1S4RA

Structure of a reaction intermediate in the photocycle of pyp extracted by a svd-driven analysis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photoactive yellow protein
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4rA00
1D06A 2PHYA 2PDRA 5J7EA 3LIFA 4BBUA 4R6LA 1V9ZA 4HNBA 4EESA 4NXFA 4HHDA 5F5YA 2V9AA 2GJ3A 4WL9A 5TBMA 2KDKA 3NJAA 2PD8A 4HIAA 4DJ2A 1S1ZA 3ULFA 3LIEA 3UB9A 1T1BA 3RH8B 3MR0A 2HV1A 1BYWA 2A24A 2W0NA 3UB8A 4M4XA 3UE6A 1UWNX 1F9IA 3H82B 1VB6A 4NXGA 3RTYA 4GW9A 2Z6CA 4K08A 3LYXA 3NOUC 4EERA 2PYPA 1TS6A 4DJ3A 4NXEA 3IBRA 1LSWA 3MJQA 4LRXC 4LRZE 3A0RA 2V0UA 2PYRA 4EETB 4HP4A 5F68A 2PR6A 3BY9A 3F1NA 3VE3A 3HJIA 3CLOA 4JGQA 2PD7A 5J3WA 3F1PA 2V1BA 3FG8A 3E4QA 3LIDA 3E4OA 1DP6A 4KQDA 4XT2B 1TS8A 4I3IA 5HWWA 4H6JA 1OT6A 4PKYG 1D7EA 4R70A 2PR5A 4HI4A 5HSQA 3GDIA 2R78A 1TS7A 3MQQA 3BWLA 4GS9B 3A0VA 2QKPA 3NHQA 3C2WA 2WKRA 3EEHA 3VE4A 3VOLA 5J4EA 2JN7A 3G6OA 1OTDA 4LRYC 3B33A 4MN6A 1S67L 1XFQA 2VEAA 1EW0A 3OLOA 1S66L 2CMNA 4HJ3A 2J80A 1S1YA 2V0WA 4EXOA 3K3DA 4BBTA 5HDDA 1OTAA 4HJ4A 1LT0A 1S4RA 4L9GA 5F6AA 2QWSA 4LLOB 2QJ7A 3H7WA 3LIAA 4I38A 1F98A 1T18A 4R3AA 2VV7A 3NOPC 5HD5A 2OOLA 4GHIB 4HH3A 2W27A 4GCZA 1GSXA 3FC7A 4HQAA 5AVEA 1Y28A 2D02A 1OTBA 3LUQA 1WA9A 5HWTA 4I5SA 4R38A 3EWKA 2Z6DA 1ODVA 2EA9A 1JNUA 4WUJA 4BBVA 4L9FA 4I3JA 1S4SA 2ZOHA 5F69A 1DRMA 1KOUA 1MZUA 5EFWA 3NOTC 2L4RA 3H82A 1X0OA 3UMDA 1OJ5A 1N9NA 2B02A 4PKYA 1LSVA 2V1AA 1N9OA 1V9YA 4EEUA 2JHEA 1GSVA 4YWZA 1XJ6A 5I5LA 1G28A 2WKQA 4WLAA 5DKKA 2K7SA 1OTIA 3GECA 5AVFA 1T19A 1UWPX 5DKLA 2L0WA 2I9VA 4I3AA 4JGPA 2OWHA 4I39A 4F3LB 3IS2B 4LPZA 1LL8A 4EEPA 3K3CA 5HWVA 3LIBA 4HJ6A 3E4PA 1DP8A 4KUKA 5A8BA 5G4YA 5DJUA 5G4ZA 3MQOA 4RQ9A 4KUOA 4XT2A 3MXQA 5IS1A 3MFXA 4WF0A 3KX0X 1P97A 2VV8A 4HP9A 1OTEA 3D72A 1LSXA 1XJ3A 3UB6A 2BASA 4GS9A 1TS0A 3F1NB 2QJ5A 5HZHA 1T1CA 3F1OB 3A0SA 3F1PB 3UB7A 2H28A 2ZBBA 2YKFA 4F3LA 3IS2A 3HJKA 4B9OA 1N9LA 4L9EA 2OWJA 1OT9A 4H6JB 1DP9A 1T1AA 3T50A 4WN5A 2WKPA 1UGUA 3UMEA 1GSWA 2M1CA 3LI8A 2YKHA 4HY8A 2D01A 4GHIA 1P0ZA 5HD3A 4HH2A 1XJ2A 5TBMB 2P7JA 2VLGA 3H9WA 1XJ4A 3LICA 3F1OA 2L1MA 4JGRA 3CAXA 3P7NA 4NXBA 3LI9A 5DJTA 4EQ1A 3C8CA 3CWFA 5KIZA 3PYPA 2QHKA 2INWA 1XFNA 5HDSA 2A24B 3H7WB 3PHYA 3SW1A 4EW7A 5HDCA 3ICYA 4E04A 1NWZA 4HOIA 4MN5A 3ZQ5A 2VV6A 1OJGA 5IU1A 3BY8A 2ZOIA 2KX6A 4JGOA
chains in the Genus database with same CATH superfamily
2PDRA 4BL3A 4BBUA 3U4LP 2OSUA 2ZQAA 3UO9A 2ZMFA 1V9ZA 1C3BA 4HNBA 2EFUA 2Y2OA 4OQHA 1P9RA 1W63M 1IELA 2HP6A 4NXFA 4HHDA 4X69A 2GNXA 4RX2A 5GHYA 4U0TA 4X53A 3Q7ZA 5L07A 1SDEA 2Q9NA 3CG5A 2XROA 4CQHA 3IH8A 1T1BA 2J9PA 2A2LA 1XA7A 2A3UA 3MR0A 2BLSA 4U3TA 1BYWA 4OQIA 4KZ5A 4GDNA 3MZEA 5IHVA 2WGWB 3UB8A 4YINA 5EM1A 1FILA 3WWXA 4NXGA 4GW9A 4ID4A 1G68A 4OQ0A 2ZM8A 4FH2A 5IT5A 3T1SA 4B88A 4EERA 4R4RA 2PYPA 2NUTC 3HUMA 4NXEA 3BQ8A 3IBRA 1FIKA 1LSWA 1NZOA 5BOHA 2H5SA 4JXSA 2Z2MB 