5DFYA

Structure of the parental state of gaf3 from slr1393 of synechocystis sp. pcc6803 (in vitro assembled protein/chromophore)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'GSLQNIFRATSDEVRHLLSCDRVLVYRFNPDWSGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRAFLTVPVFVGEQLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
molecule tags Transferase
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
publication title Three dimensional structure of the parental state of GAF3 from Slr1393 of Synechocystis sp. PCC6803
rcsb
total genus 50
structure length 158
sequence length 158
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dfyA00
1STZA 2VEAA 4QPRA 2GX5A 2W3FA 2O0YA 2VKSA 4EU0A 5DFYA 2K31A 4GLQA 5I5LA 2XSSA 3E98A 3KSIA 1MKMA 3O5YA 2M7VA 3S7OA 3NOUC 3LFVA 4RQ9A 3VV4A 1TF1A 1MC0A 3IBJA 1ZTUA 3CITA 2M7UA 4BWIA 4G3VA 3MQ0A 5AJGA 2LB5A 2LB9A 4R6LA 2W3GA 4Q0JA 3ZQ5A 3S7NA 4E04A 5HSQA 2W3EA 5HL6A 4ZRRA 2B18A 3MMHA 4Z1WA 4GW9A 4PAUA 4MDZA 2HGVA 3R4KA 3D3OA 3S7PA 2W1TA 1YKDA 4Q0HA 2OOLA 3C2WA 5LBRA 2O99A 1YSPA 4IJGA 4ETXA 3CI6A 3MF0A 2KOIA 3RFBA 4YOFA 4EUVA 3BJNA 4IUHA 1TD5A 3TRCA 3G6OA 4FOFA 1YSQA 3E0YA 3HCYA 4MN7A 4G3WA 5L8MA 3NOTC 4LRZE 1F5MA 5TJJA 3KO6A 2VJWA 5HPFA 3S7QA 4DMZA 2KLIA 2IA2A 3KSFA 4LRYC 3IBRA 4G3KA 3EEAA 5C5KA 2XRNA 3NHQA 2K2NA 4Y5FA 2ZMFA 2VZWA 4Y3IA 3OBFA 2W3HA 4Q0IA 2O9AA 3OOVA 2XROA 4YNRA 4R70A 3K2NA 5DFXA 4O01A 2Y79A 4ME4A 4Y2FA 2O9BA 4O0PA 4MCWA 2W1RA 4CQHA 3DBAA 5HPIA 3NOPC 4DN0A 5K5BA 2Y8HA 3KSGA 4IUKA 2QYBA 4ETZA 2W3DA 2W1TB 4MMNA 3W2ZA 4O8GA 2G7UA 4LRXC 2O9CA 1VHMA 3KSHA
chains in the Genus database with same CATH superfamily
4X25A 4UEYA 4EUZA 2ZOHA 3LR5A 4X1MA 4Z9QA 2ZM2A 3N8LA 4DJ2A 2XSSA 3HLDA 1RGZA 3N4IA 1ES3A 2NUPC 3VV4A 1MY8A 3W8KA 1PZPA 4NEED 2Z2LB 2W3GA 4OLDA 1TEMA 3BEBA 1CEGA 4E3IA 4X68A 3MMHA 3IQAA 3S7PA 3H82A 2V9AA 4ESPA 3JVUA 2BASA 4LENA 2XK1A 4KQQA 3PXPA 3PBOA 1IKIA 2Q9NA 2J9PA 5G4YA 1VETB 3T4LA 3TJZC 1YSQA 2V2FF 2QMIA 3HLWA 3BLSA 4RA7A 4E3NA 3MR0A 1OTAA 1UWNX 1W63M 2EX6A 4LV0A 4O7DA 1KGEA 1LL5A 4OQHA 4CLCE 2ZOIA 5HAPA 3HLEA 4PHTA 2W3HA 5AVEA 4KQRA 2JKGA 5FEFA 3CWFA 4QWOA 1FR6A 1CK3A 1MPLA 3NY4A 4P85A 3FPWA 3BFEA 4FH4A 1K56A 4PKYA 1W79A 4MMNA 4N9LA 3B33A 5JYPA 1EROA 2YKFA 1GHIA 4IBXA 5M19A 5CRFA 3IXBA 2ZC5B 2AVXA 1G6AA 5FI6A 1S4RA 2KDKA 4S2MA 3E4OA 3N8SA 3UB8A 2XDMA 1YLZA 1FSWA 3E98A 2HPBA 2OLUA 3CZDA 4M4XA 5EOOA 1MC0A 4X1LA 2YKHA 1OTIA 4Y0OA 2HZ5A 2VX8A 4X6TA 2OWHA 4WM9A 2WGWB 3FPVA 3UMEA 2XFSA 4XT2A 2W1TA 3IF5A 4KZ3A 4GDBA 1BSGA 4DXBA 4XT2B 4ARZB 3ZYTA 2V8CA 2OLVA 4JXWA 2WZZA 5FQ9A 1T1CA 3IWOA 1F5MA 3IXGA 5HDDA 1VETA 5E2FA 4ARZA 4KZ9A 4NETA 1KVMA 2K2NA 4DKIA 5FSRA 1JWPA 4Q0IA 4BD1A 4U3TA 1K4FA 2HJ9C 3KYZA 1OTBA 1Q2PA 3KYEA 5U47A 4KZ8A 4U0XA 1YLWA 2XR0A 4JXGA 2Y8HA 4ETZA 3MXSA 3QNCA 1XKZA 3M6BA 1XFNA 2DNSA 4NXFA 5DF8A 1VHMA 3KSHA 4CJNA 1LL8A 1K56D 1Z09A 3UB6A 3PYPA 2C5WB 3VE3A 1GSVA 2VKSA 3CUEC 1YLPA 3NC8A 4MLLA 1A0KA 4KUOA 4KZ7A 1ES5A 1ZTUA 5F69A 3Q1FA 3TSGA 5EVIA 1U60A 4IBRA 3ULFA 2LB9A 5DTKA 2ZC7A 5I94A 2ZMAA 1E25A 4KZ4A 3U4LP 5CERA 2GJ3A 4Q0HA 3VP4A 4IHQA 4IJGA 1ZC2A 4BBUA 1RP5A 3BWLA 2V1AA 3BYDA 4B4XA 1G5UA 5DVAA 3LUQA 2WK0A 2PT7A 3IWIA 3CUEA 4KZ5A 3GRJA 3UB9A 5FAOA 1O7EA 5FQMA 3UE3A 2IA2A 3UPPA 3WRTA 3G34A 1BULA 2HF6A 2RL3A 3OCNA 2J3WA 1TVFA 2IWBA 1XXMA 1LT0A 4UA9A 2HDRA 1BT5A 5E2GA 4B88A 5JYOA 2Y2LA 5HD5A 4IVIA 5A91A 1ZHHB 4KUKA 4WYYA 3QP2A 2EWVA 1KE4A 2WKEA 3T1RA 2BG1A 4HJ3A 1OPXA 2PDRA 1S6RA 2P7JA 3ITBA 3KSIA 4QD4A 4CLCC 4IEDA 4D60A 2M7UA 3W4QA 5CEBA 1L0GA 1KGFA 5FEGA 2VGLS 3EQUA 5IHVA 5FQKA 2V0WA 2L0WA 2PRFA 4EV4A 4I38A 3VE4A 2B18A 1XJ3A 4FTXA 4HI4A 3D72A 2GDNA 4F3LB 2DRWA 2ZLYA 2ZL1B 3SZTA 3HLBA 4EQIA 2ZQ7A 1FCMA 5AQ7A 4FOFA 3W4OA 1SHVA 3PTEA 2P04A 5FI2A 3CLOA 4LCLA 1YLJA 5EOEA 4MBHA 4K0XA 1ES4A 3IX8A 4LRYC 1VQQA 1SCWA 4DJ3A 1BLSA 5CHMA 4YNRA 5AQBA 5L09A 3T50A 2ZC3B 4FH2A 4MCWA 4B4ZA 1LSVA 1CEFA 1NRJA 4S2NC 5J7EA 5HPIA 3NOPC 4GS9A 2H0TA 3IHAA 2W1TB 3Q7VB 1NLYA 3T12B 2WYXA 3IH8A 2B02A 3F1NA 4LV3A 4ZAMA 2ZQAA 2E8IA 2Y91A 3H9WA 3NJAA 1IYPA 5E2EA 1JNUA 5M18A 2VGJA 5AQ9A 5TBMA 5AJGA 1DP6A 1SZVA 1KOUA 5EFWA 1SDEA 1K4EA 3T4SA 4PM7A 2V1BA 1L0FA 1X0OA 3G35A 1OJ5A 3E2KA 2VV8A 4OPQA 2JKRI 4S2KA 4KG2A 2Y2HA 1SKFA 4GD6A 4GN2A 3FKWA 2XFTA 4MN7A 2P9VA 3FKVA 1W63Q 2QKPA 3LY3A 1S4SA 5DTSA 1K38A 2HJEA 1MWTA 3FG8A 4Y7PA 1OMEA 1J9MA 2QZ6A 4PM5A 1FCOA 3ZHHA 2H5SA 4WZ5C 1IYSA 5CEDA 4HHDA 3MKEA 4Y0TA 1V9YA 1UGUA 3G2ZA 4O0PA 2DMWA 2W27A 3UB5P 4LLOB 3HL9A 5GHYA 3NECA 1Y54A 1D1JA 5TFQA 2W3DA 1SKOB 1OTEA 2FFFB 4HIAA 2EA9A 3GTCA 2VGLM 1FR1A 5AQAA 5F5YA 3HLCA 3A3JA 3MZFA 2K31A 2PHYA 3P09A 5HDCA 2M7VA 4RQ9A 1TF1A 2FZ0A 4I3IA 4EEUA 4G3VA 4LCMA 3O87A 4R6LA 1P97A 2C6WB 