3EGDC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22 and bound to the transport signal sequence of vesicular stomatitis virus glycoprotein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
137
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
total genus 38
structure length 137
sequence length 157
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egdC00
3BW6A 1IOUA 2DMWA 1H8MA 2VX8A 2NUTC 3KYQA 2NUPC 3EGDC 1IFQA 4B93A 4AFIA 3EGXC
chains in the Genus database with same CATH superfamily
4N1XA 3OLOA 2DRWA 3SZTA 4JXSA 4MMNA 4ZTKA 3V50A 4Y5FA 2J80A 1BUEA 1TDLA 1IKGA 1IYOA 2Y2GA 1U60A 2VV7A 3V39A 3IF6A 1E3UA 5GHYA 4GCZA 1W63Q 3WS1A 2P74A 3IH8A 3LIDA 3A3JA 4I3IA 4L9EA 3OZHA 4N9KA 2JHEA 3CLOA 2A3UA 2OSUA 5CRFA 1JVJA 4EV4A 1IFQA 3IHBA 2ZM0A 4MDZA 1JNUA 5EVLA 1JWPA 3IWOA 1NLYA 3V5MA 4FH4A 1XKZA 4DXBA 5HZHA 4S2NA 1LL5A 3UB5P 2Y2MA 4OOMA 1G28A 4B93A 1KE3A 2VKSA 4XT2B 1FCMA 5CEBA 3GRJA 3V67A 2M7UA 3T4KA 3IH9A 1SZVA 2ZD8A 3NECA 4MBHA 4FOFA 1S1ZA 1BLHA 2ZC3B 5EECA 3RH8B 5FAQA 3BFGA 1J3WA 3UB9A 1GHIA 2WAFA 2H28A 1GHPA 2FZ0A 2OLVA 2PR5A 3DTMA 1SHVA 5AQAA 3E98A 3G2ZA 3IS2B 1O7EA 5HL1A 3A3FA 4OPYA 5DF7A 5FASA 4JXWA 1ERQA 4GD6A 1ES5A 1UWPX 4DDSA 2Z6DA 3T4SA 1SCWA 3LR0A 1TS8A 1NRJA 5F83A 2ZBBA 3NJAA 1K54C 5HW3A 1ACFA 4X1MA 4R0QA 1K4FA 1YLZA 3TRCA 3C7VA 3ZHHA 3P09A 3MFDA 5HAQA 2PAVP 5DFYA 2XEPA 1JTGA 4WUJA 2IA2A 3TJZC 1NZUA 3CG5A 4OPRA 4P6ZM 5A92A 4Q0JA 1TD5A 2J9OA 3MQOA 1T1CA 3EGDC 2Y2QA 2XDMA 4LV3A 4MEZA 4ZAMA 4GS9A 2EWWA 3A0SA 2XFTA 1KDSA 2PD8A 4HJ3A 1FOFA 4KG2A 5FEGA 4PM6A 4X6TA 4S2MA 1SKOA 3QP1A 1PW1A 5TFQA 5HWWA 4K0WA 2IWCA 5M18A 3OPHA 4R4SA 1I2WA 3P7NA 2J7VA 3NC8A 3JYIA 4BBUA 4MN7A 5DKKA 4Y0OA 3ZGAB 1YLYA 3F1OB 4P6BA 3PAGA 2HV1A 1VB6A 4GNUA 3HJIA 1IEMA 4OP5A 5HD3A 4XT2A 2XRNA 4KUOA 4FD8A 3IF5A 5I5LA 4R3AA 4YWZA 4PHTA 3ZG5A 1NXYA 1IYSA 3EQUA 1S6RA 2I9VA 3MXQA 4MBFA 3TW8A 5IHVA 1LI9A 1C3BA 2O9CA 1V9YA 3HBRA 1E25A 2JKFA 3LI8A 4LRZE 3GR2A 1G6AA 5JYOA 2ZOHA 2EX2A 2Y2JA 1MWTA 4YINA 1CF0A 5I94A 2V1BA 3E4QA 4JGRA 2PHYA 4UHUA 2K31A 4WEKA 5CGWA 4PAUA 3PYPA 1BZAA 1T18A 2JKTI 4K0XA 3G34A 3T50A 4HQAA 4Y0UA 4B88A 2G2UA 1OJGA 4CLCD 5E2HA 2LB5A 2QJ5A 3PTEA 1ONGA 1G6OA 1LL9A 4R6LA 1ES3A 2PU2A 4UQIS 3MFXA 4FTXA 3T1SA 5A90A 3QNCA 2ZC4B 5BOHA 4G3WA 3QP5A 4OQ0A 4IHQA 3MSHA 2V0WA 4R23A 4O0PA 1K6RA 1S66L 3M6HA 1NYMA 2HDRA 1HVBA 1ZTUA 2EFUA 4KG5A 3CJMA 2QZ6A 1CEGA 5FDHA 3ITBA 5TR7A 5FAPA 4GS9B 3O3VA 4HI4A 2ZL1A 5AQ7A 1VM1A 1F2KA 2ZLYA 4YOFA 4PM5A 3A3IA 1DP8A 1IYPA 3QHYA 4N1HA 1PYYA 3AGFA 3LGOA 4NG2A 3JPUA 3LCEA 3UPNA 1W7FA 4LGWA 5FQQA 4E3LA 2VZWA 3UNWA 3DTKA 1STZA 5KMWA 4GHIB 4HOIA 4R3BA 3BFEA 3ZQ5A 3C30A 3O86A 3TE8A 4ME4A 3FV7A 3IHAA 3N8LA 4GW9A 4GJ4A 4NKPA 5EOOA 4IUHA 2B18A 4X56A 4OLDA 3FKWA 4E3NA 4UA6A 3HUOA 1FQGA 3ZG0A 2HPBA 3HUNA 3H82A 1PZPA 3C2WA 4EERA 2INWA 4GZBA 1RGYA 5FAOA 2IWDA 4DF6A 4QPRA 5GL9A 3CWFA 3VP0A 3E2KA 1OTBA 4HIAA 3IF6C 2XLNA 1YT4A 4EUVA 1FCOA 2KDKA 3HLCA 2VGKA 1H5XA 3MQQA 4IVIA 4X55A 4CLCA 3Q07A 2X01A 1Z09A 1W79A 1FR1A 4RQ9A 5G18A 3HL9A 2ZM2A 4DE2A 4E6WA 4BJPA 5IU1A 2Q9MA 3LYXA 4NK3A 3SS4A 2M7VA 2XF3A 2WKRA 5CX7A 1YLJA 5DJUA 2EX9A 1VEUA 1QMFA 4S2NC 4BWIA 4OLGA 4X69A 4C6YA 4JPMA 4PKYG 2ZL1B 3NOPC 3KSHA 4WLAA 4KQQA 2W3GA 1E4DA 1OTDA 3S7NA 4A5RA 1K56A 3N8SA 5FQ9A 2EX6A 4UA9A 5EVID 3IX4A 5EOEA 3LR5A 2V2FF 3UPOA 3VMAA 2WADA 3UB7A 2OAP1 4F3LB 4DRTA 1Q2PA 4Z9QA 4EQ1A 1ODVA 4OVDA 4LV2A 2A2LA 3BY9A 4LV0A 1VETB 5HDCA 3WS5A 4DKIA 3FKVA 2R9XA 1TEMA 3Q81A 4ID4A 2FH5A 5F1GA 2UWXA 5TBMB 4OQHA 5E43A 3VP4A 3GSGA 4DE1A 1VQQA 2V8FA 4PM9A 4NXGA 2EWVA 3UMEA 1XGIA 2WZZA 1DP9A 3EWKA 2XR0A 4LV1A 3HJKA 5AQBA 5FDSA 1K56D 3B42A 5AJGA 1M40A 2W27A 5GLBA 1CQAA 5EFWA 4ZJ3A 1OT6A 3N7WA 3Q7VA 3DTIA 4BL2A 2QPNA 2W3EA 4I38A 1M6KA 4EBPA 3SOIA 5F68A 1LL8A 4OQIA 1UGUA 1AXBA 3IXDA 2WKHA 3GECA 2O0YA 3OOVA 1XJ4A 3HREA 1YMSA 3LICA 2W3HA 1XP4A 1K4EA 3CAXA 3UDXA 1JTDA 4PM8A 4KG6A 1V9ZA 3S7OA 3RXWA 1W8QA 1EROA 1F9IA 1GSVA 1TS7A 4QB8A 1CI8A 3I7JA 3WWXA 2VLGA 2Y2PA 3V3RA 4GOGA 3G30A 5DJTA 2HGVA 3CZDA 4JXVA 2J3WA 3LUQA 1K6SA 4EEUA 1LSVA 4H8RA 2HP5A 4OP8A 4R1GA 3R7WB 1OTAA 2O9AA 1Z6FA 3EOIA 1PWGA 4S2LA 2DMWA 4UEYA 1N9OA 4EESA 4JF6A 4Q8IA 5L8MA 3T1RA 4EQIA 5J3WA 3N6IA 2L1MA 4DMZA 4F3LA 5CXWA 3LFVA 1G5UA 3BJNA 5FEFA 3AGDA 1HTZA 2XK1A 5L09A 2Z6CA 1DJCA 4BBTA 5EVIB 1UWNX 4U0XA 3FPWA 3SW1A 3NDGA 4EWFA 1P9WA 2WKIA 3NCKA 2AVXA 3VE3A 3O5YA 3BFDA 5F1FA 1H0MA 5FQKA 1XXMA 