3EGDC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22 and bound to the transport signal sequence of vesicular stomatitis virus glycoprotein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
b'MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
molecule tags Protein transport
source organism Homo sapiens
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egdC00
3EGXC 2NUPC 3KYQA 4B93A 2NUTC 1IOUA 4AFIA 2DMWA 2VX8A 1IFQA 3EGDC 3BW6A 1H8MA
chains in the Genus database with same CATH superfamily
2ZLYA 2R9WA 2JN7A 1K57C 3R4KA 5CGWA 2OWHA 4GW9A 3UE6A 3CPTA 3HUOA 5M1AA 1YLWA 2XA7S 2Y79A 5EM1A 1T1BA 3FV7A 4R0QA 3ZG9B 1L2SA 2WGVA 1AXBA 3B47A 1HD8A 1T1AA 2XSSA 3UDXA 2EX8A 4KZ7A 4KZ6A 1L3LA 1ES2A 3NECA 3ZFZA 1MY8A 2JKGA 3PR6A 3HLGA 2ZM0A 5GLDA 3LICA 2EX9A 3VP1A 2VA0A 2OSUA 4G3VA 3O5YA 3S7QA 3M2KA 3T4KA 2BASA 2EXAA 3TSGA 1VQQA 5F69A 3FWLA 2B02A 4LLOB 4Y7PA 4GDBA 3DBAA 3EQVA 2H5SA 4RX2A 3R7WB 1UWPX 5EVEA 3UB7A 3VP3A 3RJUA 5CX7A 3SH9A 1FSWA 4KUKA 4DE1A 2Q9MA 4KZ3A 4OLDA 3C8CA 1KGGA 1LL9A 4G3WA 2HDRA 3BFDA 1KE0A 1FIKA 2XD1A 4GNUA 5GL9A 4GKUA 3SH7A 3Q82A 1ALQA 1UWNX 4B88A 2VJWA 3VMAA 1CF0A 3DWKA 4EU0A 4I39A 1SKOB 4H6JA 1CEFA 3HLWA 4FH2A 4WL9A 1F2KA 2VLGA 3HLBA 3C4PA 3CG5A 4BWIA 4DJ2A 3E2LA 5EV0A 3KYEA 2ZL1B 1Q2QA 1EROA 5FQJA 3MFDA 3VOLA 3D3OA 1PWCA 3NY4A 3NOUC 4I38A 2OLVA 3A0SA 1TS6A 5FSRA 2CMNA 4GN2A 1XFNA 2Z2LB 5DF9A 2WKQA 2VGLM 4DE3A 2PT7A 4NETA 1TEMA 2WZZA 1GSVA 1IKIA 4OLGA 1MWRA 2W3EA 1FSYA 4NXGA 3B42A 5GHYA 4EWFA 3T1SA 3E4QA 3IXBA 3LFVA 4E3OA 5FDSA 4HH2A 4MLLA 2EFXA 3V3RA 3VP0A 5DFYA 1CJFA 4Q0IA 3OPPA 2ZM8A 3TG9A 3M6HA 3BW6A 1OT6A 5HPFA 3OPLA 4BJPA 1TF1A 2L0WA 5L07A 3CUEA 3D72A 4WUJA 4ZRRA 3ZG5A 5KMWA 2DRWA 2GNXA 4XXRA 2HDSA 1ACFA 2PR5A 4WN5A 2JHEA 4RVAA 1FOFA 4IBRA 2B95A 4O8GA 4HJ4A 3VP2A 2HDQA 4ZTKA 2ZC4B 5TFQA 4HESA 1SKFA 1W8YA 3IS2A 4LRXC 3F1NB 5DJUA 1OT9A 3QP6A 1GCEA 4S2IA 2V0UA 5EE8A 1ZKJA 4JXGA 1HVBA 1Z09A 1TS0A 1LSWA 4S2NA 3C7UA 3A3JA 4DXCA 4B4XA 2QJ5A 5CHJA 2VK3A 2EFUA 3WRTA 1S1ZA 4E3JA 1K55C 1IOUA 3F1NA 4E6XA 4KQRA 2QHKA 4IEDA 2HDUA 1E4DA 2Y2PA 3VOZA 3KYQA 5GLBA 2PAVP 2W3FA 3N8LA 4OKPA 4Y0OA 3IBJA 3RFBA 3CI6A 1H0MA 3FPVA 2Z2MB 1N9BA 2ZC5B 3HUMA 4QB8A 3HJKA 4O0PA 1VEUB 3S7PA 1OPXA 4S2LA 1I2SA 3NDEA 3V67A 3P01A 4H8RA 1G68A 3H7WB 3EEAA 1GA0A 1HLUP 3LYXA 5A91A 2P9VB 1VB6A 3F1PA 4IUKA 3SS5A 4IBXA 1L0GA 4IVIA 4R4SA 3MSHA 3JVVA 3OBFA 2KOIA 5HPIA 4MBHA 4P6ZM 5G4YA 3PHYA 1V9ZA 4IVKA 4OOLA 5CGSA 1Z6FA 4EBPA 4OQHA 4I3IA 1IKGA 4JPMA 4ETXA 3CWFA 3WS2A 4BBUA 4PAUA 3KSHA 4GZBA 3A3IA 2VX8A 4MEZA 2VV8A 3HL9A 1M40A 5FL3A 2VV7A 4DJ3A 1QMEA 3D4FA 3LUQA 4ESPA 1K57A 1DP9A 4CLCE 4DDSA 1J9MA 4YFMA 3C7VA 3N6IA 4JF6A 4EEUA 1ES3A 2HP9A 1WYCA 4C6YA 2A24B 2PR6A 3U4LP 1YQSA 4QD4A 2Y2LA 5A92A 3W4PA 3SZTA 5U47A 1VETA 4D60A 4KQOA 5A90A 3BEBA 3MMHA 3I7JA 3OPRA 4BD1A 4ZDXA 1YLYA 3BWLA 1NLYA 5FQMA 1KVLA 2BG1A 4L0LA 1F9IA 1T19A 3QNCA 3AGDA 5C5KA 1PZOA 1VETB 3Q81A 1E3UA 2DNSA 3PAGA 5TR7A 4EETB 4R70A 4PM6A 4CQHA 4DF6A 5BOHA 2OAQ1 3CAXA 4GS9B 4QY6A 3IS2B 3C30A 5AJGA 1MBLA 4ID4A 1G6AA 5AQAA 4EV4A 4MNRA 3G30A 3PBOA 3LEZA 2JKFA 3QP5A 1OJ5A 2O9CA 2WUQA 5HAIA 2Y59A 5IS1A 4CLCA 4FSFA 4F94A 1PW1A 2X02A 3W4QA 1PIOA 1BUEA 2A49A 3LR5A 2VGJA 1D7EA 3LCEA 3PXPA 4O01A 2ZOHA 4IUHA 1MKMA 1V9YA 2GDNA 4E6WA 5DTTA 3W8KA 1W63M 3WWXA 4OPZA 3E98A 3MBZA 4G3KA 4Y15A 5HAPA 1IYPA 4OPYA 2HGVA 5EVID 4N1HA 5FAPA 4X1LA 3AGFA 5I5LA 3D9YA 3ZG8B 5G18A 5FASA 3GSGA 4HNBA 1XA1A 4UQIM 3G2YA 4S2PA 2BTFP 3IBRA 3VOYA 4ZJ2A 2AVXA 3FKVA 4KZ9A 2ZC6B 3GECA 4Q0HA 5TGFA 1LI9A 1YT4A 1K54C 3UE0A 4NXEA 5DFXA 4ARZA 4S2NC 2K2NA 2FFYA 2P7JA 2UWXA 2JE5A 2K31A 1NXYA 5J8XA 1KVMA 3A3DA 2XROA 3GR2A 1E3UD 1ZG4A 5FQ9A 2EX2A 2VKSA 2VGKA 3E4PA 3Q07A 1CQAA 4PM8A 1TS8A 1ZHHB 2ZL1A 2D02A 3IHAA 4GCZA 4OP5A 1JNUA 3H9WA 4WF0A 2VV6A 4UA6A 1NYYA 5CECA 3AGEA 1XX2A 3E0YA 5D3OA 1STZA 5F5YA 2IWBA 4QWOA 4OH0A 2XDMA 3JYIA 4XUZA 2PU4A 5L09A 1JVJA 1YLJA 2Y8HA 5FEFA 2PD7A 2W0NA 2PBDP 1S4RA 3EGDC 1SDEA 4JF5A 1SDNA 3BYDA 4GOGA 3TRCA 1WYBA 2ZQ9A 4EERA 4DE0A 1NWZA 4DXBA 1S67L 1FILA 1Y28A 1JWPA 4NXBA 4X68A 5G4ZA 5EVIC 3UPNA 2HF6A 5HDCA 5AQBA 2GJ3A 4R38A 1H8YA 1XP4A 2Z6DA 3BRMA 2H0YA 2LB9A 2VEAA 3FKWA 1XGIA 3L7HA 5HDSA 4QHCA 4X56A 4KG2A 4B9OA 2E8JA 3BECA 5E43A 1Y4OA 5CXWA 5FQKA 3IXDA 2XK1A 1IEMA 3IWQA 4E3NA 2D01A 2WAEA 4HIAA 4II7A 5AQ9A 3EOIA 3BFCA 1S4SA 4X25A 4OPRA 2HJ9C 5FQQA 2WK0A 1XJ2A 2HP6A 3HLFA 1MPLA 1FCMA 3IH9A 2R9XA 