2EX2A 4DXCA 2JN7A 4WEKA 1PI5A 4LPZA 2WKIA 3LIBA 1E3UD 2XQZA 3VP0A 4S2JA 3HBRA 1KVLA 3MF0A 3I7JA 3ZCZA 5EUAA 2Z2MB 1XA7A 1T19A 2M1CA 3FZCA 4R4SA 3TRCA 5HAIA 3QP8A 3A3IA 3O88A 1YLYA 3LI9A 4Y0UA 2OV5A 2PYRA 4K0WA 4OPRA 3GV9A 1N4OA 2CMNA 4OOYA 2H0YA 3UB7A 5F1GA 2W0NA 1DY6A 5CHJA 2QHKA 3OPRA 4L9GA 4GJ4A 4GCZA 3HUMA 3RTYA 3CJMA 3UDIA 2HDUA 4LV1A 3M2JA 1D06A 1HTZA 4GB7A 4I3AA 5TGFA 4A5RA 1VEUA 2XLNA 4XUXA 3MXQA 1ERQA 3SOIA 3ZGAB 3CMZA 5FDSA 1OTDA 4X56A 5FI7A 1MKMA 3PR6A 5HWTA 5EECA 1VM1A 3WRZA 1K55A 3NOUC 3CHWP 1OT9A 4HJ4A 4BWIA 1K57C 2WUQA 4GS9B 4WELA 3MQQA 4EEPA 4HP9A 4M3KA 5J4EA 3QNBA 3ZQ5A 1XFQA 3S7NA 4E04A 4OPYA 1G28A 5D3OA 5EM1A 4RVAA 1FSYA 4X53A 3WS0A 2ZC4B 2V0UA 3L9KA 1P9WA 1H3QA 3FYZA 5FATA 2NUTC 1XPBA 4I39A 3QP5A 1S67L 1M40A 4JKTA 4YOFA 3SS5A 5KSCA 4QY6A 3T4QA 1V9ZA 3MS6A 4BJPA 1XJ2A 4PM9A 3JVVA 3HVFA 2XGNA 2GNXA 2VJWA 5AVFA 2ZQ9A 2WGIA 3NCKA 5IT5A 2PR5A 4Y5FA 3MFDA 2ZM8A 4AFIA 3LO7A 5CTNA 3K2NA 2Y2MA 4R0QA 5EVID 4NXBA 2A3UA 1ESUA 4N1HA 5IU1A 5K5BA 2B95A 2IWDA 2CC1A 3B3XA 3D9YA 4R23A 3FV7A 4PMAA 3A0RA 3OPLA 3ITAA 3WS4A 5KSHA 3L7HA 2JKTI 1HVBA 5CTMA 5FA7A 1P0ZA 5HX9A 3E4QA 3O5YA 4ZJ3A 4CLCD 3LICA 3BFFA 3IBJA 2Y2GA 4LFUA 4GKUA 1QMFA 3G2YA 4BD0A 5HDSA 2A49A 2QPNA 1IYOA 2WKPA 1ESIA 3AGDA 1LSWA 1ONHA 5DF7A 4ZRRA 4OLGA 4PAUA 1DJBA 1XJ4A 4NXGA 5CX7A 1TDGA 2X02A 2V1ZA 3N8RA 3MKFA 3BW6A 5DF9A 5IS1A 4NK3A 1W5DA 3FC7A 3A0VA 2VV6A 3FWLA 5G18A 2WGVA 4E6XA 3H82B 2PU2A 2PD8A 5EM0A 3O86A 3HJIA 5L8MA 3AGEA 4E3OA 4L9FA 4QU3A 5HPFA 2D02A 5DKKA 1K6SA 3KSFA 3UPNA 4G3KA 4EESA 3K3DA 1GSXA 3MFXA 3LCEA 5HZHA 3ZNYA 1N9LA 2WKHA 1W7FA 1ZKJA 1GA9A 3ZG9B 3VP3A 3IS2A 4WF0A 3M2KA 5EVIC 1DP8A 4GDNA 4N9KA 3P01A 3PAEA 2ACGA 1NZUA 4DE3A 5G4ZA 2JC7A 2Y2NA 3EOIA 2Y2QA 2Y2IA 1BYWA 1YPRA 2D01A 3IT9A 3C7VA 1M6KA 1QMEA 3IX3A 1F98A 3AGFA 4HEFA 2K7SA 3BM6A 4DE0A 2XA7M 3TE8A 3GQZA 2J8YA 4N1XA 4Q0JA 3O3VA 3LGOA 4P6BA 3IHBA 1PNEA 2Y2OA 3VSLA 1O07A 4ZBEA 3UE1A 2J80A 1BZAA 3B47A 4FSFA 3ZFZA 4QB8A 1PWCA 3CI6A 3UDFA 3ZG0A 2B5RA 1NWZA 3DTMA 3RFBA 5EVEA 5FQJA 3HLGA 2WGWA 4HBTA 2EFUA 2OAQ1 2H28A 2VV7A 3EGDC 3MSHA 2PR6A 3C30A 3UPOA 1G6OA 4ZJ2A 2EFXA 3GECA 3T1XA 3E4PA 3G30A 4FCFA 4DMZA 1P9RA 1MZUA 3EEAA 1FQGA 4HBUA 3LIAA 1MWUA 3F1NB 2O9AA 4JGQA 3OOVA 4JGRA 4RX3A 3ZG5A 4X55A 1CI8A 2PBDP 1GHMA 2XA7S 3WS5A 1TS7A 4F94A 5L07A 3V3SA 2JE5A 4OQ0A 1EI5A 2QYBA 2FFYA 3WWXA 3MXRA 4X69A 3VFFA 1T1BA 4UHUA 2O9CA 4JF6A 3VP2A 1I5QA 4MBFA 3LR0A 2EXBA 2X71A 3TG9A 2R9WA 4GHIB 4RX2A 3PBQA 4HP4A 4QJGA 3NDEA 4C3QA 1KGGA 3MQOA 4YFMA 5BOHA 2OWJA 4GHIA 4BQMA 1LHYA 1DJAA 3GSGA 4EWFA 1WA9A 4Z1WA 3KYQA 3K3CA 5TR7A 3CAXA 3P98A 3UO9A 1YKDA 1K6RA 1NZOA 1IFQA 4OP5A 2JKTM 3ISGA 4S2NA 4JXSA 3M6HA 4S2OA 3ZVWA 1MWSA 4WUJA 3MBZA 3MZEA 1LI9A 4JGOA 1DP9A 3C8CA 3LI8A 5TJJA 3DWZA 4HJ6A 3HLFA 5GLBA 1SKOA 4OVDA 5A92A 1HD8A 1H8MA 5FDHA 5F1FA 2V20A 4H6JB 4OPZA 4ME4A 1K54A 5KMWA 3DTKA 4CQHA 2Y55A 3JPUA 5EVIB 2INWA 1E4DA 4UQIM 2J3TD 1CI9A 2Y59A 3W2ZA 4O8GA 2JKRM 4ID4A 4XXRA 3GR2A 1ACFA 2UV0E 4HH2A 1STZA 2VEAA 4WN5A 3PBRA 1T1AA 4ZDXA 3V5MA 3PAGA 1NYMA 2Y2PA 1NJ4A 2PAVP 2XEPA 5J8XA 4BMWA 3OZHA 2HV1A 3UE0A 2XD1A 3Q7VA 2P08A 4II7A 3Q82A 4JPMA 1IYQA 1JWZA 1TS0A 4FUWA 4WZ4A 3IWQA 4DF6A 3SH8A 4JF5A 5FQQA 1H5XA 3LY4A 2R9XA 4KG6A 4JGPA 4WZ5A 3CPTA 1JVJA 4CPKA 4WMCA 5GLDA 4Y17A 3HUOA 1YSPA 3EQVA 3RH8B 5L10A 3TW8A 2Y2KA 4K91A 1HZOA 3D4FA 1F9IA 4JBFA 3LR3A 1OT6A 3WS1A 3NOTC 4N92A 1PYYA 1K0KA 3ZG8B 1XJ6A 2XRNA 2P9VB 4Y3IA 3WS2A 3T1QB 2XROA 5DFXA 4DE2A 2HP6A 4Y2FA 2PYPA 2W1RA 3DBAA 4EXOA 3F1OB 5GLAA 3A3DA 2P74A 3A3FA 4L9EA 3KSGA 2ZQCA 3BLMA 3NI9A 2DCFA 2V8FA 1T18A 3G31A 5A8BA 3UMDA 1PW1A 2G7UA 4GNUA 3BECA 4EU0A 1K25A 5I5LA 4L0LA 4YWZA 1XX2A 3BY8A 4WLAA 5CGSA 1FCNA 3GDIA 3NIAA 4JF4A 2HP5A 1L0DA 2A24A 1YMSA 3NDGA 2G2WA 1I2WA 2JBFA 2W3EA 4HQAA 1LSXA 4R3BA 1D7EA 4R1GA 1WYBA 3EGXC 4KQDA 3PBSA 1NYYA 2OAP1 5HARA 1FOFA 1JTDA 2ZJ9A 4WMCD 1ZG6A 2Z6CA 3F1PB 2ZBBA 5HWVA 4MBKA 3UNWA 3HUNA 3ICYA 2J9OA 1S66L 2XH9A 4BL3A 4FD8A 2KLIA 3IX4A 4R3AA 2UWXA 2RCXA 3HJKA 3VFHA 2HP9A 4JXVA 1FIKA 2ZMFA 3A3EA 4UQIS 4RYEA 3OBFA 3Q7ZA 3N6IA 4O01A 1K55C 3DWKA 4BL2A 1ALQA 1J3WA 1PRQA 1XGIA 3C4PA 1K57A 5TBMB 3UN7A 2JKFA 1UWPX 4GZBA 5HL1A 3VOZA 1AWIA 1MWRA 1JTGA 2J7VA 1CF0A 3S1YA 5FAQA 3GVBA 3T4KA 4Y15A 5E43A 3C4OA 4NXEA 4QPRA 3SH9A 3QP6A 1ONGA 4QY5A 1ODVA 4EERA 1S1ZA 2O0YA 2W3FA 2VA0A 3JYIA 4MEZA 5F68A 3SS3A 4EBLA 3OPPA 1PZOA 3T1SA 2XF3A 4HOIA 3ZNTA 3DTEA 3PBNA 1KE0A 5EE8A 1S1YA 3B42A 1CQAA 2ZL1A 4KZAA 2EX8A 2IWCA 2PU4A 4JLFA 3QHYA 2WAFA 3LIDA 4DRTA 3BFDA 3BY9A 5HD3A 4BBTA 5HL6A 1HLUP 1KDWA 4S2IA 5FQIA 4BENA 3G4PA 2A24B 4NG2A 2J3TC 1XA1A 3LIEA 1IELA 3U2AA 4EQ1A 1KE3A 3OCLA 3QP4A 5HAQA 1YLTA 5F82A 5EVLA 1YT4A 1L3LA 2EX9A 5E2HA 3OPHA 3LYXA 