5DFYA

Structure of the parental state of gaf3 from slr1393 of synechocystis sp. pcc6803 (in vitro assembled protein/chromophore)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'GSLQNIFRATSDEVRHLLSCDRVLVYRFNPDWSGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRAFLTVPVFVGEQLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Three dimensional structure of the parental state of GAF3 from Slr1393 of Synechocystis sp. PCC6803
rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
molecule tags Transferase
total genus 50
structure length 158
sequence length 158
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dfyA00
4ME4A 2O99A 2W1TB 3HCYA 3D3OA 3G6OA 2VEAA 3NOPC 2M7VA 1MKMA 3TRCA 2XSSA 2K2NA 3CI6A 4G3WA 4MMNA 2KLIA 3BJNA 5HSQA 1TD5A 4O8GA 2KOIA 3R4KA 2W3FA 3C2WA 2B18A 3O5YA 4GLQA 1YSQA 2VJWA 4Z1WA 5L8MA 4LRZE 4QPRA 1YKDA 4Q0HA 2O9AA 3DBAA 2HGVA 1ZTUA 3E98A 2W3GA 4IUKA 3NOTC 4Y2FA 4ETZA 3EEAA 2VKSA 4E04A 4R6LA 5DFXA 3KSGA 2QYBA 3MF0A 3S7OA 3IBRA 4DN0A 3VV4A 3KO6A 2K31A 3K2NA 1STZA 2IA2A 2O0YA 4Q0JA 5HL6A 3KSIA 3S7QA 4EUVA 4IUHA 5TJJA 2VZWA 5LBRA 4Y3IA 2GX5A 3NOUC 2W3EA 4CQHA 3LFVA 1YSPA 4DMZA 5K5BA 2LB5A 2LB9A 4MDZA 2W1RA 4ZRRA 5HPIA 3W2ZA 2O9BA 4LRXC 4G3VA 4IJGA 2XROA 4O0PA 3KSHA 2O9CA 2Y79A 4MCWA 2XRNA 2Y8HA 3MMHA 4YNRA 4YOFA 3S7PA 5HPFA 4PAUA 5C5KA 5DFYA 3RFBA 2ZMFA 3ZQ5A 3CITA 2W1TA 5AJGA 1VHMA 3S7NA 2G7UA 4G3KA 3NHQA 4Q0IA 2OOLA 1TF1A 3KSFA 1F5MA 4BWIA 4FOFA 4Y5FA 4R70A 3OBFA 2M7UA 2W3DA 4EU0A 4RQ9A 3MQ0A 5I5LA 2W3HA 1MC0A 4MN7A 4O01A 3E0YA 3OOVA 4LRYC 4ETXA 3IBJA 4GW9A
chains in the Genus database with same CATH superfamily
1WYBA 3HCYA 4ZTKA 3L7HA 2VEAA 1W63Q 4OQHA 3TRCA 1CI9A 4ZDXA 3F1OA 2HDQA 3LCEA 4ID4A 2OAQ1 3ZDJA 1K57A 3DAVA 2B95A 4NKPA 2XD5A 4MBKA 4LRZE 4QPRA 1PZPA 4GOGA 2ZM2A 1NYMA 3DTKA 1DJAA 4R6LA 4OPRA 4DN0A 3G31A 2QMIA 3K2NA 5A92A 1OTEA 2PRFA 2HDUA 1MY8A 2ZC6B 4E3NA 3KYQA 4KZ3A 1YSPA 4JF6A 2P9VB 4Y0OA 2W1RA 3DWKA 4ZRRA 2HJ9C 4BBVA 1YLTA 1S0WA 5HARA 3G32A 1BZAA 5C5KA 4N1XA 1EWZA 2W1TA 4GDNA 2OLUA 4Q0IA 1L0EA 1KGEA 1K54A 4HJ3A 3MFXA 4ARZA 5G4ZA 3H7WA 5DTTA 4UA6A 2ZL1B 2WUQA 5E2EA 1W63M 2VA0A 3CMZA 1KE3A 3HUMA 5I94A 2VGLM 3CLOA 4X69A 2PYPA 5HAPA 4ME4A 2XA7M 5HWWA 4RX3A 2P74A 1SKFA 4M4XA 4HBUA 1G28A 4WZ5A 4E3JA 4MMNA 4Y7PA 5AVFA 1T19A 1YSQA 4H8RA 3SZTA 4JGOA 4BBUA 1ONGA 1LI0A 3BRMA 2V1AA 3U4LP 3C4PA 4LPZA 1GHPA 1N4OA 5JYOA 1YPRA 3NIAA 3WS2A 4MBHA 3LYXA 3S4XA 2KDKA 5AQBA 1MWUA 2JKFA 4K91A 2GDNA 4KG6A 2W0NA 4OLDA 2ZQ8A 3ZCZA 5DF8A 4MDZA 2I9VA 5HPIA 1YLJA 1EW0A 1N9BA 4E3IA 3LIBA 1M40A 3IHBA 4LV3A 4L9GA 3QP6A 2Y2IA 3N4IA 2EFXA 2H0YA 3EWKA 1YM1A 4DJ3A 5HD5A 5TBMA 4FOFA 4Y5FA 4A5RA 4I3AA 1H0MA 2PBDP 2R78A 4LFUA 4GZBA 3Q1FA 3ICYA 4N1HA 4BQMA 3EOIA 3NCKA 1S6RA 4RYEA 4BD1A 1XPBA 1JTGA 4XUXA 2V8FA 4Y0TA 3IX4A 3LIAA 1F9IA 5CXWA 3GVBA 1H8YA 1H8ZA 1NZUA 3TE8A 5FL3A 4LV2A 3FV7A 3VE4A 2QWSA 3I7JA 3CPTA 5HSQA 3N7WA 1LI9A 1IELA 3UPPA 1OTIA 3ZVTA 1C3BA 3IH9A 4EBPA 4X1MA 5GLAA 1QMFA 1SCWA 4ESPA 4GNUA 1AWIA 4GHIB 1DP6A 4Y2FA 2P04A 4BD0A 1FR6A 1CF0A 1TVFA 4UAAA 1X0OA 4PM8A 2C5WB 4JBFA 3GRJA 3KSGA 1K57C 3E2KA 4DE3A 4KG5A 4FH2A 3GQZA 1CI8A 3HBRA 2H10A 1DP9A 4L0LA 1BTLA 4DJ2A 5DTSA 4WL9A 2Z6DA 2B02A 2WK0A 3MSHA 4E3LA 5CTNA 3SH9A 2Y79A 3WS5A 4HH3A 2P08A 1S67L 1I2WA 1LL5A 1YQSA 5EVIA 4PAUA 1YLYA 1Z6FA 4GS9A 3T1QB 1NLZA 1I2SA 3ZG9B 2ZQ9A 4MLLA 2AVXA 1AXBA 2JKTI 3HREA 2FZ0A 2PAVP 2WKIA 3HLEA 3OLOA 4EXOA 1TEMA 2W27A 3IS2B 4S2JA 4ZBEA 4HY8A 5GHYA 4P6BA 3R7WA 3KX0X 2V0UA 2DMWA 4PMAA 1PIOA 4S2NA 4OPZA 3A0VA 2XGNA 1N9LA 1K54C 2XFTA 2EFUA 1K25A 2KLIA 3RXXA 3OCNA 2GNXA 3OC2A 2OLVA 4FH4A 4QD4A 1JNUA 2J7VA 4X55A 3IF5A 1XFQA 3O5YA 2ZOIA 3UE1A 3E98A 2HGVA 3QP1A 2WGWA 5JYPA 3UMEA 4X68A 1LL9A 3B47A 2WGIA 1FOFA 3VFFA 3MZDA 5J7EA 4GD6A 1XX2A 3UB5P 3VSLA 1XJ6A 3NECA 4HP4A 3D72A 4KZ9A 3NDEA 5F1GA 2A49A 1EI5A 3IQAA 2ZM0A 4UEYA 5E2FA 3OPPA 2J9PA 3VP1A 1HLUP 3LO7A 2Y8HA 1JVJA 5CECA 1V9ZA 2ZC5B 3T50A 3WRTA 5DFYA 4ZJ1A 1G5UA 1ONHA 5M1AA 1UWNX 4RVAA 3O3VA 4EQIA 1P9RA 5FEFA 1LT0A 4CLCA 5L09A 4WUJA 2XQZA 3DTIA 4HOIA 1TS6A 3Q81A 4Q8IA 2WKEA 3T4KA 3GECA 3W4OA 3T4SA 3CWFA 4E3MA 4QU3A 2EX2A 1MKMA 5EV0A 4F3LB 2Y2KA 1D7EA 3PHYA 5IT5A 4XT2B 3LEZA 3CHWP 3GR2A 4BLMA 2GZAA 4DXBA 4HBTA 5EM0A 2JHEA 2ZOHA 1LSWA 4CLCE 4Y0UA 3DWZA 2QHKA 3Q82A 4U0TA 4JXWA 2ZMAA 3S7OA 3MKEA 4LENA 3VV4A 1J3WA 2IA2A 1UGUA 3BQ8A 1PI4A 2Y4AA 3IXHA 4KZ7A 4R23A 4WBGA 4QHCA 1ERMA 1U60A 4CQHA 3AGFA 5CHMA 5J3WA 3O86A 4OH0A 2HP5A 3VOZA 3LGOA 5DF9A 4BL3A 1T18A 3E4QA 2EA9A 3T12B 4HJ4A 1D1JA 5KMWA 3P98A 3T4TA 3UPOA 2R9XA 3PBQA 3T1SA 1T1BA 4B88A 1YAXA 4E3KA 3ZHHA 4H6JB 2EX9A 3WS0A 4Y15A 3MXSA 4QY5A 2E8IA 1IYOA 4QWOA 3OOVA 5EVIC 2RL3A 3PBRA 2H5SA 1WE4A 4WELA 1NY0A 3BLMA 