5HD3A

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: dark structure of photoactive yellow protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 36
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hd3A00
1DP6A 2QKPA 3NOTC 5J3WA 2P7JA 4EXOA 1S1ZA 2W0NA 4L9EA 3NOPC 3D72A 3LUQA 4KUOA 2W27A 5HDSA 1VB6A 4HJ3A 2WKQA 3E4QA 3KX0X 4PKYA 4F3LA 1S4RA 4R38A 1OTBA 1XFQA 1TS7A 2V1BA 5J7EA 1ODVA 3P7NA 2H28A 2R78A 3ZQ5A 4EERA 5AVEA 5HWTA 5KIZA 2V9AA 4RQ9A 4EETB 2PHYA 3EEHA 2A24B 5DKKA 4HQAA 1UWPX 2PR6A 1DRMA 3F1OB 3F1NA 4HH2A 2PDRA 4EEUA 1S66L 3CWFA 2D01A 1N9LA 3LIEA 1OTEA 3A0RA 3NHQA 4I5SA 1D7EA 3GECA 4LRZE 1T1AA 3IS2A 4H6JA 1XJ3A 2JN7A 4DJ2A 5F5YA 5HD3A 3H7WA 3CLOA 3E4OA 1XFNA 4K08A 2VV8A 4XT2A 2OWJA 3G6OA 3BY8A 4HHDA 3UMEA 5HWVA 2Z6DA 4HP9A 5DJTA 4EQ1A 5AVFA 2YKFA 3K3DA 5G4YA 3NJAA 4R70A 3IBRA 2I9VA 3H82A 3H9WA 4JGQA 3LIAA 3NOUC 1G28A 2PD8A 2VEAA 1GSVA 3F1NB 3LICA 5EFWA 3VE4A 1TS8A 4WLAA 2V0UA 2QWSA 5J4EA 4R3AA 4MN5A 2KDKA 4NXGA 1T1CA 4HJ4A 2PYPA 4I3IA 5HZHA 4HNBA 2QJ5A 5TBMA 4LPZA 1LT0A 3ICYA 1XJ6A 1GSXA 3VOLA 2VLGA 1OTDA 5HWWA 4GHIA 4LRYC 3HJIA 5F6AA 2J80A 1D06A 3EWKA 3BWLA 4NXBA 1P97A 4JGRA 2INWA 1WA9A 1UGUA 2GJ3A 1NWZA 3SW1A 3T50A 1DP9A 2VV7A 4EESA 4I3AA 3H82B 1S4SA 3UMDA 1XJ4A 1P0ZA 2WKPA 5HDDA 5F68A 4HOIA 1OJ5A 4HH3A 1T19A 2WKRA 2QJ7A 3HJKA 3LI8A 2EA9A 5IU1A 3UB8A 2Z6CA 4E04A 1JNUA 3MR0A 4MN6A 4HY8A 4HIAA 2OOLA 1F9IA 1EW0A 4LRXC 5I5LA 4JGPA 3LI9A 4F3LB 3F1PA 4GW9A 5DKLA 4GS9A 4LLOB 3CAXA 2YKHA 2A24A 3F1OA 4WF0A 3LIDA 4NXEA 4YWZA 3PYPA 2L0WA 5IS1A 3C2WA 3RTYA 2L4RA 2V1AA 4HP4A 1LL8A 3UE6A 1TS6A 5HSQA 3UB9A 2K7SA 1S1YA 1T18A 4PKYG 2VV6A 3C8CA 5HDCA 2L1MA 3MFXA 1OTIA 2ZOIA 3IS2B 4WUJA 1GSWA 4H6JB 2CMNA 4BBVA 1DP8A 1S67L 3MXQA 4L9GA 2M1CA 4L9FA 3LYXA 1OT6A 1UWNX 1V9YA 4HJ6A 1BYWA 4I38A 3H7WB 3A0SA 3MJQA 4XT2B 1MZUA 4NXFA 4I3JA 2KX6A 2B02A 3MQOA 4DJ3A 4WL9A 1LSVA 3F1PB 4GS9B 1T1BA 5G4ZA 3PHYA 3K3CA 2D02A 3ULFA 2ZOHA 3LIBA 2PYRA 1KOUA 1F98A 2V0WA 1LSWA 5DJUA 2OWHA 1N9NA 2BASA 3OLOA 2PD7A 2JHEA 2HV1A 4HI4A 3GDIA 3BY9A 5HD5A 2QHKA 3LIFA 4EW7A 3FG8A 4BBUA 3VE3A 5A8BA 3A0VA 3E4PA 4KQDA 4M4XA 4JGOA 1OJGA 3UB7A 2PR5A 5TBMB 3MQQA 2ZBBA 1TS0A 3FC7A 1N9OA 4GHIB 4EEPA 5F69A 1X0OA 1OT9A 4KUKA 3B33A 3UB6A 4R6LA 1Y28A 1V9ZA 1OTAA 4I39A 4WN5A 1LSXA 4B9OA 3RH8B 4GCZA 4BBTA 1XJ2A
chains in the Genus database with same CATH superfamily
4WELA 3LO7A 3UDXA 3NOTC 4C75A 4DE1A 3NBLA 4CPKA 3N7WA 4S2NA 5CGXA 3PR6A 3UO9A 1YLPA 4E6XA 4BQMA 3MKEA 2WKQA 3IQAA 3KX0X 4F3LA 5E43A 1NJ4A 1S4RA 3NC8A 3RXXA 4Y5FA 4Q0IA 1HTZA 4H8RA 2Y2NA 1TS7A 4DDYA 5J7EA 1TF1A 2P08A 4CLCB 3UDFA 2H28A 2GNXA 2R78A 2V8CA 2O9BA 4EERA 2DCFA 2V20A 2V9AA 5CXWA 4X56A 2ZLYA 3IH9A 3MSHA 5DKKA 4KG2A 1K55C 1HD8A 2QZ6A 4Q0JA 2XA7S 3QP4A 3CJMA 2ZL1B 5FI2A 3CWFA 2D01A 3SS5A 1YKDA 3A0RA 3BM6A 4B4XA 3WWXA 4OVDA 4KQOA 5G18A 1D7EA 3LCEA 3UE3A 4OLDA 1K56A 5DF7A 3IS2A 4Q0HA 3IHAA 4DJ2A 3CHWP 4E3LA 1AXBA 5FAQA 3D4FA 4DXBA 5HD3A 2I72A 2WGVA 1EI5A 3H7WA 1IFQA 1HLUP 3ZG0A 2DNSA 4XT2A 3W2ZA 2HF6A 3G6OA 4LV0A 3C7VA 3C4PA 5FSRA 3UE1A 1F5MA 2VX8A 3NECA 1PI5A 3QHYA 2J3TC 4MN7A 5EPHA 3K3DA 4LV2A 4QB8A 3ZGAB 3NJAA 2RCXA 1ES3A 3OPHA 3EQVA 3S4XA 3FKVA 3LEZA 2I9VA 3H82A 4BJPA 4E3JA 4JGQA 3C5AA 1SHVA 2ZQ9A 5M1AA 3RJUA 4GZBA 5DF9A 4O0PA 2Y2OA 3F1NB 2HJ9C 2P74A 1YLYA 1TS8A 1H8ZA 2PU4A 4DRTA 3QP2A 2V0UA 4CLCE 3OPLA 2ZMAA 2K31A 4HJ4A 3ZYTA 3CI6A 2FH5A 5CECA 2EX9A 4JBFA 4KZ7A 1ZKJA 3G34A 2ZC3B 4Y3IA 4G3KA 2BLSA 5F6AA 3W4OA 3BFFA 4EQIA 1D06A 2WKHA 4GB7A 3S1YA 2FZ0A 2O9AA 3PBSA 3EEAA 4ETXA 1H5XA 1GHMA 2OAQ1 1NWZA 3T50A 2JKTM 3M2JA 5KZHA 4OQ0A 4RVAA 5EVLA 4DF6A 4HOIA 2BTFP 1LHYA 3QP6A 1SZVA 2QJ7A 4KG6A 3KYEA 3LI8A 5IU1A 3BQ8A 1LLBA 2Z6CA 1VQQA 1KE0A 4MN6A 4UQIM 4HY8A 5GHYA 1F9IA 1K57C 4S2JA 3S7QA 3MS6A 1P9RA 2P9VB 1XA1A 5GLDA 3CAXA 1NLYA 5EVIC 4WF0A 3LIDA 4EU0A 4X1LA 1YAXA 5HARA 3GTCA 3DWZA 5IS1A 3RTYA 3R7WA 1O07A 4PM9A 2EFUA 1Q2PA 3W8KA 1Y54A 5MC7A 5FATA 3T4QA 3ITBA 2GZAA 3DBAA 3HLBA 4X1MA 3UPOA 3UE6A 1NRJA 1ACFA 1TS6A 5HSQA 4LV1A 3N4IA 1PFLA 1IEMA 2VV6A 3PBQA 1SKOA 3EQUA 4E3NA 2O0YA 3MFXA 1ES5A 4ZJ1A 2WGIA 2A3UA 2XD1A 1QMFA 4QY6A 1N9BA 4BBVA 1S67L 4UEYA 4ME4A 4BL2A 1PWDA 4S2MA 2M1CA 3C4OA 5IT5A 1V9YA 5FQQA 1BYWA 3EOIA 1M6KA 1F2KA 3IXHA 1XXMA 3C38A 3PXPA 4KZ8A 3MQOA 4OP8A 3PAGA 5CTMA 2HP9A 5I94A 3K3CA 3PBOA 2ZOHA 4QJGA 3BEBA 2PYRA 3T4OA 3DWKA 1K25A 2VGKA 5DJUA 2OWHA 3G31A 1N9NA 3OLOA 2PD7A 3A3IA 3GDIA 4CJNA 4EW7A 4BBUA 4BWIA 1NYYA 1E3UA 4PM8A 4WZ5A 4EUZA 3RXWA 5A8BA 3A0VA 4KQDA 3IH8A 1G68A 5HW3A 4JGOA 3L9KA 4X25A 5E2GA 3Q1FA 3W4QA 4S2OA 5TBMB 1PWCA 3CPTB 3T1RA 3GV9A 2WYXA 3VMAA 1YPRA 2XA7M 1CEFA 5EOOA 4EEPA 3QP5A 5EM1A 1X0OA 3ZVWA 3OZHA 1JWZA 3BW6A 4JF6A 1ESIA 1Y28A 3MZFA 4WEKA 1BTLA 3B3XA 4OPZA 2J3TD 3EGXC 5FDHA 4LV3A 4MMNA 2ZQ8A 1W63M 4OOYA 1MPLA 2QKPA 3T4TA 3O86A 5L09A 4MNRA 5J3WA 5E2EA 4EXOA 4YNRA 3OCNA 4GDNA 5GHXA 2Q9NA 2W27A 4MLLA 4EBNA 2EFXA 4WZ5C 4HJ3A 1ALQA 2ZMFA 5HDSA 4BENA 3UY6A 1NZUA 4GNUA 2ZM2A 4MBHA 4X6TA 1LL9A 1OTBA 1K56D 2G2WA 4AFIA 1LI0A 4FH2A 3ZQ5A 1TVFA 