1K0KA 4X1MA 1DY6A 3E2KA 4WEJA 4S2JA 3G6OA 3IX3A 2Y2HA 3UE3A 4WM9A 1ZC2A 2QYBA 1A0KA 5KSCA 3DTMA 4KG5A 1U60A 3A3EA 3FG8A 4X55A 1EI5A 2JKTI 5DTSA 2V2FF 4E3KA 1G5UA 4Y13A 2JCHA 2JKRI 3N4IA 1ODVA 4QU3A 4BL2A 1KGFA 3S1YA 1YAXA 3HLDA 4M4XA 1N9NA 4NXFA 1G6OA 4NG2A 3QP1A 4OOMA 1VM1A 4KG6A 4JXVA 2IWDA 2G2WA 4PM7A 1NZOA 1IYOA 4BBVA 3S22A 3QHYA 3ZDJA 1TD5A 2HJEA 5CTNA 4EBLA 4N1XA 4DE2A 3MS6A 2HZ5A 3KX0X 2JBFA 3DTKA 3UO9A 1EWZA 4UAAA 2GZAA 1MC0A 4Y17A 4WELA 3OC2A 2ZC7A 1I2WA 5F82A 2FZ0A 3IXHA 3IH8A 1LL8A 1LI0A 2P9VA 2Y2GA 4P6ZS 1LSXA 2R78A 1OTAA 3C38A 2X71A 2Q9NA 3T12B 2EWVA 5CRFA 3T1RA 4BENA 3LIDA 3V5MA 3BJNA 4WYYA 3CPTB 2W1TA 1YKDA 5A93A 4Y0TA 3SOIA 5MC7A 3G4PA 1GHIA 5CHMA 5TBMB 4IJGA 4R4RA 5EPHA 1H8ZA 4EXOA 2WKIA 3IX4A 3G31A 3JVUA 3MQ0A 1MWUA 4JXWA 4DKIA 1G28A 2A24A 1SZVA 5I94A 4XT2A 4LCMA 1HTZA 4WMCD 3Q7ZA 1BLSA 1GHMA 4GB7A 4F3LB 3NIAA 4KUOA 1MWTA 3GQZA 5TBMA 3H82A 3S4XA 1L0DA 1KOUA 2XRNA 2V8CA 1XPBA 3UNWA 2PDRA 2EX6A 4EBNA 4UA7A 3CUEC 3C2WA 2WKRA 2ZJ9A 3QP4A 4JGOA 2M7UA 4JGRA 5DF7A 3PTEA 1LL5A 3MKEA 1K56D 3HLCA 2Y2QA 2IA2A 2A3UA 2V8FA 4OQ0A 1MXOA 1Q2PA 4R3AA 2DCFA 1W63Q 1UGUA 3OCLA 3MKFA 5EVIA 4BLMA 1BULA 3DTEA 3BLSA 5CEBA 1BLCA 3IF6A 1LHYA 5KZHA 3CHWP 4BD0A 1XJ6A 3PBSA 4Y5FA 1D06A 3LR4A 1XJ3A 1M6KA 4EQ1A 2V0WA 1WE4A 4ZJ3A 4CLCD 2PU2A 1H8MA 3VSLA 5EVIB 4KZ8A 1S0WA 1YPRA 2DMWA 5HD3A 4DDYA 1KE3A 5FI6A 1O07A 3T4QA 1FR1A 4OP8A 3MZFA 2KDKA 5K5BA 3DW0A 1DJBA 1RCJA 4LPZA 3DWZA 4I3AA 1QMFA 5L2FA 2J3WA 2XLNA 1GHPA 3ZGAB 3CLOA 4ZAMA 2YKFA 4N9KA 4PMAA 2Y2JA 5F83A 3ZQ5A 2V20A 4KQDA 5F1FA 5IT5A 1JTGA 1JWZA 2Y55A 4ZBEA 5HX9A 4ETZA 2PRFA 4HH3A 3EGXC 4P87A 1ONHA 4GLQA 5CERA 4MN7A 4R3BA 4HP4A 1GSWA 2PD8A 2QMIA 4Y0UA 4KENB 3CITA 3ZCZA 3N8SA 4X6TA 3HBRA 5HWTA 3MZEA 1PI5A 1OTBA 1PNEA 1KDSA 4B93A 3LIFA 2ZM2A 3M2JA 3MJQA 3MZDA 3W2ZA 5EVLA 3ZVWA 3ULFA 3FPWA 1SCWA 2C6WB 4FTXA 3Q1FA 3BY9A 4WZ5C 4OQGA 1PYYA 4Y3IA 2WADA 3F1OB 3F1PB 1TDGA 4HBTA 5FA7A 4I3JA 2W27A 4K08A 5HWVA 2ZD8A 1ERMA 3UPOA 3ZNYA 1YM1A 1BLPA 1J3WA 2G7UA 4L9FA 1K25A 4KZAA 4BMWA 3OLOA 1TVFA 3FYZA 1OMEA 3ZNTA 4HOIA 3VE4A 3NHQA 3ZVTA 1VHMA 4EUZA 4UHUA 5DF8A 1DRMA 2J3TC 4N92A 3W4OA 3LIBA 5JYOA 3IHBA 4F3LA 1ERQA 3EWKA 4R23A 3OZHA 2JKTM 4OONA 2P74A 4L9GA 2ZOIA 5KIZA 2JKRM 2PYRA 4M3KA 3LY3A 5J7EA 2WZXA 3IXGA 1NYMA 4EUVA 2EWWA 3RH8B 4N9LA 3T1XA 3T4TA 4QJGA 3IF6C 5GHXA 3A3FA 3M6BA 4E3MA 5J4EA 3CJMA 3RTYA 3A0RA 1K54A 5DKKA 3P7NA 3T4LA 2ZQCA 2HV1A 4RQ9A 2W1TB 3EEHA 2L1MA 1KGEA 1DJCA 3LIAA 3UB5P 1NZUA 1W8QA 2EXBA 4CPKA 3LY4A 5FDHA 3UB6A 3LO7A 1YLPA 3OPHA 3DTIA 1NJ4A 1TDLA 1TS7A 2HP5A 2PHYA 3C4OA 2WGIA 1F5MA 1BTLA 4LRYC 4HJ3A 4GD6A 2CC1A 1LSVA 3ITAA 4GHIB 4JLFA 1X0OA 2L4RA 1NLZA 5F68A 5GLAA 4LRZE 2P08A 1OTEA 5E2EA 4GJ4A 1Y54A 4FH4A 4MDZA 3T4JA 1MZUA 2W3GA 2QWSA 4JBFA 1ONGA 1PRQA 4OPQA 2Y2MA 2X01A 3HREA 3T4OA 5IU1A 1GA9A 3HVFA 3UDFA 3LIEA 3ZHHA 1YSPA 1T18A 1OJGA 3UB8A 4JGQA 2QKPA 2ZBBA 3BFFA 2E8IA 5HL1A 5HZHA 4HHDA 1S1YA 4HBUA 4LV1A 2V9AA 3PBTA 2Y2IA 5DTKA 3O88A 2ACGA 2WAFA 1P9WA 1JTDA 4Z9QA 1RGZA 4MN6A 3A0VA 2B18A 3LI8A 5E2HA 2W3HA 5DJTA 1BLHA 4E3IA 4WZ4A 3BQAA 1NRJA 4LCLA 4LV0A 3KYZA 2QJ7A 3HLEA 5E2GA 4EESA 3B3XA 2I72A 1KDWA 3O3VA 4NEED 4OQIA 1YSQA 4QPRA 5FAQA 3NULA 5F6AA 3KSIA 2FFFB 3RXXA 2NUTC 1YMXA 4PM9A 3BY8A 4LV3A 1K4EA 3P98A 5AVEA 2A2LA 1H5XA 4GHIA 4Q8IA 5F1GA 5CEDA 5E2FA 4K0WA 2OOLA 5EECA 3WS0A 4Z1WA 3O87A 1K4FA 3TJZC 4YOFA 5HD5A 5CGXA 5HFOA 2FH5A 2J9OA 5FEGA 4E04A 2Y91A 5FI2A 1WA9A 1NRFA 1BT5A 4IHQA 4UQIS 4HP9A 4L9EA 2B5RA 2QZ6A 3HUNA 2JC7A 1XXMA 3JPUA 4S2OA 1K55A 3E4OA 3LEQA 1K56A 4P6BA 3G32A 3DAVA 3S7NA 2EA9A 3N7WA 3T1QB 2OV5A 2HPBA 4PHTA 5GLCA 4MBKA 3V39A 2XA7M 3WS4A 4K91A 2Z6CA 1XJ4A 2XEPA 1IYSA 4GS9A 1OTIA 5J3WA 3KO6A 4HEFA 4EW7A 1W7FA 2OWJA 2RCXA 2XGNA 3Q7VB 2WKEA 4S2KA 4BL3A 1CI8A 2XFTA 3K2NA 4U0TA 1CI9A 1PFLA 1DJAA 4FUWA 2H28A 4LENA 4O7DA 3ICYA 1O7EA 2WKPA 4GD8A 1P9RA 4HQAA 4JF4A 4R3JA 2V1BA 3SS3A 2QPNA 3UN7A 2YKHA 3VV4A 5KSHA 1LT0A 2ZC3B 3FZCA 1XKZA 3UB9A 1IFQA 4RA7A 2GX5A 4FD8A 3LI9A 1MKIA 4NK3A 5GHZA 2J7VA 3ZG7B 2RL3A 2G2UA 3MF0A 3IF6B 4QY5A 2NUPC 4JGPA 3MXSA 3NBLA 3QNBA 1ZG6A 3NJAA 4PKYA 3NCKA 4WBGA 5CHUA 2ZMAA 3GV9A 4CLCC 1F98A 3LGOA 2Y2OA 1S66L 3BM6A 1I5QA 4XUXA 4LGWA 3P09A 1CEGA 1N4OA 4NKPA 5HWWA 4EQIA 3G34A 3WRZA 3MQOA 1JWVA 2J9PA 3WS5A 1VEUA 1DP6A 2Y2KA 4UA9A 4MMNA 4K0XA 2Y4AA 4CLCB 3BLMA 3IX8A 4BQMA 2H0TA 3ISGA 1ESIA 2C5WB 4PPRA 4P85A 4KZ5A 4X69A 3VFFA 2KLIA 3T50A 3O86A 