3EGDC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22 and bound to the transport signal sequence of vesicular stomatitis virus glycoprotein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egdC00
3KYQA 2NUTC 2DMWA 4AFIA 3EGDC 2VX8A 4B93A 1IOUA 3BW6A 1IFQA 3EGXC 1H8MA 2NUPC
chains in the Genus database with same CATH superfamily
2WKEA 4LENA 3MR0A 1YLWA 1W63M 5CHUA 4OVDA 5KMWA 1YM1A 1GA0A 5E43A 3IF6A 2JKRM 2XQZA 4BL3A 3WS5A 4Y15A 4MEZA 4KZAA 2Y2HA 2FZ0A 5EVIB 3AGDA 4E3OA 3HLCA 1ZKJA 2Y2IA 3U2AA 4GJ4A 2WKHA 3A0RA 2VGJA 3ZG9B 3LO7A 3MS6A 4MBFA 3FZCA 4X55A 1LL8A 5FDHA 3LIEA 1L0FA 5GLDA 1U60A 4IUKA 4R4SA 4EXOA 2JKFA 1BLHA 1TEMA 1W8YA 4Y2FA 4Q0JA 3HREA 2J3TC 2IWBA 1ES4A 3PBTA 4PM5A 3V5MA 2VGKA 4GN2A 3LR5A 3S7NA 4BBUA 1VHMA 4FUWA 3G2YA 4PKYG 3ZNTA 4R0QA 3VOYA 4KZ8A 2Z6CA 4N1XA 4LCMA 1S66L 2ZMAA 1ES3A 1OTIA 5HD5A 3PBNA 4IBXA 4OP8A 3H7WA 3Q07A 1JWZA 4DF6A 1O07A 3OPHA 3EGXC 2PU2A 1M40A 4NKPA 4IUHA 3EOIA 1L0DA 1WA9A 3M6HA 2L4RA 4S2KA 4JPMA 1SDEA 1Z09A 4O01A 5HW3A 1JNUA 1ZG4A 2VGLS 1K56D 1D7EA 2Z6DA 3K2NA 4EU0A 3BECA 4GD6A 2XRNA 5CEDA 1KE3A 2PU4A 4QJGA 2ZQ7A 5G4ZA 3LEZA 5KZHA 1NRFA 3LIAA 2V1ZA 2OAQ1 1KDSA 3OPLA 4XUXA 1IFQA 4OPRA 5IU1A 5D3OA 4DDSA 4Y13A 3FYZA 4S2NA 4I3AA 4UEYA 4R70A 3C30A 5F6AA 3MF0A 4CLCB 2QJ7A 4CJNA 1VEUA 2FFYA 4KG2A 4IVKA 4ZJ2A 4BD0A 1HTZA 5FQKA 5HFOA 4U3TA 4EBNA 4DJ3A 1G28A 2C5WB 3A0VA 2QYBA 5EUAA 3L9KA 3E4QA 3VMAA 2B02A 3OC2A 4WMCA 4YFMA 2J80A 5HAIA 5MC7A 4ZDXA 3Q7ZA 4Q0IA 1MZUA 4C75A 4MN5A 2P74A 1EW0A 2FH5A 3JVUA 3WRTA 1SZVA 2ZC3B 3ZGAB 3S4XA 3S7PA 3SOIA 1F5MA 3OCLA 3V39A 4GNUA 1FSYA 3VFHA 5AVEA 1IYQA 2Q9NA 5AQAA 4MNRA 1IYSA 1RGZA 3T12B 2I72A 3NECA 3OPPA 3VFFA 3C4OA 4KQOA 4EETB 4BL2A 2ZM2A 1CI8A 4GDBA 4WYYA 4B88A 2XSSA 4MMNA 3MKEA 3LFVA 4OKPA 3NCKA 4XT2A 4OQHA 5A91A 3LGOA 1ZC2A 3MJQA 1BLPA 1BSGA 4LRXC 3P09A 1YAXA 1E3UA 2J7VA 4WZ5C 2H0TA 3LCEA 1IYOA 1YMSA 3UE3A 3FV7A 5CEBA 2A3UA 2E8IA 4X25A 4ZTKA 3IS2B 2A24B 4N1HA 1OTBA 5EV0A 4B4ZA 2WGWB 1K6RA 4LRZE 2WGIA 2J3TD 4G3WA 1JTDA 2Y2PA 3CI6A 1TS0A 5F69A 2V20A 5FAQA 3OLOA 2Y59A 1MC0A 4EERA 3CLOA 5GLCA 5A8BA 1PIOA 4R3JA 4YWZA 2INWA 4LV3A 4X69A 1PW1A 4X6TA 5J8XA 4NEED 4Y7PA 1SKOB 4DJ2A 3V3SA 1XFNA 3GSGA 4G3KA 2P08A 1EI5A 4HH3A 1H8MA 2L0WA 4IEDA 2EXAA 2JKGA 1XP4A 2HJ9C 4R23A 4JF4A 1NLYA 1FILA 2VZWA 4GB7A 1M6KA 4DE2A 1BZAA 3ZVTA 1GA9A 3C5AA 3I7JA 1OMEA 4E6XA 4KZ5A 4GS9B 1YLYA 3M6BA 3CMZA 5F1GA 2P9VA 1LL9A 4HJ3A 4MDZA 1DP9A 2G7UA 3SH7A 2VEAA 5FASA 3KSGA 1D1JA 1J3WA 1W5DA 2WYXA 2MJ6A 5IHVA 2G2UA 3LI9A 2PAVP 1XGIA 4Y0TA 4DE3A 3RTYA 4MN7A 1CF0A 2JKTI 3BYDA 3CITA 4EUVA 2V1AA 1G6AA 4RYEA 4M4XA 1S6RA 4BBVA 3F1OA 4EESA 1GSXA 5CTNA 2O9AA 3C7UA 1S4RA 3E98A 3PXPA 3WS2A 2EX6A 2DCFA 2OWJA 3N4IA 3QP2A 1P97A 5E2GA 1MWRA 1GHPA 3E4OA 3IBRA 4A5RA 1XPBA 1XX2A 1LSXA 4E3LA 4B9OA 4BD1A 3IXHA 4E3JA 1OT9A 3F1NA 5DKKA 5HD3A 4OOMA 5CXWA 2W1TA 2C6WB 5F1FA 1YLJA 1XJ6A 2I9VA 1BLSA 4PAUA 3VOLA 2DRWA 3IHBA 4FH4A 1KE4A 2WZZA 4OLDA 4DDYA 3KYEA 1S0WA 2YKFA 3OOVA 3NC8A 3G31A 3VP1A 2OWHA 1TS7A 5FAOA 3S7OA 2XDMA 5BOHA 3MQOA 4HNBA 4RX3A 4KENB 5GHXA 3KSFA 3K3DA 4ESPA 4MCWA 4HQAA 2CC1A 4WLAA 5HX9A 3ICYA 4GDNA 4HY8A 3BEBA 1MPLA 1K55A 1YQSA 2WKPA 2Y2KA 4CLCD 1K57A 3TE8A 4Z1WA 4QPRA 2V0UA 4YNRA 1L0EA 1K4EA 4EWFA 1VB6A 2YKHA 4CQHA 3LEQA 3DTKA 4C6YA 1BTLA 2HP5A 5EVEA 5GHYA 2B95A 2UV0E 2LB5A 5HPIA 5EM0A 1K54C 3IX8A 4GS9A 1FR1A 1MWUA 2PR5A 4OQGA 1KDWA 2HZ5A 4I3JA 4OPYA 4OLGA 4JXWA 2JE5A 4NXFA 4CPKA 3ZHHA 5DF9A 5GLAA 5CHJA 1YLPA 4ETXA 4S2PA 4CLCE 3B33A 3D9YA 4XUZA 3LY3A 2ZMVA 2X02A 4H6JA 3BQAA 2ZMFA 5AQ9A 5F5YA 2KX6A 4Q0HA 1STZA 3PHYA 4I3IA 1LLBA 2W3GA 4L9FA 3LICA 3ZG0A 3N7WA 4L9GA 3MKFA 3T4LA 1N9BA 1PWGA 4R38A 1ESUA 1NRJA 1H8YA 3IF6C 4EQIA 5AQ7A 2AVXA 3M2KA 5TBMA 4FTXA 4OONA 4JXGA 5HAQA 4EBLA 3HLWA 5CX7A 5A90A 2IWCA 3CAXA 1KOUA 1L3LA 2GDNA 4OP5A 3RH8B 4QHCA 2OOLA 3O87A 3G34A 2JKTM 1T1CA 3UO9A 1Q2QA 1YSPA 3M2JA 2PBDP 3CHWP 2X71A 2K2NA 3MZDA 2WZXA 1T1BA 5CGSA 1FCOA 1AXBA 4DMZA 4GHIA 1KGGA 3MFXA 4E3MA 3LI8A 3S1YA 3NOPC 3BLMA 2HDRA 4O0PA 2J3WA 3OPRA 4KQQA 1K6SA 2X01A 3IH9A 2ZQAA 4Y3IA 1DP8A 5I5LA 3R7WB 5DKLA 1YT4A 2W3HA 3HLDA 3MZEA 1S1YA 1EWZA 4OPQA 4LGWA 1DP6A 3MBZA 2LB9A 1HZOA 4X1MA 4I38A 3P01A 5HARA 3AGFA 3TW8A 2W1RA 4UA7A 3NDGA 2DMWA 5AQBA 5HL6A 2Y79A 2PD7A 1LHYA 3LUQA 3P7NA 2W3EA 5M1AA 3FG8A 1DJCA 2BG1A 1PZPA 3DTIA 3ZG7B 4U0XA 4DXCA 3UMDA 3HLGA 1PWCA 4N9KA 4OPZA 5EOEA 1VM1A 2VX8A 2H10A 