4H8RA 2VK3A 4C6YA 5J3WA 3Q07A 4E3LA 1NY0A 4R4RA 4MNRA 2X01A 1N9NA 1ZG4A 3LEZA 2VZWA 2ZQ8A 1S0WA 3NBLA 3V50A 4EETB 4KENB 2A2LA 1EWZA 3LIFA 4OQGA 2Q9MA 3EEHA 3G32A 4EBNA 2L1MA 2WADA 5DTTA 2GZAA 4KQOA 3IF6C 4IUKA 4QHCA 3CPTB 1VB6A 1L2SA 2WKQA 3KX0X 1Y4OA 4HH3A 1E3UA 2EWWA 4Y13A 5FAPA 2JCHA 2Z6DA 5FL3A 1GHPA 4I5SA 2PD7A 3V67A 4GLQA 5CXWA 1YM1A 2KX6A 5KIZA 4OP8A 1TDLA 1MBLA 2ZMVA 3LFVA 3T4OA 3EWKA 4BBVA 4OONA 3C5AA 2QWSA 2QJ5A 3IXHA 1IKGA 3VOYA 4IVKA 5A93A 4MDZA 3R4KA 3IF6B 4UA6A 5EV0A 3C2WA 3IH9A 2ZC6B 2O99A 3UDXA 1NRFA 3BFCA 4E6WA 3F1OA 4E3JA 4EUVA 3IF6A 2BTFP 4OOMA 2VLGA 3PBTA 1ES2A 4GD8A 4OOLA 3SS4A 3VOLA 3E0YA 3SW1A 5GLCA 4KZBA 3HCYA 1CJFA 2WZXA 4H6JA 1W8YA 3H7WB 2HDQA 4CLCB 1N9OA 1TS8A 1I2SA 5DJUA 1OJGA 2PBYA 4DDSA 3CG5A 4B9OA 3N7WA 1WE4A 3IS2B 3NHQA 3H7WA 4CLCA 1G68A 4WL9A 5DJTA 4ZJ1A 3OLOA 4UA7A 4KZ6A 4NKPA 3QP1A 1Y28A 4BLMA 3BRMA 3W4PA 3A0SA 3DAVA 3MZDA 1TS6A 1RCJA 5DKLA 4DE1A 4UAAA 5HWWA 2Y4AA 1JWVA 1H8YA 1F2KA 2L4RA 1SDNA 5GHXA 4U0TA 4I3JA 3SH7A 4B93A 1GCEA 1PWGA 4YINA 1PIOA 1YQSA 3VMAA 4R3JA 1XGJA 5DFYA 4PPRA 3R7WB 3NULA 5GL9A 2VGKA 3RJUA 3T4TA 4F3LA 4LV2A 4WEJA 2WKRA 3T4JA 3BFGA 4R38A 3LR4A 1AXBA 5MC7A 2HDSA 2JHEA 1BLPA 1MXOA 3V39A 1VEUB 2EXAA 2BLSA 4GW9A 3E2LA 2E8JA 3D3OA 4D2OA 3IXDA 1BLHA 5HW3A 1BUEA 2ZM0A 4ETXA 2XD5A 5EPHA 4P87A 3GMWA 1TD5A 5F83A 3G6OA 1MKIA 1WYCA 1Z6FA 2ZQDA 1GSWA 1YAXA 4XUZA 4G3WA 1PFLA 4S2LA 1FILA 4LRZE 1PI4A 1XP4A 4PM6A 3BQ8A 4GOGA 5L2FA 3DW0A 4KG5A 3S22A 5FASA 4WBGA 4K08A 1IOUA 1PW8A 2OSUA 1H8ZA 1DJCA 4PKYG 5KZHA 4C75A 2O9BA 4HESA 3HREA 4OKPA 3S4XA 2FH5A 1N9BA 3RXWA 1NXYA 4LGWA 5GHZA 3F1PA 4LRXC 5A90A 4IUHA 5CHUA 1EW0A 3LEQA 2GX5A 4PM8A 1IEMA 1LLBA 5CGWA 1KDSA 3V3RA 3TOIA 4ZTKA 2Y2JA 3S7OA 1YMXA 4P6ZS 3CITA 1NLZA 1BLCA 1W8QA 4P6ZM 3MQ0A 3MJQA 2Q0OA 2LB5A 2MJ6A 1LI0A 3R7WA 4HNBA 5HSQA 3ZG7B 1C3BA 3DTIA 5CECA 3UE6A 2HGVA 2ZD8A 3ZVTA 1LL9A 2OOLA 5LBRA 2KOIA 3UY6A 1K54C 3BJNA 4MN5A 4OH0A 4DDYA 1RGYA 4P0MA 3VP1A 4MN6A 2I72A 5CGXA 1H0MA 3BQAA 3VSKA 1DRMA 3KO6A 1BTLA 2QJ7A 3RXXA 3Q81A 3S7QA 4EBPA 2G2UA 4OQIA 3OC2A 2H10A 3IBRA 4Q8IA 2I9VA 5C5KA 5HFOA 1L0EA 2R78A 4E3KA 4HY8A 4R70A 1Q2QA 4S2PA 2Y79A 5F6AA 5M1AA 4EW7A 1GA0A 4DN0A 1PWDA 3C7UA 2WAEA 4E3MA 3P7NA 3ZDJA 1ERMA 3PHYA 3C38A
chains in the Genus database with same CATH topology
4NXEA 4QPRA 2B02A 3F1NA 4EERA 1ODVA 4UEYA 1S1ZA 2O0YA 2W3FA 2ZOHA 2VA0A 3H9WA 3NJAA 3LR5A 5F68A 4DJ2A 1F98A 2XSSA 1JNUA 2NUPC 4HOIA 3VV4A 2K7SA 3PBNA 5TBMA 2XA7M 1S1YA 3TE8A 4NEED 3B42A 5AJGA 1DP6A 1KOUA 5EFWA 2W3GA 4Q0JA 3T4SA 3LIDA 3BY9A 5HD3A 4BBTA 5HL6A 3MMHA 2V1BA 1X0OA 3S7PA 3H82A 2V9AA 2J80A 3JVUA 1OJ5A 2BASA 3B47A 4FSFA 2A24B 3CI6A 3PXPA 2VV8A 3PBOA 2JKRI 2J3TC 1NWZA 3LIEA 3RFBA 3U2AA 4EQ1A 5G4YA 3T4LA 3OCLA 3TJZC 1YSQA 2OAQ1 4MN7A 2H28A 2VV7A 3EGDC 3MR0A 2PR6A 3C30A 1G6OA 1OTAA 1W63Q 1UWNX 3GECA 3LYXA 2QKPA 1S4SA 1W63M 3E4PA 2HJEA 5J3WA 3FG8A 4DMZA 4CLCE 1P9RA 2ZOIA 1MZUA 3EEAA 1N9NA 2VZWA 3LIAA 4PHTA 2W3HA 5AVEA 3F1NB 4HHDA 2O9AA 4JGQA 3OOVA 4JGRA 1V9YA 4EETB 3CWFA 2A2LA 3LIFA 1UGUA 2XA7S 3EEHA 4O0PA 1TS7A 2DMWA 2W27A 2L1MA 3FPWA 4LLOB 2GZAA 4KQOA 4IUKA 2QYBA 1VB6A 2W3DA 4PKYA 1OTEA 4MMNA 2WKQA 3B33A 3KX0X 1T1BA 4HH3A 4HIAA 2O9CA 2YKFA 2EA9A 2EWWA 2VGLM 2Z6DA 5FL3A 3LR0A 5F5YA 4I5SA 1S4RA 2PD7A 2K31A 2KDKA 2PHYA 3V67A 4GLQA 3E4OA 3UB8A 2KX6A 5KIZA 3E98A 4GHIB 5HDCA 2ZMVA 4M4XA 2M7VA 3LFVA 4RQ9A 3T4OA 1TF1A 1MC0A 3EWKA 3PBQA 4HP4A 2FZ0A 4I3IA 4EEUA 4BBVA 2YKHA 1OTIA 4G3VA 3MQOA 2OWJA 4GHIA 4R6LA 1P97A 2QWSA 2JN7A 2QJ5A 2VX8A 2OWHA 4WEKA 3FPVA 1WA9A 4Z1WA 3UMEA 3KYQA 3K3CA 4LPZA 4MDZA 3CAXA 3R4KA 4XT2A 3LIBA 2W1TA 1YKDA 3C2WA 2O99A 3MF0A 3F1OA 1IFQA 4EUVA 1T19A 2M1CA 4OOMA 4XT2B 2VLGA 4ARZB 2JKTM 3PBTA 3TRCA 4OOLA 3VOLA 3ZYTA 3E0YA 3SW1A 3HCYA 3LI9A 4WUJA 4H6JA 3H7WB 4CLCB 1N9OA 1TS8A 2PYRA 4JGOA 1T1CA 1DP9A 3C8CA 1F5MA 3LI8A 5TJJA 5DJUA 1OJGA 5HDDA 4HJ6A 2CMNA 4ARZA 3UB7A 4B9OA 2W0NA 3IS2B 2QHKA 3NHQA 2K2NA 3H7WA 4CLCA 4WL9A 4Q0IA 4L9GA 4GJ4A 1H8MA 5DJTA 3OLOA 2HJ9C 3KYZA 4NKPA 1OTBA 4H6JB 4ME4A 1Y28A 4GCZA 3A0SA 4CQHA 3RTYA 1TS6A 5DKLA 5HWWA 2INWA 4UQIM 2J3TD 2Y8HA 1D06A 4ETZA 2L4RA 4I3AA 3W2ZA 1XFNA 4O8GA 2JKRM 4NXFA 4I3JA 4B93A 1VHMA 3KSHA 4HH2A 1STZA 2VEAA 1LL8A 4WN5A 3PBRA 1T1AA 3MXQA 3UB6A 3PYPA 3VE3A 1GSVA 2VKSA 3CUEC 5DFYA 3R7WB 1OTDA 4KUOA 4BMWA 1MKMA 2HV1A 3PR6A 5HWTA 3T4TA 3NOUC 2P08A 4F3LA 4II7A 1OT9A 1ZTUA 4HJ4A 4WEJA 1TS0A 2WKRA 4BWIA 3T4JA 5F69A 4R38A 4GS9B 4WELA 3ULFA 3LR4A 2LB9A 3MQQA 4HP9A 4EEPA 5J4EA 3ZQ5A 1XFQA 5MC7A 3S7NA 4E04A 1G28A 2JHEA 4GW9A 4JGPA 3D3OA 2GJ3A 2V0UA 1P9WA 4Q0HA 1H3QA 4IHQA 1YSPA 3EQVA 4IJGA 4ETXA 2NUTC 4I39A 3RH8B 4BBUA 1S67L 3BWLA 3TW8A 2V1AA 4YOFA 1TD5A 3G6OA 3T4QA 1F9IA 1GSWA 3LUQA 3LR3A 1YAXA 