2W3DA 2UV0E 3PYPA 3IWIA 2WGWB 2W1RA 5HDDA 2H10A 3VFHA 5HL6A 4KQQA 4RYEA 4C75A 3K3DA 5EOOA 4DMZA 3BFGA 4A5RA 3NDGA 3QP8A 1EW0A 4R6LA 5FATA 3UE1A 4DRTA 2ZMVA 1YMSA 1LLBA 4OVDA 3IWOA 3VE3A 2WGWA 2INWA 1FCOA 5HAQA 4KZ4A 2K7SA 3HCYA 1BSGA 3PBQA 4WEKA 3NI9A 3NOPC 3WS1A 3GRJA 3L9KA 4U3TA 5AVFA 2OAP1 1RP5A 4YNRA 4PM5A 2PYPA 4WMCA 1L0FA 4JXSA 2V1ZA 1W79A 2J80A 5FQIA 3OOVA 3ZG0A 3F1OA 3BFEA 5L8MA 3B33A 2XD5A 3CMZA 4E3LA 2XH9A 1RGYA 3GVBA 4HJ6A 1ES4A 2P04A 3LR3A 4HY8A 4D2OA 4MCWA 1P0ZA 5CTMA 3KSFA 3S7OA 5L10A 2O9BA 3C5AA 3IQAA 1N9OA 2IWCA 2I9VA 2VZWA 3UMEA 1K6SA 4OOYA 2WKHA 4GDNA 3UMDA 4WLAA 1FCNA 5LBRA 5EFWA 3FC7A 4ZJ1A 1K6RA 2O99A 1L0EA 1FQGA 2J3TD 5FI7A 3MQQA 3Q7VA 1DP8A 1E25A 1BYWA 3MR0A 3SW1A 1ESUA 3ITBA 5JYPA 4H6JB 2XR0A 3GMWA 4BBTA 2O9AA 3H7WA 1S6RA 5EUAA 3RXWA 1PWGA 2M7VA 3TE8A 2MJ6A 3ZYTA 2O0YA 3SS4A 4EEPA 2VGLS 1CK3A 5HARA 5DKLA 2PBYA 4R1GA 1SKOA 4XT2B 1MWSA 1D1JA 1H3QA 4U0XA 3PBRA 1IELA 3HJIA 3TOIA 1W5DA 1PW8A 3MXQA 3K3CA 5M19A 3LR0A 1XFQA 2BLSA 5EM0A 2ZQ8A 3R7WA 2Q0OA 1PZPA 5TJJA 1ZTUA 1ES5A 3PAEA 4LFUA 2J8YA 3NC8A 1P97A 4C3QA 3IF5A 5EOEA 3EQUA 3UPPA 3V50A 3UY6A 2KX6A 4B4ZA 2LB5A 5FAOA 5IHVA 4YINA 3T4SA 4P0MA 4ME4A 2XF3A 2ZQAA 4AFIA 3N8RA 4RX3A 2ZQ7A 4FCFA 2M1CA 3NOTC 4PKYG 3GTCA 4UEYA 4FOFA 5M18A 3VP4A 4MBFA 1IYQA 5HSQA 4KZBA 1K38A 1YLZA 3KSGA 3VSKA 3TW8A 1AWIA 1FR6A 3MXRA 2WYXA 4WZ5A 2XQZA 3CZDA 3SH8A 2XFSA 3OCNA 3IT9A 4HI4A 1YLTA 1NY0A 3UDIA 1HZOA 2V1AA 1C3BA 3G2ZA 1XGJA 1KE4A 3G35A 4MN5A 2OLUA 2Y2NA 4I5SA 3V3SA 1PI4A 4LV2A 3GDIA 5AQ7A 4Y2FA 1GSXA 4JKTA 4DN0A 2ZMFA 5A8BA 4ARZB 1PWDA 3MFXA 1N9LA 4Q0JA 1BZAA 3H82B 3QP2A 3BQ8A 2ZQDA 5DVAA 5HW3A 4CJNA 4YWZA 1T1CA 4X53A 1OTDA 1XA7A 4S2MA 3U2AA 1SHVA 3PBNA
chains in the Genus database with same CATH topology
4EQ1A 4GS9A 2V0WA 4CLCD 3LR5A 4IUHA 1H8MA 1D7EA 1OTIA 2JN7A 2ZOHA 3PXPA 3R4KA 4O01A 5J3WA 1MKMA 2OWHA 1V9YA 3KO6A 4GW9A 3UE6A 4EW7A 2OWJA 2DMWA 2XA7S 2Y79A 1W63M 5HD3A 1T1BA 3E98A 3T4QA 4G3KA 3B47A 1T1AA 2XSSA 2KDKA 5K5BA 2HGVA 4LPZA 3K2NA 5I5LA 3PR6A 2H28A 3ICYA 2WKPA 3LICA 4I3AA 1P9RA 2VA0A 2J3WA 4HQAA 4HNBA 4UQIM 4G3VA 3O5YA 3CLOA 3IBRA 2V1BA 3S7QA 3T4KA 3GECA 2BASA 2YKHA 2YKFA 3VV4A 4Q0HA 5KSHA 1LT0A 3ZQ5A 5F69A 4KQDA 2B02A 5IT5A 3UB9A 4LLOB 1IFQA 3DBAA 4NXEA 5DFXA 2GX5A 3EQVA 3LI9A 4ARZA 3R7WB 2K2NA 2P7JA 1UWPX 2K31A 3UB7A 2XROA 3MF0A 4ETZA 5CX7A 4HH3A 2NUPC 3EGXC 4JGPA 2VKSA 3E4PA 4KUKA 4GLQA 4MN7A 1TS8A 3C8CA 1ZHHB 3NJAA 4G3WA 2D02A 4PKYA 4GCZA 4HP4A 1JNUA 4CLCC 1F98A 3H9WA 1GSWA 1S66L 4WF0A 2VV6A 2PD8A 3E0YA 1UWNX 4NKPA 3CITA 1STZA 2VJWA 5F5YA 5HWWA 4EU0A 3MQOA 4I39A 5HWTA 4H6JA 1OTBA 4B93A 4WL9A 2VLGA 1DP6A 4BWIA 4DJ2A 4MMNA 3LIFA 3MJQA 4CLCB 3W2ZA 3ULFA 3FPWA 2Y8HA 2PD7A 2W0NA 1S4RA 3EGDC 3BY9A 3VOLA 3D3OA 4Y3IA 3F1OB 3F1PB 3NOUC 3TRCA 4I38A 2KLIA 3T50A 3A0SA 1TS6A 2CMNA 4I3JA 4EERA 2W27A 4K08A 2W3DA 5HWVA 1XFNA 1NWZA 3PYPA 5DF9A 2WKQA 1S67L 2W1RA 1Y28A 5HDDA 4NXBA 5G4ZA 5HL6A 2HF6A 2VGLM 5HDCA 3K3DA 2GJ3A 4R38A 2G7UA 2PT7A 4L9FA 1GSVA 4BMWA 3OLOA 2Z6DA 4DMZA 2LB9A 2VEAA 2W3EA 4NXGA 3B42A 5HDSA 1EW0A 4R6LA 3E4QA 2ZMVA 4HOIA 3LFVA 3VE4A 4B9OA 3NHQA 4HH2A 1VHMA 3VE3A 2INWA 5DFYA 1DRMA 2J3TC 4Q0IA 3LIBA 3BW6A 1OT6A 5HPFA 2K7SA 4F3LA 3HCYA 4BJPA 3PBQA 1TF1A 2L0WA 3EWKA 3CUEA 2D01A 4WEKA 4HIAA 4II7A 3EOIA 3D72A 3NOPC 2JKTM 1S4SA 4WUJA 2HJ9C 4ZRRA 5AVFA 4L9GA 2OAP1 2GNXA 2ZOIA 4YNRA 5KIZA 1XJ2A 2PYPA 2JKRM 2PYRA 2J80A 2PR5A 4WN5A 5J7EA 2JHEA 3OOVA 3F1OA 5L8MA 3B33A 4EUVA 2EWWA 4O8GA 3RH8B 4HJ4A 4WEJA 3T4TA 4HJ6A 3G6OA 2P04A 3LR3A 4HY8A 3UE3A 5J4EA 4MCWA 2QYBA 3IS2A 4LRXC 1P0ZA 3RTYA 3A0RA 3F1NB 3KSFA 5DJUA 1OT9A 3S7OA 3FG8A 5DKKA 3P7NA 2V0UA 3T4LA 2O9BA 1TS0A 1LSWA 2JKTI 2HV1A 4RQ9A 1N9OA 2W1TB 2I9VA 3EEHA 2VZWA 3UMEA 2L1MA 2QJ5A 2JKRI 3UMDA 1ODVA 4WLAA 5LBRA 5EFWA 3FC7A 1YAXA 3LIAA 4M4XA 2O99A 1N9NA 4NXFA 1G6OA 1S1ZA 4OOMA 1IOUA 3F1NA 3UB6A 2J3TD 1TS7A 2PHYA 2QHKA 3MQQA 4BBVA 1DP8A 1F5MA 1BYWA 4LRYC 4HJ3A 3MR0A 3SW1A 1LSVA 1TD5A 2HJEA 3KYQA 4H6JB 2W3FA 4GHIB 3IBJA 3RFBA 4BBTA 3CI6A 2O9AA 3H7WA 1X0OA 2L4RA 1NLZA 2M7VA 3FPVA 5F68A 3TE8A 2MJ6A 3KX0X 4LRZE 2P08A 3ZYTA 2O0YA 3HJKA 4O0PA 4EEPA 2VGLS 1OTEA 4GJ4A 3S7PA 1OPXA 4MDZA 3T4JA 2GZAA 5DKLA 1MZUA 1MC0A 2W3GA 2QWSA 3V67A 4XT2B 4WELA 3P01A 3OC2A 1H3QA 2FZ0A 3H7WB 3T4OA 5IU1A 3EEAA 1LL8A 3LIEA 3PBRA 3LYXA 1VB6A 1YSPA 3HJIA 1T18A 4P6ZS 1LSXA 3F1PA 2R78A 1OTAA 3MXQA 4IUKA 1OJGA 3K3CA 3UB8A 3C38A 3LR0A 2QKPA 4JGQA 