3EGDC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22 and bound to the transport signal sequence of vesicular stomatitis virus glycoprotein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egdC00
3BW6A 2NUTC 3KYQA 3EGXC 2NUPC 1IFQA 4AFIA 1IOUA 1H8MA 3EGDC 2DMWA 2VX8A 4B93A
chains in the Genus database with same CATH superfamily
3H7WB 2QKPA 3DTKA 1HD8A 2WZXA 3G2YA 3V67A 3CI6A 3CUEA 2H28A 4LV0A 3D4FA 3D3OA 2QHKA 1KDSA 3FPVA 5K5BA 3NOPC 4BD1A 2WGVA 1TVFA 3BY9A 4K0WA 4I38A 2P9VA 4R3JA 2Y59A 1OJGA 2HP5A 1XX2A 3BWLA 3VSLA 5A8BA 4YINA 3QP2A 4MMNA 4EUZA 1NWZA 2KOIA 1MBLA 4F3LA 2XFSA 2R78A 2VGLS 3EWKA 1ODVA 3CAXA 5CXWA 4LV1A 4YNRA 2XLNA 1PNEA 5CGSA 1Z09A 2PBYA 4E3OA 2J9PA 2E8JA 5FEGA 5U47A 5HL1A 3UB6A 2WKQA 2X02A 3OPRA 1ONGA 2ZC7A 3T4KA 4EERA 5HAPA 3T4TA 4EWFA 4KZ4A 4G3KA 4CLCE 5FAPA 3ZYTA 3LCEA 1OT6A 4IBXA 1H0MA 4LLOB 1XGIA 2HDQA 3M6BA 3R7WB 4QD4A 4IUHA 3HLEA 1K56A 3ITAA 4Y0UA 2LB5A 1M40A 2IWCA 5AQ7A 3ZNTA 2ZOIA 1N9BA 4LRXC 2V8FA 5F6AA 3VE4A 3FKVA 3VOYA 3A3JA 3G4PA 1IOUA 4PM6A 5HD5A 4BL2A 1CI8A 3M2JA 3EEHA 2IWBA 3HLCA 2OAQ1 4U0TA 3CUEC 3QNCA 3BLMA 1VETB 1MY8A 4KZ7A 3GTCA 2VK3A 5EVIA 2VV8A 5GLCA 1SKOB 2A2LA 3OZHA 4GHIB 2EXAA 4JXWA 4UQIS 5CTNA 3RH8B 5TBMB 5KZHA 3IH9A 3F1NA 1RGZA 2WGWB 2HDUA 4EU0A 2BASA 2V20A 2W1TB 3ISGA 2VA0A 1Q2PA 5F1GA 2ZLYA 1XJ3A 2XA7S 3A0VA 4UA6A 4GZBA 1NXYA 1W63Q 1NRJA 2WKEA 1K6RA 1PFLA 3BFFA 4GS9A 2BTFP 3E4QA 1XA1A 2L1MA 1BULA 3VFFA 4OPRA 1ERQA 2M1CA 3PBSA 3RXWA 2O9BA 3RJUA 2WUQA 3IWQA 4XUZA 3S4XA 1ZC2A 3CHWP 4KZ3A 4EBLA 3JYIA 1L3LA 3MXRA 4O01A 3WRZA 2V1AA 4UHUA 3SW1A 3LYXA 5LBRA 3T4JA 4KG6A 5J8XA 4DKIA 4DJ3A 3B33A 3E4OA 1KE0A 1YMXA 2QZ6A 4GOGA 4CQHA 3A3EA 2JKFA 2WKHA 5A90A 3N8SA 2QWSA 2Z6CA 3RXXA 4EQIA 3UO9A 2YKFA 3HLFA 4X68A 4HJ6A 2J3TD 3V3RA 2CC1A 3A0SA 5TJJA 1FCMA 4ME4A 5EPHA 3UNWA 5I94A 1J9MA 4GS9B 1K55C 3QP5A 2JKRM 3HJKA 1LI9A 1OT9A 3GECA 4WF0A 2H5SA 5HPIA 2PR6A 1CI9A 5KMWA 4OQ0A 1YM1A 5HX9A 4X69A 3E4PA 1LLBA 4X1LA 4M4XA 4QJGA 3FKWA 1S4RA 4OPZA 5L8MA 2V9AA 2XK1A 4LRZE 4Y17A 3Q7ZA 1ZTUA 2VKSA 3N8LA 2IA2A 4KZ9A 2ZM8A 3ZGAB 5HAQA 1T1BA 5CRFA 3EGDC 3PBRA 1XP4A 1OPXA 2P08A 2W27A 2EFUA 5EVEA 5I5LA 5CHMA 1FR6A 2EX6A 2C5WB 1K54A 4Y5FA 3ZCZA 1G28A 1OTEA 1L0EA 1YKDA 4NETA 1XJ6A 1XPBA 1EROA 4WELA 1G68A 4BLMA 1VEUA 1H5XA 2XGNA 5L07A 1MPLA 2R9XA 3BFDA 4IUKA 5DKKA 4LFUA 4E3NA 4FD8A 4HH3A 1JNUA 3P7NA 3ZQ5A 2NUPC 3NOUC 2OOLA 4HH2A 1V9ZA 4D2OA 3KO6A 4QWOA 2O0YA 2B02A 5CTMA 1ES3A 1YMSA 4FUWA 2NUTC 1VM1A 3B3XA 4MDZA 2Q9MA 4S2KA 4JF5A 3BY8A 4F3LB 4Y0OA 3V3SA 4FTXA 4U3TA 1XJ4A 3UMEA 1D06A 5G4ZA 1FOFA 2Y2JA 1CEGA 3V39A 3LICA 4O0PA 2RL3A 3T4OA 4ETZA 3EEAA 1W7FA 3MZDA 3K3DA 2L0WA 2WKIA 4WYYA 1XKZA 3UDFA 4R0QA 4YWZA 1WYCA 4GLQA 4ETXA 3O3VA 3MBZA 4GB7A 1NLZA 1ACFA 3U4LP 2IWDA 3ZG8B 5EOOA 2WK0A 5IHVA 2HJ9C 5DF9A 4QU3A 3GVBA 1KOUA 3E98A 3IWOA 1WA9A 1BUEA 4E3LA 3E2LA 1VEUB 3FZCA 2GNXA 5TR7A 5CECA 3MF0A 3CLOA 3T12B 3F1OA 5DTSA 2I9VA 4WM9A 5JYOA 2JCHA 3CITA 4CPKA 3W4OA 1NY0A 2YKHA 5FAOA 3NULA 1JTDA 5IU1A 2XDMA 2DCFA 5E2HA 5GLBA 1T19A 1L0GA 3W2ZA 1I2SA 4LPZA 3KSFA 3DAVA 1IYOA 3HUMA 5A91A 1LL5A 4GN2A 4UAAA 5E2EA 3HJIA 3IXBA 4HY8A 1DP6A 4HIAA 1W5DA 2Y2IA 3MFXA 3G31A 5F82A 1DJBA 4CLCB 1H8MA 3PTEA 3IBRA 1TDLA 2ZMVA 4PM7A 4JGPA 5TGFA 2G2WA 2FZ0A 4YFMA 3HUNA 2OV5A 4KZBA 3DTIA 2W3GA 1UWPX 1OJ5A 3MQQA 2DMWA 3MKEA 4NXGA 5DFYA 4E6XA 3KYZA 4G3VA 3JVVA 1LT0A 4O8GA 4N9LA 4LENA 4GW9A 1K56D 4JXSA 3LIBA 1N9LA 3GR2A 1F98A 1X0OA 3S22A 1KVMA 3G2ZA 3G32A 5AVFA 4EQ1A 3PBTA 3MXSA 1ESUA 1HLUP 4EBNA 4XUXA 2D02A 4ID4A 3RTYA 1MWRA 4MNRA 2PU4A 4NK3A 2PT7A 4EUVA 4EETB 3N7WA 1YSQA 1K57A 1RGYA 1Y54A 1W8QA 1I5QA 4B4ZA 1TS7A 1STZA 2HJEA 3BEBA 4QPRA 3Q82A 5HW3A 5HSQA 1XJ2A 2XH9A 5L2FA 3KYQA 3LEQA 1EW0A 4LCMA 3FC7A 3H9WA 1YQSA 5EECA 1WYBA 1VB6A 1SCWA 4BD0A 3F1PA 3LFVA 1DJCA 3CJMA 5FQIA 1E3UA 3IS2A 4QB8A 4YOFA 1NZOA 4ZJ1A 1O07A 3KYEA 3T50A 5CGXA 4PMAA 5AVEA 2W3FA 4K91A 2ZMFA 2OWJA 4Y7PA 1CQAA 4Y0TA 3T1SA 2XFTA 2W3EA 4QY6A 1HVBA 4XXRA 3NI9A 3TRCA 5HDDA 2ZQCA 3U2AA 3L9KA 5HWTA 1Y4OA 2H0YA 4F94A 1VETA 1IEMA 3Q1FA 2CMNA 1MXOA 3C7UA 1Z6FA 3AGDA 3S7PA 4L9GA 1W8YA 4Q0JA 4WZ4A 1TS0A 3IF6C 2VV7A 2KX6A 4NG2A 2HDSA 3N6IA 2H10A 1LI0A 2AVXA 2FFFB 4XT2B 1XXMA 3GDIA 3UB8A 5F5YA 3WS1A 4C3QA 4S2JA 2H0TA 2Y8HA 3R7WA 1E4DA 4GJ4A 2Y2GA 1ZG4A 3TJZC 4ARZA 1PW1A 3JPUA 4EW7A 4JLFA 2Q9NA 1F9IA 4I5SA 2ZQ7A 3A3FA 4KZ8A 4I39A 1HTZA 2PU2A 4BBVA 2ZQ9A 2M7UA 3UY6A 