5HD3A

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: dark structure of photoactive yellow protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
124
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 36
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hd3A00
4L9FA 3BWLA 3LIDA 5F5YA 2V0WA 3MFXA 4I3IA 3H7WA 1XFQA 4I3JA 4XT2B 4GS9B 5DJTA 4K08A 1D06A 3NHQA 1S1YA 5AVFA 4JGPA 1G28A 3CLOA 1F9IA 4GHIB 3SW1A 2W27A 1N9NA 2I9VA 2BASA 3HJKA 1GSXA 2YKFA 3G6OA 1N9LA 3MQQA 2Z6DA 4HJ6A 3IS2B 3F1OA 4R70A 4F3LA 2QWSA 4LLOB 2V1AA 1OTBA 4NXGA 2OWJA 2VV8A 4BBUA 3E4PA 3GDIA 2V9AA 1P97A 3NOTC 2V1BA 2QJ7A 4EESA 2GJ3A 4DJ2A 4I39A 1DRMA 1XJ4A 3LIBA 1Y28A 3CWFA 3PHYA 3C2WA 2PR5A 1S66L 3BY8A 1TS7A 1V9YA 2QJ5A 3T50A 3VE3A 5DJUA 2D01A 1GSWA 5G4ZA 3A0RA 4MN5A 3CAXA 1UWPX 2OWHA 1OJ5A 5TBMB 5HZHA 2L4RA 2WKPA 5F6AA 2WKRA 1V9ZA 1UWNX 4R3AA 4HY8A 1DP9A 4R6LA 1KOUA 1LSXA 4BBVA 3MQOA 4L9GA 3MJQA 4YWZA 5IS1A 1OTAA 2VV7A 1GSVA 1T1AA 1BYWA 1TS0A 5J7EA 2K7SA 4JGQA 1VB6A 1XJ6A 1T1BA 3LI8A 5HDCA 4WF0A 3A0SA 3NOPC 1T19A 3H82A 2A24A 2R78A 4BBTA 3C8CA 2VEAA 3UE6A 2PDRA 2L0WA 2L1MA 4H6JB 4HNBA 3PYPA 2P7JA 3ZQ5A 4NXEA 1JNUA 4HHDA 1LT0A 3H7WB 3F1NA 1WA9A 5EFWA 4I5SA 4EERA 3F1PA 5AVEA 1LSVA 2QKPA 3LICA 2KX6A 4GW9A 4HH2A 2H28A 4LRZE 3UB8A 1OTDA 4DJ3A 4WUJA 2JHEA 3F1OB 2WKQA 4KQDA 4F3LB 1S67L 3P7NA 4HIAA 2V0UA 3D72A 3FG8A 5J3WA 4WL9A 2PD8A 2PYRA 4EQ1A 4EETB 2PYPA 4GCZA 4M4XA 3MXQA 3E4OA 1OTEA 5HDDA 1T1CA 3LUQA 5HD5A 3GECA 4HH3A 2VLGA 5HSQA 3UB9A 4KUOA 5HD3A 4JGRA 1X0OA 5J4EA 3LYXA 5KIZA 4HJ3A 4LPZA 3H9WA 1TS6A 1S4RA 5DKLA 4I3AA 3VE4A 4EEPA 5HWVA 4XT2A 3HJIA 3MR0A 4GS9A 4HOIA 3UMEA 2Z6CA 1OJGA 4GHIA 3NOUC 1S4SA 4NXFA 3LIFA 2B02A 4PKYG 3IS2A 1XJ2A 3ICYA 3UB6A 4H6JA 1S1ZA 4RQ9A 4NXBA 4LRYC 4EEUA 5I5LA 1T18A 1XJ3A 1OT9A 4HJ4A 1D7EA 2HV1A 1NWZA 5HWTA 3RH8B 2M1CA 2W0NA 5DKKA 1OT6A 3K3DA 2OOLA 4HQAA 4MN6A 4PKYA 3EWKA 5F69A 3ULFA 2J80A 3E4QA 3OLOA 4R38A 4KUKA 4E04A 2VV6A 1LSWA 2ZOHA 3BY9A 3RTYA 2QHKA 5G4YA 2PHYA 3LI9A 4HI4A 4HP9A 4JGOA 5HWWA 1N9OA 4B9OA 3H82B 2A24B 1LL8A 3UB7A 4WN5A 4LRXC 3VOLA 1F98A 3F1NB 5IU1A 3A0VA 2INWA 3FC7A 4L9EA 1UGUA 4EW7A 3F1PB 2PD7A 5TBMA 3UMDA 2ZBBA 1OTIA 1MZUA 5HDSA 3K3CA 1TS8A 2JN7A 4HP4A 5A8BA 1DP6A 1EW0A 2CMNA 2EA9A 5F68A 2YKHA 2D02A 1DP8A 3EEHA 3IBRA 1XFNA 3LIAA 3KX0X 4I38A 3LIEA 4EXOA 2ZOIA 4WLAA 3NJAA 2PR6A 1P0ZA 2KDKA 3B33A 1ODVA
chains in the Genus database with same CATH superfamily
3IXHA 4ZBEA 4QHCA 3MMHA 5F5YA 3T4JA 4AFIA 3TG9A 4DRTA 3Q81A 4MLLA 2Y2PA 4DE2A 1KGGA 4I3JA 1BZAA 3FV7A 3PBNA 4LFUA 3T1SA 4G3VA 4OONA 1K0KA 3FKVA 1PWDA 3NHQA 1S0WA 5DTKA 2JKFA 1N9NA 3IXBA 2QPNA 1PIOA 3HLWA 2Z6DA 4HJ6A 5FL3A 3F1OA 2HDQA 3I7JA 2X01A 2OWJA 4OOLA 3LEZA 3PBSA 3KO6A 2V8FA 3E4PA 3G35A 2EX2A 2V9AA 3R7WA 1YAXA 2HGVA 3G2ZA 3M6BA 1NYYA 2ZL1B 3NBLA 4BWIA 4DJ2A 3E98A 1DRMA 1XJ4A 3UE3A 1BSGA 3LIBA 4OH0A 4Q8IA 5CTMA 2ZM2A 4FUWA 1MKMA 2XGNA 3CPTB 1YLJA 1YSPA 2PR5A 1S66L 2ZJ9A 3GRJA 1XGJA 2XD5A 5F83A 2W1RA 3C30A 1V9YA 2Z2MB 5FAQA 3VE3A 5IHVA 5DJUA 5E2FA 3ZVTA 1CI9A 3A0RA 4Z9QA 2EWWA 4WBGA 3UY6A 3MF0A 2WKRA 1BULA 2ACGA 4P6ZS 1JTDA 1BT5A 4GD6A 3RXWA 3FPWA 3HVFA 4EUZA 1KOUA 1NJ4A 5HAQA 5DTSA 2XFTA 2ZMFA 4BBVA 4ZJ1A 1K57C 4Y2FA 4FD8A 1K54A 4D2OA 5IS1A 5J7EA 3V3RA 5FI2A 1G68A 2WKIA 4CLCC 3UPPA 1QMFA 1T1BA 3LI8A 4QPRA 4B88A 1LLBA 5EVIB 1PNEA 5E2GA 5FI6A 3H82A 3LEQA 4BBTA 2HP9A 3UE6A 1RP5A 4GDNA 4H6JB 2IWCA 1BLSA 2P7JA 5HFOA 5M18A 4HHDA 3ISGA 3SZTA 3GVBA 2HDSA 5EFWA 1H8MA 4GKUA 3F1PA 4O7DA 4S2NC 5AVEA 4WEKA 4XUZA 1LSVA 4P6BA 4ZJ2A 3BEBA 2EFXA 3MXRA 5L07A 3IX4A 3G31A 1P9RA 3LICA 2KX6A 4RYEA 4KZ8A 3UB8A 3BLSA 4DJ3A 1RGZA 2GDNA 4K0XA 2JHEA 1W5DA 5GHYA 1NZOA 3P7NA 4JLFA 4C6YA 2V0UA 3QNCA 1PI5A 3FG8A 2HP6A 3KSFA 5J3WA 4PM9A 4MBFA 4OQHA 2PT7A 3SOIA 5FASA 4EQ1A 4EETB 4UQIS 2PYPA 1FR6A 4Y15A 3ZYTA 1ES3A 1SKFA 1OTEA 1VM1A 5HDDA 1ZKJA 3GECA 3EOIA 4KZ9A 2JC7A 5HSQA 2KLIA 3UE0A 2ZD8A 1U60A 4Y0OA 4NK3A 1YLYA 1A0KA 3WRZA 2ZQ8A 1IFQA 3BM6A 3LYXA 3KSHA 4HJ3A 2QZ6A 3VP4A 4Y7PA 5M1AA 4IJGA 3HLEA 1AXBA 3T4QA 5HWVA 4XT2A 3HJIA 4FH2A 2X71A 1K4EA 3V5MA 1GHMA 3ITAA 3UDFA 1PYYA 4KZ5A 4II7A 4XUXA 4GHIA 1KE4A 3W4QA 3P98A 1L2SA 4PMAA 2XA7M 3C38A 5F82A 2G2UA 5U47A 5CX7A 3IS2A 3ICYA 4H6JA 4EBPA 3Q7VA 2VGLS 2Y2OA 1K55A 1JVJA 2BLSA 4ARZB 4WM9A 1SCWA 4KQRA 3B3XA 3G4PA 4X53A 4X6TA 3M2JA 1D7EA 3QP5A 1NWZA 3MZFA 3UNWA 2M1CA 5CHJA 3OOVA 3K3DA 2OOLA 3ZG8B 3VFHA 5TJJA 1PI4A 3EWKA 3ULFA 1M6KA 4KUKA 3S7PA 4E04A 3ZFZA 3N8SA 2ZOHA 2J7VA 1IYOA 3V3SA 3CHWP 5CEBA 4U3TA 3LI9A 4HI4A 3B47A 3P01A 4R4SA 4Y0UA 2EWVA 2E8IA 3UB7A 5DFYA 3VP2A 4KG2A 2KOIA 4GD8A 1OPXA 2RL3A 4LRXC 3VOLA 4OLGA 3NDGA 1F98A 2WYXA 3F1NB 3WS5A 3EGDC 1LL5A 2PD7A 5E43A 4X68A 3BFEA 5TBMA 2J3WA 5GHXA 1L0DA 5IT5A 2Y2KA 3LR3A 1MZUA 3PTEA 5EECA 2ZQAA 1O7EA 2G2WA 4U0XA 5AQBA 4FSFA 1LI9A 4KZBA 4DXBA 5A8BA 1DP6A 3BYDA 1IOUA 3HLGA 2CMNA 1YM1A 3IWIA 1F5MA 4EBLA 2H0TA 4N1XA 2W3HA 3KX0X 1N9BA 4I38A 3EQUA 3K2NA 3BFCA 3WRTA 4WYYA 2OV5A 4WLAA 4Y5FA 2WKHA 1ONGA 2KDKA 3PBRA 3B33A 1ODVA 4L9FA 2GX5A 4OPZA 5DF7A 1MBLA 3KYEA 