1S4RA

Structure of a reaction intermediate in the photocycle of pyp extracted by a svd-driven analysis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4rA00
4BBVA 1KOUA 4LRXC 3RH8B 2PYPA 5I5LA 3FG8A 4XT2B 4H6JA 3UB7A 3E4QA 4HJ4A 4LRYC 2ZOIA 3MFXA 4L9GA 4EXOA 1S1ZA 5IU1A 4B9OA 4I3AA 3ZQ5A 1OT6A 4EETB 1OTIA 5HDDA 2KDKA 1OTDA 3UB6A 1OTBA 2BASA 5J7EA 1F98A 3G6OA 1V9YA 2V9AA 3LIDA 3MQOA 3MQQA 2V1AA 2JN7A 4HJ3A 2PHYA 2PYRA 3ULFA 1DRMA 3H82B 4NXEA 3EEHA 3FC7A 1S66L 1P97A 4EW7A 1OJ5A 3F1PB 2OWJA 4GW9A 4BBTA 4HOIA 1S1YA 2YKHA 3MXQA 3E4OA 4GS9B 5F5YA 2L4RA 3IBRA 1NWZA 2PR6A 3LIAA 4KQDA 1OT9A 4HNBA 1S4SA 3CAXA 2EA9A 1ODVA 2JHEA 2WKQA 4EQ1A 4YWZA 2W0NA 2P7JA 3LIFA 5HDSA 2PD7A 2ZBBA 3UB8A 1D7EA 1OJGA 3BWLA 1X0OA 2HV1A 1BYWA 1S67L 4KUOA 2VV6A 2QJ5A 5TBMA 4NXGA 4F3LB 3GECA 2WKRA 4RQ9A 4KUKA 5AVFA 4HIAA 4LLOB 5HSQA 5HD5A 2OOLA 5HWTA 4DJ3A 4E04A 4HH3A 3E4PA 4HJ6A 1TS7A 3B33A 4I5SA 1LSWA 3A0VA 3GDIA 1V9ZA 1JNUA 3F1NA 2YKFA 4I3JA 3C2WA 5DKKA 2Z6DA 4HI4A 1GSXA 4EEUA 5J4EA 1OTEA 4H6JB 1T1AA 4R6LA 5G4ZA 4MN5A 1T19A 4EEPA 2D02A 2WKPA 2V0WA 2VEAA 1XJ6A 3VE3A 2QKPA 1LSXA 3T50A 2W27A 2QHKA 3RTYA 1XFQA 2A24A 1GSVA 2VV7A 3IS2A 5HWVA 1N9LA 4HY8A 3NOTC 3HJKA 3LIEA 1T1CA 2INWA 4WL9A 2PD8A 5EFWA 3MJQA 2K7SA 1UWNX 4M4XA 3BY9A 4HP4A 4JGOA 4JGQA 4WUJA 1UGUA 5AVEA 4GHIA 5J3WA 3H7WB 3PYPA 1VB6A 3LICA 1F9IA 3KX0X 4HP9A 3EWKA 4DJ2A 1LT0A 1UWPX 2GJ3A 3UE6A 4LPZA 3HJIA 3PHYA 3BY8A 1S4RA 3F1OA 2CMNA 1EW0A 3K3DA 1G28A 3LUQA 3UMEA 3P7NA 5TBMB 4PKYG 4MN6A 4R3AA 4JGPA 1T1BA 2L1MA 3ICYA 1D06A 3H9WA 4XT2A 1LL8A 5KIZA 2B02A 2QWSA 3OLOA 2M1CA 5F69A 4L9EA 5F6AA 1Y28A 1T18A 3CWFA 2PDRA 1MZUA 4I39A 2J80A 5IS1A 4LRZE 2OWHA 1XJ3A 2VLGA 4L9FA 4GCZA 1DP8A 1TS6A 2KX6A 3F1NB 3H82A 4HH2A 4I3IA 3VE4A 2I9VA 2ZOHA 3NHQA 2H28A 4WF0A 1TS0A 2PR5A 1TS8A 5G4YA 5HDCA 1XJ2A 3F1PA 1WA9A 1LSVA 2QJ7A 3LIBA 1XJ4A 2V0UA 2V1BA 5HZHA 5DJTA 3C8CA 2A24B 4GS9A 4EESA 3IS2B 5HWWA 4NXFA 3CLOA 5F68A 5HD3A 4HHDA 5DKLA 4PKYA 3UB9A 5DJUA 3H7WA 1DP6A 3NOPC 1N9NA 4I38A 3UMDA 3LYXA 4EERA 3NOUC 1N9OA 3SW1A 3A0SA 3LI8A 4WLAA 4GHIB 4WN5A 2Z6CA 4F3LA 4R38A 1P0ZA 3A0RA 2VV8A 4HQAA 1DP9A 4JGRA 1GSWA 3MR0A 3D72A 3NJAA 3VOLA 3LI9A 2L0WA 1XFNA 1OTAA 2R78A 3K3CA 4BBUA 4K08A 5A8BA 3F1OB 4NXBA 2D01A 4R70A
chains in the Genus database with same CATH superfamily
2W1TB 1FSYA 4RA7A 3FKWA 5HPIA 3EGDC 5I5LA 2XD5A 3MS6A 4XT2B 2HDQA 3R7WB 4N92A 5HX9A 4II7A 4I3AA 4FOFA 2XR0A 2ZQ7A 4LV1A 2Y2HA 3IXBA 4K0WA 1K25A 4DMZA 4EETB 2RL3A 1OTIA 3HREA 2ZD8A 3QP6A 4C3QA 2V8CA 2FH5A 3IWQA 1MC0A 1PNEA 4S2LA 2PRFA 3MQOA 3IF6C 4ZJ2A 2RCXA 4HJ3A 4XUXA 3H82B 5FA7A 2VZWA 3HUOA 1CI9A 5FEGA 4KG5A 3WS0A 4MN7A 3EQVA 4IHQA 4FH2A 3ZVTA 4EW7A 1OJ5A 2XA7S 4X1MA 1Z6FA 4ID4A 4D60A 2OWJA 1CK3A 4GW9A 2GNXA 3DTEA 2VGLM 3VP3A 1K56A 4MEZA 3BECA 1S1YA 2W3HA 1IYQA 2YKHA 3PBQA 4IEDA 2HJEA 3Q7VA 1L2SA 1RP5A 3Q7ZA 1NYMA 4DE3A 4GS9B 3O88A 2WGWB 2PR6A 1STZA 2B5RA 1M40A 3FPWA 4NK3A 2EA9A 3V5MA 4R3JA 4X53A 2P04A 2Y2PA 1K38A 3HLFA 1MWUA 3P09A 3MQ0A 4GD8A 2OLUA 4PM8A 4PM7A 1J9MA 2BG1A 2EFUA 5U47A 5JYOA 2CC1A 3U2AA 3WS1A 4LV0A 1BYWA 3VP2A 2A49A 2QJ5A 5HARA 3OBFA 3OCLA 2JKTM 5EUAA 5AVFA 1HLUP 1E3UD 4ETXA 4G3WA 1ONGA 5HSQA 1VHMA 2WYXA 2HP6A 5MC7A 5DTKA 2Y2KA 3BM6A 2XSSA 4E04A 4HJ6A 1TS7A 3VSLA 1LSWA 2OLVA 3AGEA 4JF5A 3KO6A 5FQKA 4OPZA 4R0QA 1PI4A 3IQAA 4X56A 4N1XA 2D02A 2XFSA 3DTKA 4IBXA 5CGWA 3VE3A 2QKPA 4ZJ3A 4C6YA 3B42A 3MZEA 4LGWA 4FTXA 2QHKA 5FDSA 1TEMA 4NKPA 1KVLA 4QB8A 4M3KA 4R4SA 2A24A 4O7DA 3T4QA 2VV7A 3IS2A 5HWVA 2ZMFA 3IX4A 3G4PA 1I2SA 4CQHA 4KZ9A 2VA0A 1T1CA 3LR3A 4AFIA 2DNSA 3MJQA 2EXAA 2WGVA 5FASA 2OAQ1 3CHWP 1UWNX 2G2UA 4G3KA 1ES2A 4Y5FA 2HDUA 5M18A 4OKPA 5FAQA 4JGQA 5AQ9A 4HEFA 3PBNA 5AQBA 3FPVA 4MMNA 4QY5A 3NY4A 3LICA 1ZG4A 4WEKA 4HP9A 1HZOA 1LT0A 4Y15A 3HLWA 1KGEA 4Y3IA 1Z09A 3PHYA 4QHCA 3V39A 1EW0A 3CJMA 3S1YA 4CLCA 5GL9A 3RFBA 2C5WB 3D4FA 3GTCA 3LR5A 1YT4A 2XA7M 4Y17A 4PKYG 4JGPA 3VP0A 1YLZA 2HGVA 5GHXA 1PWCA 2HZ5A 2XD1A 1JVJA 3CI6A 4WZ5A 3UY6A 2ZL1B 2QWSA 2IWDA 3A3IA 2M1CA 4E6XA 2Y2JA 5F6AA 2FZ0A 2Y8HA 1XGJA 3ZG5A 4RX3A 5EV0A 2J80A 5IS1A 3IH8A 4DF6A 2DRWA 2VLGA 4L9FA 2XF3A 3OPHA 1DP8A 2KX6A 2WKEA 2GZAA 3HLDA 5EVID 3UNWA 3JVVA 4WBGA 3VE4A 5DF8A 2ZOHA 1C3BA 5KZHA 3NHQA 1Y54A 3C7UA 4WF0A 5GLCA 2W1RA 4OPQA 5EOEA 5G4YA 3E98A 5HDCA 1N9BA 3C4PA 3F1PA 5A92A 1WA9A 1LSVA 2QJ7A 4OPRA 1W8QA 4B88A 5L2FA 2Z2LB 3DAVA 3E2KA 3VSKA 3W2ZA 4Y2FA 1YM1A 2EFXA 4E3KA 2A24B 1H8ZA 3IS2B 3OCNA 2W3EA 4NXFA 3NI9A 2MJ6A 5BOHA 5EE8A 3NULA 3M2KA 4HHDA 4X55A 1DP6A 3NOPC 4PMAA 1K6RA 3SS4A 3SH7A 5FAOA 4NEED 4OOLA 4GDBA 2Y91A 2ZM8A 2ZQDA 1WYCA 4MDZA 4UAAA 5F1GA 1YMSA 5CTNA 5TR7A 4OQGA 3IT9A 4WN5A 2JC7A 3Q07A 1P0ZA 3KSGA 3IHBA 1ES5A 1O7EA 1DP9A 4JGRA 4Q8IA 5EECA 1GSWA 3D72A 2L0WA 2HDSA 4WYYA 3K3CA 4BBUA 3QP8A 3VFHA 5CHUA 4F94A 2VGLS 3PBTA 4CLCB 3UPOA 1E4DA 1L0GA 3RXXA 4EBNA 5HL1A 4Y0TA 4GOGA 4Y0UA 2ZMAA 1KOUA 3OC2A 3RH8B 5DFYA 3HBRA 1AXBA 2P74A 4DDYA 1IYPA 3FZCA 4IUHA 3E4QA 3W4OA 2OAP1 3OPPA 4ZBEA 4B9OA 2EX8A 1GHIA 4OLGA 1CF0A 2O0YA 5DF9A 5M19A 