3MBZA 3VFFA 4EUZA 2R78A 4KZ6A 4B9OA 3BYDA 1LSXA 2ZC6B 4RX2A 4HP9A 4N9LA 3EQVA 4CPKA 1P97A 3BY8A 1TVFA 5C5KA 2HDUA 5HWTA 1PI5A 1N9NA 2L0WA 2QYBA 4D60A 4XUXA 1A0KA 4IBRA 3U2AA 4NXEA 4MNRA 1IYQA 1N9BA 1XA1A 3UE1A 3MMHA 4JXGA 5F69A 3U4LP 3L9KA 2Y2NA 5HSQA 5U47A 3PBOA 2PBDP 3D3OA 3SS3A 2XA7S 4JGPA 3KYZA 3HCYA 1F5MA 4JKTA 4UAAA 1XFNA 4PMAA 5KSHA 2HP6A 4KZ5A 3PAEA 1GHMA 3B3XA 4I39A 5HWVA 3FYZA 4G3KA 3OC2A 3VOLA 5TJJA 1N9LA 2Z2MB 2ZQ7A 3F1PA 2GNXA 1DP6A 3NIAA 4E04A 2CC1A 4Y2FA 2JE5A 4Y3IA 5EVEA 3HLFA 5J4EA 1CJFA 3G31A 3Q82A 3R4KA 3FC7A 4HJ6A 3UO9A 3IS2A 1N4OA 1FIKA 3BM6A 2FFFB 2BG1A 5FA7A 2A24B 3G6OA 4HEFA 1BYWA 4CLCC 2YKFA 3NULA 2B5RA 3IQAA 4FUWA 4QY6A 2Y8HA 3SS5A 3DTEA 3WS2A 4S2JA 3CUEC 3VOZA 4CJNA 4CQHA 3ICYA 3BLSA 3F1OA 2H0TA 3CI6A 3ZNTA 1Q2QA 2EA9A 4EETB 5L10A 3LO7A 2BTFP 1FILA 5GLAA 1T1BA 5MC7A 2GDNA 1K0KA 3IWQA 4XUZA 2IWBA 1SDNA 4GKUA 2XROA 1MPLA 3RXXA 3VP1A 4HNBA 1EWZA 3E0YA 4JGQA 3IBRA 2FFYA 4KZAA 1GA9A 3ZG9B 1VETA 2X71A 4QU3A 2ACGA 3T4OA 3NHQA 3LI9A 2EXAA 3IWIA 3KYQA 1KGEA 1YSQA 2KOIA 4NXBA 2V9AA 2VGLS 1WE4A 5DVAA 1NLZA 1T19A 3UB6A 1F98A 4S2PA 2PU4A 1P9RA 4EBLA 2Z2LB 4HHDA 1L0FA 2V0UA 3V3SA 5TGFA 2H0YA 1OTIA 4K91A 3F1PB 3A3DA 2NUTC 2OOLA 2R9WA 5EUAA 3PBNA 4QHCA 3W4OA 1PIOA 3P01A 3LEZA 5AVFA 3M2KA 1MC0A 3W4PA 4P87A 3SH9A 3GV9A 3TSGA 3RJUA 4ARZB 3MF0A 2WGWB 2VX8A 4CLCE 3FWLA 2E8JA 2VA0A 1D06A 2HJEA 2WZXA 3VSLA 4DE3A 3JVVA 2LB9A 1KGFA 3LR4A 4NXFA 4HJ4A 4S2KA 2VK3A 2Y2IA 2H5SA 2QJ7A 1KE0A 2Y2HA 2VV8A 1EW0A 1FCNA 5DTKA 1BLSA 2ZMFA 1LHYA 5GLCA 4HH3A 1XPBA 2JKTM 1W8YA 4PM7A 2WYXA 2DNSA 1FR6A 4GHIA 5M19A 4HH2A 1K55A 3T1XA 1PW8A 3EEHA 4KQDA 3G2YA 4E3MA 3QP6A 2WUQA 3BW6A 5FI2A 2PYRA 3LIEA 3T4QA 4S2IA 4WF0A 5GHZA 1MY8A 4S2OA 1BSGA 4U0TA 1IOUA 2B02A 2ZQAA 3M2JA 1D7EA 4BLMA 1GSWA 3TOIA 2W1TA 4FCFA 5EM0A 1ZC2A 1S1YA 3QNBA 1PWCA 2CMNA 2O99A 1CEFA 4GDNA 2Y79A 3B47A 1YPRA 3IXHA 2HJ9C 4L0LA 2J3TC 3BFCA 4G3VA 4LCLA 1Y28A 4R4RA 4HBUA 3WRTA 2QMIA 3EGXC 1NYYA 2A49A 4QY5A 3UE3A 3OPPA 5L07A 3ZVTA 4LCMA 2ZOIA 4HP4A 3RFBA 3ISGA 2C5WB 2KX6A 3PBQA 2WGIA 3KSIA 4IVKA 3W8KA 1H8ZA 3VOYA 3H82B 1YSPA 5E2FA 4KZ9A 5HPIA 1LT0A 1YM1A 5E2EA 4WL9A 3BECA 1LSWA 2QWSA 2BLSA 2V20A 3IX8A 4WN5A 4KZ7A 1I2SA 4KENB 4L9FA 4O01A 4E3IA 3DW0A 1OPXA 4JLFA 2PDRA 4II7A 2P9VB 3H9WA 1L3LA 4JF5A 3PBTA 2BASA 2Y2KA 4GN2A 3TG9A 2WKEA 2WGWA 2RCXA 4OH0A 3MXRA 5EM1A 2XQZA 2UV0E 3RTYA 3A3EA 4BBVA 2ZM8A 3S4XA 4I3JA 2RL3A 4X25A 3FG8A 2W3FA 3L7HA 1KE4A 5G4YA 1SKFA 2OLUA 3UPPA 3H7WB 3NY4A 3CHWP 5FQIA 3LIFA 4MBKA 2OV5A 2EXBA 1K54A 1GA0A 1IELA 1L0EA 1ERMA 4WM9A 5HL6A 1XA7A 3BLMA 1BLCA 4PPRA 1D1JA 2OWJA 5F82A 3C4PA 3ZYTA 5DTSA 2V8CA 3WRZA 2GX5A 4KZ3A 1VHMA 4NETA 3A0VA 3BQAA 2HZ5A 4LFUA 3GDIA 1T1AA 3MZDA 4DN0A 4BD1A 4ZJ1A 3CUEA 3D9YA 3ZFZA 5HX9A 4U3TA 3MZEA 1S0WA 1L2SA 5D3OA 4IUKA 3S1YA 5EE8A 4RX3A 4ZDXA 3OCLA 5CTNA 4DXCA 3NDEA 1ZKJA 4MN5A 4O8GA 4OPQA 2WKPA 3DWKA 1WA9A 5CTMA 4EEPA 1KOUA 5HD5A 5FI7A 2Q9NA 2P04A 2VEAA 4GDBA 3C7UA 1ALQA 1HZOA 2XGNA 4MLLA 1FSYA 3PBSA 4WZ4A 1MBLA 1J9MA 3MZFA 2JC7A 3N8RA 4WELA 1TF1A 1YKDA 2EFXA 4KZ8A 1BTLA 3PXPA 3T12B 1S4SA 4OOYA 3UDIA 2PBYA 3KSGA 1EI5A 3FPVA 1MWRA 4R70A 3WS4A 1ZHHB 4ZRRA 3H7WA 4Q0IA 3HUMA 3ZVWA 5J7EA 1ESIA 1CI9A 2Y2OA 4M3KA 1CK3A 3C8CA 3HLBA 3W4QA 2GJ3A 3QP8A 3IBJA 1MZUA 2KLIA 4NEED 3BQ8A 2D02A 5CHUA 5JYPA 4WZ5A 2VV6A 2WK0A 5EVIC 1XJ2A 5HARA 1RCJA 1NZOA 4WMCD 3R7WA 2VGLM 4GLQA 1K25A 2JKRI 3Q7ZA 4DJ3A 2MJ6A 3ITAA 1PWDA 1TDGA 4IJGA 1YQSA 5DKLA 5HDDA 4LENA 3E4OA 1H8YA 2ZQ9A 3GMWA 4XXRA 4BQMA 4Y13A 4QD4A 2W1RA 4UQIM 4BENA 1P0ZA 2M1CA 4K08A 4RVAA 5CEDA 4PKYA 3SH7A 1SDEA 1WYCA 4OONA 3VFHA 4P6ZS 3ULFA 2VGJA 5FI6A 5HAIA 1KVLA 5EVIA 4Z1WA 1O07A 3VE4A 3NI9A 3GTCA 4BMWA 3D72A 3LIBA 5HAPA 2G7UA 3CMZA 4RA7A 4YNRA 5FSRA 2Y91A 1E3UD 3HLWA 5DF8A 5J8XA 1K55C 1L0GA 2ZMAA 3ZNYA 4GB7A 4AFIA 3EEAA 3CITA 3UY6A 3T4TA 2X02A 2Y2LA 2HP9A 1MKIA 3S22A 1YLTA 3KYEA 3NBLA 5KZHA 3P98A 1I5QA 5AQ9A 4C75A 3O88A 3LIAA 2G2WA 1YLPA 4C3QA 2B95A 1WYBA 3DWZA 3KSFA 1JWZA 1RGZA 2HF6A 5GHXA 3S7PA 4H6JA 5FL3A 2JBFA 3BEBA 3OPRA 2W1TB 4WYYA 4KQRA 2PRFA 3O87A 4HESA 1PRQA 4HY8A 4X1LA 4L9GA 2DCFA 3LR3A 4LPZA 1KDWA 1DRMA 3HLDA 3S7QA 2HDSA 1XGJA 3UE6A 4P0MA 3IXBA 3PHYA 3G32A 1XJ3A 1XFQA 4X68A 2ZC5B 3K3CA 3UE0A 2QKPA 2J3TD 5AVEA 1XJ6A 3MXSA 1ONHA 2OWHA 2ZQDA 2PT7A 3IXGA 4WBGA 5CERA 1DJAA 2ZJ9A 1PZOA 4KZBA 3IF6B 3N4IA 1PNEA 1KVMA 3VP3A 4WEJA 2A24A 3LY3A 4D2OA 4I5SA 3LY4A 2WGVA 3CPTA 2ZQCA 2L4RA 