1V9ZA 4G3WA 4BJPA 1XJ2A 1OT6A 2PT7A 3NOTC 4LRZE 3JVVA 3CUEA 3BQ8A 2GNXA 2VJWA 3UB9A 5AVFA 3UE3A 2IA2A 1XJ6A 5IT5A 2PR5A 2XRNA 4Y5FA 2HF6A 4Y3IA 4AFIA 4K08A 1IOUA 2XROA 3OCNA 4PKYG 3K2NA 5DFXA 2J3WA 4Y2FA 2O9BA 2PYPA 2W1RA 1LT0A 4NXBA 3DBAA 4EXOA 3F1OB 5IU1A 2FH5A 5K5BA 4L9EA 3KSGA 5HD5A 1T18A 1ZHHB 4KUKA 5A8BA 3UMDA 2G7UA 2EWVA 3F1PA 4LRXC 3A0RA 4IUHA 5KSHA 1EW0A 2GX5A 4EU0A 4HJ3A 1OPXA 2JKTI 2PDRA 5I5LA 2P7JA 4L0LA 4YWZA 1P0ZA 3BY8A 3KSIA 4WLAA 3E4QA 3O5YA 4CLCD 3S7OA 3GDIA 3LICA 4P6ZS 3IBJA 3CITA 4CLCC 1NLZA 2M7UA 4P6ZM 2A24A 3MQ0A 3MJQA 2LB5A 5HDSA 2VGLS 3EQUA 2MJ6A 2V0WA 2WKPA 3R7WA 4HNBA 2L0WA 4I38A 3VE4A 5HSQA 4HQAA 1LSWA 2W3EA 4ZRRA 2B18A 1XJ3A 3UE6A 1LSXA 4PAUA 1XJ4A 2HGVA 4HI4A 3D72A 4NXGA 5CX7A 1D7EA 4F3LB 2OOLA 3EGXC 5LBRA 4KQDA 3BW6A 5DF9A 5IS1A 3PBSA 2KOIA 2OAP1 3FC7A 3A0VA 3BJNA 2VV6A 4MN5A 4FOFA 3H82B 2P04A 2Z6CA 3F1PB 2PD8A 4MN6A 2ZBBA 3BQAA 1DRMA 3HJIA 5L8MA 5HWVA 3CLOA 4L9FA 3KO6A 3ICYA 2QJ7A 5HPFA 1S66L 2D02A 3S7QA 5DKKA 2KLIA 4R3AA 3OC2A 3KSFA 4LRYC 3IBRA 4G3KA 3HJKA 3K3DA 4EESA 2I9VA 5C5KA 1GSXA 2ZMFA 3MFXA 4DJ3A 4UQIS 3OBFA 2R78A 5HZHA 1N9LA 4HY8A 4YNRA 4R70A 4O01A 3T50A 2Y79A 3IS2A 5F6AA 4MCWA 4WF0A 1LSVA 1NRJA 5TBMB 4EW7A 5J7EA 5HPIA 1UWPX 1DP8A 3NOPC 4GS9A 4DN0A 3P01A 5G4ZA 3EOIA 3P7NA 2W1TB 3PHYA 1NLYA 3T4KA 1BYWA 3C38A 2D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STZ A;  2VEA A;  4QPR A;  2GX5 A;  2W3F A;  2O0Y A;  2VKS A;  4EU0 A;  5DFY A;  2K31 A;  4GLQ A;  5I5L A;  2XSS A;  3E98 A;  3KSI A;  1MKM A;  3O5Y A;  2M7V A;  3S7O A;  3NOU C;  3LFV A;  4RQ9 A;  3VV4 A;  1TF1 A;  1MC0 A;  3IBJ A;  1ZTU A;  3CIT A;  2M7U A;  4BWI A;  4G3V A;  3MQ0 A;  5AJG A;  2LB5 A;  2LB9 A;  4R6L A;  2W3G A;  4Q0J A;  3ZQ5 A;  3S7N A;  4E04 A;  5HSQ A;  2W3E A;  5HL6 A;  4ZRR A;  2B18 A;  3MMH A;  4Z1W A;  4GW9 A;  4PAU A;  4MDZ A;  2HGV A;  3R4K A;  3D3O A;  3S7P A;  2W1T A;  1YKD A;  4Q0H A;  2OOL A;  3C2W A;  5LBR A;  2O99 A;  1YSP A;  4IJG A;  4ETX A;  3CI6 A;  3MF0 A;  2KOI A;  3RFB A;  4YOF A;  4EUV A;  3BJN A;  4IUH A;  1TD5 A;  3TRC A;  3G6O A;  4FOF A;  1YSQ A;  3E0Y A;  3HCY A;  4MN7 A;  4G3W A;  5L8M A;  3NOT C;  4LRZ E;  1F5M A;  5TJJ A;  3KO6 A;  2VJW A;  5HPF A;  3S7Q A;  4DMZ A;  2KLI A;  2IA2 A;  3KSF A;  4LRY C;  3IBR A;  4G3K A;  3EEA A;  5C5K A;  2XRN A;  3NHQ A;  2K2N A;  4Y5F A;  2ZMF A;  2VZW A;  4Y3I A;  3OBF A;  2W3H A;  4Q0I A;  2O9A A;  3OOV A;  2XRO A;  4YNR A;  4R70 A;  3K2N A;  5DFX A;  4O01 A;  2Y79 A;  4ME4 A;  4Y2F A;  2O9B A;  4O0P A;  4MCW A;  2W1R A;  4CQH A;  3DBA A;  5HPI A;  3NOP C;  4DN0 A;  5K5B A;  2Y8H A;  3KSG A;  4IUK A;  2QYB A;  4ETZ A;  2W3D A;  2W1T B;  4MMN A;  3W2Z A;  4O8G A;  2G7U A;  4LRX C;  2O9C A;  1VHM A;  3KSH A; 
#chains in the Genus database with same CATH topology
 4X25 A;  4UEY A;  4EUZ A;  2ZOH A;  3LR5 A;  4X1M A;  4Z9Q A;  2ZM2 A;  3N8L A;  4DJ2 A;  2XSS A;  3HLD A;  1RGZ A;  3N4I A;  1ES3 A;  2NUP C;  3VV4 A;  1MY8 A;  3W8K A;  1PZP A;  4NEE D;  2Z2L B;  2W3G A;  4OLD A;  1TEM A;  3BEB A;  1CEG A;  4E3I A;  4X68 A;  3MMH A;  3IQA A;  3S7P A;  3H82 A;  2V9A A;  4ESP A;  3JVU A;  2BAS A;  4LEN A;  2XK1 A;  4KQQ A;  3PXP A;  3PBO A;  1IKI A;  2Q9N A;  2J9P A;  5G4Y A;  1VET B;  3T4L A;  3TJZ C;  1YSQ A;  2V2F F;  2QMI A;  3HLW A;  3BLS A;  4RA7 A;  4E3N A;  3MR0 A;  1OTA A;  1UWN X;  1W63 M;  2EX6 A;  4LV0 A;  4O7D A;  1KGE A;  1LL5 A;  4OQH A;  4CLC E;  2ZOI A;  5HAP A;  3HLE A;  4PHT A;  2W3H A;  5AVE A;  4KQR A;  2JKG A;  5FEF A;  3CWF A;  4QWO A;  1FR6 A;  1CK3 A;  1MPL A;  3NY4 A;  4P85 A;  3FPW A;  3BFE A;  4FH4 A;  1K56 A;  4PKY A;  1W79 A;  4MMN A;  4N9L A;  3B33 A;  5JYP A;  1ERO A;  2YKF A;  1GHI A;  4IBX A;  5M19 A;  5CRF A;  3IXB A;  2ZC5 B;  2AVX A;  1G6A A;  5FI6 A;  1S4R A;  2KDK A;  4S2M A;  3E4O A;  3N8S A;  3UB8 A;  2XDM A;  1YLZ A;  1FSW A;  3E98 A;  2HPB A;  2OLU A;  3CZD A;  4M4X A;  5EOO A;  1MC0 A;  4X1L A;  2YKH A;  1OTI A;  4Y0O A;  2HZ5 A;  2VX8 A;  4X6T A;  2OWH A;  4WM9 A;  2WGW B;  3FPV A;  3UME A;  2XFS A;  4XT2 A;  2W1T A;  3IF5 A;  4KZ3 A;  4GDB A;  1BSG A;  4DXB A;  4XT2 B;  4ARZ B;  3ZYT A;  2V8C A;  2OLV A;  4JXW A;  2WZZ A;  5FQ9 A;  1T1C A;  3IWO A;  1F5M A;  3IXG A;  5HDD A;  1VET A;  5E2F A;  4ARZ A;  4KZ9 A;  4NET A;  1KVM A;  2K2N A;  4DKI A;  5FSR A;  1JWP A;  4Q0I A;  4BD1 A;  4U3T A;  1K4F A;  2HJ9 C;  3KYZ A;  1OTB A;  1Q2P A;  3KYE A;  5U47 A;  4KZ8 A;  4U0X A;  1YLW A;  2XR0 A;  4JXG A;  2Y8H A;  4ETZ A;  3MXS A;  3QNC A;  1XKZ A;  3M6B A;  1XFN A;  2DNS A;  4NXF A;  5DF8 A;  1VHM A;  3KSH A;  4CJN A;  1LL8 A;  1K56 D;  1Z09 A;  3UB6 A;  3PYP A;  2C5W B;  3VE3 A;  1GSV A;  