2J3TC 1NLYA 1ZC2A 1KE0A 4LENA 3OCLA 2R9XA 5M19A 3HLBA 4PM5A 4E3MA 3IF6A 5KZHA 2Y55A 3OPHA 3T1XA 4K91A 1XFQA 1WE4A 3OPPA 4S2IA 2JCHA 5AQAA 3DBAA 5AVFA 2ZC5B 2EXAA 4JGPA 1F9IA 5I94A 2LB5A 2EX9A 5GHZA 1KVMA 2WGWA 3LR5A 5EUAA 1GSXA 4P6ZM 4FH4A 3ITBA 4F3LA 4LLOB 4OOYA 4F94A 1E25A 2XQZA 3UPNA 2H5SA 2VV8A 4CLCB 2HDUA 4EESA 3RFBA 4R4RA 1H5XA 1PZOA 3BQAA 1I5QA 2WK0A 4KZAA 3CWFA 1Q2QA 2NUPC 1TF1A 3PHYA 1LL9A 2JE5A 2Y2MA 3BY8A 3BW6A 2QJ5A 2J9OA 3NI9A 1G6AA 2HF6A 3T50A 2OLUA 3S7OA 3N6IA 2W1TA 1H8YA 3T1RA 4DKIA 2HJ9C 4MN5A 5D3OA 2GZAA 5EM1A 5DFXA 3OPLA 1OJ5A 1ZG4A 4E3IA 4KZ3A 5DVAA 4JBFA 5FQQA 1DJBA 5F6AA 1NRJA 4KQQA 4EUVA 3R4KA 2A3UA 1UWNX 4PM6A 4KG6A 1YT4A 1BLHA 4Y17A 4HY8A 1XA1A 4OQIA 3SH9A 1LSXA 5CTNA 5CGSA 1W8QA 4JXWA 1YPRA 4S2MA 4WZ5A 3MQOA 4UA6A 2Y2NA 5FDSA 5AQ9A 2Y59A 4R0QA 4WZ4A 3A3JA 2C6WB 2VX8A 1K57A 1VB6A 4JXSA 4KZ7A 1VETA 1EI5A 4Y13A 5EVID 2VJWA 4WF0A 2V2FF 3CUEA 1CEGA 4Y0TA 3L7HA 1T19A 2A24A 3OPRA 4Q0JA 1YQSA 3C8CA 4MEZA 2Y79A 3PYPA 4NXEA 5FAOA 3H7WB 3DW0A 1MWUA 5EVEA 1Z6FA 2WZXA 3N8RA 5L10A 3BJNA 4EWFA 1HLUP 4EERA 3LCEA 3M6HA 4GOGA 1NY0A 1DJAA 3IQAA 2XSSA 2QMIA 1I2WA 3P09A 2ZQ7A 1ERQA 1S6RA 1P9WA 4QB8A 2WKQA 5HARA 4HIAA 1E4DA 3D72A 3IWQA 3MBZA 3UN7A 3Q1FA 2P74A 3PXPA 3SS5A 2PD8A 4KENB 4GCZA 4M4XA 4IVKA 4ID4A 4RA7A 4P85A 1Y54A 3LUQA 5FA7A 2VLGA 2Y91A 3G2YA 1FCOA 4KUOA 4GZBA 5HD3A 4JGRA 1IYSA 3NDEA 4EU0A 2XF3A 1E3UD 3Q82A 5KIZA 1KGFA 1TEMA 5DF9A 3H9WA 5C5KA 1ES4A 4I3AA 3S22A 3S1YA 4HOIA 4CPKA 4GN2A 5EE8A 1KVLA 3DTEA 1OJGA 3DWZA 5TGFA 4IEDA 1GHIA 4NEED 1YLWA 1ACFA 2LB9A 4NXFA 3LIFA 4ZAMA 3VSLA 5A90A 3WS1A 3UB6A 2G7UA 3IH9A 1S1ZA 1FSYA 4YOFA 2MJ6A 2PAVP 5KSHA 3NULA 1T18A 3V50A 4KZ6A 2PU2A 3FPVA 4DDSA 4OLDA 1G6OA 3FZCA 2DMWA 3BFGA 2J9PA 4HJ4A 1K56D 4BD1A 1L0EA 4C75A 2HV1A 3E2LA 4KG5A 1BLPA 5FSRA 2ZL1A 5FEFA 3ZG5A 3CG5A 1VEUB 3LY4A 2B5RA 2HP5A 2J80A 5MC7A 3E4QA 3OLOA 2IWBA 1HD8A 4DXCA 4YINA 4ZJ3A 1I2SA 4JXVA 2HZ5A 3GV9A 3RTYA 2OAP1 3CPTA 2HDRA 4EV4A 4UA7A 2Q9NA 1ALQA 1TDGA 4GLQA 1XXMA 2Y2GA 3AGDA 3CZDA 1JTGA 4MNRA 3MXSA 3PBTA 3VOYA 2OAQ1 3OCNA 1IKIA 4OPQA 1STZA 1CJFA 2INWA 3FC7A 5CHUA 3LR4A 5GL9A 3Q07A 1WYBA 1W63M 2WGVA 3C5AA 1SDEA 4BJPA 4MBHA 5K5BA 1TS8A 3T4TA 4E3JA 3KSGA 4E6XA 1PRQA 4U0TA 1FR1A 3C7UA 3C7VA 4MBKA 2YKHA 3IH8A 3IXGA 3IBRA 3IHBA 1XKZA 5CGXA 3LIAA 3UB5P 4EXOA 1M40A 4E3KA 3MKEA 4X1LA 4BL3A 3CITA 3D9YA 5EVIA 2P08A 4A5RA 1K54C 3MFDA 3BWLA 1PWCA 3D4FA 5JYPA 3LIDA 3T4OA 1ZTUA 5CXWA 2V0WA 2W3FA 5AQ7A 2OLVA 2XROA 3FYZA 3MFXA 5HW3A 4OVDA 4I3IA 3A3IA 2PBYA 5L2FA 1CK3A 2P9VB 3SH8A 1SKOB 5J8XA 4GS9B 4YNRA 5DJTA 4K08A 5EM0A 5FQMA 1NZUA 2K2NA 1G28A 1O07A 3CLOA 4DE3A 1RGYA 4LV0A 2ZMAA 2W27A 2ZC6B 2I9VA 2BASA 2WGIA 3DTIA 3ZG0A 1IYPA 1W7FA 3G6OA 2V20A 1N9LA 3MQQA 4DE1A 2XDMA 4JXGA 4CLCD 1PW8A 1KDWA 3NECA 1PZPA 3O87A 5HPFA 4Y3IA 3GDIA 3IXDA 5LBRA 1P97A 2V1BA 2O99A 4EQIA 1MPLA 2GJ3A 4OPYA 4E6WA 2EXBA 3JYIA 4I39A 5FATA 4B4ZA 1K6RA 1Y28A 3C2WA 4ETZA 3HUMA 2PRFA 1E3UA 1TS7A 2K31A 1SZVA 3SS4A 2VKSA 4PM7A 1XX2A 3VP0A 1Q2PA 4H8RA 3PR6A 1CI8A 2WZZA 5HX9A 3T12B 2D01A 1OMEA 1GSWA 5G4ZA 3GQZA 2H0YA 2UWXA 3QP1A 1IKGA 1L0FA 2OWHA 4N9LA 2NUTC 4ETXA 4RVAA 3UO9A 1ESIA 3QHYA 5TR7A 1PWGA 4ZDXA 1V9ZA 3BLMA 4R3AA 3G30A 4S2OA 5KMWA 4B4XA 1JWZA 4NKPA 2AVXA 2WKEA 3C4OA 4HBUA 4R6LA 4ARZA 2ZC4B 3WS2A 1ERMA 3V39A 1MKIA 3ZG7B 2FH5A 3VV4A 1H0MA 3HUNA 3VSKA 4LCLA 3MJQA 1K56A 4GJ4A 1OTAA 4QY5A 3AGEA 4MCWA 2VV7A 4N1HA 1TS0A 1BYWA 3HCYA 4LCMA 1IELA 2K7SA 2JKRM 3DWKA 1XJ6A 2ZMVA 5HDCA 4G3KA 4JF4A 5KSCA 1FSWA 2IA2A 5FI7A 3DTMA 3UPOA 2O9BA 2JKRI 2L1MA 4ZTKA 1MY8A 4HNBA 4BMWA 1MWSA 3CJMA 1LT0A 4PM8A 5HAIA 3F1NA 5L09A 3HLDA 4I5SA 4G3WA 1YLTA 3QNBA 4IHQA 5CRFA 2QKPA 4FCFA 1FOFA 4RX3A 5BOHA 3C4PA 2H28A 4S2KA 4LRZE 1C3BA 5FQIA 4M3KA 1OTDA 2HJEA 2GNXA 4CLCE 4NG2A 3WWXA 3W4PA 3F1OB 4WEJA 5TFQA 4IBRA 1S67L 4OPRA 3QP2A 3ZVWA 1XA7A 3T4KA 3R7WB 2W3EA 4GNUA 3FKWA 2Y2HA 3TW8A 2XA7S 2H10A 3MXQA 3E4OA 4O01A 1YLPA 1T1CA 3IF5A 1YKDA 2A2LA 2O9AA 1SDNA 4S2PA 4UA9A 5CGWA 5A93A 2Y2IA 4Z1WA 4P87A 1GA0A 4LPZA 5AJGA 3OZHA 4WMCA 3MS6A 1IYQA 1HZOA 4EEPA 2R9WA 4QJGA 3HLCA 3MR0A 5FQ9A 3OBFA 3D3OA 2JKGA 2Z6CA 1FCMA 2FZ0A 4DE0A 2B95A 4UQIM 3SS3A 4RX2A 1N4OA 3G34A 4QD4A 4IVIA 5E2EA 4RQ9A 2BG1A 1K4FA 3V67A 5I5LA 3T4LA 4N92A 4CLCA 2VGJA 3PBOA 5E2HA 4B93A 1XJ3A 1OT9A 3KYZA 3IX3A 3E0YA 3GSGA 2J3TD 3O88A 3T4SA 1W8YA 1MWRA 4D60A 3O86A 2ZLYA 5HAPA 3RH8B 3NY4A 2XK1A 4HQAA 4MN6A 3ZNYA 3RXXA 1J3WA 1LSWA 1H3QA 4ME4A 2VA0A 3LY3A 2QHKA 5G4YA 4S2NA 4HP9A 4JGOA 5HWWA 1N9OA 4B9OA 3H82B 1D1JA 3ZDJA 3S7NA 2ZM0A 3JPUA 3MQ0A 2VGLM 5F1GA 2W3GA 3W8KA 2C5WB 2JKTM 1L0GA 2HPBA 5IU1A 4LV2A 5EOEA 3VFFA 5DTTA 3F1PB 2P04A 3IHAA 3DTKA 3UMDA 2PU4A 4CQHA 1OTIA 2Y8HA 1K25A 2JKTI 1RCJA 3N8LA 3HL9A 1DJCA 2XH9A 3EQVA 2JN7A 2WUQA 3LO7A 3NIAA 3KSIA 5CECA 2EX6A 3CI6A 2DNSA 4K0WA 1DP8A 3EEHA 1KE3A 5FAPA 3LIEA 3MSHA 3W2ZA 3NJAA 2PR6A 1P0ZA 4WZ5C 4R3JA 3NC8A 1FILA 1Z09A 4E3LA 1IEMA 1ES2A 2PBDP 1GCEA 1MXOA 3HUOA 3RJUA 4PAUA 2QYBA 2Q9MA 3H7WA 4LGWA 5CEDA 1BLCA 4N9KA 4XT2B 4PPRA 1W63Q 3CUEC 1AWIA 4X69A 