3HL9A 3CWFA 3CZDA 4U0XA 2QYBA 3N8RA 4BL3A 4EEPA 3C8CA 3O88A 1YLTA 1CF0A 2INWA 4MN6A 4P85A 4JF6A 3CG5A 3IXGA 4EXOA 1PWDA 1PYYA 3MSHA 3T4LA 3LI9A 1SKFA 4R4SA 3NY4A 1MWUA 3FWLA 1SHVA 2VLGA 4BQMA 3LIFA 5M18A 3HLGA 1YLWA 4DE2A 4IVKA 2WYXA 2WGIA 4S2MA 1NZUA 1P9WA 3IXDA 4Y13A 3O87A 4FCFA 5HDSA 2E8IA 3ZG7B 4JGQA 2ZL1B 3SS4A 4H6JA 2ZL1A 4ARZB 1GHPA 1MKIA 3ICYA 3SH8A 1ES5A 3UDXA 2V0WA 1LSXA 4MLLA 4M3KA 4EEUA 4MBHA 5HFOA 4WZ5C 4H6JB 3LR5A 5DFXA 4ZTKA 3VV4A 4OH0A 1L0DA 3OC2A 4QY5A 4OKPA 4HI4A 5CHUA 4JPMA 1FILA 5HPFA 1MZUA 3UE1A 2PHYA 2Y2KA 1EWZA 3MQOA 3TOIA 2Y91A 3GRJA 1Q2QA 5DKLA 4HEFA 3T4QA 2VGKA 3LO7A 4Q0HA 1GSWA 1KGGA 4N1HA 4IJGA 4S2NC 3Q07A 1PZPA 4PHTA 2JHEA 4DE0A 5FDSA 4H8RA 2Y2QA 3SS5A 4X56A 3PHYA 3WS2A 2B95A 1D1JA 2Y2NA 5DTTA 3HLWA 5DJUA 3KSGA 2V1BA 5FSRA 2EWVA 3M2KA 2VX8A 4DF6A 1OTBA 3OPPA 5TFQA 3MZEA 2P9VB 3G30A 2VZWA 3VP1A 3ZHHA 2DNSA 2GX5A 4XT2A 3C5AA 4K08A 5HWWA 4UEYA 3BFGA 3OPHA 1GHMA 1IELA 4OPQA 4RX2A 2Z2LB 3H7WA 1JWPA 4KQQA 2OSUA 1ESIA 3UB9A 3QP1A 3TG9A 4CJNA 3LEZA 2Q0OA 4E3JA 3VP0A 1NYYA 3QHYA 1GA0A 2HDRA 4PM9A 1YLPA 1UWNX 2KDKA 3BW6A 3K2NA 3W8KA 4NXBA 1BSGA 1ES4A 2W1RA 1L2SA 5FA7A 4DRTA 2WKPA 3LY3A 4UQIM 5FI2A 1H3QA 4JXVA 3IS2B 2RCXA 3VP2A 4JXGA 4DE3A 2QMIA 3MKFA 4HESA 3W4PA 3LIEA 3VOZA 3ULFA 2EX8A 3IHAA 4B93A 4R4RA 3HREA 5HD3A 1YT4A 2FH5A 4OQGA 1YPRA 1F5MA 4R1GA 1U60A 4R23A 4O7DA 3F1PB 3OLOA 4OQIA 3QP8A 4DXBA 1NJ4A 3IQAA 2ZQ8A 4IBRA 3EQVA 3AGFA 3PR6A 3RFBA 3NCKA 1RP5A 3KSHA 4PPRA 3ZG0A 4UA7A 3LR4A 3UE6A 5FQMA 3MJQA 1H8ZA 3PYPA 5CHJA 4GCZA 1S4SA 3P09A 4DN0A 5GHYA 1FIKA 2XQZA 1IKIA 4B4XA 2A49A 2XROA 4RA7A 5EUAA 4KQRA 1KE4A 4OP8A 4B88A 4BENA 1ZHHB 4RYEA 2QJ7A 1TDGA 1IYQA 3DBAA 2JKGA 5E2GA 2HP9A 1FQGA 2P7JA 4E04A 1PIOA 2WZZA 3MS6A 4EV4A 4MBFA 1Y28A 1BLCA 4KZAA 5GLAA 1YLJA 3FG8A 3S7QA 3H82B 3IF6B 2GZAA 4C6YA 4E3IA 2PYPA 4P0MA 4CLCA 2XR0A 3NHQA 1T18A 1QMFA 1GA9A 3C2WA 4QHCA 1C3BA 2R9WA 3V5MA 4OVDA 5EVIC 4I3JA 1DP8A 3QNBA 5F68A 5EVID 4S2IA 3UPOA 3EGXC 2QJ5A 5EOEA 4GD8A 3WS0A 4HBUA 2X01A 5EV0A 1CJFA 2KLIA 3OPLA 2JC7A 4HBTA 5FAQA 1DRMA 2WKRA 4G3WA 4NKPA 1HZOA 5C5KA 1CEFA 1TEMA 4LV2A 3DWZA 3WWXA 1S1ZA 3DTEA 2V8CA 4FH4A 1SDNA 1YAXA 2B18A 3M6HA 5FQKA 1CK3A 4A5RA 1DP9A 1K57C 5KSCA 4OOLA 4WL9A 4HOIA 4GD6A 4KG2A 1PI5A 5CEBA 5M19A 1K55A 3P01A 1WE4A 4X25A 4B9OA 4R3BA 1SDEA 3MZFA 3BJNA 4EBPA 3B47A 1SZVA 2J3TC 1AXBA 2JKTI 2V0UA 3EQUA 1P9RA 4II7A 3DW0A 4X55A 2VEAA 1MKMA 3UMDA 4N9KA 3MXQA 4GKUA 5FI7A 2Y2MA 4R38A 1N4OA 3D9YA 3NDGA 1IYPA 2UV0E 5HDCA 1ERMA 4N92A 4K0XA 1BLPA 3ZG5A 4JF4A 2XD5A 4LRYC 1KDWA 4FH2A 1GSVA 1G6OA 2K31A 2PD7A 2Y2LA 1BYWA 1BT5A 1GHIA 3OOVA 4WN5A 5G4YA 1K25A 2W3DA 3UDIA 3GV9A 2EX9A 3IF6A 4OLGA 1IYSA 4NEED 1PWCA 3IT9A 1K0KA 4E3KA 1P97A 4PM8A 3ZG9B 1OTAA 3IH8A 1JTGA 1MWSA 4WLAA 3C30A 2XF3A 4D60A 4HP9A 3ZDJA 5FQ9A 3ZVTA 4L9FA 3HVFA 4E6WA 1M6KA 3D72A 2I72A 4KZ5A 3ZNYA 3ZFZA 3C38A 4FOFA 1FCOA 3A3DA 3TE8A 2WAEA 2Y2OA 3SOIA 1XFNA 3EOIA 1KE3A 2OLVA 3GMWA 2HP6A 3VOLA 4KZ6A 3KX0X 2W3HA 4JGOA 3E2KA 3LY4A 5CERA 3T1QB 1G6AA 1K4FA 5FQJA 5KSHA 1K54C 4L9EA 3T1RA 4LV3A 3LR0A 4JKTA 2ZM0A 3C4PA 1NRFA 4IVIA 2HV1A 3UPNA 2Y55A 4IHQA 5DF8A 3UB5P 4WBGA 4MN5A 5FQQA 1TS8A 2XEPA 5AQBA 3C7VA 3IXHA 2XA7M 3Q81A 1KGEA 5F69A 2ZJ9A 4Q0IA 2ZC5B 5DJTA 2ZC6B 1N9NA 3PAGA 1BZAA 2ZQDA 1PI4A 3G35A 4WZ5A 2XSSA 1FSWA 1XFQA 1DY6A 2J8YA 2G2UA 1XA7A 4ZAMA 4MCWA 3UE3A 3ITBA 3HBRA 1E25A 3OBFA 1T1CA 1J3WA 1YLZA 3IX3A 4WMCA 3IF5A 3GQZA 3O5YA 2VV6A 1ONHA 3NC8A 4WEKA 3BRMA 2Z6DA 3DTMA 3OCLA 1NYMA 2ZD8A 5FI6A 2MJ6A 4NXFA 2PDRA 3LGOA 3VP3A 2B5RA 4S2NA 4DDSA 1LHYA 3A3IA 3BFCA 1GSXA 3BQ8A 2EFXA 4ESPA 5MC7A 5FATA 1TS6A 1H8YA 1FSYA 4R70A 3FYZA 4AFIA 4NXEA 2ZC3B 3JVUA 1IKGA 5A92A 4OPYA 5KIZA 2V1ZA 3PAEA 3LIDA 2WADA 2M7VA 3NBLA 3E0YA 4KENB 2WGWA 3O86A 4RVAA 4OOYA 1P0ZA 2JKRI 4HQAA 3UB7A 3IBJA 3T4SA 4GHIA 4MN7A 5HWVA 1QMEA 4RX3A 3WRTA 4KQDA 3PXPA 2HGVA 5DF7A 1ALQA 2Y79A 3F1NB 4ZDXA 4Y15A 5F83A 1GCEA 3BYDA 2P74A 2VGLM 4WEJA 3DWKA 3OCNA 2DRWA 2Y4AA 2PBDP 1S67L 5FASA 5DTKA 2XD1A 3UPPA 1OMEA 1BTLA 5F1FA 5J4EA 5HARA 2OWHA 4FSFA 3VP4A 5EFWA 1ES2A 3WS5A 1NLYA 2JKTM 1JWVA 3S1YA 1K6SA 3HCYA 1IFQA 3VE3A 3NDEA 2X71A 5A93A 2ACGA 4DMZA 2O9AA 2ZOHA 1LL8A 3FPWA 1ZKJA 2K7SA 5E2FA 4DE1A 2HZ5A 4HNBA 5EM0A 2Y2PA 1ZG6A 1PW8A 1UGUA 4EESA 3CMZA 1TF1A 4CLCC 3P98A 1W63M 1OTIA 3SH9A 5L09A 3IWIA 4DDYA 3LUQA 4HHDA 4P6ZM 1O7EA 2ZQAA 4KUKA 1LSWA 3C4OA 4E3MA 2A24A 5L10A 1VQQA 