3FKWA 2WGWB 5BOHA 5HWTA 2WAEA 4EETB 4E3KA 3LY4A 4HH2A 3F1OB 2Y2QA 1MKMA 3N8RA 2Y59A 4IBRA 1YSPA 1N9LA 4R4SA 3GR2A 2XGNA 4N1HA 1KDSA 1PWGA 1FSYA 1VEUB 5TR7A 2JN7A 3O88A 3VFHA 4XXRA 2DRWA 2ACGA 3IX8A 1PI4A 4OPRA 3MXSA 2VV8A 2OWJA 4HHDA 1KVLA 2EXAA 2IWBA 5HWVA 3GMWA 2Z6DA 4OOLA 3Q07A 4ZDXA 1K55A 3ZG7B 3TOIA 2ZQCA 1I2SA 3V3SA 4HESA 3LIAA 5DTKA 4U0XA 3ZCZA 1BLHA 3DTMA 4IJGA 2PD8A 2VEAA 1GSVA 1GA0A 5EVID 3HUMA 2LB9A 4OH0A 4B88A 3LICA 3VE4A 3G2YA 3CG5A 4O01A 1IKIA 4R3AA 2KDKA 2KOIA 1T1CA 2WKEA 1PZPA 5K5BA 3BECA 5EOEA 3LGOA 3N8SA 3G30A 1MXOA 4HNBA 1VHMA 1Z6FA 3HLGA 4LPZA 1FIKA 1KGGA 4DMZA 3ICYA 1GSXA 4P85A 2VLGA 3O5YA 2ZM0A 4JLFA 4GHIA 4R1GA 1J9MA 2H5SA 3HJIA 3NDGA 3TSGA 3FPWA 2J80A 3EWKA 3IF6A 3DAVA 1RGZA 4JGRA 1J3WA 3U2AA 3W4PA 3VP4A 4HEFA 4WM9A 4WYYA 4KZ9A 3M6HA 2Y2HA 2DMWA 5U47A 3A3DA 2GJ3A 2W3FA 3QNCA 3SW1A 4KZ6A 4LENA 1SDNA 4EESA 3H82B 2XROA 1S4SA 3UMDA 2NUTC 1XJ4A 5L8MA 5FI7A 5HDDA 5F1FA 1JTGA 3UDIA 3PAEA 1HZOA 3V67A 3NI9A 2M7UA 1K6SA 5FQKA 2EA9A 1CEGA 2J7VA 5CTNA 1JNUA 4S2PA 2GDNA 3E2KA 4IEDA 2CC1A 2XRNA 4ID4A 5CHMA 2ZD8A 3O3VA 3T1QB 1K0KA 4Y0OA 4CLCA 3Q82A 4S2KA 5HL1A 5M19A 4R4RA 3PTEA 4OQHA 3D3OA 4GW9A 4GS9A 3VOZA 2YKHA 1BT5A 4FH4A 1NZOA 3IF6C 4ZRRA 4YWZA 4II7A 4FTXA 2L4RA 3IWIA 4ZTKA 2V1AA 1YMSA 4E3IA 4LCLA 5C5KA 3BQAA 4NEED 3C7UA 2VA0A 3HLDA 5L2FA 2WK0A 3MZEA 1C3BA 3E98A 1JTDA 1S1YA 3OCLA 3IXGA 3C8CA 5FDSA 4UA7A 2L1MA 4JXWA 2HJEA 1S0WA 4IUKA 4WUJA 1GSWA 4H6JB 2CMNA 1NRFA 4EBLA 5AJGA 1K57A 2PT7A 3C30A 3VOYA 4HBUA 4BL3A 5A91A 4L9FA 5DF8A 1H8YA 3QNBA 4N9LA 3A0SA 3MJQA 4IVIA 2JE5A 4MEZA 1PRQA 1WYCA 4CLCC 3WS0A 5EVIA 4YINA 1MZUA 3Q7VA 3RFBA 1E3UD 3OPRA 4I3JA 3SH8A 2V8FA 3MZDA 2C5WB 1ZTUA 4JXGA 4DJ3A 3GQZA 4DKIA 1YLTA 3HREA 5EUAA 5FAOA 2XR0A 1AWIA 1T1BA 3MMHA 3G35A 3PHYA 4KQQA 1PW1A 4N1XA 3ULFA 4G3VA 1NLZA 3LIBA 4GN2A 2XSSA 2QMIA 1F98A 3MKFA 1VETB 2JCHA 2ZC7A 1BLSA 3MXRA 1WYBA 2BASA 2VGLS 3WS5A 4JPMA 2R9WA 5TFQA 2ZC6B 1DY6A 4KZ4A 4P6ZS 3V39A 4JXSA 2WUQA 3HVFA 2E8IA 1XGJA 2HGVA 3BLSA 2LB5A 1OJGA 1TEMA 2PR5A 5CRFA 2W1RA 2OAP1 2ZBBA 4ARZB 3O87A 2Y2MA 2C6WB 1N9OA 5M18A 3V50A 3QP8A 1OT9A 3PBNA 4Y0UA 3SH9A 3HUOA 4Z9QA 3UB6A 1I2WA 1V9ZA 1RGYA 2XQZA 4OONA 1E4DA 4GCZA 4BBTA 1DP6A 1S1ZA 2XFSA 3D72A 3LUQA 1H0MA 3WS2A 2W1TB 4HBTA 4ESPA 1W79A 2Y79A 3E4QA 4B4ZA 4PKYA 3PBTA 1STZA 2P9VA 4ZJ3A 2J8YA 3KSIA 1XA7A 4OPYA 2JKRI 4PPRA 3P7NA 4KG5A 1K4FA 3DTKA 4K0XA 3M6BA 2H10A 2PHYA 2A24B 4LGWA 1K4EA 1UWPX 2PR6A 4OKPA 2PDRA 4EEUA 3IHBA 1S66L 5GLAA 1DJCA 4KZBA 1YLZA 1OMEA 2V2FF 3HLFA 4ETZA 4I5SA 1BSGA 3GECA 1WE4A 3ZNYA 3KSGA 1XJ3A 1FSWA 3LEQA 5F5YA 1W63Q 2VGJA 2HP6A 3FYZA 2PRFA 1W8QA 1CI8A 2Y91A 3CLOA 1FCOA 1XFNA 5A93A 2B5RA 3P09A 1G5UA 5J8XA 2BG1A 5KSHA 2A49A 1TD5A 3WS4A 4PAUA 5EVEA 2HDQA 5GHZA 1JWPA 4P6BA 1YM1A 5FA7A 2JKGA 2ZJ9A 5DTTA 3CITA 5L10A 3NIAA 3NOUC 3T4KA 2Y8HA 1FILA 3AGDA 4FOFA 2HPBA 4OOMA 4P87A 2ZMVA 5FQJA 4DE2A 2XDMA 2QWSA 5J4EA 5A90A 2Y2LA 1MBLA 1VM1A 3TG9A 4GD6A 1N4OA 4QD4A 4L0LA 4NXGA 1ZC2A 3B42A 2PYPA 3ISGA 1CI9A 2JBFA 3FZCA 3T4JA 2XH9A 2PU2A 3KYQA 5HAQA 2ZC4B 3T12B 2WKIA 5TBMA 1LT0A 3CPTA 2IA2A 1XJ6A 3ZG8B 3OOVA 1OTDA 5HWWA 3IXBA 3ZNTA 4LRYC 1CJFA 2EWVA 1HVBA 3BRMA 5DTSA 1SKFA 2VK3A 1H3QA 3BWLA 4NXBA 3CUEA 5HX9A 4DXCA 2INWA 2UWXA 5HAPA 1W7FA 1IYPA 3BFCA 4NKPA 1SDEA 4OPQA 1ERMA 1ZHHB 3JVVA 1WA9A 4CLCD 1KVMA 1ESUA 1JVJA 4KQRA 3FPVA 2XFTA 4E6WA 1DP9A 2VV7A 3SOIA 2Y2IA 4I3AA 4OQGA 1P0ZA 1QMEA 3UE0A 2PAVP 3WRZA 2WKPA 5F68A 4WEJA 4UAAA 4NK3A 3VP3A 2G7UA 4HH3A 4PM5A 1T19A 2OV5A 3GRJA 3SZTA 1LL5A 2M7VA 1K54A 4XUXA 3UB8A 1FR1A 2Q9MA 4IHQA 1ONHA 2HDRA 4E04A 3MR0A 4K0WA 5I5LA 4LRXC 1EW0A 4KZ3A 1L0GA 4N92A 2QYBA 4E3MA 3LR0A 5CHUA 4JGPA 4F3LB 2WGWA 3QP1A 3P98A 3F1PA 4U0TA 1G6OA 4LLOB 2ZC5B 4JF5A 3F1OA 3CUEC 1PZOA 2J9OA 2Q0OA 4FSFA 4NXEA 5E2FA 3HBRA 3C2WA 1KGEA 3K2NA 4HP4A 1KE4A 2VGLM 2Y2GA 1H8MA 4MCWA 4EBPA 4EWFA 5GL9A 4PM7A 4P6ZM 2J9PA 5DFYA 5FAPA 5HFOA 3A3EA 2VZWA 3DTIA 4JXVA 2KLIA 1T18A 4UA9A 1MY8A 3OPPA 2ZOIA 3IS2B 1CK3A 1K54C 1DP8A 2G2UA 2ZQAA 4KZ5A 1KDWA 2X71A 5HAIA 4L9GA 3LYXA 1G6AA 1OT6A 1TDGA 4I38A 3H7WB 1DJAA 4BMWA 1KE3A 3DTEA 3KSHA 3WS1A 1YT4A 4XT2B 4BD0A 4WBGA 4RX3A 2IWDA 4YOFA 2JKRM 2E8JA 2O9CA 5GLBA 4DDSA 4WL9A 1BUEA 1LSVA 5LBRA 2EX2A 2MJ6A 5JYOA 4GS9B 5G4ZA 3SS3A 2D02A 2K2NA 1L0DA 4P0MA 1KOUA 4F94A 2FFYA 3VP1A 1ONGA 2V0WA 1LSWA 2Y4AA 5EE8A 2XK1A 3BFGA 2WAFA 2JHEA 3JPUA 1FQGA 2HV1A 4HI4A 5HPFA 5DFXA 3S7OA 4CQHA 5HD5A 2QHKA 3LIFA 4X68A 3FG8A 3VE3A 1NYMA 1ES4A 4DN0A 3LR3A 3E4PA 5CEBA 4S2NC 4M4XA 5AQ7A 4D60A 5EECA 4BD1A 2B95A 3HLWA 1TS0A 5FEGA 3VFFA 2WADA 3GSGA 2ZL1A 2QPNA 2B18A 3CZDA 4Y0TA 4IUHA 5F69A 3ZVTA 1MWTA 5EVIB 2VKSA 4KUKA 3Q7VB 1TDLA 4WZ4A 4R6LA 4I39A 3IX4A 1E25A 5FI6A 4O7DA 1LSXA 2OLVA 5CX7A 3V3RA 3M2KA 4B9OA 1PNEA 3ITAA 3RH8B 3E0YA 3T4SA 3HLCA 1NXYA 4Y7PA 5FQIA 4WMCD 2W3EA 3MBZA 5TJJA 2P7JA 1FCNA 2W0NA 4L9EA 3NOPC 4KUOA 3FWLA 5F1GA 4R0QA 1O7EA 3VSLA 1VB6A 3IX3A 4KZAA 1K6RA 4R38A 4NETA 2EX6A 4S2LA 3ZG5A 3N6IA 1XFQA 1NY0A 3TJZC 2V1BA 4U3TA 4MBFA 1ODVA 1CQAA 5AVEA 5KIZA 3D9YA 4KENB 