3EGDC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22 and bound to the transport signal sequence of vesicular stomatitis virus glycoprotein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egdC00
2VX8A 1H8MA 1IFQA 3EGDC 2NUTC 4B93A 3EGXC 1IOUA 2NUPC 3KYQA 3BW6A 4AFIA 2DMWA
chains in the Genus database with same CATH superfamily
1G28A 1IEMA 5AVFA 4BL3A 2Y2PA 2A24A 2D01A 1RGZA 3G6OA 1K57C 2JHEA 5E2EA 2PRFA 5CHJA 1OT9A 5TBMA 4OQIA 3FV7A 1K55C 4IUKA 5CX7A 5HWTA 1KVMA 2GZAA 1BUEA 1JTGA 2UV0E 3NC8A 1T1AA 2GJ3A 2W3HA 4HHDA 3T4OA 4HH3A 3TG9A 5FAPA 5HFOA 3UB9A 2A3UA 4R0QA 1YM1A 4OPYA 4EUZA 3FPWA 1MBLA 1T1CA 3MQQA 4OQHA 5FL3A 1TVFA 4LRXC 3EEAA 4NG2A 5DTTA 2Y2NA 4Y13A 4BD0A 4F3LB 2HDUA 3CG5A 3G35A 1XP4A 3DW0A 5EUAA 2VEAA 5J3WA 2D02A 2P08A 1YSPA 4MMNA 2KLIA 3VE4A 3V5MA 2ZC5B 3KSFA 4Y7PA 5G4YA 2B95A 3UE0A 3I7JA 5HWVA 3T4SA 2W3GA 1G6OA 3R4KA 4E3NA 5DFYA 3DWZA 1FQGA 4GB7A 4Y15A 5F82A 5EM0A 3CUEA 4QU3A 1OTDA 5A92A 5HX9A 1ESUA 3R7WB 3UE3A 4PMAA 5EFWA 1JTDA 2VGKA 1H3QA 4R1GA 1KGFA 4BQMA 3NCKA 1ZKJA 2KOIA 3E0YA 1BTLA 2ZQ8A 3PBQA 4BBUA 1KDSA 2W3EA 3P98A 1SKFA 1D1JA 2JBFA 4JF5A 2I9VA 5DF8A 2B5RA 2PR6A 5EOEA 4AFIA 5FAOA 1GSXA 4EBLA 5CEDA 2ZL1A 2ZLYA 4YWZA 1ES3A 3H82A 4EU0A 2HP5A 4OH0A 3WWXA 4RQ9A 3MFDA 4XXRA 1IYOA 3NIAA 4WMCD 1FSWA 4WMCA 3IS2B 4E3MA 5DKKA 3OPRA 3HBRA 4EETB 3BFCA 5FQMA 3G2YA 1ESIA 5DF7A 4ZDXA 1K25A 3K3CA 4ID4A 3HUMA 1F9IA 3M6BA 5FA7A 2P04A 1KE4A 3B33A 4PKYG 3QP6A 5L10A 2K31A 4U0XA 2EX9A 2ZQDA 3A3IA 5HARA 3HLBA 1FILA 1ZG6A 2J9OA 4BBTA 1DP9A 1SDEA 3W8KA 2ZMAA 3F1PA 3BFGA 2VA0A 3PAEA 4JF4A 3VOZA 4EESA 2OWHA 5F1GA 4LPZA 3OOVA 4E6XA 1YLYA 5A93A 2XFTA 1TEMA 5TFQA 2XH9A 1S66L 4DKIA 2WGVA 3D4FA 2XK1A 3LEQA 3LY4A 5TJJA 1K0KA 2A24B 2J3TC 3BQ8A 2X02A 3FG8A 4KUOA 1IELA 1CQAA 1LL5A 1H0MA 4LV3A 4MLLA 5GLBA 4JKTA 3SOIA 5IT5A 4P6ZS 1SCWA 3ISGA 3D72A 4NK3A 3NOTC 5J7EA 3Q1FA 5E2GA 2XRNA 3T1QB 1EWZA 1YLJA 3IH9A 4PM9A 3UB7A 1TS8A 3N8SA 4ZAMA 1ERQA 1ES5A 1YLTA 4RX2A 2H10A 2Z2LB 4UA7A 1XKZA 1YMXA 5CHUA 2O9CA 3IWIA 4CQHA 3VFFA 3BWLA 2JCHA 1IYPA 5FEFA 4OPQA 4ZRRA 3MQOA 1F2KA 5FI2A 4ZJ1A 4X56A 5GLCA 1XA7A 2XA7S 2V9AA 4WLAA 3L9KA 3MXSA 3EWKA 2B02A 1KGEA 3AGEA 3E98A 4MBKA 3P7NA 3JPUA 1W63Q 3SZTA 2H0TA 2NUTC 4WZ4A 3NDEA 3Q7ZA 1BT5A 3KSGA 3E4PA 3HREA 3QP2A 3MBZA 1MWSA 3ZFZA 4IEDA 4EEPA 4EV4A 1W8QA 1IKIA 1S67L 3VSKA 4CLCD 2ZL1B 3MZFA 5GHXA 1S0WA 2HJ9C 3H82B 1P9RA 2JKFA 2GNXA 2WUQA 4L9GA 4FD8A 4EERA 4ARZA 3UPOA 1NYMA 4WN5A 3S4XA 3UDIA 1MZUA 4WBGA 1H8YA 2QHKA 3FYZA 2J3WA 4K0XA 1Z09A 1W79A 3G2ZA 3FPVA 3V50A 4B4ZA 1VETA 4FCFA 3QNBA 3MSHA 1LSWA 2EX6A 4WL9A 1HZOA 5HAIA 4HBTA 2VGLS 3G31A 3FWLA 2BLSA 1FCNA 4KZ6A 4GLQA 1D7EA 5HDSA 1ALQA 4HOIA 3TSGA 3G32A 4G3VA 4I39A 3IX8A 3GQZA 5DVAA 5IU1A 1PRQA 2X01A 2CMNA 3SH8A 3F1PB 2G2UA 3UNWA 5FQQA 2NUPC 3UPPA 4R3JA 1QMFA 5CRFA 2VV7A 1KOUA 3C30A 4Q8IA 3ITBA 2V0WA 3KSHA 1N9LA 4PAUA 1JWVA 2C6WB 3WS2A 3LO7A 3C5AA 3MFXA 4X1MA 1JWPA 1I2WA 3PBSA 2XFSA 4KZ7A 3Q7VA 2JKGA 1ZTUA 4QHCA 1YQSA 2VJWA 5EE8A 1LLBA 3H7WA 4HP9A 3NECA 1E4DA 3B42A 4E3LA 4UA6A 2ZM8A 1STZA 4WELA 1XFQA 2OSUA 2HDQA 3UDFA 4HQAA 3EEHA 1HVBA 4OPRA 2VZWA 4Y5FA 4II7A 5HPIA 4E3KA 1MWTA 3C38A 1XX2A 3NHQA 1IOUA 3S7PA 2Z6CA 2EXBA 3OZHA 1MWRA 3LR4A 4KQDA 4OLGA 1MY8A 4PM7A 3IHBA 3IQAA 4FTXA 3UB5P 3P09A 1AXBA 1SHVA 2Y2HA 1MWUA 2WKHA 1RP5A 3C8CA 3UB6A 4MDZA 4S2OA 3DWKA 2IWBA 2BG1A 2Y2KA 1ONHA 4ZJ3A 4GHIA 3VP3A 3NI9A 1E3UD 3IBRA 3QP8A 1E25A 1BLPA 2PD8A 3ZG0A 3BFFA 3MKEA 1TDLA 1LI9A 5HL6A 5HD5A 1E3UA 3LR5A 4ME4A 4CLCE 4L0LA 4JXWA 2EA9A 2M7UA 2WZZA 1IKGA 1U60A 3GTCA 2PHYA 4Y0TA 1PNEA 3VP4A 3IT9A 3K3DA 2OLUA 4ARZB 3Q07A 4A5RA 1SDNA 2Q9NA 2QZ6A 1HLUP 4JGRA 2ZC3B 5TR7A 1PW8A 4MNRA 5L8MA 1LHYA 4NKPA 3SS5A 2EFUA 1OTEA 5EM1A 1SKOA 2JC7A 3VP2A 3BRMA 2HF6A 4DDSA 3OPHA 4PM8A 5FAQA 2DRWA 4E3JA 3NDGA 1C3BA 3G4PA 3BW6A 3QHYA 1IFQA 1FR1A 4OKPA 3RJUA 5HPFA 4JGQA 4YNRA 4KG2A 4K91A 2JKRI 4WM9A 1DP6A 2K2NA 3A0RA 4X1LA 2W27A 1N4OA 3RTYA 2L4RA 1KE3A 4S2IA 2ZM2A 1YAXA 2Q9MA 2WK0A 4O7DA 5HD3A 3MR0A 4EQIA 2IWDA 5FSRA 3LIDA 4R70A 3IX3A 3HLFA 3CHWP 4MEZA 5LBRA 4U3TA 4LCLA 2IWCA 2PR5A 4Z1WA 1DY6A 2PU2A 2PAVP 4BJPA 4HH2A 3VV4A 3HLCA 3FKWA 3UY6A 4GZBA 5CGXA 3CJMA 3Q7VB 4QY6A 3WS0A 1NZOA 4LV2A 4H8RA 5CGWA 3WRZA 1X0OA 3BQAA 3WRTA 3PAGA 2QPNA 2O0YA 3UB8A 4PM5A 3T4JA 3E4OA 3GVBA 3VP0A 5KSCA 3B47A 1TF1A 1G5UA 3B3XA 2J3TD 1JNUA 3S7QA 4U0TA 3KSIA 1UWNX 5AQAA 1RCJA 3D9YA 3DAVA 1XA1A 