1D06A 5FQKA 1S1YA 3GMWA 4OQGA 5FDHA 3LGOA 1YMSA 4GHIB 3QP4A 3SW1A 4LV3A 1J9MA 3LFVA 1CQAA 2Y4AA 3HJKA 2DCFA 2YKFA 1YMXA 5EOOA 3IS2B 4OKPA 4R70A 1PFLA 2QWSA 3HLFA 4QY6A 2V1AA 1OTBA 3Q7VB 4NXGA 4OP8A 4JF6A 1SHVA 4IBXA 1XP4A 4BBUA 3MZEA 1MC0A 3A3FA 4S2JA 3NOTC 2QJ7A 5HL6A 3ZG9B 4MMNA 3ZGAB 3TJZC 1NYMA 4R1GA 3E2KA 4IUKA 4BD0A 3VP1A 3BQ8A 2ZC7A 3TE8A 1ES5A 2XLNA 4DN0A 3UDXA 4O8GA 2I72A 1NRFA 1GA9A 4DDYA 4BENA 3MKFA 3U4LP 3ZCZA 2O0YA 1BTLA 1ESUA 4PHTA 2B18A 1YSQA 2DRWA 4UAAA 1ZHHB 3CAXA 3UDIA 1UWPX 4QWOA 3S4XA 3JVUA 1WYCA 3BECA 5L8MA 5TBMB 2Y2QA 5HZHA 2L4RA 2WKPA 5DF8A 3VMAA 3GR2A 4MDZA 1KDSA 4HEFA 2X02A 2XRNA 2EX8A 1DP9A 5EVLA 1L3LA 4L0LA 4LV1A 3BRMA 2M7VA 3EEAA 4WMCD 4L9GA 4YWZA 1H8ZA 1GSVA 1T1AA 3VP3A 1K38A 5FQJA 1VEUA 4JGQA 1ZG6A 4P0MA 1LHYA 3VOZA 4X55A 1XPBA 4JPMA 3WS4A 3A0SA 4X1MA 4Q0HA 3N7WA 3NOPC 2WAFA 5F1FA 2R78A 1F2KA 3IF6B 2VEAA 2PDRA 2L0WA 5CERA 3ZQ5A 1JNUA 1MWTA 4R3BA 1YLZA 1CF0A 3BFFA 1WA9A 2UV0E 3NCKA 2O9CA 2XEPA 4GW9A 4HH2A 1HTZA 3M2KA 3HBRA 5A91A 4MN7A 2WGWB 3EGXC 4OOMA 4BLMA 4WUJA 1G5UA 3W4OA 4KQDA 4FOFA 4IUHA 4F3LB 5GLBA 4CJNA 5EPHA 3KYQA 1PW1A 4YFMA 2WADA 1NLZA 4OQ0A 5HL1A 3PAEA 4WL9A 2JBFA 4X56A 2EFUA 2PYRA 4BQMA 2XR0A 2M7UA 5GLAA 3BFDA 4EBNA 2Y2LA 3G32A 5HD5A 3MZDA 4HH3A 3UB9A 3N4IA 1K6SA 1TVFA 1NXYA 1X0OA 5J4EA 1DY6A 4JKTA 2XFSA 3FWLA 3UE1A 4HESA 4NETA 2BTFP 1TS6A 3T1QB 5GLCA 1S4RA 5DKLA 1GHPA 4BL2A 3VE4A 2V1ZA 2P9VA 2ZQ9A 1SKOA 2W1TB 4E3NA 5EVIC 4GS9A 3UMEA 2XD1A 3Q7ZA 1Y4OA 5G18A 5EV0A 4S2LA 3NOUC 3ZHHA 2FFFB 4WELA 1S4SA 4GDBA 2ZQCA 1K55C 3TRCA 4FTXA 3SH7A 4ZRRA 2B02A 1JWPA 4PKYG 4DMZA 1XJ2A 4JF5A 4NXBA 1VQQA 4LRYC 2WAEA 4Q0IA 4EEUA 2VK3A 3S7QA 5CHMA 3IBJA 4DF6A 5GLDA 2E8JA 2ZM8A 4C3QA 5HWTA 4HBTA 4UHUA 3ZNTA 2W0NA 5DKKA 1OT6A 2FFYA 4PKYA 4OP5A 5F69A 1FCNA 4R38A 1BUEA 3B42A 1VETB 3L9KA 2W3DA 2VV6A 3A3EA 1LI0A 3BY9A 3QP8A 1QMEA 4X25A 4XXRA 4ESPA 3IWOA 3DAVA 2PHYA 5HPIA 1KGEA 2A24B 2V8CA 1EWZA 4O0PA 1LL8A 1CEFA 4KZ4A 5FEGA 3IT9A 1TD5A 2VGKA 4WN5A 3JVVA 1EROA 1HVBA 2OSUA 3IX8A 3A3DA 2J8YA 3A0VA 4E3OA 4L9EA 1UGUA 2IWDA 4EW7A 3O5YA 4KQOA 4QU3A 2ZC3B 2ZBBA 1JWVA 4UEYA 5HDSA 3K3CA 3TSGA 3OC2A 3AGFA 2ZQDA 3PBQA 2A49A 1XGIA 2Y2JA 1ONHA 1FIKA 3QP6A 3PAGA 4GB7A 4HP4A 2VZWA 3TOIA 1EW0A 1FQGA 2RCXA 2EA9A 4R23A 3CMZA 5F68A 2D02A 5A92A 2Q0OA 3O3VA 1XFNA 2Z2LB 3LR0A 2ZOIA 3WS0A 3HREA 3U2AA 1VHMA 3GTCA 3IF6C 2CC1A 5JYOA 1TDLA 1W79A
chains in the Genus database with same CATH topology
4L9FA 2GX5A 2P08A 2J3TC 1NLYA 3BWLA 3OCLA 3LIDA 3MMHA 5F5YA 3T4OA 1ZTUA 3T4JA 4AFIA 2V0WA 2W3FA 2XROA 4PAUA 3MFXA 2QYBA 4I3IA 3H7WA 1XFQA 4I3JA 4XT2B 1W63Q 3CUEC 3PBNA 4GS9B 4YNRA 4G3VA 5DJTA 4K08A 3DBAA 1D06A 3NHQA 1S1YA 5AVFA 2K2NA 4JGPA 1G28A 3CLOA 1F9IA 4GHIB 3SW1A 2LB5A 2W27A 1N9NA 2I9VA 2BASA 3LFVA 3LR5A 3HJKA 1GSXA 2YKFA 4P6ZM 3G6OA 1N9LA 3MQQA 2Z6DA 4HJ6A 3IS2B 5FL3A 3F1OA 4R70A 4F3LA 2QWSA 4LLOB 2V1AA 1OTBA 4NXGA 4CLCD 2OWJA 4OOLA 3PBSA 2VV8A 4CLCB 3KO6A 4BBUA 3PBRA 5HPFA 3E4PA 4Y3IA 1MC0A 2V9AA 3GDIA 5LBRA 1P97A 3R7WA 3NOTC 2V1BA 2O99A 2QJ7A 1YAXA 5HL6A 4MMNA 4EESA 2HGVA 3RFBA 3TJZC 2GJ3A 4BWIA 4DJ2A 4IUKA 4I39A 3BQAA 3E98A 1DRMA 3BQ8A 1XJ4A 3UE3A 3TE8A 3LIBA 1Y28A 4DN0A 3CWFA 1MKMA 4O8GA 2NUPC 1TF1A 3PHYA 3C2WA 4ETZA 1YSPA 2PR5A 1S66L 2W1RA 3BY8A 3C30A 1TS7A 1V9YA 2K31A 3BW6A 2QJ5A 2VKSA 2HF6A 3T50A 3VE3A 2O0YA 3PR6A 5DJUA 3S7OA 2W1TA 2D01A 4PHTA 1GSWA 2B18A 1YSQA 5G4ZA 2HJ9C 3A0RA 4MN5A 1ZHHB 3CAXA 2GZAA 5DFXA 2EWWA 1UWPX 2OWHA 2NUTC 1OJ5A 4ETXA 3JVUA 5L8MA 5TBMB 5HZHA 2L4RA 3MF0A 2WKPA 5F6AA 1NRJA 2WKRA 4EUVA 3R4KA 4MDZA 4P6ZS 1V9ZA 1UWNX 4R3AA 3FPWA 2XRNA 4HY8A 1DP9A 4NKPA 4R6LA 1KOUA 4ARZA 1LSXA 2ZMFA 4L0LA 4BBVA 2FH5A 3VV4A 4Y2FA 3EEAA 2M7VA 3MQOA 4L9GA 3MJQA 4YWZA 4GJ4A 5IS1A 1OTAA 4MCWA 2VV7A 1GSVA 1T1AA 1BYWA 1TS0A 3HCYA 5J7EA 2K7SA 2VX8A 4JGQA 1VB6A 2JKRM 4CLCC 1XJ6A 2ZMVA 1T1BA 3LI8A 5HDCA 4QPRA 4G3KA 2VJWA 4WF0A 3A0SA 2IA2A 4Q0HA 3CUEA 3NOPC 1T19A 3H82A 2A24A 2R78A 4Q0JA 4BBTA 3C8CA 2VEAA 2O9BA 3UE6A 2PDRA 2L0WA 2JKRI 2L1MA 4H6JB 2Y79A 4HNBA 3PYPA 2P7JA 4BMWA 3ZQ5A 4NXEA 1JNUA 4HHDA 1LT0A 3H7WB 3F1NA 1WA9A 3BJNA 5EFWA 1H8MA 4I5SA 4G3WA 4EERA 3F1PA 2O9CA 5AVEA 4WEKA 1LSVA 4IHQA 2QKPA 1P9RA 3LICA 2KX6A 4GW9A 4HH2A 2XSSA 2H28A 4LRZE 4MN7A 3UB8A 1OTDA 3EGXC 4DJ3A 4OOMA 2HJEA 2GNXA 4CLCE 4WUJA 2JHEA 1P9WA 3F1OB 2WKQA 4KQDA 4FOFA 4WEJA 4IUHA 4F3LB 1S67L 3P7NA 4HIAA 3KYQA 2V0UA 1NLZA 3D72A 3T4KA 3FG8A 3KSFA 5J3WA 3PXPA 2W3EA 3R7WB 4WL9A 2PT7A 2PD8A 2PYRA 4EQ1A 4EETB 4UQIS 2PYPA 2M7UA 4GCZA 3ZYTA 4M4XA 3TW8A 2XA7S 3MXQA 3E4OA 1OTEA 4O01A 5HDDA 1T1CA 3LUQA 5HD5A 1YKDA 3GECA 3EOIA 4HH3A 2A2LA 2O9AA 2VLGA 5HSQA 2KLIA 3UB9A 4KUOA 5HD3A 4JGRA 1X0OA 5J4EA 4EU0A 1IFQA 3LYXA 4Z1WA 3KSHA 5KIZA 4HJ3A 4LPZA 5DF9A 3H9WA 5AJGA 1TS6A 5C5KA 4IJGA 1S4RA 5DKLA 3T4QA 4I3AA 3VE4A 4EEPA 5HWVA 4XT2A 2W1TB 3HJIA 3MR0A 4GS9A 4HOIA 3OBFA 3D3OA 3UMEA 2Z6CA 2FZ0A 1OJGA 4II7A 4GHIA 3NOUC 4UQIM 4NEED 4WELA 1S4SA 2LB9A 2XA7M 4NXFA 3LIFA 3TRCA 3C38A 4ZRRA 5CX7A 2B02A 4PKYG 3IS2A 1XJ2A 2G7UA 3ICYA 3UB6A 4DMZA 4H6JA 1S1ZA 4RQ9A 