3RJUA 1EROA 1OT6A 3CZDA 2C6WB 1LLBA 1MBLA 3N8SA 4ESPA 2J8YA 4PAUA 1OTDA 3C4OA 1J3WA 3G35A 1OTBA 5CRFA 4OOYA 2BLSA 5J7EA 5FI2A 2X01A 4KG6A 1KGFA 4OOMA 3AGFA 4N1HA 4LV2A 4XUZA 3BFEA 1ERMA 4CPKA 4NXEA 3EEHA 4UQIS 4S2OA 5DF7A 1K57A 2Y79A 1P97A 5HAQA 1CEGA 3MKEA 2JKRI 3ITBA 1CI8A 3UPNA 2VJWA 3F1PB 3E2LA 3HLGA 1MWTA 5FDHA 1YAXA 3T4KA 1NY0A 5J8XA 4MLLA 4S2MA 4GJ4A 2Q0OA 2ZM2A 4DN0A 2XH9A 1HD8A 1NWZA 3EEAA 3QNCA 3T4LA 2E8JA 1K55C 3PBOA 4DE1A 5FQQA 1Q2QA 1SKFA 2Y59A 1Y4OA 4B93A 2WKQA 3MXRA 2QZ6A 2M7UA 2P7JA 4FSFA 2PD7A 3UB8A 2XQZA 1D7EA 2XK1A 4G3VA 2Z2MB 1NLZA 1X0OA 2J9OA 2HPBA 5I94A 4NXGA 1LHYA 1CQAA 4ZRRA 1FIKA 3KSHA 4RQ9A 4KUKA 4HIAA 4LLOB 2G2WA 1LI0A 3ISGA 5HD5A 4LV3A 2OOLA 3UDFA 5HWTA 4PM5A 1IKGA 1YMXA 1K56D 1MY8A 3E4PA 1PW8A 3KSFA 3FWLA 2WAFA 3LEQA 1BT5A 3T4OA 1YLYA 1PRQA 3LR0A 2FFYA 1FQGA 5CTMA 4Q0HA 3LY4A 2Y2NA 4I3JA 3C2WA 2Z6DA 4B4ZA 5GHZA 1YLPA 1T1AA 2LB5A 4R6LA 3GSGA 1XA1A 5G4ZA 1XKZA 3CG5A 1PWGA 2V2FF 1W7FA 1SZVA 2KOIA 3HL9A 2W3DA 1LSXA 2B95A 5A91A 4RVAA 1SKOA 3QP5A 4KZ3A 3UN7A 2JKRM 1HVBA 5DTTA 3ZVWA 4UHUA 3BLSA 3MZFA 1N9LA 3HJKA 5LBRA 3DWKA 4WL9A 2O99A 4DXBA 1IOUA 3DW0A 2K7SA 4LCMA 2EX9A 1PIOA 2O9BA 3T4JA 3IXDA 1I2WA 3QHYA 4JGOA 1UGUA 4GHIA 3H7WB 4UA9A 1VB6A 2XDMA 4S2NA 3GRJA 2GDNA 4UA6A 1EWZA 1G6AA 2ZC7A 2WKIA 3UDIA 2ZMVA 1H8MA 3N8LA 3IBJA 3MBZA 1YKDA 2UWXA 3HCYA 4LPZA 3HJIA 2OSUA 4U0XA 3OPLA 1SHVA 1NYYA 3BY8A 3JYIA 2CMNA 1TVFA 1AWIA 4FH4A 1G28A 1NZUA 3GVBA 4UQIM 4PM6A 2AVXA 3O5YA 3QNBA 4JXSA 4X1LA 1ERQA 3P7NA 5KSCA 1IYOA 4MN6A 3K2NA 4NETA 3ICYA 1BLPA 3H9WA 5AQ7A 4UA7A 5CEBA 2X71A 1YPRA 3P01A 3HLEA 5F69A 4L9EA 3NDEA 3BW6A 4X6TA 4K91A 4R4RA 4GKUA 3UB5P 4IBRA 2OWHA 5A90A 4S2PA 3VP4A 4BWIA 1PWDA 4GCZA 1TS6A 3LCEA 4R3BA 1ALQA 1JWPA 3UE3A 3LR4A 5FATA 3RXWA 4HH2A 4I3IA 3TJZC 4Y13A 2K31A 1FCMA 3CMZA 4WM9A 3Q81A 4E3IA 2P9VA 4CLCE 2PR5A 3HUNA 4OQIA 1XX2A 3SS3A 3KYQA 3TSGA 1ONHA 1XJ2A 1OPXA 1DJAA 2BTFP 2JKFA 1LI9A 3LIBA 2V0UA 2EXBA 4IVIA 5HZHA 3ZG9B 1G6OA 1SKOB 1IEMA 4HBUA 5HAIA 1BUEA 3EOIA 4QPRA 3C30A 1LL5A 1MKMA 1NLYA 3G31A 2JBFA 5HWWA 1PYYA 2FFFB 3ZFZA 3ZDJA 3BLMA 3Q7VB 4RYEA 1FR6A 4S2KA 4DE0A 3UB9A 4QWOA 5DJUA 4QJGA 1N9NA 1DJBA 4I38A 2VKSA 3GQZA 5E2EA 2O9AA 1BTLA 2EX2A 3SW1A 1PZOA 3LI8A 4GDNA 4WLAA 5CXWA 1SDNA 1K0KA 4GHIB 1L0EA 4GD6A 5EVLA 4LFUA 4R38A 5DVAA 2V20A 5E43A 2WK0A 4HQAA 4RX2A 3IH9A 4DE2A 3NJAA 3S7PA 3VOLA 1XFNA 1OTAA 2R78A 1YLJA 4D2OA 1XXMA 5A8BA 2H0YA 4NXBA 3WS4A 4BBVA 1O07A 1BLCA 4ARZA 4S2IA 3C7VA 3B3XA 2PYPA 4CLCC 3BFFA 1KDWA 3GR2A 4FCFA 4GZBA 2ZOIA 3MFXA 2X02A 5FI7A 4IUKA 4NG2A 3M2JA 1S0WA 3ZQ5A 2XFTA 5EPHA 2DMWA 3CUEA 4KQRA 1RGZA 5HDDA 2KDKA 4WZ5C 4MNRA 1QMFA 3UB6A 1F98A 3G6OA 4P87A 1V9YA 2V9AA 3LIDA 3NDGA 4KZ4A 2PT7A 3C5AA 1DRMA 2HDRA 1K6SA 5CHMA 1JWVA 1L0DA 3A3FA 3FC7A 3S7OA 2EWWA 2P9VB 3V3RA 3DBAA 1KE3A 3U4LP 3WS2A 4JXVA 3TE8A 4GB7A 5FQJA 1GHMA 3CPTA 4HOIA 5K5BA 4O01A 3MXQA 1M6KA 3UO9A 5F5YA 4XXRA 2L4RA 5F82A 1YQSA 3G32A 4KQDA 1OT9A 2NUTC 4JXWA 2O9CA 1ESUA 3FV7A 1ES3A 2ZBBA 4EBLA 2R9XA 1IYSA 1OJGA 5EM0A 5EVIA 4EBPA 4OQ0A 4EV4A 2WUQA 4KUOA 3G30A 3IF5A 5TBMA 2XEPA 1JTGA 3V3SA 2NUPC 2WKRA 4OP8A 4X25A 4JLFA 2XLNA 4OQHA 3S7NA 3IWIA 2K2NA 4HH3A 4CJNA 1HTZA 1K54C 1XP4A 3T1SA 2M7VA 3PR6A 4KQQA 2ZLYA 1W79A 2J7VA 5L07A 4E3LA 3ITAA 3D9YA 3A0VA 5GLBA 4EUVA 4P6BA 3GDIA 3OZHA 4LENA 3B47A 2JCHA 4ARZB 3F1NA 1MXOA 2YKFA 4KZAA 4HI4A 1GSXA 2ACGA 5HFOA 5J4EA 3MMHA 1ES4A 1ZHHB 3S7QA 1GCEA 4DXCA 4QY6A 1T19A 5CX7A 2WKPA 4C75A 2V0WA 2V8FA 3PBRA 2Y4AA 2VEAA 1XJ6A 4S2JA 5L8MA 1MKIA 3T50A 4ETZA 2ZQ9A 2J9PA 4E3MA 3ZG0A 2WAEA 1XFQA 3DTIA 3GMWA 4E3OA 5GLDA 3T12B 3TG9A 4JF4A 4MBHA 1VETA 3EQUA 3BFCA 3NOTC 2VK3A 3M6BA 3LIEA 3SOIA 4P0MA 4BENA 3W4PA 2I72A 1GA0A 3HLCA 2PD8A 4K0XA 4Q0JA 3G2YA 4WZ4A 4P6ZM 5L09A 4M4XA 3HLBA 3TRCA 2R9WA 3BY9A 1I5QA 4E3NA 1H0MA 4MCWA 4ZTKA 2B18A 3ZG7B 1K57C 5AVEA 2WADA 4O8GA 4OH0A 1W63M 3VP1A 3KSIA 3EWKA 5CGSA 4DJ2A 3EGXC 1UWPX 2GJ3A 3UE6A 3ZCZA 2HJ9C 1WE4A 2Y55A 5C5KA 2V1ZA 1S4RA 3G2ZA 4BLMA 4MBFA 5EVIB 3LUQA 1ZKJA 4JPMA 1TDGA 3LFVA 3C38A 1YLTA 5TBMB 4R3AA 2L1MA 4UEYA 1S6RA 2EWVA 3VOZA 3T1QB 1BLSA 2Q9MA 5KIZA 1XA7A 2B02A 4Y0OA 3V50A 3OLOA 1H3QA 2XRNA 4ZJ1A 3TW8A 3FKVA 3CWFA 3IF6A 1RCJA 4KZBA 2JE5A 1MZUA 4Q0IA 1ESIA 4X69A 1NJ4A 1XJ3A 3N4IA 5E2GA 4WMCA 3IXGA 3QP2A 2ZJ9A 3LEZA 4EQIA 1FCNA 1BZAA 3F1NB 4DDSA 1EI5A 4YOFA 3BFDA 2WGIA 5E2HA 1JTDA 2XROA 4BL3A 3OPRA 4GN2A 2LB9A 3WWXA 1DJCA 3GV9A 1VQQA 4KZ5A 3PTEA 3S22A 1XJ4A 1FCOA 4QD4A 4LCLA 1H5XA 4GNUA 5DJTA 3C8CA 3W8KA 4EESA 2HP9A 3A3EA 4FD8A 2DCFA 4U3TA 1VETB 3CLOA 4YNRA 5EVEA 2J3TD 5F68A 3ZG8B 5HD3A 5DKLA 1VM1A 4KG2A 2ZQ8A 5CGXA 5CECA 3UMDA 4EERA 5FAPA 3NOUC 5DFXA 3A0SA 4F3LA 1GHPA 1KE4A 1PI5A 2GX5A 4Y7PA 1PFLA 4BQMA 3O3VA 3QP1A 1F2KA 1W8YA 3LI9A 3HUMA 4KENB 4S2NC 3IHAA 5TFQA 4K08A 3VMAA 2D01A 2ZL1A 4ME4A 4R70A 2WZXA 2J3WA 4OONA 5CEDA 3MF0A 4LRXC 2Y2OA 1JWZA 4HESA 3S4XA 1SDEA 3FG8A 1N4OA 2IWBA 4H6JA 2A3UA 3UB7A 1VEUA 4HJ4A 4LRYC 4L9GA 2ZQAA 2PBDP 4EXOA 3A3DA 1S1ZA 5IU1A 1PZPA 4ZAMA 5F83A 1KDSA 2ZQCA 3IF6B 2ZC6B 1ZC2A 