3OPHA

Esbl r164s mutant of shv-1 beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDSWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ophA00
4UA7A 3OPRA 4KZ7A 4S2OA 5HARA 2G2UA 3UE1A 5FASA 3ISGA 1FR6A 5EVLA 4BD0A 1W8YA 1GA9A 4Y0OA 1PZPA 1XGJA 4P6BA 4FH4A 4GZBA 2OLVA 3OZHA 3NBLA 3VOZA 5CHMA 3WRZA 5HFOA 3ZG0A 3OCNA 3ZDJA 2OSUA 2WGWB 3BRMA 1HTZA 4ZJ1A 4U3TA 1DJAA 1LI9A 3C5AA 3MZEA 3Q07A 1KE0A 1VM1A 1K4FA 2JC7A 3Q81A 4FH2A 4WZ5A 5EUAA 2HP9A 3VP0A 5CGXA 3HBRA 2HDQA 3M2JA 3Q7VB 2C5WB 2HPBA 3WRTA 3IXGA 4KG5A 4KG6A 4D2OA 4BJPA 3G32A 2B5RA 4OLDA 3NY4A 1E25A 2GDNA 5FAOA 5EVIC 2ZLYA 1FSYA 3TG9A 3A3FA 3NIAA 3C7UA 3LO7A 2WGWA 4OQHA 4R3JA 4S2NC 3ZNYA 1K54C 3DWZA 5DF7A 2WGIA 1H5XA 3HUNA 1WE4A 2Y2GA 1ES2A 4N9LA 3IQAA 4B88A 4DDYA 1O07A 4PM8A 1JWVA 1FOFA 2Z2LB 1YMSA 1L0GA 4B4ZA 2J7VA 1PYYA 4OP8A 3G30A 3ZNTA 1XXMA 2XQZA 3V3RA 4DE3A 1XA1A 5KMWA 3LY4A 1HVBA 4KZ3A 3UY6A 5GLBA 1PI4A 3WS1A 4OQIA 2XD1A 1XPBA 5FSRA 1W8QA 4RYEA 1VQQA 1ONHA 3VFFA 2E8IA 3BLSA 5FQIA 4M3KA 4R3BA 3SOIA 3UDIA 1MWRA 3OCLA 4XXRA 5IHVA 5M18A 3FYZA 3DWKA 4RX2A 3C4OA 5CRFA 3WS2A 5A92A 5FQ9A 4UAAA 5FI7A 1TVFA 5FI2A 5CECA 2ZM2A 1ZG6A 3GR2A 1JVJA 2Y2HA 4OKPA 1MXOA 2EFXA 1K55C 1S6RA 3NC8A 4X55A 1NZUA 1PWGA 1GCEA 4DE0A 3IWOA 2J8YA 3OPHA 1W7FA 3PBSA 3VP4A 2J9OA 1U60A 2RCXA 3BEBA 4O7DA 3FV7A 4YINA 3ZG9B 3N8RA 3HLBA 2XH9A 4NK3A 3SS5A 1ES3A 1E3UD 2PU2A 1Z6FA 3IHAA 4DE1A 1IYSA 2QPNA 2Y91A 3N6IA 3FWLA 1H8YA 4KZAA 2EX9A 3W4QA 5AQ7A 3W8KA 2A49A 4WEJA 4UHUA 4FD8A 5E2GA 4X56A 3AGFA 2XFTA 2X01A 5E2EA 3ZHHA 5CGWA 2ZC4B 5KSHA 1L2SA 5EOEA 3VP3A 1RGZA 3HREA 4PM7A 2ZQ8A 5FQJA 3I7JA 5FI6A 4DE2A 1RGYA 4R1GA 5DTTA 5TGFA 1AXBA 3A3IA 2DCFA 3O88A 3OPPA 1ALQA 1FSWA 1SDEA 4LENA 3C4PA 5CEBA 1N9BA 3LEZA 4JXSA 3VFHA 1SHVA 1K57A 5FA7A 1EI5A 1ERMA 4ZJ2A 4JKTA 4CJNA 1SDNA 4S2PA 4HBUA 3IH9A 2Q9MA 4DXCA 2JBFA 3HLEA 3QHYA 3D4FA 1K6RA 1TEMA 3HVFA 5E2FA 4C75A 5HW3A 3OC2A 4OPRA 5CERA 5EPHA 2FFYA 5HAPA 1BTLA 4JLFA 1DJCA 2WUQA 3PBOA 3TSGA 1TDLA 2XFSA 1BT5A 3BFCA 2FFFB 3V39A 1BUEA 3WS0A 3GVBA 4HBTA 3EQVA 4U0XA 3BM6A 4KG2A 4E3KA 4BL2A 4N9KA 4E6XA 4DDSA 4XUXA 3IXDA 3PTEA 3ZGAB 3CG5A 4EBLA 4HEFA 4R23A 2I72A 2H10A 4OPYA 5KZHA 4DXBA 1IYOA 3VP1A 4JPMA 2OV5A 5F1FA 4E3IA 1H8ZA 2UWXA 1EWZA 5FAQA 4S2LA 5L2FA 2XD5A 4YFMA 5EVID 1ONGA 1PW8A 1K54A 1K4EA 2X71A 5DTSA 3Q7ZA 2V2FF 3B3XA 3IT9A 2QMIA 2P9VB 2PBYA 3AGEA 3C7VA 3UPOA 3HLWA 1LLBA 5KSCA 1JWPA 4S2KA 4H8RA 1MY8A 3QNCA 1CEFA 4P87A 5DVAA 2WKHA 1NRFA 3S22A 3IXHA 1ERQA 4E6WA 1IKIA 1PZOA 3W4OA 1YMXA 1ZG4A 4PMAA 4OH0A 2RL3A 5F1GA 4KZ9A 5E43A 3Q7VA 5GHXA 4R4RA 2Q9NA 3RXWA 3ZG7B 5JYPA 2ZQ9A 3G2YA 4WELA 3BFFA 4PM6A 4Y0UA 1ZKJA 3BLMA 5FQMA 1I2WA 1KGFA 1PWDA 2XK1A 4MLLA 5EE8A 1XKZA 5U47A 3VSKA 2H0YA 4OQGA 2V1ZA 1HD8A 1TDGA 4WZ5C 2ZQDA 2WGVA 3N7WA 4GOGA 1YLJA 3ZG5A 5EOOA 4GN2A 3SS4A 3M6HA 4ID4A 2EX6A 4JXGA 4OPZA 5CHUA 5FATA 2EX8A 1I5QA 1BLPA 3HLDA 1QMFA 4KQRA 1GA0A 3UN7A 4R0QA 3HUMA 2Y2PA 4X53A 3GSGA 4E3MA 3IF6B 5DF8A 3PBTA 1ES4A 2Y55A 5GHZA 5GHYA 2Y59A 1XA7A 2WYXA 5HAIA 2OLUA 2WZXA 2XGNA 3MKFA 4LCLA 2DNSA 1K56D 4K0WA 4X68A 1XGIA 2ZQAA 5GLAA 3ITAA 4E3LA 1E3UA 3BECA 5FQKA 3RJUA 1M40A 1KE3A 4CPKA 4IVIA 1J9MA 4WZ4A 5M19A 2WKEA 4Y7PA 4EUZA 5CXWA 2HP6A 1NY0A 3G35A 3IXBA 4WMCD 3IF6A 2H0TA 3S4XA 5F82A 2VGKA 3WS4A 1Q2QA 4OOMA 4WBGA 3O3VA 3O87A 1FCOA 1JTDA 1KDSA 5E2HA 1PIOA 2Y4AA 4EV4A 4QJGA 4R4SA 5G18A 1OMEA 2ZJ9A 1IEMA 4BENA 3BFEA 1LL9A 4EBNA 3SH9A 4OP5A 1GHMA 2VGJA 2IWDA 2Y2NA 4JXVA 4C6YA 5I94A 2R9WA 4QY5A 4ZBEA 1BLCA 1MKIA 2HDRA 3FZCA 4MBKA 3BFGA 1K6SA 2ZC5B 1G68A 3LCEA 1WYBA 3HUOA 3JYIA 3G2ZA 1EROA 1NZOA 3V3SA 2WKIA 2A3UA 1ESIA 1LL5A 5A91A 3V50A 4KENB 4LV3A 3GRJA 5AQ9A 2P74A 4OONA 3M2KA 4LCMA 3DTMA 1BLHA 3N8SA 1KVLA 4P0MA 3VP2A 4PM9A 1YLPA 4XUZA 4IBXA 5GLCA 2C6WB 4IVKA 4UA6A 3SH7A 4RA7A 4UA9A 2XDMA 1HZOA 3MXRA 3E2LA 3HLFA 3O86A 4L0LA 1O7EA 4MBHA 5HL1A 4DF6A 1L0EA 3A3EA 4K0XA 1CEGA 5EVIB 5J8XA 2Y2KA 4WEKA 3ITBA 1ES5A 3GTCA 5CTMA 1FCMA 2DRWA 1L0FA 1KGEA 4KZ6A 4E3OA 3UDFA 3ZG8B 4BLMA 1FQGA 2H5SA 3PBRA 5AQAA 3NI9A 2ZM0A 1RCJA 2BG1A 2EX2A 4BQMA 1IKGA 1K57C 1DY6A 2ZC6B 4WM9A 3UE3A 3MZFA 3ZCZA 1SKFA 3IHBA 4MNRA 4JF6A 2IWBA 4DKIA 1WYCA 1QMEA 2ZM8A 1PWCA 1YT4A 3CJMA 4IBRA 1M6KA 5EVIA 3P98A 4LV1A 4DRTA 4S2NA 1CK3A 1KE4A 2X02A 2Y2JA 2BLSA 5CHJA 4QY6A 2HP5A 4GDBA 1Y54A 4KQQA 4NETA 3UPPA 3G34A 2ZQ7A 4OVDA 3TOIA 1KGGA 1PI5A 3EQUA 4U0TA 1KVMA 4E3NA 1Q2PA 3CZDA 3IWQA 2HDSA 5GL9A 1W5DA 1BLSA 3VMAA 2WAEA 1YQSA 2IWCA 3HLCA 1SCWA 4PM5A 1G6AA 4C3QA 1DJBA 4JF5A 5DF9A 1NYYA 2QZ6A 4S2MA 3QNBA 1BSGA 1MPLA 2P9VA 1K38A 3FKVA 1MBLA 4JXWA 4S2IA 5EECA 5DTKA 1K55A 4LV0A 1FR1A 3NCKA 2WAFA 3PAEA 2EXAA 3PBQA 4GD6A 4RVAA 2XF3A 1N4OA 4KZBA 2ZD8A 4N92A 2R9XA 4ZDXA 5AQBA 4A5RA 3A3JA 1S0WA 1K25A 2G2WA 4JF4A 4K91A 1LI0A 3NDGA 1GHPA 2ZC7A 3CMZA 3IH8A 5FQQA 3UPNA 4GNUA 1K56A 5TFQA 2WADA 3WS5A 2V20A 4X69A 2Z2MB 2Y2IA 4GB7A 1ZC2A 1YLZA 3SS3A 3IWIA 3FKWA 2PU4A 1NYMA 4FCFA 2EFUA 4N1XA 3GQZA 5A93A 3NDEA 4WMCA 1NXYA 1I2SA 4KZ5A 5CTNA 4KQOA 3S1YA 1BZAA 4BD1A 3MFDA 2WZZA 2Y2MA 1FCNA 2Y2LA 4E3JA 4EQIA 1XX2A 3Q82A 4FSFA 4RX3A 4S2JA 4HESA 2EXBA 3AGDA 3OPLA 3VSLA 1KDWA 1NJ4A 5FDHA 4X6TA 1BULA 2ZMAA 1MWUA 3G4PA 3HL9A 4IEDA 3IF5A 1XP4A 4QHCA 4ZAMA 4QD4A 3UO9A 3ZVTA 4EWFA 3PBNA 3G31A 3PAGA 1CI9A 4GDNA 1IYPA 3A3DA 3N8LA 4GKUA 4KZ8A 3UNWA 4BL3A 5A90A 5CEDA 5HAQA 1YLWA 1C3BA 3GV9A 5CGSA 4OQ0A 2XR0A 5M1AA 4LV2A 2WK0A 3BYDA 4N1HA 1IYQA 4QU3A 4Y0TA 3V5MA 5GLDA 1LHYA 1L0DA 3MXSA 2Y2OA 4PPRA 3UDXA 4B4XA 3DW0A 4WYYA 3P09A 1MWSA 4OPQA 4OOYA 3VOYA 3ZFZA 3ZVWA 4Z9QA 3E2KA 3IF6C 5HX9A 4JBFA 2HDUA 3SH8A 3WWXA 3BFDA 4F94A 1RP5A 2XLNA 3RXXA 1W79A 2JCHA 5F83A 1GHIA 3MKEA 1PW1A 4Q8IA 3GMWA 1JTGA 1E4DA 1MWTA 1JWZA 4OLGA 2CC1A 2Y2QA 1YLTA 4OOLA 4ZTKA 4P85A 1IELA 4QB8A 1CI8A 2ZC3B 1YM1A 3UE0A 3N4IA 5TR7A 2J9PA 3MZDA 3W4PA 3HLGA 3MBZA 5FAPA 4GD8A 2XEPA 3Q1FA 5JYOA 1YLYA 4EBPA 5BOHA 4KZ4A 3M6BA 2ZQCA 4MBFA 2JE5A 5D3OA 4MEZA 3LY3A 1ESUA 4ZJ3A
chains in the Genus database with same CATH superfamily