2JCHA 4E6XA 1GCEA 3MS6A 3VV4A 3T4LA 5A8BA 3BRMA 3GQZA 3BWLA 2JKRM 4E3KA 3Q1FA 5EV0A 2XD1A 1PFLA 3BFFA 1AWIA 2JKGA 4N92A 1OJ5A 5CGXA 3A0RA 3SH8A 3F1NA 1YMXA 2XD5A 3MKFA 2WAEA 4EXOA 3C38A 4FH2A 5IS1A 4E3OA 1ZG4A 5E2GA 4MN6A 5HFOA 2O9BA 4ZBEA 3MKEA 4H6JB 4YFMA 2PR6A 3D4FA 5LBRA 2W3DA 3LEQA 1BULA 4EU0A 1IKIA 1JWVA 2XSSA 2ZC7A 2XH9A 5DTTA 4B4ZA 1NWZA 3VSKA 4Y7PA 4JBFA 5KSCA 4ARZA 4Y17A 5EPHA 3C4OA 5CHMA 3UDFA 4EW7A 2E8IA 1MWSA 1OT9A 2OAQ1 1LI0A 3QP2A 4KQOA 4CLCB 5M1AA 5L2FA 1NY0A 4R3JA 1HD8A 1K57A 3KX0X 1K38A 3PR6A 2Y55A 4LLOB 5G4ZA 2J9PA 1X0OA 4ZJ2A 4B4XA 2K2NA 5DF9A 2PD7A 4LRYC 2ZMVA 3FZCA 4LRXC 4R38A 1Y4OA 3ZDJA 1VEUB 2C6WB 5HPFA 1BLPA 3KO6A 4RYEA 3IT9A 3VP2A 4GD8A 4Y0TA 4X53A 4IEDA 1SKOB 4UA7A 4JF4A 1RP5A 3CPTB 3ZCZA 3HLEA 2PYPA 1G68A 2YKHA 1W63M 1K57C 4QWOA 4HBTA 1H8MA 2J8YA 3C5AA 1ES2A 2QHKA 3JVUA 5FQJA 3UN7A 5HDSA 5FATA 3T4JA 1PI4A 4OOLA 1H3QA 4BL3A 3MQ0A 2W0NA 5IT5A 5CECA 1YLWA 3HLGA 2XFSA 3F1NB 4IBXA 1S4RA 5TBMA 5CGSA 1MKMA 1L0DA 1TS6A 3B33A 3OPLA 1TS0A 1Y54A 4P85A 2P08A 1YAXA 3OCNA 4OKPA 2NUPC 1ZG6A 3AGEA 2GZAA 2HDQA 3K3DA 3G4PA 4WZ5C 3UMDA 2WKQA 5KIZA 1NJ4A 3E2LA 3IX3A 2P7JA 2XA7M 3UB8A 1ES4A 1FSWA 1W5DA 2V1ZA 1S67L 4E3JA 5A93A 3W2ZA 4KUKA 1QMEA 2H10A 2Y4AA 3WS0A 3HVFA 1DJBA 4DJ2A 4OQGA 4ETXA 2Q0OA 2V1AA 4DDYA 5K5BA 3DAVA 4EBNA 5A91A 3M6BA 3OBFA 4OPZA 4DE0A 3NOUC 4Q0HA 4ETZA 3MR0A 1MXOA 3Q7VB 3ZG8B 2K7SA 5F5YA 4O7DA 3DBAA 3T1QB 1OTEA 1OMEA 4F94A 1KGGA 4KZ4A 2I72A 3K2NA 2P9VA 5F6AA 1NRFA 2ZQ8A 4FSFA 3NOTC 3GVBA 2Y59A 1XX2A 1ESUA 2EX8A 2JN7A 1HLUP 3PBRA 5DFXA 4QJGA 1DY6A 4ESPA 4WMCA 5FQMA 4BD0A 1BT5A 1LLBA 4I3AA 3E4PA 3G35A 2VJWA 3QP4A 1MWUA 3MJQA 4M4XA 5CHJA 2D01A 4MCWA 1GSXA 4Y15A 5GLDA 4JGOA 3ZG7B
chains in the Genus database with same CATH topology
2V0UA 3EEAA 3CITA 3OLOA 3T4TA 2M7VA 4MMNA 1OTIA 4Y5FA 2WKRA 3F1PB 5CX7A 2J80A 5DJUA 2NUTC 2OOLA 3PBNA 2VV7A 4BWIA 3P01A 4GCZA 3LIAA 5AVFA 4PKYG 1W63Q 3KSFA 3NOPC 1MC0A 3KSHA 4WLAA 2W3GA 1OTDA 3S7NA 2HF6A 3S7PA 4H6JA 5FL3A 3LIDA 2W1TB 4I3IA 4ARZB 3MF0A 4L9EA 4HY8A 3LR5A 4L9GA 2VX8A 3LR3A 2OAP1 3UB7A 4LPZA 4CLCE 2JHEA 4F3LB 3CLOA 2VA0A 1D06A 2HJEA 4EQ1A 1IFQA 1DRMA 1ODVA 3JVVA 3S7QA 4MDZA 2LB9A 1JNUA 2A2LA 3BY9A 3LR4A 1NLYA 3UE6A 5HDCA 4NXFA 4HJ4A 5HZHA 2FH5A 4OOMA 1G28A 4B93A 5TBMB 3PHYA 1XJ3A 2QJ7A 1XFQA 4NXGA 2EWVA 3K3CA 4XT2B 2VKSA 2QKPA 3UMEA 2VV8A 1EW0A 2J3TD 5AVEA 1DP9A 3EWKA 3V67A 2ZMFA 1XJ6A 4HH3A 3HJKA 2JKTM 2M7UA 3T4KA 2OWHA 3B42A 2PT7A 4GHIA 4HH2A 3EEHA 5AJGA 4KQDA 2W27A 5EFWA 1OT6A 4FOFA 1S1ZA 3BW6A 2W3EA 4I38A 3RH8B 2PYRA 3LIEA 3T4QA 5F68A 4WF0A 1LL8A 3UB9A 1UGUA 4WEJA 2H28A 2A24A 2FZ0A 2PR5A 1IOUA 2B02A 4I5SA 1D7EA 3E98A 1GSWA 3IS2B 3GECA 2W1TA 2O0YA 1S1YA 3OOVA 1XJ4A 2CMNA 1UWPX 2O99A 3LICA 2L4RA 2W3HA 2Z6DA 2Y79A 3B47A 3T4SA 3VV4A 3LR0A 3T4LA 2HJ9C 3CAXA 4L0LA 1TS8A 2J3TC 5A8BA 4G3VA 1Y28A 1NRJA 3BWLA 1V9ZA 2JKRM 3S7OA 1F9IA 2ZBBA 1GSVA 1TS7A 3NJAA 3EGXC 1OJ5A 3A0RA 2VLGA 3UE3A 3F1NA 3TRCA 5DJTA 2HGVA 2J3WA 2ZOIA 4EXOA 4HP4A 3LUQA 3C38A 3RFBA 5DFYA 2KX6A 4EEUA 3PBQA 3KSIA 1LSVA 4WUJA 2IA2A 3TJZC 5IS1A 4P6ZM 3H82B 1YSPA 5HPIA 4Q0JA 1TD5A 1LT0A 3MQOA 4WL9A 1LSWA 2QWSA 4MN6A 1OTAA 1T1CA 3R7WB 2O9AA 3EGDC 3EOIA 4WN5A 2O9BA 4L9FA 4O01A 4GS9A 2DMWA 2EWWA 3A0SA 4UEYA 1N9OA 1OPXA 4EESA 2PD8A 2PDRA 4HJ3A 4II7A 3H9WA 5L8MA 4H6JB 2PR6A 3PBTA 2BASA 5LBRA 2W3DA 5J3WA 2L1MA 4DMZA 5HWWA 4EU0A 4F3LA 3RTYA 2XSSA 3LFVA 3BJNA 3P7NA 4BBVA 4I3JA 1NWZA 3FG8A 2W3FA 4BBUA 5G4YA 4ARZA 4MN7A 2Z6CA 5DKKA 3H7WB 4EW7A 4BBTA 3F1OB 1OT9A 1UWNX 2OAQ1 2HV1A 3FPWA 3SW1A 4KQOA 3LIFA 4CLCB 1VB6A 1P9WA 3HJIA 5HD3A 4XT2A 2XRNA 4KUOA 3VE3A 3O5YA 5I5LA 4R3AA 3KX0X 4YWZA 4PHTA 3PR6A 4LLOB 5G4ZA 2R78A 3EQUA 2I9VA 1X0OA 3MXQA 4B9OA 1LSXA 3TW8A 4HP9A 2K2NA 5DF9A 2O9CA 5HL6A 3EQVA 1V9YA 1P97A 3BY8A 2PD7A 4LRYC 5C5KA 2ZMVA 5HWTA 2OWJA 3LI8A 4LRXC 4R38A 4LRZE 3ZYTA 5HPFA 1N9NA 2ZOHA 2L0WA 3KO6A 2GX5A 1VHMA 2QYBA 3A0VA 2V1BA 3BQAA 3E4QA 3U2AA 4JGRA 3GDIA 1T1AA 4NXEA 2PHYA 4DN0A 2K31A 4WEKA 4PAUA 3CUEA 3PYPA 2PYPA 1T18A 2JKTI 2YKHA 3T50A 1W63M 4HQAA 1H8MA 3MMHA 4CLCD 1OJGA 5F69A 2QHKA 2LB5A 3JVUA 5HSQA 5HDSA 2QJ5A 4IUKA 3T4JA 1G6OA 4OOLA 4R6LA 3PBOA 1H3QA 4UQIS 3MQ0A 2W0NA 5IT5A 3D3OA 2XA7S 3OCLA 4JGPA 3KYZA 3HCYA 3MFXA 1F5MA 1XFNA 4MN5A 3F1NB 4O8GA 5KSHA 1S4RA 4G3WA 5TBMA 2WKPA 4EEPA 1WA9A 4IHQA 1KOUA 1MKMA 4I39A 2V0WA 5HWVA 4O0PA 5HD5A 1TS6A 1S66L 4G3KA 3B33A 3OC2A 3VOLA 5TJJA 1TS0A 1N9LA 2P08A 3F1PA 