5DFYA

Structure of the parental state of gaf3 from slr1393 of synechocystis sp. pcc6803 (in vitro assembled protein/chromophore)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
GSLQNIFRATSDEVRHLLSCDRVLVYRFNPDWSGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRAFLTVPVFVGEQLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Three dimensional structure of the parental state of GAF3 from Slr1393 of Synechocystis sp. PCC6803
rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
total genus 50
structure length 158
sequence length 158
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dfyA00
4LRYC 4YOFA 2G7UA 3W2ZA 2M7UA 4Q0HA 3S7OA 2Y79A 3KSHA 4YNRA 4MDZA 5DFYA 3C2WA 4O01A 4G3WA 2K31A 3NOPC 5HPFA 4DN0A 2B18A 2VKSA 4PAUA 3E98A 3RFBA 2XSSA 4IUHA 4LRXC 3MQ0A 3OOVA 3OBFA 5HPIA 3HCYA 2O9AA 4GW9A 3S7PA 4O8GA 2W3DA 5HL6A 3CITA 2O9BA 3NOTC 4Q0JA 2GX5A 2Y8HA 2W1TB 4G3KA 5C5KA 4IUKA 3EEAA 2VJWA 3S7QA 5I5LA 3VV4A 1MC0A 4MMNA 2O9CA 2K2NA 1STZA 3K2NA 4QPRA 1TF1A 3IBJA 1VHMA 4O0PA 5DFXA 5LBRA 2O99A 1YSPA 3LFVA 3IBRA 3MF0A 2W3FA 1MKMA 3G6OA 3R4KA 3KSIA 4RQ9A 5HSQA 2O0YA 2XROA 3NHQA 3TRCA 4DMZA 4E04A 4EUVA 2W3HA 4Y3IA 4ME4A 2W3EA 2IA2A 1ZTUA 3E0YA 3KSGA 3D3OA 4G3VA 3KSFA 2LB5A 4Y5FA 3S7NA 3MMHA 5L8MA 2HGVA 3CI6A 2KOIA 2VEAA 2LB9A 2W1TA 5AJGA 4R70A 3DBAA 4Y2FA 4CQHA 1F5MA 2W1RA 2XRNA 4LRZE 4MCWA 4ZRRA 3KO6A 4IJGA 2OOLA 3BJNA 4GLQA 2M7VA 1YKDA 2W3GA 4BWIA 4ETZA 2KLIA 2VZWA 3ZQ5A 1YSQA 4R6LA 4Z1WA 4EU0A 2ZMFA 3O5YA 3NOUC 4FOFA 5K5BA 1TD5A 4Q0IA 5TJJA 4ETXA 2QYBA 4MN7A
chains in the Genus database with same CATH superfamily
3UN7A 4DRTA 3MZFA 4YOFA 4R1GA 4X56A 3IX8A 4HH3A 1TS7A 4C6YA 1NWZA 3EQVA 4LV2A 2C5WB 5HPFA 1NZUA 2Y2OA 3PBOA 3LR3A 4PM7A 3MQ0A 3SS5A 1P0ZA 5CHJA 4GW9A 4KZ7A 3IWOA 1LHYA 2M1CA 3VFHA 3NOTC 5F68A 2Y8HA 2ZC7A 2Y2LA 3H82A 4L9GA 3UDXA 2IWDA 3M2KA 2EXBA 4EBLA 4JKTA 4R3BA 5FI7A 1G68A 3C4OA 2JKTI 3SS3A 4IHQA 3S22A 2I72A 2XFSA 4HP4A 3QNCA 2VV6A 2EX8A 1BTLA 3MF0A 4NXBA 3G6OA 4HBTA 4FH4A 3VE4A 3TRCA 2GNXA 3UO9A 3T1XA 3OPHA 1RGYA 2WGVA 1LI0A 1KE0A 4I39A 2Y2MA 1VB6A 4U3TA 3T1RA 2XD5A 2EXAA 4EQIA 3BFGA 4P6ZM 5FA7A 5AQAA 1YMSA 4BBTA 1OJ5A 4ZAMA 4X53A 4QJGA 3QP6A 1KE4A 4R6LA 5HWTA 5U47A 2Y2HA 4KQRA 4EESA 2PYPA 5E2FA 4B4ZA 3C30A 2OLUA 3N8SA 3SZTA 1BULA 4G3WA 2WGWA 4F3LA 2B18A 1GA9A 4OPZA 2EA9A 4OOLA 5HWWA 4E3NA 2EWVA 1LSVA 2GJ3A 2DMWA 3JPUA 1MZUA 4ZJ2A 3ZGAB 2HV1A 4QB8A 2HDUA 5A92A 2BASA 4OOYA 3V50A 1RP5A 3NBLA 5IS1A 1CEGA 1L3LA 4DKIA 1KE3A 2QKPA 2OV5A 2Y4AA 2XGNA 1OTAA 1YPRA 1OMEA 4R4RA 1DY6A 3VP4A 5HZHA 3JVVA 1XJ2A 3T4OA 4A5RA 4MEZA 5M18A 3U2AA 4I3IA 2VA0A 2XROA 1W5DA 3MXSA 5AQBA 1ONGA 2W0NA 4E6XA 3VP2A 1F2KA 1MWUA 1Q2PA 3UE1A 3E4OA 5L8MA 3B33A 3CI6A 5IHVA 5CEDA 1ZG6A 5AJGA 1PI4A 1FOFA 1BLSA 5IT5A 1UWNX 2VGKA 4KZ3A 3NDEA 3SW1A 5J3WA 5CXWA 1U60A 1BYWA 3AGFA 4UQIM 5CHUA 2EWWA 3LO7A 4ZJ1A 3LI9A 4EU0A 3V39A 4EUZA 2DRWA 4Q0IA 1AWIA 3Q07A 1ERQA 4GD6A 2JHEA 4E3IA 1H5XA 1ESIA 4PM5A 3FC7A 1XA1A 2E8IA 3GQZA 3ZG9B 1VEUB 3MKFA 1MPLA 4LFUA 3RJUA 2GZAA 4K0XA 1Z09A 5HL1A 3CITA 3GMWA 1LI9A 4OQHA 2ZD8A 4B4XA 5F6AA 3TW8A 3OCLA 2VV8A 3NCKA 3PYPA 4HJ4A 2YKHA 3K2NA 1W8YA 4BL3A 3D9YA 1G6AA 1TF1A 1ZC2A 3BY8A 1L0GA 3S1YA 5EVID 4E3KA 3EQUA 2ZMVA 1K56D 5E43A 3KYZA 3IBRA 4OLDA 4EXOA 4PKYA 5FAPA 2WKEA 1ES3A 4WLAA 5JYPA 5KSCA 4KZBA 3T4KA 4GZBA 2KDKA 3LYXA 4II7A 1VEUA 4K91A 3OC2A 5DF7A 2Y2NA 3CPTA 2B02A 4MBKA 5AQ7A 2OAQ1 3MFXA 4S2PA 2PRFA 3SH9A 1GHPA 3LCEA 4I3AA 3WS5A 3M6HA 4WZ5C 5GHYA 1DP6A 4ETZA 2VZWA 1SHVA 3MR0A 3O86A 1SKFA 2OWHA 5TJJA 2Y2PA 3BWLA 1S6RA 4HOIA 2WYXA 2Q9NA 1MKIA 1FSYA 3HLBA 3MZEA 4O01A 3QNBA 4Y0OA 4IEDA 3UB6A 4LV1A 3LUQA 3BEBA 3QHYA 5FQKA 4WYYA 2OAP1 4PMAA 4DDYA 5KMWA 2O9BA 3NY4A 4GHIB 3O87A 4G3KA 5GL9A 4B93A 3K3DA 2UWXA 2QZ6A 5E2GA 4MN6A 1T1AA 1AXBA 4NK3A 3ZCZA 5DVAA 4FUWA 5DTKA 5CGWA 4E3OA 5HAIA 3BLSA 4OQIA 5EECA 5TBMB 2YKFA 5EVIA 1ODVA 1S0WA 5GLAA 4ID4A 1K56A 1YLPA 3M6BA 4AFIA 3L7HA 3VFFA 1ES5A 1NZOA 4NXFA 3E4QA 3C7VA 4JXGA 3A3DA 5FI6A 1IELA 3FYZA 4GHIA 3MSHA 4KZ4A 2V1AA 2A2LA 2X71A 2DNSA 4EBNA 3V3SA 4QY6A 3VP0A 3N4IA 3IS2B 4GS9B 4KZ5A 1FCOA 4GCZA 1YT4A 4D2OA 3FPVA 4I3JA 2JKFA 1K6SA 2HF6A 5TBMA 2X02A 5HD5A 1G5UA 5L10A 2VX8A 1IKGA 1TDGA 5EPHA 2M7UA 4Q0HA 2QPNA 3MXRA 1L0FA 3UNWA 3CWFA 1DJAA 2JKGA 3OOVA 2WKPA 3GSGA 4X69A 5EOOA 5J8XA 5EVEA 4P87A 3T50A 3P7NA 3VV4A 3IS2A 4JXWA 5EVLA 5CTMA 3UY6A 2XFTA 4MN5A 4YINA 1MY8A 3LIDA 3DAVA 2EX9A 3WWXA 5KIZA 4DE3A 4HBUA 2IWCA 1K25A 3CMZA 3VSKA 1NRJA 3KX0X 4OKPA 5AVEA 2ZM8A 2ZL1A 4L9EA 5A8BA 4DMZA 1KVLA 2W3HA 1PNEA 3F1NB 2IA2A 1BZAA 3IF6A 3E0YA 2LB5A 1W63M 2Y59A 3PBNA 3WRTA 3A0RA 2ZQ8A 4KZ8A 1IYSA 5GHZA 2PYRA 1F5MA 2ZC6B 3JVUA 3CG5A 4X1LA 2P04A 5HW3A 2JCHA 2KX6A 3IXBA 1MWRA 