4NXBA 4LRYC 4YOFA 3V67A 2MJ6A 2VGLS 4Q0IA 4EEUA 5I5LA 3S7QA 3T4LA 4CLCA 4ARZB 5KSHA 3PBOA 3IBJA 4B93A 1T18A 1XJ3A 1OT9A 3FPVA 3KYZA 1G6OA 3E0YA 2J3TD 2DMWA 4HJ4A 3T4SA 1D7EA 2HV1A 1NWZA 5HWTA 3RH8B 2M1CA 2W0NA 3OOVA 5DKKA 1OT6A 3K3DA 2OOLA 4HQAA 4MN6A 4PKYA 5TJJA 3EWKA 5F69A 3ULFA 2J80A 5MC7A 3E4QA 3OLOA 4R38A 4KUKA 3B42A 3S7PA 4E04A 2W3DA 2VV6A 1LSWA 2ZOHA 3BY9A 1H3QA 4ME4A 2VA0A 3RTYA 2OAP1 2QHKA 5G4YA 2PHYA 5HPIA 3LI9A 4HI4A 4GLQA 4HP9A 4JGOA 3B47A 5HWWA 3P01A 1N9OA 4B9OA 3H82B 2A24B 4O0PA 1LL8A 3S7NA 2EWVA 3MQ0A 3UB7A 2VGLM 3PBTA 5DFYA 1TD5A 2KOIA 2W3GA 2OAQ1 1OPXA 4WN5A 3JVVA 4LRXC 3VOLA 2JKTM 3OCNA 1F98A 3F1NB 1STZA 5IU1A 3A0VA 2INWA 3EGDC 3FC7A 4L9EA 1UGUA 4EW7A 3LR4A 3F1PB 2PD7A 2P04A 3O5YA 5TBMA 2J3WA 4KQOA 3UMDA 2ZBBA 1W63M 4CQHA 5IT5A 1OTIA 4BJPA 3LR3A 1MZUA 2JKTI 2Y8HA 4UEYA 5HDSA 3K3CA 5K5BA 3OC2A 1TS8A 3PBQA 4FSFA 3T4TA 3EQVA 2JN7A 4HP4A 3KSGA 2VZWA 5A8BA 1DP6A 1EW0A 1IOUA 3KSIA 2CMNA 2EA9A 3CI6A 1F5MA 5F68A 2YKHA 2D02A 1DP8A 3EEHA 3IBRA 1XFNA 2W3HA 3LIAA 3KX0X 4I38A 3EQUA 3LIEA 3K2NA 3LR0A 3W2ZA 4EXOA 2ZOIA 4WLAA 3NJAA 4Y5FA 2PR6A 3CITA 3U2AA 1VHMA 1P0ZA 2KDKA 3B33A 1ODVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9F A;  3BWL A;  3LID A;  5F5Y A;  2V0W A;  3MFX A;  4I3I A;  3H7W A;  1XFQ A;  4I3J A;  4XT2 B;  4GS9 B;  5DJT A;  4K08 A;  1D06 A;  3NHQ A;  1S1Y A;  5AVF A;  4JGP A;  1G28 A;  3CLO A;  1F9I A;  4GHI B;  3SW1 A;  2W27 A;  1N9N A;  2I9V A;  2BAS A;  3HJK A;  1GSX A;  2YKF A;  3G6O A;  1N9L A;  3MQQ A;  2Z6D A;  4HJ6 A;  3IS2 B;  3F1O A;  4R70 A;  4F3L A;  2QWS A;  4LLO B;  2V1A A;  1OTB A;  4NXG A;  2OWJ A;  2VV8 A;  4BBU A;  3E4P A;  3GDI A;  2V9A A;  1P97 A;  3NOT C;  2V1B A;  2QJ7 A;  4EES A;  2GJ3 A;  4DJ2 A;  4I39 A;  1DRM A;  1XJ4 A;  3LIB A;  1Y28 A;  3CWF A;  3PHY A;  3C2W A;  2PR5 A;  1S66 L;  3BY8 A;  1TS7 A;  1V9Y A;  2QJ5 A;  3T50 A;  3VE3 A;  5DJU A;  2D01 A;  1GSW A;  5G4Z A;  3A0R A;  4MN5 A;  3CAX A;  1UWP X;  2OWH A;  1OJ5 A;  5TBM B;  5HZH A;  2L4R A;  2WKP A;  5F6A A;  2WKR A;  1V9Z A;  1UWN X;  4R3A A;  4HY8 A;  1DP9 A;  4R6L A;  1KOU A;  1LSX A;  4BBV A;  3MQO A;  4L9G A;  3MJQ A;  4YWZ A;  5IS1 A;  1OTA A;  2VV7 A;  1GSV A;  1T1A A;  1BYW A;  1TS0 A;  5J7E A;  2K7S A;  4JGQ A;  1VB6 A;  1XJ6 A;  1T1B A;  3LI8 A;  5HDC A;  4WF0 A;  3A0S A;  3NOP C;  1T19 A;  3H82 A;  2A24 A;  2R78 A;  4BBT A;  3C8C A;  2VEA A;  3UE6 A;  2PDR A;  2L0W A;  2L1M A;  4H6J B;  4HNB A;  3PYP A;  2P7J A;  3ZQ5 A;  4NXE A;  1JNU A;  4HHD A;  1LT0 A;  3H7W B;  3F1N A;  1WA9 A;  5EFW A;  4I5S A;  4EER A;  3F1P A;  5AVE A;  1LSV A;  2QKP A;  3LIC A;  2KX6 A;  4GW9 A;  4HH2 A;  2H28 A;  4LRZ E;  3UB8 A;  1OTD A;  4DJ3 A;  4WUJ A;  2JHE A;  3F1O B;  2WKQ A;  4KQD A;  4F3L B;  1S67 L;  3P7N A;  4HIA A;  2V0U A;  3D72 A;  3FG8 A;  5J3W A;  4WL9 A;  2PD8 A;  2PYR A;  4EQ1 A;  4EET B;  2PYP A;  4GCZ A;  4M4X A;  3MXQ A;  3E4O A;  1OTE A;  5HDD A;  1T1C A;  3LUQ A;  5HD5 A;  3GEC A;  4HH3 A;  2VLG A;  5HSQ A;  3UB9 A;  4KUO A;  5HD3 A;  4JGR A;  1X0O A;  5J4E A;  3LYX A;  5KIZ A;  4HJ3 A;  4LPZ A;  3H9W A;  1TS6 A;  1S4R A;  5DKL A;  4I3A A;  3VE4 A;  4EEP A;  5HWV A;  4XT2 A;  3HJI A;  3MR0 A;  4GS9 A;  4HOI A;  3UME A;  2Z6C A;  1OJG A;  4GHI A;  3NOU C;  1S4S A;  4NXF A;  3LIF A;  2B02 A;  4PKY G;  3IS2 A;  1XJ2 A;  3ICY A;  3UB6 A;  4H6J A;  1S1Z A;  4RQ9 A;  4NXB A;  4LRY C;  4EEU A;  5I5L A;  1T18 A;  1XJ3 A;  1OT9 A;  4HJ4 A;  1D7E A;  2HV1 A;  1NWZ A;  5HWT A;  3RH8 B;  2M1C A;  2W0N A;  5DKK A;  1OT6 A;  3K3D A;  2OOL A;  4HQA A;  4MN6 A;  4PKY A;  3EWK A;  5F69 A;  3ULF A;  2J80 A;  3E4Q A;  3OLO A;  4R38 A;  4KUK A;  4E04 A;  2VV6 A;  1LSW A;  2ZOH A;  3BY9 A;  3RTY A;  2QHK A;  5G4Y A;  2PHY A;  3LI9 A;  4HI4 A;  4HP9 A;  4JGO A;  5HWW A;  1N9O A;  4B9O A;  3H82 B;  2A24 B;  1LL8 A;  3UB7 A;  4WN5 A;  4LRX C;  3VOL A;  1F98 A;  3F1N B;  5IU1 A;  3A0V A;  2INW A;  3FC7 A;  4L9E A;  1UGU A;  4EW7 A;  3F1P B;  2PD7 A;  5TBM A;  3UMD A;  2ZBB A;  1OTI A;  1MZU A;  5HDS A;  3K3C A;  1TS8 A;  2JN7 A;  4HP4 A;  5A8B A;  1DP6 A;  1EW0 A;  2CMN A;  2EA9 A;  5F68 A;  2YKH A;  2D02 A;  1DP8 A;  3EEH A;  3IBR A;  1XFN A;  3LIA A;  3KX0 X;  4I38 A;  3LIE A;  4EXO A;  2ZOI A;  4WLA A;  3NJA A;  2PR6 A;  1P0Z A;  2KDK A;  3B33 A;  1ODV A; 
#chains in the Genus database with same CATH topology