2ZBBA 1XFQA 3R7WA 3JVVA 3OBFA 2KOIA 5TJJA 1ZTUA 4HHDA 5HPIA 5HZHA 4P6ZM 5G4YA 1S1YA 3PHYA 2V9AA 1V9ZA 4OOLA 3PBTA 1P97A 2EWVA 3LIDA 4I3IA 3BJNA 3EQUA 2W1TA 1YKDA 4ETXA 1P9WA 3CWFA 2KX6A 5MC7A 4MN6A 3A0VA 2B18A 2LB5A 3LI8A 4BBUA 4PAUA 5TBMB 4IJGA 3KSHA 2W3HA 5DJTA 3T4SA 2VX8A 4ME4A 3BQAA 1NRJA 4AFIA 4EXOA 2VV8A 5FL3A 3JVUA 2VV7A 2M1CA 3MQ0A 4DJ3A 3KYZA 3NOTC 4PKYG 2QJ7A 3LUQA 1G28A 2A24A 4UEYA 4EESA 1DP9A 4CLCE 4FOFA 4XT2A 4NEED 1YSQA 4QPRA 5F6AA 4EEUA 5HSQA 4F3LB 4KUOA 3KSGA 5TBMA 3KSIA 3TW8A 3H82A 2A24B 2NUTC 1KOUA 2XRNA 2PR6A 3BY8A 5AVEA 2A2LA 4GHIA 2PDRA 3OCNA 3CUEC 4KQOA 4HI4A 2OOLA 3C2WA 3MMHA 4Z1WA 2WKRA 2V1AA 4JGOA 2M7UA 4JGRA 3TJZC 4YOFA 4MN5A 5HD5A 3BWLA 1NLYA 2FH5A 4I5SA 4L0LA 4E04A 2IA2A 1F9IA 1T19A 1WA9A 5C5KA 4IHQA 4UQIS 4HP9A 4L9EA 3GDIA 4R3AA 1W63Q 1UGUA 4Y2FA 1GSXA 3OCLA 4DN0A 4EETB 4R70A 2ZMFA 5A8BA 4ARZB 4CQHA 2OAQ1 3CAXA 3MFXA 1N9LA 4Q0JA 3E4OA 3H82B 4GS9B 3IS2B 3C30A 3BQ8A 5AJGA 3S7NA 2EA9A 4YWZA 1XJ6A 1T1CA 3PBOA 3PBSA 1OJ5A 4PHTA 4Y5FA 2O9CA 1D06A 1OTDA 3U2AA 2XA7M 3LR4A 5IS1A 1XJ3A 4CLCA 4FSFA 2Z6CA 1XJ4A 3PBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGX C;  2NUP C;  3KYQ A;  4B93 A;  2NUT C;  1IOU A;  4AFI A;  2DMW A;  2VX8 A;  1IFQ A;  3EGD C;  3BW6 A;  1H8M A; 
#chains in the Genus database with same CATH topology
 2ZLY A;  2R9W A;  2JN7 A;  1K57 C;  3R4K A;  5CGW A;  2OWH A;  4GW9 A;  3UE6 A;  3CPT A;  3HUO A;  5M1A A;  1YLW A;  2XA7 S;  2Y79 A;  5EM1 A;  1T1B A;  3FV7 A;  4R0Q A;  3ZG9 B;  1L2S A;  2WGV A;  1AXB A;  3B47 A;  1HD8 A;  1T1A A;  2XSS A;  3UDX A;  2EX8 A;  4KZ7 A;  4KZ6 A;  1L3L A;  1ES2 A;  3NEC A;  3ZFZ A;  1MY8 A;  2JKG A;  3PR6 A;  3HLG A;  2ZM0 A;  5GLD A;  3LIC A;  2EX9 A;  3VP1 A;  2VA0 A;  2OSU A;  4G3V A;  3O5Y A;  3S7Q A;  3M2K A;  3T4K A;  2BAS A;  2EXA A;  3TSG A;  1VQQ A;  5F69 A;  3FWL A;  2B02 A;  4LLO B;  4Y7P A;  4GDB A;  3DBA A;  3EQV A;  2H5S A;  4RX2 A;  3R7W B;  1UWP X;  5EVE A;  3UB7 A;  3VP3 A;  3RJU A;  5CX7 A;  3SH9 A;  1FSW A;  4KUK A;  4DE1 A;  2Q9M A;  4KZ3 A;  4OLD A;  3C8C A;  1KGG A;  1LL9 A;  4G3W A;  2HDR A;  3BFD A;  1KE0 A;  1FIK A;  2XD1 A;  4GNU A;  5GL9 A;  4GKU A;  3SH7 A;  3Q82 A;  1ALQ A;  1UWN X;  4B88 A;  2VJW A;  3VMA A;  1CF0 A;  3DWK A;  4EU0 A;  4I39 A;  1SKO B;  4H6J A;  1CEF A;  3HLW A;  4FH2 A;  4WL9 A;  1F2K A;  2VLG A;  3HLB A;  3C4P A;  3CG5 A;  4BWI A;  4DJ2 A;  3E2L A;  5EV0 A;  3KYE A;  2ZL1 B;  1Q2Q A;  1ERO A;  5FQJ A;  3MFD A;  3VOL A;  3D3O A;  1PWC A;  3NY4 A;  3NOU C;  4I38 A;  2OLV A;  3A0S A;  1TS6 A;  5FSR A;  2CMN A;  4GN2 A;  1XFN A;  2Z2L B;  5DF9 A;  2WKQ A;  2VGL M;  4DE3 A;  2PT7 A;  4NET A;  1TEM A;  2WZZ A;  1GSV A;  1IKI A;  4OLG A;  1MWR A;  2W3E A;  1FSY A;  4NXG A;  3B42 A;  5GHY A;  4EWF A;  3T1S A;  3E4Q A;  3IXB A;  3LFV A;  4E3O A;  5FDS A;  4HH2 A;  4MLL A;  2EFX A;  3V3R A;  3VP0 A;  5DFY A;  1CJF A;  4Q0I A;  3OPP A;  2ZM8 A;  3TG9 A;  3M6H A;  3BW6 A;  1OT6 A;  5HPF A;  3OPL A;  4BJP A;  1TF1 A;  2L0W A;  5L07 A;  3CUE A;  3D72 A;  4WUJ A;  4ZRR A;  3ZG5 A;  5KMW A;  2DRW A;  2GNX A;  4XXR A;  2HDS A;  1ACF A;  2PR5 A;  4WN5 A;  2JHE A;  4RVA A;  1FOF A;  4IBR A;  2B95 A;  4O8G A;  4HJ4 A;  3VP2 A;  2HDQ A;  4ZTK A;  2ZC4 B;  5TFQ A;  4HES A;  1SKF A;  1W8Y A;  3IS2 A;  4LRX C;  3F1N B;  5DJU A;  1OT9 A;  3QP6 A;  1GCE A;  4S2I A;  2V0U A;  5EE8 A;  1ZKJ A;  4JXG A;  1HVB A;  1Z09 A;  1TS0 A;  1LSW A;  4S2N A;  3C7U A;  3A3J A;  4DXC A;  4B4X A;  2QJ5 A;  5CHJ A;  2VK3 A;  2EFU A;  3WRT A;  1S1Z A;  4E3J A;  1K55 C;  1IOU A;  3F1N A;  4E6X A;  4KQR A;  2QHK A;  4IED A;  2HDU A;  1E4D A;  2Y2P A;  3VOZ A;  3KYQ A;  5GLB A;  2PAV P;  2W3F A;  3N8L A;  4OKP A;  4Y0O A;  3IBJ A;  3RFB A;  3CI6 A;  1H0M A;  3FPV A;  2Z2M B;  1N9B A;  2ZC5 B;  3HUM A;  4QB8 A;  3HJK A;  4O0P A;  1VEU B;  3S7P A;  1OPX A;  4S2L A;  1I2S A;  3NDE A;  3V67 A;  3P01 A;  4H8R A;  1G68 A;  3H7W B;  3EEA A;  1GA0 A;  1HLU P;  3LYX A;  5A91 A;  2P9V B;  1VB6 A;  3F1P A;  4IUK A;  3SS5 A;  4IBX A;  1L0G A;  4IVI A;  4R4S A;  3MSH A;  3JVV A;  3OBF A;  2KOI A;  5HPI A;  4MBH A;  4P6Z M;  5G4Y A;  3PHY A;  1V9Z A;  4IVK A;  4OOL A;  5CGS A;  1Z6F A;  4EBP A;  4OQH A;  4I3I A;  1IKG A;  4JPM A;  4ETX A;  3CWF A;  3WS2 A;  4BBU A;  4PAU A;  3KSH A;  4GZB A;  3A3I A;  2VX8 A;  4MEZ A;  2VV8 A;  3HL9 A;  1M40 A;  5FL3 A;  