3CUEA 3NOPC 2P9VA 5EVID 5DJUA 3HLDA 5TGFA 2XSSA 3T4QA 1VETB 1ES2A 3H82B 3HJKA 4JF5A 3JVVA 3PYPA 3QP5A 4IBXA 2KOIA 4S2IA 3SW1A 4QY6A 3OPRA 3EGXC 4X53A 2ZJ9A 2PHYA 4OQ0A 4S2LA 5MC7A 3PAEA 1GHMA 1L0GA 5CGSA 1VEUA 4ETZA 2Z2LB 1GCEA 4LCLA 4P87A 2ZMVA 4AFIA 4UQIM 5FQMA 3MF0A 1PNEA 2K31A 1CK3A 4NG2A 4Q0JA 1XJ4A 5FI7A 5GLBA 4IUHA 4GCZA 5DJTA 2PD7A 3LR0A 3QP8A 5K5BA 2Q0OA 2LB5A 3VE3A 1K56D 3TJZC 2Y2LA 1PFLA 4Z9QA 1FCMA 4LRXC 2L1MA 2PDRA 3G35A 1YLWA 1IKGA 4GKUA 4DRTA 5L2FA 3QNBA 1NYYA 1K4EA 2OOLA 1JTDA 3SOIA 1KE0A 4HJ6A 5A93A 3M2KA 1FSWA 5DKKA 4E6XA 1KGGA 5IHVA 3MS6A 3P7NA 1NLYA 3BM6A 3ZNYA 4KENB 2V1ZA 1IOUA 2VV7A 3QP2A 3V3SA 2DRWA 4LV1A 3MZFA 4HH2A 3LY4A 3D4FA 5EVEA 4R3AA 4PM6A 3VP2A 3NJAA 4EESA 4N9LA 4ZJ2A 2HDRA 3G34A 5F6AA 2J80A 1BLPA 3NI9A 1YT4A 4CLCD 3HLWA 4RX2A 5FEGA 1ZG6A 3HLBA 4NXFA 2JKGA 3U2AA 4EQ1A 2HP6A 5DF7A 3MR0A 3JYIA 4LLOB 3F1OB 4OLGA 2JKRM 4P6ZS 3M6BA 5HWVA 4E3OA 4LCMA 4JPMA 4EWFA 3KSIA 3S7QA 4HQAA 4U0XA 3ZNTA 4EETB 2X01A 3T4OA 4UA7A 5HW3A 3Q7VB 1E3UA 3VP0A 1IYQA 2JBFA 1KE4A 4K0XA 1Y4OA 4O0PA 2KX6A 2ZLYA 1I5QA 1L2SA 4YNRA 4NXBA 1IYSA 3TOIA 5HL1A 5AJGA 3NHQA 2C6WB 3K3DA 3ISGA 3T1RA 1M6KA 3PTEA 5CTMA 2ZQDA 5DKLA 2OWJA 3MQOA 2Y2GA 3MKFA 1IYPA 4GB7A 5FASA 2JKRI 3C8CA 4D2OA 1L0FA 4LRYC 1ZC2A 1E25A 1F98A 3BFEA 3Q7ZA 2L0WA 2W1TB 4PKYA 5TFQA 3E2LA 3NDGA 4KUOA 3NBLA 4WN5A 3H7WB 1HTZA 4YWZA 1K55A 2INWA 2QJ5A 1HVBA 5FDHA 1A0KA 2VGKA 3IF6C 1KVLA 1Q2PA 3IHAA 1ZTUA 3A3IA 3EGDC 2E8JA 4LV0A 2ACGA 4UHUA 4X56A 2HPBA 1DP8A 4JGRA 2J3TD 3GSGA 4YINA 2Y2PA 2RCXA 1STZA 4BJPA 4JLFA 3SS5A 1W7FA 4R38A 3UDXA 4NXGA 1FR1A 3SH7A 1YLPA 2BLSA 1LL8A 2D02A 3NOUC 1GSXA 2LB9A 2JKTM 5GLDA 3CG5A 4R0QA 3VFHA 2B5RA 4IJGA 1VM1A 3FWLA 1ESUA 2WYXA 5IS1A 4MCWA 1H5XA 2XRNA 3F1NA 3Q07A 5FQIA 2IWBA 4B4ZA 3F1PB 4OPQA 1CJFA 4OPYA 3T1XA 1YMSA 4WEKA 1T1CA 4S2KA 4MN6A 3M6HA 3OCLA 5KSHA 3DTEA 4JGQA 4M3KA 4KZ5A 5CHJA 3VSKA 5TBMB 2HDSA 1RGYA 1XJ3A 2M7VA 1K6RA 1HZOA 5A90A 1BLSA 2QZ6A 3MZEA 3FC7A 1GSVA 3BY9A 2NUPC 2XFSA 4NXEA 1LLBA 1LSVA 4GLQA 2J3WA 3P09A 4DE0A 1PI5A 4DDSA 2A24A 3LY3A 1IEMA 5FQQA 3EEAA 3AGEA 2XDMA 2DNSA 3CPTB 5DFXA 3IBRA 2V8CA 5F83A 4IBRA 2HP9A 5FAOA 3BFFA 5EPHA 3PBSA 4XUZA 1K56A 5AQAA 5LBRA 3PBTA 3HLFA 1FQGA 2ZC7A 3A3FA 3RTYA 2VGJA 3HLGA 4WZ5C 2WAEA 4F3LA 1WA9A 2WADA 5EFWA 5M19A 4G3VA 5CHUA 5KSCA 2G2UA 4LGWA 2K7SA 3A0SA 2XROA 4IVIA 1BYWA 5DVAA 1ES3A 4HHDA 2CC1A 5HDDA 1H3QA 2P7JA 3BYDA 3UNWA 2PR6A 4BWIA 4MBFA 4DF6A 3UMDA 2V1BA 4BENA 2VV8A 4RQ9A 1NZOA 4MN7A 5FAPA 3EEHA 1E3UD 3UE0A 3C7VA 5EVIB 5CEBA 1XJ2A 3GMWA 2PU4A 4EERA 1MBLA 3A3EA 1SHVA 3RXWA 2V2FF 1O07A 4P0MA 4IEDA 4PM9A 3H9WA 4L9FA 4I38A 3IWIA 1XA1A 3B3XA 4UA9A 1S66L 2EXBA 2ZQ7A 3R7WB 5L8MA 1YKDA 3GV9A 3GDIA 3HL9A 3UN7A 4HEFA 3O88A 3A0RA 4JXVA 2FFYA 4IUKA 4NETA 1MWTA 5GHXA 3JPUA 5A8BA 1K55C 2WKPA 2VK3A 5HDSA 2QYBA 1DRMA 4DE1A 5HX9A 2PD8A 3QP4A 5GHZA 2FH5A 1BLCA 2BG1A 4HIAA 1PW8A 2JC7A 2WGWB 1QMEA 4N9KA 2WAFA 3N8SA 1ES4A 5D3OA 4KZ6A 4C6YA 5FATA 1TS0A 2ZBBA 3KSHA 3M2JA 1TDGA 3ITBA 3MBZA 3BECA 3S7PA 4B93A 2VV6A 3ZQ5A 4GDBA 1S4RA 5KZHA 1TS7A 1Q2QA 2G2WA 1ZKJA 3TG9A 4EU0A 3UPNA 5F68A 2HF6A 3E0YA 3UY6A 5EOOA 3SS3A 5HDCA 4EUZA 4GW9A 2VGLS 2ZC3B 3LIEA 4I3JA 2O99A 2XA7S 3IXDA 5BOHA 3E4OA 4WYYA 1VQQA 1XP4A 5HWTA 1OMEA 2K2NA 3CI6A 2QPNA 5CERA 3OPLA 1TDLA 3UB7A 3UB6A 2PR5A 1OJ5A 4KG2A 1V9YA 3HVFA 2ZQAA 5L10A 3DTMA 4EBLA 3TW8A 1XFNA 2ZD8A 4QB8A 3NOTC 2Y2HA 3LIDA 2VKSA 1EROA 4GN2A 2XD1A 4E6WA 4KQRA 3ZGAB 2Y91A 5FQ9A 2XF3A 3LR5A 4RA7A 4S2NC 3FPWA 3NY4A 5F5YA 5FAQA 3E4PA 1NRFA 2PYRA 2H28A 2XLNA 3SH8A 4OOMA 2WKRA 2Y2QA 3FKWA 1OPXA 2Y2JA 1GA9A 2ZL1A 3A3JA 3IX8A 3FZCA 2WKHA 3RFBA 1G6AA 3W4QA 3NC8A 1NJ4A 4KZAA 1VHMA 3RJUA 1BULA 2OWHA 4EW7A 1RGZA 3VOLA 1DJBA 1BUEA 4R70A 4OVDA 3S22A 1XGJA 5AVEA 5I5LA 1GA0A 4O01A 1T1AA 3PBNA 3AGDA 3PR6A 1XGIA 3QHYA 5FA7A 3IBJA 3LEQA 5HFOA 1FILA 2XH9A 2UWXA 5G18A 1P9WA 3Q7VA 1OT9A 4DKIA 3LI8A 1PW1A 3IXGA 4Z1WA 3IF6B 1S4SA 4R4SA 4KUKA 4MN5A 1BT5A 4KQDA 2JCHA 3T4JA 3LUQA 4CLCC 4K08A 1ACFA 1KOUA 2I72A 1MKIA 1SDEA 5CEDA 1K38A 3WWXA 2YKFA 5HL6A 1SKOB 5M18A 2H0TA 1L0DA 1G6OA 4WMCA 3HUOA 4KZBA 5IU1A 2Z6CA 4WF0A 2Z2MB 1VEUB 2BASA 2PT7A 1JWZA 3UB9A 3UE6A 4BBTA 4PPRA 3LIFA 3V67A 2XEPA 1Y28A 4FCFA 3FKVA 1PWCA 3MMHA 5KIZA 4KZ4A 3S7NA 4G3KA 5F1FA 1FCNA 3KSFA 4II7A 2WKQA 4JKTA 3SS4A 4Y17A 4B4XA 3BLSA 3P01A 3OPHA 1Y54A 3LICA 4EEUA 2V0WA 1K6SA 4X6TA 4BL2A 3O87A 4WM9A 3TSGA 1YLZA 4OOYA 4NK3A 5E2GA 4I39A 3N8LA 1W8YA 4GHIA 1ES5A 4B9OA 4FSFA 4DE2A 3IXBA 3C5AA 3UDIA 4IHQA 3ITAA 5HZHA 3BJNA 4OP8A 3C2WA 1LSXA 4I3IA 4JF4A 1K0KA 1MPLA 4EBNA 4Q0HA 3F1PA 3FPVA 5AQ9A 4R4RA 2MJ6A 4ARZB 5TR7A 2X02A 3A3DA 4E04A 3FG8A 3UB8A 2YKHA 5HAQA 4X25A 2A2LA 4IVKA 3VP4A 3MFDA 4KQOA 4XXRA 2J9OA 3CUEC 4KQQA 