3MMHA 4JBFA 2VGJA 3UN7A 3S7OA 3I7JA 4DJ2A 3N4IA 2Y2HA 4MEZA 4WUJA 2ZC4B 5EM1A 5FEFA 1DJAA 3SZTA 3PBQA 4PKYG 5FL3A 3LR3A 4JGRA 3H82A 2JBFA 2ZMAA 2D01A 4BMWA 3PBNA 1W79A 3V50A 1LSVA 3G34A 3G6OA 3R4KA 4PAUA 1K38A 3BFEA 3K3CA 5GL9A 5FDHA 5G18A 3ZVWA 1BLHA 1BLSA 4R3AA 3QP6A 1OTDA 1I2WA 2P04A 2PAVP 3VFHA 3SS3A 2PD8A 3IX4A 1TD5A 5HL6A 3BM6A 3L7HA 3TW8A 2C6WB 2J80A 1F2KA 1YSPA 4RQ9A 1KVLA 5AJGA 4P87A 3SH7A 2LB9A 3UE0A 5CX7A 4OONA 1EI5A 4HJ4A 4GNUA 3W4QA 2J9OA 1G5UA 3NIAA 1E3UD 2EA9A 4OP5A 1YLYA 3KSIA 4S2LA 4HJ3A 3CPTB 4X6TA 4N1XA 5IT5A 2J3WA 1JWZA 5HZHA 3VMAA 2OLUA 3WS4A 1XGJA 5J3WA 3LI8A 2A3UA 4DXCA 4IEDA 1L0FA 4L0LA 4ZJ3A 4CLCD 3NECA 4KG5A 4BBTA 1FR1A 5AQAA 3BLSA 2HF6A 1PZOA 4Q8IA 2L4RA 3BECA 4Y3IA 3AGEA 3VSKA 4I3AA 2FFYA 2PRFA 3IX8A 5EE8A 2JN7A 4X1MA 1S0WA 3Q7VB 2V2FF 2GJ3A 4PM5A 3S7NA 3T1XA 4OQHA 3A0RA 4S2PA 2OAP1 4S2OA 4BWIA 3B42A 5GLDA 1T1AA 4KQOA 4OLDA 4HP4A 5IS1A 1RCJA 3IHBA 5D3OA 2JE5A 5BOHA 4MBKA 2W0NA 4I3IA 4UA9A 1S1YA 2GDNA 3Q7VA 5CEDA 5CGWA 3GSGA 1FCNA 1MWTA 2PYRA 2HPBA 4R6LA 1KGFA 3NJAA 5J7EA 4BBUA 3HUOA 5JYPA 4ZRRA 1AWIA 2UWXA 2VJWA 4LGWA 4WMCD 2EXBA 2PR5A 4LCLA 1S6RA 5DVAA 4GDNA 1LL9A 5GHZA 5AQ9A 2BG1A 4Z9QA 4Y2FA 4PKYA 1N9OA 1MC0A 1V9YA 2WAFA 2K2NA 1VHMA 3HLBA 3CPTA 3TSGA 4Z1WA 1JVJA 3HLDA 5E43A 2O9CA 5HAIA 4ZBEA 4C75A 4GDBA 4OOMA 4KUOA 4ZJ2A 2BLSA 3QP4A 4P6ZS 2W1TA 2XRNA 2EWWA 2J7VA 3LIAA 3NOTC 2ZM2A 5EVLA 2A24B 3MR0A 3MFDA 1PWGA 5TBMA 4P6BA 2ZBBA 1S66L 3PBOA 4BJPA 3BQAA 4X53A 5GHXA 2EX2A 3FV7A 1SKOA 2Z2MB 2O99A 1PRQA 2G7UA 5EVIB 1A0KA 3MQ0A 5M1AA 2QPNA 3F1OB 1D7EA 1K4EA
chains in the Genus database with same CATH topology
2HJ9C 5DF9A 3O5YA 3H7WB 2VV6A 1KOUA 2QKPA 4WEKA 3E98A 2Z6DA 1WA9A 3OCLA 3V67A 3CI6A 3CUEA 2H28A 2GNXA 3D3OA 2MJ6A 2QHKA 2PDRA 4NXFA 3FPVA 1UWNX 2KDKA 3BW6A 5K5BA 3NOPC 3K2NA 3MF0A 4NXBA 3BY9A 3CLOA 3F1OA 4I38A 2W1RA 2WKPA 1GSXA 3BQ8A 4UQIM 2I9VA 5MC7A 1H3QA 1TS6A 3IS2B 1OJGA 3CITA 4R70A 2YKHA 3BWLA 5A8BA 3LIEA 5IU1A 3ULFA 4AFIA 4B93A 4MMNA 4NXEA 3JVUA 1NWZA 5HD3A 2KOIA 2FH5A 4F3LA 2R78A 2VGLS 3EWKA 1ODVA 1T19A 3CAXA 5KIZA 1F5MA 4YNRA 3W2ZA 4LPZA 3LIDA 3KSFA 2M7VA 3E0YA 3F1PB 3OLOA 1P0ZA 2JKRI 4HQAA 3UB7A 3UB6A 3IBJA 3T4SA 2WKQA 3EQVA 4GHIA 4MN7A 3HJIA 3PR6A 5HWVA 4HY8A 3RFBA 1DP6A 3T4KA 4EERA 4HIAA 3T4TA 3MFXA 3KSHA 4KQDA 3PXPA 2HGVA 4CLCB 1H8MA 4G3KA 2Y79A 3IBRA 3F1NB 2ZMVA 3LR4A 3UE6A 4JGPA 4CLCE 2FZ0A 3MJQA 3ZYTA 1OT6A 2VGLM 3PYPA 4WEJA 3OCNA 4GCZA 1S4SA 4LLOB 4DN0A 1S67L 3R7WB 4IUHA 2XROA 2W3GA 1UWPX 5J4EA 1OJ5A 2OWHA 3MQQA 2DMWA 4FSFA 4NXGA 5DFYA 2LB5A 3KYZA 4G3VA 5EFWA 3JVVA 2ZOIA 4LRXC 1LT0A 5F6AA 1ZHHB 3VE4A 4O8GA 1IOUA 2QJ7A 5HD5A 3DBAA 4GW9A 1NLYA 2JKTM 3LIBA 3EEHA 1N9LA 1F98A 1X0OA 2P7JA 3HCYA 5AVFA 2OAQ1 1IFQA 4E04A 3CUEC 3VE3A 4EQ1A 3PBTA 4DMZA 2D02A 3RTYA 2O9AA 1Y28A 2ZOHA 1LL8A 2VV8A 3FPWA 2PT7A 2A2LA 4EUVA 4EETB 1YSQA 2K7SA 3FG8A 4GHIB 3S7QA 3H82B 2GZAA 4HNBA 4UQIS 3RH8B 5TBMB 3F1NA 2PYPA 1TS7A 1STZA 4CLCA 4EU0A 2HJEA 2BASA 1UGUA 4QPRA 3NHQA 4EESA 1TF1A 1T18A 2W1TB 4CLCC 5HSQA 2VA0A 1XJ2A 3KYQA 1W63M 1OTIA 1EW0A 1XJ3A 3C2WA 3LUQA 4HHDA 2XA7S 3A0VA 4P6ZM 4KUKA 3FC7A 3H9WA 1LSWA 4I3JA 1W63Q 1DP8A 1NRJA 2A24A 1VB6A 5F68A 3F1PA 3MMHA 3LFVA 3S7OA 4DJ2A 4GS9A 3IS2A 3EGXC 3E4QA 2L1MA 4YOFA 4WUJA 2QJ5A 3T50A 3PBQA 4PKYG 2M1CA 3PBSA 5AVEA 5FL3A 2W3FA 2O9BA 2KLIA 3LR3A 4JGRA 2ZMFA 3H82A 1DRMA 2WKRA 4G3WA 4NKPA 2OWJA 5C5KA 2D01A 4BMWA 3PBNA 2W3EA 1S1ZA 3TRCA 4O01A 2V1AA 5HDDA 1LSVA 3SW1A 3U2AA 5HWTA 3LYXA 5LBRA 3T4JA 1YAXA 3G6OA 3R4KA 4PAUA 2B18A 4DJ3A 3K3CA 1DP9A 3B33A 3E4OA 2CMNA 4R3AA 3S7PA 4L9GA 4OOLA 4Q0JA 4WL9A 4CQHA 4HOIA 1TS0A 1OTDA 2VV7A 2P04A 2KX6A 2PD8A 4XT2B 1TD5A 3P01A 5HL6A 2QWSA 3GDIA 3UB8A 5HWWA 4B9OA 3TW8A 5F5YA 2J80A 2Z6CA 3BJNA 1YSPA 4RQ9A 3B47A 5AJGA 2YKFA 2J3TC 2JKTI 2LB9A 2V0UA 2Y8HA 3EQUA 4HJ6A 3R7WA 2J3TD 1P9RA 4GJ4A 4II7A 5CX7A 2VEAA 3TJZC 4ARZA 1MKMA 4HJ4A 4EW7A 3A0SA 3UMDA 5TJJA 3MXQA 4ME4A 2EA9A 3KSIA 4HJ3A 4R38A 1F9IA 4I5SA 4GS9B 5IT5A 4I39A 2J3WA 5HZHA 4BBVA 5J3WA 2M7UA 3LI8A 2JKRM 3HJKA 3CWFA 4L0LA 5HDCA 1OT9A 3GECA 4CLCD 2QYBA 4WF0A 4BBTA 4EEPA 3C8CA 5HPIA 2PR6A 4LRYC 2HF6A 2INWA 2L4RA 4MN6A 4Y3IA 1GSVA 1G6OA 2K31A 2PD7A 3E4PA 1BYWA 4I3AA 4EXOA 3T4LA 3OOVA 3LI9A 4WN5A 5G4YA 2W3DA 2JN7A 4M4XA 2VLGA 4NEED 1S4RA 3LIFA 5L8MA 2GJ3A 3S7NA 2V9AA 3A0RA 2OAP1 4LRZE 1P97A 1P9WA 4BWIA 3B42A 1ZTUA 2VKSA 1OTAA 2IA2A 5HDSA 1T1AA 4JGQA 4KQOA 1T1BA 