2VKS A;  3CUE C;  1YLP A;  3NC8 A;  4MLL A;  1A0K A;  4KUO A;  4KZ7 A;  1ES5 A;  1ZTU A;  5F69 A;  3Q1F A;  3TSG A;  5EVI A;  1U60 A;  4IBR A;  3ULF A;  2LB9 A;  5DTK A;  2ZC7 A;  5I94 A;  2ZMA A;  1E25 A;  4KZ4 A;  3U4L P;  5CER A;  2GJ3 A;  4Q0H A;  3VP4 A;  4IHQ A;  4IJG A;  1ZC2 A;  4BBU A;  1RP5 A;  3BWL A;  2V1A A;  3BYD A;  4B4X A;  1G5U A;  5DVA A;  3LUQ A;  2WK0 A;  2PT7 A;  3IWI A;  3CUE A;  4KZ5 A;  3GRJ A;  3UB9 A;  5FAO A;  1O7E A;  5FQM A;  3UE3 A;  2IA2 A;  3UPP A;  3WRT A;  3G34 A;  1BUL A;  2HF6 A;  2RL3 A;  3OCN A;  2J3W A;  1TVF A;  2IWB A;  1XXM A;  1LT0 A;  4UA9 A;  2HDR A;  1BT5 A;  5E2G A;  4B88 A;  5JYO A;  2Y2L A;  5HD5 A;  4IVI A;  5A91 A;  1ZHH B;  4KUK A;  4WYY A;  3QP2 A;  2EWV A;  1KE4 A;  2WKE A;  3T1R A;  2BG1 A;  4HJ3 A;  1OPX A;  2PDR A;  1S6R A;  2P7J A;  3ITB A;  3KSI A;  4QD4 A;  4CLC C;  4IED A;  4D60 A;  2M7U A;  3W4Q A;  5CEB A;  1L0G A;  1KGF A;  5FEG A;  2VGL S;  3EQU A;  5IHV A;  5FQK A;  2V0W A;  2L0W A;  2PRF A;  4EV4 A;  4I38 A;  3VE4 A;  2B18 A;  1XJ3 A;  4FTX A;  4HI4 A;  3D72 A;  2GDN A;  4F3L B;  2DRW A;  2ZLY A;  2ZL1 B;  3SZT A;  3HLB A;  4EQI A;  2ZQ7 A;  1FCM A;  5AQ7 A;  4FOF A;  3W4O A;  1SHV A;  3PTE A;  2P04 A;  5FI2 A;  3CLO A;  4LCL A;  1YLJ A;  5EOE A;  4MBH A;  4K0X A;  1ES4 A;  3IX8 A;  4LRY C;  1VQQ A;  1SCW A;  4DJ3 A;  1BLS A;  5CHM A;  4YNR A;  5AQB A;  5L09 A;  3T50 A;  2ZC3 B;  4FH2 A;  4MCW A;  4B4Z A;  1LSV A;  1CEF A;  1NRJ A;  4S2N C;  5J7E A;  5HPI A;  3NOP C;  4GS9 A;  2H0T A;  3IHA A;  2W1T B;  3Q7V B;  1NLY A;  3T12 B;  2WYX A;  3IH8 A;  2B02 A;  3F1N A;  4LV3 A;  4ZAM A;  2ZQA A;  2E8I A;  2Y91 A;  3H9W A;  3NJA A;  1IYP A;  5E2E A;  1JNU A;  5M18 A;  2VGJ A;  5AQ9 A;  5TBM A;  5AJG A;  1DP6 A;  1SZV A;  1KOU A;  5EFW A;  1SDE A;  1K4E A;  3T4S A;  4PM7 A;  2V1B A;  1L0F A;  1X0O A;  3G35 A;  1OJ5 A;  3E2K A;  2VV8 A;  4OPQ A;  2JKR I;  4S2K A;  4KG2 A;  2Y2H A;  1SKF A;  4GD6 A;  4GN2 A;  3FKW A;  2XFT A;  4MN7 A;  2P9V A;  3FKV A;  1W63 Q;  2QKP A;  3LY3 A;  1S4S A;  5DTS A;  1K38 A;  2HJE A;  1MWT A;  3FG8 A;  4Y7P A;  1OME A;  1J9M A;  2QZ6 A;  4PM5 A;  1FCO A;  3ZHH A;  2H5S A;  4WZ5 C;  1IYS A;  5CED A;  4HHD A;  3MKE A;  4Y0T A;  1V9Y A;  1UGU A;  3G2Z A;  4O0P A;  2DMW A;  2W27 A;  3UB5 P;  4LLO B;  3HL9 A;  5GHY A;  3NEC A;  1Y54 A;  1D1J A;  5TFQ A;  2W3D A;  1SKO B;  1OTE A;  2FFF B;  4HIA A;  2EA9 A;  3GTC A;  2VGL M;  1FR1 A;  5AQA A;  5F5Y A;  3HLC A;  3A3J A;  3MZF A;  2K31 A;  2PHY A;  3P09 A;  5HDC A;  2M7V A;  4RQ9 A;  1TF1 A;  2FZ0 A;  4I3I A;  4EEU A;  4G3V A;  4LCM A;  3O87 A;  4R6L A;  1P97 A;  2C6W B;  2EX2 A;  4DXC A;  2JN7 A;  4WEK A;  1PI5 A;  4LPZ A;  2WKI A;  3LIB A;  1E3U D;  2XQZ A;  3VP0 A;  4S2J A;  3HBR A;  1KVL A;  3MF0 A;  3I7J A;  3ZCZ A;  5EUA A;  2Z2M B;  1XA7 A;  1T19 A;  2M1C A;  3FZC A;  4R4S A;  3TRC A;  5HAI A;  3QP8 A;  3A3I A;  3O88 A;  1YLY A;  3LI9 A;  4Y0U A;  2OV5 A;  2PYR A;  4K0W A;  4OPR A;  3GV9 A;  1N4O A;  2CMN A;  4OOY A;  2H0Y A;  3UB7 A;  5F1G A;  2W0N A;  1DY6 A;  5CHJ A;  2QHK A;  3OPR A;  4L9G A;  4GJ4 A;  4GCZ A;  3HUM A;  3RTY A;  3CJM A;  3UDI A;  2HDU A;  4LV1 A;  3M2J A;  1D06 A;  1HTZ A;  4GB7 A;  4I3A A;  5TGF A;  4A5R A;  1VEU A;  2XLN A;  4XUX A;  3MXQ A;  1ERQ A;  3SOI A;  3ZGA B;  3CMZ A;  5FDS A;  1OTD A;  4X56 A;  5FI7 A;  1MKM A;  3PR6 A;  5HWT A;  5EEC A;  1VM1 A;  3WRZ A;  1K55 A;  3NOU C;  3CHW P;  1OT9 A;  4HJ4 A;  4BWI A;  1K57 C;  2WUQ A;  4GS9 B;  4WEL A;  3MQQ A;  4EEP A;  4HP9 A;  4M3K A;  5J4E A;  3QNB A;  3ZQ5 A;  1XFQ A;  3S7N A;  4E04 A;  4OPY A;  1G28 A;  5D3O A;  5EM1 A;  4RVA A;  1FSY A;  4X53 A;  3WS0 A;  2ZC4 B;  2V0U A;  3L9K A;  1P9W A;  1H3Q A;  3FYZ A;  5FAT A;  2NUT C;  1XPB A;  4I39 A;  3QP5 A;  1S67 L;  1M40 A;  4JKT A;  4YOF A;  3SS5 A;  5KSC A;  4QY6 A;  3T4Q A;  1V9Z A;  3MS6 A;  4BJP A;  1XJ2 A;  4PM9 A;  3JVV A;  3HVF A;  2XGN A;  2GNX A;  2VJW A;  5AVF A;  2ZQ9 A;  2WGI A;  3NCK A;  5IT5 A;  2PR5 A;  4Y5F A;  3MFD A;  2ZM8 A;  4AFI A;  3LO7 A;  5CTN A;  3K2N A;  2Y2M A;  4R0Q A;  5EVI D;  4NXB A;  2A3U A;  1ESU A;  4N1H A;  5IU1 A;  5K5B A;  2B95 A;  2IWD A;  2CC1 A;  3B3X A;  3D9Y A;  4R23 A;  3FV7 A;  4PMA A;  3A0R A;  3OPL A;  3ITA A;  3WS4 A;  5KSH A;  3L7H A;  2JKT I;  1HVB A;  5CTM A;  5FA7 A;  1P0Z A;  5HX9 A;  3E4Q A;  3O5Y A;  4ZJ3 A;  4CLC D;  3LIC A;  3BFF A;  3IBJ A;  2Y2G A;  4LFU A;  4GKU A;  1QMF A;  3G2Y A;  4BD0 A;  5HDS A;  2A49 A;  2QPN A;  1IYO A;  2WKP A;  1ESI A;  3AGD A;  1LSW A;  1ONH A;  5DF7 A;  4ZRR A;  4OLG A;  4PAU A;  1DJB A;  1XJ4 A;  4NXG A;  5CX7 A;  1TDG A;  2X02 A;  2V1Z A;  3N8R