3HUMA 1D06A 1PI4A 4KQRA 3Q7VB 1ACFA 2HDUA 1LI0A 2QMIA 3UY6A 4KG5A 1XGJA 4X53A 1ESIA 3IXGA 2H28A 1YLZA 4OOLA 1JWPA 2ACGA 5CGXA 4JXSA 2HJEA 2P7JA 4RA7A 4BWIA 2PYRA 2XK1A 3KYQA 3IX3A 4JGQA 3HLEA 2HPBA 2HP6A 1YSQA 4QU3A 1I5QA 3G30A 5EVIA 3RXXA 3D72A 1PYYA 4DN0A 4LRYC 1P9RA 1TF1A 3IXDA 2V9AA 3N8SA 1PWDA 1TS8A 4DE1A 4FOFA 4JKTA 3LR4A 4NXBA 4GD8A 1HD8A 4FD8A 2KOIA 3T1RA 1DJAA 3C2WA 2ZM8A 3VP4A 1JVJA 4HBTA 5HWTA 3P98A 3JPUA 1XFQA 4KG6A 3TOIA 2QPNA 5J7EA 1SHVA 5FL3A 3T4TA 2W3FA 4O8GA 3HJKA 3GRJA 1JWVA 4DRTA 3MSHA 1BYWA 3UNWA 5F82A 3CPTB 4Y0OA 3OZHA 3ZVWA 1DY6A 2R9WA 2EX8A 3QNCA 4KZ3A 1H5XA 2JC7A 2XA7S 3SS3A 1W63Q 5A92A 3BFCA 4F3LB 4YINA 4E3NA 4WELA 4DXBA 3CUEA 3DTEA 1Z6FA 5I94A 2ZD8A 2ZOIA 1UWNX 3RJUA 3A3FA 1IOUA 2D01A 1UWPX 3IXBA 3NBLA 1OTAA 1Q2PA 4LFUA 3SH9A 4JF6A 1K25A 3O3VA 5FI2A 2HP9A 5C5KA 1ERMA 2IA2A 5IT5A 2KDKA 3UE0A 3BWLA 3A3DA 2VV8A 4OQIA 1OJGA 4GCZA 3GTCA 4HBUA 2VV6A 1W7FA 4PM9A 2VGLM 2RCXA 2Y2NA 3RXWA 3UPNA 3ZG5A 3QHYA 2WKQA 1FR6A 3G32A 5EM1A 4CLCA 3O88A 4PHTA 2E8JA 3U4LP 1S1ZA 3GECA 4HOIA 2R78A 2ZC5B 3BY8A 3HLFA 4KZ7A 4O7DA 3JVVA 4LV2A 3FKVA 4S2MA 4N9LA 4E6WA 2HF6A 3MXSA 1V9ZA 4BQMA 2OV5A 2J9PA 4KZ4A 4KZBA 2XD5A 2O0YA 3Q1FA 3BW6A 4Q8IA 2W3DA 3PBRA 1PI5A 1S4SA 2Y2MA 2GNXA 3F1PB 3BFGA 4E3IA 4PM6A 1XA1A 3PBSA 1NLZA 2XH9A 3DBAA 2WAEA 1ES5A 4PM8A 3CPTA 4NETA 4P0MA 4UQIM 1G5UA 1BT5A 1S67L 4FSFA 4HI4A 5FQIA 4F3LA 1ONHA 1AWIA 4PKYA 4P6ZM 2WUQA 4WMCD 1GHMA 3BFDA 2CMNA 2W0NA 4PMAA 3VOZA 3B3XA 2HV1A 3PR6A 1ERQA 2Y55A 1PRQA 2EX9A 4KUKA 4WL9A 5EPHA 2VLGA 3MQQA 3T4SA 2L1MA 1LL5A 5DTSA 2ZC4B 2ZC7A 1Y4OA 2EXBA 1K0KA 4GW9A 3PTEA 3W8KA 3IS2A 2A24A 3B47A 1FCNA 1ONGA 1ALQA 4PPRA 4ID4A 2WGWA 5FQMA 1CI9A 1F2KA 3IQAA 2FFFB 1RP5A 1V9YA 1XJ4A 2Y2JA 3WRZA 3CG5A 3UDFA 3SZTA 4WUJA 3C38A 2BLSA 1K55C 3A3IA 2VK3A 1K57C 3WS0A 3V67A 4ZRRA 3FKWA 1MKMA 3IF6B 3BLSA 1SKOA 1SCWA 2NUTC 5L07A 3VE4A 1BLCA 3T1QB 2ZJ9A 4P6BA 1TDGA 1BUEA 3VP3A 4WZ4A 3BJNA 4K0XA 5U47A 4D60A 4IHQA 4QB8A 1OT6A 3G6OA 4ARZB 3NULA 2V8FA 4K08A 4KUOA 3UDXA 1O7EA 3BRMA 4B93A 4RX2A 3SS4A 1N4OA 3CWFA 3VE3A 3F1PA 3BM6A 1RGYA 5FA7A 3T4JA 4NG2A 5FATA 1A0KA 3G2ZA 1FQGA 3AGEA 2VJWA 1NXYA 3SS5A 5L10A 3FPVA 3LR0A 5EOOA 5AVFA 2GJ3A 2XROA 2XFSA 3GMWA 3MXQA 5DF8A 3NI9A 4I5SA 1K56A 1ZG6A 4EEPA 1J9MA 1NYYA 1TDLA 1LSVA 2WADA 1FIKA 2EWVA 1CEGA 2BASA 4K0WA 4QY5A 5A93A 3W4OA 2H0YA 4OOYA 3HUOA 2QZ6A 4ZJ3A 2K7SA 3H7WB 3GQZA 1MY8A 2Y2OA 4EV4A 2JBFA 2Y91A 1W79A 1WYCA 3EEAA 2J9OA 2ZBBA 1H0MA 3LIBA 5FDSA 3NY4A 1KGFA 3HBRA 5TGFA 4GKUA 3QP1A 4LV0A 2NUPC 2XD1A 4EBPA 3E0YA 5HWWA 4HESA 3N8RA 5F83A 1KE0A 2PD8A 3EEHA 5DTKA 5FEFA 4E04A 1NY0A 1CEFA 1ODVA 3VSLA 4HH2A 4BBTA 1BULA 2JN7A 3VV4A 5M18A 4HIAA 2RL3A 3LYXA 2M7UA 1PW8A 2JHEA 2IWDA 3BQ8A 2O9BA 3LY4A 4KQDA 2V8CA 1MWSA 1SKFA 4C3QA 3IWIA 1VETB 2Y8HA 4D2OA 2PR6A 3HCYA 4WEKA 1VEUB 2EWWA 4IBRA 4ARZA 2O99A 3KSIA 4B4XA 2PBYA 1MBLA 1GHIA 1YPRA 3PYPA 1ZTUA 2Y2GA 4Y0UA 4R4RA 2ZQ8A 4X1LA 5J4EA 4MLLA 5EFWA 3PAEA 3E2LA 4JLFA 1MKIA 2Z2LB 2J8YA 2VV7A 3UPOA 1H3QA 4L0LA 3KO6A 3Q81A 3C8CA 1HVBA 3UB8A 3E2KA 4NK3A 2R9XA 4P85A 1JTGA 2QJ5A 3T4KA 1NWZA 2OSUA 2UWXA 1XJ3A 1E4DA 3VSKA 2W27A 4MBKA 2WK0A 5J3WA 3VP0A 4GLQA 5FQQA 4HHDA 4X68A 3W2ZA 1HLUP 4II7A 5FI7A 3JYIA 4Y17A 4XT2B 4LLOB 4RVAA 1K4FA 1T1AA 5HSQA 3KSHA 3UN7A 3GVBA 4S2NC 5EVIC 4XXRA 4Y5FA 2V0WA 3LIDA 4H8RA 2ZLYA 3IWQA 4UA9A 5DVAA 1KVMA 4HP4A 3UB9A 1TS6A 2QWSA 5DFYA 1SDNA 5CECA 2VKSA 2M7VA 3PBQA 4ME4A 1QMEA 1VQQA 4I39A 3TJZC 3ZQ5A 4X56A 1FSWA 1KVLA 2XFTA 3PAGA 1L2SA 3MXRA 5TFQA 4EW7A 3G4PA 1ES2A 4U0TA 3D3OA 3OBFA 4OH0A 1VETA 3IH8A 3N8LA 2HGVA 2XEPA 3WWXA 3PBOA 1EROA 3R7WA 3DTMA 3FWLA 3TRCA 2KLIA 2EFUA 1GCEA 2ZM0A 3CUEC 2EA9A 1NZOA 1NYMA 1TD5A 1LT0A 4UQIS 3V50A 3IWOA 3ITBA 3DWZA 1XXMA 1LSWA 2HDSA 5E2FA 1KGEA 3ZDJA 5HZHA 4P6ZS 4S2OA 1I2WA 3UB5P 1XKZA 2Y4AA 1CJFA 4BLMA 2A2LA 2P9VB 2ZQCA 2G2WA 2PHYA 1ZHHB 2DNSA 5EE8A 2OLUA 5HDSA 1C3BA 3W4QA 3CZDA 3WS4A 1DJBA 3A3JA 3NOTC 4JGOA 2M1CA 1QMFA 3IF5A 4ZBEA 1OJ5A 3N6IA 5CHMA 3W4PA 2HDQA 1G68A 3Q7VA 3ZYTA 3GDIA 2Z2MB 2H5SA 3QP6A 5JYOA 3NJAA 4IVIA 3EQVA 1F98A 5HDCA 4CLCC 3F1OB 1X0OA 4RQ9A 4FCFA 4QY6A 3ULFA 3QP4A 3H82B 1NJ4A 3UB6A 5GHZA 4HJ4A 3ISGA 1CK3A 3T4QA 1XJ2A 3S7QA 5KSHA 4DE0A 1I2SA 1MWTA 3HUNA 3F1NB 2XR0A 4WM9A 2VA0A 3IBJA 4WZ5A 2W1TB 3LIFA 4G3VA 2OAP1 5FQJA 3GR2A 3ZG8B 2WAFA 3IT9A 4WBGA 3MFDA 3IHAA 4N92A 3ZFZA 3VP2A 3EGDC 3QNBA 5L09A 3UE1A 3LR3A 3DWKA 3UMEA 