3OPHA

Esbl r164s mutant of shv-1 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDSWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ophA00
2HP9A 1BZAA 3UDXA 4GD6A 1GHMA 4OP5A 2Y2HA 2Y91A 1K55C 3NY4A 4X53A 3W4QA 3AGDA 1WYBA 1K6RA 5FQ9A 1LI9A 1YMXA 4KQQA 2XF3A 1YLWA 2IWDA 1DY6A 3IT9A 1IYOA 3BECA 4WBGA 1W8QA 5DTSA 2HDUA 4U0TA 2WK0A 1K4FA 3OPLA 1WE4A 1DJBA 1JTDA 3N8SA 1ES3A 1PIOA 2HPBA 1K57A 3ZG7B 3ISGA 3FYZA 3IHBA 3PBOA 2RCXA 2EX2A 3QNBA 5FAOA 5GHZA 4B88A 4JXWA 3UE1A 1OMEA 2Y2KA 5JYOA 5EE8A 5DF9A 5FASA 1YLYA 1NZOA 2WAFA 3LY4A 3ZFZA 4FH4A 4BL3A 5FSRA 3NDEA 5DF8A 2ZC4B 4JKTA 3MZDA 1MWSA 4P0MA 3ZHHA 4GKUA 1NRFA 3HLDA 5GLDA 3GVBA 3VOYA 1GHIA 5BOHA 4N1XA 1DJCA 1Q2PA 3Q7ZA 4S2MA 5E2EA 4EQIA 4LENA 3ZDJA 2B5RA 3GR2A 1J9MA 2V20A 4MBFA 1SHVA 2PU2A 3C7UA 1FOFA 2ZQCA 2ZLYA 4WZ4A 5F82A 2XR0A 4NETA 2JCHA 4MEZA 5HAQA 3MFDA 4DXCA 4WEJA 4JXGA 4PM6A 1E4DA 1O7EA 4S2IA 1I2SA 4IVKA 5DTKA 4E6XA 3GV9A 4R1GA 4BQMA 3WS5A 1NYYA 4R4SA 3S22A 3E2LA 2ZM2A 1PWCA 4RYEA 3LY3A 4OPYA 3WS4A 1FCMA 5EVIC 5CERA 1JVJA 3VP4A 4CJNA 4UA6A 3LO7A 4OP8A 4JXSA 4E3OA 2ZQAA 1BT5A 4ZDXA 5E2HA 1YT4A 2EXAA 1EROA 4IBXA 5FA7A 3SOIA 1BTLA 2WAEA 4LV1A 4R23A 1JWVA 3G2ZA 1FCOA 1KE3A 4KZ9A 3S4XA 4DRTA 1ZG6A 3BFGA 2ZQ8A 4OQIA 3NC8A 2R9XA 3ZG0A 5G18A 1KGGA 3VMAA 1K57C 5GHYA 1FCNA 4X56A 4DE3A 4E3LA 2PU4A 3ZVTA 4JBFA 1L0EA 5EECA 3UN7A 3O3VA 4E3KA 3SH7A 1MWUA 2G2UA 4PPRA 5FI6A 3VSLA 4Y0UA 1LL5A 1ZG4A 2H0YA 4FD8A 5M18A 2J8YA 1EWZA 4OLGA 1N4OA 3C4PA 4H8RA 4HBTA 1K54C 3O88A 3W4PA 4DE1A 2ZC5B 1L0DA 2EX6A 3NDGA 5CXWA 3HLWA 5CGWA 1SKFA 1PI5A 4JF5A 4JPMA 3ZNTA 3IH9A 4PM7A 3QNCA 1MPLA 3N8LA 4PM9A 4Y7PA 3G34A 3IXHA 4PM8A 1CI8A 3ZG8B 3N4IA 1ESUA 1PI4A 1W79A 2R9WA 4OOLA 5CGSA 3ZG5A 3BFFA 1MXOA 2X02A 5M19A 4X69A 1VQQA 4GNUA 1IYQA 1I5QA 1ES4A 1RCJA 3FKWA 4QHCA 5FAQA 5CGXA 3ITBA 4OKPA 2H0TA 1K38A 3OCLA 3E2KA 5EVIA 4OQ0A 3BM6A 1HZOA 1HD8A 1H5XA 3A3IA 3Q81A 4WMCA 1NYMA 2XQZA 5CHUA 4ZAMA 4WM9A 2H5SA 3MXSA 4QJGA 4A5RA 2DNSA 4EWFA 5EVLA 1VM1A 5FI7A 1LLBA 4C6YA 3IWOA 2JBFA 1MKIA 1CEFA 2WGVA 2IWCA 3O87A 1LL9A 1S6RA 3WRZA 2H10A 1G68A 2ZMAA 1M40A 1GA0A 5AQBA 3TOIA 2XEPA 4EUZA 3N7WA 3V3SA 1SDEA 2EX8A 3HLBA 3B3XA 4UHUA 4HBUA 2UWXA 4X55A 1ESIA 4CPKA 3M2JA 4S2JA 2WKHA 4QD4A 3G30A 4U0XA 3VFHA 3MXRA 1L0GA 3IF6B 4S2KA 3SH8A 3UPNA 2XK1A 1G6AA 3V39A 5L2FA 5KSCA 1XP4A 3HLCA 5HARA 2DCFA 4KZ7A 1MY8A 2XLNA 1K54A 4LV2A 3W4OA 3G4PA 1YLJA 2C6WB 3HLGA 1XGIA 5EVID 3CZDA 3QHYA 3IHAA 4WMCD 3LEZA 4Y0OA 4QU3A 3A3JA 3ZVWA 3IF5A 3MBZA 1HTZA 2I72A 3C4OA 4LCMA 2WUQA 3PBSA 5M1AA 2EXBA 4KQRA 3FWLA 1KGEA 1BLSA 1SDNA 4OOMA 5FATA 3WS1A 2HDSA 2Y2JA 5FDHA 3RJUA 4C3QA 4Y0TA 1BLHA 2EX9A 3BFEA 3GRJA 4P87A 2Z2MB 1KVMA 3Q1FA 3D4FA 3Q07A 1YLTA 3HUMA 3VSKA 2E8IA 5A90A 4WYYA 2WZXA 5CECA 3VP3A 2XFSA 3V3RA 5F1GA 4DE0A 2J9OA 4U3TA 1FSYA 3IWQA 4BLMA 4OQHA 3FZCA 4KZ8A 3HLFA 3SH9A 3FKVA 4GB7A 3UY6A 3UDIA 4N1HA 2P9VB 2WZZA 4KZ6A 1W7FA 1HVBA 3HBRA 3BYDA 3Q7VB 4DKIA 1QMFA 1XXMA 3MKEA 2J9PA 4C75A 2WYXA 4E6WA 1K56A 1Z6FA 2QPNA 3G32A 4S2OA 1PZPA 4X68A 4GOGA 3IWIA 2C5WB 5GLBA 4K0XA 4EBLA 1CEGA 1XPBA 2OLVA 5TFQA 1ZC2A 4PM5A 4DXBA 2WGWA 2ZQ7A 3BEBA 3DWKA 3GSGA 2HP5A 3N6IA 4LV3A 4ZJ1A 4B4ZA 1L0FA 1PYYA 4RA7A 1XKZA 2Q9NA 1TVFA 2BG1A 3WWXA 3I7JA 5KMWA 1ES2A 2X01A 5EPHA 3BFCA 5GHXA 2Y2PA 5A92A 1RGZA 4B4XA 3GMWA 1XX2A 2XFTA 3P98A 2ZM0A 3PBTA 4GN2A 5TGFA 1L2SA 2ZC7A 2Q9MA 3CJMA 3G2YA 4N92A 4OPZA 2Y2QA 4PMAA 3SS3A 4OOYA 2XD1A 4P6BA 3VP1A 3OPPA 4IEDA 5CTNA 4GZBA 2JC7A 3BLMA 4IBRA 1QMEA 2WKIA 1Q2QA 1CI9A 5CHMA 1YLZA 4YFMA 2VGKA 3VP2A 2V1ZA 1NXYA 1PZOA 2DRWA 3HVFA 4OPRA 4OPQA 3WS2A 1TEMA 1K56D 4S2PA 4LCLA 5DF7A 1GHPA 3BLSA 3OPRA 5AQAA 4EBPA 3OZHA 4KZ5A 3IH8A 3W8KA 5E2FA 4E3JA 3UO9A 3RXWA 5D3OA 4UA7A 3HL9A 4QY5A 3UPPA 4BD0A 4WZ5A 2OLUA 4P85A 3RXXA 4R3JA 3OPHA 4BL2A 3M6BA 4JLFA 3PAEA 5DTTA 1IELA 2PBYA 3O86A 1K6SA 3JYIA 4XUXA 3N8RA 4QY6A 3NI9A 4BD1A 1U60A 1M6KA 2Y2NA 3A3FA 2ZD8A 1NZUA 2JE5A 5TR7A 4X6TA 1MWTA 5HFOA 4ZJ2A 5CRFA 3LCEA 3EQUA 4HEFA 3ZG9B 1CK3A 1FSWA 4FSFA 2Y55A 1H8YA 1I2WA 2GDNA 5FQKA 1BSGA 1ERMA 5E2GA 1KVLA 5JYPA 4KG5A 1YM1A 2FFFB 2HDRA 5U47A 4E3IA 1KGFA 4MLLA 3GTCA 1O07A 3PAGA 4KZBA 5HW3A 1S0WA 5GL9A 4BENA 1KDWA 3SS5A 4E3MA 1YLPA 4N9LA 2Y2IA 4ZBEA 5HX9A 3HREA 4KZ4A 3VFFA 5EVIB 5GLAA 1IKGA 4ZTKA 2BLSA 1Y54A 4YINA 2EFUA 3AGEA 4GDBA 1FR1A 2XD5A 3BFDA 4N9KA 4JXVA 2P9VA 4WEKA 4RX2A 3PTEA 1KDSA 5AQ7A 1SCWA 1TDLA 2Y2MA 1RGYA 1TDGA 1NJ4A 3IQAA 3OCNA 3MKFA 3Q7VA 4MNRA 4RX3A 1MWRA 4XUZA 1PW1A 3IXBA 4JF4A 4LV0A 1GCEA 5HL1A 4RVAA 2Y2OA 1PWGA 3WS0A 2QZ6A 3ZNYA 4KZAA 3TG9A 5IHVA 1KE4A 3ITAA 3UDFA 4UA9A 1E25A 4R3BA 4OH0A 1GA9A 3DWZA 2WGIA 4K0WA 1ONGA 5EUAA 2QMIA 2XGNA 2J7VA 4WELA 5I94A 1LI0A 1JWZA 1ZKJA 2WADA 4OVDA 4ZJ3A 1H8ZA 4WZ5C 1K25A 5FAPA 4M3KA 4R0QA 2WKEA 1DJAA 3VP0A 5FQIA 5FQMA 5FQJA 1MBLA 2A3UA 3PBQA 5FI2A 1XA1A 5DVAA 3IF6C 4FH2A 1K55A 4KG2A 4Q8IA 5A91A 2HDQA 3UE0A 2XDMA 1BLCA 3M6HA 1FR6A 5A93A 4HESA 3P09A 5HAPA 2Y4AA 3SS4A 3FV7A 2Y59A 3G31A 4S2NC 3BRMA 3NBLA 3ZCZA 1LHYA 1XA7A 1PW8A 1YMSA 2HP6A 4ID4A 4OONA 3A3EA 2P74A 3WRTA 4DF6A 4MBKA 4EBNA 5F83A 5KSHA 2EFXA 4E3NA 3Q82A 2FFYA 4R4RA 4O7DA 3UPOA 4KQOA 3V50A 1KE0A 4XXRA 1XGJA 3DTMA 3DW0A 1ALQA 2ZC6B 1WYCA 3S1YA 3G35A 1EI5A 2Y2LA 1C3BA 4KG6A 5KZHA 3GQZA 3IXGA 3M2KA 4DDYA 4GD8A 1IYPA 4D2OA 3HUNA 1E3UA 4FCFA 1JWPA 3MZFA 2RL3A 4IVIA 4Z9QA 1PWDA 4S2LA 3NIAA 3V5MA 1ERQA 5EOOA 2ZC3B 5F1FA 4EV4A 2XH9A 2ZJ9A 1IKIA 4DE2A 4JF6A 3IXDA 2Z2LB 4F94A 3UNWA 5CEDA 3A3DA 3TSGA 3AGFA 2A49A 1JTGA 1IEMA 3MZEA 4MBHA 3PBNA 4KZ3A 2VGJA 4NK3A 2ZQDA 3CMZA 2IWBA 1NY0A 2WGWB 3NCKA 1BULA 5J8XA 4DDSA 1BUEA 2Y2GA 1BLPA 2X71A 2OSUA 4UAAA 5E43A 1FQGA 2CC1A 2G2WA 1W5DA 3C7VA 4KENB 1AXBA 4QB8A 3IF6A 1YQSA 4L0LA 5CHJA 3CG5A 3OC2A 2ZQ9A 5AQ9A 1ONHA 5FQQA 1K4EA 4OLDA 5HAIA 3VOZA 2ZM8A 3HUOA 3PBRA 4K91A 5CTMA 4BJPA 4GDNA 1RP5A 4S2NA 1N9BA 5GLCA 3ZGAB 2OV5A 3EQVA 1ES5A 3HLEA 1W8YA 3C5AA 5CEBA 4OQGA 1E3UD 2V2FF 3UE3A 1IYSA 5EOEA
chains in the Genus database with same CATH superfamily