2VV7 A;  4DJ3 A;  1QME A;  3D4F A;  3LUQ A;  4ESP A;  1K57 A;  1DP9 A;  4CLC E;  4DDS A;  1J9M A;  4YFM A;  3C7V A;  3N6I A;  4JF6 A;  4EEU A;  1ES3 A;  2HP9 A;  1WYC A;  4C6Y A;  2A24 B;  2PR6 A;  3U4L P;  1YQS A;  4QD4 A;  2Y2L A;  5A92 A;  3W4P A;  3SZT A;  5U47 A;  1VET A;  4D60 A;  4KQO A;  5A90 A;  3BEB A;  3MMH A;  3I7J A;  3OPR A;  4BD1 A;  4ZDX A;  1YLY A;  3BWL A;  1NLY A;  5FQM A;  1KVL A;  2BG1 A;  4L0L A;  1F9I A;  1T19 A;  3QNC A;  3AGD A;  5C5K A;  1PZO A;  1VET B;  3Q81 A;  1E3U A;  2DNS A;  3PAG A;  5TR7 A;  4EET B;  4R70 A;  4PM6 A;  4CQH A;  4DF6 A;  5BOH A;  2OAQ 1;  3CAX A;  4GS9 B;  4QY6 A;  3IS2 B;  3C30 A;  5AJG A;  1MBL A;  4ID4 A;  1G6A A;  5AQA A;  4EV4 A;  4MNR A;  3G30 A;  3PBO A;  3LEZ A;  2JKF A;  3QP5 A;  1OJ5 A;  2O9C A;  2WUQ A;  5HAI A;  2Y59 A;  5IS1 A;  4CLC A;  4FSF A;  4F94 A;  1PW1 A;  2X02 A;  3W4Q A;  1PIO A;  1BUE A;  2A49 A;  3LR5 A;  2VGJ A;  1D7E A;  3LCE A;  3PXP A;  4O01 A;  2ZOH A;  4IUH A;  1MKM A;  1V9Y A;  2GDN A;  4E6W A;  5DTT A;  3W8K A;  1W63 M;  3WWX A;  4OPZ A;  3E98 A;  3MBZ A;  4G3K A;  4Y15 A;  5HAP A;  1IYP A;  4OPY A;  2HGV A;  5EVI D;  4N1H A;  5FAP A;  4X1L A;  3AGF A;  5I5L A;  3D9Y A;  3ZG8 B;  5G18 A;  5FAS A;  3GSG A;  4HNB A;  1XA1 A;  4UQI M;  3G2Y A;  4S2P A;  2BTF P;  3IBR A;  3VOY A;  4ZJ2 A;  2AVX A;  3FKV A;  4KZ9 A;  2ZC6 B;  3GEC A;  4Q0H A;  5TGF A;  1LI9 A;  1YT4 A;  1K54 C;  3UE0 A;  4NXE A;  5DFX A;  4ARZ A;  4S2N C;  2K2N A;  2FFY A;  2P7J A;  2UWX A;  2JE5 A;  2K31 A;  1NXY A;  5J8X A;  1KVM A;  3A3D A;  2XRO A;  3GR2 A;  1E3U D;  1ZG4 A;  5FQ9 A;  2EX2 A;  2VKS A;  2VGK A;  3E4P A;  3Q07 A;  1CQA A;  4PM8 A;  1TS8 A;  1ZHH B;  2ZL1 A;  2D02 A;  3IHA A;  4GCZ A;  4OP5 A;  1JNU A;  3H9W A;  4WF0 A;  2VV6 A;  4UA6 A;  1NYY A;  5CEC A;  3AGE A;  1XX2 A;  3E0Y A;  5D3O A;  1STZ A;  5F5Y A;  2IWB A;  4QWO A;  4OH0 A;  2XDM A;  3JYI A;  4XUZ A;  2PU4 A;  5L09 A;  1JVJ A;  1YLJ A;  2Y8H A;  5FEF A;  2PD7 A;  2W0N A;  2PBD P;  1S4R A;  3EGD C;  1SDE A;  4JF5 A;  1SDN A;  3BYD A;  4GOG A;  3TRC A;  1WYB A;  2ZQ9 A;  4EER A;  4DE0 A;  1NWZ A;  4DXB A;  1S67 L;  1FIL A;  1Y28 A;  1JWP A;  4NXB A;  4X68 A;  5G4Z A;  5EVI C;  3UPN A;  2HF6 A;  5HDC A;  5AQB A;  2GJ3 A;  4R38 A;  1H8Y A;  1XP4 A;  2Z6D A;  3BRM A;  2H0Y A;  2LB9 A;  2VEA A;  3FKW A;  1XGI A;  3L7H A;  5HDS A;  4QHC A;  4X56 A;  4KG2 A;  4B9O A;  2E8J A;  3BEC A;  5E43 A;  1Y4O A;  5CXW A;  5FQK A;  3IXD A;  2XK1 A;  1IEM A;  3IWQ A;  4E3N A;  2D01 A;  2WAE A;  4HIA A;  4II7 A;  5AQ9 A;  3EOI A;  3BFC A;  1S4S A;  4X25 A;  4OPR A;  2HJ9 C;  5FQQ A;  2WK0 A;  1XJ2 A;  2HP6 A;  3HLF A;  1MPL A;  1FCM A;  3IH9 A;  2R9X A;  1K0K A;  4X1M A;  1DY6 A;  3E2K A;  4WEJ A;  4S2J A;  3G6O A;  3IX3 A;  2Y2H A;  3UE3 A;  4WM9 A;  1ZC2 A;  2QYB A;  1A0K A;  5KSC A;  3DTM A;  4KG5 A;  1U60 A;  3A3E A;  3FG8 A;  4X55 A;  1EI5 A;  2JKT I;  5DTS A;  2V2F F;  4E3K A;  1G5U A;  4Y13 A;  2JCH A;  2JKR I;  3N4I A;  1ODV A;  4QU3 A;  4BL2 A;  1KGF A;  3S1Y A;  1YAX A;  3HLD A;  4M4X A;  1N9N A;  4NXF A;  1G6O A;  4NG2 A;  3QP1 A;  4OOM A;  1VM1 A;  4KG6 A;  4JXV A;  2IWD A;  2G2W A;  4PM7 A;  1NZO A;  1IYO A;  4BBV A;  3S22 A;  3QHY A;  3ZDJ A;  1TD5 A;  2HJE A;  5CTN A;  4EBL A;  4N1X A;  4DE2 A;  3MS6 A;  2HZ5 A;  3KX0 X;  2JBF A;  3DTK A;  3UO9 A;  1EWZ A;  4UAA A;  2GZA A;  1MC0 A;  4Y17 A;  4WEL A;  3OC2 A;  2ZC7 A;  1I2W A;  5F82 A;  2FZ0 A;  3IXH A;  3IH8 A;  1LL8 A;  1LI0 A;  2P9V A;  2Y2G A;  4P6Z S;  1LSX A;  2R78 A;  1OTA A;  3C38 A;  2X71 A;  2Q9N A;  3T12 B;  2EWV A;  5CRF A;  3T1R A;  4BEN A;  3LID A;  3V5M A;  3BJN A;  4WYY A;  3CPT B;  2W1T A;  1YKD A;  5A93 A;  4Y0T A;  3SOI A;  5MC7 A;  3G4P A;  1GHI A;  5CHM A;  5TBM B;  4IJG A;  4R4R A;  5EPH A;  1H8Z A;  4EXO A;  2WKI A;  3IX4 A;  3G31 A;  3JVU A;  3MQ0 A;  1MWU A;  4JXW A;  4DKI A;  1G28 A;  2A24 A;  1SZV A;  5I94 A;  4XT2 A;  4LCM A;  1HTZ A;  4WMC D;  3Q7Z A;  1BLS A;  1GHM A;  4GB7 A;  4F3L B;  3NIA A;  4KUO A;  1MWT A;  3GQZ A;  5TBM A;  3H82 A;  3S4X A;  1L0D A;  1KOU A;  2XRN A;  2V8C A;  1XPB A;  3UNW A;  2PDR A;  2EX6 A;  4EBN A;  4UA7 A;  3CUE C;  3C2W A;  2WKR A;  2ZJ9 A;  3QP4 A;  4JGO A;  2M7U A;  4JGR A;  5DF7 A;  3PTE A;  1LL5 A;  3MKE A;  1K56 D;  3HLC A;  2Y2Q A;  2IA2 A;  2A3U A;  2V8F A;  4OQ0 A;  1MXO A;  1Q2P A;  4R3A