5HD3A

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: dark structure of photoactive yellow protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 36
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hd3A00
3MJQA 4HJ3A 4R70A 1Y28A 3B33A 3H7WB 1TS6A 1BYWA 3H9WA 2EA9A 5G4YA 4L9GA 3LIAA 4HJ6A 2PYPA 1DP9A 3NJAA 5F6AA 1OJ5A 1XJ2A 3MQOA 4KQDA 1P0ZA 1OTIA 1T1BA 1OJGA 1JNUA 4BBVA 3UB8A 1OT9A 2QHKA 4DJ3A 4NXBA 3ULFA 2PYRA 2W0NA 2VV7A 1N9LA 3HJKA 5TBMA 2A24B 4PKYA 3F1OA 5HSQA 3LIDA 4HJ4A 4YWZA 5TBMB 1XFQA 2PD7A 2ZOIA 2K7SA 1OTBA 1TS0A 3GDIA 2D02A 3MFXA 3FC7A 4WF0A 5DKLA 3GECA 1F9IA 3HJIA 4H6JA 1DP8A 3UMEA 2KDKA 1S4SA 4PKYG 1TS8A 4GW9A 1LSWA 3C8CA 4EEUA 2M1CA 4EESA 2OWJA 4XT2A 2PHYA 2L1MA 3D72A 4HI4A 1VB6A 3F1NB 3C2WA 2PR5A 1N9NA 1LSXA 3BY9A 5HZHA 5IU1A 2PR6A 3NOTC 1KOUA 4HP9A 5EFWA 5HDSA 4I39A 3LICA 3IS2A 3UB7A 2YKHA 2R78A 4MN5A 3IBRA 3NOPC 4NXGA 4GS9A 5F5YA 5AVFA 2Z6CA 5DJUA 4EQ1A 2L0WA 3H7WA 1TS7A 4I3IA 1LL8A 4EEPA 4I38A 5AVEA 5J3WA 3E4OA 1F98A 3LIBA 2L4RA 3EEHA 4EETB 1XFNA 4JGPA 5HWVA 5J4EA 4WUJA 2J80A 2KX6A 4JGQA 1WA9A 1DP6A 1V9YA 2JN7A 3VE3A 2VV8A 3SW1A 1GSVA 5HD3A 3F1PB 4B9OA 2P7JA 2QKPA 2A24A 4HOIA 1LSVA 2D01A 4EERA 3H82A 3UB6A 3K3DA 4WLAA 3H82B 1D7EA 1G28A 2QJ5A 4LRZE 2W27A 2QWSA 2Z6DA 4WL9A 4E04A 5HWWA 5DKKA 2OOLA 4DJ2A 1UWNX 2I9VA 3LI8A 4K08A 4WN5A 2ZOHA 3F1NA 2JHEA 2V0UA 4R38A 3NOUC 1OTDA 5I5LA 2OWHA 2V1AA 1OTEA 1EW0A 3MXQA 3PYPA 4BBTA 4KUOA 1T18A 1S66L 2VV6A 1S1ZA 2ZBBA 2INWA 4JGOA 3PHYA 4KUKA 4EXOA 3MR0A 5HWTA 4I5SA 4LLOB 2CMNA 5J7EA 5HDCA 4HP4A 2V0WA 3BWLA 1XJ3A 4LRYC 4MN6A 3EWKA 4I3JA 4HH3A 1N9OA 1XJ4A 1S4RA 1X0OA 5F69A 1DRMA 1OT6A 3P7NA 4L9FA 5A8BA 3FG8A 2QJ7A 1S1YA 3LIEA 4HQAA 4M4XA 4F3LB 2B02A 4EW7A 4NXFA 2WKRA 4HY8A 4JGRA 4LPZA 1NWZA 1V9ZA 3LUQA 3VOLA 4L9EA 2GJ3A 2V1BA 4BBUA 3NHQA 3CWFA 3F1PA 3UE6A 3VE4A 1XJ6A 5HD5A 4HHDA 4RQ9A 4LRXC 3A0VA 3UMDA 1UWPX 4R6LA 3E4QA 3G6OA 2VEAA 3RH8B 3KX0X 1P97A 3A0SA 4HIAA 2VLGA 3RTYA 3F1OB 1ODVA 5F68A 3T50A 1MZUA 1T19A 4GHIA 3UB9A 3OLOA 1UGUA 4GHIB 3LYXA 4NXEA 5DJTA 4H6JB 1T1CA 3LIFA 3ZQ5A 2YKFA 1GSWA 3ICYA 3CLOA 2PD8A 2BASA 4XT2B 3LI9A 1S67L 4R3AA 5IS1A 4GCZA 3BY8A 1D06A 2H28A 1OTAA 2WKQA 4HH2A 3MQQA 4HNBA 1T1AA 1LT0A 3CAXA 2PDRA 2WKPA 2V9AA 1GSXA 3A0RA 3IS2B 3K3CA 5KIZA 4I3AA 5HDDA 4GS9B 4F3LA 2HV1A 3E4PA 5G4ZA
chains in the Genus database with same CATH superfamily
3BM6A 1JWZA 3MJQA 4BD0A 5FEFA 3H7WB 1TS6A 1BYWA 4JXVA 1SKOA 2EA9A 5FQKA 3SH9A 2PBDP 4HJ6A 5JYOA 2A3UA 2VK3A 4OQ0A 2VGKA 4O01A 1LI9A 1NLYA 1VQQA 1OJGA 1JNUA 2Q9NA 2P04A 3UB8A 4K0XA 1EI5A 2FZ0A 3GVBA 4NXBA 2O0YA 2Y2JA 3TSGA 4G3KA 5IHVA 1N9LA 2J3TD 3UPNA 1HLUP 3A3DA 2HDSA 4PKYA 4YWZA 1KE4A 2JC7A 5HARA 3N8RA 2PD7A 4CLCE 2QZ6A 2W1TB 3OPPA 5M18A 3GDIA 4GB7A 2O9AA 2EX6A 3IXBA 3SZTA 1BTLA 1DP8A 4HBTA 3NIAA 5U47A 2E8JA 2V8CA 1TS8A 4LV2A 4E3KA 4UHUA 1DY6A 3BYDA 3FWLA 5CRFA 4GKUA 3Q7VA 2Y2NA 5EVEA 3Q07A 3LCEA 4GLQA 2EFUA 3AGEA 4WZ5C 2HZ5A 1K55A 1E3UA 4JKTA 5CXWA 3LO7A 4QJGA 1NYYA 5FSRA 1K6SA 4ZTKA 1L0FA 4II7A 4P0MA 1MWUA 4P85A 3VSKA 4I39A 4LCMA 1TEMA 5L8MA 4E3MA 4MN5A 2OAP1 1XP4A 5EOEA 4C75A 4NXGA 5F5YA 4Q0JA 5CGWA 4OQGA 1YMSA 5L10A 4X68A 2RL3A 1JWVA 2L0WA 4I3IA 4S2NA 3IXGA 2WKHA 3ZYTA 4I38A 3E4OA 3CMZA 4GNUA 4E3NA 2L4RA 2X71A 3EEHA 3GQZA 1DJCA 2Y91A 2DMWA 1NYMA 3UO9A 2XFSA 3T4QA 5GHXA 5C5KA 4JF5A 4OQHA 3O3VA 2KX6A 3UE0A 3G30A 2VV8A 3MXRA 1ERQA 2WGVA 5HD3A 4YFMA 2LB9A 1PZOA 2P7JA 1E3UD 1ONGA 3H82A 5G18A 3H82B 4KENB 2QJ5A 3G34A 2W27A 4LRZE 1K56D 2QWSA 3ITAA 2HPBA 3D3OA 4JF6A 4QD4A 1DJBA 3P01A 4DN0A 4U0XA 3GMWA 4DJ2A 4ZBEA 3B47A 4U0TA 5DVAA 3E2KA 5HPIA 5FI7A 1RP5A 4MEZA 3LI8A 1IELA 1M40A 2ZQ9A 4Z1WA 2O9BA 2ZOHA 4R38A 5AQBA 4GOGA 1TVFA 3E98A 4S2PA 3T4JA 5I5LA 2V1AA 3FV7A 1MY8A 3P09A 5DFYA 4ZJ1A 1W7FA 1YLYA 1IYSA 3P98A 4KUOA 1T18A 2J9PA 1Q2PA 2WAEA 2ZBBA 3L9KA 4HESA 3NY4A 1YLJA 5HWTA 4LLOB 1JTGA 5HDCA 4G3VA 3W4OA 1W8YA 1E25A 3OZHA 4WZ5A 1PW8A 4Y15A 5AQ7A 2Y2QA 3DWZA 4X53A 1MPLA 3KYQA 3HLCA 1MC0A 1S4RA 3ZNYA 2K2NA 4OONA 3P7NA 3T1SA 1A0KA 2QJ7A 3LIEA 4F94A 2Y79A 3IBJA 2Y2PA 3SH8A 4KQRA 4JGRA 1NRFA 4NETA 4Q0HA 2JE5A 4BJPA 3CITA 1KDWA 4RX2A 2J3WA 4Y2FA 1KVLA 3NI9A 4IVIA 1PI4A 4AFIA 2W3DA 1LLBA 3IXHA 2QYBA 2G7UA 2IA2A 3E4QA 3TW8A 3HLEA 2OSUA 4GZBA 3QP5A 3KSGA 3T4TA 5F1GA 4N92A 3MBZA 1I2WA 2J3TC 2Y8HA 1P97A 3DBAA 1ACFA 2J9OA 2HDQA 1HVBA 4MBFA 5HFOA 2EWWA 4BLMA 3PBRA 1HTZA 1T19A 3C38A 3LGOA 1JTDA 3IT9A 2OLVA 5DJTA 3OPLA 4UAAA 3ZQ5A 3ICYA 3QNBA 3IX4A 3A3IA 4KG6A 3HUNA 3IH9A 2IWCA 4Z9QA 5E2EA 1DJAA 4ZRRA 1JWPA 1MWTA 3N4IA 3VFFA 3EQVA 2HJ9C 3C4OA 2ZQ7A 4EQIA 2DCFA 2Y2LA 2WKQA 4Q0IA 4HH2A 3W4QA 1BSGA 2PDRA 5HL1A 3A0RA 2GNXA 3D4FA 2WYXA 4I3AA 3G31A 5HDDA 1SHVA 4GS9B 2JKTM 3MZFA 3MZDA 2HV1A 1L3LA 3C30A 3OPRA 2JBFA 4EWFA 5EECA 1HD8A 2EFXA 3CG5A 2GZAA 2EWVA 4NK3A 4RA7A 1G68A 4OKPA 1STZA 3GR2A 3V50A 4KZ7A 5GLDA 3MQOA 4KQDA 1P0ZA 4DDYA 4E3LA 1J3WA 5JYPA 3OCLA 3S1YA 2PT7A 2WGWB 4BBVA 1H8YA 5TR7A 1IOUA 3FKWA 2P74A 1FSYA 5FQ9A 4Y3IA 1NZOA 3ULFA 2PYRA 2JKRM 1BZAA 1BLSA 2HF6A 2ZJ9A 3HJKA 3IX3A 3BLMA 