2GNXA 1DP6A 1ZTUA 1YAXA 2P04A 2VEAA 3OCNA 4E04A 4Y2FA 2NUPC 4Y3IA 3PBSA 5J4EA 2GZAA 4GS9B 3K3DA 4HI4A 3R4KA 3FC7A 4HJ6A 4WELA 1TF1A 2WKQA 4YOFA 3UMDA 5KIZA 1YKDA 3IS2A 3PXPA 1S4SA 2P7JA 2XA7M 3KSGA 3UB8A 1DP8A 3FPVA 2A24B 1S67L 3G6OA 3W2ZA 1BYWA 4CLCC 2YKFA 4KUKA 4R70A 1ZHHB 2Y8HA 4ZRRA 4DJ2A 3H7WA 4Q0IA 3CUEC 4ETXA 5J7EA 2VZWA 2V1AA 3C8CA 5K5BA 4CQHA 2GJ3A 1STZA 3IBJA 1MZUA 3ICYA 2KLIA 4GHIB 4HOIA 3BQ8A 4NEED 3F1OA 2D02A 3OBFA 3ZQ5A 3NOUC 4Q0HA 3C30A 2VV6A 3CI6A 3TE8A 3MR0A 4ETZA 4ME4A 2EA9A 1XJ2A 2K7SA 4EETB 4GW9A 4GJ4A 4NKPA 5F5YA 1T1BA 4IUHA 3R7WA 2B18A 2VGLM 3DBAA 5MC7A 1OTEA 4GLQA 2JKRI 4DJ3A 2MJ6A 3H82A 3K2NA 4IJGA 3C2WA 4EERA 5F6AA 2INWA 5DKLA 5HDDA 4FSFA 3E4OA 4QPRA 2XROA 2W1RA 3NOTC 4UQIM 1P0ZA 2M1CA 2JN7A 4K08A 4HNBA 3PBRA 3CWFA 4PKYA 3E0YA 5DFXA 4JGQA 3IBRA 4P6ZS 1OTBA 3ULFA 4HIAA 4EUVA 2KDKA 4Z1WA 3VE4A 4BMWA 3D72A 3T4OA 3LIBA 3NHQA 3MQQA 4I3AA 4CLCA 3LI9A 3E4PA 3KYQA 1YSQA 2G7UA 2KOIA 4NXBA 2V9AA 2VJWA 4YNRA 2VGLS 4RQ9A 3MJQA 1NLZA 4M4XA 1T19A 3UB6A 1F98A 2D01A 4MCWA 4BJPA 5IU1A 1P9RA 1GSXA 3LYXA 4AFIA 4HHDA 4JGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW6 A;  1IOU A;  2DMW A;  1H8M A;  2VX8 A;  2NUT C;  3KYQ A;  2NUP C;  3EGD C;  1IFQ A;  4B93 A;  4AFI A;  3EGX C; 
#chains in the Genus database with same CATH topology
 4N1X A;  3OLO A;  2DRW A;  3SZT A;  4JXS A;  4MMN A;  4ZTK A;  3V50 A;  4Y5F A;  2J80 A;  1BUE A;  1TDL A;  1IKG A;  1IYO A;  2Y2G A;  1U60 A;  2VV7 A;  3V39 A;  3IF6 A;  1E3U A;  5GHY A;  4GCZ A;  1W63 Q;  3WS1 A;  2P74 A;  3IH8 A;  3LID A;  3A3J A;  4I3I A;  4L9E A;  3OZH A;  4N9K A;  2JHE A;  3CLO A;  2A3U A;  2OSU A;  5CRF A;  1JVJ A;  4EV4 A;  1IFQ A;  3IHB A;  2ZM0 A;  4MDZ A;  1JNU A;  5EVL A;  1JWP A;  3IWO A;  1NLY A;  3V5M A;  4FH4 A;  1XKZ A;  4DXB A;  5HZH A;  4S2N A;  1LL5 A;  3UB5 P;  2Y2M A;  4OOM A;  1G28 A;  4B93 A;  1KE3 A;  2VKS A;  4XT2 B;  1FCM A;  5CEB A;  3GRJ A;  3V67 A;  2M7U A;  3T4K A;  3IH9 A;  1SZV A;  2ZD8 A;  3NEC A;  4MBH A;  4FOF A;  1S1Z A;  1BLH A;  2ZC3 B;  5EEC A;  3RH8 B;  5FAQ A;  3BFG A;  1J3W A;  3UB9 A;  1GHI A;  2WAF A;  2H28 A;  1GHP A;  2FZ0 A;  2OLV A;  2PR5 A;  3DTM A;  1SHV A;  5AQA A;  3E98 A;  3G2Z A;  3IS2 B;  1O7E A;  5HL1 A;  3A3F A;  4OPY A;  5DF7 A;  5FAS A;  4JXW A;  1ERQ A;  4GD6 A;  1ES5 A;  1UWP X;  4DDS A;  2Z6D A;  3T4S A;  1SCW A;  3LR0 A;  1TS8 A;  1NRJ A;  5F83 A;  2ZBB A;  3NJA A;  1K54 C;  5HW3 A;  1ACF A;  4X1M A;  4R0Q A;  1K4F A;  1YLZ A;  3TRC A;  3C7V A;  3ZHH A;  3P09 A;  3MFD A;  5HAQ A;  2PAV P;  5DFY A;  2XEP A;  1JTG A;  4WUJ A;  2IA2 A;  3TJZ C;  1NZU A;  3CG5 A;  4OPR A;  4P6Z M;  5A92 A;  4Q0J A;  1TD5 A;  2J9O A;  3MQO A;  1T1C A;  3EGD C;  2Y2Q A;  2XDM A;  4LV3 A;  4MEZ A;  4ZAM A;  4GS9 A;  2EWW A;  3A0S A;  2XFT A;  1KDS A;  2PD8 A;  4HJ3 A;  1FOF A;  4KG2 A;  5FEG A;  4PM6 A;  4X6T A;  4S2M A;  1SKO A;  3QP1 A;  1PW1 A;  5TFQ A;  5HWW A;  4K0W A;  2IWC A;  5M18 A;  3OPH A;  4R4S A;  1I2W A;  3P7N A;  2J7V A;  3NC8 A;  3JYI A;  4BBU A;  4MN7 A;  5DKK A;  4Y0O A;  3ZGA B;  1YLY A;  3F1O B;  4P6B A;  3PAG A;  2HV1 A;  1VB6 A;  4GNU A;  3HJI A;  1IEM A;  4OP5 A;  5HD3 A;  4XT2 A;  2XRN A;  4KUO A;  4FD8 A;  3IF5 A;  5I5L A;  4R3A A;  4YWZ A;  4PHT A;  3ZG5 A;  1NXY A;  1IYS A;  3EQU A;  1S6R A;  2I9V A;  3MXQ A;  4MBF A;  3TW8 A;  5IHV A;  1LI9 A;  1C3B A;  2O9C A;  1V9Y A;  3HBR A;  1E25 A;  2JKF A;  3LI8 A;  4LRZ E;  3GR2 A;  1G6A A;  5JYO A;  2ZOH A;  2EX2 A;  2Y2J A;  1MWT A;  4YIN A;  1CF0 A;  5I94 A;  2V1B A;  3E4Q A;  4JGR A;  2PHY A;  4UHU A;  2K31 A;  4WEK A;  5CGW A;  4PAU A;  3PYP A;  1BZA A;  1T18 A;  2JKT I;  4K0X A;  3G34 A;  3T50 A;  4HQA A;  4Y0U A;  4B88 A;  2G2U A;  1OJG A;  4CLC D;  5E2H A;  2LB5 A;  2QJ5 A;  3PTE A;  1ONG A;  1G6O A;  1LL9 A;  4R6L A;  1ES3 A;  2PU2 A;  4UQI S;  3MFX A;  4FTX A;  3T1S A;  5A90 A;  3QNC A;  2ZC4 B;  5BOH A;  4G3W A;  3QP5 A;  4OQ0 A;  4IHQ A;  3MSH A;  2V0W A;  4R23 A;  4O0P A;  1K6R A;  1S66 L;  3M6H A;  1NYM A;  2HDR A;  1HVB A;  1ZTU A;  2EFU A;  4KG5 A;  3CJM A;  2QZ6 A;  1CEG A;  5FDH A;  3ITB A;  5TR7 A;  5FAP A;  4GS9 B;  3O3V A;  4HI4 A;  2ZL1 A;  5AQ7 A;  1VM1 A;  1F2K A;  2ZLY A;  4YOF A;  4PM5 A;  3A3I A;  1DP8 A;  1IYP A;  3QHY A;  4N1H A;  1PYY A;  3AGF A;  3LGO A;  4NG2 A;  3JPU A;  3LCE A;  3UPN A;  1W7F A;  4LGW A;  5FQQ A;  4E3L