4LRXC 1H5XA 2XF3A 3C4OA 4FCFA 4E6WA 3HBRA 5A92A 4KQRA 5CGSA 3KSIA 1BLPA 4UEYA 3CPTB 5EE8A 3O5YA 2WZZA 3EEAA 3HJIA 5CXWA 2E8IA 2EWVA 2PD7A 5J3WA 3GRJA 4HBTA 3F1PA 1MWTA 2HPBA 3T1RA 3FZCA 4KQDA 3OPRA 4I3IA 4ZJ2A 3G31A 5DVAA 1BTLA 2VGLM 3QP8A 1YT4A 4UAAA 4GNUA 1D7EA 2H10A 1FCOA 3CUEA 4QWOA 4G3VA 2DMWA 3TSGA 2R78A 1LL5A 1ALQA 3BWLA 4Q0JA 3E98A 4GS9B 3A0VA 4B93A 3UPPA 1YLPA 1NZUA 1GA9A 3EEHA 3VE4A 1JWZA 1GHMA 2QMIA 1IEMA 2OV5A 3B33A 4ZTKA 3D9YA 4MN6A 3QP6A 1XFQA 3UB5P 1EW0A 2EWWA 4D2OA 4PMAA 5JYPA 4HJ3A 4Y5FA 1MPLA 1S1YA 3DTKA 4CLCC 1L0FA 1OTAA 4KENB 3JVVA 3MSHA 4L9GA 5CTNA 2QJ7A 3UDXA 1MWUA 4I38A 1F98A 3Q07A 1FOFA 1LL9A 3C30A 3UY6A 4RX3A 1FR6A 4R3AA 5FQJA 3O88A 5HD5A 2ZD8A 3ZYTA 4E3KA 2HDQA 2FFFB 1DY6A 4HH3A 2W27A 1ES3A 2VJWA 1PI5A 3JVUA 1GSXA 3OZHA 1DJBA 4FTXA 4R23A 2P04A 3EQVA 3T12B 1DJCA 1CK3A 5M18A 3BQAA 1ES5A 2Z6DA 1S0WA 2B95A 3IH9A 1N9BA 2JKRM 4WUJA 2KLIA 3UDFA 1S4SA 2LB5A 5A90A 4OPZA 3SS3A 1W79A 3GMWA 4K0WA 1STZA 3C7UA 4UQIM 2XH9A 2OLVA 3A3JA 1BLCA 4O8GA 1RGYA 1ZHHB 1ZKJA 2L4RA 1X0OA 3H82A 4DXBA 5EUAA 4LCMA 5TR7A 4DMZA 1TD5A 4DRTA 4EEUA 2BG1A 3QP2A 3WRTA 3LEQA 2IWCA 4HEFA 1XJ6A 1KGEA 4IJGA 5CERA 1E4DA 3N8SA 5DKKA 3OOVA 2W3HA 3EGXC 3GECA 2XR0A 3E2LA 3MF0A 5GHZA 3LO7A 1KE3A 4M3KA 1T19A 4X68A 4EUZA 5FA7A 3T4LA 2WYXA 2FFYA 4JGPA 2EX8A 1PIOA 3IWOA 1PW1A 5FASA 5DF7A 4KZ4A 1VEUA 3K3CA 2UWXA 3ISGA 5E2GA 2EX6A 2XA7M 2GDNA 5I94A 3BEBA 5G4ZA 2ACGA 2RL3A 3MQOA 4Y7PA 1NRFA 5IS1A 2LB9A 3KX0X 3GR2A 4BWIA 4KZAA 1JTGA 3BFEA 1IKGA 4KG6A 1SKOA 2W3GA 1TS0A 4EV4A 3IBJA 2XGNA 3F1OB 4L0LA 1YAXA 4MCWA 4N92A 1HZOA 3F1PB 3M6HA 3W4OA 2ZBBA 1L0DA 3ZNTA 2XFSA 3B42A 4LCLA 4F3LA 3IS2A 5FAOA 2Y2IA 5DF9A 3IX3A 4WM9A 1PWDA 1W8QA 4B9OA 2Y2JA 1N9LA 4L9EA 5HPFA 1T1AA 4DE0A 1NLYA 3IF6A 4DXCA 4LENA 1YMSA 2WKPA 3HCYA 2K2NA 2JKFA 1SCWA 2YKHA 4HY8A 3VSKA 3V5MA 1YSPA 4GHIA 1P0ZA 2Y2MA 4OLGA 4OH0A 4HH2A 1XJ2A 5TBMB 1M40A 2P7JA 2VLGA 4KZ8A 4OPQA 2HDUA 3CAXA 5L10A 1LHYA 3LI9A 5DJTA 4EQ1A 3C8CA 3CWFA 5GLAA 2QHKA 1CEGA 2INWA 4P85A 4WZ5C 4OONA 3KYZA 3PHYA 3LR0A 3SW1A 3IXBA 3FV7A 1K4FA 3ICYA 2G7UA 2ZLYA 3ZQ5A 4KZ6A 2QYBA 2FH5A 1ZG4A 3FWLA 3PAGA 3ITAA 3MXSA 4JGOA 3S7QA 3WS2A 2Y59A 3NDGA 2HJ9C 1D06A 2PHYA 5J7EA 5DF8A 3S7NA 4R6LA 1ONHA 4K91A 4EESA 3W8KA 4DN0A 3HLDA 5F5YA 2PT7A 3WS5A 4FH4A 3S4XA 1XGJA 3V67A 4ARZA 3FPVA 3Q82A 3VP1A 3RXXA 2DRWA 1JWPA 4E3JA 3NY4A 4KQOA 1LI0A 2B18A 2XFTA 4PM5A 5K5BA 3ZVWA 4BMWA 5FDHA 3UE6A 3BJNA 1O7EA 3UE3A 2QPNA 3H82B 4F94A 1VB6A 3SOIA 1HLUP 4EWFA 3B3XA 3MS6A 4K08A 5FATA 4QHCA 3LYXA 1DJAA 4D60A 4DJ3A 3UPOA 4DE3A 4LRZE 5E2FA 1K57A 1XKZA 2V0UA 2ZQDA 2J7VA 4GKUA 2P74A 5F68A 4GOGA 4UA6A 3F1NA 1Q2QA 4KQQA 1AXBA 1VEUB 3LR5A 3CLOA 4S2PA 3ZG0A 5DFXA 2R9WA 3DTMA 3LIDA 4PM9A 3R7WA 3E4OA 1DP6A 4Z1WA 5FI2A 4P6ZS 1YLZA 4R3BA 5HWWA 2W3DA 4DDSA 1ZC2A 5CGWA 4H6JA 3O87A 4R70A 4HI4A 2NUPC 1ONGA 1QMEA 2WAEA 3AGFA 3OCLA 1SKOB 4LV0A 3UPNA 2QKPA 4NETA 