 A;  1TVF A;  2ZD8 A;  1NY0 A;  3BFF A;  1NXY A;  3WS2 A;  4DXC A;  3GMW A;  5A90 A;  2HP5 A;  1JTG A;  5HL1 A;  4MBF A;  5FAQ A;  3BLS A;  1U60 A;  1DJB A;  1NZU A;  5GLC A;  1TEM A;  3MZE A;  2ZC3 B;  4WEL A;  3PBT A;  1ZG4 A;  3WS4 A;  3PAE A;  3G35 A;  4ZAM A;  3FKV A;  3VFF A;  3RJU A;  3ZG8 B;  1H8Z A;  3ZDJ A;  4OLD A;  2XQZ A;  3WRZ A;  3SH7 A;  3PBN A;  5I94 A;  4JXV A;  4KZ3 A;  4Y0O A;  4EQI A;  5GLB A;  1KDS A;  3NBL A;  2ZQD A;  5EPH A;  3MFD A;  3FWL A;  2ZQ8 A;  4OQI A;  5F83 A;  5FQQ A;  4E3I A;  2WGW A;  3HVF A;  1ERQ A;  2PU2 A;  3CMZ A;  3UPO A;  1JWV A;  1CEF A;  5E2G A;  4YFM A;  1TDL A;  3IF6 B;  4L0L A;  4PM6 A;  4PMA A;  1LI9 A;  2G2W A;  3G34 A;  3NI9 A;  4FH4 A;  4OKP A;  2UWX A;  4YIN A;  3C4O A;  2Y2I A;  1OME A;  4OPQ A;  1O07 A;  4KG2 A;  1PZP A;  1ES5 A;  4EBL A;  1W79 A;  2R9W A;  4WYY A;  2JE5 A;  3Q7V B;  2HDU A;  2OV5 A;  5KMW A;  3MBZ A;  3Q82 A;  5FA7 A;  4QHC A;  1FR1 A;  3OPP A;  2IWC A;  1Y54 A;  5E2H A;  5EVI A;  4GOG A;  4BL3 A;  3GVB A;  3VP4 A;  4ZDX A;  3IXD A;  3CZD A;  5EE8 A;  1HTZ A;  3GQZ A;  2WKE A;  2EXA A;  2J8Y A;  1GA0 A;  1BLC A;  3N4I A;  5E2E A;  5JYP A;  4BQM A;  3NCK A;  4JF6 A;  1SCW A;  4E3J A;  5FI7 A;  3IF5 A;  3FYZ A;  1PI5 A;  5M18 A;  5CEB A;  3Q7Z A;  1IKI A;  4OON A;  1N9B A;  2X71 A;  4EBP A;  1KE3 A;  2JCH A;  3MZF A;  4K0W A;  2ZJ9 A;  1MWR A;  3GR2 A;  5EVI C;  1YM1 A;  3C4P A;  3EQV A;  3V5M A;  1ESU A;  1I2W A;  3M2J A;  3VFH A;  1JWZ A;  2J9P A;  5EOO A;  4DDS A;  3TOI A;  1QME A;  3HUM A;  2Y2K A;  3BFG A;  2B5R A;  3UPN A;  3N7W A;  3VMA A;  4S2N C;  4P87 A;  4JF5 A;  2EXB A;  1YLY A;  1XP4 A;  4LV0 A;  4N1H A;  5DVA A;  5GL9 A;  1L0D A;  3QNB A;  4UHU A;  5DTS A;  4GZB A;  4MBK A;  1E4D A;  3G31 A;  5FQM A;  4OH0 A;  1MWS A;  5CHJ A;  4KZ5 A;  2A3U A;  1CK3 A;  1FQG A;  3PBO A;  1KGG A;  1FCN A;  4HBU A;  5FAO A;  2Y2P A;  2ZC4 B;  2ZMA A;  2H10 A;  1K57 A;  4JLF A;  4DXB A;  5F1G A;  1LI0 A;  1SHV A;  1L0E A;  3MKF A;  4GB7 A;  