A;  2VZW A;  3UNW A;  3DTK A;  1STZ A;  5KMW A;  4GHI B;  4HOI A;  4R3B A;  3BFE A;  3ZQ5 A;  3C30 A;  3O86 A;  3TE8 A;  4ME4 A;  3FV7 A;  3IHA A;  3N8L A;  4GW9 A;  4GJ4 A;  4NKP A;  5EOO A;  4IUH A;  2B18 A;  4X56 A;  4OLD A;  3FKW A;  4E3N A;  4UA6 A;  3HUO A;  1FQG A;  3ZG0 A;  2HPB A;  3HUN A;  3H82 A;  1PZP A;  3C2W A;  4EER A;  2INW A;  4GZB A;  1RGY A;  5FAO A;  2IWD A;  4DF6 A;  4QPR A;  5GL9 A;  3CWF A;  3VP0 A;  3E2K A;  1OTB A;  4HIA A;  3IF6 C;  2XLN A;  1YT4 A;  4EUV A;  1FCO A;  2KDK A;  3HLC A;  2VGK A;  1H5X A;  3MQQ A;  4IVI A;  4X55 A;  4CLC A;  3Q07 A;  2X01 A;  1Z09 A;  1W79 A;  1FR1 A;  4RQ9 A;  5G18 A;  3HL9 A;  2ZM2 A;  4DE2 A;  4E6W A;  4BJP A;  5IU1 A;  2Q9M A;  3LYX A;  4NK3 A;  3SS4 A;  2M7V A;  2XF3 A;  2WKR A;  5CX7 A;  1YLJ A;  5DJU A;  2EX9 A;  1VEU A;  1QMF A;  4S2N C;  4BWI A;  4OLG A;  4X69 A;  4C6Y A;  4JPM A;  4PKY G;  2ZL1 B;  3NOP C;  3KSH A;  4WLA A;  4KQQ A;  2W3G A;  1E4D A;  1OTD A;  3S7N A;  4A5R A;  1K56 A;  3N8S A;  5FQ9 A;  2EX6 A;  4UA9 A;  5EVI D;  3IX4 A;  5EOE A;  3LR5 A;  2V2F F;  3UPO A;  3VMA A;  2WAD A;  3UB7 A;  2OAP 1;  4F3L B;  4DRT A;  1Q2P A;  4Z9Q A;  4EQ1 A;  1ODV A;  4OVD A;  4LV2 A;  2A2L A;  3BY9 A;  4LV0 A;  1VET B;  5HDC A;  3WS5 A;  4DKI A;  3FKV A;  2R9X A;  1TEM A;  3Q81 A;  4ID4 A;  2FH5 A;  5F1G A;  2UWX A;  5TBM B;  4OQH A;  5E43 A;  3VP4 A;  3GSG A;  4DE1 A;  1VQQ A;  2V8F A;  4PM9 A;  4NXG A;  2EWV A;  3UME A;  1XGI A;  2WZZ A;  1DP9 A;  3EWK A;  2XR0 A;  4LV1 A;  3HJK A;  5AQB A;  5FDS A;  1K56 D;  3B42 A;  5AJG A;  1M40 A;  2W27 A;  5GLB A;  1CQA A;  5EFW A;  4ZJ3 A;  1OT6 A;  3N7W A;  3Q7V A;  3DTI A;  4BL2 A;  2QPN A;  2W3E A;  4I38 A;  1M6K A;  4EBP A;  3SOI A;  5F68 A;  1LL8 A;  4OQI A;  1UGU A;  1AXB A;  3IXD A;  2WKH A;  3GEC A;  2O0Y A;  3OOV A;  1XJ4 A;  3HRE A;  1YMS A;  3LIC A;  2W3H A;  1XP4 A;  1K4E A;  3CAX A;  3UDX A;  1JTD A;  4PM8 A;  4KG6 A;  1V9Z A;  3S7O A;  3RXW A;  1W8Q A;  1ERO A;  1F9I A;  1GSV A;  1TS7 A;  4QB8 A;  1CI8 A;  3I7J A;  3WWX A;  2VLG A;  2Y2P A;  3V3R A;  4GOG A;  3G30 A;  5DJT A;  2HGV A;  3CZD A;  4JXV A;  2J3W A;  3LUQ A;  1K6S A;  4EEU A;  1LSV A;  4H8R A;  2HP5 A;  4OP8 A;  4R1G A;  3R7W B;  1OTA A;  2O9A A;  1Z6F A;  3EOI A;  1PWG A;  4S2L A;  2DMW A;  4UEY A;  1N9O A;  4EES A;  4JF6 A;  4Q8I A;  5L8M A;  3T1R A;  4EQI A;  5J3W A;  3N6I A;  2L1M A;  4DMZ A;  4F3L A;  5CXW A;  3LFV A;  1G5U A;  3BJN A;  5FEF A;  3AGD A;  1HTZ A;  2XK1 A;  5L09 A;  2Z6C A;  1DJC A;  4BBT A;  5EVI B;  1UWN X;  4U0X A;  3FPW A;  3SW1 A;  3NDG A;  4EWF A;  1P9W A;  2WKI A;  3NCK A;  2AVX A;  3VE3 A;  3O5Y A;  3BFD A;  5F1F A;  1H0M A;  5FQK A;  1XXM A;  3MBZ A;  3VFF A;  4EUZ A;  2R78 A;  4KZ6 A;  4B9O A;  3BYD A;  1LSX A;  2ZC6 B;  4RX2 A;  4HP9 A;  4N9L A;  3EQV A;  4CPK A;  1P97 A;  3BY8 A;  1TVF A;  5C5K A;  2HDU A;  5HWT A;  1PI5 A;  1N9N A;  2L0W A;  2QYB A;  4D60 A;  4XUX A;  1A0K A;  4IBR A;  3U2A A;  4NXE A;  4MNR A;  1IYQ A;  1N9B A;  1XA1 A;  3UE1 A;  3MMH A;  4JXG A;  5F69 A;  3U4L P;  3L9K A;  2Y2N A;  5HSQ A;  5U47 A;  3PBO A;  2PBD P;  3D3O A;  3SS3 A;  2XA7 S;  4JGP A;  3KYZ A;  3HCY A;  1F5M A;  4JKT A;  4UAA A;  1XFN A;  4PMA A;  5KSH A;  2HP6 A;  4KZ5 A;  3PAE A;  1GHM A;  3B3X A;  4I39 A;  5HWV A;  3FYZ A;  4G3K A;  3OC2 A;  3VOL A;  5TJJ A;  1N9L A;  2Z2M B;  2ZQ7 A;  3F1P A;  2GNX A;  1DP6 A;  3NIA A;  4E04 A;  2CC1 A;  4Y2F A;  2JE5 A;  4Y3I A;  5EVE A;  3HLF A;  5J4E A;  1CJF A;  3G31 A;  3Q82 A;  3R4K A;  3FC7 A;  4HJ6 A;  3UO9 A;  3IS2 A;  1N4O A;  1FIK A;  3BM6 A;  2FFF B;  2BG1 A;  5FA7 A;  2A24 B;  3G6O A;  4HEF A;  1BYW A;  4CLC C;  2YKF A;  3NUL A;  2B5R A;  3IQA A;  4FUW A;  4QY6 A;  2Y8H A;  3SS5 A;  3DTE A;  3WS2 A;  4S2J A;  3CUE C;  3VOZ A;  4CJN A;  4CQH A;  3ICY A;  3BLS A;  3F1O A;  2H0T A;  3CI6 A;  3ZNT A;  1Q2Q A;  2EA9 A;  4EET B;  5L10 A;  3LO7 A;  2BTF P;  1FIL A;  5GLA A;  1T1B A;  5MC7 A;  2GDN A;  1K0K A;  3IWQ A;  4XUZ A;  2IWB A;  1SDN A;  4GKU A;  2XRO A;  1MPL A;  3RXX A;  3VP1 A;  4HNB A;  1EWZ A;  3E0Y A;  4JGQ A;  3IBR A;  2FFY A;  4KZA A;  1GA9 A;  3ZG9 B;  1VET A;  2X71 A;  4QU3 A;  2ACG A;  3T4O A;  3NHQ A;  3LI9 A;  2EXA A;  3IWI A;  3KYQ A;  1KGE A;  1YSQ A;  2KOI A;  4NXB A;  2V9A A;  2VGL S;  1WE4 A;  5DVA A;  1NLZ A;  1T19 A;  3UB6 A;  1F98 A;  4S2P A;  2PU4 