4GD6A 2Y2HA 1WYBA 5FQ9A 3CHWP 3CUEA 1YLWA 2IWDA 1DY6A 3IT9A 2PAVP 4WBGA 4NG2A 3VE3A 2HDUA 2J3WA 4U0TA 3N8SA 1PIOA 2HPBA 3ZG7B 3IHBA 4FTXA 1OMEA 5DF9A 1YLYA 3W2ZA 5FSRA 2V8CA 2R78A 3GDIA 2ZMVA 3VOYA 1YKDA 4N1XA 4S2MA 1KOUA 2B5RA 3GR2A 3EEAA 2V20A 2P7JA 2ZQCA 2ZLYA 4HH3A 1NWZA 4IUKA 4PM6A 2OAQ1 4E6XA 5HD5A 4R1GA 1H8MA 4R4SA 3S22A 4HIAA 4RYEA 3WS4A 4PKYG 1T18A 5EVIC 3LI9A 3CUEC 4R23A 1FCOA 3S4XA 4DRTA 4YNRA 1OT9A 4OQIA 3NC8A 2AVXA 5F6AA 3HJIA 4X25A 4HP9A 3ZVTA 3O3VA 3SH7A 1ZG4A 2H0YA 2J80A 2J8YA 4OLGA 3RTYA 2GZAA 4HBTA 1K54C 3W4PA 3LIFA 4GS9B 1L0DA 3NDGA 3BQAA 4JF5A 3OBFA 3N8LA 3G34A 3IXHA 4HQAA 3N4IA 4OOLA 3BFFA 1MXOA 5M19A 4WF0A 1IYQA 1RCJA 1ES4A 5FAQA 5DKLA 2PRFA 4HI4A 3A3IA 4WMCA 1H3QA 1OTDA 4B93A 4PKYA 5FI7A 1T1CA 2W3GA 3TOIA 5AQBA 3K3CA 5I5LA 5J7EA 4X55A 2UWXA 4CPKA 3M2JA 5L10A 3IBRA 4X1MA 1G6AA 3V39A 5KSCA 3HLCA 1D7EA 2GX5A 2XLNA 3R7WB 2C6WB 3HLGA 1D06A 3JVUA 3LEZA 2I72A 1BLSA 3WS1A 4C3QA 1BLHA 2Z2MB 3K3DA 3D4FA 2CMNA 1T1AA 5AJGA 3VSKA 5HDCA 2WZXA 2XFSA 3V3RA 5F1GA 4DE0A 1FSYA 2V1BA 4OQHA 3SH9A 3HLFA 1ZHHB 1ODVA 4N1HA 3UDIA 2P9VB 3JPUA 3BYDA 1QMFA 3G32A 3IWIA 1NLZA 2WGWA 2B02A 1NLYA 3CITA 4ZJ1A 1PYYA 1XKZA 3LIBA 5DJTA 3FC7A 5EM1A 3JVVA 3P98A 3PBTA 2L1MA 1XJ2A 3CJMA 3SS3A 4P6BA 5MC7A 2JC7A 3F1NA 2V1ZA 2DRWA 4OPQA 3LICA 2VZWA 4KZ5A 3MQ0A 4E3JA 3UO9A 3RXWA 4UA7A 4BD0A 5A8BA 1DRMA 2OLUA 4P85A 3MMHA 3DAVA 4JLFA 1IELA 3JYIA 4BD1A 1G5UA 1U60A 2GNXA 2Y2NA 2JE5A 5HFOA 4ZJ2A 5CRFA 3LCEA 3EQUA 3KYQA 2VK3A 2NUPC 3SZTA 3ZG9B 1UWPX 1H8YA 2GDNA 4I39A 1BSGA 4I3AA 2GJ3A 4KG5A 1YM1A 3T12B 5U47A 3QP8A 4UQIS 3SS5A 2Z6CA 2M7UA 5HX9A 4Y13A 4HY8A 4EERA 4ZTKA 2BLSA 1Y54A 2Y8HA 3AGEA 2VGLM 2Y79A 5EV0A 3QP4A 4RX2A 3F1OA 3PTEA 1KDSA 2D02A 1SCWA 4MNRA 3MKFA 4XUZA 3IXBA 2PDRA 2Y2OA 3WS0A 5EM0A 2WKRA 3H7WA 3TG9A 5IHVA 1KE4A 4ARZB 1VEUB 4OH0A 3DWZA 2WGIA 1ONGA 5EUAA 2XGNA 3T1XA 5I94A 2NUTC 2WADA 2OWHA 2WKEA 5FQMA 5FQJA 1MBLA 2A3UA 3B33A 3PBQA 5FI2A 1XA1A 5DVAA 3IF6C 4Q8IA 5A91A 5DKKA 1BLCA 5HAPA 1W63Q 3FV7A 3G31A 1PW8A 4HJ3A 3A3EA 4MBKA 3T50A 4E3NA 4O7DA 3V50A 5IU1A 4XXRA 4NXBA 5AVEA 1MKMA 5DFXA 2Y2LA 1C3BA 5KZHA 3GQZA 3IXGA 1E3UA 4FCFA 4Z9QA 4S2LA 3V5MA 3LIAA 4R6LA 2PD7A 2Z2LB 4F94A 2HV1A 3AGFA 1IEMA 2HJ9C 5LBRA 4KZ3A 2JKRI 3UB9A 2ZQDA 1P97A 3DTEA 1NY0A 2WGWB 5J8XA 4UAAA 3QP5A 2G2WA 1W5DA 3C7VA 3PXPA 3TW8A 3ULFA 1OJ5A 1K4EA 4EEPA 2ZM8A 4EW7A 1RP5A 1N9BA 5KIZA 4G3KA 2UV0E 1W63M 2V2FF 3UE3A 5EOEA 1BZAA 3UDXA 1GHMA 4OP5A 1XJ4A 1F2KA 1K6RA 3D72A 3MQQA 3L9KA 3BECA 3BWLA 1W8QA 4IHQA 5DTSA 3IX8A 1K4FA 3OPLA 3FYZA 3PBOA 3QNBA 1JNUA 1XJ6A 1UGUA 3KSHA 2Y2KA 5JYOA 3LY4A 1NZOA 2WAFA 4MCWA 4FH4A 4BL3A 2ZC4B 3MZDA 1T19A 4GKUA 1NRFA 1VHMA 5GLDA 1BYWA 1GHIA 3Q7ZA 3PR6A 3C7UA 1FOFA 5IS1A 3VOLA 3LYXA 2XR0A 4NETA 2BASA 4JGPA 3MFDA 4WEJA 1O7EA 4S2IA 1I2SA 3GV9A 4M4XA 4JGQA 1NYYA 5J3WA 2W1RA 3QP1A 1WA9A 1FCMA 1JVJA 4ETXA 4UA6A 4OP8A 2IA2A 4H6JA 4ZDXA 5E2HA 1YAXA 1BTLA 3H7WB 1JWVA 3G2ZA 3A0SA 1G28A 1KE3A 1Y28A 4KZ9A 3T4LA 2W3FA 2R9XA 5G18A 3VMAA 4X56A 4DE3A 4E3LA 4CLCA 3IS2A 5EECA 1TS6A 4E3KA 1MWUA 3VSLA 4Y0UA 1LL5A 4FD8A 2QYBA 2W1TA 3O88A 4D60A 5CGWA 4JPMA 3ZNTA 1OTEA 2VGLS 4PM9A 1N9NA 4Y7PA 3ZG8B 2R9WA 5CGSA 1I5QA 3FKWA 5CGXA 1K38A 1YSQA 5EVIA 3EGXC 3UMEA 2XQZA 1L3LA 2INWA 3CPTB 3MXSA 3S7PA 5EVLA 3E4PA 5F68A 1S4SA 3IWOA 2LB5A 2JBFA 3NHQA 2IWCA 3WRZA 1G68A 1YPRA 2H10A 2ZMAA 1N9LA 1SKOA 3N7WA 3B3XA 2H28A 1TS0A 3MXRA 1L0GA 2XK1A 1XP4A 1LSVA 4BMWA 4KZ7A 1MY8A 1K54A 1XGIA 4WMCD 4Y0OA 2JN7A 4CLCC 3A3JA 4LCMA 5M1AA 3C30A 2Y2JA 4Y0TA 3GRJA 3Q07A 1YLTA 2VV6A 5A90A 2J9OA 3H82A 2FZ0A 3IWQA 4BLMA 3FKVA 4GB7A 4Y17A 1PNEA 2OOLA 2WZZA 4DKIA 1STZA 3Q7VB 3RFBA 2WYXA 1FIKA 1K56A 1Z6FA 2QPNA 4X68A 4K0XA 4PM5A 2OLVA 5TFQA 1ZC2A 3OLOA 4LFUA 3GSGA 2HP5A 4GW9A 1L0FA 1TVFA 2BG1A 5KMWA 3E4OA 4WL9A 3B42A 3ICYA 2X01A 4B4XA 2EA9A 2B18A 1VETB 1L2SA 2ZC7A 2Q9MA 3VV4A 3DTIA 4N92A 2YKFA 3VP1A 4IEDA 2WKIA 2ZL1B 4BWIA 2VGKA 3VP2A 1NXYA 2Q0OA 1PZOA 3RH8B 4KUKA 1TEMA 4S2PA 4LCLA 1GHPA 3BLSA 3KSIA 3OZHA 4LRXC 5E2FA 3HL9A 4QY5A 3UPPA 3MXQA 4WZ5A 1HLUP 3LR3A 4HNBA 4BL2A 5DTTA 3O86A 3IS2B 3N8RA 1VB6A 1M6KA 3A3FA 1NZUA 3G6OA 2W1TB 3T4JA 4EEUA 4EUVA 3TJZC 3CLOA 2HDRA 2PBDP 4DJ3A 4E3IA 1TD5A 3GTCA 1O07A 2PYPA 5HZHA 1H0MA 3KYZA 4E3MA 1YLPA 2Y2IA 4ZBEA 3HREA 5EVIB 1IKGA 5TJJA 3UE6A 2EFUA 4GDBA 1LT0A 4WEKA 2A24A 3DTKA 1UWNX 1TDLA 3OCNA 1RGYA 4QPRA 1PW1A 4LV0A 1V9ZA 5DFYA 4RVAA 3NECA 3LUQA 1CJFA 2MJ6A 3ZNYA 3V67A 4R3BA 1EW0A 1GA9A 3T4KA 2J7VA 4WELA 4OVDA 5IT5A 4WZ5C 5FAPA 4M3KA 4R0QA 2O99A 3VP0A 1CF0A 4KG2A 3BY9A 3UE0A 1S67L 4O8GA 4HESA 3P09A 3SS4A 3ZCZA 1YMSA 4OONA 3E98A 3WRTA 5L09A 2EFXA 3Q82A 1ACFA 2FFYA 3T4OA 4R70A 3DTMA 2ZC6B 3S1YA 3UB5P 2L0WA 4DDYA 5TBMA 2HJEA 4MMNA 5HWWA 4K08A 1JWPA 4ETZA 4IVIA 3VE4A 5F1FA 4EV4A 2XH9A 2ZJ9A 1IKIA 1GSWA 3P01A 4HHDA 4BBTA 3LEQA 3UNWA 3A3DA 4MBHA 4NK3A 4RQ9A 2HF6A 1BUEA 2Y2GA 1BLPA 4KENB 3IF6A 4Q0IA 1OTIA 1YQSA 4L0LA 5CHJA 5EVEA 5AQ9A 4HH2A 5FQQA 4OLDA 3HUOA 4GDNA 5GLCA 1ES5A 4OQGA 1E3UD 1IYSA 2HP9A 3NY4A 3KX0X 4X53A 4WLAA 2M7VA 1YMXA 2XF3A 1OTAA 1IYOA 3LR0A 2WK0A 1JTDA 2V0WA 1ES3A 1K57A 3ISGA 3O5YA 2RCXA 5FAOA 4B88A 4JXWA 2OAP1 5EE8A 5FASA 3B47A 4B9OA 1MWSA 4P0MA 3HJKA 1P0ZA 1GSXA 1A0KA 5BOHA 1Q2PA 5E2EA 1J9MA 4MBFA 5EFWA 1SHVA 2PU2A 2W3HA 4WZ4A 2PD8A 5HPFA 1F98A 4LPZA 5AVFA 4DXCA 4JXGA 4PAUA 4GHIA 2J3TC 2W0NA 4QWOA 4BQMA 4F3LA 1PWCA 3F1PA 3LY3A 4MN7A 2G7UA 4II7A 5CERA 3VP4A 4E3OA 4JXSA 3A0RA 4IBXA 3SOIA 2KLIA 3GECA 1Z09A 2ZQ8A 3ZG0A 2JHEA 1K57C 1FCNA 3ZQ5A 2PU4A 4JBFA 1L0EA 3UN7A 4PPRA 5M18A 4EESA 1EWZA 3NOUC 3C4PA 4H8RA 2VV7A 3KYEA 2ZC5B 2EX6A 5CXWA 1XJ3A 1T1BA 4PM7A 2ACGA 4PM8A 1CI8A 3H9WA 3IX3A 1W79A 1DP9A 3ZG5A 2X02A 3T1SA 1VQQA 4GNUA 3T1RA 4QHCA 4Q0JA 3ITBA 4I3IA 5TBMB 2EWWA 1S4RA 4OQ0A 1HZOA 1HD8A 3R4KA 2OWJA 1NYMA 5F5YA 4ZAMA 3F1NB 2H5SA 1PRQA 4A5RA 4CLCD 1LLBA 4Y3IA 4R38A 5C5KA 4C6YA 1CEFA 2WGVA 3O87A 3BJNA 1LL9A 1S6RA 1GA0A 4GCZA 4EUZA 4I5SA 3V3SA 4HBUA 2PYRA 2WKHA 4QD4A 3G30A 4WN5A 3IF6B 3UPNA 2JKGA 4PHTA 3W4OA 4LV2A 3G4PA 5EVID 3QHYA 3IHAA 4QU3A 3IBJA 3ZVWA 3IF5A 3MBZA 1HTZA 3C4OA 2WUQA 2VEAA 3PBSA 3LR5A 2EXBA 1NRJA 4KQRA 4OOMA 2LB9A 5FDHA 2QKPA 3BFEA 4P87A 2E8JA 3Q1FA 1TF1A 5CECA 2V9AA 1OTBA 4U3TA 3FZCA 3UY6A 2QJ5A 3F1OB 1HVBA 3MKEA 1XXMA 2J9PA 4S2OA 3ZYTA 2EWVA 4EU0A 2C5WB 4EBLA 1CEGA 4DXBA 4GS9A 3N6IA 4LV3A 4FOFA 1Y4OA 2Q9NA 2W27A 3WWXA 5EPHA 5GHXA 5A92A 4HOIA 3GMWA 4GHIB 2XFTA 1F5MA 3G2YA 2Y2QA 4F3LB 4L9FA 4GZBA 3BLMA 3MS6A 5CHMA 5F69A 3HVFA 4OPRA 3WS2A 1K56D 2M1CA 5DF7A 3KO6A 3QP6A 1OPXA 3IH8A 5HSQA 4R3AA 3MSHA 5D3OA 3TRCA 3T4SA 3PAEA 1LSWA 3SW1A 2PBYA 1K6SA 4XUXA 4QY6A 3NI9A 2K7SA 3BQ8A 1IFQA 2ZD8A 3R7WA 5TR7A 4X6TA 5HD3A 4XT2A 4EXOA 5L07A 3IX4A 5FQKA 1P9RA 1S66L 1KVLA 5JYPA 2FFFB 4Y15A 2V1AA 3PAGA 4KZBA 2VV8A 1S1YA 1D1JA 4BENA 2BTFP 3LIEA 4LRZE 4HJ4A 1FR1A 2XD5A 4N9KA 4JXVA 2P9VA 2O0YA 1AWIA 4RX3A 1NJ4A 4P6ZM 1MWRA 4LGWA 4JF4A 1GCEA 3E4QA 2QZ6A 3BW6A 4KZAA 3PYPA 2YKHA 3LI8A 3UDFA 4E04A 4NEED 1S1ZA 3T4TA 3P7NA 3UB7A 1LI0A 1ZKJA 1DJAA 2PHYA 4KUOA 1K55A 2XDMA 1FR6A 3A0VA 4S2NC 3BRMA 1LHYA 1XA7A 2HP6A 1X0OA 4R4RA 4HJ6A 3UPOA 4UQIM 4NXGA 1KE0A 1XGJA 3DW0A 1ALQA 1K0KA 1WYCA 3LGOA 5G4YA 3CAXA 5HDDA 4KG6A 3M2KA 4O0PA 4D2OA 3CWFA 3MZFA 1F9IA 3NIAA 2ZBBA 1ERQA 4HP4A 5EOOA 2ZC3B 2W3DA 4G3VA 4H6JB 1JTGA 1G6OA 3PBNA 2VGJA 3CI6A 3CMZA 2IWBA 3NCKA 5HWTA 2OSUA 5E43A 4MN6A 3EEHA 3OC2A 4CLCB 3MF0A 3PBRA 4BJPA 4K91A 4NXEA 2D01A 5HL6A 3EQVA 3FPWA 3HLEA 1W8YA 4FUWA 5CEBA 3EGDC 2XROA 2Y91A 3NJAA 1K55C 2XA7M 4UEYA 3W4QA 3AGDA 4EQ1A 1LI9A 2O9CA 3T4QA 4KQQA 5G4ZA 1WE4A 1DJBA 2K2NA 3K2NA 4LRYC 4I3JA 5HDSA 4ARZA 1VEUA 2EX2A 5GHZA 3UE1A 2J3TD 