4S2LA 2A24B 3VP4A 4HJ4A 5AQAA 1NLZA 1XFQA 1IFQA 3O5YA 4QB8A 4E6WA 1E4DA 3MKEA 3UY6A 4WF0A 5DKLA 1RCJA 2BLSA 1YKDA 3JVVA 1VHMA 3IQAA 3A3EA 2KDKA 4PKYG 5DF7A 2M7UA 2DRWA 1BLPA 2A2LA 1K4EA 2QMIA 2RCXA 3T1QB 2M1CA 1N9BA 4CLCB 3QNCA 3VOZA 4XT2A 4UA7A 3D72A 4HI4A 3PBOA 1TF1A 1VB6A 3VSLA 3C5AA 1W8QA 2PR5A 3GV9A 3HLBA 3HLFA 4DE1A 1LSXA 2HP5A 4QU3A 1KOUA 4HP9A 5EFWA 1W5DA 1LI0A 1KVMA 4BENA 4G3WA 4OP8A 3SS4A 3LY3A 5CEDA 2WZXA 3PAEA 4MCWA 3NOPC 1ZC2A 4CQHA 2Z6CA 5DJUA 3BFFA 5FQJA 1VM1A 3H7WA 1TS7A 3HLWA 4JXGA 1LL8A 3WS0A 3FZCA 1NY0A 1L0GA 4UEYA 5J3WA 3ZG5A 1K25A 1ZHHB 3T4KA 4P6ZS 3VV4A 3S7PA 2GX5A 3U4LP 1XFNA 3ZG0A 4JGPA 2XRNA 2Y2KA 3A3FA 2XDMA 1FILA 2HGVA 1MWSA 2EX2A 2XF3A 1S0WA 3BW6A 5AJGA 3VE3A 1TDLA 2EXBA 5FDHA 4MMNA 4KZ5A 1PFLA 3DTEA 5CHUA 3F1PB 2LB5A 4EBNA 1Y4OA 3MMHA 4HOIA 4EERA 3UB6A 3KSIA 2DNSA 2W1TA 4E3IA 3C7VA 4D2OA 1PYYA 1MKIA 2V20A 3LEZA 5EPHA 2K31A 4D60A 4E04A 2EXAA 3NCKA 3HCYA 1CF0A 1YLZA 4FSFA 2I9VA 3CPTB 4GDNA 3S7QA 4GD6A 4HEFA 4K08A 4UQIS 4DE2A 4WN5A 1P9RA 3QP2A 5DF9A 4WELA 4WMCA 2OWHA 4LGWA 4WM9A 1K56A 5TGFA 4BBTA 4UA9A 2FFYA 4X1LA 4U3TA 1M6KA 3ZDJA 3GTCA 3V3RA 1J9MA 3LR0A 1ZTUA 4KUKA 5CERA 4Q8IA 4ZDXA 1YSQA 2PBYA 3HUMA 1H0MA 2CMNA 5GHZA 2V0WA 2ZMAA 3Q81A 3SH7A 3ISGA 5EUAA 4MN6A 1XX2A 5A91A 1N9OA 2VJWA 3UPOA 3PBTA 1W63M 1OT6A 4L9FA 3BRMA 3V5MA 3FG8A 3TOIA 4HQAA 3ZFZA 4F3LB 1ALQA 3VP2A 2XA7M 4HY8A 4LV3A 2H5SA 2XQZA 5K5BA 3EQUA 4LPZA 1V9ZA 1YAXA 3LUQA 4QWOA 4L9EA 3LFVA 2V1BA 4BBUA 3ITBA 1K57C 1LHYA 2I72A 2VKSA 4Y13A 1XGIA 5HD5A 4B88A 1IKGA 4RQ9A 2WKIA 1PIOA 3V3SA 2ZC7A 4BWIA 4N9LA 1ONHA 3WS1A 4LRXC 2JKGA 4IVKA 1UWPX 4R6LA 4WMCD 2ZMFA 2EX8A 4PM7A 1U60A 3DTKA 3QP4A 2VEAA 1GA9A 3KX0X 1LL5A 1BLCA 4KG5A 1AXBA 3MKFA 1ES4A 3G35A 4C3QA 2VLGA 3RTYA 3F1OB 1ODVA 4RVAA 1MZUA 5EVIC 3VP1A 1L0DA 4GHIA 1QMFA 3UE3A 4MN7A 4GHIB 4R4RA 3JVUA 3FPWA 3LEQA 1TDGA 3N8SA 4FCFA 2XD1A 2Z2LB 2Y2HA 1C3BA 4H6JB 1T1CA 3MSHA 5AQ9A 1OPXA 3LIFA 2M7VA 4EUZA 1FSWA 3V67A 4B4XA 4Y0TA 1RGYA 3U2AA 3VFHA 3CI6A 5CHMA 1KDSA 3HREA 2JKFA 3BQAA 2BG1A 3LI9A 4IUKA 4R3AA 5IS1A 1WYCA 1CJFA 1D06A 2Z2MB 5FL3A 1PI5A 1T1AA 3T1XA 3CAXA 2WZZA 5FASA 3PXPA 1YLWA 1YMXA 3IS2B 2ZM2A 3MFDA 5KIZA 2VX8A 3WS2A 4KZ8A 4BD1A 1BLHA 5FQIA 2FH5A 2XA7S 2HJEA 3E4PA 4KZBA 4GN2A 2IWDA 4OP5A 5FATA 4R70A 1Y28A 3B33A 3LY4A 3PAGA 1WE4A 3K2NA 2WUQA 5G4YA 3WS4A 1GCEA 3LIAA 4R4SA 4WEJA 2PYPA 1DP9A 3AGFA 5F6AA 1IYQA 4DXBA 1OJ5A 1XJ2A 3HUOA 4DMZA 2ZQ8A 3FYZA 5J8XA 4OLGA 3R7WA 4OPYA 2Y2GA 4K91A 3R7WB 3WRTA 1OT9A 4FUWA 4CLCC 1RGZA 3UDXA 4BMWA 4X25A 3T1RA 5MC7A 5FEGA 1W63Q 2VV7A 2ZM8A 1G6OA 1WYBA 5TBMA 1Z09A 5TBMB 3E2LA 3HLDA 2K7SA 4JXWA 4O7DA 4OPQA 4IBRA 4NKPA 3IXDA 1K57A 5A93A 1HZOA 2OLUA 3MFXA 3FC7A 1EROA 1F9IA 3DAVA 1O07A 3WS5A 3GRJA 4E6XA 1S4SA 4MBKA 3NDEA 5EM1A 2H0YA 4GW9A 1LSWA 4X69A 3C8CA 3IX8A 4MDZA 4XUZA 2P08A 4EESA 4R0QA 2PHYA 2E8IA 3EOIA 1Q2QA 2HDUA 1F2KA 3F1NB 1VETA 4N1XA 4WYYA 3VP3A 1VETB 5EVIA 3BY9A 4IBXA 5IU1A 5EVIB 2PR6A 3NOTC 5M1AA 2XSSA 5L2FA 2PAVP 1BULA 4EUVA 3C7UA 2P9VA 3IBRA 2P9VB 1GHPA 3EEAA 4RYEA 4GS9A 4N9KA 4FH4A 3PTEA 4CJNA 4ETZA 4EQ1A 4WBGA 2QPNA 1XPBA 5GL9A 4XXRA 4EEPA 3NC8A 1ZG4A 3SS3A 3VMAA 5DF8A 5AVEA 1F98A 3LIBA 2B18A 2ZC4B 2OV5A 4P6ZM 4EETB 3CZDA 5FDSA 4PMAA 5KZHA 5J4EA 5FQMA 1CI9A 2WGWA 4OPZA 2V1ZA 4WUJA 2ZQAA 1KE3A 1AWIA 4R1GA 4OH0A 2Q9MA 2XEPA 4JGQA 5GHYA 1WA9A 1V9YA 2JN7A 2PRFA 2HP6A 3SW1A 3OBFA 4X1MA 5CTMA 4EU0A 3VOYA 4B93A 3UNWA 3Q7ZA 2A24A 4OLDA 2D01A 5CGSA 2C5WB 1VEUB 3K3DA 1P9WA 5EVID 3ZG8B 2VGLS 5FAOA 2R9XA 5E43A 2KLIA 3Q1FA 2Z6DA 1XXMA 4IJGA 1ES2A 4ME4A 3IH8A 5E2HA 5DKKA 3PR6A 1XA7A 4DRTA 2WK0A 2ZC5B 2O99A 1UWNX 4CLCA 3BFDA 1SKFA 1FQGA 2Y55A 4R3BA 2W3EA 5GLAA 3FPVA 5EM0A 4UQIM 1NZUA 2V0UA 2W3GA 3BEBA 4MLLA 2Y2IA 2BTFP 1OTDA 3PBSA 3M6BA 2H0TA 3R4KA 2EX9A 2Y4AA 1OTEA 1EW0A 4S2OA 1ERMA 3MXQA 1G6AA 1PRQA 3O86A 5CGXA 3UDIA 4XUXA 4PM6A 2X01A 2VV6A 1S1ZA 2INWA 2J8YA 5HAIA 4ESPA 5KSHA 2ZL1B 3PHYA 5GLBA 3MR0A 3N8LA 4DE3A 5J7EA 4HP4A 2PU4A 1SZVA 2PU2A 1F5MA 3BWLA 3O87A 2XFTA 4LENA 2VGJA 1XJ3A 5I94A 4LRYC 1H5XA 3EWKA 2JCHA 3IWIA 1MBLA 4HH3A 4BL3A 3O88A 5F69A 3G2YA 4IHQA 4EBPA 1S1YA 3S7OA 3ZHHA 1Z6FA 2B02A 2V8FA 1IYOA 4NXFA 1FCOA 3T12B 3T4SA 3LR4A 4DXCA 1CEGA 1NRJA 2B95A 2XH9A 3VOLA 3AGDA 2WADA 2B5RA 4PAUA 1SKOB 3T4OA 4CLCD 3NHQA 4NG2A 4KZAA 3CWFA 1PW1A 1K38A 3F1PA 3UE6A 3VE4A 1XJ6A 3UPPA 3IWQA 3M2JA 4K0WA 2Q0OA 3IF6C 4GD8A 3HBRA 3N6IA 4Y5FA 3BJNA 3Q82A 1K54C 1YM1A 4DF6A 2XD5A 1YSPA 1W79A 4KZ3A 1KE0A 3QP8A 1H8ZA 4QY6A 4Y7PA 3RH8B 1PZPA 2HDRA 1YLPA 4JF4A 2A49A 2MJ6A 5F68A 3T50A 3QHYA 5DTSA 1LL9A 1H3QA 5F83A 3CPTA 4OOYA 3UB9A 2ZQDA 4RX3A 4DE0A 1UGUA 2R9WA 5LBRA 1GA0A 4NXEA 3ZVWA 1NJ4A 1EWZA 3BQ8A 1ES3A 2YKFA 4JBFA 1ES5A 1ESUA 1N4OA 3VP0A 4E3OA 3NULA 3KYZA 3Q7VB 2KOIA 1FIKA 3KO6A 4Y0UA 3HLGA 4GCZA 3MF0A 3BY8A 5HW3A 3S22A 3RFBA 5CTNA 4WEKA 3PBQA 4HNBA 3CUEC 5CHJA 1S6RA 1GSXA 1ESIA 3WRZA 3K3CA 1L2SA 3MQ0A 5CEBA 5E2GA 3UB5P 4R3JA 1NXYA 3S4XA 2O9CA 5HPFA 4F3LA 5G4ZA 3OCNA 3RJUA 5TJJA 3BFCA 3A3JA 4HJ3A 3W2ZA 2W3FA 4OQIA 4MBHA 1BUEA 3H9WA 