4A5RA 4RQ9A 2JKFA 3I7JA 3EEHA 4S2IA 4HQAA 4PMAA 1DRMA 3F1NA 1MC0A 1FR6A 3IBJA 1L0EA 2HDSA 1K38A 4GOGA 3SH7A 4FUWA 4N9KA 2Z2LB 3Q81A 3HL9A 3R7WB 1IYSA 1IYQA 3LIEA 1OTEA 1MWSA 1IOUA 5FEFA 3FV7A 2AVXA 3NHQA 4R23A 4GJ4A 3IWQA 2HZ5A 4LRZE 1T1AA 5HL6A 1DJBA 2Y55A 3T1XA 2GX5A 1XGIA 4H6JA 2UV0E 5FL3A 3S7PA 5CGWA 3BLMA 1RCJA 1SKOB 3UB5P 3OBFA 1GHPA 4OQIA 3WRTA 1GHIA 3E4OA 3GVBA 1ZG6A 4K08A 4OLGA 2X01A 3B47A 3IXDA 1BLPA 3BY8A 4IVKA 2X02A 1YLJA 2ZQ7A 5FQMA 3UMEA 4GDBA 2XD5A 3JYIA 4HP9A 5DJTA 4EQ1A 5AVFA 1W5DA 2YKFA 2P04A 3DW0A 5G4YA 4ZAMA 1Y4OA 4R70A 3G2ZA 2PBDP 5KSCA 3KO6A 2PBYA 1YQSA 3TRCA 3VP2A 1A0KA 3IBRA 3TW8A 2Y2KA 3H9WA 2W3GA 1D1JA 4D2OA 1G28A 3A3JA 5A92A 4X55A 3R4KA 1VETA 4G3WA 3UN7A 4XUZA 4C3QA 3P01A 5EFWA 1L2SA 5CHJA 2J3WA 4FD8A 1BLCA 4GD8A 1Q2QA 4WLAA 5GLCA 1XX2A 2JC7A 1JWVA 1P9WA 5F83A 3VSKA 4MN5A 4I3IA 5KMWA 5HZHA 2OLUA 3EGDC 5EV0A 3ZFZA 2QJ5A 3NCKA 4E3OA 3VOLA 4ARZA 3VP0A 2XEPA 3NDEA 1BULA 2W3HA 4PHTA 2ZQDA 1PYYA 3PBRA 1P97A 1FOFA 4WMCA 3AGEA 1XKZA 3UNWA 2EWWA 2ZM8A 1UGUA 3E2LA 3NULA 5JYPA 4IBXA 3AGFA 3S22A 3HLEA 4QWOA 4ZJ2A 4O8GA 1YLWA 4B93A 3G32A 4M3KA 5TGFA 4LFUA 4RA7A 5CGSA 1OJ5A 3N8LA 3S7NA 1L3LA 2WKRA 2W1TA 3HJKA 4UA6A 4Y17A 3BFDA 2WZXA 5F82A 4HIAA 2OOLA 4GKUA 5FQ9A 1ERQA 4X53A 2A2LA 2H0TA 4YFMA 5EM0A 3NY4A 2OSUA 4GLQA 3LI9A 1FCMA 1CF0A 3OC2A 5DKLA 4RX2A 3BYDA 1MWUA 4UHUA 5CERA 1RP5A 3MFDA 3UPPA 2A24A 4JKTA 3PYPA 1YSQA 2L0WA 2Y2JA 1SCWA 5AQAA 2WZZA 4DE0A 4Y15A 2VJWA 5DVAA 3JVUA 5CEDA 2H0YA 2IWCA 2XLNA 2RL3A 3ZG9B 4LCMA 1LL8A 4BLMA 4FCFA 4Y2FA 1LI9A 3UB9A 5E2HA 4NG2A 2K7SA 1KGFA 4PKYG 3KSFA 3MQ0A 5HDCA 2XF3A 4EV4A 1YMXA 3SS4A 1OTIA 3CMZA 5HPIA 4JF4A 2FFFB 4QY5A 3MXQA 1Z09A 1BZAA 1GCEA 1UWNX 4HJ6A 3U4LP 3LY3A 3LR4A 1PIOA 4QHCA 4MDZA 4ZBEA 2V1ZA 3ZDJA 2HP5A 3TE8A 4R3JA 3UPNA 3V5MA 5AQ9A 4UQIS 1IKGA 3Q7ZA 4NXFA 1U60A 1W8YA 2KX6A 2B02A 4DE3A 1EROA 2O99A 3LR5A 4K91A 2EXBA 3VV4A 1IELA 3IT9A 1OPXA 3F1PB 4Q8IA 2JKTI 3T4LA 2Z2MB 3L7HA 4OP5A 2W3DA 1IYOA 3G4PA 3IF5A 3HCYA 4R3BA 5AQBA 4QPRA 4Z1WA 3LFVA 3MF0A 2R9XA 3T1SA 3BY9A 1PW8A 3BFEA 1M40A 5FASA 5IHVA 1I5QA 3KYZA 1ES2A 5D3OA 1GA9A 2EX8A 4QU3A 5L07A 4X69A 3UB7A 3BJNA 1EWZA 4Y13A 1XP4A 4MBKA 3MQQA 1MWRA 3A3FA 3FC7A 4RYEA 2HDUA 3HUNA 4GHIB 2Y2PA 4C6YA 3IF6B 4PM6A 3B33A 3ZHHA 1S6RA 1XPBA 1OTAA 4WN5A 1VEUA 2NUPC 1L0FA 3IWOA 4EUVA 1ZG4A 1MKIA 1XJ2A
chains in the Genus database with same CATH topology
3E0YA 4WELA 1W63M 1DP6A 3T4SA 3T4TA 2QKPA 3NOTC 2W3EA 5J3WA 2P7JA 5TJJA 1S1ZA 4EXOA 2W0NA 4YNRA 4L9EA 3NOPC 3OCNA 3D72A 3LUQA 4KUOA 2W27A 3PR6A 2W1TB 5HDSA 1VB6A 4HJ3A 2ZMFA 2WKQA 2Y79A 3E4QA 3KX0X 4PKYA 4F3LA 3PBTA 1STZA 1S4RA 4R38A 4Y5FA 1OTBA 4Q0IA 1XFQA 1TS7A 3TJZC 2V1BA 3KSIA 4AFIA 5J7EA 1TF1A 2P08A 2JKRI 4CLCB 1ODVA 3P7NA 2H28A 2GNXA 2R78A 3ZQ5A 2O9BA 4EERA 5AVEA 5HWTA 5KIZA 2V9AA 4RQ9A 4EETB 2PHYA 3EEHA 2A24B 5DKKA 4HQAA 1UWPX 2PR6A 1DRMA 3F1OB 3F1NA 4HH2A 1MC0A 2PDRA 4Q0JA 3IBJA 1MKMA 4EEUA 2XA7S 1S66L 3R7WB 3CWFA 3LIEA 1YSPA 1N9LA 2D01A 1OTEA 1YKDA 3A0RA 1IOUA 4ETZA 3NHQA 4KQOA 4I5SA 4GJ4A 1D7EA 3GECA 3UE3A 4LRZE 1T1AA 5HL6A 3IS2A 3KSGA 2GX5A 4H6JA 1XJ3A 2JN7A 4Q0HA 4DJ2A 5F5YA 5FL3A 1W63Q 3S7PA 3OBFA 5HD3A 3H7WA 3CLOA 1IFQA 3E4OA 1XFNA 4K08A 2VV8A 3B47A 4XT2A 2OWJA 2HF6A 3G6OA 3BY8A 3W2ZA 4HHDA 5KSHA 1TD5A 3UMEA 5HWVA 4PAUA 2Z6DA 1F5MA 2VX8A 4OOLA 4HP9A 5DJTA 4EQ1A 5AVFA 2J3TC 4MN7A 2YKFA 2P04A 3K3DA 5G4YA 3NJAA 4R70A 3KO6A 3TRCA 3EQVA 3CITA 3IBRA 2I9VA 3H82A 3TW8A 4BJPA 3H9WA 2W3GA 4JGQA 3LIAA 3NOUC 1G28A 3T4KA 2Y8HA 3R4KA 4FOFA 4OOMA 4G3WA 4IJGA 5DF9A 4O0PA 2PD8A 2VEAA 1GSVA 2ZMVA 3F1NB 2LB9A 2HJ9C 3P01A 3LICA 5EFWA 2J3WA 3VE4A 1TS8A 4WLAA 2V0UA 2QWSA 4O01A 5J4EA 1P9WA 4CLCE 4R3AA 4L0LA 4MN5A 2KDKA 4NXGA 3B42A 2K31A 2KOIA 1T1CA 4HJ4A 2PYPA 4I3IA 5HZHA 3EGDC 3T4JA 5K5BA 3ZYTA 3CI6A 2FH5A 3KYQA 4HNBA 1VHMA 2QJ5A 5TBMA 4LPZA 1LT0A 4DMZA 2IA2A 3ICYA 1XJ6A 1GSXA 3VOLA 4ARZA 2VLGA 3OOVA 1OTDA 3O5YA 4Y3IA 5HWWA 4G3KA 4GHIA 2W3HA 4LRYC 3HJIA 5F6AA 2EWVA 3FPWA 4PHTA 2J80A 1D06A 1H3QA 3BWLA 3EWKA 3PBRA 1P97A 3CUEA 4NXBA 2FZ0A 4JGRA 2O9AA 2INWA 3U2AA 2EWWA 4NKPA 3PBSA 3EEAA 4ETXA 1ZHHB 3JVVA 1WA9A 2OAQ1 1UGUA 4CLCD 2DMWA 2GJ3A 2W3FA 1NWZA 3SW1A 3FPVA 3T50A 2JKTM 1DP9A 2VV7A 4EESA 4I3AA 3H82B 2XROA 1S4SA 3UMDA 2NUTC 4O8GA 1XJ4A 1P0ZA 4B93A 5L8MA 2WKPA 5HDDA 5F68A 4WEJA 2G7UA 1OJ5A 4HH3A 4HOIA 3S7NA 1T19A 3V67A 2M7UA 2WKRA 2W1TA 2QJ7A 3HJKA 3LI8A 2EA9A 2M7VA 5IU1A 3BQ8A 3UB8A 2Z6CA 4IHQA 4E04A 1JNUA 3MR0A 4MN6A 4UQIM 4HY8A 4HIAA 2OOLA 1F9IA 1EW0A 4LRXC 5I5LA 2XRNA 2A2LA 2QYBA 3LR0A 4GLQA 4CLCA 4JGPA 3LI9A 4F3LB 3S7QA 1P9RA 3D3OA 3OC2A 3F1PA 4GW9A 5DKLA 4GS9A 1G6OA 4LLOB 3CAXA 1NLYA 2YKHA 2A24A 3F1OA 4WF0A 3CUEC 3LIDA 4EU0A 4ZRRA 1YAXA 4NXEA 4FSFA 4YWZA 3PYPA 4II7A 1YSQA 2L0WA 5IS1A 3C2WA 3RTYA 2L4RA 3K2NA 3R7WA 2V1AA 2VJWA 3JVUA 4HP4A 2VGLM 1H8MA 5MC7A 5C5KA 4MCWA 3BQAA 3T4QA 4NEED 2GZAA 3DBAA 1LL8A 3UE6A 1NRJA 1TS6A 2VA0A 4Y2FA 4P6ZM 5HSQA 5DFYA 3UB9A 3E98A 2VZWA 2K7SA 1S1YA 2KLIA 3OCLA 1T18A 4PKYG 3KSFA 3MQ0A 2VV6A 3C8CA 3PBQA 5HDCA 3EQUA 2L1MA 