2P04A 4AFIA 1YSPA 2FH5A 3ZFZA 3NDEA 5DF8A 4JKTA 3LR4A 1DP6A 3ZHHA 3HLDA 1IOUA 3C38A 3GVBA 1SKOB 1DJCA 4CQHA 4XT2B 2HZ5A 3MQOA 4EQIA 4LENA 3ZDJA 2VJWA 2WKPA 2KOIA 5F82A 3S7NA 2JCHA 4MEZA 2A2LA 1MC0A 5HAQA 4JGOA 3KSGA 1E4DA 4IVKA 4DJ2A 5DTKA 3WS5A 4IUHA 3E2LA 2ZM2A 4OPYA 2ZOHA 4ME4A 4CJNA 3LO7A 1SZVA 1BT5A 2ZQAA 1XFQA 1YT4A 2HGVA 2EXAA 1EROA 5FA7A 1MZUA 2WAEA 4LV1A 4L9EA 2JKFA 3H82B 1ZG6A 3BFGA 2VX8A 4L9GA 5CX7A 1DP8A 1KGGA 5GHYA 2JKRM 4O01A 2JKTM 2G2UA 5FI6A 1N9OA 4Q0HA 1N4OA 2VLGA 4BBUA 4DE1A 1OJGA 1LSXA 3HLWA 1SKFA 1PI5A 3IH9A 3QNCA 1MPLA 1ESUA 1PI4A 4P6ZS 4X69A 3MR0A 4I38A 4OKPA 2H0TA 3OCLA 3E2KA 3BM6A 1H5XA 1V9YA 3Q81A 4DN0A 3U4LP 5CHUA 4WM9A 3UB6A 4QJGA 3BY8A 2DNSA 4EWFA 1VM1A 4GLQA 1MKIA 2O9AA 2PR5A 4MN5A 1M40A 2XEPA 3KSFA 1SDEA 2EX8A 3HLBA 4UHUA 4NKPA 5HPIA 2V8FA 1ESIA 4S2JA 2K31A 2W3EA 4U0XA 3VFHA 3MJQA 4S2KA 3SH8A 5L2FA 5HARA 2B95A 2DCFA 5DJUA 1TS7A 4ESPA 3S7QA 1YLJA 2VA0A 2P08A 3CZDA 1GSVA 3C2WA 4KQDA 4YWZA 4Y2FA 3FWLA 1KGEA 1SDNA 5FATA 2KX6A 3C8CA 3TE8A 2HDSA 3RJUA 4NXFA 2EX9A 2V0UA 1KVMA 3NOTC 3HUMA 3MFXA 2QWSA 2E8IA 4WYYA 3VP3A 1J3WA 4KZ8A 2ZMFA 2A24B 4KZ6A 1W7FA 3HBRA 3LFVA 3QP2A 4IJGA 4C75A 3OOVA 4E6WA 1PZPA 4YOFA 4GOGA 5GLBA 1XPBA 5FDSA 2ZQ7A 3BEBA 3DWKA 2XA7S 1XFNA 4B4ZA 2Z6DA 4RA7A 3I7JA 1ES2A 2QHKA 2KDKA 3BFCA 2Y2PA 3FG8A 1RGZA 3T1QB 4Z1WA 1XX2A 4GN2A 2ZM0A 5TGFA 4PMAA 4OPZA 4OOYA 2XD1A 3OPPA 5CTNA 5FEGA 4IBRA 1QMEA 3CPTA 1Q2QA 1CI9A 1YLZA 4YFMA 2I9VA 4Y5FA 4EETB 3OPRA 5AQAA 4EBPA 5K5BA 3W8KA 2DMWA 2O9BA 3D9YA 1TS8A 4MDZA 2JKTI 4G3WA 3RXXA 4R3JA 3NOPC 3OPHA 3M6BA 3D3OA 3NULA 3DBAA 4LLOB 4CLCE 5J4EA 2WKQA 3EOIA 4BBVA 1MWTA 1OT6A 5FL3A 4HEFA 1CK3A 1FSWA 4FSFA 2Y55A 1I2WA 3FPVA 1ERMA 5E2GA 1FILA 1KGFA 4MLLA 5HW3A 1S0WA 5GL9A 1KDWA 3L7HA 4N9LA 4KZ4A 3VFFA 5GLAA 3LIDA 4YINA 2XSSA 3BFDA 2L4RA 5AQ7A 3Q7VA 2Y2MA 1TDGA 3IQAA 5HWVA 2PT7A 1LL8A 1ZTUA 5HL1A 1PWGA 3ITAA 4UA9A 1E25A 4K0WA 2QMIA 4DMZA 2VKSA 1JWZA 4ZJ3A 1H8ZA 4GJ4A 1K25A 5FQIA 5FEFA 4FH2A 1VETA 2HDQA 3M6HA 5A93A 2Y4AA 5KSHA 2Y59A 3UB8A 3NBLA 3U2AA 4ID4A 2P74A 2ZOIA 4DF6A 4EBNA 2ZL1A 5F83A 2PR6A 2QJ7A 5L8MA 4KQOA 4JGRA 4WUJA 3G35A 1EI5A 4GD8A 1IYPA 3HUNA 4ZRRA 3F1PB 2RL3A 4X1LA 1PWDA 3EWKA 4DE2A 1PFLA 4JF6A 3IXDA 5CEDA 3TSGA 2A49A 3HCYA 3MZEA 3PHYA 1BULA 3E0YA 4DDSA 2X71A 3UMDA 2XRNA 1FQGA 3S7OA 2CC1A 4QB8A 1AXBA 3CG5A 2ZQ9A 1ONHA 3VOZA 5HAIA 1CQAA 1P9WA 5CTMA 4S2NA 3ZGAB 2OV5A 3C5AA
chains in the Genus database with same CATH topology
2HP9A 1BZAA 3UDXA 4GD6A 1GHMA 4OP5A 2Y2HA 2Y91A 1K55C 3NY4A 4X53A 3W4QA 3AGDA 1WYBA 1K6RA 5FQ9A 1LI9A 1YMXA 4KQQA 2XF3A 1YLWA 2IWDA 1DY6A 3IT9A 1IYOA 3BECA 4WBGA 1W8QA 5DTSA 2HDUA 4U0TA 2WK0A 1K4FA 3OPLA 1WE4A 1DJBA 1JTDA 3N8SA 1ES3A 1PIOA 2HPBA 1K57A 3ZG7B 3ISGA 3FYZA 3IHBA 3PBOA 2RCXA 2EX2A 3QNBA 5FAOA 5GHZA 4B88A 4JXWA 3UE1A 1OMEA 2Y2KA 5JYOA 5EE8A 5DF9A 5FASA 1YLYA 1NZOA 2WAFA 3LY4A 3ZFZA 4FH4A 4BL3A 5FSRA 3NDEA 5DF8A 2ZC4B 4JKTA 3MZDA 1MWSA 4P0MA 3ZHHA 4GKUA 1NRFA 3HLDA 5GLDA 3GVBA 3VOYA 1GHIA 5BOHA 4N1XA 1DJCA 1Q2PA 3Q7ZA 4S2MA 5E2EA 4EQIA 4LENA 3ZDJA 2B5RA 3GR2A 1J9MA 2V20A 4MBFA 1SHVA 2PU2A 3C7UA 1FOFA 2ZQCA 2ZLYA 4WZ4A 5F82A 2XR0A 4NETA 2JCHA 4MEZA 5HAQA 3MFDA 4DXCA 4WEJA 4JXGA 4PM6A 1E4DA 1O7EA 4S2IA 1I2SA 4IVKA 5DTKA 4E6XA 3GV9A 4R1GA 4BQMA 3WS5A 1NYYA 4R4SA 3S22A 3E2LA 2ZM2A 1PWCA 4RYEA 3LY3A 4OPYA 3WS4A 1FCMA 5EVIC 5CERA 1JVJA 3VP4A 4CJNA 4UA6A 3LO7A 4OP8A 4JXSA 4E3OA 2ZQAA 1BT5A 4ZDXA 5E2HA 1YT4A 2EXAA 1EROA 4IBXA 5FA7A 3SOIA 1BTLA 2WAEA 4LV1A 4R23A 1JWVA 3G2ZA 1FCOA 1KE3A 4KZ9A 3S4XA 4DRTA 1ZG6A 3BFGA 2ZQ8A 4OQIA 3NC8A 2R9XA 3ZG0A 5G18A 1KGGA 3VMAA 1K57C 5GHYA 1FCNA 4X56A 4DE3A 4E3LA 2PU4A 3ZVTA 4JBFA 1L0EA 5EECA 3UN7A 3O3VA 4E3KA 3SH7A 1MWUA 2G2UA 4PPRA 5FI6A 3VSLA 4Y0UA 1LL5A 1ZG4A 2H0YA 4FD8A 5M18A 2J8YA 1EWZA 4OLGA 1N4OA 3C4PA 4H8RA 4HBTA 1K54C 3O88A 3W4PA 4DE1A 2ZC5B 1L0DA 2EX6A 3NDGA 5CXWA 3HLWA 5CGWA 1SKFA 1PI5A 4JF5A 4JPMA 3ZNTA 3IH9A 4PM7A 3QNCA 1MPLA 3N8LA 4PM9A 4Y7PA 3G34A 3IXHA 4PM8A 1CI8A 3ZG8B 3N4IA 1ESUA 1PI4A 1W79A 2R9WA 4OOLA 5CGSA 3ZG5A 3BFFA 1MXOA 2X02A 5M19A 4X69A 1VQQA 4GNUA 1IYQA 1I5QA 1ES4A 1RCJA 3FKWA 4QHCA 5FAQA 5CGXA 3ITBA 4OKPA 2H0TA 1K38A 3OCLA 3E2KA 5EVIA 4OQ0A 3BM6A 1HZOA 1HD8A 1H5XA 3A3IA 3Q81A 4WMCA 1NYMA 2XQZA 5CHUA 4ZAMA 4WM9A 2H5SA 3MXSA 4QJGA 4A5RA 2DNSA 4EWFA 5EVLA 1VM1A 5FI7A 1LLBA 4C6YA 3IWOA 2JBFA 1MKIA 1CEFA 2WGVA 2IWCA 3O87A 1LL9A 1S6RA 3WRZA 2H10A 1G68A 2ZMAA 1M40A 1GA0A 5AQBA 3TOIA 2XEPA 4EUZA 3N7WA 3V3SA 1SDEA 2EX8A 3HLBA 3B3XA 4UHUA 4HBUA 2UWXA 4X55A 1ESIA 4CPKA 3M2JA 4S2JA 2WKHA 4QD4A 3G30A 4U0XA 3VFHA 3MXRA 1L0GA 3IF6B 4S2KA 3SH8A 3UPNA 2XK1A 1G6AA 3V39A 5L2FA 5KSCA 1XP4A 3HLCA 5HARA 2DCFA 4KZ7A 1MY8A 2XLNA 1K54A 4LV2A 3W4OA 3G4PA 1YLJA 2C6WB 3HLGA 1XGIA 5EVID 3CZDA 3QHYA 3IHAA 4WMCD 3LEZA 4Y0OA 4QU3A 3A3JA 3ZVWA 3IF5A 3MBZA 1HTZA 2I72A 3C4OA 4LCMA 2WUQA 3PBSA 5M1AA 2EXBA 4KQRA 3FWLA 1KGEA 1BLSA 1SDNA 4OOMA 5FATA 3WS1A 2HDSA 2Y2JA 5FDHA 3RJUA 4C3QA 4Y0TA 1BLHA 2EX9A 3BFEA 3GRJA 4P87A 2Z2MB 1KVMA 3Q1FA 3D4FA 3Q07A 1YLTA 3HUMA 3VSKA 2E8IA 5A90A 4WYYA 2WZXA 5CECA 3VP3A 2XFSA 3V3RA 5F1GA 4DE0A 2J9OA 4U3TA 1FSYA 3IWQA 4BLMA 4OQHA 3FZCA 4KZ8A 3HLFA 3SH9A 3FKVA 4GB7A 3UY6A 3UDIA 4N1HA 2P9VB 2WZZA 4KZ6A 1W7FA 1HVBA 3HBRA 3BYDA 3Q7VB 4DKIA 1QMFA 1XXMA 3MKEA 2J9PA 4C75A 2WYXA 4E6WA 1K56A 1Z6FA 2QPNA 3G32A 4S2OA 1PZPA 4X68A 4GOGA 3IWIA 2C5WB 5GLBA 4K0XA 4EBLA 1CEGA 1XPBA 2OLVA 5TFQA 1ZC2A 4PM5A 4DXBA 2WGWA 2ZQ7A 3BEBA 3DWKA 3GSGA 2HP5A 3N6IA 4LV3A 4ZJ1A 4B4ZA 1L0FA 1PYYA 4RA7A 1XKZA 2Q9NA 1TVFA 2BG1A 3WWXA 3I7JA 5KMWA 1ES2A 2X01A 5EPHA 3BFCA 5GHXA 2Y2PA 5A92A 1RGZA 4B4XA 3GMWA 1XX2A 2XFTA 3P98A 2ZM0A 3PBTA 4GN2A 5TGFA 1L2SA 2ZC7A 2Q9MA 3CJMA 3G2YA 4N92A 4OPZA 2Y2QA 4PMAA 3SS3A 4OOYA 2XD1A 4P6BA 3VP1A 3OPPA 4IEDA 5CTNA 4GZBA 2JC7A 3BLMA 4IBRA 1QMEA 2WKIA 1Q2QA 1CI9A 5CHMA 1YLZA 4YFMA 2VGKA 3VP2A 2V1ZA 1NXYA 1PZOA 2DRWA 3HVFA 4OPRA 4OPQA 3WS2A 1TEMA 1K56D 4S2PA 4LCLA 5DF7A 1GHPA 3BLSA 3OPRA 5AQAA 4EBPA 3OZHA 4KZ5A 3IH8A 3W8KA 5E2FA 4E3JA 3UO9A 3RXWA 5D3OA 4UA7A 3HL9A 4QY5A 3UPPA 4BD0A 4WZ5A 2OLUA 4P85A 3RXXA 4R3JA 3OPHA 4BL2A 3M6BA 4JLFA 3PAEA 5DTTA 1IELA 2PBYA 3O86A 1K6SA 3JYIA 4XUXA 3N8RA 4QY6A 3NI9A 4BD1A 1U60A 1M6KA 2Y2NA 3A3FA 2ZD8A 1NZUA 2JE5A 5TR7A 4X6TA 1MWTA 5HFOA 4ZJ2A 5CRFA 3LCEA 3EQUA 4HEFA 3ZG9B 1CK3A 1FSWA 4FSFA 2Y55A 1H8YA 1I2WA 2GDNA 5FQKA 1BSGA 1ERMA 5E2GA 1KVLA 5JYPA 4KG5A 1YM1A 2FFFB 2HDRA 5U47A 4E3IA 1KGFA 4MLLA 3GTCA 1O07A 3PAGA 4KZBA 5HW3A 1S0WA 5GL9A 4BENA 1KDWA 3SS5A 4E3MA 1YLPA 4N9LA 2Y2IA 4ZBEA 5HX9A 3HREA 4KZ4A 3VFFA 5EVIB 5GLAA 1IKGA 4ZTKA 2BLSA 1Y54A 4YINA 2EFUA 3AGEA 4GDBA 1FR1A 2XD5A 3BFDA 4N9KA 4JXVA 2P9VA 4WEKA 4RX2A 3PTEA 1KDSA 5AQ7A 1SCWA 1TDLA 2Y2MA 1RGYA 1TDGA 1NJ4A 3IQAA 3OCNA 3MKFA 3Q7VA 4MNRA 4RX3A 1MWRA 4XUZA 1PW1A 3IXBA 4JF4A 