A;  3MKF A;  3BW6 A;  5DF9 A;  5IS1 A;  4NK3 A;  1W5D A;  3FC7 A;  3A0V A;  2VV6 A;  3FWL A;  5G18 A;  2WGV A;  4E6X A;  3H82 B;  2PU2 A;  2PD8 A;  5EM0 A;  3O86 A;  3HJI A;  5L8M A;  3AGE A;  4E3O A;  4L9F A;  4QU3 A;  5HPF A;  2D02 A;  5DKK A;  1K6S A;  3KSF A;  3UPN A;  4G3K A;  4EES A;  3K3D A;  1GSX A;  3MFX A;  3LCE A;  5HZH A;  3ZNY A;  1N9L A;  2WKH A;  1W7F A;  1ZKJ A;  1GA9 A;  3ZG9 B;  3VP3 A;  3IS2 A;  4WF0 A;  3M2K A;  5EVI C;  1DP8 A;  4GDN A;  4N9K A;  3P01 A;  3PAE A;  2ACG A;  1NZU A;  4DE3 A;  5G4Z A;  2JC7 A;  2Y2N A;  3EOI A;  2Y2Q A;  2Y2I A;  1BYW A;  1YPR A;  2D01 A;  3IT9 A;  3C7V A;  1M6K A;  1QME A;  3IX3 A;  1F98 A;  3AGF A;  4HEF A;  2K7S A;  3BM6 A;  4DE0 A;  2XA7 M;  3TE8 A;  3GQZ A;  2J8Y A;  4N1X A;  4Q0J A;  3O3V A;  3LGO A;  4P6B A;  3IHB A;  1PNE A;  2Y2O A;  3VSL A;  1O07 A;  4ZBE A;  3UE1 A;  2J80 A;  1BZA A;  3B47 A;  4FSF A;  3ZFZ A;  4QB8 A;  1PWC A;  3CI6 A;  3UDF A;  3ZG0 A;  2B5R A;  1NWZ A;  3DTM A;  3RFB A;  5EVE A;  5FQJ A;  3HLG A;  2WGW A;  4HBT A;  2EFU A;  2OAQ 1;  2H28 A;  2VV7 A;  3EGD C;  3MSH A;  2PR6 A;  3C30 A;  3UPO A;  1G6O A;  4ZJ2 A;  2EFX A;  3GEC A;  3T1X A;  3E4P A;  3G30 A;  4FCF A;  4DMZ A;  1P9R A;  1MZU A;  3EEA A;  1FQG A;  4HBU A;  3LIA A;  1MWU A;  3F1N B;  2O9A A;  4JGQ A;  3OOV A;  4JGR A;  4RX3 A;  3ZG5 A;  4X55 A;  1CI8 A;  2PBD P;  1GHM A;  2XA7 S;  3WS5 A;  1TS7 A;  4F94 A;  5L07 A;  3V3S A;  2JE5 A;  4OQ0 A;  1EI5 A;  2QYB A;  2FFY A;  3WWX A;  3MXR A;  4X69 A;  3VFF A;  1T1B A;  4UHU A;  2O9C A;  4JF6 A;  3VP2 A;  1I5Q A;  4MBF A;  3LR0 A;  2EXB A;  2X71 A;  3TG9 A;  2R9W A;  4GHI B;  4RX2 A;  3PBQ A;  4HP4 A;  4QJG A;  3NDE A;  4C3Q A;  1KGG A;  3MQO A;  4YFM A;  5BOH A;  2OWJ A;  4GHI A;  4BQM A;  1LHY A;  1DJA A;  3GSG A;  4EWF A;  1WA9 A;  4Z1W A;  3KYQ A;  3K3C A;  5TR7 A;  3CAX A;  3P98 A;  3UO9 A;  1YKD A;  1K6R A;  1NZO A;  1IFQ A;  4OP5 A;  2JKT M;  3ISG A;  4S2N A;  4JXS A;  3M6H A;  4S2O A;  3ZVW A;  1MWS A;  4WUJ A;  3MBZ A;  3MZE A;  1LI9 A;  4JGO A;  1DP9 A;  3C8C A;  3LI8 A;  5TJJ A;  3DWZ A;  4HJ6 A;  3HLF A;  5GLB A;  1SKO A;  4OVD A;  5A92 A;  1HD8 A;  1H8M A;  5FDH A;  5F1F A;  2V20 A;  4H6J B;  4OPZ A;  4ME4 A;  1K54 A;  5KMW A;  3DTK A;  4CQH A;  2Y55 A;  3JPU A;  5EVI B;  2INW A;  1E4D A;  4UQI M;  2J3T D;  1CI9 A;  2Y59 A;  3W2Z A;  4O8G A;  2JKR M;  4ID4 A;  4XXR A;  3GR2 A;  1ACF A;  2UV0 E;  4HH2 A;  1STZ A;  2VEA A;  4WN5 A;  3PBR A;  1T1A A;  4ZDX A;  3V5M A;  3PAG A;  1NYM A;  2Y2P A;  1NJ4 A;  2PAV P;  2XEP A;  5J8X A;  4BMW A;  3OZH A;  2HV1 A;  3UE0 A;  2XD1 A;  3Q7V A;  2P08 A;  4II7 A;  3Q82 A;  4JPM A;  1IYQ A;  1JWZ A;  1TS0 A;  4FUW A;  4WZ4 A;  3IWQ A;  4DF6 A;  3SH8 A;  4JF5 A;  5FQQ A;  1H5X A;  3LY4 A;  2R9X A;  4KG6 A;  4JGP A;  4WZ5 A;  3CPT A;  1JVJ A;  4CPK A;  4WMC A;  5GLD A;  4Y17 A;  3HUO A;  1YSP A;  3EQV A;  3RH8 B;  5L10 A;  3TW8 A;  2Y2K A;  4K91 A;  1HZO A;  3D4F A;  1F9I A;  4JBF A;  3LR3 A;  1OT6 A;  3WS1 A;  3NOT C;  4N92 A;  1PYY A;  1K0K A;  3ZG8 B;  1XJ6 A;  2XRN A;  2P9V B;  4Y3I A;  3WS2 A;  3T1Q B;  2XRO A;  5DFX A;  4DE2 A;  2HP6 A;  4Y2F A;  2PYP A;  2W1R A;  3DBA A;  4EXO A;  3F1O B;  5GLA A;  3A3D A;  2P74 A;  3A3F A;  4L9E A;  3KSG A;  2ZQC A;  3BLM A;  3NI9 A;  2DCF A;  2V8F A;  1T18 A;  3G31 A;  5A8B A;  3UMD A;  1PW1 A;  2G7U A;  4GNU A;  3BEC A;  4EU0 A;  1K25 A;  5I5L A;  4L0L A;  4YWZ A;  1XX2 A;  3BY8 A;  4WLA A;  5CGS A;  1FCN A;  3GDI A;  3NIA A;  4JF4 A;  2HP5 A;  1L0D A;  2A24 A;  1YMS A;  3NDG A;  2G2W A;  1I2W A;  2JBF A;  2W3E A;  4HQA A;  1LSX A;  4R3B A;  1D7E A;  4R1G A;  1WYB A;  3EGX C;  4KQD A;  3PBS A;  1NYY A;  2OAP 1;  5HAR A;  1FOF A;  1JTD A;  2ZJ9 A;  4WMC D;  1ZG6 A;  2Z6C A;  3F1P B;  2ZBB A;  5HWV A;  4MBK A;  3UNW A;  3HUN A;  3ICY A;  2J9O A;  1S66 L;  2XH9 A;  4BL3 A;  4FD8 A;  2KLI A;  3IX4 A;  4R3A A;  2UWX A;  2RCX A;  3HJK A;  3VFH A;  2HP9 A;  4JXV A;  1FIK A;  2ZMF A;  3A3E A;  4UQI S;  4RYE A;  3OBF A;  3Q7Z A;  3N6I A;  4O01 A;  1K55 C;  3DWK A;  4BL2 A;  1ALQ A;  1J3W A;  1PRQ A;  1XGI A;  3C4P A;  1K57 A;  5TBM B;  3UN7 A;  2JKF A;  1UWP X;  4GZB A;  5HL1 A;  3VOZ A;  1AWI A;  1MWR A;  1JTG A;  2J7V A;  1CF0 A;  3S1Y A;  5FAQ A;  3GVB A;  3T4K A;  4Y15 A;  5E43 A;  3C4O A;  4NXE A;  4QPR A;  3SH9 A;  3QP6 A;  1ONG A;  4QY5 A;  1ODV A;  4EER A;  1S1Z A;  2O0Y A;  2W3F A;  2VA0 A;  3JYI A;  4MEZ A;  5F68 A;  3SS3 A;  4EBL A;  3OPP A;  1PZO A;  3T1S A;  2XF3 A;  4HOI A;  3ZNT A;  3DTE A;  3PBN A;  1KE0 A;  5EE8 A;  1S1Y A;  3B42 A;  1CQA A;  2ZL1 A;  4KZA A;  2EX8 A;  2IWC A;  2PU4 A;  4JLF A;  3QHY A;  2WAF A;  