4B4ZA 3BFEA 5M19A 4L9GA 5TFQA 3B3XA 2UV0E 3FKVA 4PM9A 3NJAA 1CEFA 3B42A 2ZD8A 1MXOA 1KGEA 2FFFB 1FCMA 2XROA 5BOHA 3EGDC 3GSGA 5FAQA 1OTIA 1T1BA 3TJZC 4DKIA 3IHAA 2C6WB 4FOFA 2QHKA 4DJ3A 4ETXA 4IUHA 2W0NA 3QP6A 3CHWP 3G4PA 2ZMVA 1I2SA 4PM5A 5HSQA 4FD8A 3F1OA 3LIDA 1PWDA 3EGXC 2ZOIA 4QHCA 3JPUA 5DTTA 3IWOA 1OTBA 1TS0A 3NECA 2D02A 4S2IA 1PNEA 3GECA 3PBNA 1CK3A 3HJIA 3JYIA 4N1HA 4H6JA 4DDSA 4LCLA 3IF6A 3UMEA 3IF6B 4IEDA 2AVXA 5FI2A 1K54A 3ZG9B 4EEUA 3IHBA 2IWBA 2OWJA 2L1MA 4LV1A 3C2WA 1KGGA 1IEMA 1N9NA 1H8MA 2WKEA 4C6YA 1XKZA 4ID4A 5HZHA 5HDSA 3LICA 3TG9A 3IS2A 3UB7A 1K0KA 2YKHA 2R78A 1BT5A 2XLNA 1TD5A 3UDFA 3V39A 5AVFA 2ZLYA 2G2WA 5HL6A 2OAQ1 3KYEA 3DTIA 3I7JA 4PPRA 5HX9A 2VZWA 3TE8A 4KZ6A 1IYPA 3HL9A 4OOLA 3WWXA 1FOFA 4ARZA 5HAQA 3G2ZA 4ARZB 2ACGA 5DTKA 3KSHA 3CUEA 5HAPA 1G5UA 5HWVA 3IF5A 5CECA 2ZC6B 2ZQCA 4GJ4A 4BL2A 2J80A 3BFGA 2J7VA 1DP6A 1GSVA 4E3JA 1XA1A 2XGNA 1SDEA 1L0EA 4OOMA 1YPRA 4B9OA 2QKPA 1LSVA 2XK1A 2WGIA 2Y59A 3C4PA 4ZJ3A 3MS6A 4WLAA 1D7EA 5IT5A 3S7NA 3TRCA 4ZAMA 5FI6A 1G28A 2VGLM 1YT4A 2CC1A 5EV0A 3W4PA 3HVFA 3RXXA 2GDNA 4WL9A 1XGJA 1QMEA 4KZ4A 5HWWA 1O7EA 2OOLA 3CJMA 5KSCA 3E0YA 3G32A 4QY5A 5DFXA 4ZJ2A 2NUPC 4QPRA 5EOOA 5GLCA 3F1NA 2JHEA 3N7WA 4YINA 5A92A 3M2KA 3NOUC 4Y0OA 1I5QA 4MNRA 4KQQA 3ZG7B 4WZ4A 4OVDA 4LV0A 3PYPA 3ZVTA 1MWRA 5EE8A 3UE1A 5L09A 3DW0A 1CI8A 1S66L 3MXSA 4PM8A 1K4FA 1D1JA 4JGOA 1SCWA 4UA6A 4EXOA 4I5SA 3M6HA 4KZ9A 4YNRA 2ZC3B 2Y2MA 4O0PA 4JLFA 2VA0A 1ZKJA 1YLTA 3OC2A 3NDGA 5FQQA 4LFUA 2WAFA 3BLSA 1FCNA 4I3JA 4H8RA 1XJ4A 4R23A 1X0OA 3BECA 1DRMA 4L0LA 5A8BA 1OMEA 4M4XA 4EW7A 4KQOA 5F1FA 2WKRA 4KG2A 4HBUA 1NWZA 1IKIA 3W8KA 2GJ3A 2X02A 3ZCZA 5CX7A 3QP1A 1Y54A 1YQSA 4GDBA 2W3HA 4FH2A 4HHDA 4BQMA 3NBLA 1VEUA 5EVLA 2NUTC 2Y2OA 3A0VA 2JKTI 3UMDA 1CQAA 3L7HA 4YOFA 3MZEA 3G6OA 4A5RA 1FR6A 2H10A 4Y17A 1K55C 4X56A 3LR3A 2UWXA 3SS5A 3A0SA 4HIAA 3SOIA 2XR0A 1SDNA 3LR5A 4X6TA 3D9YA 4M3KA 4NEED 2V2FF 5FAPA 3OLOA 3OPHA 4PHTA 5FA7A 3LYXA 1K6RA 5KMWA 5F82A 3ZNTA 4O8GA 1GHMA 4CPKA 1GSWA 4FTXA 3CLOA 4X55A 4S2MA 5E2FA 1MKMA 2JKRI 1ZG6A 4S2KA 2PD8A 1PWGA 2BASA 4OPRA 4S2NC 4XT2B 3OOVA 1PWCA 2G2UA 5D3OA 1GHIA 1S67L 3ZGAB 4S2JA 4EBLA 2ZL1A 2HP9A 3T4LA 2H28A 1OTAA 1FR1A 5L07A 3MQQA 1LT0A 2WKPA 2ZM0A 2V9AA 1JVJA 2W1RA 1KGFA 3RXWA 5A90A 3DTMA 4P6BA 4EV4A 4JPMA 3KSFA 3UN7A 4P87A 4JXSA 3DWKA
chains in the Genus database with same CATH topology
3OCNA 3MJQA 5TJJA 4HJ3A 2GZAA 3W2ZA 2W3FA 4R70A 1Y28A 3B33A 3H7WB 1TS6A 1BYWA 2EWVA 3H9WA 2EA9A 3K2NA 5G4YA 4L9GA 3LIAA 1STZA 4HJ6A 4WEJA 2PYPA 1DP9A 3NJAA 3B42A 5F6AA 4O01A 1OJ5A 2XROA 1XJ2A 3MQOA 4KQDA 1P0ZA 4DMZA 1NLYA 3EGDC 3OCLA 1OTIA 1T1BA 3R7WA 1OJGA 3TJZC 2PT7A 1JNUA 4BBVA 3R7WB 2P04A 3UB8A 4FOFA 1IOUA 1OT9A 2QHKA 4CLCC 4DJ3A 4BMWA 2FZ0A 4NXBA 4Y3IA 2O0YA 4ETXA 4IUHA 3ULFA 2PYRA 2W0NA 2JKRM 4G3KA 5MC7A 1W63Q 2VV7A 1N9LA 2J3TD 1G6OA 2HF6A 2ZMVA 3HJKA 5TBMA 2A24B 4PKYA 3F1OA 5HSQA 3LIDA 4HJ4A 4YWZA 5TBMB 1NLZA 1XFQA 2PD7A 2ZOIA 3EGXC 4CLCE 2K7SA 1IFQA 3O5YA 2W1TB 1OTBA 1TS0A 3GDIA 4NKPA 2O9AA 2D02A 3MFXA 3FC7A 4WF0A 5DKLA 3GECA 3PBNA 1F9IA 3HJIA 3JVVA 1YKDA 1VHMA 4H6JA 1DP8A 3UMEA 2KDKA 1S4SA 4PKYG 2M7UA 1TS8A 2A2LA 4GW9A 1LSWA 3C8CA 4EEUA 4MDZA 2M1CA 4CLCB 2P08A 4GLQA 4EESA 2OWJA 4XT2A 2PHYA 2L1MA 3D72A 4HI4A 3PBOA 3EOIA 1TF1A 1VB6A 3F1NB 3C2WA 2PR5A 1N9NA 1H8MA 4II7A 1LSXA 3BY9A 5HZHA 5IU1A 2PR6A 3NOTC 1KOUA 4HP9A 5EFWA 5HDSA 4I39A 2XSSA 3LICA 4EUVA 3IS2A 3UB7A 4G3WA 5L8MA 2YKHA 2R78A 2OAP1 3IBRA 4MN5A 1TD5A 4MCWA 3EEAA 3NOPC 4NXGA 4GS9A 5F5YA 4Q0JA 4CQHA 5AVFA 2Z6CA 5DJUA 5HL6A 2OAQ1 4ETZA 4EQ1A 2L0WA 3H7WA 1TS7A 2VZWA 4I3IA 1LL8A 3TE8A 3ZYTA 4EEPA 4I38A 5AVEA 4UEYA 5J3WA 3E4OA 4OOLA 1F98A 3LIBA 1ZHHB 3T4KA 2B18A 4P6ZS 4ARZA 3VV4A 3S7PA 2L4RA 3EEHA 2GX5A 4P6ZM 4ARZB 4EETB 1XFNA 3KSHA 3CUEA 4JGPA 2DMWA 2XRNA 5HWVA 5J4EA 3T4QA 4GJ4A 4WUJA 2J80A 5C5KA 2HGVA 2KX6A 4JGQA 1WA9A 3BW6A 5AJGA 1DP6A 1V9YA 2VV8A 2JN7A 3VE3A 3SW1A 3OBFA 1GSVA 4MMNA 4EU0A 5HD3A 3F1PB 2LB5A 4OOMA 4B93A 2LB9A 4B9OA 2P7JA 2QKPA 2A24A 3MMHA 4HOIA 1LSVA 2D01A 4EERA 3H82A 3UB6A 3KSIA 3K3DA 2W1TA 1P9WA 4WLAA 3H82B 2VGLS 1D7EA 5IT5A 3S7NA 3TRCA 1G28A 2KLIA 2VGLM 2QJ5A 4LRZE 2W27A 2QWSA 2Z6DA 3D3OA 4IJGA 2K31A 3P01A 4ME4A 4WL9A 4E04A 4DN0A 3HCYA 5HWWA 5DKKA 3PR6A 2OOLA 4DJ2A 4FSFA 3B47A 2O99A 1UWNX 5HPIA 4CLCA 2I9VA 3E0YA 5DFXA 3LI8A 3S7QA 2NUPC 4QPRA 4Z1WA 4K08A 4UQIS 2W3EA 4WN5A 3FPVA 2O9BA 2ZOHA 3F1NA 4UQIM 2JHEA 2V0UA 2W3GA 4R38A 1P9RA 3NOUC 1OTDA 3PBSA 5DF9A 3E98A 4WELA 3T4JA 5I5LA 3R4KA 2OWHA 2V1AA 1OTEA 1EW0A 3MXQA 5DFYA 3PYPA 4BBTA 4KUOA 1T18A 1S66L 2VV6A 1S1ZA 2ZBBA 2INWA 5KSHA 4JGOA 3LR0A 3PHYA 1ZTUA 4KUKA 4EXOA 3MR0A 1YSQA 5HWTA 4I5SA 4LLOB 2CMNA 5J7EA 5HDCA 4G3VA 4YNRA 4HP4A 4O0PA 2V0WA 2VA0A 1F5MA 3BWLA 3OC2A 1XJ3A 4LRYC 4MN6A 3EWKA 4I3JA 3KYQA 1MC0A 4HH3A 1N9OA 1XJ4A 1S4RA 2VJWA 3PBTA 1W63M 1X0OA 2K2NA 5F69A 1DRMA 1OT6A 3P7NA 4L0LA 4L9FA 5A8BA 4IHQA 3FG8A 2QJ7A 1S1YA 3LIEA 3S7OA 4HQAA 4M4XA 4F3LB 2B02A 2Y79A 3IBJA 4EW7A 4KQOA 4NXFA 2XA7M 2WKRA 4HY8A 3T4SA 3LR4A 