4WLAA 4H6JA 3EGDC 3C30A 3PBRA 1OPXA 4HP9A 4ARZB 4HP4A 3ICYA 5IS1A 2P08A 2W27A 4L9FA 2W0NA 5I5LA 4I3IA 3D72A 2V0WA 1LSXA 1S1YA 4Y5FA 4EEUA 3C38A 4FOFA 1G28A 5DFXA 4H6JB 3LR5A 1OTEA 3TE8A 1YKDA 3VV4A 1XFNA 3EOIA 1XJ6A 2PYRA 4R6LA 4WELA 3OC2A 3VOLA 3NJAA 5J7EA 4BBUA 3KX0X 4IUKA 4HI4A 5DKKA 2W3HA 4ZRRA 4JGOA 2VJWA 5HPFA 1MZUA 2PR5A 2PHYA 4HH3A 3MQOA 1JNUA 5DKLA 3P7NA 3T4QA 4Q0HA 5KSHA 1GSWA 4Y2FA 4PKYA 4L9EA 1N9OA 4IJGA 1MC0A 1V9YA 3ZQ5A 4PHTA 2JHEA 2K2NA 1VHMA 3LR0A 2NUPC 3NOUC 2OOLA 4HH2A 4Z1WA 1V9ZA 3PHYA 2O9CA 2HV1A 3KO6A 2O0YA 2B02A 4IHQA 5DJUA 3KSGA 4MN5A 2V1BA 2NUTC 4KUOA 4OOMA 1TS8A 2EWVA 2VX8A 1OTBA 4MDZA 4P6ZS 2XA7M 2W1TA 3BY8A 2XRNA 2EWWA 3LIAA 3NOTC 2VZWA 5F69A 4F3LB 4Q0IA 1XJ4A 3UMEA 5DJTA 1D06A 1N9NA 2GX5A 5G4ZA 2A24B 3MR0A 4XT2A 3LICA 4K08A 2ZBBA 4O0PA 5TBMA 3T4OA 4ETZA 1S66L 3PBOA 3EEAA 3BQAA 4BJPA 4UEYA 2XSSA 3K3DA 2L0WA 1XFQA 2O99A 2G7UA 3MQ0A 4YWZA 3H7WA 4GLQA 4MCWA 4ETXA 3UE3A 1NLZA 3OBFA 1T1CA 3F1OB 1D7EA 3UB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW6 A;  2NUT C;  3KYQ A;  3EGX C;  2NUP C;  1IFQ A;  4AFI A;  1IOU A;  1H8M A;  3EGD C;  2DMW A;  2VX8 A;  4B93 A; 
#chains in the Genus database with same CATH topology
 3H7W B;  2QKP A;  3DTK A;  1HD8 A;  2WZX A;  3G2Y A;  3V67 A;  3CI6 A;  3CUE A;  2H28 A;  4LV0 A;  3D4F A;  3D3O A;  2QHK A;  1KDS A;  3FPV A;  5K5B A;  3NOP C;  4BD1 A;  2WGV A;  1TVF A;  3BY9 A;  4K0W A;  4I38 A;  2P9V A;  4R3J A;  2Y59 A;  1OJG A;  2HP5 A;  1XX2 A;  3BWL A;  3VSL A;  5A8B A;  4YIN A;  3QP2 A;  4MMN A;  4EUZ A;  1NWZ A;  2KOI A;  1MBL A;  4F3L A;  2XFS A;  2R78 A;  2VGL S;  3EWK A;  1ODV A;  3CAX A;  5CXW A;  4LV1 A;  4YNR A;  2XLN A;  1PNE A;  5CGS A;  1Z09 A;  2PBY A;  4E3O A;  2J9P A;  2E8J A;  5FEG A;  5U47 A;  5HL1 A;  3UB6 A;  2WKQ A;  2X02 A;  3OPR A;  1ONG A;  2ZC7 A;  3T4K A;  4EER A;  5HAP A;  3T4T A;  4EWF A;  4KZ4 A;  4G3K A;  4CLC E;  5FAP A;  3ZYT A;  3LCE A;  1OT6 A;  4IBX A;  1H0M A;  4LLO B;  1XGI A;  2HDQ A;  3M6B A;  3R7W B;  4QD4 A;  4IUH A;  3HLE A;  1K56 A;  3ITA A;  4Y0U A;  2LB5 A;  1M40 A;  2IWC A;  5AQ7 A;  3ZNT A;  2ZOI A;  1N9B A;  4LRX C;  2V8F A;  5F6A A;  3VE4 A;  3FKV A;  3VOY A;  3A3J A;  3G4P A;  1IOU A;  4PM6 A;  5HD5 A;  4BL2 A;  1CI8 A;  3M2J A;  3EEH A;  2IWB A;  3HLC A;  2OAQ 1;  4U0T A;  3CUE C;  3QNC A;  3BLM A;  1VET B;  1MY8 A;  4KZ7 A;  3GTC A;  2VK3 A;  5EVI A;  2VV8 A;  5GLC A;  1SKO B;  2A2L A;  3OZH A;  4GHI B;  2EXA A;  4JXW A;  4UQI S;  5CTN A;  3RH8 B;  5TBM B;  5KZH A;  3IH9 A;  3F1N A;  1RGZ A;  2WGW B;  2HDU A;  4EU0 A;  2BAS A;  2V20 A;  2W1T B;  3ISG A;  2VA0 A;  1Q2P A;  5F1G A;  2ZLY A;  1XJ3 A;  2XA7 S;  3A0V A;  4UA6 A;  4GZB A;  1NXY A;  1W63 Q;  1NRJ A;  2WKE A;  1K6R A;  1PFL A;  3BFF A;  4GS9 A;  2BTF P;  3E4Q A;  1XA1 A;  2L1M A;  1BUL A;  3VFF A;  4OPR A;  1ERQ A;  2M1C A;  3PBS A;  3RXW A;  2O9B A;  3RJU A;  2WUQ A;  3IWQ A;  4XUZ A;  3S4X A;  1ZC2 A;  3CHW P;  4KZ3 A;  4EBL A;  3JYI A;  1L3L A;  3MXR A;  4O01 A;  3WRZ A;  2V1A A;  4UHU A;  3SW1 A;  3LYX A;  5LBR A;  3T4J A;  4KG6 A;  5J8X A;  4DKI A;  4DJ3 A;  3B33 A;  3E4O A;  1KE0 A;  1YMX A;  2QZ6 A;  4GOG A;  4CQH A;  3A3E A;  2JKF A;  2WKH A;  5A90 A;  3N8S A;  2QWS A;  2Z6C A;  3RXX A;  4EQI A;  3UO9 A;  2YKF A;  3HLF A;  4X68 A;  4HJ6 A;  2J3T D;  3V3R A;  2CC1 A;  3A0S A;  5TJJ A;  1FCM A;  4ME4 A;  5EPH A;  3UNW A;  5I94 A;  1J9M A;  4GS9 B;  1K55 C;  3QP5 A;  2JKR M;  3HJK A;  1LI9 A;  1OT9 A;  3GEC A;  4WF0 A;  2H5S A;  5HPI A;  2PR6 A;  1CI9 A;  5KMW A;  4OQ0 A;  1YM1 A;  5HX9 A;  4X69 A;  3E4P A;  1LLB A;  4X1L A;  4M4X A;  4QJG A;  3FKW A;  1S4R A;  4OPZ A;  5L8M A;  2V9A A;  2XK1 A;  4LRZ E;  4Y17 A;  3Q7Z A;  1ZTU A;  2VKS A;  3N8L A;  2IA2 A;  4KZ9 A;  2ZM8 A;  3ZGA B;  5HAQ A;  1T1B A;  5CRF A;  3EGD C;  3PBR A;  1XP4 A;  1OPX A;  2P08 A;  2W27 A;  2EFU A;  5EVE A;  5I5L A;  5CHM A;  1FR6 A;  2EX6 A;  2C5W B;  1K54 A;  4Y5F A;  3ZCZ A;  1G28 A;  1OTE A;  1L0E A;  1YKD A;  4NET A;  1XJ6 A;  1XPB A;  1ERO A;  4WEL A;  1G68 A;  4BLM A;  1VEU A;  1H5X A;  2XGN A;  5L07 A;  1MPL A;  2R9X A;  3BFD A;  4IUK A;  5DKK A;  4LFU A;  4E3N A;  4FD8 A;  4HH3 A;  1JNU A;  3P7N A;  3ZQ5 A;  2NUP C;  3NOU C;  2OOL A;  4HH2 A;  1V9Z A;  4D2O A;  3KO6 A;  4QWO A;  2O0Y A;  2B02 A;  5CTM A;  1ES3 A;  1YMS A;  4FUW A;  2NUT