3ZFZA 4BMWA 2XR0A 2J3TC 5EUAA 3UDFA 3JVUA 1DY6A 5EE8A 4DXCA 4FD8A 3BY8A 4OONA 3BW6A 3W4PA 2O9CA 5EVLA 3IS2A 4N92A 4YOFA 2A3UA 5FSRA 2VLGA 3N6IA 3CITA 5CX7A 2VX8A 1TF1A 2HJEA 1OT6A 3OBFA 1W8QA 1CEGA 3K3CA 3MQ0A 2JE5A 4MEZA 3WS1A 2X71A 2QJ7A 4L9EA 4Y13A 2ZC4B 4PM7A 5CGWA 3BFDA 2PU2A 1NWZA 5CRFA 1W5DA 3C4OA 4HI4A 3IWOA 4I5SA 1ODVA 4G3WA 3ULFA 1TD5A 1OJGA 3LR4A 1J9MA 2Y55A 2PBYA 1NRJA 3FYZA 5FI2A 2VJWA 4GJ4A 1E4DA 2Y59A 1SDNA 4S2OA 2O9AA 2GJ3A 3DBAA 4CJNA 2IWCA 1FCOA 4WLAA 2Q9NA 3KYEA 4P6ZM 1P0ZA 5CGXA 1G68A 2D01A 1CEFA 3BWLA 3OZHA 1PWGA 3G4PA 1N9NA 3W8KA 1S1YA 3C7UA 2VZWA 4Y3IA 3ZG8B 3LFVA 2EWWA 2IWDA 2O9BA 1ESIA 2L4RA 3C30A 2ZQCA 2Y2OA 1KDSA 3L9KA 4PHTA 5A91A 3V5MA 1RP5A 1D06A 2NUTC 5AQ7A 3HJIA 3D9YA 3PAGA 5HPFA 2WGVA 3N8RA 1H8MA 3RH8B 1BLHA 1HD8A 1OTBA 5G4YA 1F5MA 4OQIA 4WMCD 2M7UA 3CJMA 3HLCA 4XT2A 2WZZA 1PYYA 4O7DA 3F1NB 4F94A 1MXOA 1JWPA 1K4FA 4MNRA 3ZG5A 1MWRA 1WYCA 3D3OA 1L3LA 2FFFB 2R9WA 3IWQA 1KVMA 5J8XA 1KGFA 5FDSA 3IT9A 3QNCA 5GL9A 4NEED 3ZG7B 4O8GA 2EX8A 1P97A 3R4KA 3NULA 2W3FA 3ZYTA 3BQAA 1GSWA 1GHIA 4GS9B 4R3JA 3S1YA 2QKPA 4U3TA 3EQUA 2Y2MA 3VP3A 4OP5A 2J8YA 3IH8A 4CPKA 3IX3A 1PWDA 4UQIS 1RCJA 2WZXA 3KO6A 1VB6A 3WS4A 2O0YA 1XKZA 3B42A 4EUVA 2XK1A 2A24B 5TJJA 3UE3A 2ZM8A 2GX5A 2V9AA 4H6JA 5EECA 1UWPX 2Y2NA 4PM5A 4R1GA 3LI9A 4OKPA 4ZJ3A 3W2ZA 1W79A 2JN7A 4D60A 3MXQA 4ZAMA 5FI6A 3MXRA 3V39A 3UO9A 1OTAA 2EX6A 4FTXA 2ZMFA 3G2YA 1MWSA 5HAIA 2G7UA 1XXMA 2CMNA 4K0WA 2EXAA 3G2ZA 3GTCA 5HD3A 5L07A 4EEPA 2W3DA 3HUNA 4HP9A 1IFQA 1VETA 4C3QA 3H82A 4S2MA 1ZG4A 4R3BA 4ETXA 4JGPA 2M1CA 1NXYA 3G30A 3G6OA 4KZ8A 1TS8A 1LHYA 1ALQA 4WZ4A 5J4EA 1KDWA 4X1LA 4P85A 3ZVWA 1F2KA 2B18A 2Q9MA 4GD8A 4FUWA 3C38A 3ZG0A 2V20A 1ERQA 2W3GA 1S1ZA 4PKYG 1DJCA 5DTKA 1BSGA 3PXPA 4S2PA 1O7EA 2UV0E 4CLCB 1JWVA 4OQGA 4HNBA 1OTDA 1CQAA 3WRZA 5EOEA 1ZHHB 4OOLA 5U47A 4QJGA 4HESA 5EM1A 4DDYA 1PRQA 3BFCA 3LR3A 3VOYA 3PBOA 5F82A 3B33A 2W3EA 4DMZA 3T4LA 1Z09A 2OAP1 3BFGA 4EV4A 2EWVA 3EQVA 3V50A 3MJQA 2OV5A 1XA7A 4JXGA 2BTFP 1FIKA 5E43A 4C75A 3MQQA 4YFMA 1MZUA 1FSYA 5FQKA 5FQJA 3IF6A 1N9OA 2HV1A 3KYZA 3DW0A 4JXSA 3V3RA 3VMAA 1YMXA 5F69A 4WEJA 2OSUA 2DCFA 3CAXA 3BEBA 1IKIA 2W3HA 1MC0A 2HZ5A 1PZOA 5E2HA 5GLCA 1SKOA 1SZVA 3CZDA
chains in the Genus database with same CATH topology
1TS6A 3T4KA 3HCYA 3GECA 5TBMB 3T4SA 4I39A 3CWFA 2VEAA 1XJ3A 2M7VA 1W63Q 4GHIA 4B9OA 1MKMA 4FSFA 3TRCA 4F3LB 3PHYA 1D7EA 5IT5A 3FC7A 3F1OA 4XT2B 1GSVA 3BY9A 4IHQA 2NUPC 2OAQ1 5HZHA 3BJNA 2GZAA 4NXEA 3C2WA 1LSXA 1LSVA 4GLQA 4NKPA 2J3WA 2JHEA 4I3IA 2ZOHA 4LRZE 1LSWA 4QPRA 2A24A 4CLCE 4Q0HA 3F1PA 3FPVA 2QHKA 2MJ6A 3EEAA 4ARZB 4E04A 4R6LA 5DFXA 3S7OA 4DN0A 3FG8A 3IBRA 3UB8A 3VV4A 2YKHA 3K2NA 1OTEA 1UGUA 2IA2A 3BQ8A 2A2LA 3PBSA 4KQOA 5LBRA 3KYQA 3CUEC 3PBTA 4CQHA 1YSPA 4BMWA 2J3TC 5J3WA 3RTYA 3JVUA 2W1RA 4ZRRA 5DF9A 4F3LA 1WA9A 5EFWA 2HJ9C 3BY8A 1T18A 3E4QA 3BW6A 4BBVA 2EA9A 4G3VA 4HJ4A 2K7SA 3A0SA 2XROA 3T4TA 2O9CA 3IS2A 1BYWA 3PBQA 1T1BA 4YOFA 2VLGA 5C5KA 1YAXA 4HHDA 3CITA 5HDDA 2W1TA 1H3QA 2P7JA 4H6JB 5CX7A 4Q0IA 2PR6A 2VX8A 1TF1A 4BWIA 2HJEA 1OT6A 3OBFA 3UMDA 4HJ3A 3MFXA 2V1BA 4ARZA 5G4ZA 3H7WA 3K3CA 2VV8A 4RQ9A 3MQ0A 4MN7A 3EEHA 1W63M 2VA0A 3OOVA 2QJ7A 2VGLM 3CLOA 3PBRA 4L9EA 2PYPA 4ME4A 1XJ2A 2XA7M 5HWWA 4WELA 4EERA 3CUEA 4M4XA 1NWZA 3NOPC 5DJUA 1G28A 4HI4A 2XSSA 4I5SA 3T4QA 1ODVA 4G3WA 3H9WA 3ULFA 4L9FA 4MMNA 4I38A 3H82B 3HJKA 5AVFA 1T19A 3JVVA 1TD5A 1S66L 3PYPA 2KOIA 1OJGA 3SW1A 3LR4A 3R7WB 3EGXC 1YSQA 1NRJA 2PHYA 2VJWA 4GJ4A 4JGOA 5L8MA 4BBUA 5MC7A 1YKDA 3GDIA 2O9AA 2GJ3A 3DBAA 2V1AA 3A0RA 4IUKA 4LPZA 4WLAA 4ETZA 2ZMVA 4P6ZM 4AFIA 1P0ZA 5A8BA 4UQIM 2WKPA 2D01A 3MF0A 2QYBA 1DRMA 5HDSA 3BWLA 3LYXA 2K31A 2PD8A 2KDKA 2FH5A 4Q0JA 1XJ4A 1N9NA 1S1YA 4HIAA 4IUHA 4GCZA 2VZWA 5DJTA 2PD7A 3LR0A 4Y3IA 3LFVA 2W0NA 5K5BA 2EWWA 2LB5A 3VE3A 4MDZA 3TJZC 2I9VA 5HPIA 2O9BA 1EW0A 2L4RA 3C30A 4LRXC 1TS0A 3LIBA 2L1MA 2ZBBA 2PDRA 4PHTA 3KSHA 1D06A 2NUTC 4L9GA 3HJIA 3S7PA 5HPFA 4B93A 3EWKA 2VV6A 3ZQ5A 1H8MA 4DJ3A 5HD5A 3RH8B 2OOLA 5TBMA 1OTBA 5G4YA 1F5MA 1S4RA 4HJ6A 4FOFA 4Y5FA 1TS7A 5DKKA 4I3AA 2R78A 2M7UA 4XT2A 3P7NA 4EU0A 3ICYA 5F68A 2HF6A 3E0YA 1NLYA 3F1NB 3EOIA 5HDCA 4GW9A 2VGLS 1IOUA 2VV7A 3LIEA 4I3JA 2O99A 2XA7S 3D3OA 4HH2A 4R3AA 3LIAA 1F9IA 3NJAA 4EESA 3E4OA 3TE8A 5FL3A 3VE4A 5HWTA 2K2NA 3CI6A 5F6AA 2J80A 2QWSA 3UB7A 3UB6A 4NEED 5HSQA 2PR5A 1OJ5A 4O8GA 1P97A 3R4KA 2W3FA 1V9YA 4CLCD 3ZYTA 1OTIA 3BQAA 1GSWA 4NXFA 4GS9B 3TW8A 3U2AA 4EQ1A 4GHIB 1XFNA 3MR0A 1DP6A 2QKPA 3EQUA 3NOTC 4Y2FA 2P04A 4LLOB 3F1OB 2JKRM 3LIDA 4P6ZS 1X0OA 2VKSA 5HWVA 4UQIS 3KSGA 3KO6A 1VB6A 2O0YA 3B42A 3KSIA 3S7QA 4EUVA 2A24B 5TJJA 3UE3A 3LR5A 3FPWA 2GX5A 4HQAA 5F5YA 3E4PA 2V9AA 4H6JA 1DP9A 2PYRA 4L0LA 