5HWVA 1K38A 1YMXA 2BTFP 3ZNYA 3O86A 1E25A 4GZBA 5F68A 5CERA 1P0ZA 3V3RA 5KIZA 5FEGA 5IS1A 4EUZA 2EX2A 3UB7A 5DJTA 5DTTA 3TSGA 3T1XA 1TVFA 2PT7A 4ZJ1A 4OQ0A 4NXEA 1UGUA 5FI6A 1FOFA 2WGVA 5EVID 5HPFA 3NOUC 1N9OA 2OLVA 1IELA 4PM7A 4R6LA 3QP8A 2Q9MA 1MXOA 4FH2A 5G18A 3R4KA 3SW1A 3UDIA 2D02A 4QD4A 1IKIA 3SH8A 2PDRA 5CRFA 1RCJA 5AJGA 3ITAA 4Z9QA 2O9CA 3A0SA 5K5BA 4WEJA 3GV9A 2XA7M 4HJ6A 3FPWA 1F9IA 3UE6A 4ZAMA 1IYPA 5EECA 2ZL1B 2GZAA 4IJGA 4BMWA 2JKRI 2WKRA 4KZ6A 4H6JB 1NZUA 2ZOHA 1XA7A 2EFXA 3KYZA 5HAPA 1IEMA 3Q82A 3E4PA 5DF7A 4HEFA 4LCLA 5E2EA 3H9WA 3HVFA 5EVLA 4JBFA 2ZQ9A 5DJUA 3MZFA 4R3BA 2XLNA 4DKIA 4S2LA 2XF3A 3L7HA 3H82A 4JF5A 4ETZA 2K31A 3HLBA 4UHUA 1OPXA 2Y2QA 4F94A 5DFXA 3EQUA 1L0GA 3QP5A 1P9WA 3WS1A 2WKIA 5TBMB 4K91A 5HL1A 4M3KA 1OTDA 1E3UD 3EWKA 1FCMA 1H8ZA 1T18A 3C7VA 1PFLA 3O5YA 5CTMA 5L2FA 3TG9A 4LPZA 4R3AA 1OTEA 3RFBA 2V2FF 1PNEA 5GL9A 5JYPA 4R1GA 2XGNA 4E3KA 1T19A 3KX0X 1Y54A 3BY9A 4MBHA 3CJMA 1WYBA 3G35A 2QHKA 3B42A 4KZ9A 4JXVA 4GHIB 2PYPA 5CGWA 3HL9A 4NXGA 3MQ0A 4L9EA 4P87A 2QKPA 1CQAA 1DRMA 3IX4A 3T1SA 5KSCA 3DW0A 3C4PA 1W8QA 1Y28A 4WN5A 1IKGA 5TR7A 3HJIA 3T4OA 2B18A 3MMHA 1GSWA 4EEUA 3NIAA 4GOGA 3UPPA 2ZQDA 3ZCZA 5TJJA 1LI9A 5GLBA 4YOFA 5FQ9A 5FSRA 1N9NA 2V1BA 4S2IA 3S22A 4HP9A 4JGPA 2GX5A 2Y2LA 1WE4A 2JCHA 4UAAA 1N9LA 3NHQA 5FAPA 2Q0OA 2ZL1A 3K3CA 5E2HA 4EQ1A 3BFFA 4WF0A 3A3EA 1PZOA 1G6OA 2ZC6B 2B5RA 1K54A 4MN6A 3OCNA 3BFEA 4JGRA 4BENA 3DAVA 3FC7A 5HDDA 3D4FA 3T50A 2A49A 4LV1A 3NDEA 5L8MA 4AFIA 5M19A 5LBRA 1GSVA 1YKDA 4BJPA 4UA6A 5G4YA 4S2JA 4QWOA 2P04A 1YLTA 2PRFA
chains in the Genus database with same CATH topology
1XJ6A 4ME4A 2I9VA 4PAUA 2VGLM 3MR0A 4I39A 3VOLA 3TJZC 3ZQ5A 1W63M 2WKQA 4CLCA 2JKRM 4PHTA 2YKFA 1S1ZA 2FZ0A 3OOVA 3GECA 4EW7A 3U2AA 2OWHA 4HOIA 1TS7A 2R78A 3BY8A 3D3OA 4GJ4A 3S7OA 3OBFA 3MQOA 4HNBA 3JVVA 3KSFA 3A0RA 3K3DA 4MCWA 4HQAA 4WLAA 2HF6A 1V9ZA 2HGVA 3ICYA 4HY8A 3PBOA 3R7WA 1LL8A 2WKPA 2O0YA 4CLCD 3TRCA 3TE8A 3LIEA 4Z1WA 3BW6A 2W3DA 4QPRA 3PBRA 2KLIA 2V0UA 1S4SA 2GNXA 4YNRA 3F1PB 4IUKA 4EXOA 3CUEC 3PBSA 2EA9A 1NLZA 1VB6A 2YKHA 1TD5A 1LT0A 4CQHA 4UQIS 3DBAA 4Y2FA 4Q0JA 2LB5A 2J3TC 5HPIA 4UQIM 1LSWA 4GS9A 2PR5A 3PBTA 4I3JA 4NXFA 3LR5A 3S7NA 4BBUA 1VHMA 1S67L 5HZHA 4FSFA 5DF9A 4P6ZS 4HI4A 4F3LA 4PKYG 2Z6CA 4ETXA 4CLCE 2A2LA 1S66L 4PKYA 3B33A 4P6ZM 2PHYA 1ZHHB 1OTIA 2ZMVA 4H6JA 5HDSA 3BQAA 2CMNA 5HD5A 2W0NA 2ZMFA 3PBNA 3NOTC 4JGOA 2M1CA 5F5YA 2HV1A 3H7WA 3PR6A 1OJ5A 2KX6A 4Q0HA 1STZA 4KUKA 3PHYA 3EGXC 4I3IA 4WL9A 2VLGA 2W3GA 4L9FA 3LICA 3ZYTA 3GDIA 3MQQA 3T4SA 2L1MA 4NKPA 3NJAA 4L9GA 3T4LA 3EQVA 4R38A 4IUHA 1NRJA 3EOIA 1F98A 4GW9A 1WA9A 5HDCA 4CLCC 2L4RA 3IS2A 2A24A 3B47A 3F1OB 4O01A 1X0OA 4RQ9A 1JNUA 3ULFA 3H82B 2VGLS 1D7EA 2Z6DA 3K2NA 5TBMA 3UB6A 4EU0A 2XRNA 4HJ4A 3T4QA 1XJ2A 1V9YA 5G4ZA 3S7QA 5KSHA 1XJ4A 5CX7A 3CAXA 1KOUA 3F1NB 3LIAA 2OAQ1 2VA0A 3IBJA 4WUJA 3C38A 3RH8B 2W1TB 2OOLA 1IFQA 3LIFA 4G3VA 5IU1A 2OAP1 2JKTM 1T1CA 1YSPA 3V67A 4I3AA 4UEYA 4ZRRA 3EGDC 1MKMA 2K2NA 4R70A 3C30A 5F6AA 3MF0A 3LR3A 4CLCB 3UMEA 5HWVA 2NUTC 1T1BA 2QJ7A 3VE4A 5F68A 4DMZA 4GHIA 1P0ZA 5KIZA 3MFXA 5IS1A 3BJNA 3LI8A 3UB7A 5DJTA 3NOPC 4IHQA 1OT6A 4O0PA 1G28A 3G6OA 2J3WA 4ARZB 4DJ3A 3A0VA 2PT7A 4K08A 2QYBA 4NXEA 1UGUA 4KUOA 4B93A 4Y3IA 3E4QA 1DP8A 2B02A 5I5LA 5HPFA 3NOUC 3CWFA 3OC2A 5DKLA 3R7WB 3VE3A 2W3HA 3F1PA 1S1YA 1N9OA 2J80A 5MC7A 4Q0IA 3T4JA 1MZUA 1DP6A 4MN5A 3JVUA 1EW0A 2FH5A 4R6LA 2LB9A 3S7PA 4I38A 1F5MA 2VJWA 3OCLA 3P01A 3R4KA 3SW1A 3TW8A 2W1RA 3FPVA 2D02A 3LR0A 5AVEA 5AVFA 2GJ3A 2DMWA 2PDRA 5HL6A 2XROA 2Y79A 2PD7A 3MXQA 3LUQA 5AJGA 3P7NA 2W3EA 4I5SA 4KQOA 3FG8A 4EETB 2O9CA 4EEPA 3A0SA 5K5BA 4WEJA 1LSVA 2XA7M 2EWVA 3FPWA 1F9IA 4HJ6A 2XSSA 3UE6A 2BASA 4MMNA 3LFVA 2GZAA 4IJGA 3UMDA 4BMWA 4XT2A 2JKRI 2WKRA 4H6JB 2ZOHA 2VX8A 3KYZA 2K7SA 3H7WB 3MJQA 1D06A 3E4PA 4LRXC 1YAXA 3EEAA 3H9WA 2ZBBA 3LIBA 5DJUA 2H28A 3UE3A 3H82A 4ETZA 4OOLA 2K31A 2NUPC 1OPXA 3IS2B 2A24B 2HJEA 3EQUA 5DFXA 3E0YA 2P7JA 4BWIA 5HWWA 1P9WA 2PYRA 3KYQA 1OTBA 4JGQA 3EEHA 2PD8A 4LRZE 5TBMB 4E04A 2J3TD 4G3WA 1ODVA 4HH2A 1YSQA 4BBTA 1OTDA 2JN7A 3CI6A 3EWKA 1TS0A 5F69A 3VV4A 3D72A 1T18A 3OLOA 4HIAA 4DN0A 1MC0A 3LYXA 3CLOA 4EERA 2M7UA 4LRYC 2JHEA 3BQ8A 2O9BA 3O5YA 5A8BA 4LPZA 4R3AA 1OTEA 1P9RA 4KQDA 3RFBA 1TF1A 4YWZA 2V9AA 2INWA 1T19A 1TS8A 3KX0X 4NEED 2Y8HA 2PR6A 3BY9A 4DJ2A 4FOFA 3HCYA 3LR4A 4WEKA 4NXBA 2QHKA 3B42A 2EWWA 