4GB7A 2ACGA 3G4PA 3AGDA 3RH8B 2XF3A 5J4EA 2J7VA 1H8ZA 5EM0A 1XGJA 3NC8A 3CLOA 1QMEA 4K08A 4P85A 5EOEA 3LICA 5FASA 2VKSA 5F5YA 4IUHA 1PWCA 4OONA 3SH7A 2O9AA 4K0WA 3A3JA 5EVIC 3BRMA 3GR2A 3IF5A 2EFUA 3Q7VA 2WGIA 3G2YA 4QHCA 1BSGA 5FEFA 2XQZA 3MFDA 3OPRA 3QP4A 2FFFB 3TJZC 5CERA 3MXQA 1YLTA 3HLWA 3LGOA 5DJTA 1YSPA 4M4XA 1WYCA 3ZDJA 1T19A 2VGLM 4R3AA 1A0KA 1T18A 5FQ9A 2A24A 4E04A 4EUVA 1PWGA 4Y3IA 4GD8A 4XXRA 5EE8A 1S1YA 1ZTUA 2XA7M 3T12B 4Y0UA 3RXXA 3BM6A 3S7NA 1UGUA 1OTIA 4R3JA 2HGVA 4I5SA 1IYOA 3IH8A 2ZQCA 3IWQA 3CZDA 4NXEA 1HLUP 3GDIA 2HZ5A 1BLCA 3VOYA 2ZC3B 4QY5A 4GLQA 5M1AA 2M7VA 3UDIA 4QD4A 2XD1A 3FWLA 5HD3A 1D7EA 1VQQA 2PDRA 2WGWB 4F3LB 5J7EA 2VGJA 2J9PA 2JKTM 2HDSA 1LLBA 3UPOA 4KENB 1GCEA 3AGEA 4HJ3A 2J3WA 3W4OA 4PPRA 4S2KA 5GLBA 1I5QA 3NOPC 3MQOA 2WAEA 4BL2A 3T4JA 1ESUA 4XUXA 2XH9A 4LGWA 3QP5A 5HL6A 4UAAA 4BBVA 2V1ZA 3Q7ZA 2W1TB 1OTEA 3S7QA 3QP8A 4WZ4A 4JXVA 1OPXA 4R0QA 3BFEA 3ZG5A 4DJ2A 1I2WA 3IF6C 1Q2QA 1YQSA 4B88A 5F1FA 2UV0E 1JTDA 1NRFA 4WZ5A 2Z2MB 1PI5A 1NYMA 3B42A 4N92A 4QWOA 3LFVA 5A91A 3DW0A 1K0KA 1ZKJA 4H6JB 1K55A 1P97A 4OPQA 1XJ4A 3C8CA 3K3CA 1F9IA 3T1QB 1K4EA 4I38A 2VLGA 3GV9A 5FI2A 1KVMA 1OT9A 2HJ9C 3HJIA 3MMHA 1XPBA 1M40A 3OZHA 2KOIA 2W1TA 1CK3A 2Y2JA 4Y17A 3LR0A 3UB7A 4Z9QA 1FR1A 2Z2LB 3NI9A 3KO6A 4WEKA 3UMEA 1KGFA 4P6ZS 4ZBEA 2JKRI 5AVFA 2V8CA 2XK1A 4B9OA 4DXCA 2X01A 3O5YA 1K57A 2H0TA 4DJ3A 1N4OA 4H6JA 4KG2A 2QWSA 1H3QA 4ZTKA 1JWZA 4KG6A 4HQAA 1FSWA 2PBYA 1S4RA 4NG2A 5G4ZA 1GSWA 2ZQ7A 3FKVA 4Y0TA 1HD8A 2I9VA 2MJ6A 4DXBA 3P09A 4ARZA 1L2SA 1N9OA 4PM6A 4QPRA 3MZDA 3LI8A 3CPTB 1GSXA 5FDSA 3M2JA 4WBGA 3WS2A 1MKMA 4FSFA 4KQDA 3R7WA 3BFDA 4H8RA 2V1BA 4OH0A 1TVFA 2WKIA 2Y55A 1Y28A 3G32A 5L07A 4EQ1A 5HFOA 2Y2IA 4EETB 2ZMAA 2WZZA 2XRNA 1D06A 3UMDA 2HJEA 4UEYA 2ZOHA 2P74A 3BFFA 3IT9A 3SOIA 5F1GA 5EUAA 4GDNA 4C75A 3UDFA 2G2WA 1BUEA 3HLGA 2V2FF 3A0VA 2JE5A 3KSHA 1WE4A 1Z6FA 4LV3A 3LR5A 3T4LA 5HPIA 3LEQA 1K55C 2EFXA 4LCMA 4BD0A 1XGIA 1PW1A 3ZNTA 5F82A 2JBFA 3IHBA 1NJ4A 5EVIB 1IYPA 3TOIA 4EEPA 3L9KA 4XT2A 5KZHA 5DF9A 1VHMA 4JPMA 4O0PA 5G18A 4S2IA 5TGFA 4X68A 1H8MA 1YMXA 4OPRA 4CLCE 1IYQA 1YLZA 3IXHA 3KSIA 1HVBA 2HP9A 3TG9A 3FG8A 5HWVA 4LPZA 4HEFA 2OWJA 4KZAA 4S2NC 4XUZA 4JGOA 3UPPA 3CHWP 3FZCA 1K57C 4WMCD 1X0OA 4G3VA 4CLCD 4Y5FA 3F1PB 3PR6A 2VEAA 4UHUA 3HVFA 3W8KA 4KZ9A 4E3MA 2GDNA 4R70A 4FTXA 4BBUA 2DCFA 1H8YA 5D3OA 2BLSA 2Z6CA 3G35A 3LIFA 2FZ0A 2WKRA 4BENA 3DWKA 3WS1A 1V9ZA 2Q9MA 1KGGA 1K54C 3A3IA 1MWTA 1HZOA 4OLGA 2V0UA 1XKZA 4EW7A 3B47A 3LIAA 2FFYA 3MKEA 2OSUA 2PU4A 3D4FA 3W2ZA 2V0WA 5HAQA 3ZHHA 4YNRA 4Y15A 4MDZA 2J3TC 3A3EA 1KDWA 4GDBA 1O07A 1JNUA 2Y2KA 3BYDA 3IWIA 3UB5P 5DTTA 4DN0A 3HUOA 1PZPA 3PTEA 3F1PA 4DDSA 1PYYA 3BECA 2ZJ9A 1K6RA 1YLJA 4IUKA 4WEJA 3T4TA 3PBTA 2ZL1B 2XDMA 3BFCA 2Y2QA 4NXGA 4WELA 2WZXA 5FEGA 3Q82A 2J80A 3IBJA 3IF6B 3ZVTA 2ZQ9A 3Q81A 1CI9A 1EROA 4LCLA 4ZDXA 3ICYA 2QHKA 3N6IA 2HDQA 1VETB 3PBRA 1ONHA 4X55A 4JF4A 1D1JA 2ZM2A 1P9WA 3KSFA 1J3WA 4HHDA 3E4PA 4MBHA 3A3FA 1KDSA 3ITBA 3G31A 1OTBA 4WMCA 1IEMA 4Y2FA 4CLCA 2A3UA 3NDGA 3HJKA 2L1MA 5GHXA 2OOLA 1H0MA 3NECA 2KLIA 3MS6A 3WS4A 3HLFA 5CRFA 5FDHA 3HLDA 3ZVWA 1FILA 1G6OA 1LSWA 1BLPA 4BLMA 1OTDA 1XP4A 1VETA 4R4SA 3S7OA 3Q7VB 1QMFA 4JBFA 4M3KA 4PKYG 1T1CA 5DFYA 5EV0A 2VV7A 4DE1A 4PAUA 5M19A 5FATA 2PT7A 3F1OB 4C3QA 1KGEA 4DE2A 3N8RA 1EW0A 5CX7A 2CMNA 1W8QA 4NKPA 1KOUA 2PR5A 2NUTC 1N9LA 3WRZA 3OLOA 2K2NA 2PAVP 2A24B 3E2LA 1EI5A 2WKHA 4UA9A 2PBDP 4EEUA 3DTEA 2WKQA 4EV4A 1J9MA 1YM1A 1PIOA 3V5MA 3TSGA 3C7UA 1N9NA 5CGXA 1UWPX 1K4FA 1FR6A 4OP5A 1LT0A 1RCJA 1DP8A 1PFLA 3LEZA 3PXPA 5DTSA 3F1OA 1JWVA 5CEBA 1WYBA 1NLZA 4UA6A 4GN2A 4OVDA 4GOGA 3EOIA 5G4YA 2R9XA 1XX2A 4LRZE 3SH8A 4EERA 4LENA 4BWIA 3D72A 1LSXA 2P9VA 4Z1WA 4YFMA 5FSRA 2AVXA 4FOFA 4OPYA 3VOLA 3P01A 4MBFA 3JYIA 2E8JA 3FKWA 2IWBA 3G34A 3A0SA 4HESA 1JVJA 5F83A 4RX3A 2XEPA 4JGRA 4JF6A 5HARA 3ZG0A 3VOZA 5I94A 2H10A 2GX5A 3UPNA 2J8YA 2R9WA 5C5KA 3IQAA 3IHAA 2VJWA 1MXOA 1YLWA 5CGSA 4MMNA 3MJQA 3VE3A 1CI8A 4RX2A 3PAGA 4WF0A 4OOMA 3LY4A 3IXGA 3OPPA 3CUEC 5DFXA 1XJ3A 5LBRA 4CLCC 4N9KA 5CECA 4RQ9A 2J3TD 5HSQA 4N1HA 1NYYA 2O0YA 2VGLS 1W63Q 1IFQA 2XLNA 3QP2A 4S2MA 3KSGA 1PWDA 5L09A 2L0WA 2B95A 1GSVA 2XA7S 2LB9A 4MNRA 4E6WA 4KUKA 3EEHA 3O88A 4E3JA 1ES4A 5F69A 4GNUA 1YLYA 2QJ5A 4ZRRA 4FD8A 3N8LA 2RCXA 2D01A 3HUNA 1XA7A 4HNBA 1LL8A 3W4QA 1FCMA 1YSQA 2ZBBA 5CTNA 4RA7A 4CJNA 3N7WA 1FIKA 1TS8A 5TR7A 1DRMA 2QYBA 2PU2A 2H5SA 3HL9A 1W79A 3C2WA 4WL9A 4JLFA 3UE3A 1TEMA 4ARZB 2VK3A 1S66L 4HJ6A 4S2NA 3LR4A 1LL5A 2INWA 2PHYA 4UA7A 5HAPA 1HTZA 3HLEA 2WUQA 4IBRA 3DTKA 3C38A 2L4RA 5I5LA 3QP1A 3R7WB 4D60A 5HDSA 1STZA 4PM9A 1V9YA 3H7WB 4KQOA 2ZQAA 4CPKA 3ZG7B 4U0XA 4LLOB 2JKRM 1DJCA 3NULA 2O99A 