1A0KA 2VZWA 2JCHA 5FAQA 4II7A 4FOFA 4XUXA 2WUQA 5EECA 4KG2A 3NHQA 3C2WA 1BUEA 5TFQA 1KGGA 2WKRA 4FUWA 3VOLA 5AQ7A 1KDSA 3ZFZA 2VA0A 3IHAA 1H8MA 3Q81A 1KE0A 4E3LA 5CGXA 1S67L 2VEAA 1K4EA 5D3OA 5M19A 4HBUA 2J80A 3CUEC 5HDDA 2PAVP 1LT0A 3LCEA 1L3LA 5F82A 4OKPA 4KZ7A 2VGJA 4O0PA 1CQAA 3H7WA 2ZL1A 3O86A 2W3FA 1Y54A 1NLZA 4X25A 1EROA 3NOPC 4GHIB 5KMWA 2ZJ9A 1VQQA 4BD0A 4IUKA 4GCZA 3MQ0A 4X1LA 4IBRA 4PM7A 4Y2FA 2H0TA 3EOIA 3HLWA 3FC7A 3VMAA 1MBLA 4HQAA 2X71A 5A93A 5AVEA 1GCEA 2VGKA 3UNWA 1W63Q 1OTBA 2Y8HA 3S22A 5HWTA 1BULA 4I5SA 4R38A 5E2HA 3EWKA 2OAQ1 1ODVA 4ETZA 2M7VA 4FSFA 2JKTM 4BBVA 4JF5A 2WGIA 2V8FA 1HVBA 1FCMA 4OPRA 3RXWA 2ZOHA 3ZG9B 5AQBA 4C6YA 1DRMA 4OP8A 5E2EA 2P9VA 3KYEA 3W2ZA 2Q9MA 1AWIA 1NYMA 4R3JA 3OBFA 1Q2PA 3QP5A 3KSFA 3UMDA 1G6AA 4ZDXA 1LSVA 1V9YA 4GD6A 2JHEA 1RCJA 5HW3A 4ARZB 1CEFA 3C5AA 4QPRA 5I5LA 1G28A 2WKQA 4BQMA 4Y15A 5HARA 3QNCA 4GZBA 3MZFA 5AVFA 1GHPA 3T1QB 5LBRA 4I3AA 3PBSA 2OWHA 4ZJ1A 2Y2NA 1W7FA 1NYYA 4I39A 1BSGA 5HWVA 1CJFA 1MWSA 3P01A 4WMCD 5A8BA 5G4YA 2HJEA 4E6XA 4XT2A 2RCXA 2DCFA 1QMFA 3MXQA 1I5QA 3IWIA 2JKGA 4DKIA 2HDRA 1N4OA 1P97A 2VV8A 3TE8A 4HP9A 4OLDA 1XJ3A 3UB6A 1GA0A 2Y2HA 3F1NB 1W5DA 5EVID 4N9KA 1ESUA 1T1CA 1LLBA 4ZJ3A 3ZG5A 3N6IA 2H28A 4MBHA 2YKFA 4WMCA 3MXRA 1K54C 4GJ4A 5HFOA 5AJGA 3C4PA 2G2UA 1FCNA 4GN2A 1IFQA 1JTDA 1OT9A 4H6JB 4S2NA 1K56A 3AGDA 3IWQA 3MKFA 4YOFA 1VETA 3CMZA 4R4SA 4XUZA 5FQKA 3QHYA 4X55A 1GSWA 5TJJA 5DFYA 4X56A 5EVIA 3G2YA 1SZVA 3FPWA 4S2MA 5HD3A 2W1TA 2J3TD 1K55C 3A3IA 1XJ4A 3BFGA 2O9BA 4EU0A 3B47A 1IYQA 1H8YA 4JGRA 3P7NA 4YFMA 3S7OA 2G2WA 3PAEA 2BTFP 3PYPA 2QZ6A 5DTSA 1F2KA 3H7WB 2ZL1B 3VP4A 2DNSA 3G2ZA 4IEDA 4EW7A 5EOOA 5HDCA 4PM6A 5HAIA 1L2SA 1ZG6A 3T4TA 1O07A 4LV2A 4WBGA 4CLCA 1KVLA 4E3NA 3IT9A 4IBXA 2ZOIA 4OQGA 3D3OA 3UE1A 2EXAA 4MN7A 2JKTI 2B5RA 1YPRA 3HLGA 3T4QA 4MMNA 4O7DA 4WL9A 1YKDA 4WELA 3WS0A 3NIAA 2KDKA 3NJAA 2PD8A 4HIAA 3L9KA 3IXHA 3TOIA 1YLWA 3ULFA 3FKWA 3LIEA 5GLBA 2Y2PA 4S2OA 2A24A 3M2JA 1YLTA 2Y2LA 2W0NA 4M4XA 2PBYA 1UWNX 1F9IA 3GTCA 5DTKA 3RTYA 3CJMA 3BFDA 4S2LA 3O3VA 5EV0A 1XXMA 2Z6CA 4QU3A 1XP4A 1ACFA 2JBFA 3JPUA 1TS6A 5CEDA 5HL1A 5FQQA 3A3DA 1VM1A 4RA7A 3KO6A 3MJQA 1S6RA 3I7JA 1FR1A 3PBRA 1P9WA 3WS1A 5J8XA 4OOYA 2PYRA 4IHQA 3BRMA 4HP4A 2PR6A 3BY9A 2O0YA 1YSQA 4WZ4A 5FEFA 2V1ZA 5HPIA 4JGQA 4S2IA 1L0EA 2HDSA 2WGWA 3FG8A 2CC1A 2E8JA 2XD1A 3N4IA 1ERQA 4OVDA 3LEZA 2ZM2A 4XT2B 3WRZA 3SH9A 3VP0A 1TS8A 1TDGA 2I72A 1K57C 5FEGA 3OC2A 1OT6A 4PKYG 3D4FA 4UA9A 3NC8A 3DAVA 1TS7A 1CI8A 1PI4A 2Y2KA 3BLSA 1JWVA 1J3WA 2JKRI 4WYYA 3DW0A 3IXGA 3DWZA 4KZ3A 5KSCA 3CPTA 3Q7VA 4BENA 2JN7A 4B4ZA 3G6OA 5HL6A 5EVLA 1MKIA 4NK3A 1IKIA 3V39A 4R1GA 1S66L 3W4QA 1TF1A 5CX7A 2CMNA 4N1XA 2EFXA 4EBLA 1PWGA 3K3DA 3ZHHA 4BBTA 1FQGA 3UDIA 4Q0HA 4X6TA 1VETB 3L7HA 4LLOB 1Y4OA 3LR4A 5F6AA 2JC7A 3S1YA 3W4PA 1T18A 2VK3A 5EVIB 3P09A 2ZMVA 4JLFA 4LGWA 3G35A 5FSRA 3A3FA 2W1TB 1TVFA 