 3IXH A;  4ZBE A;  4QHC A;  3MMH A;  5F5Y A;  3T4J A;  4AFI A;  3TG9 A;  4DRT A;  3Q81 A;  4MLL A;  2Y2P A;  4DE2 A;  1KGG A;  4I3J A;  1BZA A;  3FV7 A;  3PBN A;  4LFU A;  3T1S A;  4G3V A;  4OON A;  1K0K A;  3FKV A;  1PWD A;  3NHQ A;  1S0W A;  5DTK A;  2JKF A;  1N9N A;  3IXB A;  2QPN A;  1PIO A;  3HLW A;  2Z6D A;  4HJ6 A;  5FL3 A;  3F1O A;  2HDQ A;  3I7J A;  2X01 A;  2OWJ A;  4OOL A;  3LEZ A;  3PBS A;  3KO6 A;  2V8F A;  3E4P A;  3G35 A;  2EX2 A;  2V9A A;  3R7W A;  1YAX A;  2HGV A;  3G2Z A;  3M6B A;  1NYY A;  2ZL1 B;  3NBL A;  4BWI A;  4DJ2 A;  3E98 A;  1DRM A;  1XJ4 A;  3UE3 A;  1BSG A;  3LIB A;  4OH0 A;  4Q8I A;  5CTM A;  2ZM2 A;  4FUW A;  1MKM A;  2XGN A;  3CPT B;  1YLJ A;  1YSP A;  2PR5 A;  1S66 L;  2ZJ9 A;  3GRJ A;  1XGJ A;  2XD5 A;  5F83 A;  2W1R A;  3C30 A;  1V9Y A;  2Z2M B;  5FAQ A;  3VE3 A;  5IHV A;  5DJU A;  5E2F A;  3ZVT A;  1CI9 A;  3A0R A;  4Z9Q A;  2EWW A;  4WBG A;  3UY6 A;  3MF0 A;  2WKR A;  1BUL A;  2ACG A;  4P6Z S;  1JTD A;  1BT5 A;  4GD6 A;  3RXW A;  3FPW A;  3HVF A;  4EUZ A;  1KOU A;  1NJ4 A;  5HAQ A;  5DTS A;  2XFT A;  2ZMF A;  4BBV A;  4ZJ1 A;  1K57 C;  4Y2F A;  4FD8 A;  1K54 A;  4D2O A;  5IS1 A;  5J7E A;  3V3R A;  5FI2 A;  1G68 A;  2WKI A;  4CLC C;  3UPP A;  1QMF A;  1T1B A;  3LI8 A;  4QPR A;  4B88 A;  1LLB A;  5EVI B;  1PNE A;  5E2G A;  5FI6 A;  3H82 A;  3LEQ A;  4BBT A;  2HP9 A;  3UE6 A;  1RP5 A;  4GDN A;  4H6J B;  2IWC A;  1BLS A;  2P7J A;  5HFO A;  5M18 A;  4HHD A;  3ISG A;  3SZT A;  3GVB A;  2HDS A;  5EFW A;  1H8M A;  4GKU A;  3F1P A;  4O7D A;  4S2N C;  5AVE A;  4WEK A;  4XUZ A;  1LSV A;  4P6B A;  4ZJ2 A;  3BEB A;  2EFX A;  3MXR A;  5L07 A;  3IX4 A;  3G31 A;  1P9R A;  3LIC A;  2KX6 A;  4RYE A;  4KZ8 A;  3UB8 A;  3BLS A;  4DJ3 A;  1RGZ A;  2GDN A;  4K0X A;  2JHE A;  1W5D A;  5GHY A;  1NZO A;  3P7N A;  4JLF A;  4C6Y A;  2V0U A;  3QNC A;  1PI5 A;  3FG8 A;  2HP6 A;  3KSF A;  5J3W A;  4PM9 A;  4MBF A;  4OQH A;  2PT7 A;  3SOI A;  5FAS A;  4EQ1 A;  4EET B;  4UQI S;  2PYP A;  1FR6 A;  4Y15 A;  3ZYT A;  1ES3 A;  1SKF A;  1OTE A;  1VM1 A;  5HDD A;  1ZKJ A;  3GEC A;  3EOI A;  4KZ9 A;  2JC7 A;  5HSQ A;  2KLI A;  3UE0 A;  2ZD8 A;  1U60 A;  4Y0O A;  4NK3 A;  1YLY A;  1A0K A;  3WRZ A;  2ZQ8 A;  1IFQ A;  3BM6 A;  3LYX A;  3KSH A;  4HJ3 A;  2QZ6 A;  3VP4 A;  4Y7P A;  5M1A A;  4IJG A;  3HLE A;  1AXB A;  3T4Q A;  5HWV A;  4XT2 A;  3HJI A;  4FH2 A;  2X71 A;  1K4E A;  3V5M A;  1GHM A;  3ITA A;  3UDF A;  1PYY A;  4KZ5 A;  4II7 A;  4XUX A;  4GHI A;  1KE4 A;  3W4Q A;  3P98 A;  1L2S A;  4PMA A;  2XA7 M;  3C38 A;  5F82 A;  2G2U A;  5U47 A;  5CX7 A;  3IS2 A;  3ICY A;  4H6J A;  4EBP A;  3Q7V A;  2VGL S;  2Y2O A;  1K55 A;  1JVJ A;  2BLS A;  4ARZ B;  4WM9 A;  1SCW A;  4KQR A;  3B3X A;  3G4P A;  4X53 A;  4X6T A;  3M2J A;  1D7E A;  3QP5 A;  1NWZ A;  3MZF A;  3UNW A;  2M1C A;  5CHJ A;  3OOV A;  3K3D A;  2OOL A;  3ZG8 B;  3VFH A;  5TJJ A;  1PI4 A;  3EWK A;  3ULF A;  1M6K A;  4KUK A;  3S7P A;  4E04 A;  3ZFZ A;  3N8S A;  2ZOH A;  2J7V A;  1IYO A;  3V3S A;  3CHW P;  5CEB A;  4U3T A;  3LI9 A;  4HI4 A;  3B47 A;  3P01 A;  4R4S A;  4Y0U A;  2EWV A;  2E8I A;  3UB7 A;  5DFY A;  3VP2 A;  4KG2 A;  2KOI A;  4GD8 A;  1OPX A;  2RL3 A;  4LRX C;  3VOL A;  4OLG A;  3NDG A;  1F98 A;  2WYX A;  3F1N B;  3WS5 A;  3EGD C;  1LL5 A;  2PD7 A;  5E43 A;  4X68 A;  3BFE A;  5TBM A;  2J3W A;  5GHX A;  1L0D A;  5IT5 A;  2Y2K A;  3LR3 A;  1MZU A;  3PTE A;  5EEC A;  2ZQA A;  1O7E A;  2G2W A;  4U0X A;  5AQB A;  4FSF A;  1LI9 A;  4KZB A;  4DXB A;  5A8B A;  1DP6 A;  3BYD A;  1IOU A;  3HLG A;  2CMN A;  1YM1 A;  3IWI A;  1F5M A;  4EBL A;  2H0T A;  4N1X A;  2W3H A;  3KX0 X;  1N9B A;  4I38 A;  3EQU A;  3K2N A;  3BFC A;  3WRT A;  4WYY A;  2OV5 A;  4WLA A;  4Y5F A;  2WKH A;  1ONG A;  2KDK A;  3PBR A;  3B33 A;  1ODV A;  4L9F A;  2GX5 A;  4OPZ A;  5DF7 A;  1MBL A;  3KYE A;  2J3T C;  1NLY A;  1ZC2 A;  1KE0 A;  4LEN A;  3OCL A;  2R9X A;  5M19 A;  3HLB A;  4PM5 A;  4E3M A;  3IF6 A;  5KZH A;  2Y55 A;  3OPH A;  3T1X A;  4K91 A;  1XFQ A;  1WE4 A;  3OPP A;  4S2I A;  2JCH A;  5AQA A;  3DBA A;  5AVF A;  2ZC5 B;  2EXA A;  4JGP A;  1F9I A;  5I94 A;  2LB5 A;  2EX9 A;  5GHZ A;  1KVM A;  2WGW A;  3LR5 A;  5EUA A;  1GSX A;  4P6Z M;  4FH4 A;  3ITB A;  4F3L A;  4LLO B;  4OOY A;  4F94 A;  1E25 A;  2XQZ A;  3UPN A;  2H5S A;  2VV8 A;  4CLC B;  2HDU A;  4EES A;  3RFB A;  4R4R A;  1H5X A;  1PZO A;  3BQA A;  1I5Q A;  2WK0 A;  4KZA A;  3CWF A;  1Q2Q A;  2NUP C;  1TF1 A;  3PHY A;  1LL9 A;  2JE5 A;  2Y2M A;  3BY8 A;  3BW6 A;  2QJ5 A;  2J9O A;  3NI9 A;  1G6A A;  2HF6 A;  3T50 A;  2OLU A;  3S7O A;  3N6I A;  2W1T A;  1H8Y A;  3T1R A;  4DKI A;  2HJ9 C;  4MN5 A;  5D3O A;  2GZA A;  5EM1 A;  5DFX A;  3OPL A;  1OJ5 A;  1ZG4 A;  4E3I A;  4KZ3 A;  5DVA A;  4JBF A;  5FQQ A;  1DJB A;  5F6A A;  1NRJ A;  4KQQ A;  4EUV A;  3R4K A;  2A3U A;  1UWN X;  4PM6 A;  4KG6 A;  1YT4 A;  1BLH A;  4Y17 A;  4HY8 A;  1XA1 A;  4OQI A;  3SH9 A;  1LSX A;  5CTN A;  5CGS A;  1W8Q A;  4JXW A;  1YPR A;  4S2M A;  4WZ5 A;  3MQO A;  4UA6 A;  2Y2N A;  5FDS A;  5AQ9 A;  2Y59 A;  4R0Q A;  4WZ4 A;  3A3J A;  2C6W B;  2VX8 A;  1K57 A;  1VB6 A;  4JXS A;  4KZ7 A;  1VET A;  1EI5 A;  4Y13 A;  5EVI D;  2VJW A;  4WF0 A;  2V2F F;  3CUE A;  1CEG A;  4Y0T A;  3L7H A;  1T19 A;  2A24 A;  3OPR A;  4Q0J A;  1YQS A;  3C8C A;  4MEZ A;  2Y79 A;  3PYP A;  4NXE A;  5FAO A;  3H7W B;  3DW0 A;  1MWU A;  5EVE A;  1Z6F A;  2WZX A;  3N8R A;  5L10 A;  3BJN A;  4EWF A;  1HLU P;  4EER A;  3LCE A;  3M6H A;  4GOG A;  1NY0 A;  1DJA A;  3IQA A;  2XSS A;  2QMI A;  1I2W A;  3P09 A;  2ZQ7 A;  1ERQ A;  1S6R A;  1P9W A;  4QB8 A;  2WKQ A;  5HAR A;  4HIA A;  1E4D A;  3D72 A;  3IWQ A;  3MBZ A;  3UN7 A;  3Q1F A;  2P74 A;  3PXP A;  3SS5 A;  2PD8 A;  4KEN B;  4GCZ A;  4M4X A;  4IVK A;  4ID4 A;  4RA7 A;  4P85 A;  1Y54 A;  3LUQ A;  5FA7 A;  2VLG A;  2Y91 A;  3G2Y A;  1FCO A;  4KUO A;  4GZB A;  5HD3 A;  4JGR A;  1IYS A;  3NDE A;  4EU0 A;  2XF3 A;  1E3U D;  3Q82 A;  5KIZ A;  1KGF A;  1TEM A;  5DF9 A;  3H9W A;  5C5K A;  1ES4 A;  4I3A A;  3S22 A;  3S1Y A;  4HOI A;  4CPK A;  4GN2 A;  5EE8 A;  1KVL A;  3DTE A;  1OJG A;  3DWZ A;  5TGF A;  4IED A;  1GHI A;  4NEE D;  1YLW A;  1ACF A;  2LB9 A;  4NXF A;  3LIF A;  4ZAM A;  3VSL A;  5A90 A;  3WS1 A;  3UB6 A;  2G7U A;  3IH9 A;  1S1Z A;  1FSY A;  4YOF A;  2MJ6 A;  2PAV P;  5KSH A;  3NUL A;  1T18 A;  3V50 A;  4KZ6 A;  2PU2 A;  3FPV A;  4DDS A;  4OLD A;  1G6O A;  3FZC A;  2DMW A;  3BFG A;  2J9P A;  4HJ4 A;  1K56 D;  4BD1 A;  1L0E A;  4C75 A;  2HV1 A;  3E2L A;  4KG5 A;  1BLP A;  5FSR A;  2ZL1 A;  5FEF A;  3ZG5 A;  3CG5 A;  1VEU B;  3LY4 A;  2B5R A;  2HP5 A;  2J80 A;  5MC7 A;  3E4Q A;  3OLO A;  2IWB A;  1HD8 A;  4DXC A;  4YIN A;  4ZJ3 A;  1I2S A;  4JXV A;  2HZ5 A;  3GV9 A;  3RTY A;  2OAP 1;  3CPT A;  2HDR A;  4EV4 A;  4UA7 A;  2Q9N A;  1ALQ A;  1TDG A;  4GLQ A;  1XXM A;  2Y2G A;  3AGD A;  3CZD A;  1JTG A;  4MNR A;  3MXS A;  3PBT A;  3VOY A;  2OAQ 1;  3OCN A;  1IKI A;  4OPQ A;  1STZ A;  1CJF A;  2INW A;  3FC7 A;  5CHU A;  3LR4 A;  5GL9 A;  3Q07 A;  1WYB A;  1W63 M;  2WGV A;  3C5A A;  1SDE A;  4BJP A;  4MBH A;  5K5B A;  1TS8 A;  3T4T A;  4E3J A;  3KSG A;  4E6X A;  1PRQ A;  4U0T A;  1FR1 A;  3C7U A;  3C7V A;  4MBK A;  2YKH A;  3IH8 A;  3IXG A;  3IBR A;  3IHB A;  1XKZ A;  5CGX A;  3LIA A;  3UB5 P;  4EXO A;  1M40 A;  4E3K A;  3MKE A;  4X1L A;  4BL3 A;  3CIT A;  3D9Y A;  5EVI A;  2P08 A;  4A5R A;  1K54 C;  3MFD A;  3BWL A;  1PWC A;  3D4F A;  5JYP A;  3LID A;  3T4O A;  1ZTU A;  5CXW A;  2V0W A;  2W3F A;  5AQ7 A;  2OLV A;  2XRO A;  3FYZ A;  3MFX A;  5HW3 A;  4OVD A;  4I3I A;  3A3I A;  2PBY A;  5L2F A;  1CK3 A;  2P9V B;  3SH8 A;  1SKO B;  5J8X A;  4GS9 B;  4YNR A;  5DJT A;  4K08 A;  5EM0 A;  5FQM A;  1NZU A;  2K2N A;  1G28 A;  1O07 A;  3CLO A;  4DE3 A;  1RGY A;  4LV0 A;  2ZMA A;  2W27 A;  2ZC6 B;  2I9V A;  2BAS A;  2WGI A;  3DTI A;  3ZG0 A;  1IYP A;  1W7F A;  3G6O A;  2V20 A;  1N9L A;  3MQQ A;  4DE1 A;  2XDM A;  4JXG A;  4CLC D;  1PW8 A;  1KDW A;  3NEC A;  1PZP A;  3O87 A;  5HPF A;  4Y3I A;  3GDI A;  3IXD A;  5LBR A;  1P97 A;  2V1B A;  2O99 A;  4EQI A;  1MPL A;  2GJ3 A;  4OPY A;  4E6W A;  2EXB A;  3JYI A;  4I39 A;  5FAT A;  4B4Z A;  1K6R A;  1Y28 A;  3C2W A;  4ETZ A;  3HUM A;  2PRF A;  1E3U A;  1TS7 A;  2K31 A;  1SZV A;  3SS4 A;  2VKS A;  4PM7 A;  1XX2 A;  3VP0 A;  1Q2P A;  4H8R A;  3PR6 A;  1CI8 A;  2WZZ A;  5HX9 A;  3T12 B;  2D01 A;  1OME A;  1GSW A;  5G4Z A;  3GQZ A;  2H0Y A;  2UWX A;  3QP1 A;  1IKG A;  1L0F A;  2OWH A;  4N9L A;  2NUT C;  4ETX A;  4RVA A;  3UO9 A;  1ESI A;  3QHY A;  5TR7 A;  1PWG A;  4ZDX A;  1V9Z A;  3BLM A;  4R3A A;  3G30 A;  4S2O A;  5KMW A;  4B4X A;  1JWZ A;  4NKP A;  2AVX A;  2WKE A;  3C4O A;  4HBU A;  4R6L A;  4ARZ A;  2ZC4 B;  3WS2 A;  1ERM A;  3V39 A;  1MKI A;  3ZG7 B;  2FH5 A;  3VV4 A;  1H0M A;  3HUN A;  3VSK A;  4LCL A;  3MJQ A;  1K56 A;  4GJ4 A;  1OTA A;  4QY5 A;  3AGE A;  4MCW A;  2VV7 A;  4N1H A;  1TS0 A;  1BYW A;  3HCY A;  4LCM A;  1IEL A;  2K7S A;  2JKR M;  3DWK A;  1XJ6 A;  2ZMV A;  5HDC A;  4G3K A;  4JF4 A;  5KSC A;  1FSW A;  2IA2 A;  5FI7 A;  3DTM A;  3UPO A;  2O9B A;  2JKR I;  2L1M A;  4ZTK A;  1MY8 A;  4HNB A;  4BMW A;  1MWS A;  3CJM A;  1LT0 A;  4PM8 A;  5HAI A;  3F1N A;  5L09 A;  3HLD A;  4I5S A;  4G3W A;  1YLT A;  3QNB A;  4IHQ A;  5CRF A;  2QKP A;  4FCF A;  1FOF A;  4RX3 A;  5BOH A;  3C4P A;  2H28 A;  4S2K A;  4LRZ E;  1C3B A;  5FQI A;  4M3K A;  1OTD A;  2HJE A;  2GNX A;  4CLC E;  4NG2 A;  3WWX A;  3W4P A;  3F1O B;  4WEJ A;  5TFQ A;  4IBR A;  1S67 L;  4OPR A;  3QP2 A;  3ZVW A;  1XA7 A;  3T4K A;  3R7W B;  2W3E A;  4GNU A;  3FKW A;  2Y2H A;  3TW8 A;  2XA7 S;  2H10 A;  3MXQ A;  3E4O A;  4O01 A;  1YLP A;  1T1C A;  3IF5 A;  1YKD A;  2A2L A;  2O9A A;  1SDN A;  4S2P A;  4UA9 A;  5CGW A;  5A93 A;  2Y2I A;  4Z1W A;  4P87 A;  1GA0 A;  4LPZ A;  5AJG A;  3OZH A;  4WMC A;  3MS6 A;  1IYQ A;  1HZO A;  4EEP A;  2R9W A;  4QJG A;  3HLC A;  3MR0 A;  5FQ9 A;  3OBF A;  3D3O A;  2JKG A;  2Z6C A;  1FCM A;  2FZ0 A;  4DE0 A;  2B95 A;  4UQI M;  3SS3 A;  4RX2 A;  1N4O A;  3G34 A;  4QD4 A;  4IVI A;  5E2E A;  4RQ9 A;  2BG1 A;  1K4F A;  3V67 A;  5I5L A;  3T4L A;  4N92 A;  4CLC A;  2VGJ A;  3PBO A;  5E2H A;  4B93 A;  1XJ3 A;  1OT9 A;  3KYZ A;  3IX3 A;  3E0Y A;  3GSG A;  2J3T D;  3O88 A;  3T4S A;  1W8Y A;  1MWR A;  4D60 A;  3O86 A;  2ZLY A;  5HAP A;  3RH8 B;  3NY4 A;  2XK1 A;  4HQA A;  4MN6 A;  3ZNY A;  3RXX A;  1J3W A;  1LSW A;  1H3Q A;  4ME4 A;  2VA0 A;  3LY3 A;  2QHK A;  5G4Y A;  4S2N A;  4HP9 A;  4JGO A;  5HWW A;  1N9O A;  4B9O A;  3H82 B;  1D1J A;  3ZDJ A;  3S7N A;  2ZM0 A;  3JPU