3HBR A;  5CED A;  2Z2M B;  3MXS A;  1BLH A;  5HFO A;  2V1Z A;  4XUX A;  4LEN A;  1ALQ A;  3HLC A;  2A49 A;  1BTL A;  1KE0 A;  4JXG A;  3WWX A;  4B4Z A;  5U47 A;  5DF8 A;  1BT5 A;  2Y2M A;  3IF6 A;  3Q07 A;  3VSK A;  3E2K A;  3IXB A;  1FR6 A;  3MZD A;  3N8S A;  4HEF A;  3IXH A;  4R3J A;  4FCF A;  3VP1 A;  4WZ5 C;  1N4O A;  4WZ4 A;  3ZCZ A;  3SOI A;  4M3K A;  3ITB A;  2HP9 A;  3O88 A;  1RCJ A;  2FFY A;  3O3V A;  2X01 A;  2Y59 A;  3MKE A;  1W5D A;  3Q7V A;  5FQ9 A;  4R0Q A;  1I2S A;  4F94 A;  2QPN A;  3ZGA B;  3W4O A;  2IWD A;  3WRT A;  3HLB A;  4WEJ A;  4PM8 A;  5FQJ A;  1WYB A;  2ZQC A;  3JYI A;  1ZG6 A;  1S6R A;  1K55 A;  1YQS A;  3UE0 A;  5KSC A;  1K6R A;  3DWK A;  4C75 A;  2I72 A;  3IH9 A;  4OOM A;  1NYY A;  4OQH A;  5HAP A;  1M40 A;  4RYE A;  1NJ4 A;  1LL9 A;  4P85 A;  4Z9Q A;  1FSW A;  3C5A A;  4GD8 A;  1MBL A;  5KZH A;  2E8I A;  5CGS A;  2WZZ A;  3PBR A;  3ISG A;  4UA7 A;  1XGI A;  3N8R A;  1K56 D;  4Y7P A;  3S1Y A;  1PWG A;  1ES4 A;  4QB8 A;  3UNW A;  4DF6 A;  4JBF A;  3A3F A;  1WE4 A;  3O87 A;  1YLJ A;  2H0Y A;  4KZ7 A;  2WKH A;  4QY5 A;  4ZBE A;  3OZH A;  3NY4 A;  4LV2 A;  4KZ9 A;  4N9L A;  4QY6 A;  3BLM A;  4XXR A;  5HAI A;  3ZNY A;  3GTC A;  4IED A;  4R1G A;  4OPY A;  2R9X A;  2Y4A A;  2HDR A;  2WKI A;  5DF7 A;  3BRM A;  5EEC A;  1K6S A;  1XX2 A;  2EX6 A;  3HLF A;  4IVI A;  2ZQ9 A;  2ZQ7 A;  4OLG A;  2Y2H A;  5DF9 A;  3UO9 A;  4S2P A;  2XK1 A;  1YLT A;  2XF3 A;  1XA1 A;  3NC8 A;  1BLP A;  1PWC A;  1QMF A;  5J8X A;  5AQ7 A;  3NIA A;  4LCM A;  1L0G A;  3CG5 A;  2X02 A;  1JVJ A;  4MEZ A;  1EWZ A;  4DDY A;  4GKU A;  3WS0 A;  4X69 A;  3ZNT A;  2BLS A;  5CTM A;  3G2Z A;  5AQ9 A;  1IYP A;  1RGZ A;  1XA7 A;  3EQU A;  5HAR A;  4KQQ A;  3BEB A;  4X6T A;  5FI2 A;  2HDQ A;  3G32 A;  3PAG A;  2H5S A;  1M6K A;  2HDS A;  1HZO A;  2XD1 A;  4GNU A;  4KZ6 A;  4HES A;  4JKT A;  4GDB A;  4P0M A;  3S22 A;  3DW0 A;  1CEG A;  5CEC A;  3P09 A;  1IYQ A;  4A5R A;  4P6B A;  2EFU A;  4Q8I A;  4RX2 A;  1YMS A;  3IWO A;  