1MY8A 1SDNA 1J9MA 1KVMA 2Y91A 3G32A 4EBNA 2GX5A 1KGFA 3VFFA 3NULA 1VHMA 3R4KA 5AQ9A 3N8RA 4OPYA 4QB8A 1YQSA 2D02A 1WA9A 4PAUA 2WK0A 2FZ0A 3LR3A 3T4KA 2EA9A 2V8CA 1E3UD 1G6OA 4P0MA 4I3JA 4NKPA 4IVIA 4QY5A 3MMHA 5F69A 3IF5A 1KOUA 5FQ9A 3SS4A 1OPXA 1OMEA 4EBPA 1MZUA 2ZQ8A 5MC7A 4DE1A 4Y0TA 2J9OA 5EFWA 3NOTC 3HLBA 1CF0A 1OJ5A 2X01A 3T4SA 1N9NA 4Y13A 3DTIA 1K6SA 4UHUA 2KOIA 1U60A 1IYSA 4A5RA 1E3UA 2XSSA 4YWZA 1BLSA 5KSHA 4C3QA 3G34A 4WLAA 3VP2A 1PWCA 3PTEA 1OTIA 3ZCZA 1WE4A 3T1XA 2XRNA 2IA2A 2HP9A 2L0WA 1YLYA 2I9VA 3NCKA 3G4PA 3GVBA 4F3LB 3IS2B 3T4OA 4N9LA 5U47A 4Q0IA 3SH7A 3VSLA 3E4PA 3HUNA 1DP8A 1NJ4A 4KUKA 3E2KA 3S7PA 1GHIA 4MBKA 3IF6B 4Y17A 1WYBA 1WYCA 4RQ9A 5L09A 1F5MA 5HX9A 3MFXA 4WF0A 4QY6A 3PBNA 4OP5A 3LY3A 1OTEA 1YM1A 3BFFA 4P6ZM 2BASA 1RP5A 4ME4A 1ES2A 2Y2GA 1LI9A 1MC0A 1W8YA 2J8YA 5HZHA 3GSGA 2VGLS 5EM0A 3PBTA 4UA7A 1ZTUA 3UB7A 3V50A 4LV3A 3IXDA 3WS4A 3BW6A 2OLUA 4BD1A 4E3IA 5EOEA 4GB7A 4R0QA 1PRQA 1DP9A 3T50A 3SH8A 3OCNA 4WN5A 1ES4A 5FI6A 1K6RA 2D01A 2Y4AA 4GDBA 2MJ6A 3BECA 3NI9A 3ZDJA 2Y2QA 3Q7VB 1BLHA 3LICA 3F1OA 3QP1A 2L1MA 1MWRA 3ZVTA 4S2NC 1HTZA 4NXBA 2V2FF 1ESIA 5KIZA 2P08A 1XFNA 5HDSA 3NECA 5TGFA 2HGVA 5EVIC 3FKVA 4E04A 4HOIA 4CLCE 3V3SA 3HUOA 1I2WA 3MFDA 2Y55A 5JYOA 1JVJA 2XEPA 5HAQA 5IU1A 3BY8A 1TEMA 3AGEA 3LIFA 5M1AA 2W3EA 5CHUA 2O9CA 2V9AA 1FSYA 2GJ3A 2EX9A 5TBMA 4PM8A 1K56D 4UQIS 4DJ2A 3PBOA 1S1ZA 2WKEA 2ZQ7A 3UB9A 5F1GA 3RH8B 2IWBA 4Y0OA 4DF6A 2HV1A 4RVAA 3QP4A 2J3TC 4WEKA 1E25A 3M6BA 1SHVA 4IVKA 3R7WB 1K38A 1XPBA 2EX2A 4KG5A 2PBDP 2XDMA 2EXBA 4DDYA 3NOUC 2PU2A 3BM6A 3TG9A 4QD4A 3SS5A 3TW8A 1PYYA 2WADA 2WAFA 1HD8A 4CPKA 5FDSA 3PBQA 3ZGAB 1H3QA 3A0RA 4CLCD 4EETB 5C5KA 2XA7S 2WKHA 4CJNA 3QNBA 4Y0UA 2OAP1 3KSHA 1TDLA 3CZDA 3IQAA 4S2JA 2O9AA 3VOZA 3T4JA 3VE3A 1YLJA 3E0YA 4MLLA 3IX8A 4JF4A 3MZDA 4Y3IA 2V1BA 1NY0A 4JXWA 3PR6A 3E4QA 2Y79A 3IF6C 1PNEA 4JPMA 5HAPA 4JF6A 4K0XA 2J3WA 3Q1FA 2AVXA 5A91A 1M6KA 4JXGA 1KE4A 4N1HA 5AQAA 3HLFA 2PR5A 3CHWP 4B4XA 5HSQA 3GDIA 3MQQA 4P6BA 3BFCA 4XXRA 2ZC5B 2WKIA 3OPLA 2A49A 3RJUA 2PRFA 4JKTA 4IUHA 1I2SA 5CECA 2WGVA 3ZG7B 1CI9A 5J4EA 3MBZA 4DE2A 4ETXA 1OTDA 4LRYC 4MBFA 2Q0OA 3OLOA 4WEJA 5FQMA 2ZMAA 2V0WA 4EXOA 4HJ4A 1S4RA 1K54A 3JYIA 2P9VB 2QWSA 2O99A 3TRCA 4NG2A 3LIAA 2WZXA 4G3KA 4ZAMA 3VFHA 1BT5A 3SZTA 2VV7A 2OOLA 2ZC4B 3DWKA 3EQUA 1K25A 2IWDA 4OOMA 5L2FA 5FI7A 4JXVA 5G18A 1SKFA 4YNRA 3ZG8B 1Y28A 2ZQ9A 3ZNYA 5EPHA 2XLNA 3LUQA 1K0KA 2ZM0A 1PZPA 4FD8A 5F1FA 1K55A 2HP5A 1PW8A 3KYQA 5KZHA 1JNUA 4KZ9A 3U2AA 4C75A 3C38A 4L9FA 3HVFA 5CHJA 5FQIA 3KSGA 4ZBEA 3CI6A 1PFLA 2VX8A 3BYDA 4BL2A 1BZAA 5FL3A 3RFBA 3OPHA 5GLCA 2R9XA 5FAPA 1D1JA 3DTEA 1KDWA 2XQZA 4PKYA 2B02A 3BLMA 2V1AA 1N9OA 5E43A 1GSVA 4H8RA 3NBLA 4O01A 3N7WA 1XGIA 2UV0E 4LV1A 4Q8IA 2XK1A 1EI5A 2K7SA 3LFVA 2ZC7A 3VOYA 3LGOA 1H0MA 1UWPX 5DKLA 5GLDA 1H8ZA 4QJGA 1IOUA 2HZ5A 4EQIA 4GLQA 3UE0A 5GL9A 1FSWA 4E3MA 4LPZA 