1N9NA 4GHIA 4S2OA 4CLCB 4NXBA 5FASA 1FR6A 2QJ5A 1GA9A 3K3DA 1PZPA 4FH4A 3NBLA 5CHMA 3MR0A 2WGWB 4F3LB 4U3TA 3MZEA 3Q07A 3VP0A 3Q81A 5G4YA 3M2JA 3WRTA 2W1TA 4BJPA 2HZ5A 2B5RA 3G32A 4OLDA 3NY4A 1E25A 1D7EA 3P7NA 3TG9A 4BWIA 4HH2A 4OQHA 1MC0A 5DF7A 3HUNA 4BBTA 1ES2A 1H8MA 3LR5A 3MJQA 3CPTA 2VEAA 3ZNTA 2XQZA 1XA1A 1HVBA 2Q0OA 1PI4A 5FDSA 3WS1A 3KSFA 1XPBA 4YOFA 2A24A 4HOIA 3VFFA 2E8IA 3UB5P 3OCLA 5IHVA 1L3LA 1OJ5A 5FI2A 2ZM2A 1MXOA 2EFXA 1K55C 1P0ZA 1S6RA 3NC8A 1PWGA 3OPHA 3VP4A 2QJ7A 4JGPA 2XROA 3ZG9B 3N8RA 4L9EA 1S1YA 4NK3A 3SS5A 1S4SA 2PU2A 1Z6FA 3IHAA 1IYSA 2QPNA 5DKKA 1IOUA 3W8KA 2A49A 4WEJA 2L1MA 4FD8A 2XFTA 3E4QA 5E2EA 4CLCE 5KSHA 5F69A 3VP3A 4PM7A 5C5KA 2ZQ8A 3EEHA 5FQJA 3I7JA 5FI6A 1RGYA 2JKRI 4NXFA 4R1GA 3IX8A 3S7OA 1Y4OA 2VK3A 4LENA 2HV1A 3MMHA 4NKPA 5CEBA 1K57A 3LIFA 4JKTA 1SDNA 4H6JB 3MFXA 2Q9MA 4DXCA 3HLEA 3LIAA 3HVFA 2WKRA 3H7WB 5E2FA 3D9YA 3TSGA 3BWLA 3BFCA 3BQ8A 1BUEA 3GVBA 4HBTA 3PXPA 2QYBA 3CG5A 2I72A 4DXBA 1IYOA 1F9IA 5F1FA 1EWZA 5J7EA 2X71A 3Q7ZA 4G3VA 3B47A 1H3QA 3C7VA 2J3TC 1TD5A 3QNCA 5DVAA 2WKHA 3S22A 3KO6A 5CX7A 5F1GA 2RL3A 3BY8A 3RXWA 3R7WA 1YAXA 5K5BA 4WELA 1ZKJA 1I2WA 1YPRA 1XKZA 4RQ9A 5U47A 2H0YA 4WZ5C 2ZQDA 3EOIA 3ZG5A 5EOOA 4GN2A 5EM0A 3SS4A 3M6HA 4ID4A 2E8JA 2W3DA 4PAUA 2LB9A 4O01A 1GSXA 3LR4A 3UN7A 4R0QA 2Y2PA 3NOUC 4LCLA 3KYQA 5HWTA 2ZQAA 1E3UA 3RJUA 4CPKA 1OPXA 4Y7PA 4HQAA 5CXWA 2K31A 4WMCD 3S4XA 2JKRM 3WS4A 1Q2QA 4HJ6A 4WBGA 5FEGA 3O87A 1JTDA 1KDSA 1PIOA 2Y4AA 4R4SA 4HY8A 4BENA 4D60A 4EBNA 2VGJA 2IWDA 4C6YA 2R9WA 1SKOB 3F1PA 2ZC5B 2W3EA 1NZOA 2PDRA 5HDDA 1LL5A 5EVEA 2P74A 5HL6A 3M2KA 2XSSA 3DTMA 1KVLA 3VP2A 4PM9A 4XUZA 2C6WB 5EFWA 1D06A 4RA7A 3MXRA 3O86A 3E2LA 3HLFA 4DF6A 1SZVA 4R38A 3A3EA 5IS1A 4GS9B 1XJ6A 1YKDA 2Y2KA 1KGEA 3ZG8B 2H5SA 5J3WA 3NI9A 3RH8B 3UE3A 1DY6A 3IHBA 3OOVA 4DKIA 1WYCA 3T12B 1PWCA 4IBRA 3IX4A 5EVIA 1TF1A 4S2NA 1KE4A 4L9GA 5TBMA 4GDBA 5IU1A 3UPPA 4R70A 3G34A 4OVDA 1PI5A 3EQUA 1OTEA 5GL9A 2VJWA 1YQSA 4PM5A 2ZL1A 1HLUP 1NYYA 4S2MA 3IS2A 3QNBA 2M7UA 2AVXA 5EECA 2VGLM 4MDZA 1FIKA 2WAFA 2A24B 4GD6A 4KZBA 2ZD8A 4EETB 2R9XA 5AQBA 2G2WA 4JF4A 2O9AA 2HJ9C 1MKMA 5TFQA 2WADA 3NJAA 2Z2MB 2Y2IA 4BBVA 1YLZA 4LRZE 4HH3A 1T19A 3GQZA 5A93A 3NDEA 2W3FA 4KZ5A 1OTBA 4BD1A 2PR5A 2Y2MA 4Y15A 3VE4A 4LRYC 4S2JA 4HESA 1KDWA 3E4PA 1NJ4A 5FDHA 4X6TA 1MWUA 5L07A 4GDNA 4KZ8A 1IYPA 3A3DA 3N8LA 5A90A 1YLWA 3DTEA 2HJEA 3T1RA 5M1AA 4LV2A 2WK0A 4Y0TA 1IYQA 4QU3A 3VV4A 1L0DA 2Y2OA 2XA7S 4OOYA 4O8GA 3MQ0A 1UGUA 5HX9A 4JBFA 4YWZA 5F83A 3MKEA 1JWZA 1YLTA 2ZC3B 3TRCA 3HLGA 3K2NA 2XEPA 2GZAA 5JYOA 4KZ4A 2KX6A 3M6BA 4MBFA 1N9OA 3LY3A 4UAAA 2PBDP 4UA7A 3OPRA 5HARA 4NXGA 4UEYA 1VB6A 4BD0A 1XGJA 4P6BA 3MSHA 3CHWP 3OZHA 3ZDJA 2XRNA 1KE0A 5EUAA 2C5WB 2HPBA 3R7WB 3IXGA 4KG5A 2GNXA 2ZLYA 4UQIS 5F5YA 4R3AA 1DRMA 3B42A 2O99A 4KUKA 3MS6A 4B88A 4Y13A 1LL8A 4DDYA 4PM8A 5HD3A 3EWKA 1STZA 1L0GA 4B4ZA 4OP8A 3UB9A 1D1JA 1XXMA 3LY4A 1GSWA 3UY6A 2XD1A 2PT7A 5FSRA 1W8QA 4ARZA 1VQQA 1ONHA 3UDIA 4XXRA 3DWKA 4RX2A 3WS2A 5A92A 4Q0IA 2A2LA 5FQ9A 1G6OA 1TVFA 5HD5A 1T1BA 5CECA 1JVJA 3MQOA 3IWOA 1LSWA 1W7FA 3PBSA 4GW9A 4LLOB 2RCXA 3HLBA 2XH9A 3LEQA 3N6IA 2M7VA 4CQHA 1H8YA 3W4QA 4UHUA 3H82A 3AGFA 1TS7A 2X01A 3ZHHA 5CGWA 2ZC4B 1L2SA 2LB5A 3GECA 4LPZA 3RTYA 5DTTA 5TGFA 1AXBA 3A3IA 2DCFA 3O88A 3NHQA 1G28A 4JXSA 3VFHA 1EI5A 1ERMA 1K0KA 4S2PA 2VV7A 3F1NB 1NLYA 3D4FA 1K6RA 1TEMA 5CERA 2B02A 2V1AA 3CWFA 3KSIA 2ZMVA 1DJCA 2EWWA 1BT5A 2FFFB 5AJGA 3WS0A 4ETZA 4KG2A 2J80A 4HP4A 4BL2A 2O9CA 3O5YA 4EBLA 4HEFA 3LI8A 4R23A 3EGDC 2H10A 5KZHA 4E3IA 3S7QA 1H8ZA 2UWXA 2ZL1B 5FAQA 4S2LA 1PW8A 2V2FF 4K08A 3B3XA 2OWJA 4EESA 2V0UA 1XFQA 3AGEA 2ZBBA 1OTDA 5KSCA 1MY8A 4P87A 3IXHA 1NWZA 1IKIA 1PZOA 5E43A 3MQQA 3Q7VA 5JYPA 4R4RA 5EV0A 5F68A 3HCYA 4Y0UA 5FQMA 1PWDA 4DMZA 3CITA 4OQGA 2L4RA 2WGVA 3BY9A 2HF6A 5IT5A 4I38A 2EX8A 3CUEA 1V9YA 1GA0A 3HUMA 4G3KA 4X53A 4E3MA 1AWIA 2ZMFA 2Y55A 3BQAA 5GHZA 5GHYA 2Y59A 2WYXA 3E4OA 3ICYA 2WZXA 1K56D 4K0WA 4E3LA 5J4EA 4X1LA 1M40A 1J9MA 4EUZA 1N9LA 3IXBA 3IF6A 2H0TA 2VGKA 3FPVA 2ZJ9A 5I5LA 4DJ3A 3LR0A 3SZTA 1LL9A 1GHMA 4I3IA 4JXVA 5L10A 4HJ3A 4QY5A 2O0YA 3KSHA 4ZBEA 4Y3IA 2V8CA 4MBKA 3QP1A 3BFGA 2PHYA 3HUOA 3V3SA 3NOTC 1ESIA 3V50A 3C8CA 4KENB 3U2AA 3GRJA 2PD7A 5AQ9A 4OONA 4LCMA 1BLHA 1YLPA 4L9FA 4IBXA 4UA6A 4IVKA 1HZOA 5HL1A 1P97A 2P04A 4K0XA 1CEGA 5J8XA 1ACFA 3ITBA 3GTCA 5CTMA 1FCMA 2CMNA 2ZM0A 1RCJA 2BG1A 3QP8A 4Y17A 3ZCZA 4MNRA 2PR6A 1M6KA 3LFVA 4MN5A 4IUKA 2X02A 4NETA 2ZQ7A 1KGGA 4U0TA 3IWQA 3IX3A 1XFNA 4JGRA 3JVUA 1W5DA 1BLSA 3TW8A 4JF5A 1KOUA 1BSGA 1MPLA 2JKTI 1NRJA 2P9VA 3FKVA 4JXWA 3D3OA 2B18A 4CLCC 5HWVA 1K55A 4LV0A 4ARZB 1S1ZA 2EXAA 2FH5A 2KLIA 4I3AA 4RVAA 2XF3A 3EGXC 1S0WA 1TS0A 3S7NA 3UB8A 2K2NA 1GHPA 2GX5A 3T1SA 3IH8A 5FQQA 5TJJA 5DFXA 2M1CA 3SS3A 2PU4A 3BJNA 4FCFA 4WMCA 1I2SA 1FCNA 4E3JA 1XX2A 2OWHA 2K7SA 4JGQA 3VSLA 4KQDA 4MN6A 3RXXA 4ZAMA 3ZVTA 3IF5A 3PAGA 1CI9A 1C3BA 3GV9A 2YKFA 3LICA 3BYDA 4N1HA 2OAQ1 3MXSA 3UDXA 4B4XA 3DW0A 1GSVA 3VOYA 1MWSA 3ULFA 4Z9QA 3BFDA 3KX0X 2XLNA 3T4TA 1OTIA 1GHIA 3T1QB 3GMWA 4I39A 4EU0A 5HSQA 2CC1A 2Y2QA 4ZTKA 1CI8A 1YM1A 4GHIB 3N4IA 3P01A 1FILA 3MBZA 4GD8A 1OJGA 1YLYA 4EBPA 2JKFA 4GCZA 1F2KA 1VEUA 1ESUA 4II7A 4KZ7A 5EVLA 1W8YA 2YKHA 2W1TB 3LI9A 1VETA 2OLVA 3WRZA 4XT2A 2JKTM 3OCNA 4HHDA 3BRMA 2DMWA 2W27A 1LI9A 3C5AA 3A0VA 4WZ5A 4ZRRA 2HP9A 4ME4A 3HBRA 2HDQA 3Q7VB 4CLCD 5G4ZA 4D2OA 1UWNX 3CPTB 5FAOA 1FSYA 3A3FA 3NIAA 1X0OA 2WGWA 4R3JA 3ZNYA 3IBJA 1K54C 4PKYA 4QWOA 1F5MA 2JKGA 2WGIA 1H5XA 4F3LA 2Y2GA 2D01A 3IQAA 2OAP1 4HP9A 1YMSA 3PHYA 1PYYA 2Z6CA 3G30A 2P7JA 3V3RA 4DE3A 1ODVA 5EM1A 2VV6A 5GLBA 4OQIA 4M3KA 4R3BA 1MWRA 3FYZA 5FI7A 1ZG6A 1Z09A 4OKPA 3S7PA 1W63Q 2QWSA 4WL9A 5A8BA 1GCEA 3CLOA 1XJ2A 3BEBA 4O7DA 3FV7A 2R78A 1ES3A 2EA9A 4IJGA 3FWLA 4KZAA 4X56A 1PNEA 2B95A 3HREA 2QKPA 5FEFA 4X25A 2HGVA 5HZHA 2ACGA 3HJIA 5DJUA 1N9BA 3LEZA 3QP5A 1G5UA 2KDKA 4ZJ2A 3LUQA 3IH9A 4DN0A 2JBFA 4C75A 5HW3A 3OC2A 4OPRA 5EPHA 1BTLA 4JLFA 2WUQA 3PBOA 1TDLA 1P9WA 3V39A 5DJTA 3EQVA 4H6JA 3BM6A 3IBRA 4N9KA 3T4QA 4E6XA 4XUXA 4FUWA 3C30A 4OPYA 4X1MA 3VP1A 4JPMA 2WKQA 2EWVA 5L2FA 2XD5A 1ONGA 1K54A 1K4EA 4EEUA 3IT9A 4EQ1A 1S67L 2PBYA 2P9VB 3QP2A 3HLWA 1OTAA 1LSXA 4S2KA 1CEFA 1CF0A 2D02A 4OH0A 3T1XA 1P9RA 1DP9A 3E98A 2Q9NA 3ZG7B 2XK1A 5EE8A 5F6AA 5HPFA 2MJ6A 3VSKA 5HDSA 2V1ZA 3OLOA 4GOGA 5L8MA 2EX6A 4WLAA 5FATA 1I5QA 3HLDA 1QMFA 4KQRA 3GSGA 5DF8A 3PBTA 4M4XA 4Z1WA 1XA7A 3R4KA 2OLUA 3PYPA 4X68A 5FQKA 5HDCA 1KE3A 4WZ4A 2WKEA 2HP6A 2XA7M 3F1PB 4OOMA 2ZOHA 1FCOA 5E2HA 2PYPA 4QJGA 1OMEA 3C38A 5LBRA 1IEMA 1VHMA 3BFEA 1IFQA 4OP5A 2Y2NA 4E04A 5I94A 3FZCA 4R6LA 1K6SA 1G68A 3LCEA 1OT9A 3JYIA 1EROA 2WKIA 2A3UA 3ZQ5A 3N8SA 1SKOA 3NOPC 1VEUB 5EVIB 4P6ZM 1ES5A 5TBMB 4FOFA 4EXOA 4WN5A 4KZ6A 4Y5FA 2V1BA 1Y28A 3UDFA 3FC7A 4BLMA 3PBRA 5AQAA 2EX2A 1IKGA 1K57C 3MZFA 1UWPX 1SKFA 4JF6A 4IHQA 1YT4A 3CJMA 4LV1A 1CK3A 2Y2JA 3IS2B 1DP6A 5CHJA 4QY6A 2HP5A 1Y54A 4KQQA 4UQIM 4Q0JA 1V9ZA 3E0YA 4E3NA 2G7UA 1YSQA 3UMDA 3VMAA 2WAEA 2IWCA 1SCWA 3QP4A 4GJ4A 1G6AA 4ETXA 2QZ6A 3DAVA 4S2IA 5DKLA 1OT6A 5DTKA 4MN7A 3PBQA 1YSPA 4ZDXA 2WKPA 3A3JA 1LI0A 3T4SA 2W3GA 3KSGA 3JPUA 4GNUA 1K56A 3WS5A 1LT0A 3IWIA 3FKWA 4IUHA 1NYMA 2EFUA 4N1XA 2VZWA 3H9WA 5CTNA 3S1YA 2V0WA 2Y2LA 3UE6A 2I9VA 2Z6DA 3LIEA 2PYRA 2EXBA 3AGDA 3LGOA 3OPLA 2ZMAA 4IEDA 4QHCA 3HL9A 3UO9A 4BMWA 3G31A 5HAQA 4BL3A 2NUTC 5CEDA 3T4OA 4OQ0A 3V5MA 3FPWA 1LHYA 3V67A 4PPRA 4WYYA 4KUOA 4OPQA 3ZFZA 1T18A 3E2KA 2HDUA 3C2WA 3WWXA 1RP5A 3F1OA 1PRQA 1PW1A 3LIBA 4Q8IA 2H28A 4OOLA 3K3CA 4QB8A 1NLZA 4JGOA 3UE0A 5TR7A 2Y8HA 2J9PA 2FZ0A 5FAPA 5BOHA 3T4KA 2QHKA 3B33A 5D3OA 