2Y59A 2XLNA 3DTIA 3W2ZA 2J9PA 1MC0A 5D3OA 4DXBA 1T19A 4OQ0A 1YKDA 5J8XA 2Y55A 1K4EA 5F69A 2W3FA 1W63M 4DE0A 5HL1A 3H9WA 1M40A 4KG5A 4GHIB 3RXXA 2XR0A 4Y3IA 1S4SA 4EUVA 4DF6A 1VEUB 1NRFA 1SZVA 2V8FA 3ZG8B 1XGIA 4I38A 3PXPA 4WEJA 3HLEA 3HLGA 2XA7M 1L3LA 4BENA 4L9FA 3F1OA 3IF5A 4K08A 2B18A 3ZNTA 3CUEC 3GDIA 3BFDA 4KZBA 1O07A 4GW9A 5DTKA 2YKHA 3D3OA 4OPZA 5JYOA 1YLPA 3PBTA 2EX8A 5CHMA 2RCXA 4WF0A 1BLCA 3EGDC 4MBHA 4B93A 4D60A 1MKMA 1PIOA 4LRYC 4MN7A 4S2LA 3S7NA 1ZHHB 5TBMB 2VLGA 4MCWA 1SKOB 2PD7A 3BM6A 5E43A 5CGSA 2EFXA 3UMDA 5FEGA 1K38A 1S1ZA 3A3DA 3OPPA 4NEED 1TS0A 4KUKA 2C5WB 3OPLA 3T4KA 4CJNA 3F1NA 2AVXA 2J8YA 3BFEA 2PBYA 1YPRA 1NJ4A 4WYYA 2XF3A 1TS7A 3HJKA 2CC1A 3UO9A 1J9MA 4OOMA 4NXFA 2R9WA 3BY8A 3OCLA 2OWJA 1NYYA 1PI4A 3CITA 5GHZA 5DJUA 2ZOHA 5GL9A 3JYIA 4GJ4A 1NLYA 4RYEA 1NWZA 3JVVA 4ETXA 4GDNA 4NXEA 2H0YA 4I3AA 1BLSA 3MJQA 3LCEA 4LGWA 3HCYA 5FQKA 3SW1A 4R4RA 4QD4A 4C6YA 1WA9A 4DMZA 4GS9A 4UQIS 4XT2A 4JBFA 4HBUA 2G2WA 4P85A 4BD1A 3PR6A 1EI5A 1BSGA 2QYBA 4R23A 5HAPA 3TOIA 1P97A 4HI4A 3V3RA 1XGJA 1OPXA 2W1TA 1V9YA 4OLDA 4QPRA 2P7JA 5EVID 1PWCA 2WZXA 3ZNYA 5FI6A 4CLCA 4PHTA 5EVIA 1K6RA 3UE1A 3BJNA 1N9OA 3VE3A 4LFUA 1AWIA 4CPKA 2FFYA 1XJ3A 4HJ3A 3IXGA 1Q2QA 1OTIA 2Y79A 3MZDA 4JGOA 2JKTI 2WAEA 2VV8A 2J80A 4BMWA 4WEKA 3LIEA 4FH4A 4OP8A 4NXBA 3EQUA 2XD5A 3V39A 3SH9A 2OV5A 3P01A 2OOLA 3T4QA 3T1SA 4ZJ2A 1LI0A 1F5MA 3SS4A 2V8CA 5M1AA 2HPBA 2M1CA 4EBNA 3EQVA 3M2JA 2W0NA 1V9ZA 3VSLA 4GD8A 2W3DA 4UHUA 5F5YA 4L9EA 2HDRA 3LIFA 1GA0A 3HLWA 1W5DA 3E2KA 4KZAA 3CI6A 1HTZA 3IHAA 3ZYTA 1GA9A 3T1RA 2PYPA 3O3VA 1IYQA 1Q2PA 2Y91A 1ERMA 2ZC6B 1J3WA 1K56D 4LV0A 4OVDA 4R6LA 2KDKA 4D2OA 3CLOA 5EVLA 4HIAA 3EGXC 2ZM0A 4Q0JA 3OCNA 2XGNA 4MN5A 4DN0A 4JXSA 1PWDA 4N1XA 3LGOA 3IXBA 4IUHA 3BECA 4BL2A 1CF0A 5EVEA 3GV9A 1H8MA 1Z6FA 2O9BA 4R3BA 4M4XA 5HDCA 1BULA 4EXOA 1TS6A 3N8LA 4HNBA 1TDGA 5I94A 2Y2OA 4EWFA 2Q0OA 3A0SA 1N9BA 5G4ZA 1KVLA 2OAQ1 4OOYA 3R7WA 3CPTA 4FH2A 4R38A 2V1AA 3ZVWA 4IVKA 2VV6A 1PI5A 3LIAA 1Y4OA 3M6HA 4JF6A 3HJIA 1L0GA 5CEBA 2L1MA 4X55A 5I5LA 5FDSA 3ZG5A 3LR0A 1MXOA 3GR2A 4KZ4A 2GX5A 1K55A 4EW7A 1BZAA 4K0WA 1DJCA 3E4QA 4I3IA 1WYCA 3RFBA 4UAAA 2JKRM 2HJEA 1M6KA 1Y28A 4WUJA 2PT7A 2PBDP 5FDHA 4OP5A 4JXGA 4B4XA 3NBLA 4X53A 1I5QA 2VX8A 1YT4A 4GNUA 2QJ5A 4IVIA 4GS9B 4XT2B 1T18A 3T1XA 1CK3A 5HWWA 1MKIA 2Y2GA 3ICYA 4KQRA 4PM6A 4EEUA 3MXQA 2V0UA 5FATA 4LLOB 2Y2IA 2V2FF 4O01A 2WAFA 4OONA 4JLFA 3HLDA 2HZ5A 4GD6A 2R78A 2P9VA 3NOPC 3C7VA 1LT0A 4CLCB 3CWFA 4RX3A 1PYYA 1XJ6A 2RL3A 4KZ3A 4N1HA 4Q0HA 3WS5A 4G3KA 2WKIA 4KZ9A 2FH5A 3DTKA 2ZMVA 3ZCZA 4B88A 3GMWA 1OTAA 3KYZA 3GSGA 4EQ1A 2E8IA 3IXDA 1VETB 1ONGA 4HP4A 1KGGA 5L07A 3V3SA 5AVEA 2WKEA 2QWSA 4E6WA 2O99A 2OLVA 4DE1A 2KX6A 1D06A 2Z6DA 3EOIA 1K6SA 4KENB 5CERA 3HUOA 1PZPA 3DBAA 4OOLA 3PBRA 1BLHA 1L0FA 1NLZA 3ULFA 4KZ8A 2O9AA 4GCZA 1LL9A 2XSSA 2WADA 4DJ2A 4Y0UA 4DDYA 1GSVA 1L0EA 4IBXA 3HL9A 4R4SA 5CTNA 5GHYA 2VK3A 1T1BA 3LI8A 4JPMA 4BLMA 3NY4A 1YLWA 4N9LA 5FQJA 3S1YA 5HAQA 1QMEA 3NULA 2QKPA 1VB6A 5CTMA 4DE3A 4DJ3A 4X68A 4FSFA 1JVJA 4Y2FA 2ZQAA 4E04A 5A8BA 3FC7A 2Y2MA 1P9WA 2HDSA 1Y54A 2K7SA 1LSXA 4UA9A 3O86A 1DP8A 1CI9A 1O7EA 1OJ5A 3BYDA 3VOLA 5K5BA 2OAP1 3H7WB 3GECA 3N8RA 1OJGA 4P6BA 5AQBA 2WKQA 4DRTA 5F1FA 3UDXA 3N7WA 3TE8A 5AQ9A 4I5SA 3CPTB 3MS6A 5L09A 1PWGA 2JN7A 2PDRA 4ZBEA 3Q82A 2G7UA 4X25A 1KE0A 1VHMA 3ZGAB 4KQQA 3A3FA 1ODVA 3VFHA 5IHVA 3ZQ5A 2ZQ7A 5L2FA 4XUZA 4FOFA 3A3JA 4JXVA 4P6ZM 1NY0A 1GCEA 3RH8B 5KSHA 1FOFA 3A3EA 2I72A 2XEPA 1FSYA 1LSVA 2EX2A 3NJAA 3RXWA 4GOGA 1XJ2A 4IBRA 4R3AA 3WS1A 1W8YA 1DRMA 1G6AA 3PTEA 3HUNA 1A0KA 1ACFA 5E2FA 3UE6A 3LYXA 4GN2A 2J7VA 4RA7A 3S22A 4IJGA 3T12B 1VM1A 3SH7A 3MXRA 1WE4A 3W4QA 3C7UA 3K2NA 2JE5A 3U2AA 1I2SA 5J4EA 1NXYA 5KZHA 2A2LA 4UQIM 3IX4A 2P9VB 1EW0A 3HVFA 3QP5A 4DXCA 3L7HA 4NXGA 4N92A 1PFLA 3N4IA 3LFVA 1HD8A 3IWOA 4QWOA 1XPBA 5CXWA 2Y8HA 5DKLA 5EOOA 2Y2QA 4LRZE 1H5XA 3WS4A 4KQOA 4UEYA 3UPNA 2HGVA 1OTBA 2FFFB 2ZOIA 3A0VA 2WKRA 5C5KA 4H6JA 5F6AA 3ZHHA 3AGFA 3G34A 2INWA 3OC2A 4S2MA 5DFXA 2R9XA 2LB9A 4BWIA 2ZQCA 4YFMA 2H5SA 3LY3A 2EXAA 3BY9A 4FUWA 4RVAA 1L0DA 5U47A 2JKTM 1YSQA 2Y2LA 1JWZA 1FCOA 2V1BA 5AJGA 1NZUA 3LEZA 2WGWA 1VQQA 3MMHA 2VGLM 3UN7A 3O88A 5F68A 3MZEA 1FIKA 3MF0A 4PPRA 5G18A 2HP6A 3BEBA 1N9NA 4P87A 4O8GA 1L2SA 3KX0X 3W4OA 5CECA 2ZD8A 3C4OA 5JYPA 5AQ7A 3O87A 3DTMA 4X69A 4QJGA 1W7FA 1ES2A 4IHQA 5HZHA 2V1ZA 4S2JA 2Z2MB 