4LV0A 1GCEA 5HL1A 4RVAA 2Y2OA 1PWGA 3WS0A 2QZ6A 3ZNYA 4KZAA 3TG9A 5IHVA 1KE4A 3ITAA 3UDFA 4UA9A 1E25A 4R3BA 4OH0A 1GA9A 3DWZA 2WGIA 4K0WA 1ONGA 5EUAA 2QMIA 2XGNA 2J7VA 4WELA 5I94A 1LI0A 1JWZA 1ZKJA 2WADA 4OVDA 4ZJ3A 1H8ZA 4WZ5C 1K25A 5FAPA 4M3KA 4R0QA 2WKEA 1DJAA 3VP0A 5FQIA 5FQMA 5FQJA 1MBLA 2A3UA 3PBQA 5FI2A 1XA1A 5DVAA 3IF6C 4FH2A 1K55A 4KG2A 4Q8IA 5A91A 2HDQA 3UE0A 2XDMA 1BLCA 3M6HA 1FR6A 5A93A 4HESA 3P09A 5HAPA 2Y4AA 3SS4A 3FV7A 2Y59A 3G31A 4S2NC 3BRMA 3NBLA 3ZCZA 1LHYA 1XA7A 1PW8A 1YMSA 2HP6A 4ID4A 4OONA 3A3EA 2P74A 3WRTA 4DF6A 4MBKA 4EBNA 5F83A 5KSHA 2EFXA 4E3NA 3Q82A 2FFYA 4R4RA 4O7DA 3UPOA 4KQOA 3V50A 1KE0A 4XXRA 1XGJA 3DTMA 3DW0A 1ALQA 2ZC6B 1WYCA 3S1YA 3G35A 1EI5A 2Y2LA 1C3BA 4KG6A 5KZHA 3GQZA 3IXGA 3M2KA 4DDYA 4GD8A 1IYPA 4D2OA 3HUNA 1E3UA 4FCFA 1JWPA 3MZFA 2RL3A 4IVIA 4Z9QA 1PWDA 4S2LA 3NIAA 3V5MA 1ERQA 5EOOA 2ZC3B 5F1FA 4EV4A 2XH9A 2ZJ9A 1IKIA 4DE2A 4JF6A 3IXDA 2Z2LB 4F94A 3UNWA 5CEDA 3A3DA 3TSGA 3AGFA 2A49A 1JTGA 1IEMA 3MZEA 4MBHA 3PBNA 4KZ3A 2VGJA 4NK3A 2ZQDA 3CMZA 2IWBA 1NY0A 2WGWB 3NCKA 1BULA 5J8XA 4DDSA 1BUEA 2Y2GA 1BLPA 2X71A 2OSUA 4UAAA 5E43A 1FQGA 2CC1A 2G2WA 1W5DA 3C7VA 4KENB 1AXBA 4QB8A 3IF6A 1YQSA 4L0LA 5CHJA 3CG5A 3OC2A 2ZQ9A 5AQ9A 1ONHA 5FQQA 1K4EA 4OLDA 5HAIA 3VOZA 2ZM8A 3HUOA 3PBRA 4K91A 5CTMA 4BJPA 4GDNA 1RP5A 4S2NA 1N9BA 5GLCA 3ZGAB 2OV5A 3EQVA 1ES5A 3HLEA 1W8YA 3C5AA 5CEBA 4OQGA 1E3UD 2V2FF 3UE3A 1IYSA 5EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP9 A;  1BZA A;  3UDX A;  4GD6 A;  1GHM A;  4OP5 A;  2Y2H A;  2Y91 A;  1K55 C;  3NY4 A;  4X53 A;  3W4Q A;  3AGD A;  1WYB A;  1K6R A;  5FQ9 A;  1LI9 A;  1YMX A;  4KQQ A;  2XF3 A;  1YLW A;  2IWD A;  1DY6 A;  3IT9 A;  1IYO A;  3BEC A;  4WBG A;  1W8Q A;  5DTS A;  2HDU A;  4U0T A;  2WK0 A;  1K4F A;  3OPL A;  1WE4 A;  1DJB A;  1JTD A;  3N8S A;  1ES3 A;  1PIO A;  2HPB A;  1K57 A;  3ZG7 B;  3ISG A;  3FYZ A;  3IHB A;  3PBO A;  2RCX A;  2EX2 A;  3QNB A;  5FAO A;  5GHZ A;  4B88 A;  4JXW A;  3UE1 A;  1OME A;  2Y2K A;  5JYO A;  5EE8 A;  5DF9 A;  5FAS A;  1YLY A;  1NZO A;  2WAF A;  3LY4 A;  3ZFZ A;  4FH4 A;  4BL3 A;  5FSR A;  3NDE A;  5DF8 A;  2ZC4 B;  4JKT A;  3MZD A;  1MWS A;  4P0M A;  3ZHH A;  4GKU A;  1NRF A;  3HLD A;  5GLD A;  3GVB A;  3VOY A;  1GHI A;  5BOH A;  4N1X A;  1DJC A;  1Q2P A;  3Q7Z A;  4S2M A;  5E2E A;  4EQI A;  4LEN A;  3ZDJ A;  2B5R A;  3GR2 A;  1J9M A;  2V20 A;  4MBF A;  1SHV A;  2PU2 A;  3C7U A;  1FOF A;  2ZQC A;  2ZLY A;  4WZ4 A;  5F82 A;  2XR0 A;  4NET A;  2JCH A;  4MEZ A;  5HAQ A;  3MFD A;  4DXC A;  4WEJ A;  4JXG A;  4PM6 A;  1E4D A;  1O7E A;  4S2I A;  1I2S A;  4IVK A;  5DTK A;  4E6X A;  3GV9 A;  4R1G A;  4BQM A;  3WS5 A;  1NYY A;  4R4S A;  3S22 A;  3E2L A;  2ZM2 A;  1PWC A;  4RYE A;  3LY3 A;  4OPY A;  3WS4 A;  1FCM A;  5EVI C;  5CER A;  1JVJ A;  3VP4 A;  4CJN A;  4UA6 A;  3LO7 A;  4OP8 A;  4JXS A;  4E3O A;  2ZQA A;  1BT5 A;  4ZDX A;  5E2H A;  1YT4 A;  2EXA A;  1ERO A;  4IBX A;  5FA7 A;  3SOI A;  1BTL A;  2WAE A;  4LV1 A;  4R23 A;  1JWV A;  3G2Z A;  1FCO A;  1KE3 A;  4KZ9 A;  3S4X A;  4DRT A;  1ZG6 A;  3BFG A;  2ZQ8 A;  4OQI A;  3NC8 A;  2R9X A;  3ZG0 A;  5G18 A;  1KGG A;  3VMA A;  1K57 C;  5GHY A;  1FCN A;  4X56 A;  4DE3 A;  4E3L A;  2PU4 A;  3ZVT A;  4JBF A;  1L0E A;  5EEC A;  3UN7 A;  3O3V A;  4E3K A;  3SH7 A;  1MWU A;  2G2U A;  4PPR A;  5FI6 A;  3VSL A;  4Y0U A;  1LL5 A;  1ZG4 A;  2H0Y A;  4FD8 A;  5M18 A;  2J8Y A;  1EWZ A;  4OLG A;  1N4O A;  3C4P A;  4H8R A;  4HBT A;  1K54 C;  3O88 A;  3W4P A;  4DE1 A;  2ZC5 B;  1L0D A;  2EX6 A;  3NDG A;  5CXW A;  3HLW A;  5CGW A;  1SKF A;  1PI5 A;  4JF5 A;  4JPM A;  3ZNT A;  3IH9 A;  4PM7 A;  3QNC A;  1MPL A;  3N8L A;  4PM9 A;  4Y7P A;  3G34 A;  3IXH A;  4PM8 A;  1CI8 A;  3ZG8 B;  3N4I A;  1ESU A;  1PI4 A;  1W79 A;  2R9W A;  4OOL A;  5CGS A;  3ZG5 A;  3BFF A;  1MXO A;  2X02 A;  5M19 A;  4X69 A;  1VQQ A;  4GNU A;  1IYQ A;  1I5Q A;  1ES4 A;  1RCJ A;  3FKW A;  4QHC A;  5FAQ A;  5CGX A;  3ITB A;  4OKP A;  2H0T A;  1K38 A;  3OCL A;  3E2K A;  5EVI A;  4OQ0 A;  3BM6 A;  1HZO A;  1HD8 A;  1H5X A;  3A3I A;  3Q81 A;  4WMC A;  1NYM A;  2XQZ A;  5CHU A;  4ZAM A;  4WM9 A;  2H5S A;  3MXS A;  4QJG A;  4A5R A;  2DNS A;  4EWF A;  5EVL A;  1VM1 A;  5FI7 A;  1LLB A;  4C6Y A;  3IWO A;  2JBF A;  1MKI A;  1CEF A;  2WGV A;  2IWC A;  3O87 A;  1LL9 A;  1S6R A;  3WRZ A;  2H10 A;  1G68 A;  2ZMA A;  1M40 A;  1GA0 A;  5AQB A;  3TOI A;  2XEP A;  4EUZ A;  3N7W A;  3V3S A;  1SDE A;  2EX8 A;  3HLB A;  3B3X A;  4UHU A;  4HBU A;  2UWX A;  4X55 A;  1ESI A;  4CPK A;  3M2J A;  4S2J A;  2WKH A;  4QD4 A;  3G30 A;  4U0X A;  3VFH A;  3MXR A;  1L0G A;  3IF6 B;  4S2K A;  3SH8 A;  3UPN A;  2XK1 A;  1G6A A;  3V39 A;  5L2F A;  5KSC A;  1XP4 A;  3HLC A;  5HAR A;  2DCF A;  4KZ7 A;  1MY8 A;  2XLN A;  1K54 A;  4LV2 A;  3W4O A;  3G4P A;  1YLJ A;  2C6W B;  3HLG A;  1XGI A;  5EVI D;  3CZD A;  3QHY A;  3IHA A;  4WMC D;  3LEZ A;  4Y0O A;  4QU3 A;  3A3J A;  3ZVW A;  3IF5 A;  3MBZ A;  1HTZ A;  2I72 A;  3C4O A;  4LCM A;  2WUQ A;  3PBS A;  5M1A A;  2EXB A;  4KQR A;  3FWL A;  1KGE A;  1BLS A;  1SDN A;  4OOM A;  5FAT A;  3WS1 A;  2HDS A;  2Y2J A;  5FDH A;  3RJU A;  4C3Q A;  4Y0T A;  1BLH A;  2EX9 A;  3BFE A;  3GRJ A;  4P87 A;  2Z2M B;  1KVM A;  3Q1F A;  3D4F A;  3Q07 A;  1YLT A;  3HUM A;  3VSK A;  2E8I A;  5A90 A;  4WYY A;  2WZX A;  5CEC A;  3VP3 A;  2XFS A;  3V3R A;  5F1G A;  4DE0 A;  2J9O A;  4U3T A;  1FSY A;  3IWQ A;  4BLM A;  4OQH A;  3FZC A;  4KZ8 A;  3HLF A;  3SH9 A;  3FKV A;  4GB7 A;  3UY6 A;  3UDI A;  4N1H A;  2P9V B;  2WZZ A;  4KZ6 A;  1W7F A;  1HVB A;  3HBR A;  3BYD A;  3Q7V B;  4DKI A;  1QMF A;  1XXM A;  3MKE A;  2J9P A;  4C75 A;  2WYX A;  4E6W A;  1K56 A;  1Z6F A;  2QPN A;  3G32 A;  4S2O A;  1PZP A;  4X68 A;  4GOG A;  3IWI A;  2C5W B;  5GLB A;  4K0X A;  4EBL A;  1CEG A;  1XPB A;  2OLV A;  5TFQ A;  1ZC2 A;  4PM5 A;  4DXB A;  2WGW A;  2ZQ7 A;  3BEB A;  3DWK A;  3GSG A;  2HP5 A;  3N6I A;  4LV3 A;  4ZJ1 A;  4B4Z A;  1L0F A;  1PYY A;  4RA7 A;  1XKZ A;  2Q9N A;  1TVF A;  2BG1 A;  3WWX A;  3I7J A;  5KMW A;  1ES2 A;  2X01 A;  5EPH A;  3BFC A;  5GHX A;  2Y2P A;  5A92 A;  1RGZ A;  4B4X A;  3GMW A;  1XX2 A;  2XFT A;  3P98 A;  2ZM0 A;  3PBT A;  4GN2 A;  5TGF A;  1L2S A;  2ZC7 A;  2Q9M A;  3CJM A;  3G2Y A;  4N92 A;  4OPZ A;  2Y2Q A;  4PMA A;  3SS3 A;  4OOY A;  2XD1 A;  4P6B A;  3VP1 A;  3OPP A;  4IED A;  5CTN A;  4GZB A;  2JC7 A;  3BLM A;  4IBR A;  1QME A;  2WKI A;  1Q2Q A;  1CI9 A;  5CHM A;  1YLZ A;  4YFM A;  2VGK A;  3VP2 A;  2V1Z A;  1NXY A;  1PZO A;  2DRW A;  3HVF A;  4OPR A;  4OPQ A;  3WS2 A;  1TEM A;  1K56 D;  4S2P A;  4LCL A;  5DF7 A;  1GHP A;  3BLS A;  3OPR A;  5AQA A;  4EBP A;  3OZH A;  4KZ5 A;  3IH8 A;  3W8K A;  5E2F A;  4E3J A;  3UO9 A;  