4ARZA 2O99A 1XFNA 3KSIA 4GHIB 2PYPA 2KOIA 4NXGA 4G3KA 3MQ0A 3PYPA 4L9EA 2P08A 1ZTUA 4HH3A 3C2WA 1H8MA 2QKPA 2L0WA 1DRMA 5HWTA 2HJ9C 1XFQA 5J7EA 5FL3A 5J4EA 3T4TA 1NLYA 1Y28A 2VZWA 2W3FA 4WN5A 5EFWA 4O8GA 3HJIA 3HJKA 3T4OA 1BYWA 2B18A 3MMHA 1GSWA 4EEUA 2VV7A 1H3QA 4L0LA 4GS9B 3KO6A 5TJJA 3C8CA 4YOFA 3UB8A 2XA7S 1N9NA 2QJ5A 3T4KA 1NWZA 2V1BA 1W63Q 4HJ3A 4MDZA 1DP9A 2G7UA 1XJ3A 4HP9A 4JGPA 2GX5A 2VEAA 4F3LB 3KSGA 2W27A 4WELA 3CUEA 1N9LA 5J3WA 3NHQA 2MJ6A 3LI9A 3K3CA 4EQ1A 4WF0A 4GLQA 2ZOIA 1UWNX 3RTYA 4MN7A 1G6OA 2JKTI 3CITA 4HHDA 3W2ZA 4EUVA 1IOUA 2D01A 2V1AA 1UWPX 4MN6A 3OCNA 4II7A 1OTAA 4M4XA 4JGRA 4XT2B 3FC7A 4BBVA 4LLOB 5HDDA 1T1AA 3F1OA 3KSHA 5HSQA 4EESA 3T50A 1GSXA 2O9AA 1S4RA 3E98A 3PXPA 5C5KA 4Y5FA 5L8MA 2OWJA 2V0WA 3LIDA 1P97A 2IA2A 4AFIA 3E4OA 3IBRA 5IT5A 2KDKA 3BWLA 2VV8A 4HP4A 5LBRA 1GSVA 1OJGA 1YKDA 4BJPA 1LSXA 4B9OA 3UB9A 4GCZA 1OT9A 1TS6A 2QWSA 5DFYA 5G4YA 3F1NA 5DKKA 5HD3A 2VKSA 2P04A 2M7VA 2VV6A 3PBQA 4OOMA 2W1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYQ A;  2NUT C;  2DMW A;  4AFI A;  3EGD C;  2VX8 A;  4B93 A;  1IOU A;  3BW6 A;  1IFQ A;  3EGX C;  1H8M A;  2NUP C; 
#chains in the Genus database with same CATH topology
 2WKE A;  4LEN A;  3MR0 A;  1YLW A;  1W63 M;  5CHU A;  4OVD A;  5KMW A;  1YM1 A;  1GA0 A;  5E43 A;  3IF6 A;  2JKR M;  2XQZ A;  4BL3 A;  3WS5 A;  4Y15 A;  4MEZ A;  4KZA A;  2Y2H A;  2FZ0 A;  5EVI B;  3AGD A;  4E3O A;  3HLC A;  1ZKJ A;  2Y2I A;  3U2A A;  4GJ4 A;  2WKH A;  3A0R A;  2VGJ A;  3ZG9 B;  3LO7 A;  3MS6 A;  4MBF A;  3FZC A;  4X55 A;  1LL8 A;  5FDH A;  3LIE A;  1L0F A;  5GLD A;  1U60 A;  4IUK A;  4R4S A;  4EXO A;  2JKF A;  1BLH A;  1TEM A;  1W8Y A;  4Y2F A;  4Q0J A;  3HRE A;  2J3T C;  2IWB A;  1ES4 A;  3PBT A;  4PM5 A;  3V5M A;  2VGK A;  4GN2 A;  3LR5 A;  3S7N A;  4BBU A;  1VHM A;  4FUW A;  3G2Y A;  4PKY G;  3ZNT A;  4R0Q A;  3VOY A;  4KZ8 A;  2Z6C A;  4N1X A;  4LCM A;  1S66 L;  2ZMA A;  1ES3 A;  1OTI A;  5HD5 A;  3PBN A;  4IBX A;  4OP8 A;  3H7W A;  3Q07 A;  1JWZ A;  4DF6 A;  1O07 A;  3OPH A;  3EGX C;  2PU2 A;  1M40 A;  4NKP A;  4IUH A;  3EOI A;  1L0D A;  1WA9 A;  3M6H A;  2L4R A;  4S2K A;  4JPM A;  1SDE A;  1Z09 A;  4O01 A;  5HW3 A;  1JNU A;  1ZG4 A;  2VGL S;  1K56 D;  1D7E A;  2Z6D A;  3K2N A;  4EU0 A;  3BEC A;  4GD6 A;  2XRN A;  5CED A;  1KE3 A;  2PU4 A;  4QJG A;  2ZQ7 A;  5G4Z A;  3LEZ A;  5KZH A;  1NRF A;  3LIA A;  2V1Z A;  2OAQ 1;  1KDS A;  3OPL A;  4XUX A;  1IFQ A;  4OPR A;  5IU1 A;  5D3O A;  4DDS A;  4Y13 A;  3FYZ A;  4S2N A;  4I3A A;  4UEY A;  4R70 A;  3C30 A;  5F6A A;  3MF0 A;  4CLC B;  2QJ7 A;  4CJN A;  1VEU A;  2FFY A;  4KG2 A;  4IVK A;  4ZJ2 A;  4BD0 A;  1HTZ A;  5FQK A;  5HFO A;  4U3T A;  4EBN A;  4DJ3 A;  1G28 A;  2C5W B;  3A0V A;  2QYB A;  5EUA A;  3L9K A;  3E4Q A;  3VMA A;  2B02 A;  3OC2 A;  4WMC A;  4YFM A;  2J80 A;  5HAI A;  5MC7 A;  4ZDX A;  3Q7Z A;  4Q0I A;  1MZU A;  4C75 A;  4MN5 A;  2P74 A;  1EW0 A;  2FH5 A;  3JVU A;  3WRT A;  1SZV A;  2ZC3 B;  3ZGA B;  3S4X A;  3S7P A;  3SOI A;  1F5M A;  3OCL A;  3V39 A;  4GNU A;  1FSY A;  3VFH A;  5AVE A;  1IYQ A;  2Q9N A;  5AQA A;  4MNR A;  1IYS A;  1RGZ A;  3T12 B;  2I72 A;  3NEC A;  3OPP A;  3VFF A;  3C4O A;  4KQO A;  4EET B;  4BL2 A;  2ZM2 A;  1CI8 A;  4GDB A;  4WYY A;  4B88 A;  2XSS A;  4MMN A;  3MKE A;  3LFV A;  4OKP A;  3NCK A;  4XT2 A;  4OQH A;  5A91 A;  3LGO A;  1ZC2 A;  3MJQ A;  1BLP A;  1BSG A;  4LRX C;  3P09 A;  1YAX A;  1E3U A;  2J7V A;  4WZ5 C;  2H0T A;  3LCE A;  1IYO A;  1YMS A;  3UE3 A;  3FV7 A;  5CEB A;  2A3U A;  2E8I A;  4X25 A;  4ZTK A;  3IS2 B;  2A24 B;  4N1H A;  1OTB A;  5EV0 A;  4B4Z A;  2WGW B;  1K6R A;  4LRZ E;  2WGI A;  2J3T D;  4G3W A;  1JTD A;  2Y2P A;  3CI6 A;  1TS0 A;  5F69 A;  2V20 A;  5FAQ A;  3OLO A;  2Y59 A;  1MC0 A;  4EER A;  3CLO A;  5GLC A;  5A8B A;  1PIO A;  4R3J A;  4YWZ A;  2INW A;  4LV3 A;  4X69 A;  1PW1 A;  4X6T A;  5J8X A;  4NEE D;  4Y7P A;  1SKO B;  4DJ2 A;  3V3S A;  1XFN A;  3GSG A;  4G3K A;  2P08 A;  1EI5 A;  4HH3 A;  1H8M A;  2L0W A;  4IED A;  2EXA A;  2JKG A;  1XP4 A;  2HJ9 C;  4R23 A;  4JF4 A;  1NLY A;  1FIL A;  2VZW A;  4GB7 A;  1M6K A;  4DE2 A;  1BZA A;  3ZVT A;  1GA9 A;  3C5A A;  3I7J A;  1OME A;  4E6X A;  4KZ5 A;  4GS9 B;  1YLY A;  3M6B A;  3CMZ A;  5F1G A;  2P9V A;  1LL9 A;  4HJ3 A;  4MDZ A;  1DP9 A;  2G7U A;  3SH7 A;  2VEA A;  5FAS A;  3KSG