2PD8A 2ZM0A 5EM1A 1K54A 2Y91A 1VM1A 4QU3A 5JYOA 1G28A 3ZNYA 4O7DA 3VP1A 3RXWA 4BQMA 2W3EA 3GVBA 3BY9A 1CF0A 5FAOA 1MWSA 4OQ0A 3ZYTA 4HIAA 1S67L 2PR6A 1TDLA 3C5AA 1ERMA 1CEFA 3DTMA 4CQHA 3PBSA 1L0EA 2ZLYA 3BJNA 5IU1A 3H7WA 2W3GA 5E2HA 2A49A 3VSLA 5GLCA 2QJ7A 2ZMFA 4EBPA 3NOUC 5FQQA 1TD5A 1XFNA 4BD1A 4OQGA 5A93A 4GJ4A 3TE8A 4S2JA 3EWKA 4LRYC 1P9RA 3MQQA 5L2FA 2Y79A 3E2KA 4P6BA 1SDEA 3BW6A 3UE6A 4PM8A 1O7EA 5CHMA 4F94A 4OP8A 2CC1A 2V9AA 3OBFA 1Y4OA 3HCYA 3IX3A 1JWPA 4O8GA 4XT2B 4L0LA 3NJAA 4UQIS 3IXDA 4R23A 3EGXC 3I7JA 4EWFA 5HDCA 3BQ8A 1ZG4A 1YAXA 4HH2A 1TS6A 3V3RA 2RL3A 3NIAA 1GA0A 4DF6A 1IOUA 1PW8A 3T1SA 1GHIA 1NY0A 2HPBA 1Y54A 3UB8A 5BOHA 2W27A 1MBLA 1W7FA 3V67A 2B5RA 3BQAA 1FQGA 1WA9A 2C6WB 3GTCA 4KZ6A 1F98A 4MLLA 5FAQA 2OLVA 5FQIA 3LIBA 1L0DA 1ES2A 5FQJA 4Y7PA 1C3BA 1ZHHB 1IKIA 4IBXA 4LV0A 3HUMA 1T1BA 3VMAA 3FPWA 4S2OA 4ESPA 2W1RA 3ISGA 2WK0A 4KUOA 4BMWA 4R38A 3H9WA 1CQAA 1E25A 2JC7A 1M6KA 4IVIA 2P08A 5K5BA 4WUJA 4ETXA 5AQ9A 1OT6A 4X6TA 3U4LP 2FH5A 4KG5A 2ZQDA 4X25A 5DF8A 4L9FA 2NUPC 2K31A 3MBZA 1LL9A 3E98A 2QMIA 2BG1A 1RGZA 4ZJ3A 4PHTA 3HBRA 2H0YA 3O3VA 1EWZA 2HP6A 3PAEA 4Q0JA 2EX2A 2JN7A 3C4PA 2K7SA 2O9CA 3S4XA 1DJBA 5TFQA 5HDDA 2P7JA 1N9BA 3T4QA 1XJ6A 3W4PA 3G30A 1NLYA 2ZC5B 1E3UD 1PRQA 5A90A 1BLHA 4DE0A 4JGQA 3PHYA 3GECA 2HDRA 5KSHA 1JTGA 4YWZA 4CLCB 4HP9A 4ME4A 4KQQA 2BTFP 3FV7A 5DKKA 1NXYA 4NETA 4N9LA 1CJFA 2HP5A 4FH2A 4JF5A 3CJMA 1XXMA 3VP3A 2H28A 3OCNA 3RTYA 2V20A 5DKLA 3DBAA 3DTIA 4MCWA 1K38A 1TS0A 2G2UA 4E3LA 3ZQ5A 1FCNA 1E4DA 1SZVA 1ACFA 1OJGA 1SKOB 1GHMA 3CUEA 3LY3A 3IX4A 2EX6A 3UE0A 5FL3A 2Y2GA 2G7UA 4WN5A 4GS9A 3Q1FA 4RVAA 5MC7A 3RFBA 4N1XA 2XSSA 4LRXC 3SS4A 3S7PA 3B3XA 1ALQA 2ZOIA 2W3DA 1PZOA 4BJPA 1I2SA 1S4SA 3OPLA 3EEAA 1XFQA 4X1MA 3DWZA 2WADA 1MC0A 4JXSA 4FCFA 2Q0OA 2WAFA 4U0TA 4JGPA 3T4SA 1SDNA 1SKOA 1BT5A 5FQMA 2W3FA 2PD7A 2D02A 4RYEA 3CAXA 3R4KA 4WM9A 1SCWA 3LIEA 5EFWA 4NEED 3NHQA 3UB9A 2J9OA 4S2LA 1E3UA 4Y13A 4Q8IA 3IH9A 2XR0A 4HI4A 3D3OA 3BLMA 3G2ZA 2Z6DA 2V8FA 2P9VB 4GKUA 3PBQA 3HREA 3KYQA 3H82B 3HLCA 4P0MA 2R78A 4IJGA 3F1NA 1DP9A 1YKDA 5E2EA 5GLDA 3EGDC 5DJUA 5HX9A 3ZG8B 3WS0A 3GRJA 4IVKA 3ULFA 3ITAA 3ZFZA 3P98A 4HY8A 1S1ZA 2ZC4B 3KYEA 4MN7A
chains in the Genus database with same CATH topology
3A0VA 4YOFA 2M7UA 4Q0HA 3KSHA 4HH3A 1TS7A 3C2WA 4WL9A 1NWZA 3EQVA 3UE3A 5HPFA 4ARZB 3LR5A 3PBOA 3LR3A 1S66L 3T4LA 4HJ6A 3CWFA 3MQ0A 3OOVA 1P0ZA 3LR4A 5HPIA 2WKPA 4GW9A 2INWA 2PHYA 2M1CA 3NOTC 5F68A 2Y8HA 3H82A 4L9GA 3T50A 3P7NA 3C38A 2L4RA 5I5LA 3VV4A 3IS2A 3R7WB 5HDSA 4MN5A 1STZA 3LIDA 1V9YA 3H7WB 4KQOA 4EEPA 2JKTI 4IHQA 5KIZA 4XT2A 5DF9A 4LLOB 1VHMA 2JKRM 4O0PA 2O99A 2PD8A 4HP4A 1NRJA 1H8MA 2VV6A 4NXBA 3KX0X 3MF0A 4CLCE 5AVEA 3G6OA 4L9EA 3KSIA 1G28A 5HWVA 3FG8A 3VE4A 4LPZA 3TRCA 4DMZA 5A8BA 2GNXA 2OWJA 2W3HA 2W3EA 4JGOA 3BY9A 3F1NB 2IA2A 4I39A 3E0YA 3ZYTA 1X0OA 4G3VA 4CLCD 2LB5A 4HIAA 4Y5FA 1VB6A 3F1PB 1S67L 1W63M 2PR6A 3PR6A 3PBNA 2VEAA 3A0RA 4R70A 4BBUA 2PYRA 4CQHA 1F5MA 4P6ZM 3JVUA 3PBSA 2Z6CA 2P04A 3BJNA 5IU1A 3H7WA 3LIFA 2KX6A 2W3GA 4BBTA 1OJ5A 2FZ0A 2WKRA 1V9ZA 4R6LA 5HWTA 2QJ7A 2ZMFA 3NOUC 2V0UA 1TD5A 4EW7A 3RH8B 1XFNA 5J4EA 4EESA 4GJ4A 3TE8A 2PYPA 3EWKA 4LRYC 1P9RA 3B47A 3LIAA 3MQQA 3W2ZA 2V0WA 3C30A 2Y79A 4YNRA 3CLOA 4K08A 4MDZA 2J3TC 4G3WA 1JNUA 3BW6A 3LICA 4F3LA 3UE6A 2B18A 4DN0A 2VKSA 5F5YA 4IUHA 3F1PA 2V9AA 2EA9A 3OBFA 4OOLA 3HCYA 2O9AA 5HWWA 2EWVA 1LSVA 2GJ3A 4O8GA 2DMWA 4L0LA 4XT2B 3NJAA 4UQIS 1MZUA 2HV1A 4IUKA 4WEJA 3EGXC 3T4TA 2BASA 3PBTA 5HDCA 5IS1A 3BQ8A 1YAXA 4HH2A 4NXGA 4WELA 1TS6A 2QKPA 1OTAA 3TJZC 1IOUA 2J80A 3MXQA 3IBJA 5DJTA 5HZHA 3JVVA 1XJ2A 3T4OA 3UB8A 1YSPA 2W27A 4M4XA 3V67A 1T19A 2VGLM 3BQAA 3U2AA 4I3IA 1T18A 4R3AA 3ICYA 2QHKA 2VA0A 2XROA 1WA9A 2A24A 3PBRA 4E04A 4EUVA 1F98A 4Y3IA 2W0NA 3LIBA 1S1YA 1ZTUA 2XA7M 1P9WA 3KSFA 3E4OA 3S7NA 1UGUA 1OTIA 1ZHHB 5L8MA 4HHDA 3B33A 2HGVA 3CI6A 3E4PA 4I5SA 5AJGA 1T1BA 1OTBA 4NXEA 3GDIA 3FPWA 4Y2FA 4CLCA 2W1RA 5IT5A 1UWNX 3HJKA 2L1MA 2OOLA 4GLQA 2M7VA 4KUOA 3SW1A 4BMWA 5HD3A 5J3WA 1D7EA 4R38A 3H9WA 1BYWA 2PDRA 2KLIA 4UQIM 4F3LB 5J7EA 2EWWA 3LI9A 2JKTM 4EU0A 2P08A 1G6OA 5K5BA 4Q0IA 4WUJA 1LSWA 4ETXA 1OT6A 1OTDA 2JHEA 4HJ3A 2J3WA 2FH5A 3S7OA 4PKYG 1T1CA 5DFYA 3FC7A 2NUPC 4L9FA 2K31A 3NOPC 3MQOA 2VV7A 3T4JA 4PAUA 3E98A 2GZAA 4PHTA 2PT7A 3F1OB 5HL6A 3CITA 4BBVA 4Q0JA 1EW0A 2W1TB 5CX7A 2CMNA 1OTEA 5F6AA 2JN7A 3S7QA 3TW8A 3OCLA 2VV8A 3PYPA 4NKPA 2K7SA 1KOUA 1OPXA 2PR5A 4HJ4A 2NUTC 1N9LA 2O9CA 4DJ2A 2YKHA 2K2NA 3OLOA 3K2NA 2A24B 1TF1A 5HDDA 3BY8A 2P7JA 3T4QA 1XJ6A 3EQUA 2ZMVA 4EEUA 3B42A 1NLYA 3KYZA 2WKQA 3LFVA 3IBRA 4EXOA 4PKYA 4JGQA 4H6JB 1N9NA 3PHYA 4WLAA 1UWPX 3GECA 3T4KA 5KSHA 1P97A 1LT0A 2KDKA 3LYXA 4YWZA 4CLCB 