1ACFA 4PHTA 2BASA 2J3TC 3MFDA 2VX8A 2EX6A 3MQQA 4CLCD 1KVMA 2V1AA 1PW1A 2JN7A 3NECA 2PHYA 3IWOA 4BD1A 2PYRA 3ULFA 1RGYA 4OP5A 1NXYA 5F1FA 3MSHA 2Y2GA 3WRZA 1NZOA 1E3UA 1S66L 1OMEA 4IVKA 5FI6A 1G68A 1IFQA 1NRJA 4BBTA 1F5MA 2G7UA 4R1GA 3TOIA 1WYBA 2VGKA 4EWFA 3E4OA 3BQ8A 3A3JA 3UDXA 4BD0A 3IBRA 3LIAA 1MPLA 4HNBA 1Q2PA 4P85A 1S4SA 1FSWA 3CAXA 4JBFA 1ODVA 2JHEA 1SCWA 4EQ1A 4YWZA 2W0NA 2ZC3B 1QMEA 1FR1A 3LIFA 3G34A 2ZM0A 4H8RA 5HDSA 2WKHA 4KZ8A 3SS5A 3WS5A 3NC8A 2HP5A 5HW3A 3JPUA 3BWLA 2HV1A 1D1JA 3Q82A 1S67L 1XGIA 1TD5A 2VV6A 3SH9A 4EUZA 1H8YA 4F3LB 3GECA 2H10A 4E6WA 3PAGA 5D3OA 2W3GA 3O87A 4HBTA 1ZTUA 3HVFA 2PBYA 4DJ3A 5HL6A 4KZ7A 4P6ZS 4PPRA 4FUWA 1G5UA 3B33A 4R23A 4BL2A 4I5SA 2PU4A 4WELA 2H5SA 5CERA 1V9ZA 1JNUA 5DKKA 4A5RA 3E0YA 5JYPA 4EEUA 1OTEA 3I7JA 4H6JB 1L3LA 1BLHA 1BSGA 3IXHA 5FEFA 1VEUB 4MN5A 3OOVA 4EEPA 1YSQA 3NBLA 3CITA 2ZC4B 2Y2IA 3WRTA 2A2LA 2QMIA 4QU3A 1FILA 3LGOA 2W27A 3QP4A 4Z9QA 3NIAA 5G18A 3RTYA 4U0TA 3W4QA 1GSVA 1TF1A 3N6IA 1A0KA 4YFMA 4JKTA 1ZG6A 1W5DA 4BJPA 4HY8A 3ZHHA 1P9RA 5IT5A 1MWSA 3SZTA 3CUEC 5HPFA 5FSRA 2INWA 3T4TA 3VV4A 4N9KA 1K4FA 3LY3A 5EFWA 2WZZA 1BULA 3M6HA 2ZC5B 5FQMA 1IELA 4YINA 4JF6A 5DTSA 3BEBA 4HP4A 3O86A 4WUJA 3ZYTA 3P98A 5EOOA 5J3WA 3DTMA 3IX8A 3PYPA 5EM1A 4E3JA 3ZNTA 4KZ6A 1F9IA 2PAVP 4B4XA 3T1XA 3KX0X 5GHYA 3LO7A 3KYZA 2PU2A 3UE0A 5GLAA 2E8IA 3ZNYA 3F1OA 1CJFA 1MWRA 4JXGA 3K3DA 1K54A 4N9LA 3UMEA 2W1TA 3PBSA 3VFFA 1L0FA 4OVDA 2Y2QA 4DRTA 1T1BA 1D06A 4XT2A 5E2FA 5CHJA 5IHVA 3R7WA 1LL8A 5EVIC 2IA2A 2QPNA 1Y28A 1E25A 3SH8A 1T18A 5M1AA 3BQAA 2PDRA 4DKIA 2Q9NA 3D3OA 3L7HA 4I39A 3T1RA 3MZDA 4LRZE 5KSHA 1FOFA 3V67A 4MBKA 4O0PA 3BRMA 3PXPA 2JKGA 3T4SA 2IWCA 5AJGA 3H82A 2I9VA 1IKIA 2H28A 1TS0A 1U60A 3BFGA 3VOYA 1TS8A 4PM9A 5A93A 4OPYA 4X68A 1KE0A 2KLIA 1CEFA 1LL9A 5FL3A 1K55A 2V1BA 2XGNA 2P08A 5HAPA 3MXSA 5KMWA 4GS9A 4EU0A 2WGWA 3R4KA 1KGGA 4BMWA 5AQAA 3CPTB 3FYZA 3IX3A 2OV5A 1YLWA 3NCKA 3ZGAB 4PKYA 1DY6A 4Z1WA 3H7WA 1YSPA 5TGFA 3UPPA 3Q1FA 2UV0E 2H0TA 3DWZA 1GA9A 3JVUA 2W3FA 3LYXA 3N8RA 4IJGA 2Y2LA 4ZDXA 1N9OA 4WMCD 3UE1A 3BJNA 1K4EA 3MKFA 5FQIA 5L10A 2Z6CA 1P9WA 1TDLA 2Y2MA 2VGJA 5FQ9A 1XPBA 3KYEA 5TJJA 3L9KA 3A0RA 2VV8A 4WEJA 3MR0A 1NRFA 3AGDA 2QYBA 3PAEA 3BYDA 3N7WA 2HF6A 1W63Q 2JKTI 4GLQA 4OLDA 3F1OB 4KQOA 4L0LA
chains in the Genus database with same CATH topology
4BBVA 2J3WA 2W1TB 3MF0A 1KOUA 4LRXC 4ARZA 3OC2A 3RH8B 5DFYA 5HPIA 3EGDC 2PYPA 5I5LA 4CLCC 3FG8A 4XT2B 4H6JA 4IUHA 3R7WB 3UB7A 3E4QA 4HJ4A 4LRYC 2OAP1 2ZOIA 3MFXA 4L9GA 4II7A 4EXOA 1S1ZA 4IUKA 5IU1A 4B9OA 4I3AA 4FOFA 2O0YA 5DF9A 3ZQ5A 1OT6A 2DMWA 4DMZA 4EETB 1OTIA 3CUEA 4PAUA 5HDDA 2KDKA 1OTDA 3UB6A 4PHTA 2FH5A 1OTBA 2BASA 1MC0A 2J3TC 5J7EA 1F98A 3G6OA 1V9YA 2V9AA 2VX8A 3LIDA 3MQOA 3MQQA 4CLCD 4OOMA 2V1AA 2PT7A 2JN7A 4HJ3A 2PHYA 2PYRA 3ULFA 1DRMA 3H82B 2VZWA 4NXEA 3EEHA 3FC7A 3S7OA 4UQIS 2EWWA 4MN7A 3EQVA 4IHQA 1S66L 2Y79A 1P97A 3DBAA 4EW7A 2JKRI 1OJ5A 2XA7S 3TE8A 1IFQA 1NRJA 2VJWA 3F1PB 2OWJA 4GW9A 2GNXA 2VGLM 4BBTA 4HOIA 1S1YA 1YAXA 5K5BA 3T4KA 1F5MA 2W3HA 2G7UA 2YKHA 3PBQA 2HJEA 4O01A 3MXQA 3E4OA 3BQ8A 4GS9B 4GJ4A 5F5YA 4DN0A 2L4RA 3IBRA 1NWZA 2PR6A 3EEAA 3T4LA 3LIAA 1STZA 3FPWA 3PBOA 4KQDA 1OT9A 4HNBA 2NUTC 1S4SA 3CAXA 2EA9A 2O9CA 1ODVA 2JHEA 2P04A 4B93A 2WKQA 4EQ1A 4YWZA 2W0NA 2M7UA 2P7JA 3LIFA 4FSFA 5HDSA 2PD7A 2ZBBA 3UB8A 3MQ0A 1D7EA 1OJGA 4G3VA 3BWLA 1NLZA 1X0OA 2HV1A 3U2AA 1BYWA 1S67L 4KUOA 1TD5A 2VV6A 2QJ5A 5TBMA 4NXGA 3OBFA 4F3LB 3OCLA 3GECA 2JKTM 2WKRA 2NUPC 4ZRRA 3KSHA 4RQ9A 4KUKA 5AVFA 4HIAA 4LLOB 2W3GA 4ETXA 4G3WA 5HSQA 5HD5A 1VHMA 2OOLA 3S7NA 1ZTUA 5HWTA 5MC7A 4DJ3A 5HL6A 2K2NA 2XSSA 4E04A 4HH3A 3E4PA 4P6ZS 4HJ6A 1TS7A 3B33A 3KSFA 4I5SA 2M7VA 1LSWA 3PR6A 4WELA 3T4OA 3LR0A 3A0VA 3KO6A 4EUVA 4Q0HA 3GDIA 3B47A 1V9ZA 4ARZB 1JNUA 3F1NA 2YKFA 4I3JA 3C2WA 5DKKA 2Z6DA 4HI4A 3E0YA 1GSXA 4EEUA 5J4EA 3MMHA 1OTEA 4H6JB 1ZHHB 3S7QA 1T1AA 2LB5A 4R6LA 5G4ZA 4MN5A 1T19A 3OOVA 5CX7A 4EEPA 2D02A 1YSQA 2WKPA 2V0WA 3PBRA 3CITA 2VEAA 1XJ6A 2A2LA 3VE3A 2QKPA 2KOIA 5L8MA 2W3DA 3B42A 1LSXA 3T50A 4ETZA 2W27A 2QHKA 4NKPA 3RTYA 1XFQA 1GSVA 1TF1A 2A24A 3T4QA 2JKRM 2VV7A 3IS2A 5HWVA 2ZMFA 4BJPA 1N9LA 4HY8A 3EQUA 1P9RA 5IT5A 3NOTC 3HJKA 3CUEC 5LBRA 4CQHA 3LIEA 5HPFA 2VA0A 1T1CA 2INWA 3LR3A 3T4TA 3VV4A 4WL9A 4AFIA 2PD8A 2O99A 4Q0JA 5EFWA 3MJQA 1IOUA 2OAQ1 4P6ZM 2K7SA 1UWNX 4G3KA 4Y5FA 4M4XA 3TRCA 3BY9A 2O9BA 4MCWA 3T4JA 2B18A 4HP4A 4JGOA 4JGQA 4WUJA 3ZYTA 1UGUA 5AVEA 3PBNA 4GHIA 5J3WA 3H7WB 3PYPA 1VB6A 3FPVA 4MMNA 3LICA 4O8GA 1F9IA 4WEKA 1W63M 3KSIA 3KX0X 4HP9A 3EWKA 4DJ2A 1LT0A 2ZMVA 1H8MA 3EGXC 3KYZA 1UWPX 2GJ3A 3IBJA 1YKDA 3HCYA 4LPZA 3UE6A 3HJIA 2HJ9C 4Y3IA 5C5KA 3PHYA 3BY8A 1S4RA 3F1OA 2CMNA 1EW0A 4CLCA 3K3DA 1G28A 4UQIM 3RFBA 3LUQA 3O5YA 3UMEA 2W1TA 3LFVA 3C38A 3P7NA 3PBSA 3LR5A 2XA7M 5TBMB 4PKYG 4MN6A 4R3AA 4JGPA 3K2NA 1T1BA 2L1MA 3ICYA 4UEYA 1D06A 3H9WA 2EWVA 2HGVA 4XT2A 3R7WA 1LL8A 3CI6A 2IA2A 5KIZA 3P01A 2B02A 2QWSA 3OLOA 2M1CA 5F69A 4L9EA 5F6AA 1Y28A 1H3QA 2FZ0A 2XRNA 3TW8A 1T18A 3CWFA 