A;  2DCF A;  1W63 Q;  1UGU A;  3OCL A;  3MKF A;  5EVI A;  4BLM A;  1BUL A;  3DTE A;  3BLS A;  5CEB A;  1BLC A;  3IF6 A;  1LHY A;  5KZH A;  3CHW P;  4BD0 A;  1XJ6 A;  3PBS A;  4Y5F A;  1D06 A;  3LR4 A;  1XJ3 A;  1M6K A;  4EQ1 A;  2V0W A;  1WE4 A;  4ZJ3 A;  4CLC D;  2PU2 A;  1H8M A;  3VSL A;  5EVI B;  4KZ8 A;  1S0W A;  1YPR A;  2DMW A;  5HD3 A;  4DDY A;  1KE3 A;  5FI6 A;  1O07 A;  3T4Q A;  1FR1 A;  4OP8 A;  3MZF A;  2KDK A;  5K5B A;  3DW0 A;  1DJB A;  1RCJ A;  4LPZ A;  3DWZ A;  4I3A A;  1QMF A;  5L2F A;  2J3W A;  2XLN A;  1GHP A;  3ZGA B;  3CLO A;  4ZAM A;  2YKF A;  4N9K A;  4PMA A;  2Y2J A;  5F83 A;  3ZQ5 A;  2V20 A;  4KQD A;  5F1F A;  5IT5 A;  1JTG A;  1JWZ A;  2Y55 A;  4ZBE A;  5HX9 A;  4ETZ A;  2PRF A;  4HH3 A;  3EGX C;  4P87 A;  1ONH A;  4GLQ A;  5CER A;  4MN7 A;  4R3B A;  4HP4 A;  1GSW A;  2PD8 A;  2QMI A;  4Y0U A;  4KEN B;  3CIT A;  3ZCZ A;  3N8S A;  4X6T A;  3HBR A;  5HWT A;  3MZE A;  1PI5 A;  1OTB A;  1PNE A;  1KDS A;  4B93 A;  3LIF A;  2ZM2 A;  3M2J A;  3MJQ A;  3MZD A;  3W2Z A;  5EVL A;  3ZVW A;  3ULF A;  3FPW A;  1SCW A;  2C6W B;  4FTX A;  3Q1F A;  3BY9 A;  4WZ5 C;  4OQG A;  1PYY A;  4Y3I A;  2WAD A;  3F1O B;  3F1P B;  1TDG A;  4HBT A;  5FA7 A;  4I3J A;  2W27 A;  4K08 A;  5HWV A;  2ZD8 A;  1ERM A;  3UPO A;  3ZNY A;  1YM1 A;  1BLP A;  1J3W A;  2G7U A;  4L9F A;  1K25 A;  4KZA A;  4BMW A;  3OLO A;  1TVF A;  3FYZ A;  1OME A;  3ZNT A;  4HOI A;  3VE4 A;  3NHQ A;  3ZVT A;  1VHM A;  4EUZ A;  4UHU A;  5DF8 A;  1DRM A;  2J3T C;  4N92 A;  3W4O A;  3LIB A;  5JYO A;  3IHB A;  4F3L A;  1ERQ A;  3EWK A;  4R23 A;  3OZH A;  2JKT M;  4OON A;  2P74 A;  4L9G A;  2ZOI A;  5KIZ A;  2JKR M;  2PYR A;  4M3K A;  3LY3 A;  5J7E A;  2WZX A;  3IXG A;  1NYM A;  4EUV A;  2EWW A;  3RH8 B;  4N9L A;  3T1X A;  3T4T A;  4QJG A;  3IF6 C;  5GHX A;  3A3F A;  3M6B A;  4E3M A;  5J4E A;  3CJM A;  3RTY A;  3A0R A;  1K54 A;  5DKK A;  3P7N A;  3T4L A;  2ZQC A;  2HV1 A;  4RQ9 A;  2W1T B;  3EEH A;  2L1M A;  1KGE A;  1DJC A;  3LIA A;  3UB5 P;  1NZU A;  1W8Q A;  2EXB A;  4CPK A;  3LY4 A;  5FDH A;  3UB6 A;  3LO7 A;  1YLP A;  3OPH A;  3DTI A;  1NJ4 A;  1TDL A;  1TS7 A;  2HP5 A;  2PHY A;  3C4O A;  2WGI A;  1F5M A;  1BTL A;  4LRY C;  4HJ3 A;  4GD6 A;  2CC1 A;  1LSV A;  3ITA A;  4GHI B;  4JLF A;  1X0O A;  2L4R A;  1NLZ A;  5F68 A;  5GLA A;  4LRZ E;  2P08 A;  1OTE A;  5E2E A;  4GJ4 A;  1Y54 A;  4FH4 A;  4MDZ A;  3T4J A;  1MZU A;  2W3G A;  2QWS A;  4JBF A;  1ONG A;  1PRQ A;  4OPQ A;  2Y2M A;  2X01 A;  3HRE A;  3T4O A;  5IU1 A;  1GA9 A;  3HVF A;  3UDF A;  3LIE A;  3ZHH A;  1YSP A;  1T18 A;  1OJG A;  3UB8 A;  4JGQ A;  2QKP A;  2ZBB A;  3BFF A;  2E8I A;  5HL1 A;  5HZH A;  4HHD A;  1S1Y A;  4HBU A;  4LV1 A;  2V9A A;  3PBT A;  2Y2I A;  5DTK A;  3O88 A;  2ACG A;  2WAF A;  1P9W A;  1JTD A;  4Z9Q A;  1RGZ A;  4MN6 A;  3A0V A;  2B18 A;  3LI8 A;  5E2H A;  2W3H A;  5DJT A;  1BLH A;  4E3I A;  4WZ4 A;  3BQA A;  1NRJ A;  4LCL A;  4LV0 A;  3KYZ A;  2QJ7 A;  3HLE A;  5E2G A;  4EES A;  3B3X A;  2I72 A;  1KDW A;  3O3V A;  4NEE D;  4OQI A;  1YSQ A;  4QPR A;  5FAQ A;  3NUL A;  5F6A A;  3KSI A;  2FFF B;  3RXX A;  2NUT C;  1YMX A;  4PM9 A;  3BY8 A;  4LV3 A;  1K4E A;  3P98 A;  5AVE A;  2A2L A;  1H5X A;  4GHI A;  4Q8I A;  5F1G A;  5CED A;  5E2F A;  4K0W A;  2OOL A;  5EEC A;  3WS0 A;  4Z1W A;  3O87 A;  1K4F A;  3TJZ C;  4YOF A;  5HD5 A;  5CGX A;  5HFO A;  2FH5 A;  2J9O A;  5FEG A;  4E04 A;  2Y91 A;  5FI2 A;  1WA9 A;  1NRF A;  1BT5 A;  4IHQ A;  4UQI S;  4HP9 A;  4L9E A;  2B5R A;  2QZ6 A;  3HUN A;  2JC7 A;  1XXM A;  3JPU A;  4S2O A;  1K55 A;  3E4O A;  3LEQ A;  1K56 A;  4P6B A;  3G32 A;  3DAV A;  3S7N A;  2EA9 A;  3N7W A;  3T1Q B;  2OV5 A;  2HPB A;  4PHT A;  5GLC A;  4MBK A;  3V39 A;  2XA7 M;  3WS4 A;  4K91 A;  2Z6C A;  1XJ4 A;  2XEP A;  1IYS A;  4GS9 A;  1OTI A;  5J3W A;  3KO6 A;  4HEF A;  4EW7 A;  1W7F A;  2OWJ A;  2RCX A;  2XGN A;  3Q7V B;  2WKE A;  4S2K A;  4BL3 A;  1CI8 A;  2XFT A;  3K2N A;  4U0T A;  1CI9 A;  1PFL A;  1DJA A;  4FUW A;  2H28 A;  4LEN A;  4O7D A;  3ICY A;  1O7E A;  2WKP A;  4GD8 A;  1P9R A;  4HQA A;  4JF4 A;  4R3J A;  2V1B A;  3SS3 A;  2QPN A;  3UN7 A;  2YKH A;  3VV4 A;  5KSH A;  1LT0 A;  2ZC3 B;  3FZC A;  1XKZ A;  3UB9 A;  1IFQ A;  4RA7 A;  2GX5 A;  4FD8 A;  3LI9 A;  1MKI A;  4NK3 A;  5GHZ A;  2J7V A;  3ZG7 B;  2RL3 A;  2G2U A;  3MF0 A;  3IF6 B;  4QY5 A;  2NUP C;  4JGP