3RXW A;  5D3O A;  4UA7 A;  3HL9 A;  4QY5 A;  3UPP A;  4BD0 A;  4WZ5 A;  2OLU A;  4P85 A;  3RXX A;  4R3J A;  3OPH A;  4BL2 A;  3M6B A;  4JLF A;  3PAE A;  5DTT A;  1IEL A;  2PBY A;  3O86 A;  1K6S A;  3JYI A;  4XUX A;  3N8R A;  4QY6 A;  3NI9 A;  4BD1 A;  1U60 A;  1M6K A;  2Y2N A;  3A3F A;  2ZD8 A;  1NZU A;  2JE5 A;  5TR7 A;  4X6T A;  1MWT A;  5HFO A;  4ZJ2 A;  5CRF A;  3LCE A;  3EQU A;  4HEF A;  3ZG9 B;  1CK3 A;  1FSW A;  4FSF A;  2Y55 A;  1H8Y A;  1I2W A;  2GDN A;  5FQK A;  1BSG A;  1ERM A;  5E2G A;  1KVL A;  5JYP A;  4KG5 A;  1YM1 A;  2FFF B;  2HDR A;  5U47 A;  4E3I A;  1KGF A;  4MLL A;  3GTC A;  1O07 A;  3PAG A;  4KZB A;  5HW3 A;  1S0W A;  5GL9 A;  4BEN A;  1KDW A;  3SS5 A;  4E3M A;  1YLP A;  4N9L A;  2Y2I A;  4ZBE A;  5HX9 A;  3HRE A;  4KZ4 A;  3VFF A;  5EVI B;  5GLA A;  1IKG A;  4ZTK A;  2BLS A;  1Y54 A;  4YIN A;  2EFU A;  3AGE A;  4GDB A;  1FR1 A;  2XD5 A;  3BFD A;  4N9K A;  4JXV A;  2P9V A;  4WEK A;  4RX2 A;  3PTE A;  1KDS A;  5AQ7 A;  1SCW A;  1TDL A;  2Y2M A;  1RGY A;  1TDG A;  1NJ4 A;  3IQA A;  3OCN A;  3MKF A;  3Q7V A;  4MNR A;  4RX3 A;  1MWR A;  4XUZ A;  1PW1 A;  3IXB A;  4JF4 A;  4LV0 A;  1GCE A;  5HL1 A;  4RVA A;  2Y2O A;  1PWG A;  3WS0 A;  2QZ6 A;  3ZNY A;  4KZA A;  3TG9 A;  5IHV A;  1KE4 A;  3ITA A;  3UDF A;  4UA9 A;  1E25 A;  4R3B A;  4OH0 A;  1GA9 A;  3DWZ A;  2WGI A;  4K0W A;  1ONG A;  5EUA A;  2QMI A;  2XGN A;  2J7V A;  4WEL A;  5I94 A;  1LI0 A;  1JWZ A;  1ZKJ A;  2WAD A;  4OVD A;  4ZJ3 A;  1H8Z A;  4WZ5 C;  1K25 A;  5FAP A;  4M3K A;  4R0Q A;  2WKE A;  1DJA A;  3VP0 A;  5FQI A;  5FQM A;  5FQJ A;  1MBL A;  2A3U A;  3PBQ A;  5FI2 A;  1XA1 A;  5DVA A;  3IF6 C;  4FH2 A;  1K55 A;  4KG2 A;  4Q8I A;  5A91 A;  2HDQ A;  3UE0 A;  2XDM A;  1BLC A;  3M6H A;  1FR6 A;  5A93 A;  4HES A;  3P09 A;  5HAP A;  2Y4A A;  3SS4 A;  3FV7 A;  2Y59 A;  3G31 A;  4S2N C;  3BRM A;  3NBL A;  3ZCZ A;  1LHY A;  1XA7 A;  1PW8 A;  1YMS A;  2HP6 A;  4ID4 A;  4OON A;  3A3E A;  2P74 A;  3WRT A;  4DF6 A;  4MBK A;  4EBN A;  5F83 A;  5KSH A;  2EFX A;  4E3N A;  3Q82 A;  2FFY A;  4R4R A;  4O7D A;  3UPO A;  4KQO A;  3V50 A;  1KE0 A;  4XXR A;  1XGJ A;  3DTM A;  3DW0 A;  1ALQ A;  2ZC6 B;  1WYC A;  3S1Y A;  3G35 A;  1EI5 A;  2Y2L A;  1C3B A;  4KG6 A;  5KZH A;  3GQZ A;  3IXG A;  3M2K A;  4DDY A;  4GD8 A;  1IYP A;  4D2O A;  3HUN A;  1E3U A;  4FCF A;  1JWP A;  3MZF A;  2RL3 A;  4IVI A;  4Z9Q A;  1PWD A;  4S2L A;  3NIA A;  3V5M A;  1ERQ A;  5EOO A;  2ZC3 B;  5F1F A;  4EV4 A;  2XH9 A;  2ZJ9 A;  1IKI A;  4DE2 A;  4JF6 A;  3IXD A;  2Z2L B;  4F94 A;  3UNW A;  5CED A;  3A3D A;  3TSG A;  3AGF A;  2A49 A;  1JTG A;  1IEM A;  3MZE A;  4MBH A;  3PBN A;  4KZ3 A;  2VGJ A;  4NK3 A;  2ZQD A;  3CMZ A;  2IWB A;  1NY0 A;  2WGW B;  3NCK A;  1BUL A;  5J8X A;  4DDS A;  1BUE A;  2Y2G A;  1BLP A;  2X71 A;  2OSU A;  4UAA A;  5E43 A;  1FQG A;  2CC1 A;  2G2W A;  1W5D A;  3C7V A;  4KEN B;  1AXB A;  4QB8 A;  3IF6 A;  1YQS A;  4L0L A;  5CHJ A;  3CG5 A;  3OC2 A;  2ZQ9 A;  5AQ9 A;  1ONH A;  5FQQ A;  1K4E A;  4OLD A;  5HAI A;  3VOZ A;  2ZM8 A;  3HUO A;  3PBR A;  4K91 A;  5CTM A;  4BJP A;  4GDN A;  1RP5 A;  4S2N A;  1N9B A;  5GLC A;  3ZGA B;  2OV5 A;  3EQV A;  1ES5 A;  3HLE A;  1W8Y A;  3C5A A;  5CEB A;  4OQG A;  1E3U D;  2V2F F;  3UE3 A;  1IYS A;  5EOE A; 
#chains in the Genus database with same CATH topology
 4GD6 A;  2Y2H A;  1WYB A;  5FQ9 A;  3CHW P;  3CUE A;  1YLW A;  2IWD A;  1DY6 A;  3IT9 A;  2PAV P;  4WBG A;  4NG2 A;  3VE3 A;  2HDU A;  2J3W A;  4U0T A;  3N8S A;  1PIO A;  2HPB A;  3ZG7 B;  3IHB A;  4FTX A;  1OME A;  5DF9 A;  1YLY A;  3W2Z A;  5FSR A;  2V8C A;  2R78 A;  3GDI A;  2ZMV A;  3VOY A;  1YKD A;  4N1X A;  4S2M A;  1KOU A;  2B5R A;  3GR2 A;  3EEA A;  2V20 A;  2P7J A;  2ZQC A;  2ZLY A;  4HH3 A;  1NWZ A;  4IUK A;  4PM6 A;  2OAQ 1;  4E6X A;  5HD5 A;  4R1G A;  1H8M A;  4R4S A;  3S22 A;  4HIA A;  4RYE A;  3WS4 A;  4PKY G;  1T18 A;  5EVI C;  3LI9 A;  3CUE C;  4R23 A;  1FCO A;  3S4X A;  4DRT A;  4YNR A;  1OT9 A;  4OQI A;  3NC8 A;  2AVX A;  5F6A A;  3HJI A;  4X25 A;  4HP9 A;  3ZVT A;  3O3V A;  3SH7 A;  1ZG4 A;  2H0Y A;  2J80 A;  2J8Y A;  4OLG A;  3RTY A;  2GZA A;  4HBT A;  1K54 C;  3W4P A;  3LIF A;  4GS9 B;  1L0D A;  3NDG A;  3BQA A;  4JF5 A;  3OBF A;  3N8L A;  3G34 A;  3IXH A;  4HQA A;  3N4I A;  4OOL A;  3BFF A;  1MXO A;  5M19 A;  4WF0 A;  1IYQ A;  1RCJ A;  1ES4 A;  5FAQ A;  5DKL A;  2PRF A;  4HI4 A;  3A3I A;  4WMC A;  1H3Q A;  1OTD A;  4B93 A;  4PKY A;  5FI7 A;  1T1C A;  2W3G A;  3TOI A;  5AQB A;  3K3C A;  5I5L A;  5J7E A;  4X55 A;  2UWX A;  4CPK A;  3M2J A;  5L10 A;  3IBR A;  4X1M A;  1G6A A;  3V39 A;  5KSC A;  3HLC A;  1D7E A;  2GX5 A;  2XLN A;  3R7W B;  2C6W B;  3HLG A;  1D06 A;  3JVU A;  3LEZ A;  2I72 A;  1BLS A;  3WS1 A;  4C3Q A;  1BLH A;  2Z2M B;  3K3D A;  3D4F A;  2CMN A;  1T1A A;  5AJG A;  3VSK A;  5HDC A;  2WZX A;  2XFS A;  3V3R A;  5F1G A;  4DE0 A;  1FSY A;  2V1B A;  4OQH A;  3SH9 A;  3HLF A;  1ZHH B;  1ODV A;  4N1H A;  3UDI A;  2P9V B;  3JPU A;  3BYD A;  1QMF A;  3G32 A;  3IWI A;  1NLZ A;  2WGW A;  2B02 A;  1NLY A;  3CIT A;  4ZJ1 A;  1PYY A;  1XKZ A;  3LIB A;  5DJT A;  3FC7 A;  5EM1 A;  3JVV A;  3P98 A;  3PBT A;  2L1M A;  1XJ2 A;  3CJM A;  3SS3 A;  4P6B A;  5MC7 A;  2JC7 A;  3F1N A;  2V1Z A;  2DRW A;  4OPQ A;  3LIC A;  2VZW A;  4KZ5 A;  3MQ0 A;  4E3J A;  3UO9 A;  3RXW A;  4UA7 A;  4BD0 A;  5A8B A;  1DRM A;  2OLU A;  4P85 A;  3MMH A;  3DAV A;  4JLF A;  1IEL A;  3JYI A;  4BD1 A;  1G5U A;  1U60 A;  2GNX A;  2Y2N A;  2JE5 A;  5HFO A;  4ZJ2 A;  5CRF A;  3LCE A;  3EQU A;  3KYQ A;  2VK3 A;  2NUP C;  3SZT A;  3ZG9 B;  1UWP X;  1H8Y A;  2GDN A;  4I39 A;  1BSG A;  4I3A A;  2GJ3 A;  4KG5 A;  1YM1 A;  3T12 B;  5U47 A;  3QP8 A;  4UQI S;  3SS5 A;  2Z6C A;  2M7U A;  5HX9 A;  4Y13 A;  4HY8 A;  4EER A;  4ZTK A;  2BLS A;  1Y54 A;  2Y8H A;  3AGE A;  2VGL M;  2Y79 A;  5EV0 A;  3QP4 A;  4RX2 A;  3F1O A;  3PTE A;  1KDS A;  2D02 A;  1SCW A;  4MNR A;  3MKF A;  4XUZ A;  3IXB A;  2PDR A;  2Y2O A;  3WS0 A;  5EM0 A;  2WKR A;  3H7W A;  3TG9 A;  5IHV A;  1KE4 A;  4ARZ B;  1VEU B;  4OH0 A;  3DWZ A;  2WGI A;  1ONG A;  5EUA A;  2XGN A;  3T1X A;  5I94 A;  2NUT C;  2WAD A;  2OWH A;  2WKE A;  5FQM A;  5FQJ A;  1MBL A;  2A3U A;  3B33 A;  3PBQ A;  5FI2 A;  1XA1 A;  5DVA A;  3IF6 C;  4Q8I A;  5A91 A;  5DKK A;  1BLC A;  5HAP A;  1W63 Q;  3FV7 A;  3G31 A;  1PW8 A;  4HJ3 A;  3A3E A;  4MBK A;  3T50 A;  4E3N A;  4O7D A;  3V50 A;  5IU1 A;  4XXR A;  4NXB A;  5AVE A;  1MKM A;  5DFX A;  2Y2L A;  1C3B A;  5KZH A;  3GQZ A;  3IXG A;  1E3U A;  4FCF A;  4Z9Q A;  4S2L A;  3V5M A;  3LIA A;  4R6L A;  2PD7 A;  2Z2L B;  4F94 A;  2HV1 A;  3AGF A;  1IEM A;  2HJ9 C;  5LBR A;  4KZ3 A;  2JKR I;  3UB9 A;  2ZQD A;  1P97 A;  3DTE