4II7A 1XJ4A 3C8CA 3K3CA 1F9IA 4HP9A 4ME4A 1DP8A 4I38A 3OC2A 2VLGA 5DKKA 3PXPA 1OT9A 2B02A 2HJ9C 3HJIA 3MMHA 3F1OA 2KOIA 2H28A 3OCNA 2W1TA 2OAQ1 3RTYA 1NLZA 3MFXA 5DKLA 3DBAA 3EOIA 5G4YA 4LRZE 4MCWA 3LR0A 3UB7A 4EERA 1TS0A 4I3AA 3KO6A 4WEKA 3UMEA 4P6ZS 1DP6A 4BWIA 3D72A 4ETZA 1LSXA 2JKRI 2VZWA 5AVFA 3ZQ5A 4B9OA 3MR0A 4Z1WA 3O5YA 4FOFA 1OJGA 2OWHA 3VOLA 3P01A 5TJJA 4H6JA 4DJ3A 2QWSA 1H3QA 3BWLA 3CUEA 4HOIA 5FL3A 2G7UA 4WN5A 4GS9A 4O01A 3A0SA 4HQAA 3UB6A 3LUQA 5MC7A 3RFBA 1S4RA 2XSSA 4LRXC 2OAP1 4JGRA 5G4ZA 3S7PA 1GSWA 2ZOIA 2W3DA 2O9BA 4BJPA 2GX5A 4GHIB 1S4SA 4G3KA 5C5KA 3EEAA 2VJWA 2I9VA 2MJ6A 1XFQA 1MC0A 4MMNA 4ARZA 3MJQA 3K3DA 3VE3A 4B93A 1N9OA 4MN6A 4WF0A 1T1AA 4QPRA 4OOMA 4JGPA 3LI8A 3T4SA 3CUEC 5DFXA 1XJ3A 5LBRA 1GSXA 4CLCC 2W3FA 2PD7A 5TBMB 2YKFA 1MKMA 2D02A 4FSFA 3CAXA 3R4KA 1ODVA 4RQ9A 2J3TD 3LIEA 4KQDA 3R7WA 5EFWA 4NEED 5HSQA 2O0YA 3NHQA 2VGLS 1W63Q 3UB9A 4AFIA 1IFQA 2V1BA 1Y28A 4HI4A 4NXFA 3E4QA 3KSGA 3D3OA 2L0WA 1GSVA 2XA7S 2LB9A 2Z6DA 4EQ1A 4GHIA 4KUKA 4EETB 2V1AA 3EEHA 2A2LA 5F69A 3PBQA 2XRNA 3KYQA 2QJ5A 3H82B 1D06A 4ZRRA 2HJEA 3UMDA 4UEYA 2R78A 4IJGA 3F1NA 2ZOHA 1DP9A 1YKDA 2D01A 4GS9B 3IS2B 4HNBA 1LL8A 4GCZA 3EGDC 5DJUA 3FPVA 1YSQA 2ZBBA 4I3JA 3ULFA 1TS8A 2HF6A 1DRMA 5TBMA 4HY8A 1S1ZA 2QYBA 5HD5A 4MN7A 2VX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRY C;  4YOF A;  2G7U A;  3W2Z A;  2M7U A;  4Q0H A;  3S7O A;  2Y79 A;  3KSH A;  4YNR A;  4MDZ A;  5DFY A;  3C2W A;  4O01 A;  4G3W A;  2K31 A;  3NOP C;  5HPF A;  4DN0 A;  2B18 A;  2VKS A;  4PAU A;  3E98 A;  3RFB A;  2XSS A;  4IUH A;  4LRX C;  3MQ0 A;  3OOV A;  3OBF A;  5HPI A;  3HCY A;  2O9A A;  4GW9 A;  3S7P A;  4O8G A;  2W3D A;  5HL6 A;  3CIT A;  2O9B A;  3NOT C;  4Q0J A;  2GX5 A;  2Y8H A;  2W1T B;  4G3K A;  5C5K A;  4IUK A;  3EEA A;  2VJW A;  3S7Q A;  5I5L A;  3VV4 A;  1MC0 A;  4MMN A;  2O9C A;  2K2N A;  1STZ A;  3K2N A;  4QPR A;  1TF1 A;  3IBJ A;  1VHM A;  4O0P A;  5DFX A;  5LBR A;  2O99 A;  1YSP A;  3LFV A;  3IBR A;  3MF0 A;  2W3F A;  1MKM A;  3G6O A;  3R4K A;  3KSI A;  4RQ9 A;  5HSQ A;  2O0Y A;  2XRO A;  3NHQ A;  3TRC A;  4DMZ A;  4E04 A;  4EUV A;  2W3H A;  4Y3I A;  4ME4 A;  2W3E A;  2IA2 A;  1ZTU A;  3E0Y A;  3KSG A;  3D3O A;  4G3V A;  3KSF A;  2LB5 A;  4Y5F A;  3S7N A;  3MMH A;  5L8M A;  2HGV A;  3CI6 A;  2KOI A;  2VEA A;  2LB9 A;  2W1T A;  5AJG A;  4R70 A;  3DBA A;  4Y2F A;  4CQH A;  1F5M A;  2W1R A;  2XRN A;  4LRZ E;  4MCW A;  4ZRR A;  3KO6 A;  4IJG A;  2OOL A;  3BJN A;  4GLQ A;  2M7V A;  1YKD A;  2W3G A;  4BWI A;  4ETZ A;  2KLI A;  2VZW A;  3ZQ5 A;  1YSQ A;  4R6L A;  4Z1W A;  4EU0 A;  2ZMF A;  3O5Y A;  3NOU C;  4FOF A;  5K5B A;  1TD5 A;  4Q0I A;  5TJJ A;  4ETX A;  2QYB A;  4MN7 A; 
#chains in the Genus database with same CATH topology
 3UN7 A;  4DRT A;  3MZF A;  4YOF A;  4R1G A;  4X56 A;  3IX8 A;  4HH3 A;  1TS7 A;  4C6Y A;  1NWZ A;  3EQV A;  4LV2 A;  2C5W B;  5HPF A;  1NZU A;  2Y2O A;  3PBO A;  3LR3 A;  4PM7 A;  3MQ0 A;  3SS5 A;  1P0Z A;  5CHJ A;  4GW9 A;  4KZ7 A;  3IWO A;  1LHY A;  2M1C A;  3VFH A;  3NOT C;  5F68 A;  2Y8H A;  2ZC7 A;  2Y2L A;  3H82 A;  4L9G A;  3UDX A;  2IWD A;  3M2K A;  2EXB A;  4EBL A;  4JKT A;  4R3B A;  5FI7 A;  1G68 A;  3C4O A;  2JKT I;  3SS3 A;  4IHQ A;  3S22 A;  2I72 A;  2XFS A;  4HP4 A;  3QNC A;  2VV6 A;  2EX8 A;  1BTL A;  3MF0 A;  4NXB A;  3G6O A;  4HBT A;  4FH4 A;  3VE4 A;  3TRC A;  2GNX A;  3UO9 A;  3T1X A;  3OPH A;  1RGY A;  2WGV A;  1LI0 A;  1KE0 A;  4I39 A;  2Y2M A;  1VB6 A;  4U3T A;  3T1R A;  2XD5 A;  2EXA A;  4EQI A;  3BFG A;  4P6Z M;  5FA7 A;  5AQA A;  1YMS A;  4BBT A;  1OJ5 A;  4ZAM A;  4X53 A;  4QJG A;  3QP6 A;  1KE4 A;  4R6L A;  5HWT A;  5U47 A;  2Y2H A;  4KQR A;  4EES A;  2PYP A;  5E2F A;  4B4Z A;  3C30 A;  2OLU A;  3N8S A;  3SZT A;  1BUL A;  4G3W A;  2WGW A;  4F3L A;  2B18 A;  1GA9 A;  4OPZ A;  2EA9 A;  4OOL A;  5HWW A;  4E3N A;  2EWV A;  1LSV A;  2GJ3 A;  2DMW A;  3JPU A;  1MZU A;  4ZJ2 A;  3ZGA B;  2HV1 A;  4QB8 A;  2HDU A;  5A92 A;  2BAS A;  4OOY A;  3V50 A;  1RP5 A;  3NBL A;  5IS1 A;  1CEG A;  1L3L A;  4DKI A;  1KE3 A;  2QKP A;  2OV5 A;  2Y4A A;  2XGN A;  1OTA A;  1YPR A;  1OME A;  4R4R A;  1DY6 A;  3VP4 A;  5HZH A;  3JVV A;  1XJ2 A;  3T4O A;  4A5R A;  4MEZ A;  5M18 A;  3U2A A;  4I3I A;  2VA0 A;  2XRO A;  1W5D A;  3MXS A;  5AQB A;  1ONG A;  2W0N A;  4E6X A;  3VP2 A;  1F2K A;  1MWU A;  1Q2P A;  3UE1 A;  3E4O A;  5L8M A;  3B33 A;  3CI6 A;  5IHV A;  5CED A;  1ZG6 A;  5AJG A;  1PI4 A;  1FOF A;  1BLS A;  5IT5 A;  1UWN X;  2VGK A;  4KZ3 A;  3NDE A;  3SW1 A;  5J3W A;  5CXW A;  1U60 A;  1BYW A;  3AGF A;  4UQI M;  5CHU A;  2EWW A;  3LO7 A;  4ZJ1 A;  3LI9 A;  4EU0 A;  3V39 A;  4EUZ A;  2DRW A;  4Q0I A;  1AWI A;  3Q07 A;  1ERQ A;  4GD6 A;  2JHE A;  4E3I A;  1H5X A;  1ESI A;  4PM5 A;  3FC7 A;  1XA1 A;  2E8I A;  3GQZ A;  3ZG9 B;  1VEU B;  3MKF A;  1MPL A;  4LFU A;  3RJU A;  2GZA A;  4K0X A;  1Z09 A;  5HL1 A;  3CIT A;  3GMW A;  1LI9 A;  4OQH A;  2ZD8 A;  4B4X A;  5F6A A;  3TW8 A;  3OCL A;  2VV8 A;  3NCK A;  3PYP A;  4HJ4 A;  2YKH A;  3K2N A;  1W8Y A;  4BL3 A;  3D9Y A;  1G6A A;  1TF1 A;  1ZC2 A;  3BY8 A;  1L0G A;  3S1Y A;  5EVI D;  4E3K A;  3EQU A;  2ZMV A;  1K56 D;  5E43 A;  3KYZ A;  3IBR A;  4OLD A;  4EXO A;  4PKY A;  5FAP A;  2WKE A;  1ES3 A;  4WLA A;  5JYP A;  5KSC A;  4KZB A;  3T4K A;  4GZB A;  2KDK A;  3LYX A;  4II7 A;  1VEU A;  4K91 A;  3OC2 A;  5DF7 A;  2Y2N A;  3CPT A;  2B02 A;  4MBK A;  5AQ7 A;  2OAQ 1;  3MFX A;  4S2P A;  2PRF A;  3SH9 A;  1GHP A;  3LCE A;  4I3A A;  3WS5 A;  3M6H A;  4WZ5 C;  5GHY A;  1DP6 A;  4ETZ A;  2VZW A;  1SHV A;  3MR0 A;  3O86 A;  1SKF A;  2OWH A;  5TJJ A;  2Y2P A;  3BWL A;  1S6R A;  4HOI A;  2WYX A;  2Q9N A;  1MKI A;  1FSY A;  3HLB A;  3MZE A;  4O01 A;  3QNB A;  4Y0O A;  4IED A;  3UB6 A;  4LV1 A;  3LUQ A;  3BEB A;  3QHY A;  5FQK A;  4WYY A;  2OAP 1;  4PMA A;  4DDY A;  5KMW A;  2O9B A;  3NY4 A;  4GHI B;  3O87 A;  4G3K A;  5GL9 A;  4B93 A;  3K3D A;  2UWX A;  2QZ6 A;  5E2G A;  4MN6 A;  1T1A A;  1AXB A;  4NK3 A;  3ZCZ A;  5DVA A;  4FUW A;  5DTK A;  5CGW A;  4E3O A;  5HAI A;  3BLS A;  4OQI A;  5EEC A;  5TBM B;  2YKF A;  5EVI A;  1ODV A;  1S0W A;  5GLA A;  4ID4 A;  1K56 A;  1YLP A;  3M6B A;  4AFI A;  3L7H A;  3VFF A;  1ES5 A;  1NZO A;  4NXF A;  3E4Q A;  3C7V A;  4JXG A;  3A3D A;  5FI6 A;  1IEL A;  3FYZ A;  4GHI A;  3MSH A;  4KZ4 A;  2V1A A;  2A2L A;  2X71 A;  2DNS A;  4EBN A;  3V3S A;  4QY6 A;  3VP0 A;  3N4I A;  3IS2 B;  4GS9 B;  4KZ5 A;  1FCO A;  4GCZ A;  1YT4 A;  4D2O A;  3FPV A;  4I3J A;  2JKF A;  1K6S A;  2HF6 A;  5TBM A;  2X02 A;  5HD5 A;  1G5U A;  5L10 A;  2VX8 A;  1IKG A;  1TDG A;  5EPH A;  2M7U A;  4Q0H A;  2QPN A;  3MXR A;  1L0F A;  3UNW A;  3CWF A;  1DJA A;  2JKG A;  3OOV A;  2WKP A;  3GSG A;  4X69 A;  5EOO A;  5J8X A;  5EVE A;  4P87 A;  3T50 A;  3P7N A;  3VV4 A;  3IS2 A;  4JXW A;  5EVL A;  5CTM A;  3UY6 A;  2XFT A;  4MN5 A;  4YIN A;  1MY8 A;  3LID A;  3DAV A;  2EX9 A;  3WWX A;  5KIZ A;  4DE3 A;  4HBU A;  2IWC A;  1K25 A;  3CMZ A;  3VSK A;  1NRJ A;  3KX0 X;  4OKP A;  5AVE A;  2ZM8 A;  2ZL1 A;  4L9E A;  5A8B A;  4DMZ A;  1KVL A;  2W3H A;  1PNE A;  3F1N B;  2IA2 A;  1BZA A;  3IF6 A;  3E0Y A;  2LB5 A;  1W63 M;  2Y59 A;  3PBN A;  3WRT A;  3A0R A;  2ZQ8 A;  4KZ8 A;  1IYS A;  5GHZ A;  2PYR A;  1F5M A;  2ZC6 B;  3JVU A;  3CG5 A;  4X1L A;  2P04 A;  5HW3 A;  2JCH A;  2KX6 A;  3IXB A;  1MWR A;  4GB7 A;  2ACG A;  3G4P A;  3AGD A;  3RH8 B;  2XF3 A;  5J4E A;  2J7V A;  1H8Z A;  5EM0 A;  1XGJ A;  3NC8 A;  3CLO A;  1QME A;  4K08 A;  4P85 A;  5EOE A;  3LIC A;  5FAS A;  2VKS A;  5F5Y A;  4IUH A;  1PWC A;  4OON A;  3SH7 A;  2O9A A;  4K0W A;  3A3J A;  5EVI C;  3BRM A;  3GR2 A;  3IF5 A;  2EFU A;  3Q7V A;  2WGI A;  3G2Y A;  4QHC A;  1BSG A;  5FEF A;  2XQZ A;  3MFD A;  3OPR A;  3QP4 A;  2FFF B;  3TJZ C;  5CER A;  3MXQ A;  1YLT A;  3HLW A;  3LGO A;  5DJT A;  1YSP A;  4M4X A;  1WYC A;  3ZDJ A;  1T19 A;  2VGL M;  4R3A A;  1A0K A;  1T18 A;  5FQ9 A;  2A24 A;  4E04 A;  4EUV A;  1PWG A;  4Y3I A;  4GD8 A;  4XXR A;  5EE8 A;  1S1Y A;  1ZTU A;  2XA7 M;  3T12 B;  4Y0U A;  3RXX A;  3BM6 A;  3S7N A;  1UGU A;  1OTI A;  4R3J A;  2HGV A;  4I5S A;  1IYO A;  3IH8 A;  2ZQC A;  3IWQ A;  3CZD A;  4NXE A;  1HLU P;  3GDI A;  2HZ5 A;  1BLC A;  3VOY A;  2ZC3 B;  4QY5 A;  4GLQ A;  5M1A A;  2M7V A;  3UDI A;  4QD4 A;  2XD1 A;  3FWL A;  5HD3 A;  1D7E A;  1VQQ A;  2PDR A;  2WGW B;  4F3L B;  5J7E A;  2VGJ A;  2J9P A;  2JKT M;  2HDS A;  1LLB A;  3UPO A;  4KEN B;  1GCE A;  3AGE A;  4HJ3 A;  2J3W A;  3W4O A;  4PPR A;  4S2K A;  5GLB A;  1I5Q A;  3NOP C;  3MQO A;  2WAE A;  4BL2 A;  3T4J A;  1ESU A;  4XUX A;  2XH9 A;  4LGW A;  3QP5 A;  5HL6 A;  4UAA A;  4BBV A;  2V1Z A;  3Q7Z A;  2W1T B;  1OTE A;  3S7Q A;  3QP8 A;  4WZ4 A;  4JXV A;  1OPX A;  4R0Q A;  3BFE A;  3ZG5 A;  4DJ2 A;  1I2W A;  3IF6 C;  1Q2Q A;  1YQS A;  4B88 A;  5F1F A;  2UV0 E;  1JTD A;  1NRF A;  4WZ5 A;  2Z2M B;  1PI5 A;  1NYM A;  3B42 A;  4N92 A;  4QWO A;  3LFV A;  5A91 A;  3DW0 A;  1K0K A;  1ZKJ A;  4H6J B;  1K55 A;  1P97 A;  4OPQ A;  1XJ4 A;  3C8C A;  3K3C A;  1F9I A;  3T1Q B;  1K4E A;  4I38 A;  2VLG A;  3GV9 A;  5FI2 A;  1KVM A;  1OT9 A;  2HJ9 C;  3HJI A;  3MMH A;  1XPB A;  1M40 A;  3OZH A;  2KOI A;  2W1T A;  1CK3 A;  2Y2J A;  4Y17 A;  3LR0 A;  3UB7 A;  4Z9Q A;  1FR1 A;  2Z2L B;  3NI9 A;  3KO6 A;  4WEK A;  3UME A;  1KGF A;  4P6Z