A;  1D1J A;  1J3W A;  1W5D A;  2WYX A;  2MJ6 A;  5IHV A;  2G2U A;  3LI9 A;  2PAV P;  1XGI A;  4Y0T A;  4DE3 A;  3RTY A;  4MN7 A;  1CF0 A;  2JKT I;  3BYD A;  3CIT A;  4EUV A;  2V1A A;  1G6A A;  4RYE A;  4M4X A;  1S6R A;  4BBV A;  3F1O A;  4EES A;  1GSX A;  5CTN A;  2O9A A;  3C7U A;  1S4R A;  3E98 A;  3PXP A;  3WS2 A;  2EX6 A;  2DCF A;  2OWJ A;  3N4I A;  3QP2 A;  1P97 A;  5E2G A;  1MWR A;  1GHP A;  3E4O A;  3IBR A;  4A5R A;  1XPB A;  1XX2 A;  1LSX A;  4E3L A;  4B9O A;  4BD1 A;  3IXH A;  4E3J A;  1OT9 A;  3F1N A;  5DKK A;  5HD3 A;  4OOM A;  5CXW A;  2W1T A;  2C6W B;  5F1F A;  1YLJ A;  1XJ6 A;  2I9V A;  1BLS A;  4PAU A;  3VOL A;  2DRW A;  3IHB A;  4FH4 A;  1KE4 A;  2WZZ A;  4OLD A;  4DDY A;  3KYE A;  1S0W A;  2YKF A;  3OOV A;  3NC8 A;  3G31 A;  3VP1 A;  2OWH A;  1TS7 A;  5FAO A;  3S7O A;  2XDM A;  5BOH A;  3MQO A;  4HNB A;  4RX3 A;  4KEN B;  5GHX A;  3KSF A;  3K3D A;  4ESP A;  4MCW A;  4HQA A;  2CC1 A;  4WLA A;  5HX9 A;  3ICY A;  4GDN A;  4HY8 A;  3BEB A;  1MPL A;  1K55 A;  1YQS A;  2WKP A;  2Y2K A;  4CLC D;  1K57 A;  3TE8 A;  4Z1W A;  4QPR A;  2V0U A;  4YNR A;  1L0E A;  1K4E A;  4EWF A;  1VB6 A;  2YKH A;  4CQH A;  3LEQ A;  3DTK A;  4C6Y A;  1BTL A;  2HP5 A;  5EVE A;  5GHY A;  2B95 A;  2UV0 E;  2LB5 A;  5HPI A;  5EM0 A;  1K54 C;  3IX8 A;  4GS9 A;  1FR1 A;  1MWU A;  2PR5 A;  4OQG A;  1KDW A;  2HZ5 A;  4I3J A;  4OPY A;  4OLG A;  4JXW A;  2JE5 A;  4NXF A;  4CPK A;  3ZHH A;  5DF9 A;  5GLA A;  5CHJ A;  1YLP A;  4ETX A;  4S2P A;  4CLC E;  3B33 A;  3D9Y A;  4XUZ A;  3LY3 A;  2ZMV A;  2X02 A;  4H6J A;  3BQA A;  2ZMF A;  5AQ9 A;  5F5Y A;  2KX6 A;  4Q0H A;  1STZ A;  3PHY A;  4I3I A;  1LLB A;  2W3G A;  4L9F A;  3LIC A;  3ZG0 A;  3N7W A;  4L9G A;  3MKF A;  3T4L A;  1N9B A;  1PWG A;  4R38 A;  1ESU A;  1NRJ A;  1H8Y A;  3IF6 C;  4EQI A;  5AQ7 A;  2AVX A;  3M2K A;  5TBM A;  4FTX A;  4OON A;  4JXG A;  5HAQ A;  4EBL A;  3HLW A;  5CX7 A;  5A90 A;  2IWC A;  3CAX A;  1KOU A;  1L3L A;  2GDN A;  4OP5 A;  3RH8 B;  4QHC A;  2OOL A;  3O87 A;  3G34 A;  2JKT M;  1T1C A;  3UO9 A;  1Q2Q A;  1YSP A;  3M2J A;  2PBD P;  3CHW P;  2X71 A;  2K2N A;  3MZD A;  2WZX A;  1T1B A;  5CGS A;  1FCO A;  1AXB A;  4DMZ A;  4GHI A;  1KGG A;  3MFX A;  4E3M A;  3LI8 A;  3S1Y A;  3NOP C;  3BLM A;  2HDR A;  4O0P A;  2J3W A;  3OPR A;  4KQQ A;  1K6S A;  2X01 A;  3IH9 A;  2ZQA A;  4Y3I A;  1DP8 A;  5I5L A;  3R7W B;  5DKL A;  1YT4 A;  2W3H A;  3HLD A;  3MZE A;  1S1Y A;  1EWZ A;  4OPQ A;  4LGW A;  1DP6 A;  3MBZ A;  2LB9 A;  1HZO A;  4X1M A;  4I38 A;  3P01 A;  5HAR A;  3AGF A;  3TW8 A;  2W1R A;  4UA7 A;  3NDG A;  2DMW A;  5AQB A;  5HL6 A;  2Y79 A;  2PD7 A;  1LHY A;  3LUQ A;  3P7N A;  2W3E A;  5M1A A;  3FG8 A;  1DJC A;  2BG1 A;  1PZP A;  3DTI A;  3ZG7 B;  4U0X A;  4DXC A;  3UMD A;  3HLG A;  1PWC A;  4N9K A;  4OPZ A;  5EOE A;  1VM1 A;  2VX8 A;  2H10 A;  3HUM A;  1D06 A;  1PI4 A;  4KQR A;  3Q7V B;  1ACF A;  2HDU A;  1LI0 A;  2QMI A;  3UY6 A;  4KG5 A;  1XGJ A;  4X53 A;  1ESI A;  3IXG A;  2H28 A;  1YLZ A;  4OOL A;  1JWP A;  2ACG A;  5CGX A;  4JXS A;  2HJE A;  2P7J A;  4RA7 A;  4BWI A;  2PYR A;  2XK1 A;  3KYQ A;  3IX3 A;  4JGQ A;  3HLE A;  2HPB A;  2HP6 A;  1YSQ A;  4QU3 A;  1I5Q A;  3G30 A;  5EVI A;  3RXX A;  3D72 A;  1PYY A;  4DN0 A;  4LRY C;  1P9R A;  1TF1 A;  3IXD A;  2V9A A;  3N8S A;  1PWD A;  1TS8 A;  4DE1 A;  4FOF A;  4JKT A;  3LR4 A;  4NXB A;  4GD8 A;  1HD8 A;  4FD8 A;  2KOI A;  3T1R A;  1DJA A;  3C2W A;  2ZM8 A;  3VP4 A;  1JVJ A;  4HBT A;  5HWT A;  3P98 A;  3JPU A;  1XFQ A;  4KG6 A;  3TOI A;  2QPN A;  5J7E A;  1SHV A;  5FL3 A;  3T4T A;  2W3F A;  4O8G A;  3HJK A;  3GRJ A;  1JWV A;  4DRT A;  3MSH A;  1BYW A;  3UNW A;  5F82 A;  3CPT B;  4Y0O A;  3OZH A;  3ZVW A;  1DY6 A;  2R9W A;  2EX8 A;  3QNC A;  4KZ3 A;  1H5X A;  2JC7 A;  2XA7 S;  3SS3 A;  1W63 Q;  5A92 A;  3BFC A;  4F3L B;  4YIN A;  4E3N A;  4WEL A;  4DXB A;  3CUE A;  3DTE A;  1Z6F A;  5I94 A;  2ZD8 A;  2ZOI A;  1UWN X;  3RJU A;  3A3F A;  1IOU A;  2D01 A;  1UWP X;  3IXB A;  3NBL A;  1OTA A;  1Q2P A;  4LFU A;  3SH9 A;  4JF6 A;  1K25 A;  3O3V A;  5FI2 A;  2HP9 A;  5C5K A;  1ERM A;  2IA2 A;  5IT5 A;  2KDK A;  3UE0 A;  3BWL A;  3A3D A;  2VV8 A;  4OQI A;  1OJG A;  4GCZ A;  3GTC A;  4HBU A;  2VV6 A;  1W7F A;  4PM9 A;  2VGL M;  2RCX A;  2Y2N A;  3RXW A;  3UPN A;  3ZG5 A;  3QHY A;  2WKQ A;  1FR6 A;  3G32 A;  5EM1 