A;  1P9R A;  4EBL A;  2Z2L B;  4HHD A;  1L0F A;  2V0U A;  3V3S A;  5TGF A;  2H0Y A;  1OTI A;  4K91 A;  3F1P B;  3A3D A;  2NUT C;  2OOL A;  2R9W A;  5EUA A;  3PBN A;  4QHC A;  3W4O A;  1PIO A;  3P01 A;  3LEZ A;  5AVF A;  3M2K A;  1MC0 A;  3W4P A;  4P87 A;  3SH9 A;  3GV9 A;  3TSG A;  3RJU A;  4ARZ B;  3MF0 A;  2WGW B;  2VX8 A;  4CLC E;  3FWL A;  2E8J A;  2VA0 A;  1D06 A;  2HJE A;  2WZX A;  3VSL A;  4DE3 A;  3JVV A;  2LB9 A;  1KGF A;  3LR4 A;  4NXF A;  4HJ4 A;  4S2K A;  2VK3 A;  2Y2I A;  2H5S A;  2QJ7 A;  1KE0 A;  2Y2H A;  2VV8 A;  1EW0 A;  1FCN A;  5DTK A;  1BLS A;  2ZMF A;  1LHY A;  5GLC A;  4HH3 A;  1XPB A;  2JKT M;  1W8Y A;  4PM7 A;  2WYX A;  2DNS A;  1FR6 A;  4GHI A;  5M19 A;  4HH2 A;  1K55 A;  3T1X A;  1PW8 A;  3EEH A;  4KQD A;  3G2Y A;  4E3M A;  3QP6 A;  2WUQ A;  3BW6 A;  5FI2 A;  2PYR A;  3LIE A;  3T4Q A;  4S2I A;  4WF0 A;  5GHZ A;  1MY8 A;  4S2O A;  1BSG A;  4U0T A;  1IOU A;  2B02 A;  2ZQA A;  3M2J A;  1D7E A;  4BLM A;  1GSW A;  3TOI A;  2W1T A;  4FCF A;  5EM0 A;  1ZC2 A;  1S1Y A;  3QNB A;  1PWC A;  2CMN A;  2O99 A;  1CEF A;  4GDN A;  2Y79 A;  3B47 A;  1YPR A;  3IXH A;  2HJ9 C;  4L0L A;  2J3T C;  3BFC A;  4G3V A;  4LCL A;  1Y28 A;  4R4R A;  4HBU A;  3WRT A;  2QMI A;  3EGX C;  1NYY A;  2A49 A;  4QY5 A;  3UE3 A;  3OPP A;  5L07 A;  3ZVT A;  4LCM A;  2ZOI A;  4HP4 A;  3RFB A;  3ISG A;  2C5W B;  2KX6 A;  3PBQ A;  2WGI A;  3KSI A;  4IVK A;  3W8K A;  1H8Z A;  3VOY A;  3H82 B;  1YSP A;  5E2F A;  4KZ9 A;  5HPI A;  1LT0 A;  1YM1 A;  5E2E A;  4WL9 A;  3BEC A;  1LSW A;  2QWS A;  2BLS A;  2V20 A;  3IX8 A;  4WN5 A;  4KZ7 A;  1I2S A;  4KEN B;  4L9F A;  4O01 A;  4E3I A;  3DW0 A;  1OPX A;  4JLF A;  2PDR A;  4II7 A;  2P9V B;  3H9W A;  1L3L A;  4JF5 A;  3PBT A;  2BAS A;  2Y2K A;  4GN2 A;  3TG9 A;  2WKE A;  2WGW A;  2RCX A;  4OH0 A;  3MXR A;  5EM1 A;  2XQZ A;  2UV0 E;  3RTY A;  3A3E A;  4BBV A;  2ZM8 A;  3S4X A;  4I3J A;  2RL3 A;  4X25 A;  3FG8 A;  2W3F A;  3L7H A;  1KE4 A;  5G4Y A;  1SKF A;  2OLU A;  3UPP A;  3H7W B;  3NY4 A;  3CHW P;  5FQI A;  3LIF A;  4MBK A;  2OV5 A;  2EXB A;  1K54 A;  1GA0 A;  1IEL A;  1L0E A;  1ERM A;  4WM9 A;  5HL6 A;  1XA7 A;  3BLM A;  1BLC A;  4PPR A;  1D1J A;  2OWJ A;  5F82 A;  3C4P A;  3ZYT A;  5DTS A;  2V8C A;  3WRZ A;  2GX5 A;  4KZ3 A;  1VHM A;  4NET A;  3A0V A;  3BQA A;  2HZ5 A;  4LFU A;  3GDI A;  1T1A A;  3MZD A;  4DN0 A;  4BD1 A;  4ZJ1 A;  3CUE A;  3D9Y A;  3ZFZ A;  5HX9 A;  4U3T A;  3MZE A;  1S0W A;  1L2S A;  5D3O A;  4IUK A;  3S1Y A;  5EE8 A;  4RX3 A;  4ZDX A;  3OCL A;  5CTN A;  4DXC A;  3NDE A;  1ZKJ A;  4MN5 A;  4O8G A;  4OPQ A;  2WKP A;  3DWK A;  1WA9 A;  5CTM A;  4EEP A;  1KOU A;  5HD5 A;  5FI7 A;  2Q9N A;  2P04 A;  2VEA A;  4GDB A;  3C7U A;  1ALQ A;  1HZO A;  2XGN A;  4MLL A;  1FSY A;  3PBS A;  4WZ4 A;  1MBL A;  1J9M A;  3MZF A;  2JC7 A;  3N8R A;  4WEL A;  1TF1 A;  1YKD A;  2EFX A;  4KZ8 A;  1BTL A;  3PXP A;  3T12 B;  1S4S A;  4OOY A;  3UDI A;  2PBY A;  3KSG A;  1EI5 A;  3FPV A;  1MWR A;  4R70 A;  3WS4 A;  1ZHH B;  4ZRR A;  3H7W A;  4Q0I A;  3HUM A;  3ZVW A;  5J7E A;  1ESI A;  1CI9 A;  2Y2O A;  4M3K A;  1CK3 A;  3C8C A;  3HLB A;  3W4Q A;  2GJ3 A;  3QP8 A;  3IBJ A;  1MZU A;  2KLI A;  4NEE D;  3BQ8 A;  2D02 A;  5CHU A;  5JYP A;  4WZ5 A;  2VV6 A;  2WK0 A;  5EVI C;  1XJ2 A;  5HAR A;  1RCJ A;  1NZO A;  4WMC D;  3R7W A;  2VGL M;  4GLQ A;  1K25 A;  2JKR I;  3Q7Z A;  4DJ3 A;  2MJ6 A;  3ITA A;  1PWD A;  1TDG A;  4IJG A;  1YQS A;  5DKL A;  5HDD A;  4LEN A;  3E4O A;  1H8Y A;  2ZQ9 A;  3GMW A;  4XXR A;  4BQM A;  4Y13 A;  4QD4 A;  2W1R A;  4UQI M;  4BEN A;  1P0Z A;  2M1C A;  4K08 A;  4RVA A;  5CED A;  4PKY A;  3SH7 A;  1SDE A;  1WYC A;  4OON A;  3VFH A;  4P6Z S;  3ULF A;  2VGJ A;  5FI6 A;  5HAI A;  1KVL A;  5EVI A;  4Z1W A;  1O07 A;  3VE4 A;  3NI9 A;  3GTC A;  4BMW A;  3D72 A;  3LIB A;  5HAP A;  2G7U A;  3CMZ A;  4RA7 A;  4YNR A;  5FSR A;  2Y91 A;  1E3U D;  3HLW A;  5DF8 A;  5J8X A;  1K55 C;  1L0G A;  2ZMA A;  3ZNY A;  4GB7 A;  4AFI A;  3EEA A;  3CIT A;  3UY6 A;  3T4T A;  2X02 A;  2Y2L A;  2HP9 A;  1MKI A;  3S22 A;  1YLT A;  3KYE A;  3NBL A;  5KZH A;  3P98 A;  1I5Q A;  5AQ9 A;  4C75 A;  3O88 A;  3LIA A;  2G2W A;  1YLP A;  4C3Q A;  2B95 A;  1WYB A;  3DWZ A;  3KSF A;  1JWZ A;  1RGZ A;  2HF6 A;  5GHX A;  3S7P A;  4H6J A;  5FL3 A;  2JBF A;  3BEB A;  3OPR A;  2W1T B;  4WYY A;  4KQR A;  2PRF A;  3O87 A;  4HES