4ZTKA 3IF6A 5FQ9A 5KIZA 3BLMA 1EROA 5KMWA 5M18A 2XROA 2GDNA 4F94A 2HV1A 3CMZA 5EV0A 4P0MA 1F98A 4C3QA 1XXMA 1P0ZA 4HEFA 1XFNA 3W4PA 1G68A 2ZMFA 3GRJA 3V67A 2VKSA 1UGUA 3N6IA 2L0WA 1UWPX 1S1YA 5TGFA 2E8JA 3PYPA 3ITAA 1OT6A 3IWQA 3KYQA 1GHMA 5A91A 3DTEA 3TW8A 5HW3A 2DNSA 2ZBBA 3QNCA 3T4LA 2P74A 2UWXA 1MPLA 3KYEA 2BTFP 4C75A 1FR6A 1ES4A 2IA2A 4S2NA 1ZG4A 4O0PA 2M7VA 1YMSA 2XQZA 4LV1A 3LICA 1BYWA 3MQ0A 4PKYA 4WZ5A 5MC7A 4Z9QA 2Y4AA 3PBOA 2XD1A 4S2KA 2DMWA 2XDMA 3UMEA 3S7OA 3VMAA 4E3OA 3LUQA 4N9KA 3SS3A 3ZDJA 4QY5A 1CEGA 4Y0OA 4HESA 2HP9A 4B9OA 3F1OB 3CAXA 4HY8A 2FZ0A 3ZG7B 1S6RA 1OMEA 1LL8A 1IYSA 4YINA 5HDDA 1PW1A 4F3LA 3C2WA 4Q0IA 2MJ6A 2LB5A 1S4RA 1DJBA 5EECA 2PU4A 4EBPA 3IF6C 1K56A 1XJ4A 5FQIA 4MN6A 4DE2A 3G30A 3PBNA 4JGPA 2ACGA 2QMIA 4X6TA 1GSWA 4H6JB 3TJZC 4XUXA 2WYXA 2QJ7A 1K4FA 3TRCA 4Y17A 4GDBA 3O5YA 1NRJA 2H28A 1CJFA 1K54A 4I3JA 4ESPA 1GHPA 1CEFA 3QP1A 1KDWA 4CLCC 2BASA 3F1NB 5FASA 5EVIC 3ZG9B 1ZC2A 3ZVTA 2ZQ9A 2ZC7A 3T50A 1H8ZA 5HSQA 4BBVA 2DCFA 3U4LP 4GKUA 1K57A 3C4PA 3FZCA 5GLAA 2WGWB 4ETZA 5IS1A 2X71A 4G3WA 3BLSA 4MBFA 3KO6A 5DJTA 2WKPA 2EWVA 4S2NC 5M19A 2ZJ9A 4LCMA 3PHYA 3E2LA 5A90A 1FCMA 1YLZA 1WYBA 3IBJA 4WZ5C 3QP4A 4LENA 5EPHA 2A49A 2EWWA 3IS2A 4NETA 4YOFA 5GLDA 4OQGA 3FKVA 3IF6B 4M3KA 1TD5A 5DF9A 5FI7A 2YKFA 3NOUC 1CI8A 2ZC4B 4KZ5A 3AGDA 4HJ6A 1PZOA 5F83A 3LR3A 4KG6A 2W1TB 3MKFA 4E3IA 4S2PA 2PYRA 1RGYA 4HJ4A 3VP1A 3OBFA 5DTSA 5EVIB 1VEUA 3VOYA 3OLOA 3IH8A 4QB8A 3IXHA 3JVUA 1K54C 2V20A 3T4TA 3LI9A 5BOHA 1DJAA 1GHIA 3LIBA 2W1RA 3CZDA 5E2HA 2Y2JA 2WGIA 2VGJA 3M2KA 3Q81A
chains in the Genus database with same CATH topology
3NJAA 3HCYA 1XJ2A 4R3AA 3SW1A 1G28A 1DRMA 1WA9A 5AVFA 3MFXA 2A24A 4DMZA 2D01A 4GS9A 4UQIS 4XT2A 3G6OA 2JHEA 3UE6A 3PBSA 3LYXA 1OT9A 5TBMA 4IJGA 3PR6A 1ZTUA 4IUKA 5CX7A 2VJWA 5HWTA 2GZAA 3H7WA 2QYBA 1T1AA 4HP9A 2GJ3A 2W3HA 3B42A 4HHDA 3T4OA 1P97A 4HI4A 4HH3A 3UB9A 3K2NA 3U2AA 1OPXA 3FPWA 1STZA 2W1TA 1T1CA 4WELA 5J4EA 1XFQA 2A2LA 1V9YA 3MQQA 4UQIM 4HQAA 5FL3A 4QPRA 1EW0A 2P7JA 4NXGA 3EEHA 4LRXC 3EEAA 3LFVA 2VZWA 4CLCA 4PHTA 4Y5FA 2Y8HA 4II7A 4F3LB 5HPIA 5DKLA 5J3WA 3C38A 2VEAA 3BJNA 4LRZE 1N9OA 3NHQA 2D02A 3VE3A 1IOUA 2P08A 1YSPA 4KQOA 4MMNA 2KLIA 4UEYA 3VE4A 3S7PA 2Z6CA 2HGVA 1OTBA 2ZOIA 3LR4A 4KQDA 1XJ3A 3A0VA 2WKRA 4HJ3A 3KSFA 5G4YA 5C5KA 1OTIA 4H6JA 2Y79A 5F6AA 2INWA 3OC2A 5DFXA 4JGOA 5HWVA 3T4SA 2JKTI 2W3GA 1G6OA 3R4KA 2LB9A 4BWIA 2VV8A 3C8CA 3UB6A 2J80A 4BMWA 5DFYA 4WEKA 4MDZA 3LIEA 4NXBA 3EQUA 3CUEA 3P01A 1OTDA 2OOLA 3T4QA 3R7WB 3BY9A 3UE3A 1F5MA 5EFWA 4GHIA 2JKTM 1YSQA 2M1CA 3EQVA 1H3QA 2V1BA 3IBRA 5AJGA 2KOIA 2PD8A 2W0NA 1V9ZA 3E0YA 5HL6A 5HD5A 3PBQA 3LR5A 4BBUA 4ME4A 2W3DA 4CLCE 3MMHA 2W3EA 5F5YA 2VGLM 4L0LA 5F68A 4L9EA 3LIFA 2I9VA 3MF0A 2EA9A 4AFIA 2PR6A 3CI6A 2M7UA 1GSXA 3ZYTA 1N9NA 2PYPA 4O8GA 4YWZA 2PHYA 3KX0X 3H82A 4EU0A 4R6LA 3K3DA 2KDKA 3CLOA 4RQ9A 4ARZB 4HIAA 3EGXC 4Q0JA 3OCNA 4JGRA 4MN5A 4DN0A 5L8MA 4IHQA 4NKPA 5HZHA 3IS2B 4IUHA 1OTEA 5DKKA 1H8MA 2O9BA 4M4XA 4EETB 5HDCA 2HF6A 4EXOA 1TS6A 5KIZA 4HNBA 2XROA 3K3CA 3A0SA 5G4ZA 2HV1A 2OAQ1 1F9IA 3BW6A 3R7WA 1IFQA 4R38A 1F98A 2V1AA 2P04A 3B33A 4PKYG 5HPFA 1P0ZA 4JGQA 4YNRA 2K31A 1XFNA 2VV6A 3LIAA 2JKRI 2ZMFA 3HJIA 1DP6A 2K2NA 4BBTA 2L1MA 3V67A 1DP9A 3A0RA 2VKSA 5I5LA 1UGUA 3LR0A 2W27A 2GX5A 3RTYA 3F1PA 2L4RA 2L0WA 2VA0A 4EESA 4EW7A 1UWPX 1YAXA 2OWHA 1S1YA 5HD3A 3E4QA 3RFBA 4I3IA 3MR0A 3PYPA 1OT6A 3KYQA 3LIDA 4R70A 2JKRM 2HJEA 4LPZA 3OOVA 1Y28A 4WUJA 2PT7A 3TW8A 2ZBBA 3T4LA 5LBRA 1S66L 2PR5A 4Z1WA 2VX8A 2QJ5A 2IA2A 5TJJA 4BJPA 4HH2A 2A24B 4GS9B 4XT2B 3VV4A 1T18A 2J3TC 3BQ8A 3FG8A 4KUOA 4O0PA 2M7VA 5HWWA 3ICYA 3LICA 1BYWA 3MQ0A 1X0OA 3BQAA 4EEUA 3MXQA 2O0YA 2V0UA 3UB8A 4PKYA 4LLOB 5IT5A 5MC7A 3T4JA 3E4OA 4O01A 3PBOA 2DMWA 4P6ZS 3UMEA 3S7OA 3B47A 3LUQA 1TF1A 3D72A 3NOTC 2J3TD 5J7EA 1JNUA 3S7QA 2R78A 3F1OB 3CAXA 4HY8A 2XRNA 2FZ0A 4B9OA 3NOPC 1LT0A 3KSIA 1UWNX 4CLCB 3CWFA 1LL8A 5HDDA 1XJ6A 4F3LA 3C2WA 4Q0IA 2MJ6A 2LB5A 3UB7A 1S4RA 1TS8A 4Q0HA 4G3KA 1XJ4A 2FH5A 4MN6A 3PBNA 2ZMVA 3W2ZA 1MC0A 2O9CA 4JGPA 1OTAA 1GSWA 3KYZA 3BWLA 4CQHA 4H6JB 1T19A 3TJZC 4EQ1A 2QJ7A 3TRCA 4HP4A 4ZRRA 1YKDA 3O5YA 5AVEA 1NRJA 3MQOA 2QWSA 2H28A 2O99A 4I3JA 5F69A 2KX6A 2W3FA 1D06A 2XA7S 2Z6DA 3EOIA 4CLCC 2BASA 2V9AA 3DBAA 3F1NB 4OOLA 4WLAA 3PBRA 1W63M 3EWKA 3H9WA 2B02A 3ULFA 1NLZA 4GHIB 3E98A 3P7NA 1W63Q 2O9AA 4GCZA 4Y3IA 3T50A 5HSQA 4BBVA 