A;  3MXS A;  3NBL A;  3QNB A;  1ZG6 A;  3NJA A;  4PKY A;  3NCK A;  4WBG A;  5CHU A;  2ZMA A;  3GV9 A;  4CLC C;  1F98 A;  3LGO A;  2Y2O A;  1S66 L;  3BM6 A;  1I5Q A;  4XUX A;  4LGW A;  3P09 A;  1CEG A;  1N4O A;  4NKP A;  5HWW A;  4EQI A;  3G34 A;  3WRZ A;  3MQO A;  1JWV A;  2J9P A;  3WS5 A;  1VEU A;  1DP6 A;  2Y2K A;  4UA9 A;  4MMN A;  4K0X A;  2Y4A A;  4CLC B;  3BLM A;  3IX8 A;  4BQM A;  2H0T A;  3ISG A;  1ESI A;  2C5W B;  4PPR A;  4P85 A;  4KZ5 A;  4X69 A;  3VFF A;  2KLI A;  3T50 A;  3O86 A;  2W3D A;  2UV0 E;  3PYP A;  3IWI A;  2WGW B;  2W1R A;  5HDD A;  2H10 A;  3VFH A;  5HL6 A;  4KQQ A;  4RYE A;  4C75 A;  3K3D A;  5EOO A;  4DMZ A;  3BFG A;  4A5R A;  3NDG A;  3QP8 A;  1EW0 A;  4R6L A;  5FAT A;  3UE1 A;  4DRT A;  2ZMV A;  1YMS A;  1LLB A;  4OVD A;  3IWO A;  3VE3 A;  2WGW A;  2INW A;  1FCO A;  5HAQ A;  4KZ4 A;  2K7S A;  3HCY A;  1BSG A;  3PBQ A;  4WEK A;  3NI9 A;  3NOP C;  3WS1 A;  3GRJ A;  3L9K A;  4U3T A;  5AVF A;  2OAP 1;  1RP5 A;  4YNR A;  4PM5 A;  2PYP A;  4WMC A;  1L0F A;  4JXS A;  2V1Z A;  1W79 A;  2J80 A;  5FQI A;  3OOV A;  3ZG0 A;  3F1O A;  3BFE A;  5L8M A;  3B33 A;  2XD5 A;  3CMZ A;  4E3L A;  2XH9 A;  1RGY A;  3GVB A;  4HJ6 A;  1ES4 A;  2P04 A;  3LR3 A;  4HY8 A;  4D2O A;  4MCW A;  1P0Z A;  5CTM A;  3KSF A;  3S7O A;  5L10 A;  2O9B A;  3C5A A;  3IQA A;  1N9O A;  2IWC A;  2I9V A;  2VZW A;  3UME A;  1K6S A;  4OOY A;  2WKH A;  4GDN A;  3UMD A;  4WLA A;  1FCN A;  5LBR A;  5EFW A;  3FC7 A;  4ZJ1 A;  1K6R A;  2O99 A;  1L0E A;  1FQG A;  2J3T D;  5FI7 A;  3MQQ A;  3Q7V A;  1DP8 A;  1E25 A;  1BYW A;  3MR0 A;  3SW1 A;  1ESU A;  3ITB A;  5JYP A;  4H6J B;  2XR0 A;  3GMW A;  4BBT A;  2O9A A;  3H7W A;  1S6R A;  5EUA A;  3RXW A;  1PWG A;  2M7V A;  3TE8 A;  2MJ6 A;  3ZYT A;  2O0Y A;  3SS4 A;  4EEP A;  2VGL S;  1CK3 A;  5HAR A;  5DKL A;  2PBY A;  4R1G A;  1SKO A;  4XT2 B;  1MWS A;  1D1J A;  1H3Q A;  4U0X A;  3PBR A;  1IEL A;  3HJI A;  3TOI A;  1W5D A;  1PW8 A;  3MXQ A;  3K3C A;  5M19 A;  3LR0 A;  1XFQ A;  2BLS A;  5EM0 A;  2ZQ8 A;  3R7W A;  2Q0O A;  1PZP A;  5TJJ A;  1ZTU A;  1ES5 A;  3PAE A;  4LFU A;  2J8Y A;  3NC8 A;  1P97 A;  4C3Q A;  3IF5 A;  5EOE A;  3EQU A;  3UPP A;  3V50 A;  3UY6 A;  2KX6 A;  4B4Z A;  2LB5 A;  5FAO A;  5IHV A;  4YIN A;  3T4S A;  4P0M A;  4ME4 A;  2XF3 A;  2ZQA A;  4AFI A;  3N8R A;  4RX3 A;  2ZQ7 A;  4FCF A;  2M1C A;  3NOT C;  4PKY G;  3GTC A;  4UEY A;  4FOF A;  5M18 A;  3VP4 A;  4MBF A;  1IYQ A;  5HSQ A;  4KZB A;  1K38 A;  1YLZ A;  3KSG A;  3VSK A;  3TW8 A;  1AWI A;  1FR6 A;  3MXR A;  2WYX A;  4WZ5 A;  2XQZ A;  3CZD A;  3SH8 A;  2XFS A;  3OCN A;  3IT9 A;  4HI4 A;  1YLT A;  1NY0 A;  3UDI A;  1HZO A;  2V1A A;  1C3B A;  3G2Z A;  1XGJ A;  1KE4 A;  3G35 A;  4MN5 A;  2OLU A;  2Y2N A;  4I5S A;  3V3S A;  1PI4 A;  4LV2 A;  3GDI A;  5AQ7 A;  4Y2F A;  1GSX A;  4JKT A;  4DN0 A;  2ZMF A;  5A8B A;  4ARZ B;  1PWD A;  3MFX A;  1N9L A;  4Q0J A;  1BZA A;  3H82 B;  3QP2 A;  3BQ8 A;  2ZQD A;  5DVA A;  5HW3 A;  4CJN A;  4YWZ A;  1T1C A;  4X53 A;  1OTD A;  1XA7 A;  4S2M A;  3U2A A;  1SHV A;  3PBN A; 
#chains in the Genus database with same CATH homology
 4EQ1 A;  4GS9 A;  2V0W A;  4CLC D;  3LR5 A;  4IUH A;  1H8M A;  1D7E A;  1OTI A;  2JN7 A;  2ZOH A;  3PXP A;  3R4K A;  4O01 A;  5J3W A;  1MKM A;  2OWH A;  1V9Y A;  3KO6 A;  4GW9 A;  3UE6 A;  4EW7 A;  2OWJ A;  2DMW A;  2XA7 S;  2Y79 A;  1W63 M;  5HD3 A;  1T1B A;  3E98 A;  3T4Q A;  4G3K A;  3B47 A;  1T1A A;  2XSS A;  2KDK A;  5K5B A;  2HGV A;  4LPZ A;  3K2N A;  5I5L A;  3PR6 A;  2H28 A;  3ICY A;  2WKP A;  3LIC A;  4I3A A;  1P9R A;  2VA0 A;  2J3W A;  4HQA A;  4HNB A;  4UQI M;  4G3V A;  3O5Y A;  3CLO A;  3IBR A;  2V1B A;  3S7Q A;  3T4K A;  3GEC A;  2BAS A;  2YKH A;  2YKF A;  3VV4 A;  4Q0H A;  5KSH A;  1LT0 A;  3ZQ5 A;  5F69 A;  4KQD A;  2B02 A;  5IT5 A;  3UB9 A;  4LLO B;  1IFQ A;  3DBA A;  4NXE A;  5DFX A;  2GX5 A;  3EQV A;  3LI9 A;  4ARZ A;  3R7W B;  2K2N A;  2P7J A;  1UWP X;  2K31 A;  3UB7 A;  2XRO A;  3MF0 A;  4ETZ A;  5CX7 A;  4HH3 A;  2NUP C;  3EGX C;  4JGP A;  2VKS A;  3E4P A;  4KUK A;  4GLQ A;  4MN7 A;  1TS8 A;  3C8C A;  1ZHH B;  3NJA A;  4G3W A;  2D02 A;  4PKY A;  4GCZ A;  4HP4 A;  1JNU A;  4CLC C;  1F98 A;  3H9W A;  1GSW A;  1S66 L;  4WF0 A;  2VV6 A;  2PD8 A;  3E0Y A;  1UWN X;  4NKP A;  3CIT A;  1STZ A;  2VJW A;  5F5Y A;  5HWW A;  4EU0 A;  3MQO A;  4I39 A;  5HWT A;  4H6J