2Y8HA 3BW6A 3BQAA 2PDRA 3D3OA 1MZUA 4Q0IA 4I39A 2J80A 5IS1A 4LRZE 2OWHA 5KSHA 1XJ3A 3V67A 4BWIA 4O0PA 2VLGA 4L9FA 4GCZA 1DP8A 3PXPA 1TS6A 3T4SA 2KX6A 3UE3A 5AJGA 2GZAA 3LR4A 3F1NB 3JVVA 3H82A 4HH2A 4I3IA 3VE4A 2I9VA 3TJZC 4YOFA 2ZOHA 2K31A 3NHQA 2H28A 4CLCE 4WF0A 1TS0A 2PR5A 2XROA 2W1RA 1TS8A 3E98A 3KYQA 5G4YA 5HDCA 1XJ2A 3F1PA 2LB9A 1OPXA 1WA9A 1LSVA 2QJ7A 2KLIA 5FL3A 3LIBA 1XJ4A 2V0UA 2V1BA 2P08A 3W2ZA 5HZHA 4Y2FA 1G6OA 5DJTA 3C8CA 2A24B 4GS9A 4EESA 4EU0A 3EOIA 4QPRA 3C30A 1MKMA 1NLYA 3IS2B 3OCNA 2W3EA 3R4KA 4BMWA 5HWWA 4NXFA 3CLOA 2MJ6A 4YNRA 2J3TD 5F68A 5HD3A 4HHDA 5DKLA 4PKYA 3UB9A 5DJUA 3H7WA 1DP6A 4Z1WA 1YSPA 3NOPC 1N9NA 4I38A 4NEED 2VKSA 3JVUA 3UMDA 2W3FA 4OOLA 3LYXA 4EERA 2O9AA 3NOUC 5DFXA 4IJGA 1N9OA 3SW1A 3BJNA 4MDZA 3A0SA 3LI8A 4WLAA 4GHIB 4WN5A 2Z6CA 4F3LA 1P9WA 2GX5A 4R38A 1P0ZA 3KSGA 5TJJA 3A0RA 2VV8A 4HQAA 1DP9A 4JGRA 4WEJA 1GSWA 3MR0A 3D72A 3NJAA 3S7PA 3VOLA 2QYBA 3LI9A 2L0WA 1XFNA 1OTAA 2R78A 3K3CA 4BBUA 2HF6A 1W63Q 2JKTI 4GLQA 4K08A 5A8BA 3F1OB 4NXBA 2VGLS 3PBTA 4CLCB 2D01A 4KQOA 4R70A 4ME4A 4L0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBV A;  1KOU A;  4LRX C;  3RH8 B;  2PYP A;  5I5L A;  3FG8 A;  4XT2 B;  4H6J A;  3UB7 A;  3E4Q A;  4HJ4 A;  4LRY C;  2ZOI A;  3MFX A;  4L9G A;  4EXO A;  1S1Z A;  5IU1 A;  4B9O A;  4I3A A;  3ZQ5 A;  1OT6 A;  4EET B;  1OTI A;  5HDD A;  2KDK A;  1OTD A;  3UB6 A;  1OTB A;  2BAS A;  5J7E A;  1F98 A;  3G6O A;  1V9Y A;  2V9A A;  3LID A;  3MQO A;  3MQQ A;  2V1A A;  2JN7 A;  4HJ3 A;  2PHY A;  2PYR A;  3ULF A;  1DRM A;  3H82 B;  4NXE A;  3EEH A;  3FC7 A;  1S66 L;  1P97 A;  4EW7 A;  1OJ5 A;  3F1P B;  2OWJ A;  4GW9 A;  4BBT A;  4HOI A;  1S1Y A;  2YKH A;  3MXQ A;  3E4O A;  4GS9 B;  5F5Y A;  2L4R A;  3IBR A;  1NWZ A;  2PR6 A;  3LIA A;  4KQD A;  1OT9 A;  4HNB A;  1S4S A;  3CAX A;  2EA9 A;  1ODV A;  2JHE A;  2WKQ A;  4EQ1 A;  4YWZ A;  2W0N A;  2P7J A;  3LIF A;  5HDS A;  2PD7 A;  2ZBB A;  3UB8 A;  1D7E A;  1OJG A;  3BWL A;  1X0O A;  2HV1 A;  1BYW A;  1S67 L;  4KUO A;  2VV6 A;  2QJ5 A;  5TBM A;  4NXG A;  4F3L B;  3GEC A;  2WKR A;  4RQ9 A;  4KUK A;  5AVF A;  4HIA A;  4LLO B;  5HSQ A;  5HD5 A;  2OOL A;  5HWT A;  4DJ3 A;  4E04 A;  4HH3 A;  3E4P A;  4HJ6 A;  1TS7 A;  3B33 A;  4I5S A;  1LSW A;  3A0V A;  3GDI A;  1V9Z A;  1JNU A;  3F1N A;  2YKF A;  4I3J A;  3C2W A;  5DKK A;  2Z6D A;  4HI4 A;  1GSX A;  4EEU A;  5J4E A;  1OTE A;  4H6J B;  1T1A A;  4R6L A;  5G4Z A;  4MN5 A;  1T19 A;  4EEP A;  2D02 A;  2WKP A;  2V0W A;  2VEA A;  1XJ6 A;  3VE3 A;  2QKP A;  1LSX A;  3T50 A;  2W27 A;  2QHK A;  3RTY A;  1XFQ A;  2A24 A;  1GSV A;  2VV7 A;  3IS2 A;  5HWV A;  1N9L A;  4HY8 A;  3NOT C;  3HJK A;  3LIE A;  1T1C A;  2INW A;  4WL9 A;  2PD8 A;  5EFW A;  3MJQ A;  2K7S A;  1UWN X;  4M4X A;  3BY9 A;  4HP4 A;  4JGO A;  4JGQ A;  4WUJ A;  1UGU A;  5AVE A;  4GHI A;  5J3W A;  3H7W B;  3PYP A;  1VB6 A;  3LIC A;  1F9I A;  3KX0 X;  4HP9 A;  3EWK A;  4DJ2 A;  1LT0 A;  1UWP X;  2GJ3 A;  3UE6 A;  4LPZ A;  3HJI A;  3PHY A;  3BY8 A;  1S4R A;  3F1O A;  2CMN A;  1EW0 A;  3K3D A;  1G28 A;  3LUQ A;  3UME A;  3P7N A;  5TBM B;  4PKY G;  4MN6 A;  4R3A A;  4JGP A;  1T1B A;  2L1M A;  3ICY A;  1D06 A;  3H9W A;  4XT2 A;  1LL8 A;  5KIZ A;  2B02 A;  2QWS A;  3OLO A;  2M1C A;  5F69 A;  4L9E A;  5F6A A;  1Y28 A;  1T18 A;  3CWF A;  2PDR A;  1MZU A;  4I39 A;  2J80 A;  5IS1 A;  4LRZ E;  2OWH A;  1XJ3 A;  2VLG A;  4L9F A;  4GCZ A;  1DP8 A;  1TS6 A;  2KX6 A;  3F1N B;  3H82 A;  4HH2 A;  4I3I A;  3VE4 A;  2I9V A;  2ZOH A;  3NHQ A;  2H28 A;  4WF0 A;  1TS0 A;  2PR5 A;  1TS8 A;  5G4Y A;  5HDC A;  1XJ2 A;  3F1P A;  1WA9 A;  1LSV A;  2QJ7 A;  3LIB A;  1XJ4 A;  2V0U A;  2V1B A;  5HZH A;  5DJT A;  3C8C A;  2A24 B;  4GS9 A;  4EES A;  3IS2 B;  5HWW A;  4NXF A;  3CLO A;  5F68 A;  5HD3 A;  4HHD A;  5DKL A;  4PKY A;  3UB9 A;  5DJU A;  3H7W A;  1DP6 A;  3NOP C;  1N9N A;  4I38 A;  3UMD A;  3LYX A;  4EER A;  3NOU C;  1N9O A;  3SW1 A;  3A0S A;  3LI8 A;  4WLA A;  4GHI B;  4WN5 A;  2Z6C A;  4F3L A;  4R38 A;  1P0Z A;  3A0R A;  2VV8 A;  4HQA A;  1DP9 A;  4JGR A;  1GSW A;  3MR0 A;  3D72 A;  3NJA A;  3VOL A;  3LI9 A;  2L0W A;  1XFN A;  1OTA A;  2R78 A;  3K3C A;  4BBU A;  4K08 A;  5A8B A;  3F1O B;  4NXB A;  2D01 A;  4R70 A; 
#chains in the Genus database with same CATH topology