1S4SA 2NUTC 2XSSA 4EUVA 4DJ2A 1GSVA 3KSGA 3E4PA 4ETZA 5IS1A 4G3WA 4EEPA 3KO6A 1T1BA 4I38A 3PXPA 4WEJA 3LI8A 5DJTA 2WKPA 2XA7M 1S67L 2EWVA 4CLCD 4L9FA 3F1OA 4K08A 2B18A 3H82B 2HJ9C 3CUEC 1P9RA 3GDIA 3PHYA 2GNXA 2QKPA 1VB6A 4GW9A 4DJ3A 4L9GA 4FSFA 2YKHA 3D3OA 4Y2FA 4ARZA 4EERA 4E04A 3PBTA 5A8BA 3FC7A 4WN5A 1MZUA 4WF0A 3EGDC 4B93A 3IBJA 2QHKA 2J3WA 1MKMA 4LRYC 4MN7A 3S7NA 1ZHHB 3FPVA 1P9WA 5TBMB 2VLGA 2K7SA 2EWWA 4MCWA 1LSXA 3IS2A 4YOFA 2PD7A 1DP8A 1LSWA 1TD5A 4WL9A 5DF9A 3VOLA 1OJ5A 5K5BA 2YKFA 3NOUC 2OAP1 2VGLS 3UMDA 3H7WB 3GECA 1S1ZA 4NEED 1TS0A 1OJGA 4KUKA 4HJ6A 3T4KA 2WKQA 3LR3A 3TE8A 3F1NA 4I5SA 4GLQA 1D7EA 2W1TB 5HDSA 4HOIA 2JN7A 2PDRA 2PYRA 2G7UA 4G3VA 4I39A 4HJ4A 1VHMA 1TS7A 3HJKA 3OBFA 5IU1A 1ODVA 4OOMA 4NXFA 3BY8A 3OLOA 3OCLA 2OWJA 2CMNA 3ZQ5A 3CITA 3F1PB 5DJUA 2NUPC 4FOFA 2ZOHA 3JVUA 2VV7A 4GJ4A 4P6ZM 1NLYA 1KOUA 3T4TA 3LI9A 3RH8B 3C30A 5KSHA 1NWZA 2V0WA 3LIBA 3JVVA 4ETXA 4NXEA 3KSHA 2W1RA 1N9LA 4PAUA 4I3AA 3MJQA 1LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VX8 A;  1H8M A;  1IFQ A;  3EGD C;  2NUT C;  4B93 A;  3EGX C;  1IOU A;  2NUP C;  3KYQ A;  3BW6 A;  4AFI A;  2DMW A; 
#chains in the Genus database with same CATH topology
 1G28 A;  1IEM A;  5AVF A;  4BL3 A;  2Y2P A;  2A24 A;  2D01 A;  1RGZ A;  3G6O A;  1K57 C;  2JHE A;  5E2E A;  2PRF A;  5CHJ A;  1OT9 A;  5TBM A;  4OQI A;  3FV7 A;  1K55 C;  4IUK A;  5CX7 A;  5HWT A;  1KVM A;  2GZA A;  1BUE A;  1JTG A;  2UV0 E;  3NC8 A;  1T1A A;  2GJ3 A;  2W3H A;  4HHD A;  3T4O A;  4HH3 A;  3TG9 A;  5FAP A;  5HFO A;  3UB9 A;  2A3U A;  4R0Q A;  1YM1 A;  4OPY A;  4EUZ A;  3FPW A;  1MBL A;  1T1C A;  3MQQ A;  4OQH A;  5FL3 A;  1TVF A;  4LRX C;  3EEA A;  4NG2 A;  5DTT A;  2Y2N A;  4Y13 A;  4BD0 A;  4F3L B;  2HDU A;  3CG5 A;  3G35 A;  1XP4 A;  3DW0 A;  5EUA A;  2VEA A;  5J3W A;  2D02 A;  2P08 A;  1YSP A;  4MMN A;  2KLI A;  3VE4 A;  3V5M A;  2ZC5 B;  3KSF A;  4Y7P A;  5G4Y A;  2B95 A;  3UE0 A;  3I7J A;  5HWV A;  3T4S A;  2W3G A;  1G6O A;  3R4K A;  4E3N A;  5DFY A;  3DWZ A;  1FQG A;  4GB7 A;  4Y15 A;  5F82 A;  5EM0 A;  3CUE A;  4QU3 A;  1OTD A;  5A92 A;  5HX9 A;  1ESU A;  3R7W B;  3UE3 A;  4PMA A;  5EFW A;  1JTD A;  2VGK A;  1H3Q A;  4R1G A;  1KGF A;  4BQM A;  3NCK A;  1ZKJ A;  2KOI A;  3E0Y A;  1BTL A;  2ZQ8 A;  3PBQ A;  4BBU A;  1KDS A;  2W3E A;  3P98 A;  1SKF A;  1D1J A;  2JBF A;  4JF5 A;  2I9V A;  5DF8 A;  2B5R A;  2PR6 A;  5EOE A;  4AFI A;  5FAO A;  1GSX A;  4EBL A;  5CED A;  2ZL1 A;  2ZLY A;  4YWZ A;  1ES3 A;  3H82 A;  4EU0 A;  2HP5 A;  4OH0 A;  3WWX A;  4RQ9 A;  3MFD A;  4XXR A;  1IYO A;  3NIA A;  4WMC D;  1FSW A;  4WMC A;  3IS2 B;  4E3M A;  5DKK A;  3OPR A;  3HBR A;  4EET B;  3BFC A;  5FQM A;  3G2Y A;  1ESI A;  5DF7 A;  4ZDX A;  1K25 A;  3K3C A;  4ID4 A;  3HUM A;  1F9I A;  3M6B A;  5FA7 A;  2P04 A;  1KE4 A;  3B33 A;  4PKY G;  3QP6 A;  5L10 A;  2K31 A;  4U0X A;  2EX9 A;  2ZQD A;  3A3I A;  5HAR A;  3HLB A;  1FIL A;  1ZG6 A;  2J9O A;  4BBT A;  1DP9 A;  1SDE A;  3W8K A;  2ZMA A;  3F1P A;  3BFG A;  2VA0 A;  3PAE A;  4JF4 A;  3VOZ A;  4EES A;  2OWH A;  5F1G A;  4LPZ A;  3OOV A;  4E6X A;  1YLY A;  5A93 A;  2XFT A;  1TEM A;  5TFQ A;  2XH9 A;  1S66 L;  4DKI A;  2WGV A;  3D4F A;  2XK1 A;  3LEQ A;  3LY4 A;  5TJJ A;  1K0K A;  2A24 B;  2J3T C;  3BQ8 A;  2X02 A;  3FG8 A;  4KUO A;  1IEL A;  1CQA A;  1LL5 A;  1H0M A;  4LV3 A;  4MLL A;  5GLB A;  4JKT A;  3SOI A;  5IT5 A;  4P6Z S;  1SCW A;  3ISG A;  3D72 A;  4NK3 A;  3NOT C;  5J7E A;  3Q1F A;  5E2G A;  2XRN A;  3T1Q B;  1EWZ A;  1YLJ A;  3IH9 A;  4PM9 A;  3UB7 A;  1TS8 A;  3N8S A;  4ZAM A;  1ERQ A;  1ES5 A;  1YLT A;  4RX2 A;  2H10 A;  2Z2L B;  4UA7 A;  1XKZ A;  1YMX A;  5CHU A;  2O9C A;  3IWI A;  4CQH A;  3VFF A;  3BWL A;  2JCH A;  1IYP A;  5FEF A;  4OPQ A;  4ZRR A;  3MQO A;  1F2K A;  5FI2 A;  4ZJ1 A;  4X56 A;  5GLC A;  1XA7 A;  2XA7 S;  2V9A A;  4WLA A;  3L9K A;  3MXS A;  3EWK A;  2B02 A;  1KGE A;  3AGE A;  3E98 A;  4MBK A;  3P7N A;  3JPU A;  1W63 Q;  3SZT A;  2H0T A;  2NUT C;  4WZ4 A;  3NDE A;  3Q7Z A;  1BT5 A;  3KSG A;  3E4P A;  3HRE A;  3QP2 A;  3MBZ A;  1MWS A;  3ZFZ A;  4IED A;  4EEP A;  4EV4 A;  1W8Q A;  1IKI A;  1S67 L;  3VSK A;  4CLC D;  2ZL1 B;  3MZF A;  5GHX A;  1S0W A;  2HJ9 C;  3H82 B;  1P9R A;  2JKF A;  2GNX A;  2WUQ A;  4L9G A;  4FD8 A;  4EER A;  4ARZ A;  3UPO A;  1NYM A;  4WN5 A;  3S4X A;  3UDI