1LL8A 4EEPA 3GV9A 2ZC6B 4KZBA 4OOLA 3LIBA 3M2KA 4MDZA 4PPRA 3V3RA 4HJ6A 3HLEA 2K31A 1IYPA 5DJUA 4G3WA 4KUOA 4S2KA 4BJPA 1MXOA 3MKEA 2C6WB 4PHTA 2XD5A 2ZC3B 3A3EA 3D72A 1LSXA 1MKMA 1YMXA 2M7UA 4BLMA 4GS9A 2QJ5A 2Z2LB 3HLCA 2W1RA 3A0SA 3TJZC 3UN7A 1EWZA 3PXPA 3OPPA 2GZAA 4U0XA 3VV4A 1Z09A 3HJKA 1L0GA 3IHBA 5CRFA 3ITBA 3FYZA 1Z6FA 3G30A 1IYOA 1G5UA 2OWJA 3P98A 3K2NA 4X1MA 4CLCB 4MNRA 3IX4A 3EGDC 4E3OA 1NRJA 4WZ5A 2V20A 2PU4A 5CHMA 1NXYA 1UGUA 3UMEA 5GHXA 2H0YA 2X02A 4EUVA 3HL9A 2M1CA 3LI8A 4P87A 1XX2A 3HREA 5CTMA 5L8MA 4GD8A 3DBAA 4JBFA 4LFUA 3NDEA 2HF6A 4MEZA 5EVEA 3LY4A 3H9WA 1PZOA 2C5WB 3N8LA 3VP3A 2A24B 3CITA 2ZQCA 1NWZA 3C7VA 4ZRRA 2VKSA 3GQZA 4RYEA 4MN5A 5DTTA 2VV6A 1OJGA 1RGZA 4NEED 4Z9QA 4ESPA 4HESA 1XA1A 1ERMA 2JE5A 2KX6A 5F83A 4AFIA 5CEBA
chains in the Genus database with same CATH topology
1D06A 2PHYA 2PDRA 4MN7A 5J7EA 3LIFA 4BBUA 2JKTI 3S7NA 2ZMFA 4R6LA 1V9ZA 4HNBA 2W3EA 4EESA 1P9RA 1W63M 4DN0A 3T4QA 4NXFA 4HHDA 4MMNA 2O9CA 5F5YA 2PT7A 2V9AA 2GNXA 2GJ3A 4WL9A 3V67A 1YKDA 4WELA 5TBMA 4ARZA 2KDKA 3NJAA 3FPVA 2PD8A 4HIAA 4UQIS 4DJ2A 3PBOA 1S1ZA 3ULFA 2XROA 3LIEA 4KQOA 4CQHA 2B18A 1T1BA 3UB9A 2A2LA 3RH8B 3MR0A 5K5BA 2HV1A 1BYWA 2A24A 4BMWA 2J3TC 4WEKA 2W0NA 3UB8A 4M4XA 3UE6A 3BJNA 1UWNX 3UE3A 1F9IA 3R7WB 3H82B 1VB6A 4NXGA 3RTYA 4GW9A 2Z6CA 4K08A 5IT5A 3LYXA 3NOUC 4EERA 2PYPA 1TS6A 4DJ3A 2NUTC 4NXEA 3BQ8A 3TW8A 3IBRA 1LSWA 3KO6A 3MJQA 4LRXC 4LRZE 3PBQA 3PBRA 1P9WA 1H3QA 3A0RA 2V0UA 4CLCD 2PYRA 4IHQA 4EETB 5C5KA 3KSIA 2XA7S 4HP4A 2OAP1 5F68A 3KSHA 4UEYA 2PR6A 3BY9A 2O9AA 3O5YA 2O0YA 1YSQA 3F1NA 3T4JA 3VE3A 3LR5A 3EEAA 3E0YA 3HJIA 5HPIA 3CLOA 2EWVA 4JGQA 2PD7A 5J3WA 5DFXA 3F1PA 4Y3IA 2V1BA 3FG8A 3PR6A 3E4QA 2Y79A 3LIDA 3R7WA 3E4OA 1DP6A 4Z1WA 4KQDA 4P6ZS 4XT2B 1TS8A 4I3IA 5HWWA 2J3WA 2VGLM 2W3DA 3OC2A 4H6JA 1OT6A 4PKYG 1D7EA 4R70A 3CUEA 2PR5A 4G3VA 2DMWA 4HI4A 5HSQA 3GDIA 2R78A 1TS7A 3MQQA 2NUPC 3OCLA 3BWLA 4Q0JA 3E98A 4GS9B 3A0VA 2QKPA 4B93A 2VZWA 4II7A 4FOFA 4IUHA 2JKRI 3NHQA 3C2WA 2WKRA 3EEHA 3VE4A 3VOLA 5J4EA 2VA0A 4ETXA 1H8MA 2JN7A 3G6OA 1OTDA 4LRYC 5HL6A 3B33A 4MN6A 1S67L 1XFQA 2VEAA 1EW0A 2EWWA 3OLOA 1S66L 1TF1A 5CX7A 2CMNA 4HJ3A 4WEJA 4Y5FA 2J80A 1S1YA 2V0WA 4CLCC 3CUEC 3K3DA 4BBTA 5HDDA 4EXOA 1OTAA 4HJ4A 1LT0A 3JVVA 1S4RA 4L9GA 4Q0HA 3LR4A 5F6AA 2QWSA 4LLOB 2O99A 2QJ7A 3TRCA 4O0PA 3H7WA 3LIAA 4G3KA 2W3FA 4I38A 1F98A 1T18A 3C30A 2ZMVA 4R3AA 1NLZA 2VV7A 3NOPC 5HD5A 2OOLA 4GHIB 3ZYTA 3EQUA 4HH3A 4IUKA 2W27A 2W1TB 2VJWA 4OOMA 4GCZA 3MQ0A 2GX5A 3JVUA 1GSXA 4Y2FA 3EOIA 1VHMA 3FC7A 3R4KA 4YNRA 4HQAA 2P04A 5AVEA 1Y28A 1W63Q 1OTBA 2D02A 2Y8HA 3EQVA 3LUQA 1WA9A 5HWTA 4I5SA 4R38A 4PAUA 3BQAA 2FZ0A 3EWKA 2OAQ1 2Z6DA 3LR3A 1ODVA 4ETZA 3T4KA 2EA9A 2M7VA 1G6OA 3KYQA 1JNUA 2JKRM 2KLIA 4WUJA 3U2AA 4FSFA 2JKTM 4BBVA 3C38A 4L9FA 4I3JA 4NKPA 3KSGA 1S4SA 3CI6A 2LB5A 2ZOHA 3MMHA 2VX8A 5F69A 5FL3A 1DRMA 3RFBA 1KOUA 3W2ZA 