4JGRA 5K5BA 3EQUA 4LPZA 1NWZA 1NRJA 1V9ZA 1YAXA 3LUQA 3VOLA 4L9EA 4Q0HA 3LFVA 2GJ3A 2V1BA 4BBUA 4PAUA 4BJPA 3CITA 3T4OA 4CLCD 3NHQA 2J3WA 3CWFA 2VKSA 3F1PA 4Y2FA 5CX7A 3UE6A 3VE4A 1XJ6A 5HD5A 2W3HA 4HHDA 4RQ9A 4AFIA 4BWIA 2W3DA 4Y5FA 2NUTC 3BJNA 4LRXC 3A0VA 2JKTI 2QYBA 2G7UA 3UMDA 1UWPX 4R6LA 2IA2A 2ZMFA 3E4QA 4YOFA 1YSPA 3G6OA 3TW8A 2VEAA 3KSGA 3T4TA 3RH8B 3KX0X 2J3TC 2Y8HA 1P97A 3LR3A 3DBAA 3A0SA 4HIAA 2VLGA 3RTYA 3F1OB 1ODVA 2MJ6A 5F68A 2EWWA 3T50A 1MZUA 1T19A 1H3QA 3PBRA 3LR5A 4GHIA 3UB9A 3UE3A 4NEED 4MN7A 3OLOA 3C38A 1UGUA 4GHIB 4PHTA 3JVUA 5LBRA 3FPWA 3LYXA 4NXEA 5DJTA 4H6JB 1T1CA 4O8GA 1OPXA 3LIFA 2M7VA 3ZQ5A 3BQ8A 3V67A 2YKFA 1GSWA 3ICYA 3CLOA 3U2AA 1MKMA 3CI6A 2JKRI 3KYZA 2PD8A 2KOIA 4ZRRA 3EQVA 3KO6A 2BASA 3BQAA 4XT2B 2HJ9C 3OOVA 3LI9A 4IUKA 1S67L 4R3AA 5IS1A 4GCZA 3MF0A 3BY8A 3T4LA 1D06A 2H28A 1OTAA 2WKQA 4Q0IA 3RFBA 5FL3A 4HH2A 4WEKA 3PBQA 3MQQA 4HNBA 1T1AA 3CUEC 1LT0A 3CAXA 2PDRA 2WKPA 2V9AA 1GSXA 2W1RA 3A0RA 3PXPA 2GNXA 3IS2B 3K3CA 3MQ0A 5KIZA 4I3AA 2VX8A 3KSFA 5HDDA 4GS9B 2JKTM 2O9CA 4F3LA 5HPFA 2HV1A 3C30A 2FH5A 2XA7S 2HJEA 3E4PA 5G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJQ A;  4HJ3 A;  4R70 A;  1Y28 A;  3B33 A;  3H7W B;  1TS6 A;  1BYW A;  3H9W A;  2EA9 A;  5G4Y A;  4L9G A;  3LIA A;  4HJ6 A;  2PYP A;  1DP9 A;  3NJA A;  5F6A A;  1OJ5 A;  1XJ2 A;  3MQO A;  4KQD A;  1P0Z A;  1OTI A;  1T1B A;  1OJG A;  1JNU A;  4BBV A;  3UB8 A;  1OT9 A;  2QHK A;  4DJ3 A;  4NXB A;  3ULF A;  2PYR A;  2W0N A;  2VV7 A;  1N9L A;  3HJK A;  5TBM A;  2A24 B;  4PKY A;  3F1O A;  5HSQ A;  3LID A;  4HJ4 A;  4YWZ A;  5TBM B;  1XFQ A;  2PD7 A;  2ZOI A;  2K7S A;  1OTB A;  1TS0 A;  3GDI A;  2D02 A;  3MFX A;  3FC7 A;  4WF0 A;  5DKL A;  3GEC A;  1F9I A;  3HJI A;  4H6J A;  1DP8 A;  3UME A;  2KDK A;  1S4S A;  4PKY G;  1TS8 A;  4GW9 A;  1LSW A;  3C8C A;  4EEU A;  2M1C A;  4EES A;  2OWJ A;  4XT2 A;  2PHY A;  2L1M A;  3D72 A;  4HI4 A;  1VB6 A;  3F1N B;  3C2W A;  2PR5 A;  1N9N A;  1LSX A;  3BY9 A;  5HZH A;  5IU1 A;  2PR6 A;  3NOT C;  1KOU A;  4HP9 A;  5EFW A;  5HDS A;  4I39 A;  3LIC A;  3IS2 A;  3UB7 A;  2YKH A;  2R78 A;  4MN5 A;  3IBR A;  3NOP C;  4NXG A;  4GS9 A;  5F5Y A;  5AVF A;  2Z6C A;  5DJU A;  4EQ1 A;  2L0W A;  3H7W A;  1TS7 A;  4I3I A;  1LL8 A;  4EEP A;  4I38 A;  5AVE A;  5J3W A;  3E4O A;  1F98 A;  3LIB A;  2L4R A;  3EEH A;  4EET B;  1XFN A;  4JGP A;  5HWV A;  5J4E A;  4WUJ A;  2J80 A;  2KX6 A;  4JGQ A;  1WA9 A;  1DP6 A;  1V9Y A;  2JN7 A;  3VE3 A;  2VV8 A;  3SW1 A;  1GSV A;  5HD3 A;  3F1P B;  4B9O A;  2P7J A;  2QKP A;  2A24 A;  4HOI A;  1LSV A;  2D01 A;  4EER A;  3H82 A;  3UB6 A;  3K3D A;  4WLA A;  3H82 B;  1D7E A;  1G28 A;  2QJ5 A;  4LRZ E;  2W27 A;  2QWS A;  2Z6D A;  4WL9 A;  4E04 A;  5HWW A;  5DKK A;  2OOL A;  4DJ2 A;  1UWN X;  2I9V A;  3LI8 A;  4K08 A;  4WN5 A;  2ZOH A;  3F1N A;  2JHE A;  2V0U A;  4R38 A;  3NOU C;  1OTD A;  5I5L A;  2OWH A;  2V1A A;  1OTE A;  1EW0 A;  3MXQ A;  3PYP A;  4BBT A;  4KUO A;  1T18 A;  1S66 L;  2VV6 A;  1S1Z A;  2ZBB A;  2INW A;  4JGO A;  3PHY A;  4KUK A;  4EXO A;  3MR0 A;  5HWT A;  4I5S A;  4LLO B;  2CMN A;  5J7E A;  5HDC A;  4HP4 A;  2V0W A;  3BWL A;  1XJ3 A;  4LRY C;  4MN6 A;  3EWK A;  4I3J A;  4HH3 A;  1N9O A;  1XJ4 A;  1S4R A;  1X0O A;  5F69 A;  1DRM A;  1OT6 A;  3P7N A;  4L9F A;  5A8B A;  3FG8 A;  2QJ7 A;  1S1Y A;  3LIE A;  4HQA A;  4M4X A;  4F3L B;  2B02 A;  4EW7 A;  4NXF A;  2WKR A;  4HY8 A;  4JGR A;  4LPZ A;  1NWZ A;  1V9Z A;  3LUQ A;  3VOL A;  4L9E A;  2GJ3 A;  2V1B A;  4BBU A;  3NHQ A;  3CWF A;  3F1P A;  3UE6 A;  3VE4 A;  1XJ6 A;  5HD5 A;  4HHD A;  4RQ9 A;  4LRX C;  3A0V A;  3UMD A;  1UWP X;  4R6L A;  3E4Q A;  3G6O A;  2VEA A;  3RH8 B;  3KX0 X;  1P97 A;  3A0S A;  4HIA A;  2VLG A;  3RTY A;  3F1O B;  1ODV A;  5F68 A;  3T50 A;  1MZU A;  1T19 A;  4GHI A;  3UB9 A;  3OLO A;  1UGU A;  4GHI B;  3LYX A;  4NXE A;  5DJT A;  4H6J B;  1T1C A;  3LIF A;  3ZQ5 A;  2YKF A;  1GSW A;  3ICY A;  3CLO A;  2PD8 A;  2BAS A;  4XT2 B;  3LI9 A;  1S67 L;  4R3A A;  5IS1 A;  4GCZ A;  3BY8 A;  1D06 A;  2H28 A;  1OTA A;  2WKQ A;  4HH2 A;  3MQQ A;  4HNB A;  1T1A A;  1LT0 A;  3CAX A;  2PDR A;  2WKP A;  2V9A A;  1GSX A;  3A0R A;  3IS2 B;  3K3C A;  5KIZ A;  4I3A A;  5HDD A;  4GS9 B;  4F3L A;  2HV1 A;  3E4P A;  5G4Z A; 
#chains in the Genus database with same CATH topology