A;  1MZU A;  4WBG A;  1H8Y A;  2QHK A;  3FYZ A;  2J3W A;  4K0X A;  1Z09 A;  1W79 A;  3G2Z A;  3FPV A;  3V50 A;  4B4Z A;  1VET A;  4FCF A;  3QNB A;  3MSH A;  1LSW A;  2EX6 A;  4WL9 A;  1HZO A;  5HAI A;  4HBT A;  2VGL S;  3G31 A;  3FWL A;  2BLS A;  1FCN A;  4KZ6 A;  4GLQ A;  1D7E A;  5HDS A;  1ALQ A;  4HOI A;  3TSG A;  3G32 A;  4G3V A;  4I39 A;  3IX8 A;  3GQZ A;  5DVA A;  5IU1 A;  1PRQ A;  2X01 A;  2CMN A;  3SH8 A;  3F1P B;  2G2U A;  3UNW A;  5FQQ A;  2NUP C;  3UPP A;  4R3J A;  1QMF A;  5CRF A;  2VV7 A;  1KOU A;  3C30 A;  4Q8I A;  3ITB A;  2V0W A;  3KSH A;  1N9L A;  4PAU A;  1JWV A;  2C6W B;  3WS2 A;  3LO7 A;  3C5A A;  3MFX A;  4X1M A;  1JWP A;  1I2W A;  3PBS A;  2XFS A;  4KZ7 A;  3Q7V A;  2JKG A;  1ZTU A;  4QHC A;  1YQS A;  2VJW A;  5EE8 A;  1LLB A;  3H7W A;  4HP9 A;  3NEC A;  1E4D A;  3B42 A;  4E3L A;  4UA6 A;  2ZM8 A;  1STZ A;  4WEL A;  1XFQ A;  2OSU A;  2HDQ A;  3UDF A;  4HQA A;  3EEH A;  1HVB A;  4OPR A;  2VZW A;  4Y5F A;  4II7 A;  5HPI A;  4E3K A;  1MWT A;  3C38 A;  1XX2 A;  3NHQ A;  1IOU A;  3S7P A;  2Z6C A;  2EXB A;  3OZH A;  1MWR A;  3LR4 A;  4KQD A;  4OLG A;  1MY8 A;  4PM7 A;  3IHB A;  3IQA A;  4FTX A;  3UB5 P;  3P09 A;  1AXB A;  1SHV A;  2Y2H A;  1MWU A;  2WKH A;  1RP5 A;  3C8C A;  3UB6 A;  4MDZ A;  4S2O A;  3DWK A;  2IWB A;  2BG1 A;  2Y2K A;  1ONH A;  4ZJ3 A;  4GHI A;  3VP3 A;  3NI9 A;  1E3U D;  3IBR A;  3QP8 A;  1E25 A;  1BLP A;  2PD8 A;  3ZG0 A;  3BFF A;  3MKE A;  1TDL A;  1LI9 A;  5HL6 A;  5HD5 A;  1E3U A;  3LR5 A;  4ME4 A;  4CLC E;  4L0L A;  4JXW A;  2EA9 A;  2M7U A;  2WZZ A;  1IKG A;  1U60 A;  3GTC A;  2PHY A;  4Y0T A;  1PNE A;  3VP4 A;  3IT9 A;  3K3D A;  2OLU A;  4ARZ B;  3Q07 A;  4A5R A;  1SDN A;  2Q9N A;  2QZ6 A;  1HLU P;  4JGR A;  2ZC3 B;  5TR7 A;  1PW8 A;  4MNR A;  5L8M A;  1LHY A;  4NKP A;  3SS5 A;  2EFU A;  1OTE A;  5EM1 A;  1SKO A;  2JC7 A;  3VP2 A;  3BRM A;  2HF6 A;  4DDS A;  3OPH A;  4PM8 A;  5FAQ A;  2DRW A;  4E3J A;  3NDG A;  1C3B A;  3G4P A;  3BW6 A;  3QHY A;  1IFQ A;  1FR1 A;  4OKP A;  3RJU A;  5HPF A;  4JGQ A;  4YNR A;  4KG2 A;  4K91 A;  2JKR I;  4WM9 A;  1DP6 A;  2K2N A;  3A0R A;  4X1L A;  2W27 A;  1N4O A;  3RTY A;  2L4R A;  1KE3 A;  4S2I A;  2ZM2 A;  1YAX A;  2Q9M A;  2WK0 A;  4O7D A;  5HD3 A;  3MR0 A;  4EQI A;  2IWD A;  5FSR A;  3LID A;  4R70 A;  3IX3 A;  3HLF A;  3CHW P;  4MEZ A;  5LBR A;  4U3T A;  4LCL A;  2IWC A;  2PR5 A;  4Z1W A;  1DY6 A;  2PU2 A;  2PAV P;  4BJP A;  4HH2 A;  3VV4 A;  3HLC A;  3FKW A;  3UY6 A;  4GZB A;  5CGX A;  3CJM A;  3Q7V B;  4QY6 A;  3WS0 A;  1NZO A;  4LV2 A;  4H8R A;  5CGW A;  3WRZ A;  1X0O A;  3BQA A;  3WRT A;  3PAG A;  2QPN A;  2O0Y A;  3UB8 A;  4PM5 A;  3T4J A;  3E4O A;  3GVB A;  3VP0 A;  5KSC A;  3B47 A;  1TF1 A;  1G5U A;  3B3X A;  2J3T D;  1JNU A;  3S7Q A;  4U0T A;  3KSI A;  1UWN X;  5AQA A;  1RCJ A;  3D9Y A;  3DAV A;  1XA1 A;  2Y59 A;  2XLN A;  3DTI A;  3W2Z A;  2J9P A;  1MC0 A;  5D3O A;  4DXB A;  1T19 A;  4OQ0 A;  1YKD A;  5J8X A;  2Y55 A;  1K4E A;  5F69 A;  2W3F A;  1W63 M;  4DE0 A;  5HL1 A;  3H9W A;  1M40 A;  4KG5 A;  4GHI B;  3RXX A;  2XR0 A;  4Y3I A;  1S4S A;  4EUV A;  4DF6 A;  1VEU B;  1NRF A;  1SZV A;  2V8F A;  3ZG8 B;  1XGI A;  4I38 A;  3PXP A;  4WEJ A;  3HLE A;  3HLG A;  2XA7 M;  1L3L A;  4BEN A;  4L9F A;  3F1O A;  3IF5 A;  4K08 A;  2B18 A;  3ZNT A;  3CUE C;  3GDI A;  3BFD A;  4KZB A;  1O07 A;  4GW9 A;  5DTK A;  2YKH A;  3D3O A;  4OPZ A;  5JYO A;  1YLP A;  3PBT A;  2EX8 A;  5CHM A;  2RCX A;  4WF0 A;  1BLC A;  3EGD C;  4MBH A;  4B93 A;  4D60 A;  1MKM A;  1PIO A;  4LRY C;  4MN7 A;  4S2L A;  3S7N A;  1ZHH B;  5TBM B;  2VLG A;  4MCW A;  1SKO B;  2PD7 A;  3BM6 A;  5E43 A;  5CGS A;  2EFX A;  3UMD A;  5FEG A;  1K38 A;  1S1Z A;  3A3D A;  3OPP A;  4NEE D;  1TS0 A;  4KUK A;  2C5W B;  3OPL A;  3T4K A;  4CJN A;  3F1N A;  2AVX A;  2J8Y A;  3BFE A;  2PBY A;  1YPR A;  1NJ4 A;  4WYY A;  2XF3 A;  1TS7 A;  3HJK A;  2CC1 A;  3UO9 A;  1J9M A;  4OOM A;  4NXF A;  2R9W A;  3BY8 A;  3OCL A;  2OWJ A;  1NYY A;  1PI4 A;  3CIT A;  5GHZ A;  5DJU A;  2ZOH A;  5GL9 A;  3JYI A;  4GJ4 A;  1NLY A;  4RYE A;  1NWZ A;  3JVV A;  4ETX A;  4GDN A;  4NXE A;  2H0Y A;  4I3A A;  1BLS A;  3MJQ A;  3LCE A;  4LGW A;  3HCY A;  5FQK A;  3SW1 A;  4R4R A;  4QD4 A;  4C6Y A;  1WA9 A;  4DMZ A;  4GS9 A;  4UQI S;  4XT2 A;  4JBF A;  4HBU A;  2G2W A;  4P85 A;  4BD1 A;  3PR6 A;  1EI5 