A;  3MQ0 A;  2VGL M;  5F1G A;  2W3G A;  3W8K A;  2C5W B;  2JKT M;  1L0G A;  2HPB A;  5IU1 A;  4LV2 A;  5EOE A;  3VFF A;  5DTT A;  3F1P B;  2P04 A;  3IHA A;  3DTK A;  3UMD A;  2PU4 A;  4CQH A;  1OTI A;  2Y8H A;  1K25 A;  2JKT I;  1RCJ A;  3N8L A;  3HL9 A;  1DJC A;  2XH9 A;  3EQV A;  2JN7 A;  2WUQ A;  3LO7 A;  3NIA A;  3KSI A;  5CEC A;  2EX6 A;  3CI6 A;  2DNS A;  4K0W A;  1DP8 A;  3EEH A;  1KE3 A;  5FAP A;  3LIE A;  3MSH A;  3W2Z A;  3NJA A;  2PR6 A;  1P0Z A;  4WZ5 C;  4R3J A;  3NC8 A;  1FIL A;  1Z09 A;  4E3L A;  1IEM A;  1ES2 A;  2PBD P;  1GCE A;  1MXO A;  3HUO A;  3RJU A;  4PAU A;  2QYB A;  2Q9M A;  3H7W A;  4LGW A;  5CED A;  1BLC A;  4N9K A;  4XT2 B;  4PPR A;  1W63 Q;  3CUE C;  1AWI A;  4X69 A;  1D06 A;  5FQK A;  1S1Y A;  3GMW A;  4OQG A;  5FDH A;  3LGO A;  1YMS A;  4GHI B;  3QP4 A;  3SW1 A;  4LV3 A;  1J9M A;  3LFV A;  1CQA A;  2Y4A A;  3HJK A;  2DCF A;  2YKF A;  1YMX A;  5EOO A;  3IS2 B;  4OKP A;  4R70 A;  1PFL A;  2QWS A;  3HLF A;  4QY6 A;  2V1A A;  1OTB A;  3Q7V B;  4NXG A;  4OP8 A;  4JF6 A;  1SHV A;  4IBX A;  1XP4 A;  4BBU A;  3MZE A;  1MC0 A;  3A3F A;  4S2J A;  3NOT C;  2QJ7 A;  5HL6 A;  3ZG9 B;  4MMN A;  3ZGA B;  3TJZ C;  1NYM A;  4R1G A;  3E2K A;  4IUK A;  4BD0 A;  3VP1 A;  3BQ8 A;  2ZC7 A;  3TE8 A;  1ES5 A;  2XLN A;  4DN0 A;  3UDX A;  4O8G A;  2I72 A;  1NRF A;  1GA9 A;  4DDY A;  4BEN A;  3MKF A;  3U4L P;  3ZCZ A;  2O0Y A;  1BTL A;  1ESU A;  4PHT A;  2B18 A;  1YSQ A;  2DRW A;  4UAA A;  1ZHH B;  3CAX A;  3UDI A;  1UWP X;  4QWO A;  3S4X A;  3JVU A;  1WYC A;  3BEC A;  5L8M A;  5TBM B;  2Y2Q A;  5HZH A;  2L4R A;  2WKP A;  5DF8 A;  3VMA A;  3GR2 A;  4MDZ A;  1KDS A;  4HEF A;  2X02 A;  2XRN A;  2EX8 A;  1DP9 A;  5EVL A;  1L3L A;  4L0L A;  4LV1 A;  3BRM A;  2M7V A;  3EEA A;  4WMC D;  4L9G A;  4YWZ A;  1H8Z A;  1GSV A;  1T1A A;  3VP3 A;  1K38 A;  5FQJ A;  1VEU A;  4JGQ A;  1ZG6 A;  4P0M A;  1LHY A;  3VOZ A;  4X55 A;  1XPB A;  4JPM A;  3WS4 A;  3A0S A;  4X1M A;  4Q0H A;  3N7W A;  3NOP C;  2WAF A;  5F1F A;  2R78 A;  1F2K A;  3IF6 B;  2VEA A;  2PDR A;  2L0W A;  5CER A;  3ZQ5 A;  1JNU A;  1MWT A;  4R3B A;  1YLZ A;  1CF0 A;  3BFF A;  1WA9 A;  2UV0 E;  3NCK A;  2O9C A;  2XEP A;  4GW9 A;  4HH2 A;  1HTZ A;  3M2K A;  3HBR A;  5A91 A;  4MN7 A;  2WGW B;  3EGX C;  4OOM A;  4BLM A;  4WUJ A;  1G5U A;  3W4O A;  4KQD A;  4FOF A;  4IUH A;  4F3L B;  5GLB A;  4CJN A;  5EPH A;  3KYQ A;  1PW1 A;  4YFM A;  2WAD A;  1NLZ A;  4OQ0 A;  5HL1 A;  3PAE A;  4WL9 A;  2JBF A;  4X56 A;  2EFU A;  2PYR A;  4BQM A;  2XR0 A;  2M7U A;  5GLA A;  3BFD A;  4EBN A;  2Y2L A;  3G32 A;  5HD5 A;  3MZD A;  4HH3 A;  3UB9 A;  3N4I A;  1K6S A;  1TVF A;  1NXY A;  1X0O A;  5J4E A;  1DY6 A;  4JKT A;  2XFS A;  3FWL A;  3UE1 A;  4HES A;  4NET A;  2BTF P;  1TS6 A;  3T1Q B;  5GLC A;  1S4R A;  5DKL A;  1GHP A;  4BL2 A;  3VE4 A;  2V1Z A;  2P9V A;  2ZQ9 A;  1SKO A;  2W1T B;  4E3N A;  5EVI C;  4GS9 A;  3UME A;  2XD1 A;  3Q7Z A;  1Y4O A;  5G18 A;  5EV0 A;  4S2L A;  3NOU C;  3ZHH A;  2FFF B;  4WEL A;  1S4S A;  4GDB A;  2ZQC A;  1K55 C;  3TRC A;  4FTX A;  3SH7 A;  4ZRR A;  2B02 A;  1JWP A;  4PKY G;  4DMZ A;  1XJ2 A;  4JF5 A;  4NXB A;  1VQQ A;  4LRY C;  2WAE A;  4Q0I A;  4EEU A;  2VK3 A;  3S7Q A;  5CHM A;  3IBJ A;  4DF6 A;  5GLD A;  2E8J A;  2ZM8 A;  4C3Q A;  5HWT A;  4HBT A;  4UHU A;  3ZNT A;  2W0N A;  5DKK A;  1OT6 A;  2FFY A;  4PKY A;  4OP5 A;  5F69 A;  1FCN A;  4R38 A;  1BUE A;  3B42 A;  1VET B;  3L9K A;  2W3D A;  2VV6 A;  3A3E A;  1LI0 A;  3BY9 A;  3QP8 A;  1QME A;  4X25 A;  4XXR A;  4ESP A;  3IWO A;  3DAV A;  2PHY A;  5HPI A;  1KGE A;  2A24 B;  2V8C A;  1EWZ A;  4O0P A;  1LL8 A;  1CEF A;  4KZ4 A;  5FEG A;  3IT9 A;  1TD5 A;  2VGK A;  4WN5 A;  3JVV A;  1ERO A;  1HVB A;  2OSU A;  3IX8 A;  3A3D A;  2J8Y A;  3A0V A;  4E3O A;  4L9E A;  1UGU A;  2IWD A;  4EW7 A;  3O5Y A;  4KQO A;  4QU3 A;  2ZC3 B;  2ZBB A;  1JWV A;  4UEY A;  5HDS A;  3K3C A;  3TSG A;  3OC2 A;  3AGF A;  2ZQD A;  3PBQ A;  2A49 A;  1XGI A;  2Y2J A;  1ONH A;  1FIK A;  3QP6 A;  3PAG A;  4GB7 A;  4HP4 A;  2VZW A;  3TOI A;  1EW0 A;  1FQG A;  2RCX A;  2EA9 A;  4R23 A;  3CMZ A;  5F68 A;  2D02 A;  5A92 A;  2Q0O A;  3O3V A;  1XFN A;  2Z2L B;  3LR0 A;  2ZOI A;  3WS0 A;  3HRE A;  3U2A A;  1VHM A;  3GTC A;  3IF6 C;  2CC1 A;  5JYO A;  1TDL A;  1W79 A; 
#chains in the Genus database with same CATH homology