4MEZA 2VKSA 2G2UA 3UE1A 3ISGA 3KYZA 4Y0OA 4WUJA 4GZBA 3VOZA 2V9AA 5HFOA 3ZG0A 2OOLA 3VOLA 2OSUA 4LGWA 1HTZA 3CI6A 4ZJ1A 5AVEA 1DJAA 2JC7A 1VM1A 1K4FA 3A0SA 4FH2A 5CGXA 4NG2A 4KG6A 2BASA 2VV8A 2GDNA 5EVIC 4NXEA 3C7UA 3LO7A 3QP6A 4S2NC 3DWZA 1WE4A 3PR6A 4N9LA 4HNBA 1O07A 1JWVA 1FOFA 2Z2LB 2J7VA 4EEPA 2VLGA 5KMWA 4KZ3A 2JN7A 4RYEA 3T4LA 2VGLS 3TJZC 3BLSA 5FQIA 5M18A 3SOIA 1WA9A 1J3WA 5MC7A 3C4OA 5CRFA 3DBAA 1CQAA 3GR2A 2Y2HA 1ZTUA 4X55A 4WF0A 1NZUA 4DE0A 3H82B 3DTKA 2J8YA 4I3JA 2J9OA 1U60A 3CAXA 2VX8A 1TS6A 4YINA 3BW6A 1E3UD 3W2ZA 4DE1A 2Y91A 2EX9A 5AQ7A 5E2GA 5EOEA 3LR3A 1RGZA 4Y2FA 3LIDA 4DE2A 2W3HA 5KIZA 3OPPA 3RFBA 1ALQA 1FSWA 1SDEA 3C4PA 1JNUA 2Y79A 1SHVA 5FA7A 4CJNA 4HBUA 1ZHHB 1EW0A 3QHYA 1T1AA 2FFYA 5HAPA 3FG8A 2INWA 2XFSA 1LSVA 2J3WA 4U0XA 3MXQA 4E3KA 3F1NA 4DDSA 3IXDA 3PTEA 3ZGAB 2VA0A 5HPIA 3HJKA 3NECA 2OV5A 2L0WA 3D72A 4BBUA 4CLCA 2J3TD 4YFMA 5EVID 5HWWA 5DTSA 4HIAA 2QMIA 3UPOA 1LLBA 1JWPA 4H8RA 1CJFA 1A0KA 1NRFA 1ERQA 4E6WA 3W4OA 1YMXA 1ZG4A 4PMAA 1H0MA 4KZ9A 5GHXA 2ZQ9A 3G2YA 3BFFA 4PM6A 3BLMA 2GJ3A 1KGFA 4MLLA 2PAVP 1HD8A 1TDGA 2NUPC 2KOIA 3N7WA 1YLJA 1BYWA 3EEAA 1F98A 4JXGA 4OPZA 5CHUA 1BLPA 3IF6B 3T50A 1ES4A 2W0NA 2UV0E 5HAIA 2XGNA 3MKFA 5L09A 2DNSA 4QPRA 5GLAA 3U4LP 1XGIA 3ITAA 3BECA 4IVIA 5M19A 4LRXC 1NY0A 3G35A 5F82A 3O3VA 3GDIA 4EV4A 4MCWA 5G18A 4PKYG 3SH9A 1XJ3A 3NULA 1BLCA 1MKIA 2HDRA 3F1OB 3ZYTA 1DP8A 3TE8A 2PD8A 1WYBA 3MF0A 3G2ZA 5A91A 2O9BA 4LV3A 5FL3A 4P0MA 5GLCA 1MZUA 4UA9A 2XDMA 4AFIA 4L0LA 1O7EA 4MBHA 1L0EA 4EERA 4WEKA 2DRWA 1L0FA 4E3OA 3H7WA 1FQGA 4GLQA 4BQMA 2ZC6B 4WM9A 2IWBA 1QMEA 2ZM8A 4NEED 3P98A 4DRTA 3UB6A 1PFLA 2BLSA 4EW7A 3LYXA 4P6ZS 3TOIA 1KVMA 3T4JA 1Q2PA 3CZDA 2HDSA 3HLCA 4C3QA 3L7HA 1DJBA 5DF9A 2JHEA 1K38A 1MBLA 1T1CA 2IA2A 4LFUA 3PAEA 1FR1A 3JVVA 3NCKA 1N4OA 4N92A 3L9KA 4HJ4A 4A5RA 1K25A 4K91A 3UMEA 3NDGA 2ZC7A 3CMZA 3UPNA 4DJ2A 4EUVA 3OBFA 2V20A 4X69A 2V8FA 4GB7A 4PHTA 1ZC2A 1NXYA 4B93A 4KQOA 1BZAA 1S4RA 3MFDA 2WZZA 4EQIA 3Q82A 4FSFA 4RX3A 3CUEC 1BULA 3G4PA 4EWFA 1XP4A 4QD4A 3PBNA 1S66L 4O0PA 4GKUA 3UNWA 2W1RA 5CGSA 2XR0A 1W63M 5AVFA 5GLDA 3P09A 3ZVWA 4B9OA 4I5SA 2BTFP 3IF6C 3SH8A 4F94A 1W79A 2JCHA 3G6OA 4HI4A 4YNRA 3SW1A 1JTGA 1E4DA 1MWTA 3VE3A 4OLGA 3DTIA 4ESPA 1XJ4A 4P85A 1IELA 5DFYA 4G3WA 3MZDA 2P08A 3W4PA 1TS8A 2ZOIA 3UB7A 1VETB 3Q1FA 4XT2B 2ZQCA 3KYEA 4Q0HA 4FTXA 4MMNA 2JE5A 3A0RA 4GS9A 2PRFA 3SH7A 4ZJ3A
chains in the Genus database with same CATH topology
4UA7A 3OPRA 4KZ7A 4S2OA 5HARA 2G2UA 3UE1A 5FASA 3ISGA 1FR6A 5EVLA 4BD0A 1W8YA 1GA9A 4Y0OA 1PZPA 1XGJA 4P6BA 4FH4A 4GZBA 2OLVA 3OZHA 3NBLA 3VOZA 5CHMA 3WRZA 5HFOA 3ZG0A 3OCNA 3ZDJA 2OSUA 2WGWB 3BRMA 1HTZA 4ZJ1A 4U3TA 1DJAA 1LI9A 3C5AA 3MZEA 3Q07A 1KE0A 1VM1A 1K4FA 2JC7A 3Q81A 4FH2A 4WZ5A 5EUAA 2HP9A 3VP0A 5CGXA 3HBRA 2HDQA 3M2JA 3Q7VB 2C5WB 2HPBA 3WRTA 3IXGA 4KG5A 4KG6A 4D2OA 4BJPA 3G32A 2B5RA 4OLDA 3NY4A 1E25A 2GDNA 5FAOA 5EVIC 2ZLYA 1FSYA 3TG9A 3A3FA 3NIAA 3C7UA 3LO7A 2WGWA 4OQHA 4R3JA 4S2NC 3ZNYA 1K54C 3DWZA 5DF7A 2WGIA 1H5XA 3HUNA 1WE4A 2Y2GA 1ES2A 4N9LA 3IQAA 4B88A 4DDYA 1O07A 4PM8A 1JWVA 1FOFA 2Z2LB 1YMSA 1L0GA 4B4ZA 2J7VA 1PYYA 4OP8A 3G30A 3ZNTA 1XXMA 2XQZA 3V3RA 4DE3A 1XA1A 5KMWA 3LY4A 1HVBA 4KZ3A 3UY6A 5GLBA 1PI4A 3WS1A 4OQIA 2XD1A 1XPBA 5FSRA 1W8QA 4RYEA 1VQQA 1ONHA 3VFFA 2E8IA 3BLSA 5FQIA 4M3KA 4R3BA 3SOIA 3UDIA 1MWRA 3OCLA 4XXRA 5IHVA 5M18A 3FYZA 3DWKA 4RX2A 3C4OA 5CRFA 3WS2A 5A92A 5FQ9A 4UAAA 5FI7A 1TVFA 5FI2A 5CECA 2ZM2A 1ZG6A 3GR2A 1JVJA 2Y2HA 4OKPA 1MXOA 2EFXA 1K55C 1S6RA 3NC8A 4X55A 1NZUA 1PWGA 1GCEA 4DE0A 3IWOA 2J8YA 3OPHA 1W7FA 3PBSA 3VP4A 2J9OA 1U60A 2RCXA 3BEBA 4O7DA 3FV7A 4YINA 3ZG9B 3N8RA 3HLBA 2XH9A 4NK3A 3SS5A 1ES3A 1E3UD 2PU2A 1Z6FA 3IHAA 4DE1A 1IYSA 2QPNA 2Y91A 3N6IA 3FWLA 1H8YA 4KZAA 2EX9A 3W4QA 5AQ7A 3W8KA 2A49A 4WEJA 4UHUA 4FD8A 5E2GA 4X56A 3AGFA 2XFTA 2X01A 5E2EA 3ZHHA 5CGWA 2ZC4B 5KSHA 1L2SA 5EOEA 3VP3A 1RGZA 3HREA 4PM7A 2ZQ8A 5FQJA 3I7JA 5FI6A 4DE2A 1RGYA 4R1GA 5DTTA 5TGFA 1AXBA 3A3IA 2DCFA 3O88A 3OPPA 1ALQA 1FSWA 1SDEA 4LENA 3C4PA 5CEBA 1N9BA 3LEZA 4JXSA 3VFHA 1SHVA 1K57A 5FA7A 1EI5A 1ERMA 4ZJ2A 4JKTA 4CJNA 1SDNA 4S2PA 4HBUA 3IH9A 2Q9MA 4DXCA 2JBFA 3HLEA 3QHYA 3D4FA 1K6RA 1TEMA 3HVFA 5E2FA 4C75A 5HW3A 3OC2A 4OPRA 5CERA 5EPHA 2FFYA 5HAPA 1BTLA 4JLFA 1DJCA 2WUQA 3PBOA 3TSGA 1TDLA 2XFSA 1BT5A 3BFCA 2FFFB 3V39A 1BUEA 3WS0A 3GVBA 4HBTA 3EQVA 4U0XA 3BM6A 4KG2A 4E3KA 4BL2A 4N9KA 4E6XA 4DDSA 4XUXA 3IXDA 3PTEA 3ZGAB 3CG5A 4EBLA 4HEFA 4R23A 2I72A 2H10A 4OPYA 5KZHA 4DXBA 1IYOA 3VP1A 4JPMA 2OV5A 5F1FA 4E3IA 1H8ZA 2UWXA 1EWZA 5FAQA 4S2LA 5L2FA 2XD5A 4YFMA 5EVID 1ONGA 1PW8A 1K54A 1K4EA 2X71A 5DTSA 3Q7ZA 2V2FF 3B3XA 3IT9A 2QMIA 2P9VB 2PBYA 3AGEA 3C7VA 3UPOA 3HLWA 1LLBA 5KSCA 1JWPA 4S2KA 4H8RA 1MY8A 3QNCA 1CEFA 4P87A 5DVAA 2WKHA 1NRFA 3S22A 3IXHA 1ERQA 4E6WA 1IKIA 1PZOA 3W4OA 1YMXA 1ZG4A 4PMAA 4OH0A 2RL3A 5F1GA 4KZ9A 5E43A 3Q7VA 5GHXA 4R4RA 2Q9NA 3RXWA 3ZG7B 5JYPA 2ZQ9A 3G2YA 4WELA 3BFFA 4PM6A 4Y0UA 1ZKJA 3BLMA 5FQMA 1I2WA 1KGFA 1PWDA 2XK1A 4MLLA 5EE8A 1XKZA 5U47A 3VSKA 2H0YA 4OQGA 2V1ZA 1HD8A 1TDGA 4WZ5C 2ZQDA 2WGVA 3N7WA 4GOGA 1YLJA 3ZG5A 5EOOA 4GN2A 3SS4A 3M6HA 4ID4A 2EX6A 4JXGA 4OPZA 5CHUA 5FATA 2EX8A 1I5QA 1BLPA 3HLDA 1QMFA 4KQRA 1GA0A 3UN7A 4R0QA 3HUMA 2Y2PA 4X53A 3GSGA 4E3MA 3IF6B 5DF8A 3PBTA 1ES4A 2Y55A 5GHZA 5GHYA 2Y59A 1XA7A 2WYXA 5HAIA 2OLUA 2WZXA 2XGNA 3MKFA 4LCLA 2DNSA 1K56D 4K0WA 4X68A 1XGIA 2ZQAA 5GLAA 3ITAA 4E3LA 1E3UA 3BECA 5FQKA 3RJUA 1M40A 1KE3A 4CPKA 4IVIA 1J9MA 4WZ4A 5M19A 2WKEA 4Y7PA 4EUZA 5CXWA 2HP6A 1NY0A 3G35A 3IXBA 4WMCD 3IF6A 2H0TA 3S4XA 5F82A 2VGKA 3WS4A 1Q2QA 4OOMA 4WBGA 3O3VA 3O87A 1FCOA 1JTDA 1KDSA 5E2HA 1PIOA 2Y4AA 4EV4A 4QJGA 4R4SA 5G18A 1OMEA 2ZJ9A 1IEMA 4BENA 3BFEA 1LL9A 4EBNA 3SH9A 4OP5A 1GHMA 2VGJA 2IWDA 2Y2NA 4JXVA 4C6YA 5I94A 2R9WA 4QY5A 4ZBEA 1BLCA 1MKIA 2HDRA 3FZCA 4MBKA 3BFGA 1K6SA 2ZC5B 1G68A 3LCEA 1WYBA 3HUOA 3JYIA 3G2ZA 1EROA 1NZOA 3V3SA 2WKIA 2A3UA 1ESIA 1LL5A 5A91A 3V50A 4KENB 4LV3A 3GRJA 5AQ9A 2P74A 4OONA 3M2KA 4LCMA 3DTMA 1BLHA 3N8SA 1KVLA 4P0MA 3VP2A 4PM9A 1YLPA 4XUZA 4IBXA 5GLCA 2C6WB 4IVKA 4UA6A 3SH7A 4RA7A 4UA9A 2XDMA 1HZOA 3MXRA 3E2LA 3HLFA 3O86A 4L0LA 1O7EA 4MBHA 5HL1A 4DF6A 1L0EA 3A3EA 4K0XA 1CEGA 5EVIB 5J8XA 2Y2KA 4WEKA 3ITBA 1ES5A 3GTCA 5CTMA 1FCMA 2DRWA 1L0FA 1KGEA 4KZ6A 4E3OA 3UDFA 3ZG8B 4BLMA 1FQGA 2H5SA 3PBRA 5AQAA 3NI9A 2ZM0A 1RCJA 2BG1A 2EX2A 4BQMA 1IKGA 1K57C 1DY6A 2ZC6B 4WM9A 3UE3A 3MZFA 3ZCZA 1SKFA 3IHBA 4MNRA 4JF6A 2IWBA 4DKIA 1WYCA 1QMEA 2ZM8A 1PWCA 1YT4A 3CJMA 4IBRA 1M6KA 5EVIA 3P98A 4LV1A 4DRTA 4S2NA 1CK3A 1KE4A 2X02A 2Y2JA 2BLSA 5CHJA 4QY6A 2HP5A 4GDBA 1Y54A 4KQQA 4NETA 3UPPA 3G34A 2ZQ7A 4OVDA 3TOIA 1KGGA 1PI5A 3EQUA 4U0TA 1KVMA 4E3NA 1Q2PA 3CZDA 3IWQA 2HDSA 5GL9A 1W5DA 1BLSA 3VMAA 2WAEA 1YQSA 2IWCA 3HLCA 1SCWA 4PM5A 1G6AA 4C3QA 