1UWPX 2H28A 4EETB 4DJ2A 3T4OA 4OOMA 2WKRA 4WL9A 2Z6DA 3LI9A 3W2ZA 2B02A 2JN7A 3MXQA 1OPXA 4O0PA 2KX6A 2Y79A 1OTAA 4HH3A 2P08A 1S67L 4YNRA 4NXBA 4PAUA 3RFBA 2ZMFA 4GS9A 5AJGA 1VHMA 1NLZA 2G7UA 3NHQA 3K3DA 2OWHA 2CMNA 4EW7A 3VOLA 4R70A 5HD3A 5DKLA 4EEPA 2OWJA 3MQOA 2JKTI 2W3DA 4HP9A 1IFQA 2FZ0A 4EXOA 3OLOA 5AVEA 5I5LA 2JKRI 3H82A 4O01A 3C8CA 1T1AA 2W27A 3IS2B 4HY8A 3PBNA 3PR6A 4LRYC 4ETXA 3IBJA 3R7WA 1F98A 4JGPA 2M1CA 2L0WA 3KX0X 2V0UA 2W1TB 2DMWA 4PKYA 3G6OA 4KUOA 3A0VA 1N9LA 1P9WA 1TS8A 1OT9A 4WN5A 3H7WB 3LI8A 2KLIA 4YWZA 5J4EA 3OCNA 2INWA 2GNXA 2QJ5A 3OC2A 1JNUA 2B18A 3O5YA 1XFQA 4Z1WA 1S4SA 3C38A 4KUKA 2ZOIA 3E98A 2HGVA 1ZTUA 2W3GA 4MN5A 1S1ZA 4PKYG 4KQDA 3UMEA 3EGDC 3PXPA 3T4JA 3LUQA 4CLCC 4K08A 4CLCB 1KOUA 1DP8A 3B47A 4HNBA 4JGRA 1OTDA 2J3TD 5J7EA 1STZA 1ZHHB 4OOLA 4BJPA 1XJ6A 2YKFA 5HL6A 4HP4A 3D72A 4R38A 1G6OA 4NXGA 3LR3A 3PBOA 2D02A 1LL8A 3B33A 3NOUC 1GSXA 2W3EA 5IU1A 4DMZA 2Z6CA 4WF0A 3T4LA 2BASA 2LB9A 2JKTM 2OAP1 2EWVA 3EQVA 3MJQA 2PT7A 4UEYA 4IJGA 3UB9A 3UE6A 3MQQA 4BBTA 1MZUA 3LIFA 3V67A 1Y28A 5IS1A 4MCWA 2XRNA 3F1NA 2Y8HA 3MMHA 5KIZA 1V9ZA 3T50A 5DFYA 1N9OA 2HV1A 3KYZA 1UWNX 3F1PB 3S7NA 4G3KA 4II7A 3KSFA 2WKQA 4WEJA 5F69A 1P9RA 1LT0A 4WEKA 1T1CA 4CLCA 3CAXA 3P01A 4MN6A 2W3HA 1MC0A 4WUJA 3LICA 4EEUA 2V0WA 3OCLA 5KSHA 4HOIA 4JGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME4 A;  2O99 A;  2W1T B;  3HCY A;  3D3O A;  3G6O A;  2VEA A;  3NOP C;  2M7V A;  1MKM A;  3TRC A;  2XSS A;  2K2N A;  3CI6 A;  4G3W A;  4MMN A;  2KLI A;  3BJN A;  5HSQ A;  1TD5 A;  4O8G A;  2KOI A;  3R4K A;  2W3F A;  3C2W A;  2B18 A;  3O5Y A;  4GLQ A;  1YSQ A;  2VJW A;  4Z1W A;  5L8M A;  4LRZ E;  4QPR A;  1YKD A;  4Q0H A;  2O9A A;  3DBA A;  2HGV A;  1ZTU A;  3E98 A;  2W3G A;  4IUK A;  3NOT C;  4Y2F A;  4ETZ A;  3EEA A;  2VKS A;  4E04 A;  4R6L A;  5DFX A;  3KSG A;  2QYB A;  3MF0 A;  3S7O A;  3IBR A;  4DN0 A;  3VV4 A;  3KO6 A;  2K31 A;  3K2N A;  1STZ A;  2IA2 A;  2O0Y A;  4Q0J A;  5HL6 A;  3KSI A;  3S7Q A;  4EUV A;  4IUH A;  5TJJ A;  2VZW A;  5LBR A;  4Y3I A;  2GX5 A;  3NOU C;  2W3E A;  4CQH A;  3LFV A;  1YSP A;  4DMZ A;  5K5B A;  2LB5 A;  2LB9 A;  4MDZ A;  2W1R A;  4ZRR A;  5HPI A;  3W2Z A;  2O9B A;  4LRX C;  4G3V A;  4IJG A;  2XRO A;  4O0P A;  3KSH A;  2O9C A;  2Y79 A;  4MCW A;  2XRN A;  2Y8H A;  3MMH A;  4YNR A;  4YOF A;  3S7P A;  5HPF A;  4PAU A;  5C5K A;  5DFY A;  3RFB A;  2ZMF A;  3ZQ5 A;  3CIT A;  2W1T A;  5AJG A;  1VHM A;  3S7N A;  2G7U A;  4G3K A;  3NHQ A;  4Q0I A;  2OOL A;  1TF1 A;  3KSF A;  1F5M A;  4BWI A;  4FOF A;  4Y5F A;  4R70 A;  3OBF A;  2M7U A;  2W3D A;  4EU0 A;  4RQ9 A;  3MQ0 A;  5I5L A;  2W3H A;  1MC0 A;  4MN7 A;  4O01 A;  3E0Y A;  3OOV A;  4LRY C;  4ETX A;  3IBJ A;  4GW9 A; 
#chains in the Genus database with same CATH topology
 1WYB A;  3HCY A;  4ZTK A;  3L7H A;  2VEA A;  1W63 Q;  4OQH A;  3TRC A;  1CI9 A;  4ZDX A;  3F1O A;  2HDQ A;  3LCE A;  4ID4 A;  2OAQ 1;  3ZDJ A;  1K57 A;  3DAV A;  2B95 A;  4NKP A;  2XD5 A;  4MBK A;  4LRZ E;  4QPR A;  1PZP A;  4GOG A;  2ZM2 A;  1NYM A;  3DTK A;  1DJA A;  4R6L A;  4OPR A;  4DN0 A;  3G31 A;  2QMI A;  3K2N A;  5A92 A;  1OTE A;  2PRF A;  2HDU A;  1MY8 A;  2ZC6 B;  4E3N A;  3KYQ A;  4KZ3 A;  1YSP A;  4JF6 A;  2P9V B;  4Y0O A;  2W1R A;  3DWK A;  4ZRR A;  2HJ9 C;  4BBV A;  1YLT A;  1S0W A;  5HAR A;  3G32 A;  1BZA A;  5C5K A;  4N1X A;  1EWZ A;  2W1T A;  4GDN A;  2OLU A;  4Q0I A;  1L0E A;  1KGE A;  1K54 A;  4HJ3 A;  3MFX A;  4ARZ A;  5G4Z A;  3H7W A;  5DTT A;  4UA6 A;  2ZL1 B;  2WUQ A;  5E2E A;  1W63 M;  2VA0 A;  3CMZ A;  1KE3 A;  3HUM A;  5I94 A;  2VGL M;  3CLO A;  4X69 A;  2PYP A;  5HAP A;  4ME4 A;  2XA7 M;  5HWW A;  4RX3 A;  2P74 A;  1SKF A;  4M4X A;  4HBU A;  1G28 A;  4WZ5 A;  4E3J A;  4MMN A;  4Y7P A;  5AVF A;  1T19 A;  1YSQ A;  4H8R A;  3SZT A;  4JGO A;  4BBU A;  1ONG A;  1LI0 A;  3BRM A;  2V1A A;  3U4L P;  3C4P A;  4LPZ A;  1GHP A;  1N4O A;  5JYO A;  1YPR A;  3NIA A;  3WS2 A;  4MBH A;  3LYX A;  3S4X A;  2KDK A;  5AQB A;  1MWU A;  2JKF A;  4K91 A;  2GDN A;  4KG6 A;  2W0N A;  4OLD A;  2ZQ8 A;  3ZCZ A;  5DF8 A;  4MDZ A;  2I9V A;  5HPI A;  1YLJ A;  1EW0 A;  1N9B A;  4E3I A;  3LIB A;  1M40 A;  3IHB A;  4LV3 A;  4L9G A;  3QP6 A;  2Y2I A;  3N4I A;  2EFX A;  2H0Y A;  3EWK A;  1YM1 A;  4DJ3 A;  5HD5 A;  5TBM A;  4FOF A;  4Y5F A;  4A5R A;  4I3A A;  1H0M A;  2PBD P;  2R78 A;  4LFU A;  4GZB A;  3Q1F A;  3ICY A;  4N1H A;  4BQM A;  3EOI A;  3NCK A;  1S6R A;  4RYE A;  4BD1 A;  1XPB A;  1JTG A;  4XUX A;  2V8F A;  4Y0T A;  3IX4 A;  3LIA A;  1F9I A;  5CXW A;  3GVB A;  1H8Y A;  1H8Z A;  1NZU A;  3TE8 A;  5FL3 A;  4LV2 A;  3FV7 A;  3VE4 A;  2QWS A;  3I7J A;  3CPT A;  5HSQ A;  