1OPXA 3OBFA 1MZUA 1STZA 5MC7A 4UQIM 5EFWA 4O8GA 3NOTC 1ZHHB 2L4RA 3H82A 1X0OA 3KSFA 3UMDA 1OJ5A 3T4SA 4DMZA 1N9NA 2B02A 4PKYA 1LSVA 1TD5A 2V1AA 1N9OA 1V9YA 4EEUA 2JHEA 2KOIA 4ARZB 1GSVA 4QPRA 4YWZA 2XSSA 4O01A 1XJ6A 4IJGA 5I5LA 1G28A 5KSHA 2WKQA 4WLAA 5DKKA 2K7SA 3OOVA 2W3HA 3EGXC 3LFVA 1OTIA 3GECA 3MF0A 2XRNA 5AVFA 1T19A 1UWPX 2IA2A 5DKLA 2L0WA 2I9VA 5LBRA 4I3AA 1IOUA 3T4LA 4GLQA 3PBSA 4JGPA 2OWHA 4I39A 4F3LB 3IS2B 4LPZA 3T4OA 1LL8A 4EEPA 3K3CA 5HWVA 4OOLA 3LIBA 4MDZA 4Q0IA 4HJ6A 3E4PA 3P01A 1DP8A 2XA7M 4KUKA 5A8BA 2K31A 3S7PA 5G4YA 5DJUA 5G4ZA 2HJEA 3MQOA 4RQ9A 4G3WA 4KUOA 4XT2A 4BJPA 3MXQA 1F5MA 4PHTA 5IS1A 3MFXA 2LB9A 4WF0A 3KX0X 4BWIA 3PBNA 1P97A 2VV8A 3TE8A 4HP9A 1OTEA 3D72A 1LSXA 1XJ3A 1MKMA 3UB6A 4P6ZM 2M7UA 2BASA 2W3GA 4GS9A 1TS0A 3F1NB 4ME4A 1MC0A 2QJ5A 3IBJA 5HZHA 1T1CA 3F1OB 4L0LA 1YAXA 2VGLS 2W1RA 3A0SA 4MCWA 3TJZC 3PBTA 3F1PB 3PXPA 1ZTUA 3UB7A 2H28A 2ZBBA 2YKFA 3B42A 3BW6A 2GZAA 4F3LA 3IS2A 5DF9A 3VV4A 4GJ4A 5AJGA 3HJKA 4B9OA 1N9LA 4L9EA 5HPFA 1IFQA 2OWJA 1OT9A 4H6JB 1DP9A 1T1AA 3K2NA 4CLCB 3T50A 1NLYA 3EGDC 3OCNA 4WN5A 1NRJA 4YOFA 2WKPA 1UGUA 3HCYA 2K2NA 3UMEA 4EUVA 1GSWA 5TJJA 2M1CA 3LI8A 5DFYA 2YKHA 4HY8A 2D01A 1YSPA 3FPWA 2MJ6A 4GHIA 1P0ZA 5L8MA 3DBAA 5HD3A 2HF6A 2W1TA 4HH2A 2J3TD 1XJ2A 5TBMB 2P7JA 2VLGA 3H9WA 1XJ4A 3LICA 2O9BA 3F1OA 4EU0A 3B47A 2L1MA 4JGRA 3CAXA 3P7NA 3S7OA 4NXBA 3LI9A 5DJTA 4EQ1A 3C8CA 3CWFA 5KIZA 3PYPA 2P08A 2QHKA 2INWA 1XFNA 5HDSA 2A24B 3H7WB 3KYZA 3PHYA 2HGVA 3LR0A 3SW1A 4EW7A 3CITA 5HDCA 3ICYA 4E04A 1NWZA 4ZRRA 2VKSA 4HOIA 3T4TA 2G7UA 4MN5A 4CLCE 3ZQ5A 4CLCA 2VV6A 2QYBA 1OJGA 4NEED 2FH5A 5IU1A 3BY8A 2ZOIA 2KX6A 4JGOA 3S7QA 4AFIA 3D3OA 2HJ9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D06 A;  2PHY A;  2PDR A;  5J7E A;  3LIF A;  4BBU A;  4R6L A;  1V9Z A;  4HNB A;  4EES A;  4NXF A;  4HHD A;  5F5Y A;  2V9A A;  2GJ3 A;  4WL9 A;  5TBM A;  2KDK A;  3NJA A;  2PD8 A;  4HIA A;  4DJ2 A;  1S1Z A;  3ULF A;  3LIE A;  3UB9 A;  1T1B A;  3RH8 B;  3MR0 A;  2HV1 A;  1BYW A;  2A24 A;  2W0N A;  3UB8 A;  4M4X A;  3UE6 A;  1UWN X;  1F9I A;  3H82 B;  1VB6 A;  4NXG A;  3RTY A;  4GW9 A;  2Z6C A;  4K08 A;  3LYX A;  3NOU C;  4EER A;  2PYP A;  1TS6 A;  4DJ3 A;  4NXE A;  3IBR A;  1LSW A;  3MJQ A;  4LRX C;  4LRZ E;  3A0R A;  2V0U A;  2PYR A;  4EET B;  4HP4 A;  5F68 A;  2PR6 A;  3BY9 A;  3F1N A;  3VE3 A;  3HJI A;  3CLO A;  4JGQ A;  2PD7 A;  5J3W A;  3F1P A;  2V1B A;  3FG8 A;  3E4Q A;  3LID A;  3E4O A;  1DP6 A;  4KQD A;  4XT2 B;  1TS8 A;  4I3I A;  5HWW A;  4H6J A;  1OT6 A;  4PKY G;  1D7E A;  4R70 A;  2PR5 A;  4HI4 A;  5HSQ A;  3GDI A;  2R78 A;  1TS7 A;  3MQQ A;  3BWL A;  4GS9 B;  3A0V A;  2QKP A;  3NHQ A;  3C2W A;  2WKR A;  3EEH A;  3VE4 A;  3VOL A;  5J4E A;  2JN7 A;  3G6O A;  1OTD A;  4LRY C;  3B33 A;  4MN6 A;  1S67 L;  1XFQ A;  2VEA A;  1EW0 A;  3OLO A;  1S66 L;  2CMN A;  4HJ3 A;  2J80 A;  