A;  1OTB A;  4B93 A;  4WL9 A;  2VLG A;  1DP6 A;  4BWI A;  4DJ2 A;  4MMN A;  3LIF A;  3MJQ A;  4CLC B;  3W2Z A;  3ULF A;  3FPW A;  2Y8H A;  2PD7 A;  2W0N A;  1S4R A;  3EGD C;  3BY9 A;  3VOL A;  3D3O A;  4Y3I A;  3F1O B;  3F1P B;  3NOU C;  3TRC A;  4I38 A;  2KLI A;  3T50 A;  3A0S A;  1TS6 A;  2CMN A;  4I3J A;  4EER A;  2W27 A;  4K08 A;  2W3D A;  5HWV A;  1XFN A;  1NWZ A;  3PYP A;  5DF9 A;  2WKQ A;  1S67 L;  2W1R A;  1Y28 A;  5HDD A;  4NXB A;  5G4Z A;  5HL6 A;  2HF6 A;  2VGL M;  5HDC A;  3K3D A;  2GJ3 A;  4R38 A;  2G7U A;  2PT7 A;  4L9F A;  1GSV A;  4BMW A;  3OLO A;  2Z6D A;  4DMZ A;  2LB9 A;  2VEA A;  2W3E A;  4NXG A;  3B42 A;  5HDS A;  1EW0 A;  4R6L A;  3E4Q A;  2ZMV A;  4HOI A;  3LFV A;  3VE4 A;  4B9O A;  3NHQ A;  4HH2 A;  1VHM A;  3VE3 A;  2INW A;  5DFY A;  1DRM A;  2J3T C;  4Q0I A;  3LIB A;  3BW6 A;  1OT6 A;  5HPF A;  2K7S A;  4F3L A;  3HCY A;  4BJP A;  3PBQ A;  1TF1 A;  2L0W A;  3EWK A;  3CUE A;  2D01 A;  4WEK A;  4HIA A;  4II7 A;  3EOI A;  3D72 A;  3NOP C;  2JKT M;  1S4S A;  4WUJ A;  2HJ9 C;  4ZRR A;  5AVF A;  4L9G A;  2OAP 1;  2GNX A;  2ZOI A;  4YNR A;  5KIZ A;  1XJ2 A;  2PYP A;  2JKR M;  2PYR A;  2J80 A;  2PR5 A;  4WN5 A;  5J7E A;  2JHE A;  3OOV A;  3F1O A;  5L8M A;  3B33 A;  4EUV A;  2EWW A;  4O8G A;  3RH8 B;  4HJ4 A;  4WEJ A;  3T4T A;  4HJ6 A;  3G6O A;  2P04 A;  3LR3 A;  4HY8 A;  3UE3 A;  5J4E A;  4MCW A;  2QYB A;  3IS2 A;  4LRX C;  1P0Z A;  3RTY A;  3A0R A;  3F1N B;  3KSF A;  5DJU A;  1OT9 A;  3S7O A;  3FG8 A;  5DKK A;  3P7N A;  2V0U A;  3T4L A;  2O9B A;  1TS0 A;  1LSW A;  2JKT I;  2HV1 A;  4RQ9 A;  1N9O A;  2W1T B;  2I9V A;  3EEH A;  2VZW A;  3UME A;  2L1M A;  2QJ5 A;  2JKR I;  3UMD A;  1ODV A;  4WLA A;  5LBR A;  5EFW A;  3FC7 A;  1YAX A;  3LIA A;  4M4X A;  2O99 A;  1N9N A;  4NXF A;  1G6O A;  1S1Z A;  4OOM A;  1IOU A;  3F1N A;  3UB6 A;  2J3T D;  1TS7 A;  2PHY A;  2QHK A;  3MQQ A;  4BBV A;  1DP8 A;  1F5M A;  1BYW A;  4LRY C;  4HJ3 A;  3MR0 A;  3SW1 A;  1LSV A;  1TD5 A;  2HJE A;  3KYQ A;  4H6J B;  2W3F A;  4GHI B;  3IBJ A;  3RFB A;  4BBT A;  3CI6 A;  2O9A A;  3H7W A;  1X0O A;  2L4R A;  1NLZ A;  2M7V A;  3FPV A;  5F68 A;  3TE8 A;  2MJ6 A;  3KX0 X;  4LRZ E;  2P08 A;  3ZYT A;  2O0Y A;  3HJK A;  4O0P A;  4EEP A;  2VGL S;  1OTE A;  4GJ4 A;  3S7P A;  1OPX A;  4MDZ A;  3T4J A;  2GZA A;  5DKL A;  1MZU A;  1MC0 A;  2W3G A;  2QWS A;  3V67 A;  4XT2 B;  4WEL A;  3P01 A;  3OC2 A;  1H3Q A;  2FZ0 A;  3H7W B;  3T4O A;  5IU1 A;  3EEA A;  1LL8 A;  3LIE A;  3PBR A;  3LYX A;  1VB6 A;  1YSP A;  3HJI A;  1T18 A;  4P6Z S;  1LSX A;  3F1P A;  2R78 A;  1OTA A;  3MXQ A;  4IUK A;  1OJG A;  3K3C A;  3UB8 A;  3C38 A;  3LR0 A;  2QKP A;  4JGQ A;  2ZBB A;  1XFQ A;  3R7W A;  3JVV A;  3OBF A;  2KOI A;  5TJJ A;  1ZTU A;  4HHD A;  5HPI A;  5HZH A;  4P6Z M;  5G4Y A;  1S1Y A;  3PHY A;  2V9A A;  1V9Z A;  4OOL A;  3PBT A;  1P97 A;  2EWV A;  3LID A;  4I3I A;  3BJN A;  3EQU A;  2W1T A;  1YKD A;  4ETX A;  1P9W A;  3CWF A;  2KX6 A;  5MC7 A;  4MN6 A;  3A0V A;  2B18 A;  2LB5 A;  3LI8 A;  4BBU A;  4PAU A;  5TBM B;  4IJG A;  3KSH A;  2W3H A;  5DJT A;  3T4S A;  2VX8 A;  4ME4 A;  3BQA A;  1NRJ A;  4AFI A;  4EXO A;  2VV8 A;  5FL3 A;  3JVU A;  2VV7 A;  2M1C A;  3MQ0 A;  4DJ3 A;  3KYZ A;  3NOT C;  4PKY G;  2QJ7 A;  3LUQ A;  1G28 A;  2A24 A;  4UEY A;  4EES A;  1DP9 A;  4CLC E;  4FOF A;  4XT2 A;  4NEE D;  1YSQ A;  4QPR A;  5F6A A;  4EEU A;  5HSQ A;  4F3L B;  4KUO A;  3KSG A;  5TBM A;  3KSI A;  3TW8 A;  3H82 A;  2A24 B;  2NUT C;  1KOU A;  2XRN A;  2PR6 A;  3BY8 A;  5AVE A;  2A2L A;  4GHI A;  2PDR A;  3OCN A;  3CUE C;  4KQO A;  4HI4 A;  2OOL A;  3C2W A;  3MMH A;  4Z1W A;  2WKR A;  2V1A A;  4JGO A;  2M7U A;  4JGR A;  3TJZ C;  4YOF A;  4MN5 A;  5HD5 A;  3BWL A;  1NLY A;  2FH5 A;  4I5S A;  4L0L A;  4E04 A;  2IA2 A;  1F9I A;  1T19 A;  1WA9 A;  5C5K A;  4IHQ A;  4UQI S;  4HP9 A;  4L9E A;  3GDI A;  4R3A A;  1W63 Q;  1UGU A;  4Y2F A;  1GSX A;  3OCL A;  4DN0 A;  4EET B;  4R70 A;  2ZMF A;  5A8B A;  4ARZ B;  4CQH A;  2OAQ 1;  3CAX A;  3MFX A;  1N9L A;  4Q0J A;  3E4O A;  3H82 B;  4GS9 B;  3IS2 B;  3C30 A;  3BQ8 A;  5AJG A;  3S7N A;  2EA9 A;  4YWZ A;  1XJ6 A;  1T1C A;  3PBO A;  3PBS A;  1OJ5 A;  4PHT A;  4Y5F A;  2O9C A;  1D06 A;  1OTD A;  3U2A A;  2XA7 M;  3LR4 A;  5IS1 A;  1XJ3 A;  4CLC A;  4FSF A;  2Z6C A;  1XJ4 A;  3PBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...