3N7W A;  1LI9 A;  1IEL A;  3UPP A;  1OTI A;  3ZVT A;  1C3B A;  3IH9 A;  4EBP A;  4X1M A;  5GLA A;  1QMF A;  1SCW A;  4ESP A;  4GNU A;  1AWI A;  4GHI B;  1DP6 A;  4Y2F A;  2P04 A;  4BD0 A;  1FR6 A;  1CF0 A;  1TVF A;  4UAA A;  1X0O A;  4PM8 A;  2C5W B;  4JBF A;  3GRJ A;  3KSG A;  1K57 C;  3E2K A;  4DE3 A;  4KG5 A;  4FH2 A;  3GQZ A;  1CI8 A;  3HBR A;  2H10 A;  1DP9 A;  4L0L A;  1BTL A;  4DJ2 A;  5DTS A;  4WL9 A;  2Z6D A;  2B02 A;  2WK0 A;  3MSH A;  4E3L A;  5CTN A;  3SH9 A;  2Y79 A;  3WS5 A;  4HH3 A;  2P08 A;  1S67 L;  1I2W A;  1LL5 A;  1YQS A;  5EVI A;  4PAU A;  1YLY A;  1Z6F A;  4GS9 A;  3T1Q B;  1NLZ A;  1I2S A;  3ZG9 B;  2ZQ9 A;  4MLL A;  2AVX A;  1AXB A;  2JKT I;  3HRE A;  2FZ0 A;  2PAV P;  2WKI A;  3HLE A;  3OLO A;  4EXO A;  1TEM A;  2W27 A;  3IS2 B;  4S2J A;  4ZBE A;  4HY8 A;  5GHY A;  4P6B A;  3R7W A;  3KX0 X;  2V0U A;  2DMW A;  4PMA A;  1PIO A;  4S2N A;  4OPZ A;  3A0V A;  2XGN A;  1N9L A;  1K54 C;  2XFT A;  2EFU A;  1K25 A;  2KLI A;  3RXX A;  3OCN A;  2GNX A;  3OC2 A;  2OLV A;  4FH4 A;  4QD4 A;  1JNU A;  2J7V A;  4X55 A;  3IF5 A;  1XFQ A;  3O5Y A;  2ZOI A;  3UE1 A;  3E98 A;  2HGV A;  3QP1 A;  2WGW A;  5JYP A;  3UME A;  4X68 A;  1LL9 A;  3B47 A;  2WGI A;  1FOF A;  3VFF A;  3MZD A;  5J7E A;  4GD6 A;  1XX2 A;  3UB5 P;  3VSL A;  1XJ6 A;  3NEC A;  4HP4 A;  3D72 A;  4KZ9 A;  3NDE A;  5F1G A;  2A49 A;  1EI5 A;  3IQA A;  2ZM0 A;  4UEY A;  5E2F A;  3OPP A;  2J9P A;  3VP1 A;  1HLU P;  3LO7 A;  2Y8H A;  1JVJ A;  5CEC A;  1V9Z A;  2ZC5 B;  3T50 A;  3WRT A;  5DFY A;  4ZJ1 A;  1G5U A;  1ONH A;  5M1A A;  1UWN X;  4RVA A;  3O3V A;  4EQI A;  1P9R A;  5FEF A;  1LT0 A;  4CLC A;  5L09 A;  4WUJ A;  2XQZ A;  3DTI A;  4HOI A;  1TS6 A;  3Q81 A;  4Q8I A;  2WKE A;  3T4K A;  3GEC A;  3W4O A;  3T4S A;  3CWF A;  4E3M A;  4QU3 A;  2EX2 A;  1MKM A;  5EV0 A;  4F3L B;  2Y2K A;  1D7E A;  3PHY A;  5IT5 A;  4XT2 B;  3LEZ A;  3CHW P;  3GR2 A;  4BLM A;  2GZA A;  4DXB A;  4HBT A;  5EM0 A;  2JHE A;  2ZOH A;  1LSW A;  4CLC E;  4Y0U A;  3DWZ A;  2QHK A;  3Q82 A;  4U0T A;  4JXW A;  2ZMA A;  3S7O A;  3MKE A;  4LEN A;  3VV4 A;  1J3W A;  2IA2 A;  1UGU A;  3BQ8 A;  1PI4 A;  2Y4A A;  3IXH A;  4KZ7 A;  4R23 A;  4WBG A;  4QHC A;  1ERM A;  1U60 A;  4CQH A;  3AGF A;  5CHM A;  5J3W A;  3O86 A;  4OH0 A;  2HP5 A;  3VOZ A;  3LGO A;  5DF9 A;  4BL3 A;  1T18 A;  3E4Q A;  2EA9 A;  3T12 B;  4HJ4 A;  1D1J A;  5KMW A;  3P98 A;  3T4T A;  3UPO A;  2R9X A;  3PBQ A;  3T1S A;  1T1B A;  4B88 A;  1YAX A;  4E3K A;  3ZHH A;  4H6J B;  2EX9 A;  3WS0 A;  4Y15 A;  3MXS A;  4QY5 A;  2E8I A;  1IYO A;  4QWO A;  3OOV A;  5EVI C;  2RL3 A;  3PBR A;  2H5S A;  1WE4 A;  4WEL A;  1NY0 A;  3BLM A;  3CUE A;  3NOP C;  2P9V A;  5EVI D;  5DJU A;  3HLD A;  5TGF A;  2XSS A;  3T4Q A;  1VET B;  1ES2 A;  3H82 B;  3HJK A;  4JF5 A;  3JVV A;  3PYP A;  3QP5 A;  4IBX A;  2KOI A;  4S2I A;  3SW1 A;  4QY6 A;  3OPR A;  3EGX C;  4X53 A;  2ZJ9 A;  2PHY A;  4OQ0 A;  4S2L A;  5MC7 A;  3PAE A;  1GHM A;  1L0G A;  5CGS A;  1VEU A;  4ETZ A;  2Z2L B;  1GCE A;  4LCL A;  4P87 A;  2ZMV A;  4AFI A;  4UQI M;  5FQM A;  3MF0 A;  1PNE A;  2K31 A;  1CK3 A;  4NG2 A;  4Q0J A;  1XJ4 A;  5FI7 A;  5GLB A;  4IUH A;  4GCZ A;  5DJT A;  2PD7 A;  3LR0 A;  3QP8 A;  5K5B A;  2Q0O A;  2LB5 A;  3VE3 A;  1K56 D;  3TJZ C;  2Y2L A;  1PFL A;  4Z9Q A;  1FCM A;  4LRX C;  2L1M A;  2PDR A;  3G35 A;  1YLW A;  1IKG A;  4GKU A;  4DRT A;  5L2F A;  3QNB A;  1NYY A;  1K4E A;  2OOL A;  1JTD A;  3SOI A;  1KE0 A;  4HJ6 A;  5A93 A;  3M2K A;  1FSW A;  5DKK A;  4E6X A;  1KGG A;  5IHV A;  3MS6 A;  3P7N A;  1NLY A;  3BM6 A;  3ZNY A;  4KEN B;  2V1Z A;  1IOU A;  2VV7 A;  3QP2 A;  3V3S A;  2DRW A;  4LV1 A;  3MZF A;  4HH2 A;  3LY4 A;  3D4F A;  5EVE A;  4R3A A;  4PM6 A;  3VP2 A;  3NJA A;  4EES A;  4N9L A;  4ZJ2 A;  2HDR A;  3G34 A;  5F6A A;  2J80 A;  1BLP A;  3NI9 A;  1YT4 A;  4CLC D;  3HLW A;  4RX2 A;  5FEG A;  1ZG6 A;  3HLB A;  4NXF A;  2JKG A;  3U2A A;  4EQ1 A;  2HP6 A;  5DF7 A;  3MR0 A;  3JYI A;  4LLO B;  3F1O B;  4OLG A;  2JKR M;  4P6Z S;  3M6B A;  5HWV A;  4E3O A;  4LCM A;  4JPM A;  4EWF A;  3KSI A;  3S7Q A;  4HQA A;  4U0X A;  3ZNT A;  4EET B;  2X01 A;  3T4O A;  4UA7 A;  5HW3 A;  3Q7V B;  1E3U A;  3VP0 A;  1IYQ A;  2JBF A;  1KE4 A;  4K0X A;  1Y4O A;  4O0P A;  2KX6 A;  2ZLY A;  1I5Q A;  1L2S A;  4YNR A;  4NXB A;  1IYS A;  3TOI A;  5HL1 A;  5AJG A;  3NHQ A;  2C6W B;  3K3D A;  3ISG A;  3T1R A;  1M6K A;  3PTE A;  5CTM A;  2ZQD A;  5DKL A;  2OWJ A;  3MQO A;  2Y2G A;  3MKF A;  1IYP A;  4GB7 A;  5FAS A;  2JKR I;  3C8C A;  4D2O A;  1L0F A;  4LRY C;  1ZC2 A;  1E25 A;  1F98 A;  3BFE A;  3Q7Z A;  2L0W A;  2W1T B;  4PKY A;  5TFQ A;  3E2L A;  3NDG A;  4KUO