A;  1BSG A;  2QYB A;  4R23 A;  5HAP A;  3TOI A;  1P97 A;  4HI4 A;  3V3R A;  1XGJ A;  1OPX A;  2W1T A;  1V9Y A;  4OLD A;  4QPR A;  2P7J A;  5EVI D;  1PWC A;  2WZX A;  3ZNY A;  5FI6 A;  4CLC A;  4PHT A;  5EVI A;  1K6R A;  3UE1 A;  3BJN A;  1N9O A;  3VE3 A;  4LFU A;  1AWI A;  4CPK A;  2FFY A;  1XJ3 A;  4HJ3 A;  3IXG A;  1Q2Q A;  1OTI A;  2Y79 A;  3MZD A;  4JGO A;  2JKT I;  2WAE A;  2VV8 A;  2J80 A;  4BMW A;  4WEK A;  3LIE A;  4FH4 A;  4OP8 A;  4NXB A;  3EQU A;  2XD5 A;  3V39 A;  3SH9 A;  2OV5 A;  3P01 A;  2OOL A;  3T4Q A;  3T1S A;  4ZJ2 A;  1LI0 A;  1F5M A;  3SS4 A;  2V8C A;  5M1A A;  2HPB A;  2M1C A;  4EBN A;  3EQV A;  3M2J A;  2W0N A;  1V9Z A;  3VSL A;  4GD8 A;  2W3D A;  4UHU A;  5F5Y A;  4L9E A;  2HDR A;  3LIF A;  1GA0 A;  3HLW A;  1W5D A;  3E2K A;  4KZA A;  3CI6 A;  1HTZ A;  3IHA A;  3ZYT A;  1GA9 A;  3T1R A;  2PYP A;  3O3V A;  1IYQ A;  1Q2P A;  2Y91 A;  1ERM A;  2ZC6 B;  1J3W A;  1K56 D;  4LV0 A;  4OVD A;  4R6L A;  2KDK A;  4D2O A;  3CLO A;  5EVL A;  4HIA A;  3EGX C;  2ZM0 A;  4Q0J A;  3OCN A;  2XGN A;  4MN5 A;  4DN0 A;  4JXS A;  1PWD A;  4N1X A;  3LGO A;  3IXB A;  4IUH A;  3BEC A;  4BL2 A;  1CF0 A;  5EVE A;  3GV9 A;  1H8M A;  1Z6F A;  2O9B A;  4R3B A;  4M4X A;  5HDC A;  1BUL A;  4EXO A;  1TS6 A;  3N8L A;  4HNB A;  1TDG A;  5I94 A;  2Y2O A;  4EWF A;  2Q0O A;  3A0S A;  1N9B A;  5G4Z A;  1KVL A;  2OAQ 1;  4OOY A;  3R7W A;  3CPT A;  4FH2 A;  4R38 A;  2V1A A;  3ZVW A;  4IVK A;  2VV6 A;  1PI5 A;  3LIA A;  1Y4O A;  3M6H A;  4JF6 A;  3HJI A;  1L0G A;  5CEB A;  2L1M A;  4X55 A;  5I5L A;  5FDS A;  3ZG5 A;  3LR0 A;  1MXO A;  3GR2 A;  4KZ4 A;  2GX5 A;  1K55 A;  4EW7 A;  1BZA A;  4K0W A;  1DJC A;  3E4Q A;  4I3I A;  1WYC A;  3RFB A;  4UAA A;  2JKR M;  2HJE A;  1M6K A;  1Y28 A;  4WUJ A;  2PT7 A;  2PBD P;  5FDH A;  4OP5 A;  4JXG A;  4B4X A;  3NBL A;  4X53 A;  1I5Q A;  2VX8 A;  1YT4 A;  4GNU A;  2QJ5 A;  4IVI A;  4GS9 B;  4XT2 B;  1T18 A;  3T1X A;  1CK3 A;  5HWW A;  1MKI A;  2Y2G A;  3ICY A;  4KQR A;  4PM6 A;  4EEU A;  3MXQ A;  2V0U A;  5FAT A;  4LLO B;  2Y2I A;  2V2F F;  4O01 A;  2WAF A;  4OON A;  4JLF A;  3HLD A;  2HZ5 A;  4GD6 A;  2R78 A;  2P9V A;  3NOP C;  3C7V A;  1LT0 A;  4CLC B;  3CWF A;  4RX3 A;  1PYY A;  1XJ6 A;  2RL3 A;  4KZ3 A;  4N1H A;  4Q0H A;  3WS5 A;  4G3K A;  2WKI A;  4KZ9 A;  2FH5 A;  3DTK A;  2ZMV A;  3ZCZ A;  4B88 A;  3GMW A;  1OTA A;  3KYZ A;  3GSG A;  4EQ1 A;  2E8I A;  3IXD A;  1VET B;  1ONG A;  4HP4 A;  1KGG A;  5L07 A;  3V3S A;  5AVE A;  2WKE A;  2QWS A;  4E6W A;  2O99 A;  2OLV A;  4DE1 A;  2KX6 A;  1D06 A;  2Z6D A;  3EOI A;  1K6S A;  4KEN B;  5CER A;  3HUO A;  1PZP A;  3DBA A;  4OOL A;  3PBR A;  1BLH A;  1L0F A;  1NLZ A;  3ULF A;  4KZ8 A;  2O9A A;  4GCZ A;  1LL9 A;  2XSS A;  2WAD A;  4DJ2 A;  4Y0U A;  4DDY A;  1GSV A;  1L0E A;  4IBX A;  3HL9 A;  4R4S A;  5CTN A;  5GHY A;  2VK3 A;  1T1B A;  3LI8 A;  4JPM A;  4BLM A;  3NY4 A;  1YLW A;  4N9L A;  5FQJ A;  3S1Y A;  5HAQ A;  1QME A;  3NUL A;  2QKP A;  1VB6 A;  5CTM A;  4DE3 A;  4DJ3 A;  4X68 A;  4FSF A;  1JVJ A;  4Y2F A;  2ZQA A;  4E04 A;  5A8B A;  3FC7 A;  2Y2M A;  1P9W A;  2HDS A;  1Y54 A;  2K7S A;  1LSX A;  4UA9 A;  3O86 A;  1DP8 A;  1CI9 A;  1O7E A;  1OJ5 A;  3BYD A;  3VOL A;  5K5B A;  2OAP 1;  3H7W B;  3GEC A;  3N8R A;  1OJG A;  4P6B A;  5AQB A;  2WKQ A;  4DRT A;  5F1F A;  3UDX A;  3N7W A;  3TE8 A;  5AQ9 A;  4I5S A;  3CPT B;  3MS6 A;  5L09 A;  1PWG A;  2JN7 A;  2PDR A;  4ZBE A;  3Q82 A;  2G7U A;  4X25 A;  1KE0 A;  1VHM A;  3ZGA B;  4KQQ A;  3A3F A;  1ODV A;  3VFH A;  5IHV A;  3ZQ5 A;  2ZQ7 A;  5L2F A;  4XUZ A;  4FOF A;  3A3J A;  4JXV A;  4P6Z M;  1NY0 A;  1GCE A;  3RH8 B;  5KSH A;  1FOF A;  3A3E A;  2I72 A;  2XEP A;  1FSY A;  1LSV A;  2EX2 A;  3NJA A;  3RXW A;  4GOG A;  1XJ2 A;  4IBR A;  4R3A A;  3WS1 A;  1W8Y A;  1DRM A;  1G6A A;  3PTE A;  3HUN A;  1A0K A;  1ACF A;  5E2F A;  3UE6 A;  3LYX A;  4GN2 A;  2J7V A;  4RA7 A;  3S22 A;  4IJG A;  3T12 B;  1VM1 A;  3SH7 A;  3MXR A;  1WE4 A;  3W4Q A;  3C7U A;  3K2N A;  2JE5 A;  3U2A A;  1I2S A;  5J4E A;  1NXY A;  5KZH A;  2A2L A;  4UQI M;  3IX4 A;  2P9V B;  1EW0 A;  3HVF A;  3QP5 A;  4DXC A;  3L7H A;  4NXG A;  4N92 A;  1PFL A;  3N4I A;  3LFV A;  1HD8 A;  3IWO A;  4QWO A;  1XPB A;  5CXW A;  2Y8H A;  5DKL A;  5EOO A;  2Y2Q A;  4LRZ E;  1H5X A;  3WS4 A;  4KQO A;  4UEY A;  3UPN A;  2HGV A;  1OTB A;  