A;  1PRQ A;  4HY8 A;  4X1L A;  4L9G A;  2DCF A;  3LR3 A;  4LPZ A;  1KDW A;  1DRM A;  3HLD A;  3S7Q A;  2HDS A;  1XGJ A;  3UE6 A;  4P0M A;  3IXB A;  3PHY A;  3G32 A;  1XJ3 A;  1XFQ A;  4X68 A;  2ZC5 B;  3K3C A;  3UE0 A;  2QKP A;  2J3T D;  5AVE A;  1XJ6 A;  3MXS A;  1ONH A;  2OWH A;  2ZQD A;  2PT7 A;  3IXG A;  4WBG A;  5CER A;  1DJA A;  2ZJ9 A;  1PZO A;  4KZB A;  3IF6 B;  3N4I A;  1PNE A;  1KVM A;  3VP3 A;  4WEJ A;  2A24 A;  3LY3 A;  4D2O A;  4I5S A;  3LY4 A;  2WGV A;  3CPT A;  2ZQC A;  2L4R A;  2JCH A;  4E6X A;  1GCE A;  3MS6 A;  3VV4 A;  3T4L A;  5A8B A;  3BRM A;  3GQZ A;  3BWL A;  2JKR M;  4E3K A;  3Q1F A;  5EV0 A;  2XD1 A;  1PFL A;  3BFF A;  1AWI A;  2JKG A;  4N92 A;  1OJ5 A;  5CGX A;  3A0R A;  3SH8 A;  3F1N A;  1YMX A;  2XD5 A;  3MKF A;  2WAE A;  4EXO A;  3C38 A;  4FH2 A;  5IS1 A;  4E3O A;  1ZG4 A;  5E2G A;  4MN6 A;  5HFO A;  2O9B A;  4ZBE A;  3MKE A;  4H6J B;  4YFM A;  2PR6 A;  3D4F A;  5LBR A;  2W3D A;  3LEQ A;  1BUL A;  4EU0 A;  1IKI A;  1JWV A;  2XSS A;  2ZC7 A;  2XH9 A;  5DTT A;  4B4Z A;  1NWZ A;  3VSK A;  4Y7P A;  4JBF A;  5KSC A;  4ARZ A;  4Y17 A;  5EPH A;  3C4O A;  5CHM A;  3UDF A;  4EW7 A;  2E8I A;  1MWS A;  1OT9 A;  2OAQ 1;  1LI0 A;  3QP2 A;  4KQO A;  4CLC B;  5M1A A;  5L2F A;  1NY0 A;  4R3J A;  1HD8 A;  1K57 A;  3KX0 X;  1K38 A;  3PR6 A;  2Y55 A;  4LLO B;  5G4Z A;  2J9P A;  1X0O A;  4ZJ2 A;  4B4X A;  2K2N A;  5DF9 A;  2PD7 A;  4LRY C;  2ZMV A;  3FZC A;  4LRX C;  4R38 A;  1Y4O A;  3ZDJ A;  1VEU B;  2C6W B;  5HPF A;  1BLP A;  3KO6 A;  4RYE A;  3IT9 A;  3VP2 A;  4GD8 A;  4Y0T A;  4X53 A;  4IED A;  1SKO B;  4UA7 A;  4JF4 A;  1RP5 A;  3CPT B;  3ZCZ A;  3HLE A;  2PYP A;  1G68 A;  2YKH A;  1W63 M;  1K57 C;  4QWO A;  4HBT A;  1H8M A;  2J8Y A;  3C5A A;  1ES2 A;  2QHK A;  3JVU A;  5FQJ A;  3UN7 A;  5HDS A;  5FAT A;  3T4J A;  1PI4 A;  4OOL A;  1H3Q A;  4BL3 A;  3MQ0 A;  2W0N A;  5IT5 A;  5CEC A;  1YLW A;  3HLG A;  2XFS A;  3F1N B;  4IBX A;  1S4R A;  5TBM A;  5CGS A;  1MKM A;  1L0D A;  1TS6 A;  3B33 A;  3OPL A;  1TS0 A;  1Y54 A;  4P85 A;  2P08 A;  1YAX A;  3OCN A;  4OKP A;  2NUP C;  1ZG6 A;  3AGE A;  2GZA A;  2HDQ A;  3K3D A;  3G4P A;  4WZ5 C;  3UMD A;  2WKQ A;  5KIZ A;  1NJ4 A;  3E2L A;  3IX3 A;  2P7J A;  2XA7 M;  3UB8 A;  1ES4 A;  1FSW A;  1W5D A;  2V1Z A;  1S67 L;  4E3J A;  5A93 A;  3W2Z A;  4KUK A;  1QME A;  2H10 A;  2Y4A A;  3WS0 A;  3HVF A;  1DJB A;  4DJ2 A;  4OQG A;  4ETX A;  2Q0O A;  2V1A A;  4DDY A;  5K5B A;  3DAV A;  4EBN A;  5A91 A;  3M6B A;  3OBF A;  4OPZ A;  4DE0 A;  3NOU C;  4Q0H A;  4ETZ A;  3MR0 A;  1MXO A;  3Q7V B;  3ZG8 B;  2K7S A;  5F5Y A;  4O7D A;  3DBA A;  3T1Q B;  1OTE A;  1OME A;  4F94 A;  1KGG A;  4KZ4 A;  2I72 A;  3K2N A;  2P9V A;  5F6A A;  1NRF A;  2ZQ8 A;  4FSF A;  3NOT C;  3GVB A;  2Y59 A;  1XX2 A;  1ESU A;  2EX8 A;  2JN7 A;  1HLU P;  3PBR A;  5DFX A;  4QJG A;  1DY6 A;  4ESP A;  4WMC A;  5FQM A;  4BD0 A;  1BT5 A;  1LLB A;  4I3A A;  3E4P A;  3G35 A;  2VJW A;  3QP4 A;  1MWU A;  3MJQ A;  4M4X A;  5CHJ A;  2D01 A;  4MCW A;  1GSX A;  4Y15 A;  5GLD A;  4JGO A;  3ZG7 B; 
#chains in the Genus database with same CATH homology
 2V0U A;  3EEA A;  3CIT A;  3OLO A;  3T4T A;  2M7V A;  4MMN A;  1OTI A;  4Y5F A;  2WKR A;  3F1P B;  5CX7 A;  2J80 A;  5DJU A;  2NUT C;  2OOL A;  3PBN A;  2VV7 A;  4BWI A;  3P01 A;  4GCZ A;  3LIA A;  5AVF A;  4PKY G;  1W63 Q;  3KSF A;  3NOP C;  1MC0 A;  3KSH A;  4WLA A;  2W3G A;  1OTD A;  3S7N A;  2HF6 A;  3S7P A;  4H6J A;  5FL3 A;  3LID A;  2W1T B;  4I3I A;  4ARZ B;  3MF0 A;  4L9E A;  4HY8 A;  3LR5 A;  4L9G A;  2VX8 A;  3LR3 A;  2OAP 1;  3UB7 A;  4LPZ A;  4CLC E;  2JHE A;  4F3L B;  3CLO A;  2VA0 A;  1D06 A;  2HJE A;  4EQ1 A;  1IFQ A;  1DRM A;  1ODV A;  3JVV A;  3S7Q A;  4MDZ A;  2LB9 A;  1JNU A;  2A2L A;  3BY9 A;  3LR4 A;  1NLY A;  3UE6 A;  5HDC A;  4NXF A;  4HJ4 A;  5HZH A;  2FH5 A;  4OOM A;  1G28 A;  4B93 A;  5TBM B;  3PHY A;  1XJ3 A;  2QJ7 A;  1XFQ A;  4NXG A;  2EWV A;  3K3C A;  4XT2 B;  2VKS A;  2QKP A;  3UME A;  2VV8 A;  1EW0 A;  2J3T D;  5AVE A;  1DP9 A;  3EWK A;  3V67 A;  2ZMF A;  1XJ6 A;  4HH3 A;  3HJK A;  2JKT M;  2M7U A;  3T4K A;  2OWH A;  3B42 A;  2PT7 A;  4GHI A;  4HH2 A;  3EEH A;  5AJG A;  4KQD A;  2W27 A;  5EFW A;  1OT6 A;  4FOF A;  1S1Z A;  3BW6 A;  2W3E A;  4I38 A;  3RH8 B;  2PYR A;  3LIE A;  3T4Q A;  5F68 A;  4WF0 A;  1LL8 A;  3UB9 A;  1UGU A;  4WEJ A;  2H28 