S;  4ZBE A;  2JKR I;  5AVF A;  2V8C A;  2XK1 A;  4B9O A;  4DXC A;  2X01 A;  3O5Y A;  1K57 A;  2H0T A;  4DJ3 A;  1N4O A;  4H6J A;  4KG2 A;  2QWS A;  1H3Q A;  4ZTK A;  1JWZ A;  4KG6 A;  4HQA A;  1FSW A;  2PBY A;  1S4R A;  4NG2 A;  5G4Z A;  1GSW A;  2ZQ7 A;  3FKV A;  4Y0T A;  1HD8 A;  2I9V A;  2MJ6 A;  4DXB A;  3P09 A;  4ARZ A;  1L2S A;  1N9O A;  4PM6 A;  4QPR A;  3MZD A;  3LI8 A;  3CPT B;  1GSX A;  5FDS A;  3M2J A;  4WBG A;  3WS2 A;  1MKM A;  4FSF A;  4KQD A;  3R7W A;  3BFD A;  4H8R A;  2V1B A;  4OH0 A;  1TVF A;  2WKI A;  2Y55 A;  1Y28 A;  3G32 A;  5L07 A;  4EQ1 A;  5HFO A;  2Y2I A;  4EET B;  2ZMA A;  2WZZ A;  2XRN A;  1D06 A;  3UMD A;  2HJE A;  4UEY A;  2ZOH A;  2P74 A;  3BFF A;  3IT9 A;  3SOI A;  5F1G A;  5EUA A;  4GDN A;  4C75 A;  3UDF A;  2G2W A;  1BUE A;  3HLG A;  2V2F F;  3A0V A;  2JE5 A;  3KSH A;  1WE4 A;  1Z6F A;  4LV3 A;  3LR5 A;  3T4L A;  5HPI A;  3LEQ A;  1K55 C;  2EFX A;  4LCM A;  4BD0 A;  1XGI A;  1PW1 A;  3ZNT A;  5F82 A;  2JBF A;  3IHB A;  1NJ4 A;  5EVI B;  1IYP A;  3TOI A;  4EEP A;  3L9K A;  4XT2 A;  5KZH A;  5DF9 A;  1VHM A;  4JPM A;  4O0P A;  5G18 A;  4S2I A;  5TGF A;  4X68 A;  1H8M A;  1YMX A;  4OPR A;  4CLC E;  1IYQ A;  1YLZ A;  3IXH A;  3KSI A;  1HVB A;  2HP9 A;  3TG9 A;  3FG8 A;  5HWV A;  4LPZ A;  4HEF A;  2OWJ A;  4KZA A;  4S2N C;  4XUZ A;  4JGO A;  3UPP A;  3CHW P;  3FZC A;  1K57 C;  4WMC D;  1X0O A;  4G3V A;  4CLC D;  4Y5F A;  3F1P B;  3PR6 A;  2VEA A;  4UHU A;  3HVF A;  3W8K A;  4KZ9 A;  4E3M A;  2GDN A;  4R70 A;  4FTX A;  4BBU A;  2DCF A;  1H8Y A;  5D3O A;  2BLS A;  2Z6C A;  3G35 A;  3LIF A;  2FZ0 A;  2WKR A;  4BEN A;  3DWK A;  3WS1 A;  1V9Z A;  2Q9M A;  1KGG A;  1K54 C;  3A3I A;  1MWT A;  1HZO A;  4OLG A;  2V0U A;  1XKZ A;  4EW7 A;  3B47 A;  3LIA A;  2FFY A;  3MKE A;  2OSU A;  2PU4 A;  3D4F A;  3W2Z A;  2V0W A;  5HAQ A;  3ZHH A;  4YNR A;  4Y15 A;  4MDZ A;  2J3T C;  3A3E A;  1KDW A;  4GDB A;  1O07 A;  1JNU A;  2Y2K A;  3BYD A;  3IWI A;  3UB5 P;  5DTT A;  4DN0 A;  3HUO A;  1PZP A;  3PTE A;  3F1P A;  4DDS A;  1PYY A;  3BEC A;  2ZJ9 A;  1K6R A;  1YLJ A;  4IUK A;  4WEJ A;  3T4T A;  3PBT A;  2ZL1 B;  2XDM A;  3BFC A;  2Y2Q A;  4NXG A;  4WEL A;  2WZX A;  5FEG A;  3Q82 A;  2J80 A;  3IBJ A;  3IF6 B;  3ZVT A;  2ZQ9 A;  3Q81 A;  1CI9 A;  1ERO A;  4LCL A;  4ZDX A;  3ICY A;  2QHK A;  3N6I A;  2HDQ A;  1VET B;  3PBR A;  1ONH A;  4X55 A;  4JF4 A;  1D1J A;  2ZM2 A;  1P9W A;  3KSF A;  1J3W A;  4HHD A;  3E4P A;  4MBH A;  3A3F A;  1KDS A;  3ITB A;  3G31 A;  1OTB A;  4WMC A;  1IEM A;  4Y2F A;  4CLC A;  2A3U A;  3NDG A;  3HJK A;  2L1M A;  5GHX A;  2OOL A;  1H0M A;  3NEC A;  2KLI A;  3MS6 A;  3WS4 A;  3HLF A;  5CRF A;  5FDH A;  3HLD A;  3ZVW A;  1FIL A;  1G6O A;  1LSW A;  1BLP A;  4BLM A;  1OTD A;  1XP4 A;  1VET A;  4R4S A;  3S7O A;  3Q7V B;  1QMF A;  4JBF A;  4M3K A;  4PKY G;  1T1C A;  5DFY A;  5EV0 A;  2VV7 A;  4DE1 A;  4PAU A;  5M19 A;  5FAT A;  2PT7 A;  3F1O B;  4C3Q A;  1KGE A;  4DE2 A;  3N8R A;  1EW0 A;  5CX7 A;  2CMN A;  1W8Q A;  4NKP A;  1KOU A;  2PR5 A;  2NUT C;  1N9L A;  3WRZ A;  3OLO A;  2K2N A;  2PAV P;  2A24 B;  3E2L A;  1EI5 A;  2WKH A;  4UA9 A;  2PBD P;  4EEU A;  3DTE A;  2WKQ A;  4EV4 A;  1J9M A;  1YM1 A;  1PIO A;  3V5M A;  3TSG A;  3C7U A;  1N9N A;  5CGX A;  1UWP X;  1K4F A;  1FR6 A;  4OP5 A;  1LT0 A;  1RCJ A;  1DP8 A;  1PFL A;  3LEZ A;  3PXP A;  5DTS A;  3F1O A;  1JWV A;  5CEB A;  1WYB A;  1NLZ A;  4UA6 A;  4GN2 A;  4OVD A;  4GOG A;  3EOI A;  5G4Y A;  2R9X A;  1XX2 A;  4LRZ E;  3SH8 A;  4EER A;  4LEN A;  4BWI A;  3D72 A;  1LSX A;  2P9V A;  4Z1W A;  4YFM A;  5FSR A;  2AVX A;  4FOF A;  4OPY A;  3VOL A;  3P01 A;  4MBF A;  3JYI A;  2E8J A;  3FKW A;  2IWB A;  3G34 A;  3A0S A;  4HES A;  1JVJ A;  5F83 A;  4RX3 A;  2XEP A;  4JGR A;  4JF6 A;  5HAR A;  3ZG0 A;  3VOZ A;  5I94 A;  2H10 A;  2GX5 A;  3UPN A;  2J8Y A;  2R9W A;  5C5K A;  3IQA A;  3IHA A;  2VJW A;  1MXO A;  1YLW A;  5CGS A;  4MMN A;  3MJQ A;  3VE3 A;  1CI8 A;  4RX2 A;  3PAG A;  4WF0 A;  4OOM A;  3LY4 A;  3IXG A;  3OPP A;  3CUE C;  5DFX A;  1XJ3 A;  5LBR A;  4CLC C;  4N9K A;  5CEC A;  4RQ9 A;  2J3T D;  5HSQ A;  4N1H A;  1NYY A;  2O0Y A;  2VGL S;  1W63 Q;  1IFQ A;  2XLN A;  3QP2 A;  4S2M A;  3KSG A;  1PWD A;  5L09 A;  2L0W A;  2B95 A;  1GSV A;  2XA7 S;  2LB9 A;  4MNR A;  4E6W A;  4KUK A;  3EEH A;  3O88 A;  4E3J A;  1ES4 A;  5F69 A;  4GNU A;  1YLY A;  2QJ5 A;  4ZRR A;  4FD8 A;  3N8L A;  2RCX A;  2D01 A;  3HUN A;  1XA7 A;  4HNB A;  1LL8 A;  3W4Q A;  1FCM A;  1YSQ A;  2ZBB A;  5CTN A;  4RA7 A;  4CJN A;  3N7W A;  1FIK A;  1TS8 A;  5TR7 A;  1DRM A;  2QYB A;  2PU2 A;  2H5S A;  3HL9 A;  1W79 A;  3C2W A;  4WL9 A;  4JLF A;  3UE3 