2O0YA 3MFXA 2HJEA 4IUKA 1OTIA 2ZOIA 3IS2B 4WUJA 1GSWA 5HPIA 4H6JB 2CMNA 5AJGA 4BBVA 1DP8A 2PT7A 1S67L 3MXQA 3C30A 4UEYA 4ME4A 4L9GA 2M1CA 4L9FA 3LYXA 1OT6A 1UWNX 1V9YA 5IT5A 4HJ6A 1BYWA 3EOIA 4I38A 3H7WB 3LR4A 3A0SA 3MJQA 4BMWA 4CLCC 3KSHA 4MDZA 4XT2B 3TE8A 4UQIS 1MZUA 3RFBA 4NXFA 3C38A 3PXPA 4YOFA 2JKRM 4I3JA 2KX6A 2B02A 1ZTUA 2O9CA 3MQOA 4DJ3A 4WL9A 2O99A 3LR5A 1LSVA 3VV4A 5LBRA 2MJ6A 1OPXA 3F1PB 4GS9B 1T1BA 3MMHA 5G4ZA 3PHYA 2JKTI 3K3CA 2D02A 2K2NA 3PBOA 3T4LA 3ULFA 4G3VA 2ZOHA 1NLZA 3LIBA 2PYRA 3T4OA 1KOUA 2XSSA 2W3DA 1F98A 2V0WA 3HCYA 1LSWA 5DJUA 2OWHA 4QPRA 4Z1WA 3LFVA 1N9NA 2BASA 3OLOA 2PD7A 3MF0A 2VGLS 2JHEA 2HV1A 4HI4A 5HPFA 5DFXA 3S7OA 4CQHA 3GDIA 3BY9A 5HD5A 2QHKA 3LIFA 4EW7A 3FG8A 4BBUA 4BWIA 4P6ZS 3VE3A 3KYZA 4DN0A 3LR3A 5A8BA 2HGVA 3A0VA 3E4PA 2LB5A 4KQDA 4M4XA 4JGOA 1OJGA 3UB7A 3BJNA 2PR5A 5TBMB 3MQQA 2W1RA 2OAP1 2ZBBA 1TS0A 4ARZB 3FC7A 1N9OA 2XA7M 4GHIB 4EEPA 2B18A 4IUHA 5F69A 1X0OA 1OT9A 3PBNA 2VKSA 4KUKA 3B33A 3UB6A 3BW6A 4R6LA 1Y28A 1V9ZA 1OTAA 4I39A 4WN5A 4WEKA 2NUPC 2J3TD 1LSXA 3EGXC 5CX7A 4B9OA 4EUVA 4MMNA 3RH8B 4GCZA 4BBTA 1XJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP6 A;  2QKP A;  3NOT C;  5J3W A;  2P7J A;  4EXO A;  1S1Z A;  2W0N A;  4L9E A;  3NOP C;  3D72 A;  3LUQ A;  4KUO A;  2W27 A;  5HDS A;  1VB6 A;  4HJ3 A;  2WKQ A;  3E4Q A;  3KX0 X;  4PKY A;  4F3L A;  1S4R A;  4R38 A;  1OTB A;  1XFQ A;  1TS7 A;  2V1B A;  5J7E A;  1ODV A;  3P7N A;  2H28 A;  2R78 A;  3ZQ5 A;  4EER A;  5AVE A;  5HWT A;  5KIZ A;  2V9A A;  4RQ9 A;  4EET B;  2PHY A;  3EEH A;  2A24 B;  5DKK A;  4HQA A;  1UWP X;  2PR6 A;  1DRM A;  3F1O B;  3F1N A;  4HH2 A;  2PDR A;  4EEU A;  1S66 L;  3CWF A;  2D01 A;  1N9L A;  3LIE A;  1OTE A;  3A0R A;  3NHQ A;  4I5S A;  1D7E A;  3GEC A;  4LRZ E;  1T1A A;  3IS2 A;  4H6J A;  1XJ3 A;  2JN7 A;  4DJ2 A;  5F5Y A;  5HD3 A;  3H7W A;  3CLO A;  3E4O A;  1XFN A;  4K08 A;  2VV8 A;  4XT2 A;  2OWJ A;  3G6O A;  3BY8 A;  4HHD A;  3UME A;  5HWV A;  2Z6D A;  4HP9 A;  5DJT A;  4EQ1 A;  5AVF A;  2YKF A;  3K3D A;  5G4Y A;  3NJA A;  4R70 A;  3IBR A;  2I9V A;  3H82 A;  3H9W A;  4JGQ A;  3LIA A;  3NOU C;  1G28 A;  2PD8 A;  2VEA A;  1GSV A;  3F1N B;  3LIC A;  5EFW A;  3VE4 A;  1TS8 A;  4WLA A;  2V0U A;  2QWS A;  5J4E A;  4R3A A;  4MN5 A;  2KDK A;  4NXG A;  1T1C A;  4HJ4 A;  2PYP A;  4I3I A;  5HZH A;  4HNB A;  2QJ5 A;  5TBM A;  4LPZ A;  1LT0 A;  3ICY A;  1XJ6 A;  1GSX A;  3VOL A;  2VLG A;  1OTD A;  5HWW A;  4GHI A;  4LRY C;  3HJI A;  5F6A A;  2J80 A;  1D06 A;  3EWK A;  3BWL A;  4NXB A;  1P97 A;  4JGR A;  2INW A;  1WA9 A;  1UGU A;  2GJ3 A;  1NWZ A;  3SW1 A;  3T50 A;  1DP9 A;  2VV7 A;  4EES A;  4I3A A;  3H82 B;  1S4S A;  3UMD A;  1XJ4 A;  1P0Z A;  2WKP A;  5HDD A;  5F68 A;  4HOI A;  1OJ5 A;  4HH3 A;  1T19 A;  2WKR A;  2QJ7 A;  3HJK A;  3LI8 A;  2EA9 A;  5IU1 A;  3UB8 A;  2Z6C A;  4E04 A;  1JNU A;  3MR0 A;  4MN6 A;  4HY8 A;  4HIA A;  2OOL A;  1F9I A;  1EW0 A;  4LRX C;  5I5L A;  4JGP A;  3LI9 A;  4F3L B;  3F1P A;  4GW9 A;  5DKL A;  4GS9 A;  4LLO B;  3CAX A;  2YKH A;  2A24 A;  3F1O A;  4WF0 A;  3LID A;  4NXE A;  4YWZ A;  3PYP A;  2L0W A;  5IS1 A;  3C2W A;  3RTY A;  2L4R A;  2V1A A;  4HP4 A;  1LL8 A;  3UE6 A;  1TS6 A;  5HSQ A;  3UB9 A;  2K7S A;  1S1Y A;  1T18 A;  4PKY G;  2VV6 A;  3C8C A;  5HDC A;  2L1M A;  3MFX A;  1OTI A;  2ZOI A;  3IS2 B;  4WUJ A;  1GSW A;  4H6J B;  2CMN A;  4BBV A;  1DP8 A;  1S67 L;  3MXQ A;  4L9G A;  2M1C A;  4L9F A;  3LYX A;  1OT6 A;  1UWN X;  1V9Y A;  4HJ6 A;  1BYW A;  4I38 A;  3H7W B;  3A0S A;  3MJQ A;  4XT2 B;  1MZU A;  4NXF A;  4I3J A;  2KX6 A;  2B02 A;  3MQO A;  4DJ3 A;  4WL9 A;  1LSV A;  3F1P B;  4GS9 B;  1T1B A;  5G4Z A;  3PHY A;  3K3C A;  2D02 A;  3ULF A;  2ZOH A;  3LIB A;  2PYR A;  1KOU A;  1F98 A;  2V0W A;  1LSW A;  5DJU A;  2OWH A;  1N9N A;  2BAS A;  3OLO A;  2PD7 A;  2JHE A;  2HV1 A;  4HI4 A;  3GDI A;  3BY9 A;  5HD5 A;  2QHK A;  3LIF A;  4EW7 A;  3FG8 A;  4BBU A;  3VE3 A;  5A8B A;  3A0V A;  3E4P A;  4KQD A;  4M4X A;  4JGO A;  1OJG A;  3UB7 A;  2PR5 A;  5TBM B;  3MQQ A;  2ZBB A;  1TS0 A;  3FC7 A;  1N9O A;  4GHI B;  4EEP A;  5F69 A;  1X0O A;  1OT9 A;  4KUK A;  3B33 A;  3UB6 A;  4R6L A;  1Y28 A;  1V9Z A;  1OTA A;  4I39 A;  4WN5 A;  1LSX A;  4B9O A;  3RH8 B;  4GCZ A;  4BBT A;  1XJ2 A; 
#chains in the Genus database with same CATH topology