C;  1VM1 A;  3B3X A;  4MDZ A;  2Q9M A;  4S2K A;  4JF5 A;  3BY8 A;  4F3L B;  4Y0O A;  3V3S A;  4FTX A;  4U3T A;  1XJ4 A;  3UME A;  1D06 A;  5G4Z A;  1FOF A;  2Y2J A;  1CEG A;  3V39 A;  3LIC A;  4O0P A;  2RL3 A;  3T4O A;  4ETZ A;  3EEA A;  1W7F A;  3MZD A;  3K3D A;  2L0W A;  2WKI A;  4WYY A;  1XKZ A;  3UDF A;  4R0Q A;  4YWZ A;  1WYC A;  4GLQ A;  4ETX A;  3O3V A;  3MBZ A;  4GB7 A;  1NLZ A;  1ACF A;  3U4L P;  2IWD A;  3ZG8 B;  5EOO A;  2WK0 A;  5IHV A;  2HJ9 C;  5DF9 A;  4QU3 A;  3GVB A;  1KOU A;  3E98 A;  3IWO A;  1WA9 A;  1BUE A;  4E3L A;  3E2L A;  1VEU B;  3FZC A;  2GNX A;  5TR7 A;  5CEC A;  3MF0 A;  3CLO A;  3T12 B;  3F1O A;  5DTS A;  2I9V A;  4WM9 A;  5JYO A;  2JCH A;  3CIT A;  4CPK A;  3W4O A;  1NY0 A;  2YKH A;  5FAO A;  3NUL A;  1JTD A;  5IU1 A;  2XDM A;  2DCF A;  5E2H A;  5GLB A;  1T19 A;  1L0G A;  3W2Z A;  1I2S A;  4LPZ A;  3KSF A;  3DAV A;  1IYO A;  3HUM A;  5A91 A;  1LL5 A;  4GN2 A;  4UAA A;  5E2E A;  3HJI A;  3IXB A;  4HY8 A;  1DP6 A;  4HIA A;  1W5D A;  2Y2I A;  3MFX A;  3G31 A;  5F82 A;  1DJB A;  4CLC B;  1H8M A;  3PTE A;  3IBR A;  1TDL A;  2ZMV A;  4PM7 A;  4JGP A;  5TGF A;  2G2W A;  2FZ0 A;  4YFM A;  3HUN A;  2OV5 A;  4KZB A;  3DTI A;  2W3G A;  1UWP X;  1OJ5 A;  3MQQ A;  2DMW A;  3MKE A;  4NXG A;  5DFY A;  4E6X A;  3KYZ A;  4G3V A;  3JVV A;  1LT0 A;  4O8G A;  4N9L A;  4LEN A;  4GW9 A;  1K56 D;  4JXS A;  3LIB A;  1N9L A;  3GR2 A;  1F98 A;  1X0O A;  3S22 A;  1KVM A;  3G2Z A;  3G32 A;  5AVF A;  4EQ1 A;  3PBT A;  3MXS A;  1ESU A;  1HLU P;  4EBN A;  4XUX A;  2D02 A;  4ID4 A;  3RTY A;  1MWR A;  4MNR A;  2PU4 A;  4NK3 A;  2PT7 A;  4EUV A;  4EET B;  3N7W A;  1YSQ A;  1K57 A;  1RGY A;  1Y54 A;  1W8Q A;  1I5Q A;  4B4Z A;  1TS7 A;  1STZ A;  2HJE A;  3BEB A;  4QPR A;  3Q82 A;  5HW3 A;  5HSQ A;  1XJ2 A;  2XH9 A;  5L2F A;  3KYQ A;  3LEQ A;  1EW0 A;  4LCM A;  3FC7 A;  3H9W A;  1YQS A;  5EEC A;  1WYB A;  1VB6 A;  1SCW A;  4BD0 A;  3F1P A;  3LFV A;  1DJC A;  3CJM A;  5FQI A;  1E3U A;  3IS2 A;  4QB8 A;  4YOF A;  1NZO A;  4ZJ1 A;  1O07 A;  3KYE A;  3T50 A;  5CGX A;  4PMA A;  5AVE A;  2W3F A;  4K91 A;  2ZMF A;  2OWJ A;  4Y7P A;  1CQA A;  4Y0T A;  3T1S A;  2XFT A;  2W3E A;  4QY6 A;  1HVB A;  4XXR A;  3NI9 A;  3TRC A;  5HDD A;  2ZQC A;  3U2A A;  3L9K A;  5HWT A;  1Y4O A;  2H0Y A;  4F94 A;  1VET A;  1IEM A;  3Q1F A;  2CMN A;  1MXO A;  3C7U A;  1Z6F A;  3AGD A;  3S7P A;  4L9G A;  1W8Y A;  4Q0J A;  4WZ4 A;  1TS0 A;  3IF6 C;  2VV7 A;  2KX6 A;  4NG2 A;  2HDS A;  3N6I A;  2H10 A;  1LI0 A;  2AVX A;  2FFF B;  4XT2 B;  1XXM A;  3GDI A;  3UB8 A;  5F5Y A;  3WS1 A;  4C3Q A;  4S2J A;  2H0T A;  2Y8H A;  3R7W A;  1E4D A;  4GJ4 A;  2Y2G A;  1ZG4 A;  3TJZ C;  4ARZ A;  1PW1 A;  3JPU A;  4EW7 A;  4JLF A;  2Q9N A;  1F9I A;  4I5S A;  2ZQ7 A;  3A3F A;  4KZ8 A;  4I39 A;  1HTZ A;  2PU2 A;  4BBV A;  2ZQ9 A;  2M7U A;  3UY6 A;  3HL9 A;  3CWF A;  3CZD A;  4U0X A;  2QYB A;  3N8R A;  4BL3 A;  4EEP A;  3C8C A;  3O88 A;  1YLT A;  1CF0 A;  2INW A;  4MN6 A;  4P85 A;  4JF6 A;  3CG5 A;  3IXG A;  4EXO A;  1PWD A;  1PYY A;  3MSH A;  3T4L A;  3LI9 A;  1SKF A;  4R4S A;  3NY4 A;  1MWU A;  3FWL A;  1SHV A;  2VLG A;  4BQM A;  3LIF A;  5M18 A;  3HLG A;  1YLW A;  4DE2 A;  4IVK A;  2WYX A;  2WGI A;  4S2M A;  1NZU A;  1P9W A;  3IXD A;  4Y13 A;  3O87 A;  4FCF A;  5HDS A;  2E8I A;  3ZG7 B;  4JGQ A;  2ZL1 B;  3SS4 A;  4H6J A;  2ZL1 A;  4ARZ B;  1GHP A;  1MKI A;  3ICY A;  3SH8 A;  1ES5 A;  3UDX A;  2V0W A;  1LSX A;  4MLL A;  4M3K A;  4EEU A;  4MBH A;  5HFO A;  4WZ5 C;  4H6J B;  3LR5 A;  5DFX A;  4ZTK A;  3VV4 A;  4OH0 A;  1L0D A;  3OC2 A;  4QY5 A;  4OKP A;  4HI4 A;  5CHU A;  4JPM A;  1FIL A;  5HPF A;  1MZU A;  3UE1 A;  2PHY A;  2Y2K A;  1EWZ A;  3MQO A;  3TOI A;  2Y91 A;  3GRJ A;  1Q2Q A;  5DKL A;  4HEF A;  3T4Q A;  2VGK A;  3LO7 A;  4Q0H A;  1GSW A;  1KGG A;  4N1H A;  4IJG A;  4S2N C;  3Q07 A;  1PZP A;  4PHT A;  2JHE A;  4DE0 A;  5FDS A;  4H8R A;  2Y2Q A;  3SS5 A;  4X56 A;  3PHY A;  3WS2 A;  2B95 A;  1D1J A;  2Y2N A;  5DTT A;  3HLW A;  5DJU A;  3KSG A;  2V1B A;  5FSR A;  2EWV A;  3M2K A;  2VX8 A;  4DF6 A;  1OTB A;  3OPP A;  5TFQ A;  3MZE A;  2P9V B;  3G30 A;  2VZW A;  3VP1 A;  3ZHH A;  2DNS A;  2GX5 A;  4XT2 A;  3C5A A;  4K08 A;  5HWW A;  4UEY A;  3BFG A;  3OPH A;  1GHM A;  1IEL A;  4OPQ A;  4RX2 A;  2Z2L B;  3H7W A;  1JWP A;  4KQQ A;  2OSU A;  1ESI A;  3UB9 