A;  2A24 A;  2FZ0 A;  2PR5 A;  1IOU A;  2B02 A;  4I5S A;  1D7E A;  3E98 A;  1GSW A;  3IS2 B;  3GEC A;  2W1T A;  2O0Y A;  1S1Y A;  3OOV A;  1XJ4 A;  2CMN A;  1UWP X;  2O99 A;  3LIC A;  2L4R A;  2W3H A;  2Z6D A;  2Y79 A;  3B47 A;  3T4S A;  3VV4 A;  3LR0 A;  3T4L A;  2HJ9 C;  3CAX A;  4L0L A;  1TS8 A;  2J3T C;  5A8B A;  4G3V A;  1Y28 A;  1NRJ A;  3BWL A;  1V9Z A;  2JKR M;  3S7O A;  1F9I A;  2ZBB A;  1GSV A;  1TS7 A;  3NJA A;  3EGX C;  1OJ5 A;  3A0R A;  2VLG A;  3UE3 A;  3F1N A;  3TRC A;  5DJT A;  2HGV A;  2J3W A;  2ZOI A;  4EXO A;  4HP4 A;  3LUQ A;  3C38 A;  3RFB A;  5DFY A;  2KX6 A;  4EEU A;  3PBQ A;  3KSI A;  1LSV A;  4WUJ A;  2IA2 A;  3TJZ C;  5IS1 A;  4P6Z M;  3H82 B;  1YSP A;  5HPI A;  4Q0J A;  1TD5 A;  1LT0 A;  3MQO A;  4WL9 A;  1LSW A;  2QWS A;  4MN6 A;  1OTA A;  1T1C A;  3R7W B;  2O9A A;  3EGD C;  3EOI A;  4WN5 A;  2O9B A;  4L9F A;  4O01 A;  4GS9 A;  2DMW A;  2EWW A;  3A0S A;  4UEY A;  1N9O A;  1OPX A;  4EES A;  2PD8 A;  2PDR A;  4HJ3 A;  4II7 A;  3H9W A;  5L8M A;  4H6J B;  2PR6 A;  3PBT A;  2BAS A;  5LBR A;  2W3D A;  5J3W A;  2L1M A;  4DMZ A;  5HWW A;  4EU0 A;  4F3L A;  3RTY A;  2XSS A;  3LFV A;  3BJN A;  3P7N A;  4BBV A;  4I3J A;  1NWZ A;  3FG8 A;  2W3F A;  4BBU A;  5G4Y A;  4ARZ A;  4MN7 A;  2Z6C A;  5DKK A;  3H7W B;  4EW7 A;  4BBT A;  3F1O B;  1OT9 A;  1UWN X;  2OAQ 1;  2HV1 A;  3FPW A;  3SW1 A;  4KQO A;  3LIF A;  4CLC B;  1VB6 A;  1P9W A;  3HJI A;  5HD3 A;  4XT2 A;  2XRN A;  4KUO A;  3VE3 A;  3O5Y A;  5I5L A;  4R3A A;  3KX0 X;  4YWZ A;  4PHT A;  3PR6 A;  4LLO B;  5G4Z A;  2R78 A;  3EQU A;  2I9V A;  1X0O A;  3MXQ A;  4B9O A;  1LSX A;  3TW8 A;  4HP9 A;  2K2N A;  5DF9 A;  2O9C A;  5HL6 A;  3EQV A;  1V9Y A;  1P97 A;  3BY8 A;  2PD7 A;  4LRY C;  5C5K A;  2ZMV A;  5HWT A;  2OWJ A;  3LI8 A;  4LRX C;  4R38 A;  4LRZ E;  3ZYT A;  5HPF A;  1N9N A;  2ZOH A;  2L0W A;  3KO6 A;  2GX5 A;  1VHM A;  2QYB A;  3A0V A;  2V1B A;  3BQA A;  3E4Q A;  3U2A A;  4JGR A;  3GDI A;  1T1A A;  4NXE A;  2PHY A;  4DN0 A;  2K31 A;  4WEK A;  4PAU A;  3CUE A;  3PYP A;  2PYP A;  1T18 A;  2JKT I;  2YKH A;  3T50 A;  1W63 M;  4HQA A;  1H8M A;  3MMH A;  4CLC D;  1OJG A;  5F69 A;  2QHK A;  2LB5 A;  3JVU A;  5HSQ A;  5HDS A;  2QJ5 A;  4IUK A;  3T4J A;  1G6O A;  4OOL A;  4R6L A;  3PBO A;  1H3Q A;  4UQI S;  3MQ0 A;  2W0N A;  5IT5 A;  3D3O A;  2XA7 S;  3OCL A;  4JGP A;  3KYZ A;  3HCY A;  3MFX A;  1F5M A;  1XFN A;  4MN5 A;  3F1N B;  4O8G A;  5KSH A;  1S4R A;  4G3W A;  5TBM A;  2WKP A;  4EEP A;  1WA9 A;  4IHQ A;  1KOU A;  1MKM A;  4I39 A;  2V0W A;  5HWV A;  4O0P A;  5HD5 A;  1TS6 A;  1S66 L;  4G3K A;  3B33 A;  3OC2 A;  3VOL A;  5TJJ A;  1TS0 A;  1N9L A;  2P08 A;  3F1P A;  2GNX A;  1DP6 A;  1ZTU A;  1YAX A;  2P04 A;  2VEA A;  3OCN A;  4E04 A;  4Y2F A;  2NUP C;  4Y3I A;  3PBS A;  5J4E A;  2GZA A;  4GS9 B;  3K3D A;  4HI4 A;  3R4K A;  3FC7 A;  4HJ6 A;  4WEL A;  1TF1 A;  2WKQ A;  4YOF A;  3UMD A;  5KIZ A;  1YKD A;  3IS2 A;  3PXP A;  1S4S A;  2P7J A;  2XA7 M;  3KSG A;  3UB8 A;  1DP8 A;  3FPV A;  2A24 B;  1S67 L;  3G6O A;  3W2Z A;  1BYW A;  4CLC C;  2YKF A;  4KUK A;  4R70 A;  1ZHH B;  2Y8H A;  4ZRR A;  4DJ2 A;  3H7W A;  4Q0I A;  3CUE C;  4ETX A;  5J7E A;  2VZW A;  2V1A A;  3C8C A;  5K5B A;  4CQH A;  2GJ3 A;  1STZ A;  3IBJ A;  1MZU A;  3ICY A;  2KLI A;  4GHI B;  4HOI A;  3BQ8 A;  4NEE D;  3F1O A;  2D02 A;  3OBF A;  3ZQ5 A;  3NOU C;  4Q0H A;  3C30 A;  2VV6 A;  3CI6 A;  3TE8 A;  3MR0 A;  4ETZ A;  4ME4 A;  2EA9 A;  1XJ2 A;  2K7S A;  4EET B;  4GW9 A;  4GJ4 A;  4NKP A;  5F5Y A;  1T1B A;  4IUH A;  3R7W A;  2B18 A;  2VGL M;  3DBA A;  5MC7 A;  1OTE A;  4GLQ A;  2JKR I;  4DJ3 A;  2MJ6 A;  3H82 A;  3K2N A;  4IJG A;  3C2W A;  4EER A;  5F6A A;  2INW A;  5DKL A;  5HDD A;  4FSF A;  3E4O A;  4QPR A;  2XRO A;  2W1R A;  3NOT C;  4UQI M;  1P0Z A;  2M1C A;  2JN7 A;  4K08 A;  4HNB A;  3PBR A;  3CWF A;  4PKY A;  3E0Y A;  5DFX A;  4JGQ A;  3IBR A;  4P6Z S;  1OTB A;  3ULF A;  4HIA A;  4EUV A;  2KDK A;  4Z1W A;  3VE4 A;  4BMW A;  3D72 A;  3T4O A;  3LIB A;  3NHQ A;  3MQQ A;  4I3A A;  4CLC A;  3LI9 A;  3E4P A;  3KYQ A;  1YSQ A;  2G7U A;  2KOI A;  4NXB A;  2V9A A;  2VJW A;  4YNR A;  2VGL S;  4RQ9 A;  3MJQ A;  1NLZ A;  4M4X A;  1T19 A;  3UB6 A;  1F98 A;  2D01 A;  4MCW A;  4BJP A;  5IU1 A;  1P9R A;  1GSX A;  3LYX A;  4AFI A;  4HHD A;  4JGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...