1DJBA 4JF5A 5DF9A 1NYYA 2QZ6A 4S2MA 3QNBA 1BSGA 1MPLA 2P9VA 1K38A 3FKVA 1MBLA 4JXWA 4S2IA 5EECA 5DTKA 1K55A 4LV0A 1FR1A 3NCKA 2WAFA 3PAEA 2EXAA 3PBQA 4GD6A 4RVAA 2XF3A 1N4OA 4KZBA 2ZD8A 4N92A 2R9XA 4ZDXA 5AQBA 4A5RA 3A3JA 1S0WA 1K25A 2G2WA 4JF4A 4K91A 1LI0A 3NDGA 1GHPA 2ZC7A 3CMZA 3IH8A 5FQQA 3UPNA 4GNUA 1K56A 5TFQA 2WADA 3WS5A 2V20A 4X69A 2Z2MB 2Y2IA 4GB7A 1ZC2A 1YLZA 3SS3A 3IWIA 3FKWA 2PU4A 1NYMA 4FCFA 2EFUA 4N1XA 3GQZA 5A93A 3NDEA 4WMCA 1NXYA 1I2SA 4KZ5A 5CTNA 4KQOA 3S1YA 1BZAA 4BD1A 3MFDA 2WZZA 2Y2MA 1FCNA 2Y2LA 4E3JA 4EQIA 1XX2A 3Q82A 4FSFA 4RX3A 4S2JA 4HESA 2EXBA 3AGDA 3OPLA 3VSLA 1KDWA 1NJ4A 5FDHA 4X6TA 1BULA 2ZMAA 1MWUA 3G4PA 3HL9A 4IEDA 3IF5A 1XP4A 4QHCA 4ZAMA 4QD4A 3UO9A 3ZVTA 4EWFA 3PBNA 3G31A 3PAGA 1CI9A 4GDNA 1IYPA 3A3DA 3N8LA 4GKUA 4KZ8A 3UNWA 4BL3A 5A90A 5CEDA 5HAQA 1YLWA 1C3BA 3GV9A 5CGSA 4OQ0A 2XR0A 5M1AA 4LV2A 2WK0A 3BYDA 4N1HA 1IYQA 4QU3A 4Y0TA 3V5MA 5GLDA 1LHYA 1L0DA 3MXSA 2Y2OA 4PPRA 3UDXA 4B4XA 3DW0A 4WYYA 3P09A 1MWSA 4OPQA 4OOYA 3VOYA 3ZFZA 3ZVWA 4Z9QA 3E2KA 3IF6C 5HX9A 4JBFA 2HDUA 3SH8A 3WWXA 3BFDA 4F94A 1RP5A 2XLNA 3RXXA 1W79A 2JCHA 5F83A 1GHIA 3MKEA 1PW1A 4Q8IA 3GMWA 1JTGA 1E4DA 1MWTA 1JWZA 4OLGA 2CC1A 2Y2QA 1YLTA 4OOLA 4ZTKA 4P85A 1IELA 4QB8A 1CI8A 2ZC3B 1YM1A 3UE0A 3N4IA 5TR7A 2J9PA 3MZDA 3W4PA 3HLGA 3MBZA 5FAPA 4GD8A 2XEPA 3Q1FA 5JYOA 1YLYA 4EBPA 5BOHA 4KZ4A 3M6BA 2ZQCA 4MBFA 2JE5A 5D3OA 4MEZA 3LY3A 1ESUA 4ZJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UA7 A;  3OPR A;  4KZ7 A;  4S2O A;  5HAR A;  2G2U A;  3UE1 A;  5FAS A;  3ISG A;  1FR6 A;  5EVL A;  4BD0 A;  1W8Y A;  1GA9 A;  4Y0O A;  1PZP A;  1XGJ A;  4P6B A;  4FH4 A;  4GZB A;  2OLV A;  3OZH A;  3NBL A;  3VOZ A;  5CHM A;  3WRZ A;  5HFO A;  3ZG0 A;  3OCN A;  3ZDJ A;  2OSU A;  2WGW B;  3BRM A;  1HTZ A;  4ZJ1 A;  4U3T A;  1DJA A;  1LI9 A;  3C5A A;  3MZE A;  3Q07 A;  1KE0 A;  1VM1 A;  1K4F A;  2JC7 A;  3Q81 A;  4FH2 A;  4WZ5 A;  5EUA A;  2HP9 A;  3VP0 A;  5CGX A;  3HBR A;  2HDQ A;  3M2J A;  3Q7V B;  2C5W B;  2HPB A;  3WRT A;  3IXG A;  4KG5 A;  4KG6 A;  4D2O A;  4BJP A;  3G32 A;  2B5R A;  4OLD A;  3NY4 A;  1E25 A;  2GDN A;  5FAO A;  5EVI C;  2ZLY A;  1FSY A;  3TG9 A;  3A3F A;  3NIA A;  3C7U A;  3LO7 A;  2WGW A;  4OQH A;  4R3J A;  4S2N C;  3ZNY A;  1K54 C;  3DWZ A;  5DF7 A;  2WGI A;  1H5X A;  3HUN A;  1WE4 A;  2Y2G A;  1ES2 A;  4N9L A;  3IQA A;  4B88 A;  4DDY A;  1O07 A;  4PM8 A;  1JWV A;  1FOF A;  2Z2L B;  1YMS A;  1L0G A;  4B4Z A;  2J7V A;  1PYY A;  4OP8 A;  3G30 A;  3ZNT A;  1XXM A;  2XQZ A;  3V3R A;  4DE3 A;  1XA1 A;  5KMW A;  3LY4 A;  1HVB A;  4KZ3 A;  3UY6 A;  5GLB A;  1PI4 A;  3WS1 A;  4OQI A;  2XD1 A;  1XPB A;  5FSR A;  1W8Q A;  4RYE A;  1VQQ A;  1ONH A;  3VFF A;  2E8I A;  3BLS A;  5FQI A;  4M3K A;  4R3B A;  3SOI A;  3UDI A;  1MWR A;  3OCL A;  4XXR A;  5IHV A;  5M18 A;  3FYZ A;  3DWK A;  4RX2 A;  3C4O A;  5CRF A;  3WS2 A;  5A92 A;  5FQ9 A;  4UAA A;  5FI7 A;  1TVF A;  5FI2 A;  5CEC A;  2ZM2 A;  1ZG6 A;  3GR2 A;  1JVJ A;  2Y2H A;  4OKP A;  1MXO A;  2EFX A;  1K55 C;  1S6R A;  3NC8 A;  4X55 A;  1NZU A;  1PWG A;  1GCE A;  4DE0 A;  3IWO A;  2J8Y A;  3OPH A;  1W7F A;  3PBS A;  3VP4 A;  2J9O A;  1U60 A;  2RCX A;  3BEB A;  4O7D A;  3FV7 A;  4YIN A;  3ZG9 B;  3N8R A;  3HLB A;  2XH9 A;  4NK3 A;  3SS5 A;  1ES3 A;  1E3U D;  2PU2 A;  1Z6F A;  3IHA A;  4DE1 A;  1IYS A;  2QPN A;  2Y91 A;  3N6I A;  3FWL A;  1H8Y A;  4KZA A;  2EX9 A;  3W4Q A;  5AQ7 A;  3W8K A;  2A49 A;  4WEJ A;  4UHU A;  4FD8 A;  5E2G A;  4X56 A;  3AGF A;  2XFT A;  2X01 A;  5E2E A;  3ZHH A;  5CGW A;  2ZC4 B;  5KSH A;  1L2S A;  5EOE A;  3VP3 A;  1RGZ A;  3HRE A;  4PM7 A;  2ZQ8 A;  5FQJ A;  3I7J A;  5FI6 A;  4DE2 A;  1RGY A;  4R1G A;  5DTT A;  5TGF A;  1AXB A;  3A3I A;  2DCF A;  3O88 A;  3OPP A;  1ALQ A;  1FSW A;  1SDE A;  4LEN A;  3C4P A;  5CEB A;  1N9B A;  3LEZ A;  4JXS A;  3VFH A;  1SHV A;  1K57 A;  5FA7 A;  1EI5 A;  1ERM A;  4ZJ2 A;  4JKT A;  4CJN A;  1SDN A;  4S2P A;  4HBU A;  3IH9 A;  2Q9M A;  4DXC A;  2JBF A;  3HLE A;  3QHY A;  3D4F A;  1K6R A;  1TEM A;  3HVF A;  5E2F A;  4C75 A;  5HW3 A;  3OC2 A;  4OPR A;  5CER A;  5EPH A;  2FFY A;  5HAP A;  1BTL A;  4JLF A;  1DJC A;  2WUQ A;  3PBO A;  3TSG A;  1TDL A;  2XFS A;  1BT5 A;  3BFC A;  2FFF B;  3V39 A;  1BUE A;  3WS0 A;  3GVB A;  4HBT A;  3EQV A;  4U0X A;  3BM6 A;  4KG2 A;  4E3K A;  4BL2 A;  4N9K A;  4E6X A;  4DDS A;  4XUX A;  3IXD A;  3PTE A;  3ZGA B;  3CG5 A;  4EBL A;  4HEF A;  4R23 A;  2I72 A;  2H10 A;  4OPY A;  5KZH A;  4DXB A;  1IYO A;  3VP1 A;  4JPM A;  2OV5 A;  5F1F A;  4E3I A;  1H8Z A;  2UWX A;  1EWZ A;  5FAQ A;  4S2L A;  5L2F A;  2XD5 A;  4YFM A;  5EVI D;  1ONG A;  1PW8 A;  1K54 A;  1K4E A;  2X71 A;  5DTS A;  3Q7Z A;  2V2F F;  3B3X A;  3IT9 A;  2QMI A;  2P9V B;  2PBY A;  3AGE A;  3C7V A;  3UPO A;  3HLW A;  1LLB A;  5KSC A;  1JWP A;  4S2K A;  4H8R A;  1MY8 A;  3QNC A;  1CEF A;  4P87 A;  5DVA A;  2WKH A;  1NRF A;  3S22 A;  3IXH A;  1ERQ A;  4E6W A;  1IKI A;  1PZO A;  3W4O A;  1YMX A;  1ZG4 A;  4PMA A;  4OH0 A;  2RL3 A;  5F1G A;  4KZ9 A;  5E43 A;  3Q7V A;  5GHX A;  4R4R A;  2Q9N A;  3RXW A;  3ZG7 B;  5JYP A;  2ZQ9 A;  3G2Y A;  4WEL A;  3BFF A;  4PM6 A;  4Y0U A;  1ZKJ A;  3BLM A;  5FQM A;  1I2W A;  1KGF A;  1PWD A;  2XK1 A;  4MLL A;  5EE8 A;  1XKZ A;  5U47 A;  3VSK A;  2H0Y A;  4OQG A;  2V1Z A;  1HD8 A;  1TDG A;  4WZ5 C;  2ZQD A;  2WGV A;  3N7W A;  4GOG A;  1YLJ A;  3ZG5 A;  5EOO A;  4GN2 A;  3SS4 A;  3M6H A;  4ID4 A;  2EX6 A;  4JXG A;  4OPZ A;  5CHU A;  5FAT A;  2EX8 A;  1I5Q A;  1BLP A;  3HLD A;  1QMF A;  4KQR A;  1GA0 A;  3UN7 A;  4R0Q A;  3HUM A;  2Y2P A;  4X53 A;  3GSG A;  4E3M A;  3IF6 B;  5DF8 A;  3PBT A;  1ES4 A;  2Y55 A;  5GHZ A;  5GHY A;  2Y59 A;  1XA7 A;  2WYX A;  5HAI A;  2OLU A;  2WZX A;  2XGN A;  3MKF A;  4LCL A;  2DNS A;  1K56 D;  4K0W A;  4X68 A;  1XGI A;  2ZQA A;  5GLA A;  3ITA A;  4E3L A;  1E3U A;  3BEC A;  5FQK A;  3RJU A;  1M40 A;  1KE3 A;  4CPK A;  4IVI A;  1J9M A;  4WZ4 A;  5M19 A;  2WKE A;  4Y7P A;  4EUZ A;  5CXW A;  2HP6 A;  1NY0 A;  3G35 A;  3IXB A;  4WMC D;  3IF6 A;  2H0T A;  3S4X A;  5F82 A;  2VGK A;  3WS4 A;  1Q2Q A;  4OOM A;  4WBG A;  3O3V A;  3O87 A;  1FCO A;  1JTD A;  1KDS A;  5E2H A;  1PIO A;  2Y4A A;  4EV4 A;  4QJG A;  4R4S A;  5G18 A;  1OME A;  2ZJ9 A;  1IEM A;  4BEN A;  3BFE A;  1LL9 A;  4EBN A;  3SH9 A;  4OP5 A;  1GHM A;  2VGJ A;  2IWD A;  2Y2N A;  4JXV A;  4C6Y A;  5I94 A;  2R9W A;  4QY5 A;  4ZBE A;  1BLC A;  1MKI A;  2HDR A;  3FZC A;  4MBK A;  3BFG A;  1K6S A;  2ZC5 B;  1G68 A;  3LCE A;  1WYB A;  3HUO A;  3JYI A;  3G2Z A;  1ERO A;  1NZO A;  3V3S A;  2WKI A;  2A3U A;  1ESI A;  1LL5 A;  5A91 A;  3V50 A;  4KEN B;  4LV3 A;  3GRJ A;  5AQ9 A;  2P74 A;  4OON A;  3M2K A;  4LCM A;  3DTM A;  1BLH A;  