2FFF B;  2ZOI A;  3A0V A;  2WKR A;  5C5K A;  4H6J A;  5F6A A;  3ZHH A;  3AGF A;  3G34 A;  2INW A;  3OC2 A;  4S2M A;  5DFX A;  2R9X A;  2LB9 A;  4BWI A;  2ZQC A;  4YFM A;  2H5S A;  3LY3 A;  2EXA A;  3BY9 A;  4FUW A;  4RVA A;  1L0D A;  5U47 A;  2JKT M;  1YSQ A;  2Y2L A;  1JWZ A;  1FCO A;  2V1B A;  5AJG A;  1NZU A;  3LEZ A;  2WGW A;  1VQQ A;  3MMH A;  2VGL M;  3UN7 A;  3O88 A;  5F68 A;  3MZE A;  1FIK A;  3MF0 A;  4PPR A;  5G18 A;  2HP6 A;  3BEB A;  1N9N A;  4P87 A;  4O8G A;  1L2S A;  3KX0 X;  3W4O A;  5CEC A;  2ZD8 A;  3C4O A;  5JYP A;  5AQ7 A;  3O87 A;  3DTM A;  4X69 A;  4QJG A;  1W7F A;  1ES2 A;  4IHQ A;  5HZH A;  2V1Z A;  4S2J A;  2Z2M B;  4ZTK A;  3IF6 A;  5FQ9 A;  5KIZ A;  3BLM A;  1ERO A;  5KMW A;  5M18 A;  2XRO A;  2GDN A;  4F94 A;  2HV1 A;  3CMZ A;  5EV0 A;  4P0M A;  1F98 A;  4C3Q A;  1XXM A;  1P0Z A;  4HEF A;  1XFN A;  3W4P A;  1G68 A;  2ZMF A;  3GRJ A;  3V67 A;  2VKS A;  1UGU A;  3N6I A;  2L0W A;  1UWP X;  1S1Y A;  5TGF A;  2E8J A;  3PYP A;  3ITA A;  1OT6 A;  3IWQ A;  3KYQ A;  1GHM A;  5A91 A;  3DTE A;  3TW8 A;  5HW3 A;  2DNS A;  2ZBB A;  3QNC A;  3T4L A;  2P74 A;  2UWX A;  1MPL A;  3KYE A;  2BTF P;  4C75 A;  1FR6 A;  1ES4 A;  2IA2 A;  4S2N A;  1ZG4 A;  4O0P A;  2M7V A;  1YMS A;  2XQZ A;  4LV1 A;  3LIC A;  1BYW A;  3MQ0 A;  4PKY A;  4WZ5 A;  5MC7 A;  4Z9Q A;  2Y4A A;  3PBO A;  2XD1 A;  4S2K A;  2DMW A;  2XDM A;  3UME A;  3S7O A;  3VMA A;  4E3O A;  3LUQ A;  4N9K A;  3SS3 A;  3ZDJ A;  4QY5 A;  1CEG A;  4Y0O A;  4HES A;  2HP9 A;  4B9O A;  3F1O B;  3CAX A;  4HY8 A;  2FZ0 A;  3ZG7 B;  1S6R A;  1OME A;  1LL8 A;  1IYS A;  4YIN A;  5HDD A;  1PW1 A;  4F3L A;  3C2W A;  4Q0I A;  2MJ6 A;  2LB5 A;  1S4R A;  1DJB A;  5EEC A;  2PU4 A;  4EBP A;  3IF6 C;  1K56 A;  1XJ4 A;  5FQI A;  4MN6 A;  4DE2 A;  3G30 A;  3PBN A;  4JGP A;  2ACG A;  2QMI A;  4X6T A;  1GSW A;  4H6J B;  3TJZ C;  4XUX A;  2WYX A;  2QJ7 A;  1K4F A;  3TRC A;  4Y17 A;  4GDB A;  3O5Y A;  1NRJ A;  2H28 A;  1CJF A;  1K54 A;  4I3J A;  4ESP A;  1GHP A;  1CEF A;  3QP1 A;  1KDW A;  4CLC C;  2BAS A;  3F1N B;  5FAS A;  5EVI C;  3ZG9 B;  1ZC2 A;  3ZVT A;  2ZQ9 A;  2ZC7 A;  3T50 A;  1H8Z A;  5HSQ A;  4BBV A;  2DCF A;  3U4L P;  4GKU A;  1K57 A;  3C4P A;  3FZC A;  5GLA A;  2WGW B;  4ETZ A;  5IS1 A;  2X71 A;  4G3W A;  3BLS A;  4MBF A;  3KO6 A;  5DJT A;  2WKP A;  2EWV A;  4S2N C;  5M19 A;  2ZJ9 A;  4LCM A;  3PHY A;  3E2L A;  5A90 A;  1FCM A;  1YLZ A;  1WYB A;  3IBJ A;  4WZ5 C;  3QP4 A;  4LEN A;  5EPH A;  2A49 A;  2EWW A;  3IS2 A;  4NET A;  4YOF A;  5GLD A;  4OQG A;  3FKV A;  3IF6 B;  4M3K A;  1TD5 A;  5DF9 A;  5FI7 A;  2YKF A;  3NOU C;  1CI8 A;  2ZC4 B;  4KZ5 A;  3AGD A;  4HJ6 A;  1PZO A;  5F83 A;  3LR3 A;  4KG6 A;  2W1T B;  3MKF A;  4E3I A;  4S2P A;  2PYR A;  1RGY A;  4HJ4 A;  3VP1 A;  3OBF A;  5DTS A;  5EVI B;  1VEU A;  3VOY A;  3OLO A;  3IH8 A;  4QB8 A;  3IXH A;  3JVU A;  1K54 C;  2V20 A;  3T4T A;  3LI9 A;  5BOH A;  1DJA A;  1GHI A;  3LIB A;  2W1R A;  3CZD A;  5E2H A;  2Y2J A;  2WGI A;  2VGJ A;  3M2K A;  3Q81 A; 
#chains in the Genus database with same CATH homology
 3NJA A;  3HCY A;  1XJ2 A;  4R3A A;  3SW1 A;  1G28 A;  1DRM A;  1WA9 A;  5AVF A;  3MFX A;  2A24 A;  4DMZ A;  2D01 A;  4GS9 A;  4UQI S;  4XT2 A;  3G6O A;  2JHE A;  3UE6 A;  3PBS A;  3LYX A;  1OT9 A;  5TBM A;  4IJG A;  3PR6 A;  1ZTU A;  4IUK A;  5CX7 A;  2VJW A;  5HWT A;  2GZA A;  3H7W A;  2QYB A;  1T1A A;  4HP9 A;  2GJ3 A;  2W3H A;  3B42 A;  4HHD A;  3T4O A;  1P97 A;  4HI4 A;  4HH3 A;  3UB9 A;  3K2N A;  3U2A A;  1OPX A;  3FPW A;  1STZ A;  2W1T A;  1T1C A;  4WEL A;  5J4E A;  1XFQ A;  2A2L A;  1V9Y A;  3MQQ A;  4UQI M;  4HQA A;  5FL3 A;  4QPR A;  1EW0 A;  2P7J A;  4NXG A;  3EEH A;  4LRX C;  3EEA A;  3LFV A;  2VZW A;  4CLC A;  4PHT A;  4Y5F A;  2Y8H A;  4II7 A;  4F3L B;  5HPI A;  5DKL A;  5J3W A;  3C38 A;  2VEA A;  3BJN A;  4LRZ E;  1N9O A;  3NHQ A;  2D02 A;  3VE3 A;  1IOU A;  2P08 A;  1YSP A;  4KQO A;  4MMN A;  2KLI A;  4UEY A;  3VE4 A;  3S7P A;  2Z6C A;  2HGV A;  1OTB A;  2ZOI A;  3LR4 A;  4KQD A;  1XJ3 A;  3A0V A;  2WKR A;  4HJ3 A;  3KSF A;  5G4Y A;  5C5K A;  1OTI A;  4H6J A;  2Y79 A;  5F6A A;  2INW A;  3OC2 A;  5DFX A;  4JGO A;  5HWV A;  3T4S A;  2JKT I;  2W3G A;  1G6O A;  3R4K A;  2LB9 A;  4BWI A;  2VV8 A;  3C8C A;  3UB6 A;  2J80 A;  4BMW A;  5DFY A;  4WEK A;  4MDZ A;  3LIE A;  4NXB A;  3EQU