3LID A;  4DRT A;  3BFD A;  3BY9 A;  5HD3 A;  4BBT A;  5HL6 A;  1HLU P;  1KDW A;  4S2I A;  5FQI A;  4BEN A;  3G4P A;  2A24 B;  4NG2 A;  2J3T C;  1XA1 A;  3LIE A;  1IEL A;  3U2A A;  4EQ1 A;  1KE3 A;  3OCL A;  3QP4 A;  5HAQ A;  1YLT A;  5F82 A;  5EVL A;  1YT4 A;  1L3L A;  2EX9 A;  5E2H A;  3OPH A;  3LYX A;  4H8R A;  2VK3 A;  4C6Y A;  5J3W A;  3Q07 A;  4E3L A;  1NY0 A;  4R4R A;  4MNR A;  2X01 A;  1N9N A;  1ZG4 A;  3LEZ A;  2VZW A;  2ZQ8 A;  1S0W A;  3NBL A;  3V50 A;  4EET B;  4KEN B;  2A2L A;  1EWZ A;  3LIF A;  4OQG A;  2Q9M A;  3EEH A;  3G32 A;  4EBN A;  2L1M A;  2WAD A;  5DTT A;  2GZA A;  4KQO A;  3IF6 C;  4IUK A;  4QHC A;  3CPT B;  1VB6 A;  1L2S A;  2WKQ A;  3KX0 X;  1Y4O A;  4HH3 A;  1E3U A;  2EWW A;  4Y13 A;  5FAP A;  2JCH A;  2Z6D A;  5FL3 A;  1GHP A;  4I5S A;  2PD7 A;  3V67 A;  4GLQ A;  5CXW A;  1YM1 A;  2KX6 A;  5KIZ A;  4OP8 A;  1TDL A;  1MBL A;  2ZMV A;  3LFV A;  3T4O A;  3EWK A;  4BBV A;  4OON A;  3C5A A;  2QWS A;  2QJ5 A;  3IXH A;  1IKG A;  3VOY A;  4IVK A;  5A93 A;  4MDZ A;  3R4K A;  3IF6 B;  4UA6 A;  5EV0 A;  3C2W A;  3IH9 A;  2ZC6 B;  2O99 A;  3UDX A;  1NRF A;  3BFC A;  4E6W A;  3F1O A;  4E3J A;  4EUV A;  3IF6 A;  2BTF P;  4OOM A;  2VLG A;  3PBT A;  1ES2 A;  4GD8 A;  4OOL A;  3SS4 A;  3VOL A;  3E0Y A;  3SW1 A;  5GLC A;  4KZB A;  3HCY A;  1CJF A;  2WZX A;  4H6J A;  1W8Y A;  3H7W B;  2HDQ A;  4CLC B;  1N9O A;  1TS8 A;  1I2S A;  5DJU A;  1OJG A;  2PBY A;  4DDS A;  3CG5 A;  4B9O A;  3N7W A;  1WE4 A;  3IS2 B;  3NHQ A;  3H7W A;  4CLC A;  1G68 A;  4WL9 A;  5DJT A;  4ZJ1 A;  3OLO A;  4UA7 A;  4KZ6 A;  4NKP A;  3QP1 A;  1Y28 A;  4BLM A;  3BRM A;  3W4P A;  3A0S A;  3DAV A;  3MZD A;  1TS6 A;  1RCJ A;  5DKL A;  4DE1 A;  4UAA A;  5HWW A;  2Y4A A;  1JWV A;  1H8Y A;  1F2K A;  2L4R A;  1SDN A;  5GHX A;  4U0T A;  4I3J A;  3SH7 A;  4B93 A;  1GCE A;  1PWG A;  4YIN A;  1PIO A;  1YQS A;  3VMA A;  4R3J A;  1XGJ A;  5DFY A;  4PPR A;  3R7W B;  3NUL A;  5GL9 A;  2VGK A;  3RJU A;  3T4T A;  4F3L A;  4LV2 A;  4WEJ A;  2WKR A;  3T4J A;  3BFG A;  4R38 A;  3LR4 A;  1AXB A;  5MC7 A;  2HDS A;  2JHE A;  1BLP A;  1MXO A;  3V39 A;  1VEU B;  2EXA A;  2BLS A;  4GW9 A;  3E2L A;  2E8J A;  3D3O A;  4D2O A;  3IXD A;  1BLH A;  5HW3 A;  1BUE A;  2ZM0 A;  4ETX A;  2XD5 A;  5EPH A;  4P87 A;  3GMW A;  1TD5 A;  5F83 A;  3G6O A;  1MKI A;  1WYC A;  1Z6F A;  2ZQD A;  1GSW A;  1YAX A;  4XUZ A;  4G3W A;  1PFL A;  4S2L A;  1FIL A;  4LRZ E;  1PI4 A;  1XP4 A;  4PM6 A;  3BQ8 A;  4GOG A;  5L2F A;  3DW0 A;  4KG5 A;  3S22 A;  5FAS A;  4WBG A;  4K08 A;  1IOU A;  1PW8 A;  2OSU A;  1H8Z A;  1DJC A;  4PKY G;  5KZH A;  4C75 A;  2O9B A;  4HES A;  3HRE A;  4OKP A;  3S4X A;  2FH5 A;  1N9B A;  3RXW A;  1NXY A;  4LGW A;  5GHZ A;  3F1P A;  4LRX C;  5A90 A;  4IUH A;  5CHU A;  1EW0 A;  3LEQ A;  2GX5 A;  4PM8 A;  1IEM A;  1LLB A;  5CGW A;  1KDS A;  3V3R A;  3TOI A;  4ZTK A;  2Y2J A;  3S7O A;  1YMX A;  4P6Z S;  3CIT A;  1NLZ A;  1BLC A;  1W8Q A;  4P6Z M;  3MQ0 A;  3MJQ A;  2Q0O A;  2LB5 A;  2MJ6 A;  1LI0 A;  3R7W A;  4HNB A;  5HSQ A;  3ZG7 B;  1C3B A;  3DTI A;  5CEC A;  3UE6 A;  2HGV A;  2ZD8 A;  3ZVT A;  1LL9 A;  2OOL A;  5LBR A;  2KOI A;  3UY6 A;  1K54 C;  3BJN A;  4MN5 A;  4OH0 A;  4DDY A;  1RGY A;  4P0M A;  3VP1 A;  4MN6 A;  2I72 A;  5CGX A;  1H0M A;  3BQA A;  3VSK A;  1DRM A;  3KO6 A;  1BTL A;  2QJ7 A;  3RXX A;  3Q81 A;  3S7Q A;  4EBP A;  2G2U A;  4OQI A;  3OC2 A;  2H10 A;  3IBR A;  4Q8I A;  2I9V A;  5C5K A;  5HFO A;  1L0E A;  2R78 A;  4E3K A;  4HY8 A;  4R70 A;  1Q2Q A;  4S2P A;  2Y79 A;  5F6A A;  5M1A A;  4EW7 A;  1GA0 A;  4DN0 A;  1PWD A;  3C7U A;  2WAE A;  4E3M A;  3P7N A;  3ZDJ A;  1ERM A;  3PHY A;  3C38 A; 
#chains in the Genus database with same CATH homology
 4NXE A;  4QPR A;  2B02 A;  3F1N A;  4EER A;  1ODV A;  4UEY A;  1S1Z A;  2O0Y A;  2W3F A;  2ZOH A;  2VA0 A;  3H9W A;  3NJA A;  3LR5 A;  5F68 A;  4DJ2 A;  1F98 A;  2XSS A;  1JNU A;  2NUP C;  4HOI A;  3VV4 A;  2K7S A;  3PBN A;  5TBM A;  2XA7 M;  1S1Y A;  3TE8 A;  4NEE D;  3B42 A;  5AJG A;  1DP6 A;  1KOU A;  5EFW A;  2W3G A;  4Q0J A;  3T4S A;  3LID A;  3BY9 A;  5HD3 A;  4BBT A;  5HL6 A;  3MMH A;  2V1B A;  1X0O A;  3S7P A;  3H82 A;  2V9A A;  2J80 A;  3JVU A;  1OJ5 A;  2BAS A;  3B47 A;  4FSF A;  2A24 B;  3CI6 A;  3PXP A;  2VV8 A;  3PBO A;  2JKR I;  2J3T C;  1NWZ A;  3LIE A;  3RFB A;  3U2A A;  4EQ1 A;  5G4Y A;  3T4L A;  3OCL A;  3TJZ C;  1YSQ A;  2OAQ 1;  4MN7 A;  2H28 A;  2VV7 A;  3EGD C;  3MR0 A;  2PR6 A;  3C30 A;  1G6O A;  1OTA A;  1W63 Q;  1UWN X;  3GEC A;  3LYX A;  2QKP A;  1S4S A;  1W63 M;  3E4P A;  2HJE A;  5J3W A;  3FG8 A;  4DMZ A;  4CLC E;  1P9R A;  2ZOI A;  1MZU A;  3EEA A;  1N9N A;  2VZW