 4WEL A;  3LO7 A;  3UDX A;  3NOT C;  4C75 A;  4DE1 A;  3NBL A;  4CPK A;  3N7W A;  4S2N A;  5CGX A;  3PR6 A;  3UO9 A;  1YLP A;  4E6X A;  4BQM A;  3MKE A;  2WKQ A;  3IQA A;  3KX0 X;  4F3L A;  5E43 A;  1NJ4 A;  1S4R A;  3NC8 A;  3RXX A;  4Y5F A;  4Q0I A;  1HTZ A;  4H8R A;  2Y2N A;  1TS7 A;  4DDY A;  5J7E A;  1TF1 A;  2P08 A;  4CLC B;  3UDF A;  2H28 A;  2GNX A;  2R78 A;  2V8C A;  2O9B A;  4EER A;  2DCF A;  2V20 A;  2V9A A;  5CXW A;  4X56 A;  2ZLY A;  3IH9 A;  3MSH A;  5DKK A;  4KG2 A;  1K55 C;  1HD8 A;  2QZ6 A;  4Q0J A;  2XA7 S;  3QP4 A;  3CJM A;  2ZL1 B;  5FI2 A;  3CWF A;  2D01 A;  3SS5 A;  1YKD A;  3A0R A;  3BM6 A;  4B4X A;  3WWX A;  4OVD A;  4KQO A;  5G18 A;  1D7E A;  3LCE A;  3UE3 A;  4OLD A;  1K56 A;  5DF7 A;  3IS2 A;  4Q0H A;  3IHA A;  4DJ2 A;  3CHW P;  4E3L A;  1AXB A;  5FAQ A;  3D4F A;  4DXB A;  5HD3 A;  2I72 A;  2WGV A;  1EI5 A;  3H7W A;  1IFQ A;  1HLU P;  3ZG0 A;  2DNS A;  4XT2 A;  3W2Z A;  2HF6 A;  3G6O A;  4LV0 A;  3C7V A;  3C4P A;  5FSR A;  3UE1 A;  1F5M A;  2VX8 A;  3NEC A;  1PI5 A;  3QHY A;  2J3T C;  4MN7 A;  5EPH A;  3K3D A;  4LV2 A;  4QB8 A;  3ZGA B;  3NJA A;  2RCX A;  1ES3 A;  3OPH A;  3EQV A;  3S4X A;  3FKV A;  3LEZ A;  2I9V A;  3H82 A;  4BJP A;  4E3J A;  4JGQ A;  3C5A A;  1SHV A;  2ZQ9 A;  5M1A A;  3RJU A;  4GZB A;  5DF9 A;  4O0P A;  2Y2O A;  3F1N B;  2HJ9 C;  2P74 A;  1YLY A;  1TS8 A;  1H8Z A;  2PU4 A;  4DRT A;  3QP2 A;  2V0U A;  4CLC E;  3OPL A;  2ZMA A;  2K31 A;  4HJ4 A;  3ZYT A;  3CI6 A;  2FH5 A;  5CEC A;  2EX9 A;  4JBF A;  4KZ7 A;  1ZKJ A;  3G34 A;  2ZC3 B;  4Y3I A;  4G3K A;  2BLS A;  5F6A A;  3W4O A;  3BFF A;  4EQI A;  1D06 A;  2WKH A;  4GB7 A;  3S1Y A;  2FZ0 A;  2O9A A;  3PBS A;  3EEA A;  4ETX A;  1H5X A;  1GHM A;  2OAQ 1;  1NWZ A;  3T50 A;  2JKT M;  3M2J A;  5KZH A;  4OQ0 A;  4RVA A;  5EVL A;  4DF6 A;  4HOI A;  2BTF P;  1LHY A;  3QP6 A;  1SZV A;  2QJ7 A;  4KG6 A;  3KYE A;  3LI8 A;  5IU1 A;  3BQ8 A;  1LLB A;  2Z6C A;  1VQQ A;  1KE0 A;  4MN6 A;  4UQI M;  4HY8 A;  5GHY A;  1F9I A;  1K57 C;  4S2J A;  3S7Q A;  3MS6 A;  1P9R A;  2P9V B;  1XA1 A;  5GLD A;  3CAX A;  1NLY A;  5EVI C;  4WF0 A;  3LID A;  4EU0 A;  4X1L A;  1YAX A;  5HAR A;  3GTC A;  3DWZ A;  5IS1 A;  3RTY A;  3R7W A;  1O07 A;  4PM9 A;  2EFU A;  1Q2P A;  3W8K A;  1Y54 A;  5MC7 A;  5FAT A;  3T4Q A;  3ITB A;  2GZA A;  3DBA A;  3HLB A;  4X1M A;  3UPO A;  3UE6 A;  1NRJ A;  1ACF A;  1TS6 A;  5HSQ A;  4LV1 A;  3N4I A;  1PFL A;  1IEM A;  2VV6 A;  3PBQ A;  1SKO A;  3EQU A;  4E3N A;  2O0Y A;  3MFX A;  1ES5 A;  4ZJ1 A;  2WGI A;  2A3U A;  2XD1 A;  1QMF A;  4QY6 A;  1N9B A;  4BBV A;  1S67 L;  4UEY A;  4ME4 A;  4BL2 A;  1PWD A;  4S2M A;  2M1C A;  3C4O A;  5IT5 A;  1V9Y A;  5FQQ A;  1BYW A;  3EOI A;  1M6K A;  1F2K A;  3IXH A;  1XXM A;  3C38 A;  3PXP A;  4KZ8 A;  3MQO A;  4OP8 A;  3PAG A;  5CTM A;  2HP9 A;  5I94 A;  3K3C A;  3PBO A;  2ZOH A;  4QJG A;  3BEB A;  2PYR A;  3T4O A;  3DWK A;  1K25 A;  2VGK A;  5DJU A;  2OWH A;  3G31 A;  1N9N A;  3OLO A;  2PD7 A;  3A3I A;  3GDI A;  4CJN A;  4EW7 A;  4BBU A;  4BWI A;  1NYY A;  1E3U A;  4PM8 A;  4WZ5 A;  4EUZ A;  3RXW A;  5A8B A;  3A0V A;  4KQD A;  3IH8 A;  1G68 A;  5HW3 A;  4JGO A;  3L9K A;  4X25 A;  5E2G A;  3Q1F A;  3W4Q A;  4S2O A;  5TBM B;  1PWC A;  3CPT B;  3T1R A;  3GV9 A;  2WYX A;  3VMA A;  1YPR A;  2XA7 M;  1CEF A;  5EOO A;  4EEP A;  3QP5 A;  5EM1 A;  1X0O A;  3ZVW A;  3OZH A;  1JWZ A;  3BW6 A;  4JF6 A;  1ESI A;  1Y28 A;  3MZF A;  4WEK A;  1BTL A;  3B3X A;  4OPZ A;  2J3T D;  3EGX C;  5FDH A;  4LV3 A;  4MMN A;  2ZQ8 A;  1W63 M;  4OOY A;  1MPL A;  2QKP A;  3T4T A;  3O86 A;  5L09 A;  4MNR A;  5J3W A;  5E2E A;  4EXO A;  4YNR A;  3OCN A;  4GDN A;  5GHX A;  2Q9N A;  2W27 A;  4MLL A;  4EBN A;  2EFX A;  4WZ5 C;  4HJ3 A;  1ALQ A;  2ZMF A;  5HDS A;  4BEN A;  3UY6 A;  1NZU A;  4GNU A;  2ZM2 A;  4MBH A;  4X6T A;  1LL9 A;  1OTB A;  1K56 D;  2G2W A;  4AFI A;  1LI0 A;  4FH2 A;  3ZQ5 A;  1TVF A;  3FKW A;  2WGW B;  5BOH A;  5HWT A;  2WAE A;  4EET B;  4E3K A;  3LY4 A;  4HH2 A;  3F1O B;  2Y2Q A;  1MKM A;  3N8R A;  2Y59 A;  4IBR A;  1YSP A;  1N9L A;  4R4S A;  3GR2 A;  2XGN A;  4N1H A;  1KDS A;  1PWG A;  1FSY A;  1VEU B;  5TR7 A;  2JN7 A;  3O88 A;  3VFH A;  4XXR A;  2DRW A;  2ACG A;  3IX8 A;  1PI4 A;  4OPR A;  3MXS A;  2VV8 A;  2OWJ A;  4HHD A;  1KVL A;  2EXA A;  2IWB A;  5HWV A;  3GMW A;  2Z6D A;  4OOL A;  3Q07 A;  4ZDX A;  1K55 A;  3ZG7 B;  3TOI A;  2ZQC A;  1I2S A;  3V3S A;  4HES A;  3LIA A;  5DTK A;  4U0X A;  3ZCZ A;  1BLH A;  3DTM A;  4IJG A;  2PD8 A;  2VEA A;  1GSV A;  1GA0 A;  5EVI D;  3HUM A;  2LB9 A;  4OH0 A;  4B88 A;  3LIC A;  3VE4 A;  3G2Y A;  3CG5 A;  4O01 A;  1IKI A;  4R3A A;  2KDK A;  2KOI A;  1T1C A;  2WKE A;  1PZP A;  5K5B A;  3BEC A;  5EOE A;  3LGO A;  3N8S A;  3G30 A;  1MXO A;  4HNB A;  1VHM A;  1Z6F A;  3HLG A;  4LPZ A;  1FIK A;  1KGG A;  4DMZ A;  3ICY A;  1GSX A;  4P85 A;  2VLG A;  3O5Y A;  2ZM0 A;  4JLF A;  4GHI A;  4R1G A;  1J9M A;  2H5S A;  3HJI A;  3NDG A;  3TSG A;  3FPW A;  2J80 A;  3EWK A;  3IF6 A;  3DAV A;  1RGZ A;  4JGR A;  1J3W A;  3U2A A;  3W4P A;  3VP4 A;  4HEF A;  4WM9 A;  4WYY A;  4KZ9 A;  3M6H A;  2Y2H A;  2DMW A;  5U47 A;  3A3D A;  2GJ3 A;  2W3F A;  3QNC A;  3SW1 A;  4KZ6 A;  4LEN A;  1SDN A;  4EES A;  3H82 B;  2XRO A;  1S4S A;  3UMD A;  2NUT C;  1XJ4 A;  5L8M A;  5FI7 A;  5HDD A;  5F1F A;  1JTG A;  3UDI A;  3PAE A;  1HZO A;  3V67 A;  3NI9 A;  2M7U A;  1K6S A;  5FQK A;  2EA9 A;  1CEG A;  2J7V A;  5CTN A;  1JNU A;  4S2P A;  2GDN A;  3E2K A;  4IED A;  2CC1 A;  2XRN A;  4ID4 A;  5CHM A;  2ZD8 A;  3O3V A;  3T1Q B;  1K0K A;  4Y0O A;  4CLC A;  3Q82 A;  4S2K A;  5HL1 A;  