A;  3CUE A;  3P01 A;  1OTD A;  2OOL A;  3T4Q A;  3R7W B;  3BY9 A;  3UE3 A;  1F5M A;  5EFW A;  4GHI A;  2JKT M;  1YSQ A;  2M1C A;  3EQV A;  1H3Q A;  2V1B A;  3IBR A;  5AJG A;  2KOI A;  2PD8 A;  2W0N A;  1V9Z A;  3E0Y A;  5HL6 A;  5HD5 A;  3PBQ A;  3LR5 A;  4BBU A;  4ME4 A;  2W3D A;  4CLC E;  3MMH A;  2W3E A;  5F5Y A;  2VGL M;  4L0L A;  5F68 A;  4L9E A;  3LIF A;  2I9V A;  3MF0 A;  2EA9 A;  4AFI A;  2PR6 A;  3CI6 A;  2M7U A;  1GSX A;  3ZYT A;  1N9N A;  2PYP A;  4O8G A;  4YWZ A;  2PHY A;  3KX0 X;  3H82 A;  4EU0 A;  4R6L A;  3K3D A;  2KDK A;  3CLO A;  4RQ9 A;  4ARZ B;  4HIA A;  3EGX C;  4Q0J A;  3OCN A;  4JGR A;  4MN5 A;  4DN0 A;  5L8M A;  4IHQ A;  4NKP A;  5HZH A;  3IS2 B;  4IUH A;  1OTE A;  5DKK A;  1H8M A;  2O9B A;  4M4X A;  4EET B;  5HDC A;  2HF6 A;  4EXO A;  1TS6 A;  5KIZ A;  4HNB A;  2XRO A;  3K3C A;  3A0S A;  5G4Z A;  2HV1 A;  2OAQ 1;  1F9I A;  3BW6 A;  3R7W A;  1IFQ A;  4R38 A;  1F98 A;  2V1A A;  2P04 A;  3B33 A;  4PKY G;  5HPF A;  1P0Z A;  4JGQ A;  4YNR A;  2K31 A;  1XFN A;  2VV6 A;  3LIA A;  2JKR I;  2ZMF A;  3HJI A;  1DP6 A;  2K2N A;  4BBT A;  2L1M A;  3V67 A;  1DP9 A;  3A0R A;  2VKS A;  5I5L A;  1UGU A;  3LR0 A;  2W27 A;  2GX5 A;  3RTY A;  3F1P A;  2L4R A;  2L0W A;  2VA0 A;  4EES A;  4EW7 A;  1UWP X;  1YAX A;  2OWH A;  1S1Y A;  5HD3 A;  3E4Q A;  3RFB A;  4I3I A;  3MR0 A;  3PYP A;  1OT6 A;  3KYQ A;  3LID A;  4R70 A;  2JKR M;  2HJE A;  4LPZ A;  3OOV A;  1Y28 A;  4WUJ A;  2PT7 A;  3TW8 A;  2ZBB A;  3T4L A;  5LBR A;  1S66 L;  2PR5 A;  4Z1W A;  2VX8 A;  2QJ5 A;  2IA2 A;  5TJJ A;  4BJP A;  4HH2 A;  2A24 B;  4GS9 B;  4XT2 B;  3VV4 A;  1T18 A;  2J3T C;  3BQ8 A;  3FG8 A;  4KUO A;  4O0P A;  2M7V A;  5HWW A;  3ICY A;  3LIC A;  1BYW A;  3MQ0 A;  1X0O A;  3BQA A;  4EEU A;  3MXQ A;  2O0Y A;  2V0U A;  3UB8 A;  4PKY A;  4LLO B;  5IT5 A;  5MC7 A;  3T4J A;  3E4O A;  4O01 A;  3PBO A;  2DMW A;  4P6Z S;  3UME A;  3S7O A;  3B47 A;  3LUQ A;  1TF1 A;  3D72 A;  3NOT C;  2J3T D;  5J7E A;  1JNU A;  3S7Q A;  2R78 A;  3F1O B;  3CAX A;  4HY8 A;  2XRN A;  2FZ0 A;  4B9O A;  3NOP C;  1LT0 A;  3KSI A;  1UWN X;  4CLC B;  3CWF A;  1LL8 A;  5HDD A;  1XJ6 A;  4F3L A;  3C2W A;  4Q0I A;  2MJ6 A;  2LB5 A;  3UB7 A;  1S4R A;  1TS8 A;  4Q0H A;  4G3K A;  1XJ4 A;  2FH5 A;  4MN6 A;  3PBN A;  2ZMV A;  3W2Z A;  1MC0 A;  2O9C A;  4JGP A;  1OTA A;  1GSW A;  3KYZ A;  3BWL A;  4CQH A;  4H6J B;  1T19 A;  3TJZ C;  4EQ1 A;  2QJ7 A;  3TRC A;  4HP4 A;  4ZRR A;  1YKD A;  3O5Y A;  5AVE A;  1NRJ A;  3MQO A;  2QWS A;  2H28 A;  2O99 A;  4I3J A;  5F69 A;  2KX6 A;  2W3F A;  1D06 A;  2XA7 S;  2Z6D A;  3EOI A;  4CLC C;  2BAS A;  2V9A A;  3DBA A;  3F1N B;  4OOL A;  4WLA A;  3PBR A;  1W63 M;  3EWK A;  3H9W A;  2B02 A;  3ULF A;  1NLZ A;  4GHI B;  3E98 A;  3P7N A;  1W63 Q;  2O9A A;  4GCZ A;  4Y3I A;  3T50 A;  5HSQ A;  4BBV A;  1S4S A;  2NUT C;  2XSS A;  4EUV A;  4DJ2 A;  1GSV A;  3KSG A;  3E4P A;  4ETZ A;  5IS1 A;  4G3W A;  4EEP A;  3KO6 A;  1T1B A;  4I38 A;  3PXP A;  4WEJ A;  3LI8 A;  5DJT A;  2WKP A;  2XA7 M;  1S67 L;  2EWV A;  4CLC D;  4L9F A;  3F1O A;  4K08 A;  2B18 A;  3H82 B;  2HJ9 C;  3CUE C;  1P9R A;  3GDI A;  3PHY A;  2GNX A;  2QKP A;  1VB6 A;  4GW9 A;  4DJ3 A;  4L9G A;  4FSF A;  2YKH A;  3D3O A;  4Y2F A;  4ARZ A;  4EER A;  4E04 A;  3PBT A;  5A8B A;  3FC7 A;  4WN5 A;  1MZU A;  4WF0 A;  3EGD C;  4B93 A;  3IBJ A;  2QHK A;  2J3W A;  1MKM A;  4LRY C;  4MN7 A;  3S7N A;  1ZHH B;  3FPV A;  1P9W A;  5TBM B;  2VLG A;  2K7S A;  2EWW A;  4MCW A;  1LSX A;  3IS2 A;  4YOF A;  2PD7 A;  1DP8 A;  1LSW A;  1TD5 A;  4WL9 A;  5DF9 A;  3VOL A;  1OJ5 A;  5K5B A;  2YKF A;  3NOU C;  2OAP 1;  2VGL S;  3UMD A;  3H7W B;  3GEC A;  1S1Z A;  4NEE D;  1TS0 A;  1OJG A;  4KUK A;  4HJ6 A;  3T4K A;  2WKQ A;  3LR3 A;  3TE8 A;  3F1N A;  4I5S A;  4GLQ A;  1D7E A;  2W1T B;  5HDS A;  4HOI A;  2JN7 A;  2PDR A;  2PYR A;  2G7U A;  4G3V A;  4I39 A;  4HJ4 A;  1VHM A;  1TS7 A;  3HJK A;  3OBF A;  5IU1 A;  1ODV A;  4OOM A;  4NXF A;  3BY8 A;  3OLO A;  3OCL A;  2OWJ A;  2CMN A;  3ZQ5 A;  3CIT A;  3F1P B;  5DJU A;  2NUP C;  4FOF A;  2ZOH A;  3JVU A;  2VV7 A;  4GJ4 A;  4P6Z M;  1NLY A;  1KOU A;  3T4T A;  3LI9 A;  3RH8 B;  3C30 A;  5KSH A;  1NWZ A;  2V0W A;  3LIB A;  3JVV A;  4ETX A;  4NXE A;  3KSH A;  2W1R A;  1N9L A;  4PAU A;  4I3A A;  3MJQ A;  1LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...