A;  3QP1 A;  3TG9 A;  4CJN A;  3LEZ A;  2Q0O A;  4E3J A;  3VP0 A;  1NYY A;  3QHY A;  1GA0 A;  2HDR A;  4PM9 A;  1YLP A;  1UWN X;  2KDK A;  3BW6 A;  3K2N A;  3W8K A;  4NXB A;  1BSG A;  1ES4 A;  2W1R A;  1L2S A;  5FA7 A;  4DRT A;  2WKP A;  3LY3 A;  4UQI M;  5FI2 A;  1H3Q A;  4JXV A;  3IS2 B;  2RCX A;  3VP2 A;  4JXG A;  4DE3 A;  2QMI A;  3MKF A;  4HES A;  3W4P A;  3LIE A;  3VOZ A;  3ULF A;  2EX8 A;  3IHA A;  4B93 A;  4R4R A;  3HRE A;  5HD3 A;  1YT4 A;  2FH5 A;  4OQG A;  1YPR A;  1F5M A;  4R1G A;  1U60 A;  4R23 A;  4O7D A;  3F1P B;  3OLO A;  4OQI A;  3QP8 A;  4DXB A;  1NJ4 A;  3IQA A;  2ZQ8 A;  4IBR A;  3EQV A;  3AGF A;  3PR6 A;  3RFB A;  3NCK A;  1RP5 A;  3KSH A;  4PPR A;  3ZG0 A;  4UA7 A;  3LR4 A;  3UE6 A;  5FQM A;  3MJQ A;  1H8Z A;  3PYP A;  5CHJ A;  4GCZ A;  1S4S A;  3P09 A;  4DN0 A;  5GHY A;  1FIK A;  2XQZ A;  1IKI A;  4B4X A;  2A49 A;  2XRO A;  4RA7 A;  5EUA A;  4KQR A;  1KE4 A;  4OP8 A;  4B88 A;  4BEN A;  1ZHH B;  4RYE A;  2QJ7 A;  1TDG A;  1IYQ A;  3DBA A;  2JKG A;  5E2G A;  2HP9 A;  1FQG A;  2P7J A;  4E04 A;  1PIO A;  2WZZ A;  3MS6 A;  4EV4 A;  4MBF A;  1Y28 A;  1BLC A;  4KZA A;  5GLA A;  1YLJ A;  3FG8 A;  3S7Q A;  3H82 B;  3IF6 B;  2GZA A;  4C6Y A;  4E3I A;  2PYP A;  4P0M A;  4CLC A;  2XR0 A;  3NHQ A;  1T18 A;  1QMF A;  1GA9 A;  3C2W A;  4QHC A;  1C3B A;  2R9W A;  3V5M A;  4OVD A;  5EVI C;  4I3J A;  1DP8 A;  3QNB A;  5F68 A;  5EVI D;  4S2I A;  3UPO A;  3EGX C;  2QJ5 A;  5EOE A;  4GD8 A;  3WS0 A;  4HBU A;  2X01 A;  5EV0 A;  1CJF A;  2KLI A;  3OPL A;  2JC7 A;  4HBT A;  5FAQ A;  1DRM A;  2WKR A;  4G3W A;  4NKP A;  1HZO A;  5C5K A;  1CEF A;  1TEM A;  4LV2 A;  3DWZ A;  3WWX A;  1S1Z A;  3DTE A;  2V8C A;  4FH4 A;  1SDN A;  1YAX A;  2B18 A;  3M6H A;  5FQK A;  1CK3 A;  4A5R A;  1DP9 A;  1K57 C;  5KSC A;  4OOL A;  4WL9 A;  4HOI A;  4GD6 A;  4KG2 A;  1PI5 A;  5CEB A;  5M19 A;  1K55 A;  3P01 A;  1WE4 A;  4X25 A;  4B9O A;  4R3B A;  1SDE A;  3MZF A;  3BJN A;  4EBP A;  3B47 A;  1SZV A;  2J3T C;  1AXB A;  2JKT I;  2V0U A;  3EQU A;  1P9R A;  4II7 A;  3DW0 A;  4X55 A;  2VEA A;  1MKM A;  3UMD A;  4N9K A;  3MXQ A;  4GKU A;  5FI7 A;  2Y2M A;  4R38 A;  1N4O A;  3D9Y A;  3NDG A;  1IYP A;  2UV0 E;  5HDC A;  1ERM A;  4N92 A;  4K0X A;  1BLP A;  3ZG5 A;  4JF4 A;  2XD5 A;  4LRY C;  1KDW A;  4FH2 A;  1GSV A;  1G6O A;  2K31 A;  2PD7 A;  2Y2L A;  1BYW A;  1BT5 A;  1GHI A;  3OOV A;  4WN5 A;  5G4Y A;  1K25 A;  2W3D A;  3UDI A;  3GV9 A;  2EX9 A;  3IF6 A;  4OLG A;  1IYS A;  4NEE D;  1PWC A;  3IT9 A;  1K0K A;  4E3K A;  1P97 A;  4PM8 A;  3ZG9 B;  1OTA A;  3IH8 A;  1JTG A;  1MWS A;  4WLA A;  3C30 A;  2XF3 A;  4D60 A;  4HP9 A;  3ZDJ A;  5FQ9 A;  3ZVT A;  4L9F A;  3HVF A;  4E6W A;  1M6K A;  3D72 A;  2I72 A;  4KZ5 A;  3ZNY A;  3ZFZ A;  3C38 A;  4FOF A;  1FCO A;  3A3D A;  3TE8 A;  2WAE A;  2Y2O A;  3SOI A;  1XFN A;  3EOI A;  1KE3 A;  2OLV A;  3GMW A;  2HP6 A;  3VOL A;  4KZ6 A;  3KX0 X;  2W3H A;  4JGO A;  3E2K A;  3LY4 A;  5CER A;  3T1Q B;  1G6A A;  1K4F A;  5FQJ A;  5KSH A;  1K54 C;  4L9E A;  3T1R A;  4LV3 A;  3LR0 A;  4JKT A;  2ZM0 A;  3C4P A;  1NRF A;  4IVI A;  2HV1 A;  3UPN A;  2Y55 A;  4IHQ A;  5DF8 A;  3UB5 P;  4WBG A;  4MN5 A;  5FQQ A;  1TS8 A;  2XEP A;  5AQB A;  3C7V A;  3IXH A;  2XA7 M;  3Q81 A;  1KGE A;  5F69 A;  2ZJ9 A;  4Q0I A;  2ZC5 B;  5DJT A;  2ZC6 B;  1N9N A;  3PAG A;  1BZA A;  2ZQD A;  1PI4 A;  3G35 A;  4WZ5 A;  2XSS A;  1FSW A;  1XFQ A;  1DY6 A;  2J8Y A;  2G2U A;  1XA7 A;  4ZAM A;  4MCW A;  3UE3 A;  3ITB A;  3HBR A;  1E25 A;  3OBF A;  1T1C A;  1J3W A;  1YLZ A;  3IX3 A;  4WMC A;  3IF5 A;  3GQZ A;  3O5Y A;  2VV6 A;  1ONH A;  3NC8 A;  4WEK A;  3BRM A;  2Z6D A;  3DTM A;  3OCL A;  1NYM A;  2ZD8 A;  5FI6 A;  2MJ6 A;  4NXF A;  2PDR A;  3LGO A;  3VP3 A;  2B5R A;  4S2N A;  4DDS A;  1LHY A;  3A3I A;  3BFC A;  1GSX A;  3BQ8 A;  2EFX A;  4ESP A;  5MC7 A;  5FAT A;  1TS6 A;  1H8Y A;  1FSY A;  4R70 A;  3FYZ A;  4AFI A;  4NXE A;  2ZC3 B;  3JVU A;  1IKG A;  5A92 A;  4OPY A;  5KIZ A;  2V1Z A;  3PAE A;  3LID A;  2WAD A;  2M7V A;  3NBL A;  3E0Y A;  4KEN B;  2WGW A;  3O86 A;  4RVA A;  4OOY A;  1P0Z A;  2JKR I;  4HQA A;  3UB7 A;  3IBJ A;  3T4S A;  4GHI A;  4MN7 A;  5HWV A;  1QME A;  4RX3 A;  3WRT A;  4KQD A;  3PXP A;  2HGV A;  5DF7 A;  1ALQ A;  2Y79 A;  3F1N B;  4ZDX A;  4Y15 A;  5F83 A;  1GCE A;  3BYD A;  2P74 A;  2VGL M;  4WEJ A;  