5M19 A;  4R4R A;  3PTE A;  4OQH A;  3D3O A;  4GW9 A;  4GS9 A;  3VOZ A;  2YKH A;  1BT5 A;  4FH4 A;  1NZO A;  3IF6 C;  4ZRR A;  4YWZ A;  4II7 A;  4FTX A;  2L4R A;  3IWI A;  4ZTK A;  2V1A A;  1YMS A;  4E3I A;  4LCL A;  5C5K A;  3BQA A;  4NEE D;  3C7U A;  2VA0 A;  3HLD A;  5L2F A;  2WK0 A;  3MZE A;  1C3B A;  3E98 A;  1JTD A;  1S1Y A;  3OCL A;  3IXG A;  3C8C A;  5FDS A;  4UA7 A;  2L1M A;  4JXW A;  2HJE A;  1S0W A;  4IUK A;  4WUJ A;  1GSW A;  4H6J B;  2CMN A;  1NRF A;  4EBL A;  5AJG A;  1K57 A;  2PT7 A;  3C30 A;  3VOY A;  4HBU A;  4BL3 A;  5A91 A;  4L9F A;  5DF8 A;  1H8Y A;  3QNB A;  4N9L A;  3A0S A;  3MJQ A;  4IVI A;  2JE5 A;  4MEZ A;  1PRQ A;  1WYC A;  4CLC C;  3WS0 A;  5EVI A;  4YIN A;  1MZU A;  3Q7V A;  3RFB A;  1E3U D;  3OPR A;  4I3J A;  3SH8 A;  2V8F A;  3MZD A;  2C5W B;  1ZTU A;  4JXG A;  4DJ3 A;  3GQZ A;  4DKI A;  1YLT A;  3HRE A;  5EUA A;  5FAO A;  2XR0 A;  1AWI A;  1T1B A;  3MMH A;  3G35 A;  3PHY A;  4KQQ A;  1PW1 A;  4N1X A;  3ULF A;  4G3V A;  1NLZ A;  3LIB A;  4GN2 A;  2XSS A;  2QMI A;  1F98 A;  3MKF A;  1VET B;  2JCH A;  2ZC7 A;  1BLS A;  3MXR A;  1WYB A;  2BAS A;  2VGL S;  3WS5 A;  4JPM A;  2R9W A;  5TFQ A;  2ZC6 B;  1DY6 A;  4KZ4 A;  4P6Z S;  3V39 A;  4JXS A;  2WUQ A;  3HVF A;  2E8I A;  1XGJ A;  2HGV A;  3BLS A;  2LB5 A;  1OJG A;  1TEM A;  2PR5 A;  5CRF A;  2W1R A;  2OAP 1;  2ZBB A;  4ARZ B;  3O87 A;  2Y2M A;  2C6W B;  1N9O A;  5M18 A;  3V50 A;  3QP8 A;  1OT9 A;  3PBN A;  4Y0U A;  3SH9 A;  3HUO A;  4Z9Q A;  3UB6 A;  1I2W A;  1V9Z A;  1RGY A;  2XQZ A;  4OON A;  1E4D A;  4GCZ A;  4BBT A;  1DP6 A;  1S1Z A;  2XFS A;  3D72 A;  3LUQ A;  1H0M A;  3WS2 A;  2W1T B;  4HBT A;  4ESP A;  1W79 A;  2Y79 A;  3E4Q A;  4B4Z A;  4PKY A;  3PBT A;  1STZ A;  2P9V A;  4ZJ3 A;  2J8Y A;  3KSI A;  1XA7 A;  4OPY A;  2JKR I;  4PPR A;  3P7N A;  4KG5 A;  1K4F A;  3DTK A;  4K0X A;  3M6B A;  2H10 A;  2PHY A;  2A24 B;  4LGW A;  1K4E A;  1UWP X;  2PR6 A;  4OKP A;  2PDR A;  4EEU A;  3IHB A;  1S66 L;  5GLA A;  1DJC A;  4KZB A;  1YLZ A;  1OME A;  2V2F F;  3HLF A;  4ETZ A;  4I5S A;  1BSG A;  3GEC A;  1WE4 A;  3ZNY A;  3KSG A;  1XJ3 A;  1FSW A;  3LEQ A;  5F5Y A;  1W63 Q;  2VGJ A;  2HP6 A;  3FYZ A;  2PRF A;  1W8Q A;  1CI8 A;  2Y91 A;  3CLO A;  1FCO A;  1XFN A;  5A93 A;  2B5R A;  3P09 A;  1G5U A;  5J8X A;  2BG1 A;  5KSH A;  2A49 A;  1TD5 A;  3WS4 A;  4PAU A;  5EVE A;  2HDQ A;  5GHZ A;  1JWP A;  4P6B A;  1YM1 A;  5FA7 A;  2JKG A;  2ZJ9 A;  5DTT A;  3CIT A;  5L10 A;  3NIA A;  3NOU C;  3T4K A;  2Y8H A;  1FIL A;  3AGD A;  4FOF A;  2HPB A;  4OOM A;  4P87 A;  2ZMV A;  5FQJ A;  4DE2 A;  2XDM A;  2QWS A;  5J4E A;  5A90 A;  2Y2L A;  1MBL A;  1VM1 A;  3TG9 A;  4GD6 A;  1N4O A;  4QD4 A;  4L0L A;  4NXG A;  1ZC2 A;  3B42 A;  2PYP A;  3ISG A;  1CI9 A;  2JBF A;  3FZC A;  3T4J A;  2XH9 A;  2PU2 A;  3KYQ A;  5HAQ A;  2ZC4 B;  3T12 B;  2WKI A;  5TBM A;  1LT0 A;  3CPT A;  2IA2 A;  1XJ6 A;  3ZG8 B;  3OOV A;  1OTD A;  5HWW A;  3IXB A;  3ZNT A;  4LRY C;  1CJF A;  2EWV A;  1HVB A;  3BRM A;  5DTS A;  1SKF A;  2VK3 A;  1H3Q A;  3BWL A;  4NXB A;  3CUE A;  5HX9 A;  4DXC A;  2INW A;  2UWX A;  5HAP A;  1W7F A;  1IYP A;  3BFC A;  4NKP A;  1SDE A;  4OPQ A;  1ERM A;  1ZHH B;  3JVV A;  1WA9 A;  4CLC D;  1KVM A;  1ESU A;  1JVJ A;  4KQR A;  3FPV A;  2XFT A;  4E6W A;  1DP9 A;  2VV7 A;  3SOI A;  2Y2I A;  4I3A A;  4OQG A;  1P0Z A;  1QME A;  3UE0 A;  2PAV P;  3WRZ A;  2WKP A;  5F68 A;  4WEJ A;  4UAA A;  4NK3 A;  3VP3 A;  2G7U A;  4HH3 A;  4PM5 A;  1T19 A;  2OV5 A;  3GRJ A;  3SZT A;  1LL5 A;  2M7V A;  1K54 A;  4XUX A;  3UB8 A;  1FR1 A;  2Q9M A;  4IHQ A;  1ONH A;  2HDR A;  4E04 A;  3MR0 A;  4K0W A;  5I5L A;  4LRX C;  1EW0 A;  4KZ3 A;  1L0G A;  4N92 A;  2QYB A;  4E3M A;  3LR0 A;  5CHU A;  4JGP A;  4F3L B;  2WGW A;  3QP1 A;  3P98 A;  3F1P A;  4U0T A;  1G6O A;  4LLO B;  2ZC5 B;  4JF5 A;  3F1O A;  3CUE C;  1PZO A;  2J9O A;  2Q0O A;  4FSF A;  4NXE A;  5E2F A;  3HBR A;  3C2W A;  1KGE A;  3K2N A;  4HP4 A;  1KE4 A;  2VGL M;  2Y2G A;  1H8M A;  4MCW A;  4EBP A;  4EWF A;  5GL9 A;  4PM7 A;  4P6Z M;  2J9P A;  5DFY A;  5FAP A;  5HFO A;  3A3E A;  2VZW A;  3DTI A;  4JXV A;  2KLI A;  1T18 A;  4UA9 A;  1MY8 A;  3OPP A;  2ZOI A;  3IS2 B;  1CK3 A;  1K54 C;  1DP8 A;  2G2U A;  2ZQA A;  4KZ5 A;  1KDW A;  2X71 A;  5HAI A;  4L9G A;  3LYX A;  1G6A A;  1OT6 A;  1TDG A;  4I38 A;  3H7W B;  1DJA A;  4BMW A;  1KE3 A;  3DTE A;  3KSH A;  3WS1 A;  1YT4 A;  4XT2 B;  4BD0 A;  4WBG A;  4RX3 A;  2IWD A;  4YOF A;  2JKR M;  2E8J A;  2O9C A;  5GLB A;  4DDS A;  4WL9 A;  1BUE A;  1LSV A;  5LBR A;  2EX2 A;  2MJ6 A;  5JYO A;  4GS9 B;  5G4Z A;  3SS3 A;  2D02 A;  2K2N A;  1L0D A;  4P0M A;  1KOU A;  4F94 A;  2FFY A;  3VP1 A;  1ONG A;  2V0W A;  1LSW A;  2Y4A A;  5EE8 A;  2XK1 A;  3BFG A;  2WAF A;  2JHE A;  3JPU A;  1FQG A;  2HV1 A;  4HI4 A;  5HPF A;  5DFX A;  3S7O A;  4CQH A;  5HD5 A;  2QHK A;  3LIF A;  4X68 A;  3FG8 A;  3VE3 A;  1NYM A;  1ES4 A;  4DN0 A;  3LR3 A;  3E4P A;  5CEB A;  4S2N C;  4M4X A;  5AQ7 