A;  1NY0 A;  2WGW B;  5J8X A;  4UAA A;  3QP5 A;  2G2W A;  1W5D A;  3C7V A;  3PXP A;  3TW8 A;  3ULF A;  1OJ5 A;  1K4E A;  4EEP A;  2ZM8 A;  4EW7 A;  1RP5 A;  1N9B A;  5KIZ A;  4G3K A;  2UV0 E;  1W63 M;  2V2F F;  3UE3 A;  5EOE A;  1BZA A;  3UDX A;  1GHM A;  4OP5 A;  1XJ4 A;  1F2K A;  1K6R A;  3D72 A;  3MQQ A;  3L9K A;  3BEC A;  3BWL A;  1W8Q A;  4IHQ A;  5DTS A;  3IX8 A;  1K4F A;  3OPL A;  3FYZ A;  3PBO A;  3QNB A;  1JNU A;  1XJ6 A;  1UGU A;  3KSH A;  2Y2K A;  5JYO A;  3LY4 A;  1NZO A;  2WAF A;  4MCW A;  4FH4 A;  4BL3 A;  2ZC4 B;  3MZD A;  1T19 A;  4GKU A;  1NRF A;  1VHM A;  5GLD A;  1BYW A;  1GHI A;  3Q7Z A;  3PR6 A;  3C7U A;  1FOF A;  5IS1 A;  3VOL A;  3LYX A;  2XR0 A;  4NET A;  2BAS A;  4JGP A;  3MFD A;  4WEJ A;  1O7E A;  4S2I A;  1I2S A;  3GV9 A;  4M4X A;  4JGQ A;  1NYY A;  5J3W A;  2W1R A;  3QP1 A;  1WA9 A;  1FCM A;  1JVJ A;  4ETX A;  4UA6 A;  4OP8 A;  2IA2 A;  4H6J A;  4ZDX A;  5E2H A;  1YAX A;  1BTL A;  3H7W B;  1JWV A;  3G2Z A;  3A0S A;  1G28 A;  1KE3 A;  1Y28 A;  4KZ9 A;  3T4L A;  2W3F A;  2R9X A;  5G18 A;  3VMA A;  4X56 A;  4DE3 A;  4E3L A;  4CLC A;  3IS2 A;  5EEC A;  1TS6 A;  4E3K A;  1MWU A;  3VSL A;  4Y0U A;  1LL5 A;  4FD8 A;  2QYB A;  2W1T A;  3O88 A;  4D60 A;  5CGW A;  4JPM A;  3ZNT A;  1OTE A;  2VGL S;  4PM9 A;  1N9N A;  4Y7P A;  3ZG8 B;  2R9W A;  5CGS A;  1I5Q A;  3FKW A;  5CGX A;  1K38 A;  1YSQ A;  5EVI A;  3EGX C;  3UME A;  2XQZ A;  1L3L A;  2INW A;  3CPT B;  3MXS A;  3S7P A;  5EVL A;  3E4P A;  5F68 A;  1S4S A;  3IWO A;  2LB5 A;  2JBF A;  3NHQ A;  2IWC A;  3WRZ A;  1G68 A;  1YPR A;  2H10 A;  2ZMA A;  1N9L A;  1SKO A;  3N7W A;  3B3X A;  2H28 A;  1TS0 A;  3MXR A;  1L0G A;  2XK1 A;  1XP4 A;  1LSV A;  4BMW A;  4KZ7 A;  1MY8 A;  1K54 A;  1XGI A;  4WMC D;  4Y0O A;  2JN7 A;  4CLC C;  3A3J A;  4LCM A;  5M1A A;  3C30 A;  2Y2J A;  4Y0T A;  3GRJ A;  3Q07 A;  1YLT A;  2VV6 A;  5A90 A;  2J9O A;  3H82 A;  2FZ0 A;  3IWQ A;  4BLM A;  3FKV A;  4GB7 A;  4Y17 A;  1PNE A;  2OOL A;  2WZZ A;  4DKI A;  1STZ A;  3Q7V B;  3RFB A;  2WYX A;  1FIK A;  1K56 A;  1Z6F A;  2QPN A;  4X68 A;  4K0X A;  4PM5 A;  2OLV A;  5TFQ A;  1ZC2 A;  3OLO A;  4LFU A;  3GSG A;  2HP5 A;  4GW9 A;  1L0F A;  1TVF A;  2BG1 A;  5KMW A;  3E4O A;  4WL9 A;  3B42 A;  3ICY A;  2X01 A;  4B4X A;  2EA9 A;  2B18 A;  1VET B;  1L2S A;  2ZC7 A;  2Q9M A;  3VV4 A;  3DTI A;  4N92 A;  2YKF A;  3VP1 A;  4IED A;  2WKI A;  2ZL1 B;  4BWI A;  2VGK A;  3VP2 A;  1NXY A;  2Q0O A;  1PZO A;  3RH8 B;  4KUK A;  1TEM A;  4S2P A;  4LCL A;  1GHP A;  3BLS A;  3KSI A;  3OZH A;  4LRX C;  5E2F A;  3HL9 A;  4QY5 A;  3UPP A;  3MXQ A;  4WZ5 A;  1HLU P;  3LR3 A;  4HNB A;  4BL2 A;  5DTT A;  3O86 A;  3IS2 B;  3N8R A;  1VB6 A;  1M6K A;  3A3F A;  1NZU A;  3G6O A;  2W1T B;  3T4J A;  4EEU A;  4EUV A;  3TJZ C;  3CLO A;  2HDR A;  2PBD P;  4DJ3 A;  4E3I A;  1TD5 A;  3GTC A;  1O07 A;  2PYP A;  5HZH A;  1H0M A;  3KYZ A;  4E3M A;  1YLP A;  2Y2I A;  4ZBE A;  3HRE A;  5EVI B;  1IKG A;  5TJJ A;  3UE6 A;  2EFU A;  4GDB A;  1LT0 A;  4WEK A;  2A24 A;  3DTK A;  1UWN X;  1TDL A;  3OCN A;  1RGY A;  4QPR A;  1PW1 A;  4LV0 A;  1V9Z A;  5DFY A;  4RVA A;  3NEC A;  3LUQ A;  1CJF A;  2MJ6 A;  3ZNY A;  3V67 A;  4R3B A;  1EW0 A;  1GA9 A;  3T4K A;  2J7V A;  4WEL A;  4OVD A;  5IT5 A;  4WZ5 C;  5FAP A;  4M3K A;  4R0Q A;  2O99 A;  3VP0 A;  1CF0 A;  4KG2 A;  3BY9 A;  3UE0 A;  1S67 L;  4O8G A;  4HES A;  3P09 A;  3SS4 A;  3ZCZ A;  1YMS A;  4OON A;  3E98 A;  3WRT A;  5L09 A;  2EFX A;  3Q82 A;  1ACF A;  2FFY A;  3T4O A;  4R70 A;  3DTM A;  2ZC6 B;  3S1Y A;  3UB5 P;  2L0W A;  4DDY A;  5TBM A;  2HJE A;  4MMN A;  5HWW A;  4K08 A;  1JWP A;  4ETZ A;  4IVI A;  3VE4 A;  5F1F A;  4EV4 A;  2XH9 A;  2ZJ9 A;  1IKI A;  1GSW A;  3P01 A;  4HHD A;  4BBT A;  3LEQ A;  3UNW A;  3A3D A;  4MBH A;  4NK3 A;  4RQ9 A;  2HF6 A;  1BUE A;  2Y2G A;  1BLP A;  4KEN B;  3IF6 A;  4Q0I A;  1OTI A;  1YQS A;  4L0L A;  5CHJ A;  5EVE A;  5AQ9 A;  4HH2 A;  5FQQ A;  4OLD A;  3HUO A;  4GDN A;  5GLC A;  1ES5 A;  4OQG A;  1E3U D;  1IYS A;  2HP9 A;  3NY4 A;  3KX0 X;  4X53 A;  4WLA A;  2M7V A;  1YMX A;  2XF3 A;  1OTA A;  1IYO A;  3LR0 A;  2WK0 A;  1JTD A;  2V0W A;  1ES3 A;  1K57 A;  3ISG A;  3O5Y A;  2RCX A;  5FAO A;  4B88 A;  4JXW A;  2OAP 1;  5EE8 A;  5FAS A;  3B47 A;  4B9O A;  1MWS A;  4P0M A;  3HJK A;  1P0Z A;  1GSX A;  1A0K A;  5BOH A;  1Q2P A;  5E2E A;  1J9M A;  4MBF A;  5EFW A;  1SHV A;  2PU2 A;  2W3H A;  4WZ4 A;  2PD8 A;  5HPF A;  1F98 A;  4LPZ A;  5AVF A;  4DXC A;  4JXG A;  4PAU A;  4GHI A;  2J3T C;  2W0N A;  4QWO A;  4BQM A;  4F3L A;  1PWC A;  3F1P A;  3LY3 A;  4MN7 A;  2G7U A;  4II7 A;  5CER A;  3VP4 A;  4E3O A;  4JXS A;  3A0R A;  4IBX A;  3SOI A;  2KLI A;  3GEC A;  1Z09 A;  2ZQ8 A;  3ZG0 A;  2JHE A;  1K57 C;  1FCN A;  3ZQ5 A;  2PU4 A;  4JBF A;  1L0E A;  3UN7 A;  4PPR A;  5M18 A;  4EES A;  1EWZ A;  3NOU C;  3C4P A;  4H8R A;  2VV7 A;  3KYE A;  2ZC5 B;  2EX6 A;  5CXW A;  1XJ3 A;  1T1B A;  4PM7 A;  2ACG A;  4PM8 A;  1CI8 A;  3H9W A;  3IX3 A;  1W79 A;  1DP9 A;  3ZG5 A;  2X02 A;  3T1S A;  1VQQ A;  4GNU A;  3T1R A;  4QHC A;  4Q0J A;  3ITB A;  4I3I A;  5TBM B;  2EWW A;  1S4R A;  4OQ0 A;  1HZO A;  1HD8 A;  3R4K A;  2OWJ A;  1NYM A;  5F5Y A;  4ZAM A;  3F1N B;  2H5S A;  1PRQ A;  4A5R A;  4CLC D;  1LLB A;  4Y3I A;  4R38 A;  5C5K A;  4C6Y A;  1CEF A;  2WGV A;  3O87 A;  3BJN A;  1LL9 A;  1S6R A;  1GA0 A;  4GCZ A;  4EUZ A;  4I5S A;  3V3S A;  4HBU A;  2PYR A;  2WKH A;  4QD4 A;  3G30 A;  4WN5 A;  3IF6 B;  3UPN A;  2JKG A;  4PHT A;  3W4O A;  4LV2 A;  3G4P A;  5EVI D;  3QHY A;  3IHA A;  4QU3 A;  3IBJ A;  3ZVW A;  3IF5 A;  3MBZ A;  1HTZ A;  3C4O A;  2WUQ A;  2VEA A;  3PBS A;  3LR5 A;  2EXB A;  1NRJ A;  4KQR A;  4OOM A;  2LB9 A;  5FDH A;  2QKP A;  3BFE A;  4P87 A;  2E8J A;  3Q1F A;  1TF1 A;  5CEC A;  2V9A A;  1OTB A;  4U3T A;  3FZC A;  3UY6 A;  2QJ5 A;  3F1O B;  1HVB A;  3MKE A;  1XXM A;  2J9P A;  4S2O A;  3ZYT A;  2EWV A;  4EU0 A;  2C5W B;  4EBL A;  1CEG A;  4DXB A;  4GS9 A;  3N6I A;  4LV3 A;  4FOF A;  1Y4O A;  2Q9N A;  2W27 A;  3WWX A;  5EPH A;  5GHX A;  5A92 A;  4HOI A;  3GMW A;  4GHI B;  2XFT A;  1F5M A;  3G2Y A;  2Y2Q A;  4F3L B;  4L9F A;  4GZB A;  3BLM A;  3MS6 A;  5CHM A;  5F69 A;  3HVF A;  4OPR A;  3WS2 A;  1K56 D;  2M1C A;  5DF7 A;  3KO6 A;  3QP6 A;  1OPX A;  3IH8 A;  5HSQ A;  4R3A A;  3MSH A;  5D3O A;  3TRC A;  3T4S A;  3PAE A;  1LSW A;  3SW1 A;  2PBY A;  1K6S A;  4XUX A;  4QY6 A;  3NI9 A;  2K7S A;  3BQ8 A;  1IFQ A;  2ZD8 A;  3R7W A;  5TR7 A;  4X6T A;  5HD3 A;  4XT2 A;  4EXO A;  5L07 A;  3IX4 A;  5FQK A;  1P9R A;  1S66 L;  1KVL A;  5JYP A;  2FFF B;  4Y15 A;  2V1A A;  3PAG A;  4KZB A;  2VV8 A;  1S1Y A;  1D1J A;  4BEN A;  2BTF P;  3LIE A;  4LRZ E;  4HJ4 A;  1FR1 A;  2XD5 