3DWK A;  3OCN A;  2DRW A;  2Y4A A;  2PBD P;  1S67 L;  5FAS A;  5DTK A;  2XD1 A;  3UPP A;  1OME A;  1BTL A;  5F1F A;  5J4E A;  5HAR A;  2OWH A;  4FSF A;  3VP4 A;  5EFW A;  1ES2 A;  3WS5 A;  1NLY A;  2JKT M;  1JWV A;  3S1Y A;  1K6S A;  3HCY A;  1IFQ A;  3VE3 A;  3NDE A;  2X71 A;  5A93 A;  2ACG A;  4DMZ A;  2O9A A;  2ZOH A;  1LL8 A;  3FPW A;  1ZKJ A;  2K7S A;  5E2F A;  4DE1 A;  2HZ5 A;  4HNB A;  5EM0 A;  2Y2P A;  1ZG6 A;  1PW8 A;  1UGU A;  4EES A;  3CMZ A;  1TF1 A;  4CLC C;  3P98 A;  1W63 M;  1OTI A;  3SH9 A;  5L09 A;  3IWI A;  4DDY A;  3LUQ A;  4HHD A;  4P6Z M;  1O7E A;  2ZQA A;  4KUK A;  1LSW A;  3C4O A;  4E3M A;  2A24 A;  5L10 A;  1VQQ A;  3MMH A;  4JBF A;  2VGJ A;  3UN7 A;  3S7O A;  3I7J A;  4DJ2 A;  3N4I A;  2Y2H A;  4MEZ A;  4WUJ A;  2ZC4 B;  5EM1 A;  5FEF A;  1DJA A;  3SZT A;  3PBQ A;  4PKY G;  5FL3 A;  3LR3 A;  4JGR A;  3H82 A;  2JBF A;  2ZMA A;  2D01 A;  4BMW A;  3PBN A;  1W79 A;  3V50 A;  1LSV A;  3G34 A;  3G6O A;  3R4K A;  4PAU A;  1K38 A;  3BFE A;  3K3C A;  5GL9 A;  5FDH A;  5G18 A;  3ZVW A;  1BLH A;  1BLS A;  4R3A A;  3QP6 A;  1OTD A;  1I2W A;  2P04 A;  2PAV P;  3VFH A;  3SS3 A;  2PD8 A;  3IX4 A;  1TD5 A;  5HL6 A;  3BM6 A;  3L7H A;  3TW8 A;  2C6W B;  2J80 A;  1F2K A;  1YSP A;  4RQ9 A;  1KVL A;  5AJG A;  4P87 A;  3SH7 A;  2LB9 A;  3UE0 A;  5CX7 A;  4OON A;  1EI5 A;  4HJ4 A;  4GNU A;  3W4Q A;  2J9O A;  1G5U A;  3NIA A;  1E3U D;  2EA9 A;  4OP5 A;  1YLY A;  3KSI A;  4S2L A;  4HJ3 A;  3CPT B;  4X6T A;  4N1X A;  5IT5 A;  2J3W A;  1JWZ A;  5HZH A;  3VMA A;  2OLU A;  3WS4 A;  1XGJ A;  5J3W A;  3LI8 A;  2A3U A;  4DXC A;  4IED A;  1L0F A;  4L0L A;  4ZJ3 A;  4CLC D;  3NEC A;  4KG5 A;  4BBT A;  1FR1 A;  5AQA A;  3BLS A;  2HF6 A;  1PZO A;  4Q8I A;  2L4R A;  3BEC A;  4Y3I A;  3AGE A;  3VSK A;  4I3A A;  2FFY A;  2PRF A;  3IX8 A;  5EE8 A;  2JN7 A;  4X1M A;  1S0W A;  3Q7V B;  2V2F F;  2GJ3 A;  4PM5 A;  3S7N A;  3T1X A;  4OQH A;  3A0R A;  4S2P A;  2OAP 1;  4S2O A;  4BWI A;  3B42 A;  5GLD A;  1T1A A;  4KQO A;  4OLD A;  4HP4 A;  5IS1 A;  1RCJ A;  3IHB A;  5D3O A;  2JE5 A;  5BOH A;  4MBK A;  2W0N A;  4I3I A;  4UA9 A;  1S1Y A;  2GDN A;  3Q7V A;  5CED A;  5CGW A;  3GSG A;  1FCN A;  1MWT A;  2PYR A;  2HPB A;  4R6L A;  1KGF A;  3NJA A;  5J7E A;  4BBU A;  3HUO A;  5JYP A;  4ZRR A;  1AWI A;  2UWX A;  2VJW A;  4LGW A;  4WMC D;  2EXB A;  2PR5 A;  4LCL A;  1S6R A;  5DVA A;  4GDN A;  1LL9 A;  5GHZ A;  5AQ9 A;  2BG1 A;  4Z9Q A;  4Y2F A;  4PKY A;  1N9O A;  1MC0 A;  1V9Y A;  2WAF A;  2K2N A;  1VHM A;  3HLB A;  3CPT A;  3TSG A;  4Z1W A;  1JVJ A;  3HLD A;  5E43 A;  2O9C A;  5HAI A;  4ZBE A;  4C75 A;  4GDB A;  4OOM A;  4KUO A;  4ZJ2 A;  2BLS A;  3QP4 A;  4P6Z S;  2W1T A;  2XRN A;  2EWW A;  2J7V A;  3LIA A;  3NOT C;  2ZM2 A;  5EVL A;  2A24 B;  3MR0 A;  3MFD A;  1PWG A;  5TBM A;  4P6B A;  2ZBB A;  1S66 L;  3PBO A;  4BJP A;  3BQA A;  4X53 A;  5GHX A;  2EX2 A;  3FV7 A;  1SKO A;  2Z2M B;  2O99 A;  1PRQ A;  2G7U A;  5EVI B;  1A0K A;  3MQ0 A;  5M1A A;  2QPN A;  3F1O B;  1D7E A;  1K4E A; 
#chains in the Genus database with same CATH homology
 2HJ9 C;  5DF9 A;  3O5Y A;  3H7W B;  2VV6 A;  1KOU A;  2QKP A;  4WEK A;  3E98 A;  2Z6D A;  1WA9 A;  3OCL A;  3V67 A;  3CI6 A;  3CUE A;  2H28 A;  2GNX A;  3D3O A;  2MJ6 A;  2QHK A;  2PDR A;  4NXF A;  3FPV A;  1UWN X;  2KDK A;  3BW6 A;  5K5B A;  3NOP C;  3K2N A;  3MF0 A;  4NXB A;  3BY9 A;  3CLO A;  3F1O A;  4I38 A;  2W1R A;  2WKP A;  1GSX A;  3BQ8 A;  4UQI M;  2I9V A;  5MC7 A;  1H3Q A;  1TS6 A;  3IS2 B;  1OJG A;  3CIT A;  4R70 A;  2YKH A;  3BWL A;  5A8B A;  3LIE A;  5IU1 A;  3ULF A;  4AFI A;  4B93 A;  4MMN A;  4NXE A;  3JVU A;  1NWZ A;  5HD3 A;  2KOI A;  2FH5 A;  4F3L A;  2R78 A;  2VGL S;  3EWK A;  1ODV A;  1T19 A;  3CAX A;  5KIZ A;  1F5M A;  4YNR A;  3W2Z A;  4LPZ A;  3LID A;  3KSF A;  2M7V A;  3E0Y A;  3F1P B;  3OLO A;  1P0Z A;  2JKR I;  4HQA A;  3UB7 A;  3UB6 A;  3IBJ A;  3T4S A;  2WKQ A;  3EQV A;  4GHI A;  4MN7 A;  3HJI A;  3PR6 A;  5HWV A;  4HY8 A;  3RFB A;  1DP6 A;  3T4K A;  4EER A;  4HIA A;  3T4T A;  3MFX A;  3KSH A;  4KQD A;  3PXP A;  2HGV A;  4CLC B;  1H8M A;  4G3K A;  2Y79 A;  3IBR A;  3F1N B;  2ZMV A;  3LR4 A;  3UE6 A;  4JGP A;  4CLC E;  2FZ0 A;  3MJQ A;  3ZYT A;  1OT6 A;  2VGL M;  3PYP A;  4WEJ A;  3OCN A;  4GCZ A;  1S4S A;  4LLO B;  4DN0 A;  1S67 L;  3R7W B;  4IUH A;  2XRO A;  2W3G A;  