A;  4D60 A;  5EEC A;  4BD1 A;  2B95 A;  3HLW A;  1TS0 A;  5FEG A;  3VFF A;  2WAD A;  3GSG A;  2ZL1 A;  2QPN A;  2B18 A;  3CZD A;  4Y0T A;  4IUH A;  5F69 A;  3ZVT A;  1MWT A;  5EVI B;  2VKS A;  4KUK A;  3Q7V B;  1TDL A;  4WZ4 A;  4R6L A;  4I39 A;  3IX4 A;  1E25 A;  5FI6 A;  4O7D A;  1LSX A;  2OLV A;  5CX7 A;  3V3R A;  3M2K A;  4B9O A;  1PNE A;  3ITA A;  3RH8 B;  3E0Y A;  3T4S A;  3HLC A;  1NXY A;  4Y7P A;  5FQI A;  4WMC D;  2W3E A;  3MBZ A;  5TJJ A;  2P7J A;  1FCN A;  2W0N A;  4L9E A;  3NOP C;  4KUO A;  3FWL A;  5F1G A;  4R0Q A;  1O7E A;  3VSL A;  1VB6 A;  3IX3 A;  4KZA A;  1K6R A;  4R38 A;  4NET A;  2EX6 A;  4S2L A;  3ZG5 A;  3N6I A;  1XFQ A;  1NY0 A;  3TJZ C;  2V1B A;  4U3T A;  4MBF A;  1ODV A;  1CQA A;  5AVE A;  5KIZ A;  3D9Y A;  4KEN B;  4A5R A;  4RQ9 A;  2JKF A;  3I7J A;  3EEH A;  4S2I A;  4HQA A;  4PMA A;  1DRM A;  3F1N A;  1MC0 A;  1FR6 A;  3IBJ A;  1L0E A;  2HDS A;  1K38 A;  4GOG A;  3SH7 A;  4FUW A;  4N9K A;  2Z2L B;  3Q81 A;  3HL9 A;  3R7W B;  1IYS A;  1IYQ A;  3LIE A;  1OTE A;  1MWS A;  1IOU A;  5FEF A;  3FV7 A;  2AVX A;  3NHQ A;  4R23 A;  4GJ4 A;  3IWQ A;  2HZ5 A;  4LRZ E;  1T1A A;  5HL6 A;  1DJB A;  2Y55 A;  3T1X A;  2GX5 A;  1XGI A;  4H6J A;  2UV0 E;  5FL3 A;  3S7P A;  5CGW A;  3BLM A;  1RCJ A;  1SKO B;  3UB5 P;  3OBF A;  1GHP A;  4OQI A;  3WRT A;  1GHI A;  3E4O A;  3GVB A;  1ZG6 A;  4K08 A;  4OLG A;  2X01 A;  3B47 A;  3IXD A;  1BLP A;  3BY8 A;  4IVK A;  2X02 A;  1YLJ A;  2ZQ7 A;  5FQM A;  3UME A;  4GDB A;  2XD5 A;  3JYI A;  4HP9 A;  5DJT A;  4EQ1 A;  5AVF A;  1W5D A;  2YKF A;  2P04 A;  3DW0 A;  5G4Y A;  4ZAM A;  1Y4O A;  4R70 A;  3G2Z A;  2PBD P;  5KSC A;  3KO6 A;  2PBY A;  1YQS A;  3TRC A;  3VP2 A;  1A0K A;  3IBR A;  3TW8 A;  2Y2K A;  3H9W A;  2W3G A;  1D1J A;  4D2O A;  1G28 A;  3A3J A;  5A92 A;  4X55 A;  3R4K A;  1VET A;  4G3W A;  3UN7 A;  4XUZ A;  4C3Q A;  3P01 A;  5EFW A;  1L2S A;  5CHJ A;  2J3W A;  4FD8 A;  1BLC A;  4GD8 A;  1Q2Q A;  4WLA A;  5GLC A;  1XX2 A;  2JC7 A;  1JWV A;  1P9W A;  5F83 A;  3VSK A;  4MN5 A;  4I3I A;  5KMW A;  5HZH A;  2OLU A;  3EGD C;  5EV0 A;  3ZFZ A;  2QJ5 A;  3NCK A;  4E3O A;  3VOL A;  4ARZ A;  3VP0 A;  2XEP A;  3NDE A;  1BUL A;  2W3H A;  4PHT A;  2ZQD A;  1PYY A;  3PBR A;  1P97 A;  1FOF A;  4WMC A;  3AGE A;  1XKZ A;  3UNW A;  2EWW A;  2ZM8 A;  1UGU A;  3E2L A;  3NUL A;  5JYP A;  4IBX A;  3AGF A;  3S22 A;  3HLE A;  4QWO A;  4ZJ2 A;  4O8G A;  1YLW A;  4B93 A;  3G32 A;  4M3K A;  5TGF A;  4LFU A;  4RA7 A;  5CGS A;  1OJ5 A;  3N8L A;  3S7N A;  1L3L A;  2WKR A;  2W1T A;  3HJK A;  4UA6 A;  4Y17 A;  3BFD A;  2WZX A;  5F82 A;  4HIA A;  2OOL A;  4GKU A;  5FQ9 A;  1ERQ A;  4X53 A;  2A2L A;  2H0T A;  4YFM A;  5EM0 A;  3NY4 A;  2OSU A;  4GLQ A;  3LI9 A;  1FCM A;  1CF0 A;  3OC2 A;  5DKL A;  4RX2 A;  3BYD A;  1MWU A;  4UHU A;  5CER A;  1RP5 A;  3MFD A;  3UPP A;  2A24 A;  4JKT A;  3PYP A;  1YSQ A;  2L0W A;  2Y2J A;  1SCW A;  5AQA A;  2WZZ A;  4DE0 A;  4Y15 A;  2VJW A;  5DVA A;  3JVU A;  5CED A;  2H0Y A;  2IWC A;  2XLN A;  2RL3 A;  3ZG9 B;  4LCM A;  1LL8 A;  4BLM A;  4FCF A;  4Y2F A;  1LI9 A;  3UB9 A;  5E2H A;  4NG2 A;  2K7S A;  1KGF A;  4PKY G;  3KSF A;  3MQ0 A;  5HDC A;  2XF3 A;  4EV4 A;  1YMX A;  3SS4 A;  1OTI A;  3CMZ A;  5HPI A;  4JF4 A;  2FFF B;  4QY5 A;  3MXQ A;  1Z09 A;  1BZA A;  1GCE A;  1UWN X;  4HJ6 A;  3U4L P;  3LY3 A;  3LR4 A;  1PIO A;  4QHC A;  4MDZ A;  4ZBE A;  2V1Z A;  3ZDJ A;  2HP5 A;  3TE8 A;  4R3J A;  3UPN A;  3V5M A;  5AQ9 A;  4UQI S;  1IKG A;  3Q7Z A;  4NXF A;  1U60 A;  1W8Y A;  2KX6 A;  2B02 A;  4DE3 A;  1ERO A;  2O99 A;  3LR5 A;  4K91 A;  2EXB A;  3VV4 A;  1IEL A;  3IT9 A;  1OPX A;  3F1P B;  4Q8I A;  2JKT I;  3T4L A;  2Z2M B;  3L7H A;  4OP5 A;  2W3D A;  1IYO A;  3G4P A;  3IF5 A;  3HCY A;  4R3B A;  5AQB A;  4QPR A;  4Z1W A;  3LFV A;  3MF0 A;  2R9X A;  3T1S A;  3BY9 A;  1PW8 A;  3BFE A;  1M40 A;  5FAS A;  5IHV A;  1I5Q A;  3KYZ A;  1ES2 A;  5D3O A;  1GA9 A;  2EX8 A;  4QU3 A;  5L07 A;  4X69 A;  3UB7 A;  3BJN A;  1EWZ A;  4Y13 A;  1XP4 A;  4MBK A;  3MQQ A;  1MWR A;  3A3F A;  3FC7 A;  4RYE A;  2HDU A;  3HUN A;  4GHI B;  2Y2P A;  4C6Y A;  3IF6 B;  4PM6 A;  3B33 A;  3ZHH A;  1S6R A;  1XPB A;  1OTA A;  4WN5 A;  1VEU A;  2NUP C;  1L0F A;  3IWO A;  4EUV A;  1ZG4 A;  1MKI A;  1XJ2 A; 
#chains in the Genus database with same CATH homology