 2W1T B;  1FSY A;  4RA7 A;  3FKW A;  5HPI A;  3EGD C;  5I5L A;  2XD5 A;  3MS6 A;  4XT2 B;  2HDQ A;  3R7W B;  4N92 A;  5HX9 A;  4II7 A;  4I3A A;  4FOF A;  2XR0 A;  2ZQ7 A;  4LV1 A;  2Y2H A;  3IXB A;  4K0W A;  1K25 A;  4DMZ A;  4EET B;  2RL3 A;  1OTI A;  3HRE A;  2ZD8 A;  3QP6 A;  4C3Q A;  2V8C A;  2FH5 A;  3IWQ A;  1MC0 A;  1PNE A;  4S2L A;  2PRF A;  3MQO A;  3IF6 C;  4ZJ2 A;  2RCX A;  4HJ3 A;  4XUX A;  3H82 B;  5FA7 A;  2VZW A;  3HUO A;  1CI9 A;  5FEG A;  4KG5 A;  3WS0 A;  4MN7 A;  3EQV A;  4IHQ A;  4FH2 A;  3ZVT A;  4EW7 A;  1OJ5 A;  2XA7 S;  4X1M A;  1Z6F A;  4ID4 A;  4D60 A;  2OWJ A;  1CK3 A;  4GW9 A;  2GNX A;  3DTE A;  2VGL M;  3VP3 A;  1K56 A;  4MEZ A;  3BEC A;  1S1Y A;  2W3H A;  1IYQ A;  2YKH A;  3PBQ A;  4IED A;  2HJE A;  3Q7V A;  1L2S A;  1RP5 A;  3Q7Z A;  1NYM A;  4DE3 A;  4GS9 B;  3O88 A;  2WGW B;  2PR6 A;  1STZ A;  2B5R A;  1M40 A;  3FPW A;  4NK3 A;  2EA9 A;  3V5M A;  4R3J A;  4X53 A;  2P04 A;  2Y2P A;  1K38 A;  3HLF A;  1MWU A;  3P09 A;  3MQ0 A;  4GD8 A;  2OLU A;  4PM8 A;  4PM7 A;  1J9M A;  2BG1 A;  2EFU A;  5U47 A;  5JYO A;  2CC1 A;  3U2A A;  3WS1 A;  4LV0 A;  1BYW A;  3VP2 A;  2A49 A;  2QJ5 A;  5HAR A;  3OBF A;  3OCL A;  2JKT M;  5EUA A;  5AVF A;  1HLU P;  1E3U D;  4ETX A;  4G3W A;  1ONG A;  5HSQ A;  1VHM A;  2WYX A;  2HP6 A;  5MC7 A;  5DTK A;  2Y2K A;  3BM6 A;  2XSS A;  4E04 A;  4HJ6 A;  1TS7 A;  3VSL A;  1LSW A;  2OLV A;  3AGE A;  4JF5 A;  3KO6 A;  5FQK A;  4OPZ A;  4R0Q A;  1PI4 A;  3IQA A;  4X56 A;  4N1X A;  2D02 A;  2XFS A;  3DTK A;  4IBX A;  5CGW A;  3VE3 A;  2QKP A;  4ZJ3 A;  4C6Y A;  3B42 A;  3MZE A;  4LGW A;  4FTX A;  2QHK A;  5FDS A;  1TEM A;  4NKP A;  1KVL A;  4QB8 A;  4M3K A;  4R4S A;  2A24 A;  4O7D A;  3T4Q A;  2VV7 A;  3IS2 A;  5HWV A;  2ZMF A;  3IX4 A;  3G4P A;  1I2S A;  4CQH A;  4KZ9 A;  2VA0 A;  1T1C A;  3LR3 A;  4AFI A;  2DNS A;  3MJQ A;  2EXA A;  2WGV A;  5FAS A;  2OAQ 1;  3CHW P;  1UWN X;  2G2U A;  4G3K A;  1ES2 A;  4Y5F A;  2HDU A;  5M18 A;  4OKP A;  5FAQ A;  4JGQ A;  5AQ9 A;  4HEF A;  3PBN A;  5AQB A;  3FPV A;  4MMN A;  4QY5 A;  3NY4 A;  3LIC A;  1ZG4 A;  4WEK A;  4HP9 A;  1HZO A;  1LT0 A;  4Y15 A;  3HLW A;  1KGE A;  4Y3I A;  1Z09 A;  3PHY A;  4QHC A;  3V39 A;  1EW0 A;  3CJM A;  3S1Y A;  4CLC A;  5GL9 A;  3RFB A;  2C5W B;  3D4F A;  3GTC A;  3LR5 A;  1YT4 A;  2XA7 M;  4Y17 A;  4PKY G;  4JGP A;  3VP0 A;  1YLZ A;  2HGV A;  5GHX A;  1PWC A;  2HZ5 A;  2XD1 A;  1JVJ A;  3CI6 A;  4WZ5 A;  3UY6 A;  2ZL1 B;  2QWS A;  2IWD A;  3A3I A;  2M1C A;  4E6X A;  2Y2J A;  5F6A A;  2FZ0 A;  2Y8H A;  1XGJ A;  3ZG5 A;  4RX3 A;  5EV0 A;  2J80 A;  5IS1 A;  3IH8 A;  4DF6 A;  2DRW A;  2VLG A;  4L9F A;  2XF3 A;  3OPH A;  1DP8 A;  2KX6 A;  2WKE A;  2GZA A;  3HLD A;  5EVI D;  3UNW A;  3JVV A;  4WBG A;  3VE4 A;  5DF8 A;  2ZOH A;  1C3B A;  5KZH A;  3NHQ A;  1Y54 A;  3C7U A;  4WF0 A;  5GLC A;  2W1R A;  4OPQ A;  5EOE A;  5G4Y A;  3E98 A;  5HDC A;  1N9B A;  3C4P A;  3F1P A;  5A92 A;  1WA9 A;  1LSV A;  2QJ7 A;  4OPR A;  1W8Q A;  4B88 A;  5L2F A;  2Z2L B;  3DAV A;  3E2K A;  3VSK A;  3W2Z A;  4Y2F A;  1YM1 A;  2EFX A;  4E3K A;  2A24 B;  1H8Z A;  3IS2 B;  3OCN A;  2W3E A;  4NXF A;  3NI9 A;  2MJ6 A;  5BOH A;  5EE8 A;  3NUL A;  3M2K A;  4HHD A;  4X55 A;  1DP6 A;  3NOP C;  4PMA A;  1K6R A;  3SS4 A;  3SH7 A;  5FAO A;  4NEE D;  4OOL A;  4GDB A;  2Y91 A;  2ZM8 A;  2ZQD A;  1WYC A;  4MDZ A;  4UAA A;  5F1G A;  1YMS A;  5CTN A;  5TR7 A;  4OQG A;  3IT9 A;  4WN5 A;  2JC7 A;  3Q07 A;  1P0Z A;  3KSG A;  3IHB A;  1ES5 A;  1O7E A;  1DP9 A;  4JGR A;  4Q8I A;  5EEC A;  1GSW A;  3D72 A;  2L0W A;  2HDS A;  4WYY A;  3K3C A;  4BBU A;  3QP8 A;  3VFH A;  5CHU A;  4F94 A;  2VGL S;  3PBT A;  4CLC B;  3UPO A;  1E4D A;  1L0G A;  3RXX A;  4EBN A;  5HL1 A;  4Y0T A;  4GOG A;  4Y0U A;  2ZMA A;  1KOU A;  3OC2 A;  3RH8 B;  5DFY A;  3HBR A;  1AXB A;  2P74 A;  4DDY A;  1IYP A;  3FZC A;  4IUH A;  3E4Q A;  3W4O A;  2OAP 1;  3OPP A;  4ZBE A;  4B9O A;  2EX8 A;  1GHI A;  4OLG A;  1CF0 A;  2O0Y A;  5DF9 A;  5M19 A;  3RJU A;  1ERO A;  1OT6 A;  3CZD A;  2C6W B;  1LLB A;  1MBL A;  3N8S A;  4ESP A;  2J8Y A;  4PAU A;  1OTD A;  3C4O A;  1J3W A;  3G35 A;  1OTB A;  5CRF A;  4OOY A;  2BLS A;  5J7E A;  5FI2 A;  2X01 A;  4KG6 A;  1KGF A;  4OOM A;  3AGF A;  4N1H A;  4LV2 A;  4XUZ A;  3BFE A;  1ERM A;  4CPK A;  4NXE A;  3EEH A;  4UQI S;  4S2O A;  5DF7 A;  1K57 A;  2Y79 A;  1P97 A;  5HAQ A;  1CEG A;  3MKE A;  2JKR I;  3ITB A;  1CI8 A;  3UPN A;  2VJW A;  3F1P B;  3E2L A;  3HLG A;  1MWT A;  5FDH A;  1YAX A;  3T4K A;  1NY0 A;  5J8X A;  4MLL A;  4S2M A;  4GJ4 A;  2Q0O A;  2ZM2 A;  4DN0 A;  2XH9 A;  1HD8 A;  1NWZ A;  3EEA A;  3QNC A;  3T4L A;  2E8J A;  1K55 C;  3PBO A;  4DE1 A;  5FQQ A;  1Q2Q A;  1SKF A;  2Y59 A;  1Y4O A;  4B93 A;  2WKQ A;  3MXR A;  2QZ6 A;  2M7U A;  2P7J A;  4FSF A;  2PD7 A;  3UB8 A;  2XQZ A;  1D7E A;  2XK1 A;  4G3V A;  2Z2M B;  1NLZ A;  1X0O A;  2J9O A;  2HPB A;  5I94 A;  4NXG A;  1LHY A;  1CQA A;  4ZRR A;  1FIK A;  3KSH A;  4RQ9 A;  4KUK A;  4HIA A;  4LLO B;  2G2W A;  1LI0 A;  3ISG A;  5HD5 A;  4LV3 A;  2OOL A;  3UDF A;  5HWT A;  4PM5 A;  1IKG A;  1YMX A;  1K56 D;  1MY8 A;  3E4P A;  1PW8 A;  3KSF A;  3FWL A;  2WAF A;  3LEQ A;  1BT5 A;  3T4O A;  1YLY A;  1PRQ A;  3LR0 A;  2FFY A;  1FQG A;  5CTM A;  4Q0H A;  3LY4 A;  2Y2N A;  4I3J A;  3C2W A;  2Z6D A;  4B4Z A;  5GHZ A;  1YLP A;  1T1A A;  2LB5 A;  4R6L A;  3GSG A;  1XA1 A;  5G4Z A;  1XKZ A;  3CG5 A;  1PWG A;  2V2F F;  1W7F A;  1SZV A;  2KOI A;  3HL9 A;  2W3D A;  1LSX A;  2B95 A;  5A91 A;  4RVA A;  1SKO A;  3QP5 A;  4KZ3 A;  3UN7 A;  2JKR M;  1HVB A;  5DTT A;  3ZVW A;  4UHU A;  3BLS A;  3MZF A;  1N9L A;  3HJK