1S1Y A;  2V0W A;  4EXO A;  3K3D A;  4BBT A;  5HDD A;  1OTA A;  4HJ4 A;  1LT0 A;  1S4R A;  4L9G A;  5F6A A;  2QWS A;  4LLO B;  2QJ7 A;  3H7W A;  3LIA A;  4I38 A;  1F98 A;  1T18 A;  4R3A A;  2VV7 A;  3NOP C;  5HD5 A;  2OOL A;  4GHI B;  4HH3 A;  2W27 A;  4GCZ A;  1GSX A;  3FC7 A;  4HQA A;  5AVE A;  1Y28 A;  2D02 A;  1OTB A;  3LUQ A;  1WA9 A;  5HWT A;  4I5S A;  4R38 A;  3EWK A;  2Z6D A;  1ODV A;  2EA9 A;  1JNU A;  4WUJ A;  4BBV A;  4L9F A;  4I3J A;  1S4S A;  2ZOH A;  5F69 A;  1DRM A;  1KOU A;  1MZU A;  5EFW A;  3NOT C;  2L4R A;  3H82 A;  1X0O A;  3UMD A;  1OJ5 A;  1N9N A;  2B02 A;  4PKY A;  1LSV A;  2V1A A;  1N9O A;  1V9Y A;  4EEU A;  2JHE A;  1GSV A;  4YWZ A;  1XJ6 A;  5I5L A;  1G28 A;  2WKQ A;  4WLA A;  5DKK A;  2K7S A;  1OTI A;  3GEC A;  5AVF A;  1T19 A;  1UWP X;  5DKL A;  2L0W A;  2I9V A;  4I3A A;  4JGP A;  2OWH A;  4I39 A;  4F3L B;  3IS2 B;  4LPZ A;  1LL8 A;  4EEP A;  3K3C A;  5HWV A;  3LIB A;  4HJ6 A;  3E4P A;  1DP8 A;  4KUK A;  5A8B A;  5G4Y A;  5DJU A;  5G4Z A;  3MQO A;  4RQ9 A;  4KUO A;  4XT2 A;  3MXQ A;  5IS1 A;  3MFX A;  4WF0 A;  3KX0 X;  1P97 A;  2VV8 A;  4HP9 A;  1OTE A;  3D72 A;  1LSX A;  1XJ3 A;  3UB6 A;  2BAS A;  4GS9 A;  1TS0 A;  3F1N B;  2QJ5 A;  5HZH A;  1T1C A;  3F1O B;  3A0S A;  3F1P B;  3UB7 A;  2H28 A;  2ZBB A;  2YKF A;  4F3L A;  3IS2 A;  3HJK A;  4B9O A;  1N9L A;  4L9E A;  2OWJ A;  1OT9 A;  4H6J B;  1DP9 A;  1T1A A;  3T50 A;  4WN5 A;  2WKP A;  1UGU A;  3UME A;  1GSW A;  2M1C A;  3LI8 A;  2YKH A;  4HY8 A;  2D01 A;  4GHI A;  1P0Z A;  5HD3 A;  4HH2 A;  1XJ2 A;  5TBM B;  2P7J A;  2VLG A;  3H9W A;  1XJ4 A;  3LIC A;  3F1O A;  2L1M A;  4JGR A;  3CAX A;  3P7N A;  4NXB A;  3LI9 A;  5DJT A;  4EQ1 A;  3C8C A;  3CWF A;  5KIZ A;  3PYP A;  2QHK A;  2INW A;  1XFN A;  5HDS A;  2A24 B;  3H7W B;  3PHY A;  3SW1 A;  4EW7 A;  5HDC A;  3ICY A;  4E04 A;  1NWZ A;  4HOI A;  4MN5 A;  3ZQ5 A;  2VV6 A;  1OJG A;  5IU1 A;  3BY8 A;  2ZOI A;  2KX6 A;  4JGO A; 
#chains in the Genus database with same CATH topology
 2PDR A;  4BL3 A;  4BBU A;  3U4L P;  2OSU A;  2ZQA A;  3UO9 A;  2ZMF A;  1V9Z A;  1C3B A;  4HNB A;  2EFU A;  2Y2O A;  4OQH A;  1P9R A;  1W63 M;  1IEL A;  2HP6 A;  4NXF A;  4HHD A;  4X69 A;  2GNX A;  4RX2 A;  5GHY A;  4U0T A;  4X53 A;  3Q7Z A;  5L07 A;  1SDE A;  2Q9N A;  3CG5 A;  2XRO A;  4CQH A;  3IH8 A;  1T1B A;  2J9P A;  2A2L A;  1XA7 A;  2A3U A;  3MR0 A;  2BLS A;  4U3T A;  1BYW A;  4OQI A;  4KZ5 A;  4GDN A;  3MZE A;  5IHV A;  2WGW B;  3UB8 A;  4YIN A;  5EM1 A;  1FIL A;  3WWX A;  4NXG A;  4GW9 A;  4ID4 A;  1G68 A;  4OQ0 A;  2ZM8 A;  4FH2 A;  5IT5 A;  3T1S A;  4B88 A;  4EER A;  4R4R A;  2PYP A;  2NUT C;  3HUM A;  4NXE A;  3BQ8 A;  3IBR A;  1FIK A;  1LSW A;  1NZO A;  5BOH A;  2H5S A;  4JXS A;  2Z2M B;  4LRX C;  1H5X A;  2XF3 A;  3C4O A;  4FCF A;  4E6W A;  3HBR A;  5A92 A;  4KQR A;  5CGS A;  3KSI A;  1BLP A;  4UEY