 3BM6 A;  1JWZ A;  3MJQ A;  4BD0 A;  5FEF A;  3H7W B;  1TS6 A;  1BYW A;  4JXV A;  1SKO A;  2EA9 A;  5FQK A;  3SH9 A;  2PBD P;  4HJ6 A;  5JYO A;  2A3U A;  2VK3 A;  4OQ0 A;  2VGK A;  4O01 A;  1LI9 A;  1NLY A;  1VQQ A;  1OJG A;  1JNU A;  2Q9N A;  2P04 A;  3UB8 A;  4K0X A;  1EI5 A;  2FZ0 A;  3GVB A;  4NXB A;  2O0Y A;  2Y2J A;  3TSG A;  4G3K A;  5IHV A;  1N9L A;  2J3T D;  3UPN A;  1HLU P;  3A3D A;  2HDS A;  4PKY A;  4YWZ A;  1KE4 A;  2JC7 A;  5HAR A;  3N8R A;  2PD7 A;  4CLC E;  2QZ6 A;  2W1T B;  3OPP A;  5M18 A;  3GDI A;  4GB7 A;  2O9A A;  2EX6 A;  3IXB A;  3SZT A;  1BTL A;  1DP8 A;  4HBT A;  3NIA A;  5U47 A;  2E8J A;  2V8C A;  1TS8 A;  4LV2 A;  4E3K A;  4UHU A;  1DY6 A;  3BYD A;  3FWL A;  5CRF A;  4GKU A;  3Q7V A;  2Y2N A;  5EVE A;  3Q07 A;  3LCE A;  4GLQ A;  2EFU A;  3AGE A;  4WZ5 C;  2HZ5 A;  1K55 A;  1E3U A;  4JKT A;  5CXW A;  3LO7 A;  4QJG A;  1NYY A;  5FSR A;  1K6S A;  4ZTK A;  1L0F A;  4II7 A;  4P0M A;  1MWU A;  4P85 A;  3VSK A;  4I39 A;  4LCM A;  1TEM A;  5L8M A;  4E3M A;  4MN5 A;  2OAP 1;  1XP4 A;  5EOE A;  4C75 A;  4NXG A;  5F5Y A;  4Q0J A;  5CGW A;  4OQG A;  1YMS A;  5L10 A;  4X68 A;  2RL3 A;  1JWV A;  2L0W A;  4I3I A;  4S2N A;  3IXG A;  2WKH A;  3ZYT A;  4I38 A;  3E4O A;  3CMZ A;  4GNU A;  4E3N A;  2L4R A;  2X71 A;  3EEH A;  3GQZ A;  1DJC A;  2Y91 A;  2DMW A;  1NYM A;  3UO9 A;  2XFS A;  3T4Q A;  5GHX A;  5C5K A;  4JF5 A;  4OQH A;  3O3V A;  2KX6 A;  3UE0 A;  3G30 A;  2VV8 A;  3MXR A;  1ERQ A;  2WGV A;  5HD3 A;  4YFM A;  2LB9 A;  1PZO A;  2P7J A;  1E3U D;  1ONG A;  3H82 A;  5G18 A;  3H82 B;  4KEN B;  2QJ5 A;  3G34 A;  2W27 A;  4LRZ E;  1K56 D;  2QWS A;  3ITA A;  2HPB A;  3D3O A;  4JF6 A;  4QD4 A;  1DJB A;  3P01 A;  4DN0 A;  4U0X A;  3GMW A;  4DJ2 A;  4ZBE A;  3B47 A;  4U0T A;  5DVA A;  3E2K A;  5HPI A;  5FI7 A;  1RP5 A;  4MEZ A;  3LI8 A;  1IEL A;  1M40 A;  2ZQ9 A;  4Z1W A;  2O9B A;  2ZOH A;  4R38 A;  5AQB A;  4GOG A;  1TVF A;  3E98 A;  4S2P A;  3T4J A;  5I5L A;  2V1A A;  3FV7 A;  1MY8 A;  3P09 A;  5DFY A;  4ZJ1 A;  1W7F A;  1YLY A;  1IYS A;  3P98 A;  4KUO A;  1T18 A;  2J9P A;  1Q2P A;  2WAE A;  2ZBB A;  3L9K A;  4HES A;  3NY4 A;  1YLJ A;  5HWT A;  4LLO B;  1JTG A;  5HDC A;  4G3V A;  3W4O A;  1W8Y A;  1E25 A;  3OZH A;  4WZ5 A;  1PW8 A;  4Y15 A;  5AQ7 A;  2Y2Q A;  3DWZ A;  4X53 A;  1MPL A;  3KYQ A;  3HLC A;  1MC0 A;  1S4R A;  3ZNY A;  2K2N A;  4OON A;  3P7N A;  3T1S A;  1A0K A;  2QJ7 A;  3LIE A;  4F94 A;  2Y79 A;  3IBJ A;  2Y2P A;  3SH8 A;  4KQR A;  4JGR A;  1NRF A;  4NET A;  4Q0H A;  2JE5 A;  4BJP A;  3CIT A;  1KDW A;  4RX2 A;  2J3W A;  4Y2F A;  1KVL A;  3NI9 A;  4IVI A;  1PI4 A;  4AFI A;  2W3D A;  1LLB A;  3IXH A;  2QYB A;  2G7U A;  2IA2 A;  3E4Q A;  3TW8 A;  3HLE A;  2OSU A;  4GZB A;  3QP5 A;  3KSG A;  3T4T A;  5F1G A;  4N92 A;  3MBZ A;  1I2W A;  2J3T C;  2Y8H A;  1P97 A;  3DBA A;  1ACF A;  2J9O A;  2HDQ A;  1HVB A;  4MBF A;  5HFO A;  2EWW A;  4BLM A;  3PBR A;  1HTZ A;  1T19 A;  3C38 A;  3LGO A;  1JTD A;  3IT9 A;  2OLV A;  5DJT A;  3OPL A;  4UAA A;  3ZQ5 A;  3ICY A;  3QNB A;  3IX4 A;  3A3I A;  4KG6 A;  3HUN A;  3IH9 A;  2IWC A;  4Z9Q A;  5E2E A;  1DJA A;  4ZRR A;  1JWP A;  1MWT A;  3N4I A;  3VFF A;  3EQV A;  2HJ9 C;  3C4O A;  2ZQ7 A;  4EQI A;  2DCF A;  2Y2L A;  2WKQ A;  4Q0I A;  4HH2 A;  3W4Q A;  1BSG A;  2PDR A;  5HL1 A;  3A0R A;  2GNX A;  3D4F A;  2WYX A;  4I3A A;  3G31 A;  5HDD A;  1SHV A;  4GS9 B;  2JKT M;  3MZF A;  3MZD A;  2HV1 A;  1L3L A;  3C30 A;  3OPR A;  2JBF A;  4EWF A;  5EEC A;  1HD8 A;  2EFX A;  3CG5 A;  2GZA A;  2EWV A;  4NK3 A;  4RA7 A;  1G68 A;  4OKP A;  1STZ A;  3GR2 A;  3V50 A;  4KZ7 A;  5GLD A;  3MQO A;  4KQD A;  1P0Z A;  4DDY A;  4E3L A;  1J3W A;  5JYP A;  3OCL A;  3S1Y A;  2PT7 A;  2WGW B;  4BBV A;  1H8Y A;  5TR7 A;  1IOU A;  3FKW A;  2P74 A;  1FSY A;  5FQ9 A;  4Y3I A;  1NZO A;  3ULF A;  2PYR A;  2JKR M;  1BZA A;  1BLS A;  2HF6 A;  2ZJ9 A;  3HJK A;  3IX3 A;  3BLM A;  4S2L A;  2A24 B;  3VP4 A;  4HJ4 A;  5AQA A;  1NLZ A;  1XFQ A;  1IFQ A;  3O5Y A;  4QB8 A;  4E6W A;  1E4D A;  3MKE A;  3UY6 A;  4WF0 A;  5DKL A;  1RCJ A;  2BLS A;  1YKD A;  3JVV A;  1VHM A;  3IQA A;  3A3E A;  2KDK A;  4PKY G;  5DF7 A;  2M7U A;  2DRW A;  1BLP A;  2A2L A;  1K4E A;  2QMI A;  2RCX A;  3T1Q B;  2M1C A;  1N9B A;  4CLC B;  3QNC A;  3VOZ A;  4XT2 A;  4UA7 A;  3D72 A;  4HI4 A;  3PBO A;  1TF1 A;  1VB6 A;  3VSL A;  3C5A A;  1W8Q A;  2PR5 A;  3GV9 A;  3HLB A;  3HLF A;  4DE1 A;  1LSX A;  2HP5 A;  4QU3 A;  1KOU A;  4HP9 A;  5EFW A;  1W5D A;  1LI0 A;  1KVM A;  4BEN A;  4G3W A;  4OP8 A;  3SS4 A;  3LY3 A;  5CED A;  2WZX A;  3PAE A;  4MCW A;  3NOP C;  1ZC2 A;  4CQH A;  2Z6C A;  5DJU A;  3BFF A;  5FQJ A;  1VM1 A;  3H7W A;  1TS7 A;  3HLW A;  4JXG A;  1LL8 A;  3WS0 A;  3FZC A;  1NY0 A;  1L0G A;  4UEY A;  5J3W A;  3ZG5 A;  1K25 A;  1ZHH B;  3T4K A;  4P6Z S;  3VV4 A;  3S7P A;  2GX5 A;  3U4L P;  1XFN A;  3ZG0 A;  4JGP A;  2XRN A;  2Y2K A;  3A3F A;  2XDM A;  1FIL A;  2HGV A;  1MWS A;  2EX2 A;  2XF3 A;  1S0W A;  3BW6 A;  5AJG A;  3VE3 A;  1TDL A;  2EXB A;  5FDH A;  4MMN A;  4KZ5 A;  1PFL A;  3DTE A;  5CHU A;  3F1P B;  2LB5 A;  4EBN A;  1Y4O A;  3MMH A;  4HOI A;  4EER A;  3UB6 A;  3KSI A;  2DNS A;  2W1T A;  4E3I A;  3C7V A;  4D2O A;  1PYY A;  1MKI A;  2V20 A;  3LEZ A;  5EPH A;  2K31 A;  4D60 A;  4E04 A;  2EXA A;  3NCK A;  3HCY A;  1CF0 A;  1YLZ A;  4FSF A;  2I9V A;  3CPT B;  4GDN A;  3S7Q A;  4GD6 A;  4HEF A;  4K08 A;  4UQI S;  4DE2 A;  4WN5 A;  1P9R A;  3QP2 A;  5DF9 A;  4WEL A;  4WMC A;  2OWH A;  4LGW A;  4WM9 A;  1K56 A;  5TGF A;  4BBT A;  4UA9 A;  2FFY A;  4X1L A;  4U3T A;  1M6K A;  3ZDJ A;  3GTC A;  3V3R A;  