A;  5LBR A;  3DWK A;  4WL9 A;  2O99 A;  4DXB A;  1IOU A;  3DW0 A;  2K7S A;  4LCM A;  2EX9 A;  1PIO A;  2O9B A;  3T4J A;  3IXD A;  1I2W A;  3QHY A;  4JGO A;  1UGU A;  4GHI A;  3H7W B;  4UA9 A;  1VB6 A;  2XDM A;  4S2N A;  3GRJ A;  2GDN A;  4UA6 A;  1EWZ A;  1G6A A;  2ZC7 A;  2WKI A;  3UDI A;  2ZMV A;  1H8M A;  3N8L A;  3IBJ A;  3MBZ A;  1YKD A;  2UWX A;  3HCY A;  4LPZ A;  3HJI A;  2OSU A;  4U0X A;  3OPL A;  1SHV A;  1NYY A;  3BY8 A;  3JYI A;  2CMN A;  1TVF A;  1AWI A;  4FH4 A;  1G28 A;  1NZU A;  3GVB A;  4UQI M;  4PM6 A;  2AVX A;  3O5Y A;  3QNB A;  4JXS A;  4X1L A;  1ERQ A;  3P7N A;  5KSC A;  1IYO A;  4MN6 A;  3K2N A;  4NET A;  3ICY A;  1BLP A;  3H9W A;  5AQ7 A;  4UA7 A;  5CEB A;  2X71 A;  1YPR A;  3P01 A;  3HLE A;  5F69 A;  4L9E A;  3NDE A;  3BW6 A;  4X6T A;  4K91 A;  4R4R A;  4GKU A;  3UB5 P;  4IBR A;  2OWH A;  5A90 A;  4S2P A;  3VP4 A;  4BWI A;  1PWD A;  4GCZ A;  1TS6 A;  3LCE A;  4R3B A;  1ALQ A;  1JWP A;  3UE3 A;  3LR4 A;  5FAT A;  3RXW A;  4HH2 A;  4I3I A;  3TJZ C;  4Y13 A;  2K31 A;  1FCM A;  3CMZ A;  4WM9 A;  3Q81 A;  4E3I A;  2P9V A;  4CLC E;  2PR5 A;  3HUN A;  4OQI A;  1XX2 A;  3SS3 A;  3KYQ A;  3TSG A;  1ONH A;  1XJ2 A;  1OPX A;  1DJA A;  2BTF P;  2JKF A;  1LI9 A;  3LIB A;  2V0U A;  2EXB A;  4IVI A;  5HZH A;  3ZG9 B;  1G6O A;  1SKO B;  1IEM A;  4HBU A;  5HAI A;  1BUE A;  3EOI A;  4QPR A;  3C30 A;  1LL5 A;  1MKM A;  1NLY A;  3G31 A;  2JBF A;  5HWW A;  1PYY A;  2FFF B;  3ZFZ A;  3ZDJ A;  3BLM A;  3Q7V B;  4RYE A;  1FR6 A;  4S2K A;  4DE0 A;  3UB9 A;  4QWO A;  5DJU A;  4QJG A;  1N9N A;  1DJB A;  4I38 A;  2VKS A;  3GQZ A;  5E2E A;  2O9A A;  1BTL A;  2EX2 A;  3SW1 A;  1PZO A;  3LI8 A;  4GDN A;  4WLA A;  5CXW A;  1SDN A;  1K0K A;  4GHI B;  1L0E A;  4GD6 A;  5EVL A;  4LFU A;  4R38 A;  5DVA A;  2V20 A;  5E43 A;  2WK0 A;  4HQA A;  4RX2 A;  3IH9 A;  4DE2 A;  3NJA A;  3S7P A;  3VOL A;  1XFN A;  1OTA A;  2R78 A;  1YLJ A;  4D2O A;  1XXM A;  5A8B A;  2H0Y A;  4NXB A;  3WS4 A;  4BBV A;  1O07 A;  1BLC A;  4ARZ A;  4S2I A;  3C7V A;  3B3X A;  2PYP A;  4CLC C;  3BFF A;  1KDW A;  3GR2 A;  4FCF A;  4GZB A;  2ZOI A;  3MFX A;  2X02 A;  5FI7 A;  4IUK A;  4NG2 A;  3M2J A;  1S0W A;  3ZQ5 A;  2XFT A;  5EPH A;  2DMW A;  3CUE A;  4KQR A;  1RGZ A;  5HDD A;  2KDK A;  4WZ5 C;  4MNR A;  1QMF A;  3UB6 A;  1F98 A;  3G6O A;  4P87 A;  1V9Y A;  2V9A A;  3LID A;  3NDG A;  4KZ4 A;  2PT7 A;  3C5A A;  1DRM A;  2HDR A;  1K6S A;  5CHM A;  1JWV A;  1L0D A;  3A3F A;  3FC7 A;  3S7O A;  2EWW A;  2P9V B;  3V3R A;  3DBA A;  1KE3 A;  3U4L P;  3WS2 A;  4JXV A;  3TE8 A;  4GB7 A;  5FQJ A;  1GHM A;  3CPT A;  4HOI A;  5K5B A;  4O01 A;  3MXQ A;  1M6K A;  3UO9 A;  5F5Y A;  4XXR A;  2L4R A;  5F82 A;  1YQS A;  3G32 A;  4KQD A;  1OT9 A;  2NUT C;  4JXW A;  2O9C A;  1ESU A;  3FV7 A;  1ES3 A;  2ZBB A;  4EBL A;  2R9X A;  1IYS A;  1OJG A;  5EM0 A;  5EVI A;  4EBP A;  4OQ0 A;  4EV4 A;  2WUQ A;  4KUO A;  3G30 A;  3IF5 A;  5TBM A;  2XEP A;  1JTG A;  3V3S A;  2NUP C;  2WKR A;  4OP8 A;  4X25 A;  4JLF A;  2XLN A;  4OQH A;  3S7N A;  3IWI A;  2K2N A;  4HH3 A;  4CJN A;  1HTZ A;  1K54 C;  1XP4 A;  3T1S A;  2M7V A;  3PR6 A;  4KQQ A;  2ZLY A;  1W79 A;  2J7V A;  5L07 A;  4E3L A;  3ITA A;  3D9Y A;  3A0V A;  5GLB A;  4EUV A;  4P6B A;  3GDI A;  3OZH A;  4LEN A;  3B47 A;  2JCH A;  4ARZ B;  3F1N A;  1MXO A;  2YKF A;  4KZA A;  4HI4 A;  1GSX A;  2ACG A;  5HFO A;  5J4E A;  3MMH A;  1ES4 A;  1ZHH B;  3S7Q A;  1GCE A;  4DXC A;  4QY6 A;  1T19 A;  5CX7 A;  2WKP A;  4C75 A;  2V0W A;  2V8F A;  3PBR A;  2Y4A A;  2VEA A;  1XJ6 A;  4S2J A;  5L8M A;  1MKI A;  3T50 A;  4ETZ A;  2ZQ9 A;  2J9P A;  4E3M A;  3ZG0 A;  2WAE A;  1XFQ A;  3DTI A;  3GMW A;  4E3O A;  5GLD A;  3T12 B;  3TG9 A;  4JF4 A;  4MBH A;  1VET A;  3EQU A;  3BFC A;  3NOT C;  2VK3 A;  3M6B A;  3LIE A;  3SOI A;  4P0M A;  4BEN A;  3W4P A;  2I72 A;  1GA0 A;  3HLC A;  2PD8 A;  4K0X A;  4Q0J A;  3G2Y A;  4WZ4 A;  4P6Z M;  5L09 A;  4M4X A;  3HLB A;  3TRC A;  2R9W A;  3BY9 A;  1I5Q A;  4E3N A;  1H0M A;  4MCW A;  4ZTK A;  2B18 A;  3ZG7 B;  1K57 C;  5AVE A;  2WAD A;  4O8G A;  4OH0 A;  1W63 M;  3VP1 A;  3KSI A;  3EWK A;  5CGS A;  4DJ2 A;  3EGX C;  1UWP X;  2GJ3 A;  3UE6 A;  3ZCZ A;  2HJ9 C;  1WE4 A;  2Y55 A;  5C5K A;  2V1Z A;  1S4R A;  3G2Z A;  4BLM A;  4MBF A;  5EVI B;  3LUQ A;  1ZKJ A;  4JPM A;  1TDG A;  3LFV A;  3C38 A;  1YLT A;  5TBM B;  4R3A A;  2L1M A;  4UEY A;  1S6R A;  2EWV A;  3VOZ A;  3T1Q B;  1BLS A;  2Q9M A;  5KIZ A;  1XA7 A;  2B02 A;  4Y0O A;  3V50 A;  3OLO A;  1H3Q A;  2XRN A;  4ZJ1 A;  3TW8 A;  3FKV A;  3CWF A;  3IF6 A;  1RCJ A;  4KZB A;  2JE5 A;  1MZU A;  4Q0I A;  1ESI A;  4X69 A;  1NJ4 A;  1XJ3 A;  3N4I A;  5E2G A;  4WMC A;  3IXG A;  3QP2 A;  2ZJ9 A;  3LEZ A;  4EQI A;  1FCN A;  1BZA A;  3F1N B;  4DDS A;  1EI5 A;  4YOF A;  3BFD A;  2WGI A;  5E2H A;  1JTD A;  2XRO A;  4BL3 A;  3OPR A;  4GN2 A;  2LB9 A;  3WWX A;  1DJC A;  3GV9 A;  1VQQ A;  4KZ5 A;  3PTE A;  3S22 A;  1XJ4 A;  1FCO A;  4QD4 A;  4LCL A;  