A;  4N9K A;  4JXV A;  2P9V A;  2O0Y A;  1AWI A;  4RX3 A;  1NJ4 A;  4P6Z M;  1MWR A;  4LGW A;  4JF4 A;  1GCE A;  3E4Q A;  2QZ6 A;  3BW6 A;  4KZA A;  3PYP A;  2YKH A;  3LI8 A;  3UDF A;  4E04 A;  4NEE D;  1S1Z A;  3T4T A;  3P7N A;  3UB7 A;  1LI0 A;  1ZKJ A;  1DJA A;  2PHY A;  4KUO A;  1K55 A;  2XDM A;  1FR6 A;  3A0V A;  4S2N C;  3BRM A;  1LHY A;  1XA7 A;  2HP6 A;  1X0O A;  4R4R A;  4HJ6 A;  3UPO A;  4UQI M;  4NXG A;  1KE0 A;  1XGJ A;  3DW0 A;  1ALQ A;  1K0K A;  1WYC A;  3LGO A;  5G4Y A;  3CAX A;  5HDD A;  4KG6 A;  3M2K A;  4O0P A;  4D2O A;  3CWF A;  3MZF A;  1F9I A;  3NIA A;  2ZBB A;  1ERQ A;  4HP4 A;  5EOO A;  2ZC3 B;  2W3D A;  4G3V A;  4H6J B;  1JTG A;  1G6O A;  3PBN A;  2VGJ A;  3CI6 A;  3CMZ A;  2IWB A;  3NCK A;  5HWT A;  2OSU A;  5E43 A;  4MN6 A;  3EEH A;  3OC2 A;  4CLC B;  3MF0 A;  3PBR A;  4BJP A;  4K91 A;  4NXE A;  2D01 A;  5HL6 A;  3EQV A;  3FPW A;  3HLE A;  1W8Y A;  4FUW A;  5CEB A;  3EGD C;  2XRO A;  2Y91 A;  3NJA A;  1K55 C;  2XA7 M;  4UEY A;  3W4Q A;  3AGD A;  4EQ1 A;  1LI9 A;  2O9C A;  3T4Q A;  4KQQ A;  5G4Z A;  1WE4 A;  1DJB A;  2K2N A;  3K2N A;  4LRY C;  4I3J A;  5HDS A;  4ARZ A;  1VEU A;  2EX2 A;  5GHZ A;  3UE1 A;  2J3T D;  2P04 A;  4AFI A;  1YSP A;  2FH5 A;  3ZFZ A;  3NDE A;  5DF8 A;  4JKT A;  3LR4 A;  1DP6 A;  3ZHH A;  3HLD A;  1IOU A;  3C38 A;  3GVB A;  1SKO B;  1DJC A;  4CQH A;  4XT2 B;  2HZ5 A;  3MQO A;  4EQI A;  4LEN A;  3ZDJ A;  2VJW A;  2WKP A;  2KOI A;  5F82 A;  3S7N A;  2JCH A;  4MEZ A;  2A2L A;  1MC0 A;  5HAQ A;  4JGO A;  3KSG A;  1E4D A;  4IVK A;  4DJ2 A;  5DTK A;  3WS5 A;  4IUH A;  3E2L A;  2ZM2 A;  4OPY A;  2ZOH A;  4ME4 A;  4CJN A;  3LO7 A;  1SZV A;  1BT5 A;  2ZQA A;  1XFQ A;  1YT4 A;  2HGV A;  2EXA A;  1ERO A;  5FA7 A;  1MZU A;  2WAE A;  4LV1 A;  4L9E A;  2JKF A;  3H82 B;  1ZG6 A;  3BFG A;  2VX8 A;  4L9G A;  5CX7 A;  1DP8 A;  1KGG A;  5GHY A;  2JKR M;  4O01 A;  2JKT M;  2G2U A;  5FI6 A;  1N9O A;  4Q0H A;  1N4O A;  2VLG A;  4BBU A;  4DE1 A;  1OJG A;  1LSX A;  3HLW A;  1SKF A;  1PI5 A;  3IH9 A;  3QNC A;  1MPL A;  1ESU A;  1PI4 A;  4P6Z S;  4X69 A;  3MR0 A;  4I38 A;  4OKP A;  2H0T A;  3OCL A;  3E2K A;  3BM6 A;  1H5X A;  1V9Y A;  3Q81 A;  4DN0 A;  3U4L P;  5CHU A;  4WM9 A;  3UB6 A;  4QJG A;  3BY8 A;  2DNS A;  4EWF A;  1VM1 A;  4GLQ A;  1MKI A;  2O9A A;  2PR5 A;  4MN5 A;  1M40 A;  2XEP A;  3KSF A;  1SDE A;  2EX8 A;  3HLB A;  4UHU A;  4NKP A;  5HPI A;  2V8F A;  1ESI A;  4S2J A;  2K31 A;  2W3E A;  4U0X A;  3VFH A;  3MJQ A;  4S2K A;  3SH8 A;  5L2F A;  5HAR A;  2B95 A;  2DCF A;  5DJU A;  1TS7 A;  4ESP A;  3S7Q A;  1YLJ A;  2VA0 A;  2P08 A;  3CZD A;  1GSV A;  3C2W A;  4KQD A;  4YWZ A;  4Y2F A;  3FWL A;  1KGE A;  1SDN A;  5FAT A;  2KX6 A;  3C8C A;  3TE8 A;  2HDS A;  3RJU A;  4NXF A;  2EX9 A;  2V0U A;  1KVM A;  3NOT C;  3HUM A;  3MFX A;  2QWS A;  2E8I A;  4WYY A;  3VP3 A;  1J3W A;  4KZ8 A;  2ZMF A;  2A24 B;  4KZ6 A;  1W7F A;  3HBR A;  3LFV A;  3QP2 A;  4IJG A;  4C75 A;  3OOV A;  4E6W A;  1PZP A;  4YOF A;  4GOG A;  5GLB A;  1XPB A;  5FDS A;  2ZQ7 A;  3BEB A;  3DWK A;  2XA7 S;  1XFN A;  4B4Z A;  2Z6D A;  4RA7 A;  3I7J A;  1ES2 A;  2QHK A;  2KDK A;  3BFC A;  2Y2P A;  3FG8 A;  1RGZ A;  3T1Q B;  4Z1W A;  1XX2 A;  4GN2 A;  2ZM0 A;  5TGF A;  4PMA A;  4OPZ A;  4OOY A;  2XD1 A;  3OPP A;  5CTN A;  5FEG A;  4IBR A;  1QME A;  3CPT A;  1Q2Q A;  1CI9 A;  1YLZ A;  4YFM A;  2I9V A;  4Y5F A;  4EET B;  3OPR A;  5AQA A;  4EBP A;  5K5B A;  3W8K A;  2DMW A;  2O9B A;  3D9Y A;  1TS8 A;  4MDZ A;  2JKT I;  4G3W A;  3RXX A;  4R3J A;  3NOP C;  3OPH A;  3M6B A;  3D3O A;  3NUL A;  3DBA A;  4LLO B;  4CLC E;  5J4E A;  2WKQ A;  3EOI A;  4BBV A;  1MWT A;  1OT6 A;  5FL3 A;  4HEF A;  1CK3 A;  1FSW A;  4FSF A;  2Y55 A;  1I2W A;  3FPV A;  1ERM A;  5E2G A;  1FIL A;  1KGF A;  4MLL A;  5HW3 A;  1S0W A;  5GL9 A;  1KDW A;  3L7H A;  4N9L A;  4KZ4 A;  3VFF A;  5GLA A;  3LID A;  4YIN A;  2XSS A;  3BFD A;  2L4R A;  5AQ7 A;  3Q7V A;  2Y2M A;  1TDG A;  3IQA A;  5HWV A;  2PT7 A;  1LL8 A;  1ZTU A;  5HL1 A;  1PWG A;  3ITA A;  4UA9 A;  1E25 A;  4K0W A;  2QMI A;  4DMZ A;  2VKS A;  1JWZ A;  4ZJ3 A;  1H8Z A;  4GJ4 A;  1K25 A;  5FQI A;  5FEF A;  4FH2 A;  1VET A;  2HDQ A;  3M6H A;  5A93 A;  2Y4A A;  5KSH A;  2Y59 A;  3UB8 A;  3NBL A;  3U2A A;  4ID4 A;  2P74 A;  2ZOI A;  4DF6 A;  4EBN A;  2ZL1 A;  5F83 A;  2PR6 A;  2QJ7 A;  5L8M A;  4KQO A;  4JGR A;  4WUJ A;  3G35 A;  1EI5 A;  4GD8 A;  1IYP A;  3HUN A;  4ZRR A;  3F1P B;  2RL3 A;  4X1L A;  1PWD A;  3EWK A;  4DE2 A;  1PFL A;  4JF6 A;  3IXD A;  5CED A;  3TSG A;  2A49 A;  3HCY A;  3MZE A;  3PHY A;  1BUL A;  3E0Y A;  4DDS A;  2X71 A;  3UMD A;  2XRN A;  1FQG A;  3S7O A;  2CC1 A;  4QB8 A;  1AXB A;  3CG5 A;  2ZQ9 A;  1ONH A;  3VOZ A;  5HAI A;  1CQA A;  1P9W A;  5CTM A;  4S2N A;  3ZGA B;  2OV5 A;  3C5A A; 
#chains in the Genus database with same CATH homology
 2HP9 A;  1BZA A;  3UDX A;  4GD6 A;  1GHM A;  4OP5 A;  2Y2H A;  2Y91 A;  1K55 C;  3NY4 A;  4X53 A;  3W4Q A;  3AGD A;  1WYB A;  1K6R A;  5FQ9 A;  1LI9 A;  1YMX A;  4KQQ A;  2XF3 A;  1YLW A;  2IWD A;  1DY6 A;  3IT9 A;  1IYO A;  3BEC A;  4WBG A;  1W8Q A;  5DTS A;  2HDU A;  4U0T A;  2WK0 A;  1K4F A;  3OPL A;  1WE4 A;  1DJB A;  1JTD A;  3N8S A;  1ES3 A;  1PIO A;  2HPB A;  1K57 A;  3ZG7 B;  3ISG A;  3FYZ A;  3IHB A;  3PBO A;  2RCX A;  2EX2 A;  3QNB A;  5FAO A;  5GHZ A;  4B88 A;  4JXW A;  3UE1 A;  1OME A;  2Y2K A;  5JYO A;  5EE8 A;  5DF9 A;  5FAS A;  1YLY A;  1NZO A;  2WAF A;  3LY4 A;  3ZFZ A;  4FH4 A;  4BL3 A;  5FSR A;  3NDE A;  5DF8 A;  2ZC4 B;  4JKT A;  3MZD A;  1MWS A;  4P0M A;  3ZHH A;  4GKU A;  1NRF A;  3HLD A;  5GLD A;  3GVB A;  3VOY A;  1GHI A;  5BOH A;  4N1X A;  1DJC A;  1Q2P A;  3Q7Z A;  4S2M A;  5E2E A;  4EQI A;  4LEN A;  3ZDJ A;  2B5R A;  3GR2 A;  1J9M A;  2V20 A;  4MBF A;  1SHV A;  2PU2 A;  3C7U A;  1FOF A;  2ZQC A;  2ZLY A;  4WZ4 A;  5F82 A;  2XR0 A;  4NET A;  2JCH A;  4MEZ A;  5HAQ A;  3MFD A;  4DXC A;  4WEJ A;  4JXG A;  4PM6 A;  1E4D A;  1O7E A;  4S2I A;  1I2S A;  4IVK A;  5DTK A;  4E6X A;  3GV9 A;  4R1G A;  4BQM A;  3WS5 A;  1NYY A;  4R4S A;  3S22 A;  3E2L A;  2ZM2 A;  1PWC A;  4RYE A;  3LY3 A;  4OPY A;  3WS4 A;  1FCM A;  5EVI C;  5CER A;  1JVJ A;  3VP4 A;  4CJN A;  4UA6 A;  3LO7 A;  4OP8 A;  4JXS A;  4E3O A;  2ZQA A;  1BT5 A;  4ZDX A;  5E2H A;  1YT4 A;  2EXA A;  1ERO A;  4IBX A;  5FA7 A;  3SOI A;  1BTL A;  2WAE A;  4LV1 A;  4R23 A;  1JWV A;  3G2Z A;  1FCO A;  1KE3 A;  4KZ9 A;  3S4X A;  4DRT A;  1ZG6 A;  3BFG A;  2ZQ8 A;  4OQI A;  3NC8 A;  2R9X A;  3ZG0 A;  5G18 A;  1KGG A;  3VMA A;  1K57 C;  5GHY A;  1FCN A;  4X56 A;  4DE3 A;  4E3L A;  2PU4 A;  3ZVT A;  4JBF A;  1L0E A;  5EEC A;  3UN7 A;  3O3V A;  4E3K A;  3SH7 A;  1MWU A;  2G2U A;  4PPR A;  5FI6 A;  