 4L9F A;  2GX5 A;  2P08 A;  2J3T C;  1NLY A;  3BWL A;  3OCL A;  3LID A;  3MMH A;  5F5Y A;  3T4O A;  1ZTU A;  3T4J A;  4AFI A;  2V0W A;  2W3F A;  2XRO A;  4PAU A;  3MFX A;  2QYB A;  4I3I A;  3H7W A;  1XFQ A;  4I3J A;  4XT2 B;  1W63 Q;  3CUE C;  3PBN A;  4GS9 B;  4YNR A;  4G3V A;  5DJT A;  4K08 A;  3DBA A;  1D06 A;  3NHQ A;  1S1Y A;  5AVF A;  2K2N A;  4JGP A;  1G28 A;  3CLO A;  1F9I A;  4GHI B;  3SW1 A;  2LB5 A;  2W27 A;  1N9N A;  2I9V A;  2BAS A;  3LFV A;  3LR5 A;  3HJK A;  1GSX A;  2YKF A;  4P6Z M;  3G6O A;  1N9L A;  3MQQ A;  2Z6D A;  4HJ6 A;  3IS2 B;  5FL3 A;  3F1O A;  4R70 A;  4F3L A;  2QWS A;  4LLO B;  2V1A A;  1OTB A;  4NXG A;  4CLC D;  2OWJ A;  4OOL A;  3PBS A;  2VV8 A;  4CLC B;  3KO6 A;  4BBU A;  3PBR A;  5HPF A;  3E4P A;  4Y3I A;  1MC0 A;  2V9A A;  3GDI A;  5LBR A;  1P97 A;  3R7W A;  3NOT C;  2V1B A;  2O99 A;  2QJ7 A;  1YAX A;  5HL6 A;  4MMN A;  4EES A;  2HGV A;  3RFB A;  3TJZ C;  2GJ3 A;  4BWI A;  4DJ2 A;  4IUK A;  4I39 A;  3BQA A;  3E98 A;  1DRM A;  3BQ8 A;  1XJ4 A;  3UE3 A;  3TE8 A;  3LIB A;  1Y28 A;  4DN0 A;  3CWF A;  1MKM A;  4O8G A;  2NUP C;  1TF1 A;  3PHY A;  3C2W A;  4ETZ A;  1YSP A;  2PR5 A;  1S66 L;  2W1R A;  3BY8 A;  3C30 A;  1TS7 A;  1V9Y A;  2K31 A;  3BW6 A;  2QJ5 A;  2VKS A;  2HF6 A;  3T50 A;  3VE3 A;  2O0Y A;  3PR6 A;  5DJU A;  3S7O A;  2W1T A;  2D01 A;  4PHT A;  1GSW A;  2B18 A;  1YSQ A;  5G4Z A;  2HJ9 C;  3A0R A;  4MN5 A;  1ZHH B;  3CAX A;  2GZA A;  5DFX A;  2EWW A;  1UWP X;  2OWH A;  2NUT C;  1OJ5 A;  4ETX A;  3JVU A;  5L8M A;  5TBM B;  5HZH A;  2L4R A;  3MF0 A;  2WKP A;  5F6A A;  1NRJ A;  2WKR A;  4EUV A;  3R4K A;  4MDZ A;  4P6Z S;  1V9Z A;  1UWN X;  4R3A A;  3FPW A;  2XRN A;  4HY8 A;  1DP9 A;  4NKP A;  4R6L A;  1KOU A;  4ARZ A;  1LSX A;  2ZMF A;  4L0L A;  4BBV A;  2FH5 A;  3VV4 A;  4Y2F A;  3EEA A;  2M7V A;  3MQO A;  4L9G A;  3MJQ A;  4YWZ A;  4GJ4 A;  5IS1 A;  1OTA A;  4MCW A;  2VV7 A;  1GSV A;  1T1A A;  1BYW A;  1TS0 A;  3HCY A;  5J7E A;  2K7S A;  2VX8 A;  4JGQ A;  1VB6 A;  2JKR M;  4CLC C;  1XJ6 A;  2ZMV A;  1T1B A;  3LI8 A;  5HDC A;  4QPR A;  4G3K A;  2VJW A;  4WF0 A;  3A0S A;  2IA2 A;  4Q0H A;  3CUE A;  3NOP C;  1T19 A;  3H82 A;  2A24 A;  2R78 A;  4Q0J A;  4BBT A;  3C8C A;  2VEA A;  2O9B A;  3UE6 A;  2PDR A;  2L0W A;  2JKR I;  2L1M A;  4H6J B;  2Y79 A;  4HNB A;  3PYP A;  2P7J A;  4BMW A;  3ZQ5 A;  4NXE A;  1JNU A;  4HHD A;  1LT0 A;  3H7W B;  3F1N A;  1WA9 A;  3BJN A;  5EFW A;  1H8M A;  4I5S A;  4G3W A;  4EER A;  3F1P A;  2O9C A;  5AVE A;  4WEK A;  1LSV A;  4IHQ A;  2QKP A;  1P9R A;  3LIC A;  2KX6 A;  4GW9 A;  4HH2 A;  2XSS A;  2H28 A;  4LRZ E;  4MN7 A;  3UB8 A;  1OTD A;  3EGX C;  4DJ3 A;  4OOM A;  2HJE A;  2GNX A;  4CLC E;  4WUJ A;  2JHE A;  1P9W A;  3F1O B;  2WKQ A;  4KQD A;  4FOF A;  4WEJ A;  4IUH A;  4F3L B;  1S67 L;  3P7N A;  4HIA A;  3KYQ A;  2V0U A;  1NLZ A;  3D72 A;  3T4K A;  3FG8 A;  3KSF A;  5J3W A;  3PXP A;  2W3E A;  3R7W B;  4WL9 A;  2PT7 A;  2PD8 A;  2PYR A;  4EQ1 A;  4EET B;  4UQI S;  2PYP A;  2M7U A;  4GCZ A;  3ZYT A;  4M4X A;  3TW8 A;  2XA7 S;  3MXQ A;  3E4O A;  1OTE A;  4O01 A;  5HDD A;  1T1C A;  3LUQ A;  5HD5 A;  1YKD A;  3GEC A;  3EOI A;  4HH3 A;  2A2L A;  2O9A A;  2VLG A;  5HSQ A;  2KLI A;  3UB9 A;  4KUO A;  5HD3 A;  4JGR A;  1X0O A;  5J4E A;  4EU0 A;  1IFQ A;  3LYX A;  4Z1W A;  3KSH A;  5KIZ A;  4HJ3 A;  4LPZ A;  5DF9 A;  3H9W A;  5AJG A;  1TS6 A;  5C5K A;  4IJG A;  1S4R A;  5DKL A;  3T4Q A;  4I3A A;  3VE4 A;  4EEP A;  5HWV A;  4XT2 A;  2W1T B;  3HJI A;  3MR0 A;  4GS9 A;  4HOI A;  3OBF A;  3D3O A;  3UME A;  2Z6C A;  2FZ0 A;  1OJG A;  4II7 A;  4GHI A;  3NOU C;  4UQI M;  4NEE D;  4WEL A;  1S4S A;  2LB9 A;  2XA7 M;  4NXF A;  3LIF A;  3TRC A;  3C38 A;  4ZRR A;  5CX7 A;  2B02 A;  4PKY G;  3IS2 A;  1XJ2 A;  2G7U A;  3ICY A;  3UB6 A;  4DMZ A;  4H6J A;  1S1Z A;  4RQ9 A;  4NXB A;  4LRY C;  4YOF A;  3V67 A;  2MJ6 A;  2VGL S;  4Q0I A;  4EEU A;  5I5L A;  3S7Q A;  3T4L A;  4CLC A;  4ARZ B;  5KSH A;  3PBO A;  3IBJ A;  4B93 A;  1T18 A;  1XJ3 A;  1OT9 A;  3FPV A;  3KYZ A;  1G6O A;  3E0Y A;  2J3T D;  2DMW A;  4HJ4 A;  3T4S A;  1D7E A;  2HV1 A;  1NWZ A;  5HWT A;  3RH8 B;  2M1C A;  2W0N A;  3OOV A;  5DKK A;  1OT6 A;  3K3D A;  2OOL A;  4HQA A;  4MN6 A;  4PKY A;  5TJJ A;  3EWK A;  5F69 A;  3ULF A;  2J80 A;  5MC7 A;  3E4Q A;  3OLO A;  4R38 A;  4KUK A;  3B42 A;  3S7P A;  4E04 A;  2W3D A;  2VV6 A;  1LSW A;  2ZOH A;  3BY9 A;  1H3Q A;  4ME4 A;  2VA0 A;  3RTY A;  2OAP 1;  2QHK A;  5G4Y A;  2PHY A;  5HPI A;  3LI9 A;  4HI4 A;  4GLQ A;  4HP9 A;  4JGO A;  3B47 A;  5HWW A;  3P01 A;  1N9O A;  4B9O A;  3H82 B;  2A24 B;  4O0P A;  1LL8 A;  3S7N A;  2EWV A;  3MQ0 A;  3UB7 A;  2VGL M;  3PBT A;  5DFY A;  1TD5 A;  2KOI A;  2W3G A;  2OAQ 1;  1OPX A;  4WN5 A;  3JVV A;  4LRX C;  3VOL A;  2JKT M;  3OCN A;  1F98 A;  3F1N B;  1STZ A;  5IU1 A;  3A0V A;  2INW A;  3EGD C;  3FC7 A;  4L9E A;  1UGU A;  4EW7 A;  3LR4 A;  3F1P B;  2PD7 A;  2P04 A;  3O5Y A;  5TBM A;  2J3W A;  4KQO A;  3UMD A;  2ZBB A;  1W63 M;  4CQH A;  5IT5 A;  1OTI A;  4BJP A;  3LR3 A;  1MZU A;  2JKT I;  2Y8H A;  4UEY A;  5HDS A;  3K3C A;  5K5B A;  3OC2 A;  1TS8 A;  3PBQ A;  4FSF A;  3T4T A;  3EQV A;  2JN7 A;  4HP4 A;  3KSG A;  2VZW A;  5A8B A;  1DP6 A;  1EW0 A;  1IOU A;  3KSI A;  2CMN A;  2EA9 A;  3CI6 A;  1F5M A;  5F68 A;  2YKH A;  2D02 A;  1DP8 A;  3EEH A;  3IBR A;  1XFN A;  2W3H A;  3LIA A;  3KX0 X;  4I38 A;  3EQU A;  3LIE A;  3K2N A;  3LR0 A;  3W2Z A;  4EXO A;  2ZOI A;  4WLA A;  3NJA A;  4Y5F A;  2PR6 A;  3CIT A;  3U2A A;  1VHM A;  1P0Z A;  2KDK A;  3B33 A;  1ODV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...