1H5X A;  4GNU A;  5DJT A;  3C8C A;  3W8K A;  4EES A;  2HP9 A;  3A3E A;  4FD8 A;  2DCF A;  4U3T A;  1VET B;  3CLO A;  4YNR A;  5EVE A;  2J3T D;  5F68 A;  3ZG8 B;  5HD3 A;  5DKL A;  1VM1 A;  4KG2 A;  2ZQ8 A;  5CGX A;  5CEC A;  3UMD A;  4EER A;  5FAP A;  3NOU C;  5DFX A;  3A0S A;  4F3L A;  1GHP A;  1KE4 A;  1PI5 A;  2GX5 A;  4Y7P A;  1PFL A;  4BQM A;  3O3V A;  3QP1 A;  1F2K A;  1W8Y A;  3LI9 A;  3HUM A;  4KEN B;  4S2N C;  3IHA A;  5TFQ A;  4K08 A;  3VMA A;  2D01 A;  2ZL1 A;  4ME4 A;  4R70 A;  2WZX A;  2J3W A;  4OON A;  5CED A;  3MF0 A;  4LRX C;  2Y2O A;  1JWZ A;  4HES A;  3S4X A;  1SDE A;  3FG8 A;  1N4O A;  2IWB A;  4H6J A;  2A3U A;  3UB7 A;  1VEU A;  4HJ4 A;  4LRY C;  4L9G A;  2ZQA A;  2PBD P;  4EXO A;  3A3D A;  1S1Z A;  5IU1 A;  1PZP A;  4ZAM A;  5F83 A;  1KDS A;  2ZQC A;  3IF6 B;  2ZC6 B;  1ZC2 A;  1ACF A;  4PHT A;  2BAS A;  2J3T C;  3MFD A;  2VX8 A;  2EX6 A;  3MQQ A;  4CLC D;  1KVM A;  2V1A A;  1PW1 A;  2JN7 A;  3NEC A;  2PHY A;  3IWO A;  4BD1 A;  2PYR A;  3ULF A;  1RGY A;  4OP5 A;  1NXY A;  5F1F A;  3MSH A;  2Y2G A;  3WRZ A;  1NZO A;  1E3U A;  1S66 L;  1OME A;  4IVK A;  5FI6 A;  1G68 A;  1IFQ A;  1NRJ A;  4BBT A;  1F5M A;  2G7U A;  4R1G A;  3TOI A;  1WYB A;  2VGK A;  4EWF A;  3E4O A;  3BQ8 A;  3A3J A;  3UDX A;  4BD0 A;  3IBR A;  3LIA A;  1MPL A;  4HNB A;  1Q2P A;  4P85 A;  1S4S A;  1FSW A;  3CAX A;  4JBF A;  1ODV A;  2JHE A;  1SCW A;  4EQ1 A;  4YWZ A;  2W0N A;  2ZC3 B;  1QME A;  1FR1 A;  3LIF A;  3G34 A;  2ZM0 A;  4H8R A;  5HDS A;  2WKH A;  4KZ8 A;  3SS5 A;  3WS5 A;  3NC8 A;  2HP5 A;  5HW3 A;  3JPU A;  3BWL A;  2HV1 A;  1D1J A;  3Q82 A;  1S67 L;  1XGI A;  1TD5 A;  2VV6 A;  3SH9 A;  4EUZ A;  1H8Y A;  4F3L B;  3GEC A;  2H10 A;  4E6W A;  3PAG A;  5D3O A;  2W3G A;  3O87 A;  4HBT A;  1ZTU A;  3HVF A;  2PBY A;  4DJ3 A;  5HL6 A;  4KZ7 A;  4P6Z S;  4PPR A;  4FUW A;  1G5U A;  3B33 A;  4R23 A;  4BL2 A;  4I5S A;  2PU4 A;  4WEL A;  2H5S A;  5CER A;  1V9Z A;  1JNU A;  5DKK A;  4A5R A;  3E0Y A;  5JYP A;  4EEU A;  1OTE A;  3I7J A;  4H6J B;  1L3L A;  1BLH A;  1BSG A;  3IXH A;  5FEF A;  1VEU B;  4MN5 A;  3OOV A;  4EEP A;  1YSQ A;  3NBL A;  3CIT A;  2ZC4 B;  2Y2I A;  3WRT A;  2A2L A;  2QMI A;  4QU3 A;  1FIL A;  3LGO A;  2W27 A;  3QP4 A;  4Z9Q A;  3NIA A;  5G18 A;  3RTY A;  4U0T A;  3W4Q A;  1GSV A;  1TF1 A;  3N6I A;  1A0K A;  4YFM A;  4JKT A;  1ZG6 A;  1W5D A;  4BJP A;  4HY8 A;  3ZHH A;  1P9R A;  5IT5 A;  1MWS A;  3SZT A;  3CUE C;  5HPF A;  5FSR A;  2INW A;  3T4T A;  3VV4 A;  4N9K A;  1K4F A;  3LY3 A;  5EFW A;  2WZZ A;  1BUL A;  3M6H A;  2ZC5 B;  5FQM A;  1IEL A;  4YIN A;  4JF6 A;  5DTS A;  3BEB A;  4HP4 A;  3O86 A;  4WUJ A;  3ZYT A;  3P98 A;  5EOO A;  5J3W A;  3DTM A;  3IX8 A;  3PYP A;  5EM1 A;  4E3J A;  3ZNT A;  4KZ6 A;  1F9I A;  2PAV P;  4B4X A;  3T1X A;  3KX0 X;  5GHY A;  3LO7 A;  3KYZ A;  2PU2 A;  3UE0 A;  5GLA A;  2E8I A;  3ZNY A;  3F1O A;  1CJF A;  1MWR A;  4JXG A;  3K3D A;  1K54 A;  4N9L A;  3UME A;  2W1T A;  3PBS A;  3VFF A;  1L0F A;  4OVD A;  2Y2Q A;  4DRT A;  1T1B A;  1D06 A;  4XT2 A;  5E2F A;  5CHJ A;  5IHV A;  3R7W A;  1LL8 A;  5EVI C;  2IA2 A;  2QPN A;  1Y28 A;  1E25 A;  3SH8 A;  1T18 A;  5M1A A;  3BQA A;  2PDR A;  4DKI A;  2Q9N A;  3D3O A;  3L7H A;  4I39 A;  3T1R A;  3MZD A;  4LRZ E;  5KSH A;  1FOF A;  3V67 A;  4MBK A;  4O0P A;  3BRM A;  3PXP A;  2JKG A;  3T4S A;  2IWC A;  5AJG A;  3H82 A;  2I9V A;  1IKI A;  2H28 A;  1TS0 A;  1U60 A;  3BFG A;  3VOY A;  1TS8 A;  4PM9 A;  5A93 A;  4OPY A;  4X68 A;  1KE0 A;  2KLI A;  1CEF A;  1LL9 A;  5FL3 A;  1K55 A;  2V1B A;  2XGN A;  2P08 A;  5HAP A;  3MXS A;  5KMW A;  4GS9 A;  4EU0 A;  2WGW A;  3R4K A;  1KGG A;  4BMW A;  5AQA A;  3CPT B;  3FYZ A;  3IX3 A;  2OV5 A;  1YLW A;  3NCK A;  3ZGA B;  4PKY A;  1DY6 A;  4Z1W A;  3H7W A;  1YSP A;  5TGF A;  3UPP A;  3Q1F A;  2UV0 E;  2H0T A;  3DWZ A;  1GA9 A;  3JVU A;  2W3F A;  3LYX A;  3N8R A;  4IJG A;  2Y2L A;  4ZDX A;  1N9O A;  4WMC D;  3UE1 A;  3BJN A;  1K4E A;  3MKF A;  5FQI A;  5L10 A;  2Z6C A;  1P9W A;  1TDL A;  2Y2M A;  2VGJ A;  5FQ9 A;  1XPB A;  3KYE A;  5TJJ A;  3L9K A;  3A0R A;  2VV8 A;  4WEJ A;  3MR0 A;  1NRF A;  3AGD A;  2QYB A;  3PAE A;  3BYD A;  3N7W A;  2HF6 A;  1W63 Q;  2JKT I;  4GLQ A;  4OLD A;  3F1O B;  4KQO A;  4L0L A; 
#chains in the Genus database with same CATH homology