A;  1TEM A;  4ARZ B;  2VK3 A;  1S66 L;  4HJ6 A;  4S2N A;  3LR4 A;  1LL5 A;  2INW A;  2PHY A;  4UA7 A;  5HAP A;  1HTZ A;  3HLE A;  2WUQ A;  4IBR A;  3DTK A;  3C38 A;  2L4R A;  5I5L A;  3QP1 A;  3R7W B;  4D60 A;  5HDS A;  1STZ A;  4PM9 A;  1V9Y A;  3H7W B;  4KQO A;  2ZQA A;  4CPK A;  3ZG7 B;  4U0X A;  4LLO B;  2JKR M;  1DJC A;  3NUL A;  2O99 A;  2PD8 A;  2ZM0 A;  5EM1 A;  1K54 A;  2Y91 A;  1VM1 A;  4QU3 A;  5JYO A;  1G28 A;  3ZNY A;  4O7D A;  3VP1 A;  3RXW A;  4BQM A;  2W3E A;  3GVB A;  3BY9 A;  1CF0 A;  5FAO A;  1MWS A;  4OQ0 A;  3ZYT A;  4HIA A;  1S67 L;  2PR6 A;  1TDL A;  3C5A A;  1ERM A;  1CEF A;  3DTM A;  4CQH A;  3PBS A;  1L0E A;  2ZLY A;  3BJN A;  5IU1 A;  3H7W A;  2W3G A;  5E2H A;  2A49 A;  3VSL A;  5GLC A;  2QJ7 A;  2ZMF A;  4EBP A;  3NOU C;  5FQQ A;  1TD5 A;  1XFN A;  4BD1 A;  4OQG A;  5A93 A;  4GJ4 A;  3TE8 A;  4S2J A;  3EWK A;  4LRY C;  1P9R A;  3MQQ A;  5L2F A;  2Y79 A;  3E2K A;  4P6B A;  1SDE A;  3BW6 A;  3UE6 A;  4PM8 A;  1O7E A;  5CHM A;  4F94 A;  4OP8 A;  2CC1 A;  2V9A A;  3OBF A;  1Y4O A;  3HCY A;  3IX3 A;  1JWP A;  4O8G A;  4XT2 B;  4L0L A;  3NJA A;  4UQI S;  3IXD A;  4R23 A;  3EGX C;  3I7J A;  4EWF A;  5HDC A;  3BQ8 A;  1ZG4 A;  1YAX A;  4HH2 A;  1TS6 A;  3V3R A;  2RL3 A;  3NIA A;  1GA0 A;  4DF6 A;  1IOU A;  1PW8 A;  3T1S A;  1GHI A;  1NY0 A;  2HPB A;  1Y54 A;  3UB8 A;  5BOH A;  2W27 A;  1MBL A;  1W7F A;  3V67 A;  2B5R A;  3BQA A;  1FQG A;  1WA9 A;  2C6W B;  3GTC A;  4KZ6 A;  1F98 A;  4MLL A;  5FAQ A;  2OLV A;  5FQI A;  3LIB A;  1L0D A;  1ES2 A;  5FQJ A;  4Y7P A;  1C3B A;  1ZHH B;  1IKI A;  4IBX A;  4LV0 A;  3HUM A;  1T1B A;  3VMA A;  3FPW A;  4S2O A;  4ESP A;  2W1R A;  3ISG A;  2WK0 A;  4KUO A;  4BMW A;  4R38 A;  3H9W A;  1CQA A;  1E25 A;  2JC7 A;  1M6K A;  4IVI A;  2P08 A;  5K5B A;  4WUJ A;  4ETX A;  5AQ9 A;  1OT6 A;  4X6T A;  3U4L P;  2FH5 A;  4KG5 A;  2ZQD A;  4X25 A;  5DF8 A;  4L9F A;  2NUP C;  2K31 A;  3MBZ A;  1LL9 A;  3E98 A;  2QMI A;  2BG1 A;  1RGZ A;  4ZJ3 A;  4PHT A;  3HBR A;  2H0Y A;  3O3V A;  1EWZ A;  2HP6 A;  3PAE A;  4Q0J A;  2EX2 A;  2JN7 A;  3C4P A;  2K7S A;  2O9C A;  3S4X A;  1DJB A;  5TFQ A;  5HDD A;  2P7J A;  1N9B A;  3T4Q A;  1XJ6 A;  3W4P A;  3G30 A;  1NLY A;  2ZC5 B;  1E3U D;  1PRQ A;  5A90 A;  1BLH A;  4DE0 A;  4JGQ A;  3PHY A;  3GEC A;  2HDR A;  5KSH A;  1JTG A;  4YWZ A;  4CLC B;  4HP9 A;  4ME4 A;  4KQQ A;  2BTF P;  3FV7 A;  5DKK A;  1NXY A;  4NET A;  4N9L A;  1CJF A;  2HP5 A;  4FH2 A;  4JF5 A;  3CJM A;  1XXM A;  3VP3 A;  2H28 A;  3OCN A;  3RTY A;  2V20 A;  5DKL A;  3DBA A;  3DTI A;  4MCW A;  1K38 A;  1TS0 A;  2G2U A;  4E3L A;  3ZQ5 A;  1FCN A;  1E4D A;  1SZV A;  1ACF A;  1OJG A;  1SKO B;  1GHM A;  3CUE A;  3LY3 A;  3IX4 A;  2EX6 A;  3UE0 A;  5FL3 A;  2Y2G A;  2G7U A;  4WN5 A;  4GS9 A;  3Q1F A;  4RVA A;  5MC7 A;  3RFB A;  4N1X A;  2XSS A;  4LRX C;  3SS4 A;  3S7P A;  3B3X A;  1ALQ A;  2ZOI A;  2W3D A;  1PZO A;  4BJP A;  1I2S A;  1S4S A;  3OPL A;  3EEA A;  1XFQ A;  4X1M A;  3DWZ A;  2WAD A;  1MC0 A;  4JXS A;  4FCF A;  2Q0O A;  2WAF A;  4U0T A;  4JGP A;  3T4S A;  1SDN A;  1SKO A;  1BT5 A;  5FQM A;  2W3F A;  2PD7 A;  2D02 A;  4RYE A;  3CAX A;  3R4K A;  4WM9 A;  1SCW A;  3LIE A;  5EFW A;  4NEE D;  3NHQ A;  3UB9 A;  2J9O A;  4S2L A;  1E3U A;  4Y13 A;  4Q8I A;  3IH9 A;  2XR0 A;  4HI4 A;  3D3O A;  3BLM A;  3G2Z A;  2Z6D A;  2V8F A;  2P9V B;  4GKU A;  3PBQ A;  3HRE A;  3KYQ A;  3H82 B;  3HLC A;  4P0M A;  2R78 A;  4IJG A;  3F1N A;  1DP9 A;  1YKD A;  5E2E A;  5GLD A;  3EGD C;  5DJU A;  5HX9 A;  3ZG8 B;  3WS0 A;  3GRJ A;  4IVK A;  3ULF A;  3ITA A;  3ZFZ A;  3P98 A;  4HY8 A;  1S1Z A;  2ZC4 B;  3KYE A;  4MN7 A; 
#chains in the Genus database with same CATH homology
 3A0V A;  4YOF A;  2M7U A;  4Q0H A;  3KSH A;  4HH3 A;  1TS7 A;  3C2W A;  4WL9 A;  1NWZ A;  3EQV A;  3UE3 A;  5HPF A;  4ARZ B;  3LR5 A;  3PBO A;  3LR3 A;  1S66 L;  3T4L A;  4HJ6 A;  3CWF A;  3MQ0 A;  3OOV A;  1P0Z A;  3LR4 A;  5HPI A;  2WKP A;  4GW9 A;  2INW A;  2PHY A;  2M1C A;  3NOT C;  5F68 A;  2Y8H A;  3H82 A;  4L9G A;  3T50 A;  3P7N A;  3C38 A;  2L4R A;  5I5L A;  3VV4 A;  3IS2 A;  3R7W B;  5HDS A;  4MN5 A;  1STZ A;  3LID A;  1V9Y A;  3H7W B;  4KQO A;  4EEP A;  2JKT I;  4IHQ A;  5KIZ A;  4XT2 A;  5DF9 A;  4LLO B;  1VHM A;  2JKR M;  4O0P A;  2O99 A;  2PD8 A;  4HP4 A;  1NRJ A;  1H8M A;  2VV6 A;  4NXB A;  3KX0 X;  3MF0 A;  4CLC E;  5AVE A;  3G6O A;  4L9E A;  3KSI A;  1G28 A;  5HWV A;  3FG8 A;  3VE4 A;  4LPZ A;  3TRC A;  4DMZ A;  5A8B A;  2GNX A;  2OWJ A;  2W3H A;  2W3E A;  4JGO A;  3BY9 A;  3F1N B;  2IA2 A;  4I39 A;  3E0Y A;  3ZYT A;  1X0O A;  4G3V A;  4CLC D;  2LB5 A;  4HIA A;  4Y5F A;  1VB6 A;  3F1P