1IKG A;  4CJN A;  1XXM A;  2ZM0 A;  3IWI A;  2XFT A;  5GHX A;  1YLW A;  2Q9M A;  4NK3 A;  1GHM A;  1HVB A;  1IEL A;  3M6B A;  4OPR A;  1AXB A;  2G2U A;  4U0T A;  1G6A A;  4JXW A;  3O86 A;  4E3N A;  3IHB A;  2ZM8 A;  3B3X A;  4OOY A;  1BLS A;  3VOZ A;  4MBH A;  3A3J A;  3S4X A;  1Q2Q A;  3ZG9 B;  5EVL A;  1O7E A;  5GHZ A;  1K56 A;  3QHY A;  5HX9 A;  3SH8 A;  2XLN A;  2Z2L B;  1PYY A;  3AGF A;  2PU4 A;  3ZG7 B;  1FCM A;  4K0X A;  2C6W B;  3CJM A;  1K54 A;  2XR0 A;  1K4E A;  1S0W A;  2XGN A;  3C7V A;  1DY6 A;  2Y91 A;  3IQA A;  3IT9 A;  5M19 A;  2P74 A;  5M1A A;  1NYM A;  1ONH A;  5DTK A;  2QZ6 A;  1VM1 A;  1MPL A;  3OCN A;  5CGW A;  2VGK A;  2WK0 A;  3QNC A;  4CPK A;  4DE2 A;  2J7V A;  3BM6 A;  1E3U D;  3TG9 A;  3A3I A;  1K4F A;  5HAQ A;  1GCE A;  2Y2O A;  1E25 A;  3OCL A;  2WGW B;  4JXS A;  3UE1 A;  1MWT A;  1K54 C;  3VSL A;  3HLE A;  4OP5 A;  4DE1 A;  3HLD A;  3ZG0 A;  4EBN A;  2P9V B;  1K57 C;  3IH8 A;  4PM9 A;  4BD0 A;  3LY4 A;  4E3M A;  4E6W A;  4O7D A;  4QU3 A;  4KQO A;  1RP5 A;  3N6I A;  4PM5 A;  2WYX A;  1XKZ A;  2H0T A;  4QJG A;  1JTD A;  3RXW A;  5CTN A;  4R23 A;  2Y55 A;  4BJP A;  3V3S A;  4PM7 A;  3GRJ A;  3IF6 C;  4S2M A;  2Y2N A;  5F82 A;  5TR7 A;  3ZVT A;  5EVI B;  2EX9 A;  4KZ8 A;  4S2L A;  2OSU A;  2PBY A;  2WZX A;  5FSR A;  5A92 A;  2BG1 A;  3Q1F A;  1K25 A;  3HRE A;  3GSG A;  4X56 A;  4GD6 A;  2V2F F;  4KZA A;  1GHI A;  4ID4 A;  4OOL A;  3OPL A;  2ZQA A;  2JC7 A;  1PW8 A;  4U3T A;  3DTM A;  4UAA A;  4BEN A;  4H8R A;  3BFD A;  5GHY A;  3C7U A;  3Q81 A;  3AGD A;  5FDH A;  4HBT A;  3MXR A;  4B88 A;  1J9M A;  1G68 A;  1W7F A;  4UA9 A;  5TFQ A;  3V50 A;  4E6X A;  5A93 A;  1SKF A;  1FSY A;  1NZO A;  5GLD A;  5IHV A;  1K55 C;  2IWB A;  5A91 A;  1JWP A;  3IHA A;  1IYS A;  4X68 A;  1PW1 A;  5E2F A;  4E3K A;  2XFS A;  3NDE A;  3V39 A;  3G2Y A;  4ZJ1 A;  2ZM2 A;  1KGF A;  1C3B A;  2WUQ A;  4BL2 A;  4D2O A;  4R3B A;  2WAE A;  1GHP A;  3NDG A;  1FOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...