3N8S A;  1KVL A;  4P0M A;  3VP2 A;  4PM9 A;  1YLP A;  4XUZ A;  4IBX A;  5GLC A;  2C6W B;  4IVK A;  4UA6 A;  3SH7 A;  4RA7 A;  4UA9 A;  2XDM A;  1HZO A;  3MXR A;  3E2L A;  3HLF A;  3O86 A;  4L0L A;  1O7E A;  4MBH A;  5HL1 A;  4DF6 A;  1L0E A;  3A3E A;  4K0X A;  1CEG A;  5EVI B;  5J8X A;  2Y2K A;  4WEK A;  3ITB A;  1ES5 A;  3GTC A;  5CTM A;  1FCM A;  2DRW A;  1L0F A;  1KGE A;  4KZ6 A;  4E3O A;  3UDF A;  3ZG8 B;  4BLM A;  1FQG A;  2H5S A;  3PBR A;  5AQA A;  3NI9 A;  2ZM0 A;  1RCJ A;  2BG1 A;  2EX2 A;  4BQM A;  1IKG A;  1K57 C;  1DY6 A;  2ZC6 B;  4WM9 A;  3UE3 A;  3MZF A;  3ZCZ A;  1SKF A;  3IHB A;  4MNR A;  4JF6 A;  2IWB A;  4DKI A;  1WYC A;  1QME A;  2ZM8 A;  1PWC A;  1YT4 A;  3CJM A;  4IBR A;  1M6K A;  5EVI A;  3P98 A;  4LV1 A;  4DRT A;  4S2N A;  1CK3 A;  1KE4 A;  2X02 A;  2Y2J A;  2BLS A;  5CHJ A;  4QY6 A;  2HP5 A;  4GDB A;  1Y54 A;  4KQQ A;  4NET A;  3UPP A;  3G34 A;  2ZQ7 A;  4OVD A;  3TOI A;  1KGG A;  1PI5 A;  3EQU A;  4U0T A;  1KVM A;  4E3N A;  1Q2P A;  3CZD A;  3IWQ A;  2HDS A;  5GL9 A;  1W5D A;  1BLS A;  3VMA A;  2WAE A;  1YQS A;  2IWC A;  3HLC A;  1SCW A;  4PM5 A;  1G6A A;  4C3Q A;  1DJB A;  4JF5 A;  5DF9 A;  1NYY A;  2QZ6 A;  4S2M A;  3QNB A;  1BSG A;  1MPL A;  2P9V A;  1K38 A;  3FKV A;  1MBL A;  4JXW A;  4S2I A;  5EEC A;  5DTK A;  1K55 A;  4LV0 A;  1FR1 A;  3NCK A;  2WAF A;  3PAE A;  2EXA A;  3PBQ A;  4GD6 A;  4RVA A;  2XF3 A;  1N4O A;  4KZB A;  2ZD8 A;  4N92 A;  2R9X A;  4ZDX A;  5AQB A;  4A5R A;  3A3J A;  1S0W A;  1K25 A;  2G2W A;  4JF4 A;  4K91 A;  1LI0 A;  3NDG A;  1GHP A;  2ZC7 A;  3CMZ A;  3IH8 A;  5FQQ A;  3UPN A;  4GNU A;  1K56 A;  5TFQ A;  2WAD A;  3WS5 A;  2V20 A;  4X69 A;  2Z2M B;  2Y2I A;  4GB7 A;  1ZC2 A;  1YLZ A;  3SS3 A;  3IWI A;  3FKW A;  2PU4 A;  1NYM A;  4FCF A;  2EFU A;  4N1X A;  3GQZ A;  5A93 A;  3NDE A;  4WMC A;  1NXY A;  1I2S A;  4KZ5 A;  5CTN A;  4KQO A;  3S1Y A;  1BZA A;  4BD1 A;  3MFD A;  2WZZ A;  2Y2M A;  1FCN A;  2Y2L A;  4E3J A;  4EQI A;  1XX2 A;  3Q82 A;  4FSF A;  4RX3 A;  4S2J A;  4HES A;  2EXB A;  3AGD A;  3OPL A;  3VSL A;  1KDW A;  1NJ4 A;  5FDH A;  4X6T A;  1BUL A;  2ZMA A;  1MWU A;  3G4P A;  3HL9 A;  4IED A;  3IF5 A;  1XP4 A;  4QHC A;  4ZAM A;  4QD4 A;  3UO9 A;  3ZVT A;  4EWF A;  3PBN A;  3G31 A;  3PAG A;  1CI9 A;  4GDN A;  1IYP A;  3A3D A;  3N8L A;  4GKU A;  4KZ8 A;  3UNW A;  4BL3 A;  5A90 A;  5CED A;  5HAQ A;  1YLW A;  1C3B A;  3GV9 A;  5CGS A;  4OQ0 A;  2XR0 A;  5M1A A;  4LV2 A;  2WK0 A;  3BYD A;  4N1H A;  1IYQ A;  4QU3 A;  4Y0T A;  3V5M A;  5GLD A;  1LHY A;  1L0D A;  3MXS A;  2Y2O A;  4PPR A;  3UDX A;  4B4X A;  3DW0 A;  4WYY A;  3P09 A;  1MWS A;  4OPQ A;  4OOY A;  3VOY A;  3ZFZ A;  3ZVW A;  4Z9Q A;  3E2K A;  3IF6 C;  5HX9 A;  4JBF A;  2HDU A;  3SH8 A;  3WWX A;  3BFD A;  4F94 A;  1RP5 A;  2XLN A;  3RXX A;  1W79 A;  2JCH A;  5F83 A;  1GHI A;  3MKE A;  1PW1 A;  4Q8I A;  3GMW A;  1JTG A;  1E4D A;  1MWT A;  1JWZ A;  4OLG A;  2CC1 A;  2Y2Q A;  1YLT A;  4OOL A;  4ZTK A;  4P85 A;  1IEL A;  4QB8 A;  1CI8 A;  2ZC3 B;  1YM1 A;  3UE0 A;  3N4I A;  5TR7 A;  2J9P A;  3MZD A;  3W4P A;  3HLG A;  3MBZ A;  5FAP A;  4GD8 A;  2XEP A;  3Q1F A;  5JYO A;  1YLY A;  4EBP A;  5BOH A;  4KZ4 A;  3M6B A;  2ZQC A;  4MBF A;  2JE5 A;  5D3O A;  4MEZ A;  3LY3 A;  1ESU A;  4ZJ3 A; 
#chains in the Genus database with same CATH topology
 1N9N A;  4GHI A;  4S2O A;  4CLC B;  4NXB A;  5FAS A;  1FR6 A;  2QJ5 A;  1GA9 A;  3K3D A;  1PZP A;  4FH4 A;  3NBL A;  5CHM A;  3MR0 A;  2WGW B;  4F3L B;  4U3T A;  3MZE A;  3Q07 A;  3VP0 A;  3Q81 A;  5G4Y A;  3M2J A;  3WRT A;  2W1T A;  4BJP A;  2HZ5 A;  2B5R A;  3G32 A;  4OLD A;  3NY4 A;  1E25 A;  1D7E A;  3P7N A;  3TG9 A;  4BWI A;  4HH2 A;  4OQH A;  1MC0 A;  5DF7 A;  3HUN A;  4BBT A;  1ES2 A;  1H8M A;  3LR5 A;  3MJQ A;  3CPT A;  2VEA A;  3ZNT A;  2XQZ A;  1XA1 A;  1HVB A;  2Q0O A;  1PI4 A;  5FDS A;  3WS1 A;  3KSF A;  1XPB A;  4YOF A;  2A24 A;  4HOI A;  3VFF A;  2E8I A;  3UB5 P;  3OCL A;  5IHV A;  1L3L A;  1OJ5 A;  5FI2 A;  2ZM2 A;  1MXO A;  2EFX A;  1K55 C;  1P0Z A;  1S6R A;  3NC8 A;  1PWG A;  3OPH A;  3VP4 A;  2QJ7 A;  4JGP A;  2XRO A;  3ZG9 B;  3N8R A;  4L9E A;  1S1Y A;  4NK3 A;  3SS5 A;  1S4S A;  2PU2 A;  1Z6F A;  3IHA A;  1IYS A;  2QPN A;  5DKK A;  1IOU A;  3W8K A;  2A49 A;  4WEJ A;  2L1M A;  4FD8 A;  2XFT A;  3E4Q A;  5E2E A;  4CLC E;  5KSH A;  5F69 A;  3VP3 A;  4PM7 A;  5C5K A;  2ZQ8 A;  3EEH A;  5FQJ A;  3I7J A;  5FI6 A;  1RGY A;  2JKR I;  4NXF A;  4R1G A;  3IX8 A;  3S7O A;  1Y4O A;  2VK3 A;  4LEN A;  2HV1 A;  3MMH A;  4NKP A;  5CEB A;  1K57 A;  3LIF A;  4JKT A;  1SDN A;  4H6J B;  3MFX A;  2Q9M A;  4DXC A;  3HLE A;  3LIA A;  3HVF A;  2WKR A;  3H7W B;  5E2F A;  3D9Y A;  3TSG A;  3BWL A;  3BFC A;  3BQ8 A;  1BUE A;  3GVB A;  4HBT A;  3PXP A;  2QYB A;  3CG5 A;  2I72 A;  4DXB A;  1IYO A;  1F9I A;  5F1F A;  1EWZ A;  5J7E A;  2X71 A;  3Q7Z A;  4G3V A;  3B47 A;  1H3Q A;  3C7V A;  2J3T C;  1TD5 A;  3QNC A;  5DVA A;  2WKH A;  3S22 A;  3KO6 A;  5CX7 A;  5F1G A;  2RL3 A;  3BY8 A;  3RXW A;  3R7W A;  1YAX A;  5K5B A;  4WEL A;  1ZKJ A;  1I2W A;  1YPR A;  1XKZ A;  4RQ9 A;  5U47 A;  2H0Y A;  4WZ5 C;  2ZQD A;  3EOI A;  3ZG5 A;  5EOO A;  4GN2 A;  5EM0 A;  3SS4 A;  3M6H A;  4ID4 A;  2E8J A;  2W3D A;  4PAU A;  2LB9 A;  4O01 A;  1GSX A;  3LR4 A;  3UN7 A;  4R0Q A;  2Y2P A;  3NOU C;  4LCL A;  3KYQ A;  5HWT A;  2ZQA A;  1E3U A;  3RJU A;  4CPK A;  1OPX A;  4Y7P A;  4HQA A;  5CXW A;  2K31 A;  4WMC D;  3S4X A;  2JKR M;  3WS4 A;  1Q2Q A;  4HJ6 A;  4WBG A;  5FEG A;  3O87 A;  1JTD A;  1KDS A;  1PIO A;  2Y4A A;  4R4S A;  4HY8 A;  4BEN A;  4D60 A;  4EBN A;  2VGJ A;  2IWD A;  4C6Y A;  2R9W A;  1SKO B;  3F1P A;  2ZC5 B;  2W3E A;  1NZO A;  2PDR A;  5HDD A;  1LL5 A;  5EVE A;  2P74 A;  5HL6 A;  3M2K A;  2XSS A;  3DTM A;  1KVL A;  3VP2 A;  4PM9 A;  4XUZ A;  2C6W B;  5EFW A;  1D06 A;  4RA7 A;  3MXR A;  3O86 A;  3E2L A;  3HLF A;  4DF6 A;  1SZV A;  4R38 A;  3A3E A;  5IS1 A;  4GS9 B;  1XJ6 A;  1YKD A;  2Y2K A;  1KGE A;  3ZG8 B;  2H5S A;  5J3W A;  3NI9 A;  3RH8 B;  3UE3 A;  1DY6 A;  3IHB A;  3OOV A;  4DKI A;  1WYC A;  3T12 B;  1PWC A;  4IBR A;  3IX4 A;  5EVI A;  1TF1 A;  4S2N A;  1KE4 A;  4L9G A;  5TBM A;  4GDB A;  5IU1 A;  3UPP A;  4R70 A;  3G34 A;  4OVD A;  1PI5 A;  3EQU A;  1OTE A;  5GL9 A;  2VJW A;  1YQS A;  4PM5 A;  2ZL1 A;  1HLU P;  1NYY A;  4S2M A;  3IS2 A;  3QNB A;  2M7U A;  2AVX A;  5EEC A;  2VGL M;  4MDZ A;  1FIK A;  2WAF A;  2A24 B;  4GD6 A;  4KZB A;  2ZD8 A;  4EET B;  2R9X A;  5AQB A;  2G2W A;  4JF4 A;  2O9A A;  2HJ9 C;  1MKM A;  5TFQ A;  2WAD A;  3NJA A;  2Z2M B;  2Y2I A;  4BBV A;  1YLZ A;  4LRZ E;  4HH3 A;  1T19 A;  3GQZ A;  5A93 A;  3NDE A;  2W3F A;  4KZ5 A;  1OTB A;  4BD1 A;  2PR5 A;  2Y2M A;  