A;  4CLC A;  3O88 A;  4PHT A;  2E8J A;  3U4L P;  1S1Z A;  3GEC A;  4HOI A;  2R78 A;  2ZC5 B;  3BY8 A;  3HLF A;  4KZ7 A;  4O7D A;  3JVV A;  4LV2 A;  3FKV A;  4S2M A;  4N9L A;  4E6W A;  2HF6 A;  3MXS A;  1V9Z A;  4BQM A;  2OV5 A;  2J9P A;  4KZ4 A;  4KZB A;  2XD5 A;  2O0Y A;  3Q1F A;  3BW6 A;  4Q8I A;  2W3D A;  3PBR A;  1PI5 A;  1S4S A;  2Y2M A;  2GNX A;  3F1P B;  3BFG A;  4E3I A;  4PM6 A;  1XA1 A;  3PBS A;  1NLZ A;  2XH9 A;  3DBA A;  2WAE A;  1ES5 A;  4PM8 A;  3CPT A;  4NET A;  4P0M A;  4UQI M;  1G5U A;  1BT5 A;  1S67 L;  4FSF A;  4HI4 A;  5FQI A;  4F3L A;  1ONH A;  1AWI A;  4PKY A;  4P6Z M;  2WUQ A;  4WMC D;  1GHM A;  3BFD A;  2CMN A;  2W0N A;  4PMA A;  3VOZ A;  3B3X A;  2HV1 A;  3PR6 A;  1ERQ A;  2Y55 A;  1PRQ A;  2EX9 A;  4KUK A;  4WL9 A;  5EPH A;  2VLG A;  3MQQ A;  3T4S A;  2L1M A;  1LL5 A;  5DTS A;  2ZC4 B;  2ZC7 A;  1Y4O A;  2EXB A;  1K0K A;  4GW9 A;  3PTE A;  3W8K A;  3IS2 A;  2A24 A;  3B47 A;  1FCN A;  1ONG A;  1ALQ A;  4PPR A;  4ID4 A;  2WGW A;  5FQM A;  1CI9 A;  1F2K A;  3IQA A;  2FFF B;  1RP5 A;  1V9Y A;  1XJ4 A;  2Y2J A;  3WRZ A;  3CG5 A;  3UDF A;  3SZT A;  4WUJ A;  3C38 A;  2BLS A;  1K55 C;  3A3I A;  2VK3 A;  1K57 C;  3WS0 A;  3V67 A;  4ZRR A;  3FKW A;  1MKM A;  3IF6 B;  3BLS A;  1SKO A;  1SCW A;  2NUT C;  5L07 A;  3VE4 A;  1BLC A;  3T1Q B;  2ZJ9 A;  4P6B A;  1TDG A;  1BUE A;  3VP3 A;  4WZ4 A;  3BJN A;  4K0X A;  5U47 A;  4D60 A;  4IHQ A;  4QB8 A;  1OT6 A;  3G6O A;  4ARZ B;  3NUL A;  2V8F A;  4K08 A;  4KUO A;  3UDX A;  1O7E A;  3BRM A;  4B93 A;  4RX2 A;  3SS4 A;  1N4O A;  3CWF A;  3VE3 A;  3F1P A;  3BM6 A;  1RGY A;  5FA7 A;  3T4J A;  4NG2 A;  5FAT A;  1A0K A;  3G2Z A;  1FQG A;  3AGE A;  2VJW A;  1NXY A;  3SS5 A;  5L10 A;  3FPV A;  3LR0 A;  5EOO A;  5AVF A;  2GJ3 A;  2XRO A;  2XFS A;  3GMW A;  3MXQ A;  5DF8 A;  3NI9 A;  4I5S A;  1K56 A;  1ZG6 A;  4EEP A;  1J9M A;  1NYY A;  1TDL A;  1LSV A;  2WAD A;  1FIK A;  2EWV A;  1CEG A;  2BAS A;  4K0W A;  4QY5 A;  5A93 A;  3W4O A;  2H0Y A;  4OOY A;  3HUO A;  2QZ6 A;  4ZJ3 A;  2K7S A;  3H7W B;  3GQZ A;  1MY8 A;  2Y2O A;  4EV4 A;  2JBF A;  2Y91 A;  1W79 A;  1WYC A;  3EEA A;  2J9O A;  2ZBB A;  1H0M A;  3LIB A;  5FDS A;  3NY4 A;  1KGF A;  3HBR A;  5TGF A;  4GKU A;  3QP1 A;  4LV0 A;  2NUP C;  2XD1 A;  4EBP A;  3E0Y A;  5HWW A;  4HES A;  3N8R A;  5F83 A;  1KE0 A;  2PD8 A;  3EEH A;  5DTK A;  5FEF A;  4E04 A;  1NY0 A;  1CEF A;  1ODV A;  3VSL A;  4HH2 A;  4BBT A;  1BUL A;  2JN7 A;  3VV4 A;  5M18 A;  4HIA A;  2RL3 A;  3LYX A;  2M7U A;  1PW8 A;  2JHE A;  2IWD A;  3BQ8 A;  2O9B A;  3LY4 A;  4KQD A;  2V8C A;  1MWS A;  1SKF A;  4C3Q A;  3IWI A;  1VET B;  2Y8H A;  4D2O A;  2PR6 A;  3HCY A;  4WEK A;  1VEU B;  2EWW A;  4IBR A;  4ARZ A;  2O99 A;  3KSI A;  4B4X A;  2PBY A;  1MBL A;  1GHI A;  1YPR A;  3PYP A;  1ZTU A;  2Y2G A;  4Y0U A;  4R4R A;  2ZQ8 A;  4X1L A;  5J4E A;  4MLL A;  5EFW A;  3PAE A;  3E2L A;  4JLF A;  1MKI A;  2Z2L B;  2J8Y A;  2VV7 A;  3UPO A;  1H3Q A;  4L0L A;  3KO6 A;  3Q81 A;  3C8C A;  1HVB A;  3UB8 A;  3E2K A;  4NK3 A;  2R9X A;  4P85 A;  1JTG A;  2QJ5 A;  3T4K A;  1NWZ A;  2OSU A;  2UWX A;  1XJ3 A;  1E4D A;  3VSK A;  2W27 A;  4MBK A;  2WK0 A;  5J3W A;  3VP0 A;  4GLQ A;  5FQQ A;  4HHD A;  4X68 A;  3W2Z A;  1HLU P;  4II7 A;  5FI7 A;  3JYI A;  4Y17 A;  4XT2 B;  4LLO B;  4RVA A;  1K4F A;  1T1A A;  5HSQ A;  3KSH A;  3UN7 A;  3GVB A;  4S2N C;  5EVI C;  4XXR A;  4Y5F A;  2V0W A;  3LID A;  4H8R A;  2ZLY A;  3IWQ A;  4UA9 A;  5DVA A;  1KVM A;  4HP4 A;  3UB9 A;  1TS6 A;  2QWS A;  5DFY A;  1SDN A;  5CEC A;  2VKS A;  2M7V A;  3PBQ A;  4ME4 A;  1QME A;  1VQQ A;  4I39 A;  3TJZ C;  3ZQ5 A;  4X56 A;  1FSW A;  1KVL A;  2XFT A;  3PAG A;  1L2S A;  3MXR A;  5TFQ A;  4EW7 A;  3G4P A;  1ES2 A;  4U0T A;  3D3O A;  3OBF A;  4OH0 A;  1VET A;  3IH8 A;  3N8L A;  2HGV A;  2XEP A;  3WWX A;  3PBO A;  1ERO A;  3R7W A;  3DTM A;  3FWL A;  3TRC A;  2KLI A;  2EFU A;  1GCE A;  2ZM0 A;  3CUE C;  2EA9 A;  1NZO A;  1NYM A;  1TD5 A;  1LT0 A;  4UQI S;  3V50 A;  3IWO A;  3ITB A;  3DWZ A;  1XXM A;  1LSW A;  2HDS A;  5E2F A;  1KGE A;  3ZDJ A;  5HZH A;  4P6Z S;  4S2O A;  1I2W A;  3UB5 P;  1XKZ A;  2Y4A A;  1CJF A;  4BLM A;  2A2L A;  2P9V B;  2ZQC A;  2G2W A;  2PHY A;  1ZHH B;  2DNS A;  5EE8 A;  2OLU A;  5HDS A;  1C3B A;  3W4Q A;  3CZD A;  3WS4 A;  1DJB A;  3A3J A;  3NOT C;  4JGO A;  2M1C A;  