A;  3LIA A;  4PHT A;  2W3H A;  5AVE A;  3F1N B;  4HHD A;  2O9A A;  4JGQ A;  3OOV A;  4JGR A;  1V9Y A;  4EET B;  3CWF A;  2A2L A;  3LIF A;  1UGU A;  2XA7 S;  3EEH A;  4O0P A;  1TS7 A;  2DMW A;  2W27 A;  2L1M A;  3FPW A;  4LLO B;  2GZA A;  4KQO A;  4IUK A;  2QYB A;  1VB6 A;  2W3D A;  4PKY A;  1OTE A;  4MMN A;  2WKQ A;  3B33 A;  3KX0 X;  1T1B A;  4HH3 A;  4HIA A;  2O9C A;  2YKF A;  2EA9 A;  2EWW A;  2VGL M;  2Z6D A;  5FL3 A;  3LR0 A;  5F5Y A;  4I5S A;  1S4R A;  2PD7 A;  2K31 A;  2KDK A;  2PHY A;  3V67 A;  4GLQ A;  3E4O A;  3UB8 A;  2KX6 A;  5KIZ A;  3E98 A;  4GHI B;  5HDC A;  2ZMV A;  4M4X A;  2M7V A;  3LFV A;  4RQ9 A;  3T4O A;  1TF1 A;  1MC0 A;  3EWK A;  3PBQ A;  4HP4 A;  2FZ0 A;  4I3I A;  4EEU A;  4BBV A;  2YKH A;  1OTI A;  4G3V A;  3MQO A;  2OWJ A;  4GHI A;  4R6L A;  1P97 A;  2QWS A;  2JN7 A;  2QJ5 A;  2VX8 A;  2OWH A;  4WEK A;  3FPV A;  1WA9 A;  4Z1W A;  3UME A;  3KYQ A;  3K3C A;  4LPZ A;  4MDZ A;  3CAX A;  3R4K A;  4XT2 A;  3LIB A;  2W1T A;  1YKD A;  3C2W A;  2O99 A;  3MF0 A;  3F1O A;  1IFQ A;  4EUV A;  1T19 A;  2M1C A;  4OOM A;  4XT2 B;  2VLG A;  4ARZ B;  2JKT M;  3PBT A;  3TRC A;  4OOL A;  3VOL A;  3ZYT A;  3E0Y A;  3SW1 A;  3HCY A;  3LI9 A;  4WUJ A;  4H6J A;  3H7W B;  4CLC B;  1N9O A;  1TS8 A;  2PYR A;  4JGO A;  1T1C A;  1DP9 A;  3C8C A;  1F5M A;  3LI8 A;  5TJJ A;  5DJU A;  1OJG A;  5HDD A;  4HJ6 A;  2CMN A;  4ARZ A;  3UB7 A;  4B9O A;  2W0N A;  3IS2 B;  2QHK A;  3NHQ A;  2K2N A;  3H7W A;  4CLC A;  4WL9 A;  4Q0I A;  4L9G A;  4GJ4 A;  1H8M A;  5DJT A;  3OLO A;  2HJ9 C;  3KYZ A;  4NKP A;  1OTB A;  4H6J B;  4ME4 A;  1Y28 A;  4GCZ A;  3A0S A;  4CQH A;  3RTY A;  1TS6 A;  5DKL A;  5HWW A;  2INW A;  4UQI M;  2J3T D;  2Y8H A;  1D06 A;  4ETZ A;  2L4R A;  4I3A A;  3W2Z A;  1XFN A;  4O8G A;  2JKR M;  4NXF A;  4I3J A;  4B93 A;  1VHM A;  3KSH A;  4HH2 A;  1STZ A;  2VEA A;  1LL8 A;  4WN5 A;  3PBR A;  1T1A A;  3MXQ A;  3UB6 A;  3PYP A;  3VE3 A;  1GSV A;  2VKS A;  3CUE C;  5DFY A;  3R7W B;  1OTD A;  4KUO A;  4BMW A;  1MKM A;  2HV1 A;  3PR6 A;  5HWT A;  3T4T A;  3NOU C;  2P08 A;  4F3L A;  4II7 A;  1OT9 A;  1ZTU A;  4HJ4 A;  4WEJ A;  1TS0 A;  2WKR A;  4BWI A;  3T4J A;  5F69 A;  4R38 A;  4GS9 B;  4WEL A;  3ULF A;  3LR4 A;  2LB9 A;  3MQQ A;  4HP9 A;  4EEP A;  5J4E A;  3ZQ5 A;  1XFQ A;  5MC7 A;  3S7N A;  4E04 A;  1G28 A;  2JHE A;  4GW9 A;  4JGP A;  3D3O A;  2GJ3 A;  2V0U A;  1P9W A;  4Q0H A;  1H3Q A;  4IHQ A;  1YSP A;  3EQV A;  4IJG A;  4ETX A;  2NUT C;  4I39 A;  3RH8 B;  4BBU A;  1S67 L;  3BWL A;  3TW8 A;  2V1A A;  4YOF A;  1TD5 A;  3G6O A;  3T4Q A;  1F9I A;  1GSW A;  3LUQ A;  3LR3 A;  1YAX A;  1V9Z A;  4G3W A;  4BJP A;  1XJ2 A;  1OT6 A;  2PT7 A;  3NOT C;  4LRZ E;  3JVV A;  3CUE A;  3BQ8 A;  2GNX A;  2VJW A;  3UB9 A;  5AVF A;  3UE3 A;  2IA2 A;  1XJ6 A;  5IT5 A;  2PR5 A;  2XRN A;  4Y5F A;  2HF6 A;  4Y3I A;  4AFI A;  4K08 A;  1IOU A;  2XRO A;  3OCN A;  4PKY G;  3K2N A;  5DFX A;  2J3W A;  4Y2F A;  2O9B A;  2PYP A;  2W1R A;  1LT0 A;  4NXB A;  3DBA A;  4EXO A;  3F1O B;  5IU1 A;  2FH5 A;  5K5B A;  4L9E A;  3KSG A;  5HD5 A;  1T18 A;  1ZHH B;  4KUK A;  5A8B A;  3UMD A;  2G7U A;  2EWV A;  3F1P A;  4LRX C;  3A0R A;  4IUH A;  5KSH A;  1EW0 A;  2GX5 A;  4EU0 A;  4HJ3 A;  1OPX A;  2JKT I;  2PDR A;  5I5L A;  2P7J A;  4L0L A;  4YWZ A;  1P0Z A;  3BY8 A;  3KSI A;  4WLA A;  3E4Q A;  3O5Y A;  4CLC D;  3S7O A;  3GDI A;  3LIC A;  4P6Z S;  3IBJ A;  3CIT A;  4CLC C;  1NLZ A;  2M7U A;  4P6Z M;  2A24 A;  3MQ0 A;  3MJQ A;  2LB5 A;  5HDS A;  2VGL S;  3EQU A;  2MJ6 A;  2V0W A;  2WKP A;  3R7W A;  4HNB A;  2L0W A;  4I38 A;  3VE4 A;  5HSQ A;  4HQA A;  1LSW A;  2W3E A;  4ZRR A;  2B18 A;  1XJ3 A;  3UE6 A;  1LSX A;  4PAU A;  1XJ4 A;  2HGV A;  4HI4 A;  3D72 A;  4NXG A;  5CX7 A;  1D7E A;  4F3L B;  2OOL A;  3EGX C;  5LBR A;  4KQD A;  3BW6 A;  5DF9 A;  5IS1 A;  3PBS A;  2KOI A;  2OAP 1;  3FC7 A;  3A0V A;  3BJN A;  2VV6 A;  4MN5 A;  4FOF A;  3H82 B;  2P04 A;  2Z6C A;  3F1P B;  2PD8 A;  4MN6 A;  2ZBB A;  3BQA A;  1DRM A;  3HJI A;  5L8M A;  5HWV A;  3CLO A;  4L9F A;  3KO6 A;  3ICY A;  2QJ7 A;  5HPF A;  1S66 L;  2D02 A;  3S7Q A;  5DKK A;  2KLI A;  4R3A A;  3OC2 A;  3KSF A;  4LRY C;  3IBR A;  4G3K A;  3HJK A;  3K3D A;  4EES A;  2I9V A;  5C5K A;  1GSX A;  2ZMF A;  3MFX A;  4DJ3 A;  4UQI S;  3OBF A;  2R78 A;  5HZH A;  1N9L A;  4HY8 A;  4YNR A;  4R70 A;  4O01 A;  3T50 A;  2Y79 A;  3IS2 A;  5F6A A;  4MCW A;  4WF0 A;  1LSV A;  1NRJ A;  5TBM B;  4EW7 A;  5J7E A;  5HPI A;  1UWP X;  1DP8 A;  3NOP C;  4GS9 A;  4DN0 A;  3P01 A;  5G4Z A;  3EOI A;  3P7N A;  2W1T B;  3PHY A;  1NLY A;  3T4K A;  1BYW A;  3C38 A;  2D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...