1J9M A;  3LR0 A;  1ZTU A;  4KUK A;  5CER A;  4Q8I A;  4ZDX A;  1YSQ A;  2PBY A;  3HUM A;  1H0M A;  2CMN A;  5GHZ A;  2V0W A;  2ZMA A;  3Q81 A;  3SH7 A;  3ISG A;  5EUA A;  4MN6 A;  1XX2 A;  5A91 A;  1N9O A;  2VJW A;  3UPO A;  3PBT A;  1W63 M;  1OT6 A;  4L9F A;  3BRM A;  3V5M A;  3FG8 A;  3TOI A;  4HQA A;  3ZFZ A;  4F3L B;  1ALQ A;  3VP2 A;  2XA7 M;  4HY8 A;  4LV3 A;  2H5S A;  2XQZ A;  5K5B A;  3EQU A;  4LPZ A;  1V9Z A;  1YAX A;  3LUQ A;  4QWO A;  4L9E A;  3LFV A;  2V1B A;  4BBU A;  3ITB A;  1K57 C;  1LHY A;  2I72 A;  2VKS A;  4Y13 A;  1XGI A;  5HD5 A;  4B88 A;  1IKG A;  4RQ9 A;  2WKI A;  1PIO A;  3V3S A;  2ZC7 A;  4BWI A;  4N9L A;  1ONH A;  3WS1 A;  4LRX C;  2JKG A;  4IVK A;  1UWP X;  4R6L A;  4WMC D;  2ZMF A;  2EX8 A;  4PM7 A;  1U60 A;  3DTK A;  3QP4 A;  2VEA A;  1GA9 A;  3KX0 X;  1LL5 A;  1BLC A;  4KG5 A;  1AXB A;  3MKF A;  1ES4 A;  3G35 A;  4C3Q A;  2VLG A;  3RTY A;  3F1O B;  1ODV A;  4RVA A;  1MZU A;  5EVI C;  3VP1 A;  1L0D A;  4GHI A;  1QMF A;  3UE3 A;  4MN7 A;  4GHI B;  4R4R A;  3JVU A;  3FPW A;  3LEQ A;  1TDG A;  3N8S A;  4FCF A;  2XD1 A;  2Z2L B;  2Y2H A;  1C3B A;  4H6J B;  1T1C A;  3MSH A;  5AQ9 A;  1OPX A;  3LIF A;  2M7V A;  4EUZ A;  1FSW A;  3V67 A;  4B4X A;  4Y0T A;  1RGY A;  3U2A A;  3VFH A;  3CI6 A;  5CHM A;  1KDS A;  3HRE A;  2JKF A;  3BQA A;  2BG1 A;  3LI9 A;  4IUK A;  4R3A A;  5IS1 A;  1WYC A;  1CJF A;  1D06 A;  2Z2M B;  5FL3 A;  1PI5 A;  1T1A A;  3T1X A;  3CAX A;  2WZZ A;  5FAS A;  3PXP A;  1YLW A;  1YMX A;  3IS2 B;  2ZM2 A;  3MFD A;  5KIZ A;  2VX8 A;  3WS2 A;  4KZ8 A;  4BD1 A;  1BLH A;  5FQI A;  2FH5 A;  2XA7 S;  2HJE A;  3E4P A;  4KZB A;  4GN2 A;  2IWD A;  4OP5 A;  5FAT A;  4R70 A;  1Y28 A;  3B33 A;  3LY4 A;  3PAG A;  1WE4 A;  3K2N A;  2WUQ A;  5G4Y A;  3WS4 A;  1GCE A;  3LIA A;  4R4S A;  4WEJ A;  2PYP A;  1DP9 A;  3AGF A;  5F6A A;  1IYQ A;  4DXB A;  1OJ5 A;  1XJ2 A;  3HUO A;  4DMZ A;  2ZQ8 A;  3FYZ A;  5J8X A;  4OLG A;  3R7W A;  4OPY A;  2Y2G A;  4K91 A;  3R7W B;  3WRT A;  1OT9 A;  4FUW A;  4CLC C;  1RGZ A;  3UDX A;  4BMW A;  4X25 A;  3T1R A;  5MC7 A;  5FEG A;  1W63 Q;  2VV7 A;  2ZM8 A;  1G6O A;  1WYB A;  5TBM A;  1Z09 A;  5TBM B;  3E2L A;  3HLD A;  2K7S A;  4JXW A;  4O7D A;  4OPQ A;  4IBR A;  4NKP A;  3IXD A;  1K57 A;  5A93 A;  1HZO A;  2OLU A;  3MFX A;  3FC7 A;  1ERO A;  1F9I A;  3DAV A;  1O07 A;  3WS5 A;  3GRJ A;  4E6X A;  1S4S A;  4MBK A;  3NDE A;  5EM1 A;  2H0Y A;  4GW9 A;  1LSW A;  4X69 A;  3C8C A;  3IX8 A;  4MDZ A;  4XUZ A;  2P08 A;  4EES A;  4R0Q A;  2PHY A;  2E8I A;  3EOI A;  1Q2Q A;  2HDU A;  1F2K A;  3F1N B;  1VET A;  4N1X A;  4WYY A;  3VP3 A;  1VET B;  5EVI A;  3BY9 A;  4IBX A;  5IU1 A;  5EVI B;  2PR6 A;  3NOT C;  5M1A A;  2XSS A;  5L2F A;  2PAV P;  1BUL A;  4EUV A;  3C7U A;  2P9V A;  3IBR A;  2P9V B;  1GHP A;  3EEA A;  4RYE A;  4GS9 A;  4N9K A;  4FH4 A;  3PTE A;  4CJN A;  4ETZ A;  4EQ1 A;  4WBG A;  2QPN A;  1XPB A;  5GL9 A;  4XXR A;  4EEP A;  3NC8 A;  1ZG4 A;  3SS3 A;  3VMA A;  5DF8 A;  5AVE A;  1F98 A;  3LIB A;  2B18 A;  2ZC4 B;  2OV5 A;  4P6Z M;  4EET B;  3CZD A;  5FDS A;  4PMA A;  5KZH A;  5J4E A;  5FQM A;  1CI9 A;  2WGW A;  4OPZ A;  2V1Z A;  4WUJ A;  2ZQA A;  1KE3 A;  1AWI A;  4R1G A;  4OH0 A;  2Q9M A;  2XEP A;  4JGQ A;  5GHY A;  1WA9 A;  1V9Y A;  2JN7 A;  2PRF A;  2HP6 A;  3SW1 A;  3OBF A;  4X1M A;  5CTM A;  4EU0 A;  3VOY A;  4B93 A;  3UNW A;  3Q7Z A;  2A24 A;  4OLD A;  2D01 A;  5CGS A;  2C5W B;  1VEU B;  3K3D A;  1P9W A;  5EVI D;  3ZG8 B;  2VGL S;  5FAO A;  2R9X A;  5E43 A;  2KLI A;  3Q1F A;  2Z6D A;  1XXM A;  4IJG A;  1ES2 A;  4ME4 A;  3IH8 A;  5E2H A;  5DKK A;  3PR6 A;  1XA7 A;  4DRT A;  2WK0 A;  2ZC5 B;  2O99 A;  1UWN X;  4CLC A;  3BFD A;  1SKF A;  1FQG A;  2Y55 A;  4R3B A;  2W3E A;  5GLA A;  3FPV A;  5EM0 A;  4UQI M;  1NZU A;  2V0U A;  2W3G A;  3BEB A;  4MLL A;  2Y2I A;  2BTF P;  1OTD A;  3PBS A;  3M6B A;  2H0T A;  3R4K A;  2EX9 A;  2Y4A A;  1OTE A;  1EW0 A;  4S2O A;  1ERM A;  3MXQ A;  1G6A A;  1PRQ A;  3O86 A;  5CGX A;  3UDI A;  4XUX A;  4PM6 A;  2X01 A;  2VV6 A;  1S1Z A;  2INW A;  2J8Y A;  5HAI A;  4ESP A;  5KSH A;  2ZL1 B;  3PHY A;  5GLB A;  3MR0 A;  3N8L A;  4DE3 A;  5J7E A;  4HP4 A;  2PU4 A;  1SZV A;  2PU2 A;  1F5M A;  3BWL A;  3O87 A;  2XFT A;  4LEN A;  2VGJ A;  1XJ3 A;  5I94 A;  4LRY C;  1H5X A;  3EWK A;  2JCH A;  3IWI A;  1MBL A;  4HH3 A;  4BL3 A;  3O88 A;  5F69 A;  3G2Y A;  4IHQ A;  4EBP A;  1S1Y A;  3S7O A;  3ZHH A;  1Z6F A;  2B02 A;  2V8F A;  1IYO A;  4NXF A;  1FCO A;  3T12 B;  3T4S A;  3LR4 A;  4DXC A;  1CEG A;  1NRJ A;  2B95 A;  2XH9 A;  3VOL A;  3AGD A;  2WAD A;  2B5R A;  4PAU A;  1SKO B;  3T4O A;  4CLC D;  3NHQ A;  4NG2 A;  4KZA A;  3CWF A;  1PW1 A;  1K38 A;  3F1P A;  3UE6 A;  3VE4 A;  1XJ6 A;  3UPP A;  3IWQ A;  3M2J A;  4K0W A;  2Q0O A;  3IF6 C;  4GD8 A;  3HBR A;  3N6I A;  4Y5F A;  3BJN A;  3Q82 A;  1K54 C;  1YM1 A;  4DF6 A;  2XD5 A;  1YSP A;  1W79 A;  4KZ3 A;  1KE0 A;  3QP8 A;  1H8Z A;  4QY6 A;  4Y7P A;  3RH8 B;  1PZP A;  