A;  3NBL A;  4WN5 A;  3H7W B;  1HTZ A;  4YWZ A;  1K55 A;  2INW A;  2QJ5 A;  1HVB A;  5FDH A;  1A0K A;  2VGK A;  3IF6 C;  1KVL A;  1Q2P A;  3IHA A;  1ZTU A;  3A3I A;  3EGD C;  2E8J A;  4LV0 A;  2ACG A;  4UHU A;  4X56 A;  2HPB A;  1DP8 A;  4JGR A;  2J3T D;  3GSG A;  4YIN A;  2Y2P A;  2RCX A;  1STZ A;  4BJP A;  4JLF A;  3SS5 A;  1W7F A;  4R38 A;  3UDX A;  4NXG A;  1FR1 A;  3SH7 A;  1YLP A;  2BLS A;  1LL8 A;  2D02 A;  3NOU C;  1GSX A;  2LB9 A;  2JKT M;  5GLD A;  3CG5 A;  4R0Q A;  3VFH A;  2B5R A;  4IJG A;  1VM1 A;  3FWL A;  1ESU A;  2WYX A;  5IS1 A;  4MCW A;  1H5X A;  2XRN A;  3F1N A;  3Q07 A;  5FQI A;  2IWB A;  4B4Z A;  3F1P B;  4OPQ A;  1CJF A;  4OPY A;  3T1X A;  1YMS A;  4WEK A;  1T1C A;  4S2K A;  4MN6 A;  3M6H A;  3OCL A;  5KSH A;  3DTE A;  4JGQ A;  4M3K A;  4KZ5 A;  5CHJ A;  3VSK A;  5TBM B;  2HDS A;  1RGY A;  1XJ3 A;  2M7V A;  1K6R A;  1HZO A;  5A90 A;  1BLS A;  2QZ6 A;  3MZE A;  3FC7 A;  1GSV A;  3BY9 A;  2NUP C;  2XFS A;  4NXE A;  1LLB A;  1LSV A;  4GLQ A;  2J3W A;  3P09 A;  4DE0 A;  1PI5 A;  4DDS A;  2A24 A;  3LY3 A;  1IEM A;  5FQQ A;  3EEA A;  3AGE A;  2XDM A;  2DNS A;  3CPT B;  5DFX A;  3IBR A;  2V8C A;  5F83 A;  4IBR A;  2HP9 A;  5FAO A;  3BFF A;  5EPH A;  3PBS A;  4XUZ A;  1K56 A;  5AQA A;  5LBR A;  3PBT A;  3HLF A;  1FQG A;  2ZC7 A;  3A3F A;  3RTY A;  2VGJ A;  3HLG A;  4WZ5 C;  2WAE A;  4F3L A;  1WA9 A;  2WAD A;  5EFW A;  5M19 A;  4G3V A;  5CHU A;  5KSC A;  2G2U A;  4LGW A;  2K7S A;  3A0S A;  2XRO A;  4IVI A;  1BYW A;  5DVA A;  1ES3 A;  4HHD A;  2CC1 A;  5HDD A;  1H3Q A;  2P7J A;  3BYD A;  3UNW A;  2PR6 A;  4BWI A;  4MBF A;  4DF6 A;  3UMD A;  2V1B A;  4BEN A;  2VV8 A;  4RQ9 A;  1NZO A;  4MN7 A;  5FAP A;  3EEH A;  1E3U D;  3UE0 A;  3C7V A;  5EVI B;  5CEB A;  1XJ2 A;  3GMW A;  2PU4 A;  4EER A;  1MBL A;  3A3E A;  1SHV A;  3RXW A;  2V2F F;  1O07 A;  4P0M A;  4IED A;  4PM9 A;  3H9W A;  4L9F A;  4I38 A;  3IWI A;  1XA1 A;  3B3X A;  4UA9 A;  1S66 L;  2EXB A;  2ZQ7 A;  3R7W B;  5L8M A;  1YKD A;  3GV9 A;  3GDI A;  3HL9 A;  3UN7 A;  4HEF A;  3O88 A;  3A0R A;  4JXV A;  2FFY A;  4IUK A;  4NET A;  1MWT A;  5GHX A;  3JPU A;  5A8B A;  1K55 C;  2WKP A;  2VK3 A;  5HDS A;  2QYB A;  1DRM A;  4DE1 A;  5HX9 A;  2PD8 A;  3QP4 A;  5GHZ A;  2FH5 A;  1BLC A;  2BG1 A;  4HIA A;  1PW8 A;  2JC7 A;  2WGW B;  1QME A;  4N9K A;  2WAF A;  3N8S A;  1ES4 A;  5D3O A;  4KZ6 A;  4C6Y A;  5FAT A;  1TS0 A;  2ZBB A;  3KSH A;  3M2J A;  1TDG A;  3ITB A;  3MBZ A;  3BEC A;  3S7P A;  4B93 A;  2VV6 A;  3ZQ5 A;  4GDB A;  1S4R A;  5KZH A;  1TS7 A;  1Q2Q A;  2G2W A;  1ZKJ A;  3TG9 A;  4EU0 A;  3UPN A;  5F68 A;  2HF6 A;  3E0Y A;  3UY6 A;  5EOO A;  3SS3 A;  5HDC A;  4EUZ A;  4GW9 A;  2VGL S;  2ZC3 B;  3LIE A;  4I3J A;  2O99 A;  2XA7 S;  3IXD A;  5BOH A;  3E4O A;  4WYY A;  1VQQ A;  1XP4 A;  5HWT A;  1OME A;  2K2N A;  3CI6 A;  2QPN A;  5CER A;  3OPL A;  1TDL A;  3UB7 A;  3UB6 A;  2PR5 A;  1OJ5 A;  4KG2 A;  1V9Y A;  3HVF A;  2ZQA A;  5L10 A;  3DTM A;  4EBL A;  3TW8 A;  1XFN A;  2ZD8 A;  4QB8 A;  3NOT C;  2Y2H A;  3LID A;  2VKS A;  1ERO A;  4GN2 A;  2XD1 A;  4E6W A;  4KQR A;  3ZGA B;  2Y91 A;  5FQ9 A;  2XF3 A;  3LR5 A;  4RA7 A;  4S2N C;  3FPW A;  3NY4 A;  5F5Y A;  5FAQ A;  3E4P A;  1NRF A;  2PYR A;  2H28 A;  2XLN A;  3SH8 A;  4OOM A;  2WKR A;  2Y2Q A;  3FKW A;  1OPX A;  2Y2J A;  1GA9 A;  2ZL1 A;  3A3J A;  3IX8 A;  3FZC A;  2WKH A;  3RFB A;  1G6A A;  3W4Q A;  3NC8 A;  1NJ4 A;  4KZA A;  1VHM A;  3RJU A;  1BUL A;  2OWH A;  4EW7 A;  1RGZ A;  3VOL A;  1DJB A;  1BUE A;  4R70 A;  4OVD A;  3S22 A;  1XGJ A;  5AVE A;  5I5L A;  1GA0 A;  4O01 A;  1T1A A;  3PBN A;  3AGD A;  3PR6 A;  1XGI A;  3QHY A;  5FA7 A;  3IBJ A;  3LEQ A;  5HFO A;  1FIL A;  2XH9 A;  2UWX A;  5G18 A;  1P9W A;  3Q7V A;  1OT9 A;  4DKI A;  3LI8 A;  1PW1 A;  3IXG A;  4Z1W A;  3IF6 B;  1S4S A;  4R4S A;  4KUK A;  4MN5 A;  1BT5 A;  4KQD A;  2JCH A;  3T4J A;  3LUQ A;  4CLC C;  4K08 A;  1ACF A;  1KOU A;  2I72 A;  1MKI A;  1SDE A;  5CED A;  1K38 A;  3WWX A;  2YKF A;  5HL6 A;  1SKO B;  5M18 A;  2H0T A;  1L0D A;  1G6O A;  4WMC A;  3HUO A;  4KZB A;  5IU1 A;  2Z6C A;  4WF0 A;  2Z2M B;  1VEU B;  2BAS A;  2PT7 A;  1JWZ A;  3UB9 A;  3UE6 A;  4BBT A;  4PPR A;  3LIF A;  3V67 A;  2XEP A;  1Y28 A;  4FCF A;  3FKV A;  1PWC A;  3MMH A;  5KIZ A;  4KZ4 A;  3S7N A;  4G3K A;  5F1F A;  1FCN A;  3KSF A;  4II7 A;  2WKQ A;  4JKT A;  3SS4 A;  4Y17 A;  4B4X A;  3BLS A;  3P01 A;  3OPH A;  1Y54 A;  3LIC A;  4EEU A;  2V0W A;  1K6S A;  4X6T A;  4BL2 A;  3O87 A;  4WM9 A;  3TSG A;  1YLZ A;  4OOY A;  4NK3 A;  5E2G A;  4I39 A;  3N8L A;  1W8Y A;  4GHI A;  1ES5 A;  4B9O A;  4FSF A;  4DE2 A;  3IXB A;  3C5A A;  3UDI A;  4IHQ A;  