3VSL A;  4Y0U A;  1LL5 A;  1ZG4 A;  2H0Y A;  4FD8 A;  5M18 A;  2J8Y A;  1EWZ A;  4OLG A;  1N4O A;  3C4P A;  4H8R A;  4HBT A;  1K54 C;  3O88 A;  3W4P A;  4DE1 A;  2ZC5 B;  1L0D A;  2EX6 A;  3NDG A;  5CXW A;  3HLW A;  5CGW A;  1SKF A;  1PI5 A;  4JF5 A;  4JPM A;  3ZNT A;  3IH9 A;  4PM7 A;  3QNC A;  1MPL A;  3N8L A;  4PM9 A;  4Y7P A;  3G34 A;  3IXH A;  4PM8 A;  1CI8 A;  3ZG8 B;  3N4I A;  1ESU A;  1PI4 A;  1W79 A;  2R9W A;  4OOL A;  5CGS A;  3ZG5 A;  3BFF A;  1MXO A;  2X02 A;  5M19 A;  4X69 A;  1VQQ A;  4GNU A;  1IYQ A;  1I5Q A;  1ES4 A;  1RCJ A;  3FKW A;  4QHC A;  5FAQ A;  5CGX A;  3ITB A;  4OKP A;  2H0T A;  1K38 A;  3OCL A;  3E2K A;  5EVI A;  4OQ0 A;  3BM6 A;  1HZO A;  1HD8 A;  1H5X A;  3A3I A;  3Q81 A;  4WMC A;  1NYM A;  2XQZ A;  5CHU A;  4ZAM A;  4WM9 A;  2H5S A;  3MXS A;  4QJG A;  4A5R A;  2DNS A;  4EWF A;  5EVL A;  1VM1 A;  5FI7 A;  1LLB A;  4C6Y A;  3IWO A;  2JBF A;  1MKI A;  1CEF A;  2WGV A;  2IWC A;  3O87 A;  1LL9 A;  1S6R A;  3WRZ A;  2H10 A;  1G68 A;  2ZMA A;  1M40 A;  1GA0 A;  5AQB A;  3TOI A;  2XEP A;  4EUZ A;  3N7W A;  3V3S A;  1SDE A;  2EX8 A;  3HLB A;  3B3X A;  4UHU A;  4HBU A;  2UWX A;  4X55 A;  1ESI A;  4CPK A;  3M2J A;  4S2J A;  2WKH A;  4QD4 A;  3G30 A;  4U0X A;  3VFH A;  3MXR A;  1L0G A;  3IF6 B;  4S2K A;  3SH8 A;  3UPN A;  2XK1 A;  1G6A A;  3V39 A;  5L2F A;  5KSC A;  1XP4 A;  3HLC A;  5HAR A;  2DCF A;  4KZ7 A;  1MY8 A;  2XLN A;  1K54 A;  4LV2 A;  3W4O A;  3G4P A;  1YLJ A;  2C6W B;  3HLG A;  1XGI A;  5EVI D;  3CZD A;  3QHY A;  3IHA A;  4WMC D;  3LEZ A;  4Y0O A;  4QU3 A;  3A3J A;  3ZVW A;  3IF5 A;  3MBZ A;  1HTZ A;  2I72 A;  3C4O A;  4LCM A;  2WUQ A;  3PBS A;  5M1A A;  2EXB A;  4KQR A;  3FWL A;  1KGE A;  1BLS A;  1SDN A;  4OOM A;  5FAT A;  3WS1 A;  2HDS A;  2Y2J A;  5FDH A;  3RJU A;  4C3Q A;  4Y0T A;  1BLH A;  2EX9 A;  3BFE A;  3GRJ A;  4P87 A;  2Z2M B;  1KVM A;  3Q1F A;  3D4F A;  3Q07 A;  1YLT A;  3HUM A;  3VSK A;  2E8I A;  5A90 A;  4WYY A;  2WZX A;  5CEC A;  3VP3 A;  2XFS A;  3V3R A;  5F1G A;  4DE0 A;  2J9O A;  4U3T A;  1FSY A;  3IWQ A;  4BLM A;  4OQH A;  3FZC A;  4KZ8 A;  3HLF A;  3SH9 A;  3FKV A;  4GB7 A;  3UY6 A;  3UDI A;  4N1H A;  2P9V B;  2WZZ A;  4KZ6 A;  1W7F A;  1HVB A;  3HBR A;  3BYD A;  3Q7V B;  4DKI A;  1QMF A;  1XXM A;  3MKE A;  2J9P A;  4C75 A;  2WYX A;  4E6W A;  1K56 A;  1Z6F A;  2QPN A;  3G32 A;  4S2O A;  1PZP A;  4X68 A;  4GOG A;  3IWI A;  2C5W B;  5GLB A;  4K0X A;  4EBL A;  1CEG A;  1XPB A;  2OLV A;  5TFQ A;  1ZC2 A;  4PM5 A;  4DXB A;  2WGW A;  2ZQ7 A;  3BEB A;  3DWK A;  3GSG A;  2HP5 A;  3N6I A;  4LV3 A;  4ZJ1 A;  4B4Z A;  1L0F A;  1PYY A;  4RA7 A;  1XKZ A;  2Q9N A;  1TVF A;  2BG1 A;  3WWX A;  3I7J A;  5KMW A;  1ES2 A;  2X01 A;  5EPH A;  3BFC A;  5GHX A;  2Y2P A;  5A92 A;  1RGZ A;  4B4X A;  3GMW A;  1XX2 A;  2XFT A;  3P98 A;  2ZM0 A;  3PBT A;  4GN2 A;  5TGF A;  1L2S A;  2ZC7 A;  2Q9M A;  3CJM A;  3G2Y A;  4N92 A;  4OPZ A;  2Y2Q A;  4PMA A;  3SS3 A;  4OOY A;  2XD1 A;  4P6B A;  3VP1 A;  3OPP A;  4IED A;  5CTN A;  4GZB A;  2JC7 A;  3BLM A;  4IBR A;  1QME A;  2WKI A;  1Q2Q A;  1CI9 A;  5CHM A;  1YLZ A;  4YFM A;  2VGK A;  3VP2 A;  2V1Z A;  1NXY A;  1PZO A;  2DRW A;  3HVF A;  4OPR A;  4OPQ A;  3WS2 A;  1TEM A;  1K56 D;  4S2P A;  4LCL A;  5DF7 A;  1GHP A;  3BLS A;  3OPR A;  5AQA A;  4EBP A;  3OZH A;  4KZ5 A;  3IH8 A;  3W8K A;  5E2F A;  4E3J A;  3UO9 A;  3RXW A;  5D3O A;  4UA7 A;  3HL9 A;  4QY5 A;  3UPP A;  4BD0 A;  4WZ5 A;  2OLU A;  4P85 A;  3RXX A;  4R3J A;  3OPH A;  4BL2 A;  3M6B A;  4JLF A;  3PAE A;  5DTT A;  1IEL A;  2PBY A;  3O86 A;  1K6S A;  3JYI A;  4XUX A;  3N8R A;  4QY6 A;  3NI9 A;  4BD1 A;  1U60 A;  1M6K A;  2Y2N A;  3A3F A;  2ZD8 A;  1NZU A;  2JE5 A;  5TR7 A;  4X6T A;  1MWT A;  5HFO A;  4ZJ2 A;  5CRF A;  3LCE A;  3EQU A;  4HEF A;  3ZG9 B;  1CK3 A;  1FSW A;  4FSF A;  2Y55 A;  1H8Y A;  1I2W A;  2GDN A;  5FQK A;  1BSG A;  1ERM A;  5E2G A;  1KVL A;  5JYP A;  4KG5 A;  1YM1 A;  2FFF B;  2HDR A;  5U47 A;  4E3I A;  1KGF A;  4MLL A;  3GTC A;  1O07 A;  3PAG A;  4KZB A;  5HW3 A;  1S0W A;  5GL9 A;  4BEN A;  1KDW A;  3SS5 A;  4E3M A;  1YLP A;  4N9L A;  2Y2I A;  4ZBE A;  5HX9 A;  3HRE A;  4KZ4 A;  3VFF A;  5EVI B;  5GLA A;  1IKG A;  4ZTK A;  2BLS A;  1Y54 A;  4YIN A;  2EFU A;  3AGE A;  4GDB A;  1FR1 A;  2XD5 A;  3BFD A;  4N9K A;  4JXV A;  2P9V A;  4WEK A;  4RX2 A;  3PTE A;  1KDS A;  5AQ7 A;  1SCW A;  1TDL A;  2Y2M A;  1RGY A;  1TDG A;  1NJ4 A;  3IQA A;  3OCN A;  3MKF A;  3Q7V A;  4MNR A;  4RX3 A;  1MWR A;  4XUZ A;  1PW1 A;  3IXB A;  4JF4 A;  4LV0 A;  1GCE A;  5HL1 A;  4RVA A;  2Y2O A;  1PWG A;  3WS0 A;  2QZ6 A;  3ZNY A;  4KZA A;  3TG9 A;  5IHV A;  1KE4 A;  3ITA A;  3UDF A;  4UA9 A;  1E25 A;  4R3B A;  4OH0 A;  1GA9 A;  3DWZ A;  2WGI A;  4K0W A;  1ONG A;  5EUA A;  2QMI A;  2XGN A;  2J7V A;  4WEL A;  5I94 A;  1LI0 A;  1JWZ A;  1ZKJ A;  2WAD A;  4OVD A;  4ZJ3 A;  1H8Z A;  4WZ5 C;  1K25 A;  5FAP A;  4M3K A;  4R0Q A;  2WKE A;  1DJA A;  3VP0 A;  5FQI A;  5FQM A;  5FQJ A;  1MBL A;  2A3U A;  3PBQ A;  5FI2 A;  1XA1 A;  5DVA A;  3IF6 C;  4FH2 A;  1K55 A;  4KG2 A;  4Q8I A;  5A91 A;  2HDQ A;  3UE0 A;  2XDM A;  1BLC A;  3M6H A;  1FR6 A;  5A93 A;  4HES A;  3P09 A;  5HAP A;  2Y4A A;  3SS4 A;  3FV7 A;  2Y59 A;  3G31 A;  4S2N C;  3BRM A;  3NBL A;  3ZCZ A;  1LHY A;  1XA7 A;  1PW8 A;  1YMS A;  2HP6 A;  4ID4 A;  4OON A;  3A3E A;  2P74 A;  3WRT A;  4DF6 A;  4MBK A;  4EBN A;  5F83 A;  5KSH A;  2EFX A;  4E3N A;  3Q82 A;  2FFY A;  4R4R A;  4O7D A;  3UPO A;  4KQO A;  3V50 A;  1KE0 A;  4XXR A;  1XGJ A;  3DTM A;  3DW0 A;  1ALQ A;  2ZC6 B;  1WYC A;  3S1Y A;  3G35 A;  1EI5 A;  2Y2L A;  1C3B A;  4KG6 A;  5KZH A;  3GQZ A;  3IXG A;  3M2K A;  4DDY A;  4GD8 A;  1IYP A;  4D2O A;  3HUN A;  1E3U A;  4FCF A;  1JWP A;  3MZF A;  2RL3 A;  4IVI A;  4Z9Q A;  1PWD A;  4S2L A;  3NIA A;  3V5M A;  1ERQ A;  5EOO A;  2ZC3 B;  5F1F A;  4EV4 A;  2XH9 A;  2ZJ9 A;  1IKI A;  4DE2 A;  4JF6 A;  3IXD A;  2Z2L B;  4F94 A;  3UNW A;  5CED A;  3A3D A;  3TSG A;  3AGF A;  2A49 A;  1JTG A;  1IEM A;  3MZE A;  4MBH A;  3PBN A;  4KZ3 A;  2VGJ A;  4NK3 A;  2ZQD A;  3CMZ A;  2IWB A;  1NY0 A;  2WGW B;  3NCK A;  1BUL A;  5J8X A;  4DDS A;  1BUE A;  2Y2G A;  1BLP A;  2X71 A;  2OSU A;  4UAA A;  5E43 A;  1FQG A;  2CC1 A;  2G2W A;  1W5D A;  3C7V A;  4KEN B;  1AXB A;  4QB8 A;  3IF6 A;  1YQS A;  4L0L A;  5CHJ A;  3CG5 A;  3OC2 A;  2ZQ9 A;  5AQ9 A;  1ONH A;  5FQQ A;  1K4E A;  4OLD A;  5HAI A;  3VOZ A;  2ZM8 A;  3HUO A;  3PBR A;  4K91 A;  5CTM A;  4BJP A;  4GDN A;  1RP5 A;  4S2N A;  1N9B A;  5GLC A;  3ZGA B;  2OV5 A;  3EQV A;  1ES5 A;  3HLE A;  1W8Y A;  3C5A A;  5CEB A;  4OQG A;  1E3U D;  2V2F F;  3UE3 A;  1IYS A;  5EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...