2HDR A;  1YLP A;  4JF4 A;  2A49 A;  2MJ6 A;  5F68 A;  3T50 A;  3QHY A;  5DTS A;  1LL9 A;  1H3Q A;  5F83 A;  3CPT A;  4OOY A;  3UB9 A;  2ZQD A;  4RX3 A;  4DE0 A;  1UGU A;  2R9W A;  5LBR A;  1GA0 A;  4NXE A;  3ZVW A;  1NJ4 A;  1EWZ A;  3BQ8 A;  1ES3 A;  2YKF A;  4JBF A;  1ES5 A;  1ESU A;  1N4O A;  3VP0 A;  4E3O A;  3NUL A;  3KYZ A;  3Q7V B;  2KOI A;  1FIK A;  3KO6 A;  4Y0U A;  3HLG A;  4GCZ A;  3MF0 A;  3BY8 A;  5HW3 A;  3S22 A;  3RFB A;  5CTN A;  4WEK A;  3PBQ A;  4HNB A;  3CUE C;  5CHJ A;  1S6R A;  1GSX A;  1ESI A;  3WRZ A;  3K3C A;  1L2S A;  3MQ0 A;  5CEB A;  5E2G A;  3UB5 P;  4R3J A;  1NXY A;  3S4X A;  2O9C A;  5HPF A;  4F3L A;  5G4Z A;  3OCN A;  3RJU A;  5TJJ A;  3BFC A;  3A3J A;  4HJ3 A;  3W2Z A;  2W3F A;  4OQI A;  4MBH A;  1BUE A;  3H9W A;  4B4Z A;  3BFE A;  5M19 A;  4L9G A;  5TFQ A;  3B3X A;  2UV0 E;  3FKV A;  4PM9 A;  3NJA A;  1CEF A;  3B42 A;  2ZD8 A;  1MXO A;  1KGE A;  2FFF B;  1FCM A;  2XRO A;  5BOH A;  3EGD C;  3GSG A;  5FAQ A;  1OTI A;  1T1B A;  3TJZ C;  4DKI A;  3IHA A;  2C6W B;  4FOF A;  2QHK A;  4DJ3 A;  4ETX A;  4IUH A;  2W0N A;  3QP6 A;  3CHW P;  3G4P A;  2ZMV A;  1I2S A;  4PM5 A;  5HSQ A;  4FD8 A;  3F1O A;  3LID A;  1PWD A;  3EGX C;  2ZOI A;  4QHC A;  3JPU A;  5DTT A;  3IWO A;  1OTB A;  1TS0 A;  3NEC A;  2D02 A;  4S2I A;  1PNE A;  3GEC A;  3PBN A;  1CK3 A;  3HJI A;  3JYI A;  4N1H A;  4H6J A;  4DDS A;  4LCL A;  3IF6 A;  3UME A;  3IF6 B;  4IED A;  2AVX A;  5FI2 A;  1K54 A;  3ZG9 B;  4EEU A;  3IHB A;  2IWB A;  2OWJ A;  2L1M A;  4LV1 A;  3C2W A;  1KGG A;  1IEM A;  1N9N A;  1H8M A;  2WKE A;  4C6Y A;  1XKZ A;  4ID4 A;  5HZH A;  5HDS A;  3LIC A;  3TG9 A;  3IS2 A;  3UB7 A;  1K0K A;  2YKH A;  2R78 A;  1BT5 A;  2XLN A;  1TD5 A;  3UDF A;  3V39 A;  5AVF A;  2ZLY A;  2G2W A;  5HL6 A;  2OAQ 1;  3KYE A;  3DTI A;  3I7J A;  4PPR A;  5HX9 A;  2VZW A;  3TE8 A;  4KZ6 A;  1IYP A;  3HL9 A;  4OOL A;  3WWX A;  1FOF A;  4ARZ A;  5HAQ A;  3G2Z A;  4ARZ B;  2ACG A;  5DTK A;  3KSH A;  3CUE A;  5HAP A;  1G5U A;  5HWV A;  3IF5 A;  5CEC A;  2ZC6 B;  2ZQC A;  4GJ4 A;  4BL2 A;  2J80 A;  3BFG A;  2J7V A;  1DP6 A;  1GSV A;  4E3J A;  1XA1 A;  2XGN A;  1SDE A;  1L0E A;  4OOM A;  1YPR A;  4B9O A;  2QKP A;  1LSV A;  2XK1 A;  2WGI A;  2Y59 A;  3C4P A;  4ZJ3 A;  3MS6 A;  4WLA A;  1D7E A;  5IT5 A;  3S7N A;  3TRC A;  4ZAM A;  5FI6 A;  1G28 A;  2VGL M;  1YT4 A;  2CC1 A;  5EV0 A;  3W4P A;  3HVF A;  3RXX A;  2GDN A;  4WL9 A;  1XGJ A;  1QME A;  4KZ4 A;  5HWW A;  1O7E A;  2OOL A;  3CJM A;  5KSC A;  3E0Y A;  3G32 A;  4QY5 A;  5DFX A;  4ZJ2 A;  2NUP C;  4QPR A;  5EOO A;  5GLC A;  3F1N A;  2JHE A;  3N7W A;  4YIN A;  5A92 A;  3M2K A;  3NOU C;  4Y0O A;  1I5Q A;  4MNR A;  4KQQ A;  3ZG7 B;  4WZ4 A;  4OVD A;  4LV0 A;  3PYP A;  3ZVT A;  1MWR A;  5EE8 A;  3UE1 A;  5L09 A;  3DW0 A;  1CI8 A;  1S66 L;  3MXS A;  4PM8 A;  1K4F A;  1D1J A;  4JGO A;  1SCW A;  4UA6 A;  4EXO A;  4I5S A;  3M6H A;  4KZ9 A;  4YNR A;  2ZC3 B;  2Y2M A;  4O0P A;  4JLF A;  2VA0 A;  1ZKJ A;  1YLT A;  3OC2 A;  3NDG A;  5FQQ A;  4LFU A;  2WAF A;  3BLS A;  1FCN A;  4I3J A;  4H8R A;  1XJ4 A;  4R23 A;  1X0O A;  3BEC A;  1DRM A;  4L0L A;  5A8B A;  1OME A;  4M4X A;  4EW7 A;  4KQO A;  5F1F A;  2WKR A;  4KG2 A;  4HBU A;  1NWZ A;  1IKI A;  3W8K A;  2GJ3 A;  2X02 A;  3ZCZ A;  5CX7 A;  3QP1 A;  1Y54 A;  1YQS A;  4GDB A;  2W3H A;  4FH2 A;  4HHD A;  4BQM A;  3NBL A;  1VEU A;  5EVL A;  2NUT C;  2Y2O A;  3A0V A;  2JKT I;  3UMD A;  1CQA A;  3L7H A;  4YOF A;  3MZE A;  3G6O A;  4A5R A;  1FR6 A;  2H10 A;  4Y17 A;  1K55 C;  4X56 A;  3LR3 A;  2UWX A;  3SS5 A;  3A0S A;  4HIA A;  3SOI A;  2XR0 A;  1SDN A;  3LR5 A;  4X6T A;  3D9Y A;  4M3K A;  4NEE D;  2V2F F;  5FAP A;  3OLO A;  3OPH A;  4PHT A;  5FA7 A;  3LYX A;  1K6R A;  5KMW A;  5F82 A;  3ZNT A;  4O8G A;  1GHM A;  4CPK A;  1GSW A;  4FTX A;  3CLO A;  4X55 A;  4S2M A;  5E2F A;  1MKM A;  2JKR I;  1ZG6 A;  4S2K A;  2PD8 A;  1PWG A;  2BAS A;  4OPR A;  4S2N C;  4XT2 B;  3OOV A;  1PWC A;  2G2U A;  5D3O A;  1GHI A;  1S67 L;  3ZGA B;  4S2J A;  4EBL A;  2ZL1 A;  2HP9 A;  3T4L A;  2H28 A;  1OTA A;  1FR1 A;  5L07 A;  3MQQ A;  1LT0 A;  2WKP A;  2ZM0 A;  2V9A A;  1JVJ A;  2W1R A;  1KGF A;  3RXW A;  5A90 A;  3DTM A;  4P6B A;  4EV4 A;  4JPM A;  3KSF A;  3UN7 A;  4P87 A;  4JXS A;  3DWK A; 
#chains in the Genus database with same CATH homology