4Y15 A;  3VE4 A;  4LRY C;  4S2J A;  4HES A;  1KDW A;  3E4P A;  1NJ4 A;  5FDH A;  4X6T A;  1MWU A;  5L07 A;  4GDN A;  4KZ8 A;  1IYP A;  3A3D A;  3N8L A;  5A90 A;  1YLW A;  3DTE A;  2HJE A;  3T1R A;  5M1A A;  4LV2 A;  2WK0 A;  4Y0T A;  1IYQ A;  4QU3 A;  3VV4 A;  1L0D A;  2Y2O A;  2XA7 S;  4OOY A;  4O8G A;  3MQ0 A;  1UGU A;  5HX9 A;  4JBF A;  4YWZ A;  5F83 A;  3MKE A;  1JWZ A;  1YLT A;  2ZC3 B;  3TRC A;  3HLG A;  3K2N A;  2XEP A;  2GZA A;  5JYO A;  4KZ4 A;  2KX6 A;  3M6B A;  4MBF A;  1N9O A;  3LY3 A;  4UAA A;  2PBD P;  4UA7 A;  3OPR A;  5HAR A;  4NXG A;  4UEY A;  1VB6 A;  4BD0 A;  1XGJ A;  4P6B A;  3MSH A;  3CHW P;  3OZH A;  3ZDJ A;  2XRN A;  1KE0 A;  5EUA A;  2C5W B;  2HPB A;  3R7W B;  3IXG A;  4KG5 A;  2GNX A;  2ZLY A;  4UQI S;  5F5Y A;  4R3A A;  1DRM A;  3B42 A;  2O99 A;  4KUK A;  3MS6 A;  4B88 A;  4Y13 A;  1LL8 A;  4DDY A;  4PM8 A;  5HD3 A;  3EWK A;  1STZ A;  1L0G A;  4B4Z A;  4OP8 A;  3UB9 A;  1D1J A;  1XXM A;  3LY4 A;  1GSW A;  3UY6 A;  2XD1 A;  2PT7 A;  5FSR A;  1W8Q A;  4ARZ A;  1VQQ A;  1ONH A;  3UDI A;  4XXR A;  3DWK A;  4RX2 A;  3WS2 A;  5A92 A;  4Q0I A;  2A2L A;  5FQ9 A;  1G6O A;  1TVF A;  5HD5 A;  1T1B A;  5CEC A;  1JVJ A;  3MQO A;  3IWO A;  1LSW A;  1W7F A;  3PBS A;  4GW9 A;  4LLO B;  2RCX A;  3HLB A;  2XH9 A;  3LEQ A;  3N6I A;  2M7V A;  4CQH A;  1H8Y A;  3W4Q A;  4UHU A;  3H82 A;  3AGF A;  1TS7 A;  2X01 A;  3ZHH A;  5CGW A;  2ZC4 B;  1L2S A;  2LB5 A;  3GEC A;  4LPZ A;  3RTY A;  5DTT A;  5TGF A;  1AXB A;  3A3I A;  2DCF A;  3O88 A;  3NHQ A;  1G28 A;  4JXS A;  3VFH A;  1EI5 A;  1ERM A;  1K0K A;  4S2P A;  2VV7 A;  3F1N B;  1NLY A;  3D4F A;  1K6R A;  1TEM A;  5CER A;  2B02 A;  2V1A A;  3CWF A;  3KSI A;  2ZMV A;  1DJC A;  2EWW A;  1BT5 A;  2FFF B;  5AJG A;  3WS0 A;  4ETZ A;  4KG2 A;  2J80 A;  4HP4 A;  4BL2 A;  2O9C A;  3O5Y A;  4EBL A;  4HEF A;  3LI8 A;  4R23 A;  3EGD C;  2H10 A;  5KZH A;  4E3I A;  3S7Q A;  1H8Z A;  2UWX A;  2ZL1 B;  5FAQ A;  4S2L A;  1PW8 A;  2V2F F;  4K08 A;  3B3X A;  2OWJ A;  4EES A;  2V0U A;  1XFQ A;  3AGE A;  2ZBB A;  1OTD A;  5KSC A;  1MY8 A;  4P87 A;  3IXH A;  1NWZ A;  1IKI A;  1PZO A;  5E43 A;  3MQQ A;  3Q7V A;  5JYP A;  4R4R A;  5EV0 A;  5F68 A;  3HCY A;  4Y0U A;  5FQM A;  1PWD A;  4DMZ A;  3CIT A;  4OQG A;  2L4R A;  2WGV A;  3BY9 A;  2HF6 A;  5IT5 A;  4I38 A;  2EX8 A;  3CUE A;  1V9Y A;  1GA0 A;  3HUM A;  4G3K A;  4X53 A;  4E3M A;  1AWI A;  2ZMF A;  2Y55 A;  3BQA A;  5GHZ A;  5GHY A;  2Y59 A;  2WYX A;  3E4O A;  3ICY A;  2WZX A;  1K56 D;  4K0W A;  4E3L A;  5J4E A;  4X1L A;  1M40 A;  1J9M A;  4EUZ A;  1N9L A;  3IXB A;  3IF6 A;  2H0T A;  2VGK A;  3FPV A;  2ZJ9 A;  5I5L A;  4DJ3 A;  3LR0 A;  3SZT A;  1LL9 A;  1GHM A;  4I3I A;  4JXV A;  5L10 A;  4HJ3 A;  4QY5 A;  2O0Y A;  3KSH A;  4ZBE A;  4Y3I A;  2V8C A;  4MBK A;  3QP1 A;  3BFG A;  2PHY A;  3HUO A;  3V3S A;  3NOT C;  1ESI A;  3V50 A;  3C8C A;  4KEN B;  3U2A A;  3GRJ A;  2PD7 A;  5AQ9 A;  4OON A;  4LCM A;  1BLH A;  1YLP A;  4L9F A;  4IBX A;  4UA6 A;  4IVK A;  1HZO A;  5HL1 A;  1P97 A;  2P04 A;  4K0X A;  1CEG A;  5J8X A;  1ACF A;  3ITB A;  3GTC A;  5CTM A;  1FCM A;  2CMN A;  2ZM0 A;  1RCJ A;  2BG1 A;  3QP8 A;  4Y17 A;  3ZCZ A;  4MNR A;  2PR6 A;  1M6K A;  3LFV A;  4MN5 A;  4IUK A;  2X02 A;  4NET A;  2ZQ7 A;  1KGG A;  4U0T A;  3IWQ A;  3IX3 A;  1XFN A;  4JGR A;  3JVU A;  1W5D A;  1BLS A;  3TW8 A;  4JF5 A;  1KOU A;  1BSG A;  1MPL A;  2JKT I;  1NRJ A;  2P9V A;  3FKV A;  4JXW A;  3D3O A;  2B18 A;  4CLC C;  5HWV A;  1K55 A;  4LV0 A;  4ARZ B;  1S1Z A;  2EXA A;  2FH5 A;  2KLI A;  4I3A A;  4RVA A;  2XF3 A;  3EGX C;  1S0W A;  1TS0 A;  3S7N A;  3UB8 A;  2K2N A;  1GHP A;  2GX5 A;  3T1S A;  3IH8 A;  5FQQ A;  5TJJ A;  5DFX A;  2M1C A;  3SS3 A;  2PU4 A;  3BJN A;  4FCF A;  4WMC A;  1I2S A;  1FCN A;  4E3J A;  1XX2 A;  2OWH A;  2K7S A;  4JGQ A;  3VSL A;  4KQD A;  4MN6 A;  3RXX A;  4ZAM A;  3ZVT A;  3IF5 A;  3PAG A;  1CI9 A;  1C3B A;  3GV9 A;  2YKF A;  3LIC A;  3BYD A;  4N1H A;  2OAQ 1;  3MXS A;  3UDX A;  4B4X A;  3DW0 A;  1GSV A;  3VOY A;  1MWS A;  3ULF A;  4Z9Q A;  3BFD A;  3KX0 X;  2XLN A;  3T4T A;  1OTI A;  1GHI A;  3T1Q B;  3GMW A;  4I39 A;  4EU0 A;  5HSQ A;  2CC1 A;  2Y2Q A;  4ZTK A;  1CI8 A;  1YM1 A;  4GHI B;  3N4I A;  3P01 A;  1FIL A;  3MBZ A;  4GD8 A;  1OJG A;  1YLY A;  4EBP A;  2JKF A;  4GCZ A;  1F2K A;  1VEU A;  1ESU A;  4II7 A;  4KZ7 A;  5EVL A;  1W8Y A;  2YKH A;  2W1T B;  3LI9 A;  1VET A;  2OLV A;  3WRZ A;  4XT2 A;  2JKT M;  3OCN A;  4HHD A;  3BRM A;  2DMW A;  2W27 A;  1LI9 A;  3C5A A;  3A0V A;  4WZ5 A;  4ZRR A;  2HP9 A;  4ME4 A;  3HBR A;  2HDQ A;  3Q7V B;  4CLC D;  5G4Z A;  4D2O A;  1UWN X;  3CPT B;  5FAO A;  1FSY A;  3A3F A;  3NIA A;  1X0O A;  2WGW A;  4R3J A;  3ZNY A;  3IBJ A;  1K54 C;  4PKY A;  4QWO A;  1F5M A;  2JKG A;  2WGI A;  1H5X A;  4F3L A;  2Y2G A;  2D01 A;  3IQA A;  2OAP 1;  4HP9 A;  1YMS A;  3PHY A;  1PYY A;  2Z6C A;  3G30 A;  2P7J A;  3V3R A;  4DE3 A;  1ODV A;  5EM1 A;  2VV6 A;  5GLB A;  4OQI A;  4M3K A;  4R3B A;  1MWR A;  3FYZ A;  5FI7 A;  1ZG6 A;  1Z09 A;  4OKP A;  3S7P A;  1W63 Q;  2QWS A;  4WL9 A;  5A8B A;  1GCE A;  3CLO A;  1XJ2 A;  3BEB A;  4O7D A;  3FV7 A;  2R78 A;  1ES3 A;  2EA9 A;  4IJG A;  3FWL A;  4KZA A;  4X56 A;  1PNE A;  2B95 A;  3HRE A;  2QKP A;  5FEF A;  4X25 A;  2HGV A;  5HZH A;  2ACG A;  3HJI A;  5DJU A;  1N9B A;  3LEZ A;  3QP5 A;  1G5U A;  2KDK A;  4ZJ2 A;  3LUQ A;  3IH9 A;  4DN0 A;  2JBF A;  4C75 A;  5HW3 A;  3OC2 A;  4OPR A;  5EPH A;  1BTL A;  4JLF A;  2WUQ A;  3PBO A;  1TDL A;  1P9W A;  3V39 A;  5DJT A;  3EQV A;  4H6J A;  3BM6 A;  3IBR A;  4N9K A;  3T4Q A;  4E6X A;  4XUX A;  4FUW A;  3C30 A;  4OPY A;  4X1M A;  3VP1 A;  4JPM A;  2WKQ A;  2EWV A;  5L2F A;  2XD5 A;  1ONG A;  1K54 A;  1K4E A;  4EEU A;  3IT9 A;  4EQ1 A;  1S67 L;  2PBY A;  2P9V B;  3QP2 A;  3HLW A;  1OTA A;  1LSX A;  4S2K A;  1CEF A;  1CF0 A;  2D02 A;  4OH0 A;  3T1X A;  1P9R A;  1DP9 A;  3E98 A;  2Q9N A;  3ZG7 B;  2XK1 A;  5EE8 A;  5F6A A;  5HPF A;  2MJ6 A;  3VSK A;  5HDS A;  2V1Z A;  3OLO A;  4GOG A;  5L8M A;  2EX6 A;  4WLA A;  5FAT A;  1I5Q A;  3HLD A;  1QMF A;  4KQR A;  3GSG A;  5DF8 A;  3PBT A;  4M4X A;  4Z1W A;  1XA7 A;  3R4K A;  2OLU A;  3PYP A;  4X68 A;  5FQK A;  5HDC A;  1KE3 A;  4WZ4 A;  2WKE A;  2HP6 A;  2XA7 M;  3F1P B;  4OOM A;  2ZOH A;  1FCO A;  5E2H A;  2PYP A;  4QJG A;  1OME A;  3C38 A;  5LBR A;  1IEM A;  1VHM A;  3BFE A;  1IFQ A;  4OP5 A;  2Y2N A;  4E04 A;  5I94 A;  3FZC A;  4R6L A;  1K6S A;  1G68 A;  3LCE A;  1OT9 A;  3JYI A;  1ERO A;  2WKI A;  2A3U A;  3ZQ5 A;  3N8S A;  1SKO A;  3NOP C;  1VEU B;  5EVI B;  4P6Z M;  1ES5 A;  5TBM B;  4FOF A;  4EXO A;  4WN5 A;  4KZ6 A;  4Y5F A;  2V1B A;  1Y28 A;  3UDF A;  3FC7 A;  4BLM A;  3PBR A;  5AQA