 4BBV A;  2J3W A;  2W1T B;  3MF0 A;  1KOU A;  4LRX C;  4ARZ A;  3OC2 A;  3RH8 B;  5DFY A;  5HPI A;  3EGD C;  2PYP A;  5I5L A;  4CLC C;  3FG8 A;  4XT2 B;  4H6J A;  4IUH A;  3R7W B;  3UB7 A;  3E4Q A;  4HJ4 A;  4LRY C;  2OAP 1;  2ZOI A;  3MFX A;  4L9G A;  4II7 A;  4EXO A;  1S1Z A;  4IUK A;  5IU1 A;  4B9O A;  4I3A A;  4FOF A;  2O0Y A;  5DF9 A;  3ZQ5 A;  1OT6 A;  2DMW A;  4DMZ A;  4EET B;  1OTI A;  3CUE A;  4PAU A;  5HDD A;  2KDK A;  1OTD A;  3UB6 A;  4PHT A;  2FH5 A;  1OTB A;  2BAS A;  1MC0 A;  2J3T C;  5J7E A;  1F98 A;  3G6O A;  1V9Y A;  2V9A A;  2VX8 A;  3LID A;  3MQO A;  3MQQ A;  4CLC D;  4OOM A;  2V1A A;  2PT7 A;  2JN7 A;  4HJ3 A;  2PHY A;  2PYR A;  3ULF A;  1DRM A;  3H82 B;  2VZW A;  4NXE A;  3EEH A;  3FC7 A;  3S7O A;  4UQI S;  2EWW A;  4MN7 A;  3EQV A;  4IHQ A;  1S66 L;  2Y79 A;  1P97 A;  3DBA A;  4EW7 A;  2JKR I;  1OJ5 A;  2XA7 S;  3TE8 A;  1IFQ A;  1NRJ A;  2VJW A;  3F1P B;  2OWJ A;  4GW9 A;  2GNX A;  2VGL M;  4BBT A;  4HOI A;  1S1Y A;  1YAX A;  5K5B A;  3T4K A;  1F5M A;  2W3H A;  2G7U A;  2YKH A;  3PBQ A;  2HJE A;  4O01 A;  3MXQ A;  3E4O A;  3BQ8 A;  4GS9 B;  4GJ4 A;  5F5Y A;  4DN0 A;  2L4R A;  3IBR A;  1NWZ A;  2PR6 A;  3EEA A;  3T4L A;  3LIA A;  1STZ A;  3FPW A;  3PBO A;  4KQD A;  1OT9 A;  4HNB A;  2NUT C;  1S4S A;  3CAX A;  2EA9 A;  2O9C A;  1ODV A;  2JHE A;  2P04 A;  4B93 A;  2WKQ A;  4EQ1 A;  4YWZ A;  2W0N A;  2M7U A;  2P7J A;  3LIF A;  4FSF A;  5HDS A;  2PD7 A;  2ZBB A;  3UB8 A;  3MQ0 A;  1D7E A;  1OJG A;  4G3V A;  3BWL A;  1NLZ A;  1X0O A;  2HV1 A;  3U2A A;  1BYW A;  1S67 L;  4KUO A;  1TD5 A;  2VV6 A;  2QJ5 A;  5TBM A;  4NXG A;  3OBF A;  4F3L B;  3OCL A;  3GEC A;  2JKT M;  2WKR A;  2NUP C;  4ZRR A;  3KSH A;  4RQ9 A;  4KUK A;  5AVF A;  4HIA A;  4LLO B;  2W3G A;  4ETX A;  4G3W A;  5HSQ A;  5HD5 A;  1VHM A;  2OOL A;  3S7N A;  1ZTU A;  5HWT A;  5MC7 A;  4DJ3 A;  5HL6 A;  2K2N A;  2XSS A;  4E04 A;  4HH3 A;  3E4P A;  4P6Z S;  4HJ6 A;  1TS7 A;  3B33 A;  3KSF A;  4I5S A;  2M7V A;  1LSW A;  3PR6 A;  4WEL A;  3T4O A;  3LR0 A;  3A0V A;  3KO6 A;  4EUV A;  4Q0H A;  3GDI A;  3B47 A;  1V9Z A;  4ARZ B;  1JNU A;  3F1N A;  2YKF A;  4I3J A;  3C2W A;  5DKK A;  2Z6D A;  4HI4 A;  3E0Y A;  1GSX A;  4EEU A;  5J4E A;  3MMH A;  1OTE A;  4H6J B;  1ZHH B;  3S7Q A;  1T1A A;  2LB5 A;  4R6L A;  5G4Z A;  4MN5 A;  1T19 A;  3OOV A;  5CX7 A;  4EEP A;  2D02 A;  1YSQ A;  2WKP A;  2V0W A;  3PBR A;  3CIT A;  2VEA A;  1XJ6 A;  2A2L A;  3VE3 A;  2QKP A;  2KOI A;  5L8M A;  2W3D A;  3B42 A;  1LSX A;  3T50 A;  4ETZ A;  2W27 A;  2QHK A;  4NKP A;  3RTY A;  1XFQ A;  1GSV A;  1TF1 A;  2A24 A;  3T4Q A;  2JKR M;  2VV7 A;  3IS2 A;  5HWV A;  2ZMF A;  4BJP A;  1N9L A;  4HY8 A;  3EQU A;  1P9R A;  5IT5 A;  3NOT C;  3HJK A;  3CUE C;  5LBR A;  4CQH A;  3LIE A;  5HPF A;  2VA0 A;  1T1C A;  2INW A;  3LR3 A;  3T4T A;  3VV4 A;  4WL9 A;  4AFI A;  2PD8 A;  2O99 A;  4Q0J A;  5EFW A;  3MJQ A;  1IOU A;  2OAQ 1;  4P6Z M;  2K7S A;  1UWN X;  4G3K A;  4Y5F A;  4M4X A;  3TRC A;  3BY9 A;  2O9B A;  4MCW A;  3T4J A;  2B18 A;  4HP4 A;  4JGO A;  4JGQ A;  4WUJ A;  3ZYT A;  1UGU A;  5AVE A;  3PBN A;  4GHI A;  5J3W A;  3H7W B;  3PYP A;  1VB6 A;  3FPV A;  4MMN A;  3LIC A;  4O8G A;  1F9I A;  4WEK A;  1W63 M;  3KSI A;  3KX0 X;  4HP9 A;  3EWK A;  4DJ2 A;  1LT0 A;  2ZMV A;  1H8M A;  3EGX C;  3KYZ A;  1UWP X;  2GJ3 A;  3IBJ A;  1YKD A;  3HCY A;  4LPZ A;  3UE6 A;  3HJI A;  2HJ9 C;  4Y3I A;  5C5K A;  3PHY A;  3BY8 A;  1S4R A;  3F1O A;  2CMN A;  1EW0 A;  4CLC A;  3K3D A;  1G28 A;  4UQI M;  3RFB A;  3LUQ A;  3O5Y A;  3UME A;  2W1T A;  3LFV A;  3C38 A;  3P7N A;  3PBS A;  3LR5 A;  2XA7 M;  5TBM B;  4PKY G;  4MN6 A;  4R3A A;  4JGP A;  3K2N A;  1T1B A;  2L1M A;  3ICY A;  4UEY A;  1D06 A;  3H9W A;  2EWV A;  2HGV A;  4XT2 A;  3R7W A;  1LL8 A;  3CI6 A;  2IA2 A;  5KIZ A;  3P01 A;  2B02 A;  2QWS A;  3OLO A;  2M1C A;  5F69 A;  4L9E A;  5F6A A;  1Y28 A;  1H3Q A;  2FZ0 A;  2XRN A;  3TW8 A;  1T18 A;  3CWF A;  2Y8H A;  3BW6 A;  3BQA A;  2PDR A;  3D3O A;  1MZU A;  4Q0I A;  4I39 A;  2J80 A;  5IS1 A;  4LRZ E;  2OWH A;  5KSH A;  1XJ3 A;  3V67 A;  4BWI A;  4O0P A;  2VLG A;  4L9F A;  4GCZ A;  1DP8 A;  3PXP A;  1TS6 A;  3T4S A;  2KX6 A;  3UE3 A;  5AJG A;  2GZA A;  3LR4 A;  3F1N B;  3JVV A;  3H82 A;  4HH2 A;  4I3I A;  3VE4 A;  2I9V A;  3TJZ C;  4YOF A;  2ZOH A;  2K31 A;  3NHQ A;  2H28 A;  4CLC E;  4WF0 A;  1TS0 A;  2PR5 A;  2XRO A;  2W1R A;  1TS8 A;  3E98 A;  3KYQ A;  5G4Y A;  5HDC A;  1XJ2 A;  3F1P A;  2LB9 A;  1OPX A;  1WA9 A;  1LSV A;  2QJ7 A;  2KLI A;  5FL3 A;  3LIB A;  1XJ4 A;  2V0U A;  2V1B A;  2P08 A;  3W2Z A;  5HZH A;  4Y2F A;  1G6O A;  5DJT A;  3C8C A;  2A24 B;  4GS9 A;  4EES A;  4EU0 A;  3EOI A;  4QPR A;  3C30 A;  1MKM A;  1NLY A;  3IS2 B;  3OCN A;  2W3E A;  3R4K A;  4BMW A;  5HWW A;  4NXF A;  3CLO A;  2MJ6 A;  4YNR A;  2J3T D;  5F68 A;  5HD3 A;  4HHD A;  5DKL A;  4PKY A;  3UB9 A;  5DJU A;  3H7W A;  1DP6 A;  4Z1W A;  1YSP A;  3NOP C;  1N9N A;  4I38 A;  4NEE D;  2VKS A;  3JVU A;  3UMD A;  2W3F A;  4OOL A;  3LYX A;  4EER A;  2O9A A;  3NOU C;  5DFX A;  4IJG A;  1N9O A;  3SW1 A;  3BJN A;  4MDZ A;  3A0S A;  3LI8 A;  4WLA A;  4GHI B;  4WN5 A;  2Z6C A;  4F3L A;  1P9W A;  2GX5 A;  4R38 A;  1P0Z A;  3KSG A;  5TJJ A;  3A0R A;  2VV8 A;  4HQA A;  1DP9 A;  4JGR A;  4WEJ A;  1GSW A;  3MR0 A;  3D72 A;  3NJA A;  3S7P A;  3VOL A;  2QYB A;  3LI9 A;  2L0W A;  1XFN A;  1OTA A;  2R78 A;  3K3C A;  4BBU A;  2HF6 A;  1W63 Q;  2JKT I;  4GLQ A;  4K08 A;  5A8B A;  3F1O B;  4NXB A;  2VGL S;  3PBT A;  4CLC B;  2D01 A;  4KQO A;  4R70 A;  4ME4 A;  4L0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...