 3OCN A;  3MJQ A;  5TJJ A;  4HJ3 A;  2GZA A;  3W2Z A;  2W3F A;  4R70 A;  1Y28 A;  3B33 A;  3H7W B;  1TS6 A;  1BYW A;  2EWV A;  3H9W A;  2EA9 A;  3K2N A;  5G4Y A;  4L9G A;  3LIA A;  1STZ A;  4HJ6 A;  4WEJ A;  2PYP A;  1DP9 A;  3NJA A;  3B42 A;  5F6A A;  4O01 A;  1OJ5 A;  2XRO A;  1XJ2 A;  3MQO A;  4KQD A;  1P0Z A;  4DMZ A;  1NLY A;  3EGD C;  3OCL A;  1OTI A;  1T1B A;  3R7W A;  1OJG A;  3TJZ C;  2PT7 A;  1JNU A;  4BBV A;  3R7W B;  2P04 A;  3UB8 A;  4FOF A;  1IOU A;  1OT9 A;  2QHK A;  4CLC C;  4DJ3 A;  4BMW A;  2FZ0 A;  4NXB A;  4Y3I A;  2O0Y A;  4ETX A;  4IUH A;  3ULF A;  2PYR A;  2W0N A;  2JKR M;  4G3K A;  5MC7 A;  1W63 Q;  2VV7 A;  1N9L A;  2J3T D;  1G6O A;  2HF6 A;  2ZMV A;  3HJK A;  5TBM A;  2A24 B;  4PKY A;  3F1O A;  5HSQ A;  3LID A;  4HJ4 A;  4YWZ A;  5TBM B;  1NLZ A;  1XFQ A;  2PD7 A;  2ZOI A;  3EGX C;  4CLC E;  2K7S A;  1IFQ A;  3O5Y A;  2W1T B;  1OTB A;  1TS0 A;  3GDI A;  4NKP A;  2O9A A;  2D02 A;  3MFX A;  3FC7 A;  4WF0 A;  5DKL A;  3GEC A;  3PBN A;  1F9I A;  3HJI A;  3JVV A;  1YKD A;  1VHM A;  4H6J A;  1DP8 A;  3UME A;  2KDK A;  1S4S A;  4PKY G;  2M7U A;  1TS8 A;  2A2L A;  4GW9 A;  1LSW A;  3C8C A;  4EEU A;  4MDZ A;  2M1C A;  4CLC B;  2P08 A;  4GLQ A;  4EES A;  2OWJ A;  4XT2 A;  2PHY A;  2L1M A;  3D72 A;  4HI4 A;  3PBO A;  3EOI A;  1TF1 A;  1VB6 A;  3F1N B;  3C2W A;  2PR5 A;  1N9N A;  1H8M A;  4II7 A;  1LSX A;  3BY9 A;  5HZH A;  5IU1 A;  2PR6 A;  3NOT C;  1KOU A;  4HP9 A;  5EFW A;  5HDS A;  4I39 A;  2XSS A;  3LIC A;  4EUV A;  3IS2 A;  3UB7 A;  4G3W A;  5L8M A;  2YKH A;  2R78 A;  2OAP 1;  3IBR A;  4MN5 A;  1TD5 A;  4MCW A;  3EEA A;  3NOP C;  4NXG A;  4GS9 A;  5F5Y A;  4Q0J A;  4CQH A;  5AVF A;  2Z6C A;  5DJU A;  5HL6 A;  2OAQ 1;  4ETZ A;  4EQ1 A;  2L0W A;  3H7W A;  1TS7 A;  2VZW A;  4I3I A;  1LL8 A;  3TE8 A;  3ZYT A;  4EEP A;  4I38 A;  5AVE A;  4UEY A;  5J3W A;  3E4O A;  4OOL A;  1F98 A;  3LIB A;  1ZHH B;  3T4K A;  2B18 A;  4P6Z S;  4ARZ A;  3VV4 A;  3S7P A;  2L4R A;  3EEH A;  2GX5 A;  4P6Z M;  4ARZ B;  4EET B;  1XFN A;  3KSH A;  3CUE A;  4JGP A;  2DMW A;  2XRN A;  5HWV A;  5J4E A;  3T4Q A;  4GJ4 A;  4WUJ A;  2J80 A;  5C5K A;  2HGV A;  2KX6 A;  4JGQ A;  1WA9 A;  3BW6 A;  5AJG A;  1DP6 A;  1V9Y A;  2VV8 A;  2JN7 A;  3VE3 A;  3SW1 A;  3OBF A;  1GSV A;  4MMN A;  4EU0 A;  5HD3 A;  3F1P B;  2LB5 A;  4OOM A;  4B93 A;  2LB9 A;  4B9O A;  2P7J A;  2QKP A;  2A24 A;  3MMH A;  4HOI A;  1LSV A;  2D01 A;  4EER A;  3H82 A;  3UB6 A;  3KSI A;  3K3D A;  2W1T A;  1P9W A;  4WLA A;  3H82 B;  2VGL S;  1D7E A;  5IT5 A;  3S7N A;  3TRC A;  1G28 A;  2KLI A;  2VGL M;  2QJ5 A;  4LRZ E;  2W27 A;  2QWS A;  2Z6D A;  3D3O A;  4IJG A;  2K31 A;  3P01 A;  4ME4 A;  4WL9 A;  4E04 A;  4DN0 A;  3HCY A;  5HWW A;  5DKK A;  3PR6 A;  2OOL A;  4DJ2 A;  4FSF A;  3B47 A;  2O99 A;  1UWN X;  5HPI A;  4CLC A;  2I9V A;  3E0Y A;  5DFX A;  3LI8 A;  3S7Q A;  2NUP C;  4QPR A;  4Z1W A;  4K08 A;  4UQI S;  2W3E A;  4WN5 A;  3FPV A;  2O9B A;  2ZOH A;  3F1N A;  4UQI M;  2JHE A;  2V0U A;  2W3G A;  4R38 A;  1P9R A;  3NOU C;  1OTD A;  3PBS A;  5DF9 A;  3E98 A;  4WEL A;  3T4J A;  5I5L A;  3R4K A;  2OWH A;  2V1A A;  1OTE A;  1EW0 A;  3MXQ A;  5DFY A;  3PYP A;  4BBT A;  4KUO A;  1T18 A;  1S66 L;  2VV6 A;  1S1Z A;  2ZBB A;  2INW A;  5KSH A;  4JGO A;  3LR0 A;  3PHY A;  1ZTU A;  4KUK A;  4EXO A;  3MR0 A;  1YSQ A;  5HWT A;  4I5S A;  4LLO B;  2CMN A;  5J7E A;  5HDC A;  4G3V A;  4YNR A;  4HP4 A;  4O0P A;  2V0W A;  2VA0 A;  1F5M A;  3BWL A;  3OC2 A;  1XJ3 A;  4LRY C;  4MN6 A;  3EWK A;  4I3J A;  3KYQ A;  1MC0 A;  4HH3 A;  1N9O A;  1XJ4 A;  1S4R A;  2VJW A;  3PBT A;  1W63 M;  1X0O A;  2K2N A;  5F69 A;  1DRM A;  1OT6 A;  3P7N A;  4L0L A;  4L9F A;  5A8B A;  4IHQ A;  3FG8 A;  2QJ7 A;  1S1Y A;  3LIE A;  3S7O A;  4HQA A;  4M4X A;  4F3L B;  2B02 A;  2Y79 A;  3IBJ A;  4EW7 A;  4KQO A;  4NXF A;  2XA7 M;  2WKR A;  4HY8 A;  3T4S A;  3LR4 A;  4JGR A;  5K5B A;  3EQU A;  4LPZ A;  1NWZ A;  1NRJ A;  1V9Z A;  1YAX A;  3LUQ A;  3VOL A;  4L9E A;  4Q0H A;  3LFV A;  2GJ3 A;  2V1B A;  4BBU A;  4PAU A;  4BJP A;  3CIT A;  3T4O A;  4CLC D;  3NHQ A;  2J3W A;  3CWF A;  2VKS A;  3F1P A;  4Y2F A;  5CX7 A;  3UE6 A;  3VE4 A;  1XJ6 A;  5HD5 A;  2W3H A;  4HHD A;  4RQ9 A;  4AFI A;  4BWI A;  2W3D A;  4Y5F A;  2NUT C;  3BJN A;  4LRX C;  3A0V A;  2JKT I;  2QYB A;  2G7U A;  3UMD A;  1UWP X;  4R6L A;  2IA2 A;  2ZMF A;  3E4Q A;  4YOF A;  1YSP A;  3G6O A;  3TW8 A;  2VEA A;  3KSG A;  3T4T A;  3RH8 B;  3KX0 X;  2J3T C;  2Y8H A;  1P97 A;  3LR3 A;  3DBA A;  3A0S A;  4HIA A;  2VLG A;  3RTY A;  3F1O B;  1ODV A;  2MJ6 A;  5F68 A;  2EWW A;  3T50 A;  1MZU A;  1T19 A;  1H3Q A;  3PBR A;  3LR5 A;  4GHI A;  3UB9 A;  3UE3 A;  4NEE D;  4MN7 A;  3OLO A;  3C38 A;  1UGU A;  4GHI B;  4PHT A;  3JVU A;  5LBR A;  3FPW A;  3LYX A;  4NXE A;  5DJT A;  4H6J B;  1T1C A;  4O8G A;  1OPX A;  3LIF A;  2M7V A;  3ZQ5 A;  3BQ8 A;  3V67 A;  2YKF A;  1GSW A;  3ICY A;  3CLO A;  3U2A A;  1MKM A;  3CI6 A;  2JKR I;  3KYZ A;  2PD8 A;  2KOI A;  4ZRR A;  3EQV A;  3KO6 A;  2BAS A;  3BQA A;  4XT2 B;  2HJ9 C;  3OOV A;  3LI9 A;  4IUK A;  1S67 L;  4R3A A;  5IS1 A;  4GCZ A;  3MF0 A;  3BY8 A;  3T4L A;  1D06 A;  2H28 A;  1OTA A;  2WKQ A;  4Q0I A;  3RFB A;  5FL3 A;  4HH2 A;  4WEK A;  3PBQ A;  3MQQ A;  4HNB A;  1T1A A;  3CUE C;  1LT0 A;  3CAX A;  2PDR A;  2WKP A;  2V9A A;  1GSX A;  2W1R A;  3A0R A;  3PXP A;  2GNX A;  3IS2 B;  3K3C A;  3MQ0 A;  5KIZ A;  4I3A A;  2VX8 A;  3KSF A;  5HDD A;  4GS9 B;  2JKT M;  2O9C A;  4F3L A;  5HPF A;  2HV1 A;  3C30 A;  2FH5 A;  2XA7 S;  2HJE A;  3E4P A;  5G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...