1QMF A;  3IF5 A;  4ZBE A;  1OJ5 A;  3N6I A;  5CHM A;  3W4P A;  2HDQ A;  1G68 A;  3Q7V A;  3ZYT A;  3GDI A;  2Z2M B;  2H5S A;  3QP6 A;  5JYO A;  3NJA A;  4IVI A;  3EQV A;  1F98 A;  5HDC A;  4CLC C;  3F1O B;  1X0O A;  4RQ9 A;  4FCF A;  4QY6 A;  3ULF A;  3QP4 A;  3H82 B;  1NJ4 A;  3UB6 A;  5GHZ A;  4HJ4 A;  3ISG A;  1CK3 A;  3T4Q A;  1XJ2 A;  3S7Q A;  5KSH A;  4DE0 A;  1I2S A;  1MWT A;  3HUN A;  3F1N B;  2XR0 A;  4WM9 A;  2VA0 A;  3IBJ A;  4WZ5 A;  2W1T B;  3LIF A;  4G3V A;  2OAP 1;  5FQJ A;  3GR2 A;  3ZG8 B;  2WAF A;  3IT9 A;  4WBG A;  3MFD A;  3IHA A;  4N92 A;  3ZFZ A;  3VP2 A;  3EGD C;  3QNB A;  5L09 A;  3UE1 A;  3LR3 A;  3DWK A;  3UME A;  5HWV A;  1K38 A;  1YMX A;  2BTF P;  3ZNY A;  3O86 A;  1E25 A;  4GZB A;  5F68 A;  5CER A;  1P0Z A;  3V3R A;  5KIZ A;  5FEG A;  5IS1 A;  4EUZ A;  2EX2 A;  3UB7 A;  5DJT A;  5DTT A;  3TSG A;  3T1X A;  1TVF A;  2PT7 A;  4ZJ1 A;  4OQ0 A;  4NXE A;  1UGU A;  5FI6 A;  1FOF A;  2WGV A;  5EVI D;  5HPF A;  3NOU C;  1N9O A;  2OLV A;  1IEL A;  4PM7 A;  4R6L A;  3QP8 A;  2Q9M A;  1MXO A;  4FH2 A;  5G18 A;  3R4K A;  3SW1 A;  3UDI A;  2D02 A;  4QD4 A;  1IKI A;  3SH8 A;  2PDR A;  5CRF A;  1RCJ A;  5AJG A;  3ITA A;  4Z9Q A;  2O9C A;  3A0S A;  5K5B A;  4WEJ A;  3GV9 A;  2XA7 M;  4HJ6 A;  3FPW A;  1F9I A;  3UE6 A;  4ZAM A;  1IYP A;  5EEC A;  2ZL1 B;  2GZA A;  4IJG A;  4BMW A;  2JKR I;  2WKR A;  4KZ6 A;  4H6J B;  1NZU A;  2ZOH A;  1XA7 A;  2EFX A;  3KYZ A;  5HAP A;  1IEM A;  3Q82 A;  3E4P A;  5DF7 A;  4HEF A;  4LCL A;  5E2E A;  3H9W A;  3HVF A;  5EVL A;  4JBF A;  2ZQ9 A;  5DJU A;  3MZF A;  4R3B A;  2XLN A;  4DKI A;  4S2L A;  2XF3 A;  3L7H A;  3H82 A;  4JF5 A;  4ETZ A;  2K31 A;  3HLB A;  4UHU A;  1OPX A;  2Y2Q A;  4F94 A;  5DFX A;  3EQU A;  1L0G A;  3QP5 A;  1P9W A;  3WS1 A;  2WKI A;  5TBM B;  4K91 A;  5HL1 A;  4M3K A;  1OTD A;  1E3U D;  3EWK A;  1FCM A;  1H8Z A;  1T18 A;  3C7V A;  1PFL A;  3O5Y A;  5CTM A;  5L2F A;  3TG9 A;  4LPZ A;  4R3A A;  1OTE A;  3RFB A;  2V2F F;  1PNE A;  5GL9 A;  5JYP A;  4R1G A;  2XGN A;  4E3K A;  1T19 A;  3KX0 X;  1Y54 A;  3BY9 A;  4MBH A;  3CJM A;  1WYB A;  3G35 A;  2QHK A;  3B42 A;  4KZ9 A;  4JXV A;  4GHI B;  2PYP A;  5CGW A;  3HL9 A;  4NXG A;  3MQ0 A;  4L9E A;  4P87 A;  2QKP A;  1CQA A;  1DRM A;  3IX4 A;  3T1S A;  5KSC A;  3DW0 A;  3C4P A;  1W8Q A;  1Y28 A;  4WN5 A;  1IKG A;  5TR7 A;  3HJI A;  3T4O A;  2B18 A;  3MMH A;  1GSW A;  4EEU A;  3NIA A;  4GOG A;  3UPP A;  2ZQD A;  3ZCZ A;  5TJJ A;  1LI9 A;  5GLB A;  4YOF A;  5FQ9 A;  5FSR A;  1N9N A;  2V1B A;  4S2I A;  3S22 A;  4HP9 A;  4JGP A;  2GX5 A;  2Y2L A;  1WE4 A;  2JCH A;  4UAA A;  1N9L A;  3NHQ A;  5FAP A;  2Q0O A;  2ZL1 A;  3K3C A;  5E2H A;  4EQ1 A;  3BFF A;  4WF0 A;  3A3E A;  1PZO A;  1G6O A;  2ZC6 B;  2B5R A;  1K54 A;  4MN6 A;  3OCN A;  3BFE A;  4JGR A;  4BEN A;  3DAV A;  3FC7 A;  5HDD A;  3D4F A;  3T50 A;  2A49 A;  4LV1 A;  3NDE A;  5L8M A;  4AFI A;  5M19 A;  5LBR A;  1GSV A;  1YKD A;  4BJP A;  4UA6 A;  5G4Y A;  4S2J A;  4QWO A;  2P04 A;  1YLT A;  2PRF A; 
#chains in the Genus database with same CATH homology
 1XJ6 A;  4ME4 A;  2I9V A;  4PAU A;  2VGL M;  3MR0 A;  4I39 A;  3VOL A;  3TJZ C;  3ZQ5 A;  1W63 M;  2WKQ A;  4CLC A;  2JKR M;  4PHT A;  2YKF A;  1S1Z A;  2FZ0 A;  3OOV A;  3GEC A;  4EW7 A;  3U2A A;  2OWH A;  4HOI A;  1TS7 A;  2R78 A;  3BY8 A;  3D3O A;  4GJ4 A;  3S7O A;  3OBF A;  3MQO A;  4HNB A;  3JVV A;  3KSF A;  3A0R A;  3K3D A;  4MCW A;  4HQA A;  4WLA A;  2HF6 A;  1V9Z A;  2HGV A;  3ICY A;  4HY8 A;  3PBO A;  3R7W A;  1LL8 A;  2WKP A;  2O0Y A;  4CLC D;  3TRC A;  3TE8 A;  3LIE A;  4Z1W A;  3BW6 A;  2W3D A;  4QPR A;  3PBR A;  2KLI A;  2V0U A;  1S4S A;  2GNX A;  4YNR A;  3F1P B;  4IUK A;  4EXO A;  3CUE C;  3PBS A;  2EA9 A;  1NLZ A;  1VB6 A;  2YKH A;  1TD5 A;  1LT0 A;  4CQH A;  4UQI S;  3DBA A;  4Y2F A;  4Q0J A;  2LB5 A;  2J3T C;  5HPI A;  4UQI M;  1LSW A;  4GS9 A;  2PR5 A;  3PBT A;  4I3J A;  4NXF A;  3LR5 A;  3S7N A;  4BBU A;  1VHM A;  1S67 L;  5HZH A;  4FSF A;  5DF9 A;  4P6Z S;  4HI4 A;  4F3L A;  4PKY G;  2Z6C A;  4ETX A;  4CLC E;  2A2L A;  1S66 L;  4PKY A;  3B33 A;  4P6Z M;  2PHY A;  1ZHH B;  1OTI A;  2ZMV A;  4H6J A;  5HDS A;  3BQA A;  2CMN A;  5HD5 A;  2W0N A;  2ZMF A;  3PBN A;  3NOT C;  4JGO A;  2M1C A;  5F5Y A;  2HV1 A;  3H7W A;  3PR6 A;  1OJ5 A;  2KX6 A;  4Q0H A;  1STZ A;  4KUK A;  3PHY A;  