 3E0Y A;  4WEL A;  1W63 M;  1DP6 A;  3T4S A;  3T4T A;  2QKP A;  3NOT C;  2W3E A;  5J3W A;  2P7J A;  5TJJ A;  1S1Z A;  4EXO A;  2W0N A;  4YNR A;  4L9E A;  3NOP C;  3OCN A;  3D72 A;  3LUQ A;  4KUO A;  2W27 A;  3PR6 A;  2W1T B;  5HDS A;  1VB6 A;  4HJ3 A;  2ZMF A;  2WKQ A;  2Y79 A;  3E4Q A;  3KX0 X;  4PKY A;  4F3L A;  3PBT A;  1STZ A;  1S4R A;  4R38 A;  4Y5F A;  1OTB A;  4Q0I A;  1XFQ A;  1TS7 A;  3TJZ C;  2V1B A;  3KSI A;  4AFI A;  5J7E A;  1TF1 A;  2P08 A;  2JKR I;  4CLC B;  1ODV A;  3P7N A;  2H28 A;  2GNX A;  2R78 A;  3ZQ5 A;  2O9B A;  4EER A;  5AVE A;  5HWT A;  5KIZ A;  2V9A A;  4RQ9 A;  4EET B;  2PHY A;  3EEH A;  2A24 B;  5DKK A;  4HQA A;  1UWP X;  2PR6 A;  1DRM A;  3F1O B;  3F1N A;  4HH2 A;  1MC0 A;  2PDR A;  4Q0J A;  3IBJ A;  1MKM A;  4EEU A;  2XA7 S;  1S66 L;  3R7W B;  3CWF A;  3LIE A;  1YSP A;  1N9L A;  2D01 A;  1OTE A;  1YKD A;  3A0R A;  1IOU A;  4ETZ A;  3NHQ A;  4KQO A;  4I5S A;  4GJ4 A;  1D7E A;  3GEC A;  3UE3 A;  4LRZ E;  1T1A A;  5HL6 A;  3IS2 A;  3KSG A;  2GX5 A;  4H6J A;  1XJ3 A;  2JN7 A;  4Q0H A;  4DJ2 A;  5F5Y A;  5FL3 A;  1W63 Q;  3S7P A;  3OBF A;  5HD3 A;  3H7W A;  3CLO A;  1IFQ A;  3E4O A;  1XFN A;  4K08 A;  2VV8 A;  3B47 A;  4XT2 A;  2OWJ A;  2HF6 A;  3G6O A;  3BY8 A;  3W2Z A;  4HHD A;  5KSH A;  1TD5 A;  3UME A;  5HWV A;  4PAU A;  2Z6D A;  1F5M A;  2VX8 A;  4OOL A;  4HP9 A;  5DJT A;  4EQ1 A;  5AVF A;  2J3T C;  4MN7 A;  2YKF A;  2P04 A;  3K3D A;  5G4Y A;  3NJA A;  4R70 A;  3KO6 A;  3TRC A;  3EQV A;  3CIT A;  3IBR A;  2I9V A;  3H82 A;  3TW8 A;  4BJP A;  3H9W A;  2W3G A;  4JGQ A;  3LIA A;  3NOU C;  1G28 A;  3T4K A;  2Y8H A;  3R4K A;  4FOF A;  4OOM A;  4G3W A;  4IJG A;  5DF9 A;  4O0P A;  2PD8 A;  2VEA A;  1GSV A;  2ZMV A;  3F1N B;  2LB9 A;  2HJ9 C;  3P01 A;  3LIC A;  5EFW A;  2J3W A;  3VE4 A;  1TS8 A;  4WLA A;  2V0U A;  2QWS A;  4O01 A;  5J4E A;  1P9W A;  4CLC E;  4R3A A;  4L0L A;  4MN5 A;  2KDK A;  4NXG A;  3B42 A;  2K31 A;  2KOI A;  1T1C A;  4HJ4 A;  2PYP A;  4I3I A;  5HZH A;  3EGD C;  3T4J A;  5K5B A;  3ZYT A;  3CI6 A;  2FH5 A;  3KYQ A;  4HNB A;  1VHM A;  2QJ5 A;  5TBM A;  4LPZ A;  1LT0 A;  4DMZ A;  2IA2 A;  3ICY A;  1XJ6 A;  1GSX A;  3VOL A;  4ARZ A;  2VLG A;  3OOV A;  1OTD A;  3O5Y A;  4Y3I A;  5HWW A;  4G3K A;  4GHI A;  2W3H A;  4LRY C;  3HJI A;  5F6A A;  2EWV A;  3FPW A;  4PHT A;  2J80 A;  1D06 A;  1H3Q A;  3BWL A;  3EWK A;  3PBR A;  1P97 A;  3CUE A;  4NXB A;  2FZ0 A;  4JGR A;  2O9A A;  2INW A;  3U2A A;  2EWW A;  4NKP A;  3PBS A;  3EEA A;  4ETX A;  1ZHH B;  3JVV A;  1WA9 A;  2OAQ 1;  1UGU A;  4CLC D;  2DMW A;  2GJ3 A;  2W3F A;  1NWZ A;  3SW1 A;  3FPV A;  3T50 A;  2JKT M;  1DP9 A;  2VV7 A;  4EES A;  4I3A A;  3H82 B;  2XRO A;  1S4S A;  3UMD A;  2NUT C;  4O8G A;  1XJ4 A;  1P0Z A;  4B93 A;  5L8M A;  2WKP A;  5HDD A;  5F68 A;  4WEJ A;  2G7U A;  1OJ5 A;  4HH3 A;  4HOI A;  3S7N A;  1T19 A;  3V67 A;  2M7U A;  2WKR A;  2W1T A;  2QJ7 A;  3HJK A;  3LI8 A;  2EA9 A;  2M7V A;  5IU1 A;  3BQ8 A;  3UB8 A;  2Z6C A;  4IHQ A;  4E04 A;  1JNU A;  3MR0 A;  4MN6 A;  4UQI M;  4HY8 A;  4HIA A;  2OOL A;  1F9I A;  1EW0 A;  4LRX C;  5I5L A;  2XRN A;  2A2L A;  2QYB A;  3LR0 A;  4GLQ A;  4CLC A;  4JGP A;  3LI9 A;  4F3L B;  3S7Q A;  1P9R A;  3D3O A;  3OC2 A;  3F1P A;  4GW9 A;  5DKL A;  4GS9 A;  1G6O A;  4LLO B;  3CAX A;  1NLY A;  2YKH A;  2A24 A;  3F1O A;  4WF0 A;  3CUE C;  3LID A;  4EU0 A;  4ZRR A;  1YAX A;  4NXE A;  4FSF A;  4YWZ A;  3PYP A;  4II7 A;  1YSQ A;  2L0W A;  5IS1 A;  3C2W A;  3RTY A;  2L4R A;  3K2N A;  3R7W A;  2V1A A;  2VJW A;  3JVU A;  4HP4 A;  2VGL M;  1H8M A;  5MC7 A;  5C5K A;  4MCW A;  3BQA A;  3T4Q A;  4NEE D;  2GZA A;  3DBA A;  1LL8 A;  3UE6 A;  1NRJ A;  1TS6 A;  2VA0 A;  4Y2F A;  4P6Z M;  5HSQ A;  5DFY A;  3UB9 A;  3E98 A;  2VZW A;  2K7S A;  1S1Y A;  2KLI A;  3OCL A;  1T18 A;  4PKY G;  3KSF A;  3MQ0 A;  2VV6 A;  3C8C A;  3PBQ A;  5HDC A;  3EQU A;  2L1M A;  2O0Y A;  3MFX A;  2HJE A;  4IUK A;  1OTI A;  2ZOI A;  3IS2 B;  4WUJ A;  1GSW A;  5HPI A;  4H6J B;  2CMN A;  5AJG A;  4BBV A;  1DP8 A;  2PT7 A;  1S67 L;  3MXQ A;  3C30 A;  4UEY A;  4ME4 A;  4L9G A;  2M1C A;  4L9F A;  3LYX A;  1OT6 A;  1UWN X;  1V9Y A;  5IT5 A;  4HJ6 A;  1BYW A;  3EOI A;  4I38 A;  3H7W B;  3LR4 A;  3A0S A;  3MJQ A;  4BMW A;  4CLC C;  3KSH A;  4MDZ A;  4XT2 B;  3TE8 A;  4UQI S;  1MZU A;  3RFB A;  4NXF A;  3C38 A;  3PXP A;  4YOF A;  2JKR M;  4I3J A;  2KX6 A;  2B02 A;  1ZTU A;  2O9C A;  3MQO A;  4DJ3 A;  4WL9 A;  2O99 A;  3LR5 A;  1LSV A;  3VV4 A;  5LBR A;  2MJ6 A;  1OPX A;  3F1P B;  4GS9 B;  1T1B A;  3MMH A;  5G4Z A;  3PHY A;  2JKT I;  3K3C A;  2D02 A;  2K2N A;  3PBO A;  3T4L A;  3ULF A;  4G3V A;  2ZOH A;  1NLZ A;  3LIB A;  2PYR A;  3T4O A;  1KOU A;  2XSS A;  2W3D A;  1F98 A;  2V0W A;  3HCY A;  1LSW A;  5DJU A;  2OWH A;  4QPR A;  4Z1W A;  3LFV A;  1N9N A;  2BAS A;  3OLO A;  2PD7 A;  3MF0 A;  2VGL S;  2JHE A;  2HV1 A;  4HI4 A;  5HPF A;  5DFX A;  3S7O A;  4CQH A;  3GDI A;  3BY9 A;  5HD5 A;  2QHK A;  3LIF A;  4EW7 A;  3FG8 A;  4BBU A;  4BWI A;  4P6Z S;  3VE3 A;  3KYZ A;  4DN0 A;  3LR3 A;  5A8B A;  2HGV A;  3A0V A;  3E4P A;  2LB5 A;  4KQD A;  4M4X A;  4JGO A;  1OJG A;  3UB7 A;  3BJN A;  2PR5 A;  5TBM B;  3MQQ A;  2W1R A;  2OAP 1;  2ZBB A;  1TS0 A;  4ARZ B;  3FC7 A;  1N9O A;  2XA7 M;  4GHI B;  4EEP A;  2B18 A;  4IUH A;  5F69 A;  1X0O A;  1OT9 A;  3PBN A;  2VKS A;  4KUK A;  3B33 A;  3UB6 A;  3BW6 A;  4R6L A;  1Y28 A;  1V9Z A;  1OTA A;  4I39 A;  4WN5 A;  4WEK A;  2NUP C;  2J3T D;  1LSX A;  3EGX C;  5CX7 A;  4B9O A;  4EUV A;  4MMN A;  3RH8 B;  4GCZ A;  4BBT A;  1XJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...