A;  2EX2 A;  1IKG A;  1K57 C;  3MZF A;  1UWP X;  1SKF A;  4JF6 A;  4IHQ A;  1YT4 A;  3CJM A;  4LV1 A;  1CK3 A;  2Y2J A;  3IS2 B;  1DP6 A;  5CHJ A;  4QY6 A;  2HP5 A;  1Y54 A;  4KQQ A;  4UQI M;  4Q0J A;  1V9Z A;  3E0Y A;  4E3N A;  2G7U A;  1YSQ A;  3UMD A;  3VMA A;  2WAE A;  2IWC A;  1SCW A;  3QP4 A;  4GJ4 A;  1G6A A;  4ETX A;  2QZ6 A;  3DAV A;  4S2I A;  5DKL A;  1OT6 A;  5DTK A;  4MN7 A;  3PBQ A;  1YSP A;  4ZDX A;  2WKP A;  3A3J A;  1LI0 A;  3T4S A;  2W3G A;  3KSG A;  3JPU A;  4GNU A;  1K56 A;  3WS5 A;  1LT0 A;  3IWI A;  3FKW A;  4IUH A;  1NYM A;  2EFU A;  4N1X A;  2VZW A;  3H9W A;  5CTN A;  3S1Y A;  2V0W A;  2Y2L A;  3UE6 A;  2I9V A;  2Z6D A;  3LIE A;  2PYR A;  2EXB A;  3AGD A;  3LGO A;  3OPL A;  2ZMA A;  4IED A;  4QHC A;  3HL9 A;  3UO9 A;  4BMW A;  3G31 A;  5HAQ A;  4BL3 A;  2NUT C;  5CED A;  3T4O A;  4OQ0 A;  3V5M A;  3FPW A;  1LHY A;  3V67 A;  4PPR A;  4WYY A;  4KUO A;  4OPQ A;  3ZFZ A;  1T18 A;  3E2K A;  2HDU A;  3C2W A;  3WWX A;  1RP5 A;  3F1O A;  1PRQ A;  1PW1 A;  3LIB A;  4Q8I A;  2H28 A;  4OOL A;  3K3C A;  4QB8 A;  1NLZ A;  4JGO A;  3UE0 A;  5TR7 A;  2Y8H A;  2J9P A;  2FZ0 A;  5FAP A;  5BOH A;  3T4K A;  2QHK A;  3B33 A;  5D3O A;  4MEZ A;  2VKS A;  2G2U A;  3UE1 A;  3ISG A;  3KYZ A;  4Y0O A;  4WUJ A;  4GZB A;  3VOZ A;  2V9A A;  5HFO A;  3ZG0 A;  2OOL A;  3VOL A;  2OSU A;  4LGW A;  1HTZ A;  3CI6 A;  4ZJ1 A;  5AVE A;  1DJA A;  2JC7 A;  1VM1 A;  1K4F A;  3A0S A;  4FH2 A;  5CGX A;  4NG2 A;  4KG6 A;  2BAS A;  2VV8 A;  2GDN A;  5EVI C;  4NXE A;  3C7U A;  3LO7 A;  3QP6 A;  4S2N C;  3DWZ A;  1WE4 A;  3PR6 A;  4N9L A;  4HNB A;  1O07 A;  1JWV A;  1FOF A;  2Z2L B;  2J7V A;  4EEP A;  2VLG A;  5KMW A;  4KZ3 A;  2JN7 A;  4RYE A;  3T4L A;  2VGL S;  3TJZ C;  3BLS A;  5FQI A;  5M18 A;  3SOI A;  1WA9 A;  1J3W A;  5MC7 A;  3C4O A;  5CRF A;  3DBA A;  1CQA A;  3GR2 A;  2Y2H A;  1ZTU A;  4X55 A;  4WF0 A;  1NZU A;  4DE0 A;  3H82 B;  3DTK A;  2J8Y A;  4I3J A;  2J9O A;  1U60 A;  3CAX A;  2VX8 A;  1TS6 A;  4YIN A;  3BW6 A;  1E3U D;  3W2Z A;  4DE1 A;  2Y91 A;  2EX9 A;  5AQ7 A;  5E2G A;  5EOE A;  3LR3 A;  1RGZ A;  4Y2F A;  3LID A;  4DE2 A;  2W3H A;  5KIZ A;  3OPP A;  3RFB A;  1ALQ A;  1FSW A;  1SDE A;  3C4P A;  1JNU A;  2Y79 A;  1SHV A;  5FA7 A;  4CJN A;  4HBU A;  1ZHH B;  1EW0 A;  3QHY A;  1T1A A;  2FFY A;  5HAP A;  3FG8 A;  2INW A;  2XFS A;  1LSV A;  2J3W A;  4U0X A;  3MXQ A;  4E3K A;  3F1N A;  4DDS A;  3IXD A;  3PTE A;  3ZGA B;  2VA0 A;  5HPI A;  3HJK A;  3NEC A;  2OV5 A;  2L0W A;  3D72 A;  4BBU A;  4CLC A;  2J3T D;  4YFM A;  5EVI D;  5HWW A;  5DTS A;  4HIA A;  2QMI A;  3UPO A;  1LLB A;  1JWP A;  4H8R A;  1CJF A;  1A0K A;  1NRF A;  1ERQ A;  4E6W A;  3W4O A;  1YMX A;  1ZG4 A;  4PMA A;  1H0M A;  4KZ9 A;  5GHX A;  2ZQ9 A;  3G2Y A;  3BFF A;  4PM6 A;  3BLM A;  2GJ3 A;  1KGF A;  4MLL A;  2PAV P;  1HD8 A;  1TDG A;  2NUP C;  2KOI A;  3N7W A;  1YLJ A;  1BYW A;  3EEA A;  1F98 A;  4JXG A;  4OPZ A;  5CHU A;  1BLP A;  3IF6 B;  3T50 A;  1ES4 A;  2W0N A;  2UV0 E;  5HAI A;  2XGN A;  3MKF A;  5L09 A;  2DNS A;  4QPR A;  5GLA A;  3U4L P;  1XGI A;  3ITA A;  3BEC A;  4IVI A;  5M19 A;  4LRX C;  1NY0 A;  3G35 A;  5F82 A;  3O3V A;  3GDI A;  4EV4 A;  4MCW A;  5G18 A;  4PKY G;  3SH9 A;  1XJ3 A;  3NUL A;  1BLC A;  1MKI A;  2HDR A;  3F1O B;  3ZYT A;  1DP8 A;  3TE8 A;  2PD8 A;  1WYB A;  3MF0 A;  3G2Z A;  5A91 A;  2O9B A;  4LV3 A;  5FL3 A;  4P0M A;  5GLC A;  1MZU A;  4UA9 A;  2XDM A;  4AFI A;  4L0L A;  1O7E A;  4MBH A;  1L0E A;  4EER A;  4WEK A;  2DRW A;  1L0F A;  4E3O A;  3H7W A;  1FQG A;  4GLQ A;  4BQM A;  2ZC6 B;  4WM9 A;  2IWB A;  1QME A;  2ZM8 A;  4NEE D;  3P98 A;  4DRT A;  3UB6 A;  1PFL A;  2BLS A;  4EW7 A;  3LYX A;  4P6Z S;  3TOI A;  1KVM A;  3T4J A;  1Q2P A;  3CZD A;  2HDS A;  3HLC A;  4C3Q A;  3L7H A;  1DJB A;  5DF9 A;  2JHE A;  1K38 A;  1MBL A;  1T1C A;  2IA2 A;  4LFU A;  3PAE A;  1FR1 A;  3JVV A;  3NCK A;  1N4O A;  4N92 A;  3L9K A;  4HJ4 A;  4A5R A;  1K25 A;  4K91 A;  3UME A;  3NDG A;  2ZC7 A;  3CMZ A;  3UPN A;  4DJ2 A;  4EUV A;  3OBF A;  2V20 A;  4X69 A;  2V8F A;  4GB7 A;  4PHT A;  1ZC2 A;  1NXY A;  4B93 A;  4KQO A;  1BZA A;  1S4R A;  3MFD A;  2WZZ A;  4EQI A;  3Q82 A;  4FSF A;  4RX3 A;  3CUE C;  1BUL A;  3G4P A;  4EWF A;  1XP4 A;  4QD4 A;  3PBN A;  1S66 L;  4O0P A;  4GKU A;  3UNW A;  2W1R A;  5CGS A;  2XR0 A;  1W63 M;  5AVF A;  5GLD A;  3P09 A;  3ZVW A;  4B9O A;  4I5S A;  2BTF P;  3IF6 C;  3SH8 A;  4F94 A;  1W79 A;  2JCH A;  3G6O A;  4HI4 A;  4YNR A;  3SW1 A;  1JTG A;  1E4D A;  1MWT A;  3VE3 A;  4OLG A;  3DTI A;  4ESP A;  1XJ4 A;  4P85 A;  1IEL A;  5DFY A;  4G3W A;  3MZD A;  2P08 A;  3W4P A;  1TS8 A;  2ZOI A;  3UB7 A;  1VET B;  3Q1F A;  4XT2 B;  2ZQC A;  3KYE A;  4Q0H A;  4FTX A;  4MMN A;  2JE5 A;  3A0R A;  4GS9 A;  2PRF A;  3SH7 A;  4ZJ3 A; 
#chains in the Genus database with same CATH homology
 4UA7 A;  3OPR A;  4KZ7 A;  4S2O A;  5HAR A;  2G2U A;  3UE1 A;  5FAS A;  3ISG A;  1FR6 A;  5EVL A;  4BD0 A;  1W8Y A;  1GA9 A;  4Y0O A;  1PZP A;  1XGJ A;  4P6B A;  4FH4 A;  4GZB A;  2OLV A;  3OZH A;  3NBL A;  3VOZ A;  5CHM A;  3WRZ A;  5HFO A;  3ZG0 A;  3OCN A;  3ZDJ A;  2OSU A;  2WGW B;  3BRM A;  1HTZ A;  4ZJ1 A;  4U3T A;  1DJA A;  1LI9 A;  3C5A A;  3MZE A;  3Q07 A;  1KE0 A;  1VM1 A;  1K4F A;  2JC7 A;  3Q81 A;  4FH2 A;  4WZ5 A;  5EUA A;  2HP9 A;  3VP0 A;  5CGX A;  3HBR A;  2HDQ A;  3M2J A;  3Q7V B;  2C5W B;  2HPB A;  3WRT A;  3IXG A;  4KG5 A;  4KG6 A;  4D2O A;  4BJP A;  3G32 A;  2B5R A;  4OLD A;  3NY4 A;  1E25 A;  2GDN A;  5FAO A;  5EVI C;  2ZLY A;  1FSY A;  3TG9 A;  3A3F A;  3NIA A;  3C7U A;  3LO7 A;  2WGW A;  4OQH A;  4R3J A;  4S2N C;  3ZNY A;  1K54 C;  3DWZ A;  5DF7 A;  2WGI A;  1H5X A;  3HUN A;  1WE4 A;  2Y2G A;  1ES2 A;  4N9L A;  3IQA A;  4B88 A;  4DDY A;  1O07 A;  4PM8 A;  1JWV A;  1FOF A;  2Z2L B;  1YMS A;  1L0G A;  4B4Z A;  2J7V A;  1PYY A;  4OP8 A;  3G30 A;  3ZNT A;  1XXM A;  2XQZ A;  3V3R A;  4DE3 A;  1XA1 A;  5KMW A;  3LY4 A;  1HVB A;  4KZ3 A;  3UY6 A;  5GLB A;  1PI4 A;  3WS1 A;  4OQI A;  2XD1 A;  1XPB A;  5FSR A;  1W8Q A;  4RYE A;  1VQQ A;  1ONH A;  3VFF A;  2E8I A;  3BLS A;  5FQI A;  4M3K A;  4R3B A;  3SOI A;  3UDI A;  1MWR A;  3OCL A;  4XXR A;  5IHV A;  5M18 A;  3FYZ A;  3DWK A;  4RX2 A;  3C4O A;  5CRF A;  3WS2 A;  5A92 A;  5FQ9 A;  4UAA A;  5FI7 A;  1TVF A;  5FI2 A;  5CEC A;  2ZM2 A;  1ZG6 A;  3GR2 A;  1JVJ A;  2Y2H A;  4OKP A;  1MXO A;  2EFX A;  1K55 C;  1S6R A;  3NC8 A;  4X55 A;  1NZU A;  1PWG A;  1GCE A;  4DE0 A;  3IWO A;  2J8Y A;  3OPH A;  1W7F A;  3PBS A;  3VP4 A;  2J9O A;  1U60 A;  2RCX A;  3BEB A;  4O7D A;  3FV7 A;  4YIN A;  3ZG9 B;  3N8R A;  3HLB A;  2XH9 A;  4NK3 A;  3SS5 A;  1ES3 A;  1E3U D;  2PU2 A;  1Z6F A;  3IHA A;  4DE1 A;  1IYS A;  