1UWP X;  5J4E A;  1OJ5 A;  2OWH A;  3MQQ A;  2DMW A;  4FSF A;  4NXG A;  5DFY A;  2LB5 A;  3KYZ A;  4G3V A;  5EFW A;  3JVV A;  2ZOI A;  4LRX C;  1LT0 A;  5F6A A;  1ZHH B;  3VE4 A;  4O8G A;  1IOU A;  2QJ7 A;  5HD5 A;  3DBA A;  4GW9 A;  1NLY A;  2JKT M;  3LIB A;  3EEH A;  1N9L A;  1F98 A;  1X0O A;  2P7J A;  3HCY A;  5AVF A;  2OAQ 1;  1IFQ A;  4E04 A;  3CUE C;  3VE3 A;  4EQ1 A;  3PBT A;  4DMZ A;  2D02 A;  3RTY A;  2O9A A;  1Y28 A;  2ZOH A;  1LL8 A;  2VV8 A;  3FPW A;  2PT7 A;  2A2L A;  4EUV A;  4EET B;  1YSQ A;  2K7S A;  3FG8 A;  4GHI B;  3S7Q A;  3H82 B;  2GZA A;  4HNB A;  4UQI S;  3RH8 B;  5TBM B;  3F1N A;  2PYP A;  1TS7 A;  1STZ A;  4CLC A;  4EU0 A;  2HJE A;  2BAS A;  1UGU A;  4QPR A;  3NHQ A;  4EES A;  1TF1 A;  1T18 A;  2W1T B;  4CLC C;  5HSQ A;  2VA0 A;  1XJ2 A;  3KYQ A;  1W63 M;  1OTI A;  1EW0 A;  1XJ3 A;  3C2W A;  3LUQ A;  4HHD A;  2XA7 S;  3A0V A;  4P6Z M;  4KUK A;  3FC7 A;  3H9W A;  1LSW A;  4I3J A;  1W63 Q;  1DP8 A;  1NRJ A;  2A24 A;  1VB6 A;  5F68 A;  3F1P A;  3MMH A;  3LFV A;  3S7O A;  4DJ2 A;  4GS9 A;  3IS2 A;  3EGX C;  3E4Q A;  2L1M A;  4YOF A;  4WUJ A;  2QJ5 A;  3T50 A;  3PBQ A;  4PKY G;  2M1C A;  3PBS A;  5AVE A;  5FL3 A;  2W3F A;  2O9B A;  2KLI A;  3LR3 A;  4JGR A;  2ZMF A;  3H82 A;  1DRM A;  2WKR A;  4G3W A;  4NKP A;  2OWJ A;  5C5K A;  2D01 A;  4BMW A;  3PBN A;  2W3E A;  1S1Z A;  3TRC A;  4O01 A;  2V1A A;  5HDD A;  1LSV A;  3SW1 A;  3U2A A;  5HWT A;  3LYX A;  5LBR A;  3T4J A;  1YAX A;  3G6O A;  3R4K A;  4PAU A;  2B18 A;  4DJ3 A;  3K3C A;  1DP9 A;  3B33 A;  3E4O A;  2CMN A;  4R3A A;  3S7P A;  4L9G A;  4OOL A;  4Q0J A;  4WL9 A;  4CQH A;  4HOI A;  1TS0 A;  1OTD A;  2VV7 A;  2P04 A;  2KX6 A;  2PD8 A;  4XT2 B;  1TD5 A;  3P01 A;  5HL6 A;  2QWS A;  3GDI A;  3UB8 A;  5HWW A;  4B9O A;  3TW8 A;  5F5Y A;  2J80 A;  2Z6C A;  3BJN A;  1YSP A;  4RQ9 A;  3B47 A;  5AJG A;  2YKF A;  2J3T C;  2JKT I;  2LB9 A;  2V0U A;  2Y8H A;  3EQU A;  4HJ6 A;  3R7W A;  2J3T D;  1P9R A;  4GJ4 A;  4II7 A;  5CX7 A;  2VEA A;  3TJZ C;  4ARZ A;  1MKM A;  4HJ4 A;  4EW7 A;  3A0S A;  3UMD A;  5TJJ A;  3MXQ A;  4ME4 A;  2EA9 A;  3KSI A;  4HJ3 A;  4R38 A;  1F9I A;  4I5S A;  4GS9 B;  5IT5 A;  4I39 A;  2J3W A;  5HZH A;  4BBV A;  5J3W A;  2M7U A;  3LI8 A;  2JKR M;  3HJK A;  3CWF A;  4L0L A;  5HDC A;  1OT9 A;  3GEC A;  4CLC D;  2QYB A;  4WF0 A;  4BBT A;  4EEP A;  3C8C A;  5HPI A;  2PR6 A;  4LRY C;  2HF6 A;  2INW A;  2L4R A;  4MN6 A;  4Y3I A;  1GSV A;  1G6O A;  2K31 A;  2PD7 A;  3E4P A;  1BYW A;  4I3A A;  4EXO A;  3T4L A;  3OOV A;  3LI9 A;  4WN5 A;  5G4Y A;  2W3D A;  2JN7 A;  4M4X A;  2VLG A;  4NEE D;  1S4R A;  3LIF A;  5L8M A;  2GJ3 A;  3S7N A;  2V9A A;  3A0R A;  2OAP 1;  4LRZ E;  1P97 A;  1P9W A;  4BWI A;  3B42 A;  1ZTU A;  2VKS A;  1OTA A;  2IA2 A;  5HDS A;  1T1A A;  4JGQ A;  4KQO A;  1T1B A;  4WLA A;  4H6J A;  3EGD C;  3C30 A;  3PBR A;  1OPX A;  4HP9 A;  4ARZ B;  4HP4 A;  3ICY A;  5IS1 A;  2P08 A;  2W27 A;  4L9F A;  2W0N A;  5I5L A;  4I3I A;  3D72 A;  2V0W A;  1LSX A;  1S1Y A;  4Y5F A;  4EEU A;  3C38 A;  4FOF A;  1G28 A;  5DFX A;  4H6J B;  3LR5 A;  1OTE A;  3TE8 A;  1YKD A;  3VV4 A;  1XFN A;  3EOI A;  1XJ6 A;  2PYR A;  4R6L A;  4WEL A;  3OC2 A;  3VOL A;  3NJA A;  5J7E A;  4BBU A;  3KX0 X;  4IUK A;  4HI4 A;  5DKK A;  2W3H A;  4ZRR A;  4JGO A;  2VJW A;  5HPF A;  1MZU A;  2PR5 A;  2PHY A;  4HH3 A;  3MQO A;  1JNU A;  5DKL A;  3P7N A;  3T4Q A;  4Q0H A;  5KSH A;  1GSW A;  4Y2F A;  4PKY A;  4L9E A;  1N9O A;  4IJG A;  1MC0 A;  1V9Y A;  3ZQ5 A;  4PHT A;  2JHE A;  2K2N A;  1VHM A;  3LR0 A;  2NUP C;  3NOU C;  2OOL A;  4HH2 A;  4Z1W A;  1V9Z A;  3PHY A;  2O9C A;  2HV1 A;  3KO6 A;  2O0Y A;  2B02 A;  4IHQ A;  5DJU A;  3KSG A;  4MN5 A;  2V1B A;  2NUT C;  4KUO A;  4OOM A;  1TS8 A;  2EWV A;  2VX8 A;  1OTB A;  4MDZ A;  4P6Z S;  2XA7 M;  2W1T A;  3BY8 A;  2XRN A;  2EWW A;  3LIA A;  3NOT C;  2VZW A;  5F69 A;  4F3L B;  4Q0I A;  1XJ4 A;  3UME A;  5DJT A;  1D06 A;  1N9N A;  2GX5 A;  5G4Z A;  2A24 B;  3MR0 A;  4XT2 A;  3LIC A;  4K08 A;  2ZBB A;  4O0P A;  5TBM A;  3T4O A;  4ETZ A;  1S66 L;  3PBO A;  3EEA A;  3BQA A;  4BJP A;  4UEY A;  2XSS A;  3K3D A;  2L0W A;  1XFQ A;  2O99 A;  2G7U A;  3MQ0 A;  4YWZ A;  3H7W A;  4GLQ A;  4MCW A;  4ETX A;  3UE3 A;  1NLZ A;  3OBF A;  1T1C A;  3F1O B;  1D7E A;  3UB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...