3ITA A;  5HZH A;  3BJN A;  4OP8 A;  3C2W A;  1LSX A;  4I3I A;  4JF4 A;  1K0K A;  1MPL A;  4EBN A;  4Q0H A;  3F1P A;  3FPV A;  5AQ9 A;  4R4R A;  2MJ6 A;  4ARZ B;  5TR7 A;  2X02 A;  3A3D A;  4E04 A;  3FG8 A;  3UB8 A;  2YKH A;  5HAQ A;  4X25 A;  2A2L A;  4IVK A;  3VP4 A;  3MFD A;  4KQO A;  4XXR A;  2J9O A;  3CUE C;  4KQQ A;  3ZFZ A;  4BMW A;  2XR0 A;  2J3T C;  5EUA A;  3UDF A;  3JVU A;  1DY6 A;  5EE8 A;  4DXC A;  4FD8 A;  3BY8 A;  4OON A;  3BW6 A;  3W4P A;  2O9C A;  5EVL A;  3IS2 A;  4N92 A;  4YOF A;  2A3U A;  5FSR A;  2VLG A;  3N6I A;  3CIT A;  5CX7 A;  2VX8 A;  1TF1 A;  2HJE A;  1OT6 A;  3OBF A;  1W8Q A;  1CEG A;  3K3C A;  3MQ0 A;  2JE5 A;  4MEZ A;  3WS1 A;  2X71 A;  2QJ7 A;  4L9E A;  4Y13 A;  2ZC4 B;  4PM7 A;  5CGW A;  3BFD A;  2PU2 A;  1NWZ A;  5CRF A;  1W5D A;  3C4O A;  4HI4 A;  3IWO A;  4I5S A;  1ODV A;  4G3W A;  3ULF A;  1TD5 A;  1OJG A;  3LR4 A;  1J9M A;  2Y55 A;  2PBY A;  1NRJ A;  3FYZ A;  5FI2 A;  2VJW A;  4GJ4 A;  1E4D A;  2Y59 A;  1SDN A;  4S2O A;  2O9A A;  2GJ3 A;  3DBA A;  4CJN A;  2IWC A;  1FCO A;  4WLA A;  2Q9N A;  3KYE A;  4P6Z M;  1P0Z A;  5CGX A;  1G68 A;  2D01 A;  1CEF A;  3BWL A;  3OZH A;  1PWG A;  3G4P A;  1N9N A;  3W8K A;  1S1Y A;  3C7U A;  2VZW A;  4Y3I A;  3ZG8 B;  3LFV A;  2EWW A;  2IWD A;  2O9B A;  1ESI A;  2L4R A;  3C30 A;  2ZQC A;  2Y2O A;  1KDS A;  3L9K A;  4PHT A;  5A91 A;  3V5M A;  1RP5 A;  1D06 A;  2NUT C;  5AQ7 A;  3HJI A;  3D9Y A;  3PAG A;  5HPF A;  2WGV A;  3N8R A;  1H8M A;  3RH8 B;  1BLH A;  1HD8 A;  1OTB A;  5G4Y A;  1F5M A;  4OQI A;  4WMC D;  2M7U A;  3CJM A;  3HLC A;  4XT2 A;  2WZZ A;  1PYY A;  4O7D A;  3F1N B;  4F94 A;  1MXO A;  1JWP A;  1K4F A;  4MNR A;  3ZG5 A;  1MWR A;  1WYC A;  3D3O A;  1L3L A;  2FFF B;  2R9W A;  3IWQ A;  1KVM A;  5J8X A;  1KGF A;  5FDS A;  3IT9 A;  3QNC A;  5GL9 A;  4NEE D;  3ZG7 B;  4O8G A;  2EX8 A;  1P97 A;  3R4K A;  3NUL A;  2W3F A;  3ZYT A;  3BQA A;  1GSW A;  1GHI A;  4GS9 B;  4R3J A;  3S1Y A;  2QKP A;  4U3T A;  3EQU A;  2Y2M A;  3VP3 A;  4OP5 A;  2J8Y A;  3IH8 A;  4CPK A;  3IX3 A;  1PWD A;  4UQI S;  1RCJ A;  2WZX A;  3KO6 A;  1VB6 A;  3WS4 A;  2O0Y A;  1XKZ A;  3B42 A;  4EUV A;  2XK1 A;  2A24 B;  5TJJ A;  3UE3 A;  2ZM8 A;  2GX5 A;  2V9A A;  4H6J A;  5EEC A;  1UWP X;  2Y2N A;  4PM5 A;  4R1G A;  3LI9 A;  4OKP A;  4ZJ3 A;  3W2Z A;  1W79 A;  2JN7 A;  4D60 A;  3MXQ A;  4ZAM A;  5FI6 A;  3MXR A;  3V39 A;  3UO9 A;  1OTA A;  2EX6 A;  4FTX A;  2ZMF A;  3G2Y A;  1MWS A;  5HAI A;  2G7U A;  1XXM A;  2CMN A;  4K0W A;  2EXA A;  3G2Z A;  3GTC A;  5HD3 A;  5L07 A;  4EEP A;  2W3D A;  3HUN A;  4HP9 A;  1IFQ A;  1VET A;  4C3Q A;  3H82 A;  4S2M A;  1ZG4 A;  4R3B A;  4ETX A;  4JGP A;  2M1C A;  1NXY A;  3G30 A;  3G6O A;  4KZ8 A;  1TS8 A;  1LHY A;  1ALQ A;  4WZ4 A;  5J4E A;  1KDW A;  4X1L A;  4P85 A;  3ZVW A;  1F2K A;  2B18 A;  2Q9M A;  4GD8 A;  4FUW A;  3C38 A;  3ZG0 A;  2V20 A;  1ERQ A;  2W3G A;  1S1Z A;  4PKY G;  1DJC A;  5DTK A;  1BSG A;  3PXP A;  4S2P A;  1O7E A;  2UV0 E;  4CLC B;  1JWV A;  4OQG A;  4HNB A;  1OTD A;  1CQA A;  3WRZ A;  5EOE A;  1ZHH B;  4OOL A;  5U47 A;  4QJG A;  4HES A;  5EM1 A;  4DDY A;  1PRQ A;  3BFC A;  3LR3 A;  3VOY A;  3PBO A;  5F82 A;  3B33 A;  2W3E A;  4DMZ A;  3T4L A;  1Z09 A;  2OAP 1;  3BFG A;  4EV4 A;  2EWV A;  3EQV A;  3V50 A;  3MJQ A;  2OV5 A;  1XA7 A;  4JXG A;  2BTF P;  1FIK A;  5E43 A;  4C75 A;  3MQQ A;  4YFM A;  1MZU A;  1FSY A;  5FQK A;  5FQJ A;  3IF6 A;  1N9O A;  2HV1 A;  3KYZ A;  3DW0 A;  4JXS A;  3V3R A;  3VMA A;  1YMX A;  5F69 A;  4WEJ A;  2OSU A;  2DCF A;  3CAX A;  3BEB A;  1IKI A;  2W3H A;  1MC0 A;  2HZ5 A;  1PZO A;  5E2H A;  5GLC A;  1SKO A;  1SZV A;  3CZD A; 
#chains in the Genus database with same CATH homology
 1TS6 A;  3T4K A;  3HCY A;  3GEC A;  5TBM B;  3T4S A;  4I39 A;  3CWF A;  2VEA A;  1XJ3 A;  2M7V A;  1W63 Q;  4GHI A;  4B9O A;  1MKM A;  4FSF A;  3TRC A;  4F3L B;  3PHY A;  1D7E A;  5IT5 A;  3FC7 A;  3F1O A;  4XT2 B;  1GSV A;  3BY9 A;  4IHQ A;  2NUP C;  2OAQ 1;  5HZH A;  3BJN A;  2GZA A;  4NXE A;  3C2W A;  1LSX A;  1LSV A;  4GLQ A;  4NKP A;  2J3W A;  2JHE A;  4I3I A;  2ZOH A;  4LRZ E;  1LSW A;  4QPR A;  2A24 A;  4CLC E;  4Q0H A;  3F1P A;  3FPV A;  2QHK A;  2MJ6 A;  3EEA A;  4ARZ B;  4E04 A;  4R6L A;  5DFX A;  3S7O A;  4DN0 A;  3FG8 A;  3IBR A;  3UB8 A;  3VV4 A;  2YKH A;  3K2N A;  1OTE A;  1UGU A;  2IA2 A;  3BQ8 A;  2A2L A;  3PBS A;  4KQO A;  5LBR A;  3KYQ A;  3CUE C;  3PBT A;  4CQH A;  1YSP A;  4BMW A;  2J3T C;  5J3W A;  3RTY A;  3JVU A;  2W1R A;  4ZRR A;  5DF9 A;  4F3L A;  1WA9 A;  5EFW A;  2HJ9 C;  3BY8 A;  1T18 A;  3E4Q A;  3BW6 A;  4BBV A;  2EA9 A;  4G3V A;  4HJ4 A;  2K7S A;  3A0S A;  2XRO A;  