2QPN A;  2Y91 A;  3N6I A;  3FWL A;  1H8Y A;  4KZA A;  2EX9 A;  3W4Q A;  5AQ7 A;  3W8K A;  2A49 A;  4WEJ A;  4UHU A;  4FD8 A;  5E2G A;  4X56 A;  3AGF A;  2XFT A;  2X01 A;  5E2E A;  3ZHH A;  5CGW A;  2ZC4 B;  5KSH A;  1L2S A;  5EOE A;  3VP3 A;  1RGZ A;  3HRE A;  4PM7 A;  2ZQ8 A;  5FQJ A;  3I7J A;  5FI6 A;  4DE2 A;  1RGY A;  4R1G A;  5DTT A;  5TGF A;  1AXB A;  3A3I A;  2DCF A;  3O88 A;  3OPP A;  1ALQ A;  1FSW A;  1SDE A;  4LEN A;  3C4P A;  5CEB A;  1N9B A;  3LEZ A;  4JXS A;  3VFH A;  1SHV A;  1K57 A;  5FA7 A;  1EI5 A;  1ERM A;  4ZJ2 A;  4JKT A;  4CJN A;  1SDN A;  4S2P A;  4HBU A;  3IH9 A;  2Q9M A;  4DXC A;  2JBF A;  3HLE A;  3QHY A;  3D4F A;  1K6R A;  1TEM A;  3HVF A;  5E2F A;  4C75 A;  5HW3 A;  3OC2 A;  4OPR A;  5CER A;  5EPH A;  2FFY A;  5HAP A;  1BTL A;  4JLF A;  1DJC A;  2WUQ A;  3PBO A;  3TSG A;  1TDL A;  2XFS A;  1BT5 A;  3BFC A;  2FFF B;  3V39 A;  1BUE A;  3WS0 A;  3GVB A;  4HBT A;  3EQV A;  4U0X A;  3BM6 A;  4KG2 A;  4E3K A;  4BL2 A;  4N9K A;  4E6X A;  4DDS A;  4XUX A;  3IXD A;  3PTE A;  3ZGA B;  3CG5 A;  4EBL A;  4HEF A;  4R23 A;  2I72 A;  2H10 A;  4OPY A;  5KZH A;  4DXB A;  1IYO A;  3VP1 A;  4JPM A;  2OV5 A;  5F1F A;  4E3I A;  1H8Z A;  2UWX A;  1EWZ A;  5FAQ A;  4S2L A;  5L2F A;  2XD5 A;  4YFM A;  5EVI D;  1ONG A;  1PW8 A;  1K54 A;  1K4E A;  2X71 A;  5DTS A;  3Q7Z A;  2V2F F;  3B3X A;  3IT9 A;  2QMI A;  2P9V B;  2PBY A;  3AGE A;  3C7V A;  3UPO A;  3HLW A;  1LLB A;  5KSC A;  1JWP A;  4S2K A;  4H8R A;  1MY8 A;  3QNC A;  1CEF A;  4P87 A;  5DVA A;  2WKH A;  1NRF A;  3S22 A;  3IXH A;  1ERQ A;  4E6W A;  1IKI A;  1PZO A;  3W4O A;  1YMX A;  1ZG4 A;  4PMA A;  4OH0 A;  2RL3 A;  5F1G A;  4KZ9 A;  5E43 A;  3Q7V A;  5GHX A;  4R4R A;  2Q9N A;  3RXW A;  3ZG7 B;  5JYP A;  2ZQ9 A;  3G2Y A;  4WEL A;  3BFF A;  4PM6 A;  4Y0U A;  1ZKJ A;  3BLM A;  5FQM A;  1I2W A;  1KGF A;  1PWD A;  2XK1 A;  4MLL A;  5EE8 A;  1XKZ A;  5U47 A;  3VSK A;  2H0Y A;  4OQG A;  2V1Z A;  1HD8 A;  1TDG A;  4WZ5 C;  2ZQD A;  2WGV A;  3N7W A;  4GOG A;  1YLJ A;  3ZG5 A;  5EOO A;  4GN2 A;  3SS4 A;  3M6H A;  4ID4 A;  2EX6 A;  4JXG A;  4OPZ A;  5CHU A;  5FAT A;  2EX8 A;  1I5Q A;  1BLP A;  3HLD A;  1QMF A;  4KQR A;  1GA0 A;  3UN7 A;  4R0Q A;  3HUM A;  2Y2P A;  4X53 A;  3GSG A;  4E3M A;  3IF6 B;  5DF8 A;  3PBT A;  1ES4 A;  2Y55 A;  5GHZ A;  5GHY A;  2Y59 A;  1XA7 A;  2WYX A;  5HAI A;  2OLU A;  2WZX A;  2XGN A;  3MKF A;  4LCL A;  2DNS A;  1K56 D;  4K0W A;  4X68 A;  1XGI A;  2ZQA A;  5GLA A;  3ITA A;  4E3L A;  1E3U A;  3BEC A;  5FQK A;  3RJU A;  1M40 A;  1KE3 A;  4CPK A;  4IVI A;  1J9M A;  4WZ4 A;  5M19 A;  2WKE A;  4Y7P A;  4EUZ A;  5CXW A;  2HP6 A;  1NY0 A;  3G35 A;  3IXB A;  4WMC D;  3IF6 A;  2H0T A;  3S4X A;  5F82 A;  2VGK A;  3WS4 A;  1Q2Q A;  4OOM A;  4WBG A;  3O3V A;  3O87 A;  1FCO A;  1JTD A;  1KDS A;  5E2H A;  1PIO A;  2Y4A A;  4EV4 A;  4QJG A;  4R4S A;  5G18 A;  1OME A;  2ZJ9 A;  1IEM A;  4BEN A;  3BFE A;  1LL9 A;  4EBN A;  3SH9 A;  4OP5 A;  1GHM A;  2VGJ A;  2IWD A;  2Y2N A;  4JXV A;  4C6Y A;  5I94 A;  2R9W A;  4QY5 A;  4ZBE A;  1BLC A;  1MKI A;  2HDR A;  3FZC A;  4MBK A;  3BFG A;  1K6S A;  2ZC5 B;  1G68 A;  3LCE A;  1WYB A;  3HUO A;  3JYI A;  3G2Z A;  1ERO A;  1NZO A;  3V3S A;  2WKI A;  2A3U A;  1ESI A;  1LL5 A;  5A91 A;  3V50 A;  4KEN B;  4LV3 A;  3GRJ A;  5AQ9 A;  2P74 A;  4OON A;  3M2K A;  4LCM A;  3DTM A;  1BLH A;  3N8S A;  1KVL A;  4P0M A;  3VP2 A;  4PM9 A;  1YLP A;  4XUZ A;  4IBX A;  5GLC A;  2C6W B;  4IVK A;  4UA6 A;  3SH7 A;  4RA7 A;  4UA9 A;  2XDM A;  1HZO A;  3MXR A;  3E2L A;  3HLF A;  3O86 A;  4L0L A;  1O7E A;  4MBH A;  5HL1 A;  4DF6 A;  1L0E A;  3A3E A;  4K0X A;  1CEG A;  5EVI B;  5J8X A;  2Y2K A;  4WEK A;  3ITB A;  1ES5 A;  3GTC A;  5CTM A;  1FCM A;  2DRW A;  1L0F A;  1KGE A;  4KZ6 A;  4E3O A;  3UDF A;  3ZG8 B;  4BLM A;  1FQG A;  2H5S A;  3PBR A;  5AQA A;  3NI9 A;  2ZM0 A;  1RCJ A;  2BG1 A;  2EX2 A;  4BQM A;  1IKG A;  1K57 C;  1DY6 A;  2ZC6 B;  4WM9 A;  3UE3 A;  3MZF A;  3ZCZ A;  1SKF A;  3IHB A;  4MNR A;  4JF6 A;  2IWB A;  4DKI A;  1WYC A;  1QME A;  2ZM8 A;  1PWC A;  1YT4 A;  3CJM A;  4IBR A;  1M6K A;  5EVI A;  3P98 A;  4LV1 A;  4DRT A;  4S2N A;  1CK3 A;  1KE4 A;  2X02 A;  2Y2J A;  2BLS A;  5CHJ A;  4QY6 A;  2HP5 A;  4GDB A;  1Y54 A;  4KQQ A;  4NET A;  3UPP A;  3G34 A;  2ZQ7 A;  4OVD A;  3TOI A;  1KGG A;  1PI5 A;  3EQU A;  4U0T A;  1KVM A;  4E3N A;  1Q2P A;  3CZD A;  3IWQ A;  2HDS A;  5GL9 A;  1W5D A;  1BLS A;  3VMA A;  2WAE A;  1YQS A;  2IWC A;  3HLC A;  1SCW A;  4PM5 A;  1G6A A;  4C3Q A;  1DJB A;  4JF5 A;  5DF9 A;  1NYY A;  2QZ6 A;  4S2M A;  3QNB A;  1BSG A;  1MPL A;  2P9V A;  1K38 A;  3FKV A;  1MBL A;  4JXW A;  4S2I A;  5EEC A;  5DTK A;  1K55 A;  4LV0 A;  1FR1 A;  3NCK A;  2WAF A;  3PAE A;  2EXA A;  3PBQ A;  4GD6 A;  4RVA A;  2XF3 A;  1N4O A;  4KZB A;  2ZD8 A;  4N92 A;  2R9X A;  4ZDX A;  5AQB A;  4A5R A;  3A3J A;  1S0W A;  1K25 A;  2G2W A;  4JF4 A;  4K91 A;  1LI0 A;  3NDG A;  1GHP A;  2ZC7 A;  3CMZ A;  3IH8 A;  5FQQ A;  3UPN A;  4GNU A;  1K56 A;  5TFQ A;  2WAD A;  3WS5 A;  2V20 A;  4X69 A;  2Z2M B;  2Y2I A;  4GB7 A;  1ZC2 A;  1YLZ A;  3SS3 A;  3IWI A;  3FKW A;  2PU4 A;  1NYM A;  4FCF A;  2EFU A;  4N1X A;  3GQZ A;  5A93 A;  3NDE A;  4WMC A;  1NXY A;  1I2S A;  4KZ5 A;  5CTN A;  4KQO A;  3S1Y A;  1BZA A;  4BD1 A;  3MFD A;  2WZZ A;  2Y2M A;  1FCN A;  2Y2L A;  4E3J A;  4EQI A;  1XX2 A;  3Q82 A;  4FSF A;  4RX3 A;  4S2J A;  4HES A;  2EXB A;  3AGD A;  3OPL A;  3VSL A;  1KDW A;  1NJ4 A;  5FDH A;  4X6T A;  1BUL A;  2ZMA A;  1MWU A;  3G4P A;  3HL9 A;  4IED A;  3IF5 A;  1XP4 A;  4QHC A;  4ZAM A;  4QD4 A;  3UO9 A;  3ZVT A;  4EWF A;  3PBN A;  3G31 A;  3PAG A;  1CI9 A;  4GDN A;  1IYP A;  3A3D A;  3N8L A;  4GKU A;  4KZ8 A;  3UNW A;  4BL3 A;  5A90 A;  5CED A;  5HAQ A;  1YLW A;  1C3B A;  3GV9 A;  5CGS A;  4OQ0 A;  2XR0 A;  5M1A A;  4LV2 A;  2WK0 A;  3BYD A;  4N1H A;  1IYQ A;  4QU3 A;  4Y0T A;  3V5M A;  5GLD A;  1LHY A;  1L0D A;  3MXS A;  2Y2O A;  4PPR A;  3UDX A;  4B4X A;  3DW0 A;  4WYY A;  3P09 A;  1MWS A;  4OPQ A;  4OOY A;  3VOY A;  3ZFZ A;  3ZVW A;  4Z9Q A;  3E2K A;  3IF6 C;  5HX9 A;  4JBF A;  2HDU A;  3SH8 A;  3WWX A;  3BFD A;  4F94 A;  1RP5 A;  2XLN A;  3RXX A;  1W79 A;  2JCH A;  5F83 A;  1GHI A;  3MKE A;  1PW1 A;  4Q8I A;  3GMW A;  1JTG A;  1E4D A;  1MWT A;  1JWZ A;  4OLG A;  2CC1 A;  2Y2Q A;  1YLT A;  4OOL A;  4ZTK A;  4P85 A;  1IEL A;  4QB8 A;  1CI8 A;  2ZC3 B;  1YM1 A;  3UE0 A;  3N4I A;  5TR7 A;  2J9P A;  3MZD A;  3W4P A;  3HLG A;  3MBZ A;  5FAP A;  4GD8 A;  2XEP A;  3Q1F A;  5JYO A;  1YLY A;  4EBP A;  5BOH A;  4KZ4 A;  3M6B A;  2ZQC A;  4MBF A;  2JE5 A;  5D3O A;  4MEZ A;  3LY3 A;  1ESU A;  4ZJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...