3EGX C;  4I3I A;  4WL9 A;  2VLG A;  2W3G A;  4L9F A;  3LIC A;  3ZYT A;  3GDI A;  3MQQ A;  3T4S A;  2L1M A;  4NKP A;  3NJA A;  4L9G A;  3T4L A;  3EQV A;  4R38 A;  4IUH A;  1NRJ A;  3EOI A;  1F98 A;  4GW9 A;  1WA9 A;  5HDC A;  4CLC C;  2L4R A;  3IS2 A;  2A24 A;  3B47 A;  3F1O B;  4O01 A;  1X0O A;  4RQ9 A;  1JNU A;  3ULF A;  3H82 B;  2VGL S;  1D7E A;  2Z6D A;  3K2N A;  5TBM A;  3UB6 A;  4EU0 A;  2XRN A;  4HJ4 A;  3T4Q A;  1XJ2 A;  1V9Y A;  5G4Z A;  3S7Q A;  5KSH A;  1XJ4 A;  5CX7 A;  3CAX A;  1KOU A;  3F1N B;  3LIA A;  2OAQ 1;  2VA0 A;  3IBJ A;  4WUJ A;  3C38 A;  3RH8 B;  2W1T B;  2OOL A;  1IFQ A;  3LIF A;  4G3V A;  5IU1 A;  2OAP 1;  2JKT M;  1T1C A;  1YSP A;  3V67 A;  4I3A A;  4UEY A;  4ZRR A;  3EGD C;  1MKM A;  2K2N A;  4R70 A;  3C30 A;  5F6A A;  3MF0 A;  3LR3 A;  4CLC B;  3UME A;  5HWV A;  2NUT C;  1T1B A;  2QJ7 A;  3VE4 A;  5F68 A;  4DMZ A;  4GHI A;  1P0Z A;  5KIZ A;  3MFX A;  5IS1 A;  3BJN A;  3LI8 A;  3UB7 A;  5DJT A;  3NOP C;  4IHQ A;  1OT6 A;  4O0P A;  1G28 A;  3G6O A;  2J3W A;  4ARZ B;  4DJ3 A;  3A0V A;  2PT7 A;  4K08 A;  2QYB A;  4NXE A;  1UGU A;  4KUO A;  4B93 A;  4Y3I A;  3E4Q A;  1DP8 A;  2B02 A;  5I5L A;  5HPF A;  3NOU C;  3CWF A;  3OC2 A;  5DKL A;  3R7W B;  3VE3 A;  2W3H A;  3F1P A;  1S1Y A;  1N9O A;  2J80 A;  5MC7 A;  4Q0I A;  3T4J A;  1MZU A;  1DP6 A;  4MN5 A;  3JVU A;  1EW0 A;  2FH5 A;  4R6L A;  2LB9 A;  3S7P A;  4I38 A;  1F5M A;  2VJW A;  3OCL A;  3P01 A;  3R4K A;  3SW1 A;  3TW8 A;  2W1R A;  3FPV A;  2D02 A;  3LR0 A;  5AVE A;  5AVF A;  2GJ3 A;  2DMW A;  2PDR A;  5HL6 A;  2XRO A;  2Y79 A;  2PD7 A;  3MXQ A;  3LUQ A;  5AJG A;  3P7N A;  2W3E A;  4I5S A;  4KQO A;  3FG8 A;  4EET B;  2O9C A;  4EEP A;  3A0S A;  5K5B A;  4WEJ A;  1LSV A;  2XA7 M;  2EWV A;  3FPW A;  1F9I A;  4HJ6 A;  2XSS A;  3UE6 A;  2BAS A;  4MMN A;  3LFV A;  2GZA A;  4IJG A;  3UMD A;  4BMW A;  4XT2 A;  2JKR I;  2WKR A;  4H6J B;  2ZOH A;  2VX8 A;  3KYZ A;  2K7S A;  3H7W B;  3MJQ A;  1D06 A;  3E4P A;  4LRX C;  1YAX A;  3EEA A;  3H9W A;  2ZBB A;  3LIB A;  5DJU A;  2H28 A;  3UE3 A;  3H82 A;  4ETZ A;  4OOL A;  2K31 A;  2NUP C;  1OPX A;  3IS2 B;  2A24 B;  2HJE A;  3EQU A;  5DFX A;  3E0Y A;  2P7J A;  4BWI A;  5HWW A;  1P9W A;  2PYR A;  3KYQ A;  1OTB A;  4JGQ A;  3EEH A;  2PD8 A;  4LRZ E;  5TBM B;  4E04 A;  2J3T D;  4G3W A;  1ODV A;  4HH2 A;  1YSQ A;  4BBT A;  1OTD A;  2JN7 A;  3CI6 A;  3EWK A;  1TS0 A;  5F69 A;  3VV4 A;  3D72 A;  1T18 A;  3OLO A;  4HIA A;  4DN0 A;  1MC0 A;  3LYX A;  3CLO A;  4EER A;  2M7U A;  4LRY C;  2JHE A;  3BQ8 A;  2O9B A;  3O5Y A;  5A8B A;  4LPZ A;  4R3A A;  1OTE A;  1P9R A;  4KQD A;  3RFB A;  1TF1 A;  4YWZ A;  2V9A A;  2INW A;  1T19 A;  1TS8 A;  3KX0 X;  4NEE D;  2Y8H A;  2PR6 A;  3BY9 A;  4DJ2 A;  4FOF A;  3HCY A;  3LR4 A;  4WEK A;  4NXB A;  2QHK A;  3B42 A;  2EWW A;  4ARZ A;  2O99 A;  1XFN A;  3KSI A;  4GHI B;  2PYP A;  2KOI A;  4NXG A;  4G3K A;  3MQ0 A;  3PYP A;  4L9E A;  2P08 A;  1ZTU A;  4HH3 A;  3C2W A;  1H8M A;  2QKP A;  2L0W A;  1DRM A;  5HWT A;  2HJ9 C;  1XFQ A;  5J7E A;  5FL3 A;  5J4E A;  3T4T A;  1NLY A;  1Y28 A;  2VZW A;  2W3F A;  4WN5 A;  5EFW A;  4O8G A;  3HJI A;  3HJK A;  3T4O A;  1BYW A;  2B18 A;  3MMH A;  1GSW A;  4EEU A;  2VV7 A;  1H3Q A;  4L0L A;  4GS9 B;  3KO6 A;  5TJJ A;  3C8C A;  4YOF A;  3UB8 A;  2XA7 S;  1N9N A;  2QJ5 A;  3T4K A;  1NWZ A;  2V1B A;  1W63 Q;  4HJ3 A;  4MDZ A;  1DP9 A;  2G7U A;  1XJ3 A;  4HP9 A;  4JGP A;  2GX5 A;  2VEA A;  4F3L B;  3KSG A;  2W27 A;  4WEL A;  3CUE A;  1N9L A;  5J3W A;  3NHQ A;  2MJ6 A;  3LI9 A;  3K3C A;  4EQ1 A;  4WF0 A;  4GLQ A;  2ZOI A;  1UWN X;  3RTY A;  4MN7 A;  1G6O A;  2JKT I;  3CIT A;  4HHD A;  3W2Z A;  4EUV A;  1IOU A;  2D01 A;  2V1A A;  1UWP X;  4MN6 A;  3OCN A;  4II7 A;  1OTA A;  4M4X A;  4JGR A;  4XT2 B;  3FC7 A;  4BBV A;  4LLO B;  5HDD A;  1T1A A;  3F1O A;  3KSH A;  5HSQ A;  4EES A;  3T50 A;  1GSX A;  2O9A A;  1S4R A;  3E98 A;  3PXP A;  5C5K A;  4Y5F A;  5L8M A;  2OWJ A;  2V0W A;  3LID A;  1P97 A;  2IA2 A;  4AFI A;  3E4O A;  3IBR A;  5IT5 A;  2KDK A;  3BWL A;  2VV8 A;  4HP4 A;  5LBR A;  1GSV A;  1OJG A;  1YKD A;  4BJP A;  1LSX A;  4B9O A;  3UB9 A;  4GCZ A;  1OT9 A;  1TS6 A;  2QWS A;  5DFY A;  5G4Y A;  3F1N A;  5DKK A;  5HD3 A;  2VKS A;  2P04 A;  2M7V A;  2VV6 A;  3PBQ A;  4OOM A;  2W1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...