3T4T A;  2O9C A;  3IS2 A;  1BYW A;  3PBQ A;  1T1B A;  4YOF A;  2VLG A;  5C5K A;  1YAX A;  4HHD A;  3CIT A;  5HDD A;  2W1T A;  1H3Q A;  2P7J A;  4H6J B;  5CX7 A;  4Q0I A;  2PR6 A;  2VX8 A;  1TF1 A;  4BWI A;  2HJE A;  1OT6 A;  3OBF A;  3UMD A;  4HJ3 A;  3MFX A;  2V1B A;  4ARZ A;  5G4Z A;  3H7W A;  3K3C A;  2VV8 A;  4RQ9 A;  3MQ0 A;  4MN7 A;  3EEH A;  1W63 M;  2VA0 A;  3OOV A;  2QJ7 A;  2VGL M;  3CLO A;  3PBR A;  4L9E A;  2PYP A;  4ME4 A;  1XJ2 A;  2XA7 M;  5HWW A;  4WEL A;  4EER A;  3CUE A;  4M4X A;  1NWZ A;  3NOP C;  5DJU A;  1G28 A;  4HI4 A;  2XSS A;  4I5S A;  3T4Q A;  1ODV A;  4G3W A;  3H9W A;  3ULF A;  4L9F A;  4MMN A;  4I38 A;  3H82 B;  3HJK A;  5AVF A;  1T19 A;  3JVV A;  1TD5 A;  1S66 L;  3PYP A;  2KOI A;  1OJG A;  3SW1 A;  3LR4 A;  3R7W B;  3EGX C;  1YSQ A;  1NRJ A;  2PHY A;  2VJW A;  4GJ4 A;  4JGO A;  5L8M A;  4BBU A;  5MC7 A;  1YKD A;  3GDI A;  2O9A A;  2GJ3 A;  3DBA A;  2V1A A;  3A0R A;  4IUK A;  4LPZ A;  4WLA A;  4ETZ A;  2ZMV A;  4P6Z M;  4AFI A;  1P0Z A;  5A8B A;  4UQI M;  2WKP A;  2D01 A;  3MF0 A;  2QYB A;  1DRM A;  5HDS A;  3BWL A;  3LYX A;  2K31 A;  2PD8 A;  2KDK A;  2FH5 A;  4Q0J A;  1XJ4 A;  1N9N A;  1S1Y A;  4HIA A;  4IUH A;  4GCZ A;  2VZW A;  5DJT A;  2PD7 A;  3LR0 A;  4Y3I A;  3LFV A;  2W0N A;  5K5B A;  2EWW A;  2LB5 A;  3VE3 A;  4MDZ A;  3TJZ C;  2I9V A;  5HPI A;  2O9B A;  1EW0 A;  2L4R A;  3C30 A;  4LRX C;  1TS0 A;  3LIB A;  2L1M A;  2ZBB A;  2PDR A;  4PHT A;  3KSH A;  1D06 A;  2NUT C;  4L9G A;  3HJI A;  3S7P A;  5HPF A;  4B93 A;  3EWK A;  2VV6 A;  3ZQ5 A;  1H8M A;  4DJ3 A;  5HD5 A;  3RH8 B;  2OOL A;  5TBM A;  1OTB A;  5G4Y A;  1F5M A;  1S4R A;  4HJ6 A;  4FOF A;  4Y5F A;  1TS7 A;  5DKK A;  4I3A A;  2R78 A;  2M7U A;  4XT2 A;  3P7N A;  4EU0 A;  3ICY A;  5F68 A;  2HF6 A;  3E0Y A;  1NLY A;  3F1N B;  3EOI A;  5HDC A;  4GW9 A;  2VGL S;  1IOU A;  2VV7 A;  3LIE A;  4I3J A;  2O99 A;  2XA7 S;  3D3O A;  4HH2 A;  4R3A A;  3LIA A;  1F9I A;  3NJA A;  4EES A;  3E4O A;  3TE8 A;  5FL3 A;  3VE4 A;  5HWT A;  2K2N A;  3CI6 A;  5F6A A;  2J80 A;  2QWS A;  3UB7 A;  3UB6 A;  4NEE D;  5HSQ A;  2PR5 A;  1OJ5 A;  4O8G A;  1P97 A;  3R4K A;  2W3F A;  1V9Y A;  4CLC D;  3ZYT A;  1OTI A;  3BQA A;  1GSW A;  4NXF A;  4GS9 B;  3TW8 A;  3U2A A;  4EQ1 A;  4GHI B;  1XFN A;  3MR0 A;  1DP6 A;  2QKP A;  3EQU A;  3NOT C;  4Y2F A;  2P04 A;  4LLO B;  3F1O B;  2JKR M;  3LID A;  4P6Z S;  1X0O A;  2VKS A;  5HWV A;  4UQI S;  3KSG A;  3KO6 A;  1VB6 A;  2O0Y A;  3B42 A;  3KSI A;  3S7Q A;  4EUV A;  2A24 B;  5TJJ A;  3UE3 A;  3LR5 A;  3FPW A;  2GX5 A;  4HQA A;  5F5Y A;  3E4P A;  2V9A A;  4H6J A;  1DP9 A;  2PYR A;  4L0L A;  1UWP X;  2H28 A;  4EET B;  4DJ2 A;  3T4O A;  4OOM A;  2WKR A;  4WL9 A;  2Z6D A;  3LI9 A;  3W2Z A;  2B02 A;  2JN7 A;  3MXQ A;  1OPX A;  4O0P A;  2KX6 A;  2Y79 A;  1OTA A;  4HH3 A;  2P08 A;  1S67 L;  4YNR A;  4NXB A;  4PAU A;  3RFB A;  2ZMF A;  4GS9 A;  5AJG A;  1VHM A;  1NLZ A;  2G7U A;  3NHQ A;  3K3D A;  2OWH A;  2CMN A;  4EW7 A;  3VOL A;  4R70 A;  5HD3 A;  5DKL A;  4EEP A;  2OWJ A;  3MQO A;  2JKT I;  2W3D A;  4HP9 A;  1IFQ A;  2FZ0 A;  4EXO A;  3OLO A;  5AVE A;  5I5L A;  2JKR I;  3H82 A;  4O01 A;  3C8C A;  1T1A A;  2W27 A;  3IS2 B;  4HY8 A;  3PBN A;  3PR6 A;  4LRY C;  4ETX A;  3IBJ A;  3R7W A;  1F98 A;  4JGP A;  2M1C A;  2L0W A;  3KX0 X;  2V0U A;  2W1T B;  2DMW A;  4PKY A;  3G6O A;  4KUO A;  3A0V A;  1N9L A;  1P9W A;  1TS8 A;  1OT9 A;  4WN5 A;  3H7W B;  3LI8 A;  2KLI A;  4YWZ A;  5J4E A;  3OCN A;  2INW A;  2GNX A;  2QJ5 A;  3OC2 A;  1JNU A;  2B18 A;  3O5Y A;  1XFQ A;  4Z1W A;  1S4S A;  3C38 A;  4KUK A;  2ZOI A;  3E98 A;  2HGV A;  1ZTU A;  2W3G A;  4MN5 A;  1S1Z A;  4PKY G;  4KQD A;  3UME A;  3EGD C;  3PXP A;  3T4J A;  3LUQ A;  4CLC C;  4K08 A;  4CLC B;  1KOU A;  1DP8 A;  3B47 A;  4HNB A;  4JGR A;  1OTD A;  2J3T D;  5J7E A;  1STZ A;  1ZHH B;  4OOL A;  4BJP A;  1XJ6 A;  2YKF A;  5HL6 A;  4HP4 A;  3D72 A;  4R38 A;  1G6O A;  4NXG A;  3LR3 A;  3PBO A;  2D02 A;  1LL8 A;  3B33 A;  3NOU C;  1GSX A;  2W3E A;  5IU1 A;  4DMZ A;  2Z6C A;  4WF0 A;  3T4L A;  2BAS A;  2LB9 A;  2JKT M;  2OAP 1;  2EWV A;  3EQV A;  3MJQ A;  2PT7 A;  4UEY A;  4IJG A;  3UB9 A;  3UE6 A;  3MQQ A;  4BBT A;  1MZU A;  3LIF A;  3V67 A;  1Y28 A;  5IS1 A;  4MCW A;  2XRN A;  3F1N A;  2Y8H A;  3MMH A;  5KIZ A;  1V9Z A;  3T50 A;  5DFY A;  1N9O A;  2HV1 A;  3KYZ A;  1UWN X;  3F1P B;  3S7N A;  4G3K A;  4II7 A;  3KSF A;  2WKQ A;  4WEJ A;  5F69 A;  1P9R A;  1LT0 A;  4WEK A;  1T1C A;  4CLC A;  3CAX A;  3P01 A;  4MN6 A;  2W3H A;  1MC0 A;  4WUJ A;  3LIC A;  4EEU A;  2V0W A;  3OCL A;  5KSH A;  4HOI A;  4JGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...