B;  1S67 L;  1W63 M;  2PR6 A;  3PR6 A;  3PBN A;  2VEA A;  3A0R A;  4R70 A;  4BBU A;  2PYR A;  4CQH A;  1F5M A;  4P6Z M;  3JVU A;  3PBS A;  2Z6C A;  2P04 A;  3BJN A;  5IU1 A;  3H7W A;  3LIF A;  2KX6 A;  2W3G A;  4BBT A;  1OJ5 A;  2FZ0 A;  2WKR A;  1V9Z A;  4R6L A;  5HWT A;  2QJ7 A;  2ZMF A;  3NOU C;  2V0U A;  1TD5 A;  4EW7 A;  3RH8 B;  1XFN A;  5J4E A;  4EES A;  4GJ4 A;  3TE8 A;  2PYP A;  3EWK A;  4LRY C;  1P9R A;  3B47 A;  3LIA A;  3MQQ A;  3W2Z A;  2V0W A;  3C30 A;  2Y79 A;  4YNR A;  3CLO A;  4K08 A;  4MDZ A;  2J3T C;  4G3W A;  1JNU A;  3BW6 A;  3LIC A;  4F3L A;  3UE6 A;  2B18 A;  4DN0 A;  2VKS A;  5F5Y A;  4IUH A;  3F1P A;  2V9A A;  2EA9 A;  3OBF A;  4OOL A;  3HCY A;  2O9A A;  5HWW A;  2EWV A;  1LSV A;  2GJ3 A;  4O8G A;  2DMW A;  4L0L A;  4XT2 B;  3NJA A;  4UQI S;  1MZU A;  2HV1 A;  4IUK A;  4WEJ A;  3EGX C;  3T4T A;  2BAS A;  3PBT A;  5HDC A;  5IS1 A;  3BQ8 A;  1YAX A;  4HH2 A;  4NXG A;  4WEL A;  1TS6 A;  2QKP A;  1OTA A;  3TJZ C;  1IOU A;  2J80 A;  3MXQ A;  3IBJ A;  5DJT A;  5HZH A;  3JVV A;  1XJ2 A;  3T4O A;  3UB8 A;  1YSP A;  2W27 A;  4M4X A;  3V67 A;  1T19 A;  2VGL M;  3BQA A;  3U2A A;  4I3I A;  1T18 A;  4R3A A;  3ICY A;  2QHK A;  2VA0 A;  2XRO A;  1WA9 A;  2A24 A;  3PBR A;  4E04 A;  4EUV A;  1F98 A;  4Y3I A;  2W0N A;  3LIB A;  1S1Y A;  1ZTU A;  2XA7 M;  1P9W A;  3KSF A;  3E4O A;  3S7N A;  1UGU A;  1OTI A;  1ZHH B;  5L8M A;  4HHD A;  3B33 A;  2HGV A;  3CI6 A;  3E4P A;  4I5S A;  5AJG A;  1T1B A;  1OTB A;  4NXE A;  3GDI A;  3FPW A;  4Y2F A;  4CLC A;  2W1R A;  5IT5 A;  1UWN X;  3HJK A;  2L1M A;  2OOL A;  4GLQ A;  2M7V A;  4KUO A;  3SW1 A;  4BMW A;  5HD3 A;  5J3W A;  1D7E A;  4R38 A;  3H9W A;  1BYW A;  2PDR A;  2KLI A;  4UQI M;  4F3L B;  5J7E A;  2EWW A;  3LI9 A;  2JKT M;  4EU0 A;  2P08 A;  1G6O A;  5K5B A;  4Q0I A;  4WUJ A;  1LSW A;  4ETX A;  1OT6 A;  1OTD A;  2JHE A;  4HJ3 A;  2J3W A;  2FH5 A;  3S7O A;  4PKY G;  1T1C A;  5DFY A;  3FC7 A;  2NUP C;  4L9F A;  2K31 A;  3NOP C;  3MQO A;  2VV7 A;  3T4J A;  4PAU A;  3E98 A;  2GZA A;  4PHT A;  2PT7 A;  3F1O B;  5HL6 A;  3CIT A;  4BBV A;  4Q0J A;  1EW0 A;  2W1T B;  5CX7 A;  2CMN A;  1OTE A;  5F6A A;  2JN7 A;  3S7Q A;  3TW8 A;  3OCL A;  2VV8 A;  3PYP A;  4NKP A;  2K7S A;  1KOU A;  1OPX A;  2PR5 A;  4HJ4 A;  2NUT C;  1N9L A;  2O9C A;  4DJ2 A;  2YKH A;  2K2N A;  3OLO A;  3K2N A;  2A24 B;  1TF1 A;  5HDD A;  3BY8 A;  2P7J A;  3T4Q A;  1XJ6 A;  3EQU A;  2ZMV A;  4EEU A;  3B42 A;  1NLY A;  3KYZ A;  2WKQ A;  3LFV A;  3IBR A;  4EXO A;  4PKY A;  4JGQ A;  4H6J B;  1N9N A;  3PHY A;  4WLA A;  1UWP X;  3GEC A;  3T4K A;  5KSH A;  1P97 A;  1LT0 A;  2KDK A;  3LYX A;  4YWZ A;  4CLC B;  4II7 A;  1XJ4 A;  3C8C A;  3K3C A;  1F9I A;  4HP9 A;  4ME4 A;  1DP8 A;  4I38 A;  3OC2 A;  2VLG A;  5DKK A;  3PXP A;  1OT9 A;  2B02 A;  2HJ9 C;  3HJI A;  3MMH A;  3F1O A;  2KOI A;  2H28 A;  3OCN A;  2W1T A;  2OAQ 1;  3RTY A;  1NLZ A;  3MFX A;  5DKL A;  3DBA A;  3EOI A;  5G4Y A;  4LRZ E;  4MCW A;  3LR0 A;  3UB7 A;  4EER A;  1TS0 A;  4I3A A;  3KO6 A;  4WEK A;  3UME A;  4P6Z S;  1DP6 A;  4BWI A;  3D72 A;  4ETZ A;  1LSX A;  2JKR I;  2VZW A;  5AVF A;  3ZQ5 A;  4B9O A;  3MR0 A;  4Z1W A;  3O5Y A;  4FOF A;  1OJG A;  2OWH A;  3VOL A;  3P01 A;  5TJJ A;  4H6J A;  4DJ3 A;  2QWS A;  1H3Q A;  3BWL A;  3CUE A;  4HOI A;  5FL3 A;  2G7U A;  4WN5 A;  4GS9 A;  4O01 A;  3A0S A;  4HQA A;  3UB6 A;  3LUQ A;  5MC7 A;  3RFB A;  1S4R A;  2XSS A;  4LRX C;  2OAP 1;  4JGR A;  5G4Z A;  3S7P A;  1GSW A;  2ZOI A;  2W3D A;  2O9B A;  4BJP A;  2GX5 A;  4GHI B;  1S4S A;  4G3K A;  5C5K A;  3EEA A;  2VJW A;  2I9V A;  2MJ6 A;  1XFQ A;  1MC0 A;  4MMN A;  4ARZ A;  3MJQ A;  3K3D A;  3VE3 A;  4B93 A;  1N9O A;  4MN6 A;  4WF0 A;  1T1A A;  4QPR A;  4OOM A;  4JGP A;  3LI8 A;  3T4S A;  3CUE C;  5DFX A;  1XJ3 A;  5LBR A;  1GSX A;  4CLC C;  2W3F A;  2PD7 A;  5TBM B;  2YKF A;  1MKM A;  2D02 A;  4FSF A;  3CAX A;  3R4K A;  1ODV A;  4RQ9 A;  2J3T D;  3LIE A;  4KQD A;  3R7W A;  5EFW A;  4NEE D;  5HSQ A;  2O0Y A;  3NHQ A;  2VGL S;  1W63 Q;  3UB9 A;  4AFI A;  1IFQ A;  2V1B A;  1Y28 A;  4HI4 A;  4NXF A;  3E4Q A;  3KSG A;  3D3O A;  2L0W A;  1GSV A;  2XA7 S;  2LB9 A;  2Z6D A;  4EQ1 A;  4GHI A;  4KUK A;  4EET B;  2V1A A;  3EEH A;  2A2L A;  5F69 A;  3PBQ A;  2XRN A;  3KYQ A;  2QJ5 A;  3H82 B;  1D06 A;  4ZRR A;  2HJE A;  3UMD A;  4UEY A;  2R78 A;  4IJG A;  3F1N A;  2ZOH A;  1DP9 A;  1YKD A;  2D01 A;  4GS9 B;  3IS2 B;  4HNB A;  1LL8 A;  4GCZ A;  3EGD C;  5DJU A;  3FPV A;  1YSQ A;  2ZBB A;  4I3J A;  3ULF A;  1TS8 A;  2HF6 A;  1DRM A;  5TBM A;  4HY8 A;  1S1Z A;  2QYB A;  5HD5 A;  4MN7 A;  2VX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...