A;  3CPT B;  5EE8 A;  3O5Y A;  2WZZ A;  3EEA A;  3HJI A;  5CXW A;  2E8I A;  2EWV A;  2PD7 A;  5J3W A;  3GRJ A;  4HBT A;  3F1P A;  1MWT A;  2HPB A;  3T1R A;  3FZC A;  4KQD A;  3OPR A;  4I3I A;  4ZJ2 A;  3G31 A;  5DVA A;  1BTL A;  2VGL M;  3QP8 A;  1YT4 A;  4UAA A;  4GNU A;  1D7E A;  2H10 A;  1FCO A;  3CUE A;  4QWO A;  4G3V A;  2DMW A;  3TSG A;  2R78 A;  1LL5 A;  1ALQ A;  3BWL A;  4Q0J A;  3E98 A;  4GS9 B;  3A0V A;  4B93 A;  3UPP A;  1YLP A;  1NZU A;  1GA9 A;  3EEH A;  3VE4 A;  1JWZ A;  1GHM A;  2QMI A;  1IEM A;  2OV5 A;  3B33 A;  4ZTK A;  3D9Y A;  4MN6 A;  3QP6 A;  1XFQ A;  3UB5 P;  1EW0 A;  2EWW A;  4D2O A;  4PMA A;  5JYP A;  4HJ3 A;  4Y5F A;  1MPL A;  1S1Y A;  3DTK A;  4CLC C;  1L0F A;  1OTA A;  4KEN B;  3JVV A;  3MSH A;  4L9G A;  5CTN A;  2QJ7 A;  3UDX A;  1MWU A;  4I38 A;  1F98 A;  3Q07 A;  1FOF A;  1LL9 A;  3C30 A;  3UY6 A;  4RX3 A;  1FR6 A;  4R3A A;  5FQJ A;  3O88 A;  5HD5 A;  2ZD8 A;  3ZYT A;  4E3K A;  2HDQ A;  2FFF B;  1DY6 A;  4HH3 A;  2W27 A;  1ES3 A;  2VJW A;  1PI5 A;  3JVU A;  1GSX A;  3OZH A;  1DJB A;  4FTX A;  4R23 A;  2P04 A;  3EQV A;  3T12 B;  1DJC A;  1CK3 A;  5M18 A;  3BQA A;  1ES5 A;  2Z6D A;  1S0W A;  2B95 A;  3IH9 A;  1N9B A;  2JKR M;  4WUJ A;  2KLI A;  3UDF A;  1S4S A;  2LB5 A;  5A90 A;  4OPZ A;  3SS3 A;  1W79 A;  3GMW A;  4K0W A;  1STZ A;  3C7U A;  4UQI M;  2XH9 A;  2OLV A;  3A3J A;  1BLC A;  4O8G A;  1RGY A;  1ZHH B;  1ZKJ A;  2L4R A;  1X0O A;  3H82 A;  4DXB A;  5EUA A;  4LCM A;  5TR7 A;  4DMZ A;  1TD5 A;  4DRT A;  4EEU A;  2BG1 A;  3QP2 A;  3WRT A;  3LEQ A;  2IWC A;  4HEF A;  1XJ6 A;  1KGE A;  4IJG A;  5CER A;  1E4D A;  3N8S A;  5DKK A;  3OOV A;  2W3H A;  3EGX C;  3GEC A;  2XR0 A;  3E2L A;  3MF0 A;  5GHZ A;  3LO7 A;  1KE3 A;  4M3K A;  1T19 A;  4X68 A;  4EUZ A;  5FA7 A;  3T4L A;  2WYX A;  2FFY A;  4JGP A;  2EX8 A;  1PIO A;  3IWO A;  1PW1 A;  5FAS A;  5DF7 A;  4KZ4 A;  1VEU A;  3K3C A;  2UWX A;  3ISG A;  5E2G A;  2EX6 A;  2XA7 M;  2GDN A;  5I94 A;  3BEB A;  5G4Z A;  2ACG A;  2RL3 A;  3MQO A;  4Y7P A;  1NRF A;  5IS1 A;  2LB9 A;  3KX0 X;  3GR2 A;  4BWI A;  4KZA A;  1JTG A;  3BFE A;  1IKG A;  4KG6 A;  1SKO A;  2W3G A;  1TS0 A;  4EV4 A;  3IBJ A;  2XGN A;  3F1O B;  4L0L A;  1YAX A;  4MCW A;  4N92 A;  1HZO A;  3F1P B;  3M6H A;  3W4O A;  2ZBB A;  1L0D A;  3ZNT A;  2XFS A;  3B42 A;  4LCL A;  4F3L A;  3IS2 A;  5FAO A;  2Y2I A;  5DF9 A;  3IX3 A;  4WM9 A;  1PWD A;  1W8Q A;  4B9O A;  2Y2J A;  1N9L A;  4L9E A;  5HPF A;  1T1A A;  4DE0 A;  1NLY A;  3IF6 A;  4DXC A;  4LEN A;  1YMS A;  2WKP A;  3HCY A;  2K2N A;  2JKF A;  1SCW A;  2YKH A;  4HY8 A;  3VSK A;  3V5M A;  1YSP A;  4GHI A;  1P0Z A;  2Y2M A;  4OLG A;  4OH0 A;  4HH2 A;  1XJ2 A;  5TBM B;  1M40 A;  2P7J A;  2VLG A;  4KZ8 A;  4OPQ A;  2HDU A;  3CAX A;  5L10 A;  1LHY A;  3LI9 A;  5DJT A;  4EQ1 A;  3C8C A;  3CWF A;  5GLA A;  2QHK A;  1CEG A;  2INW A;  4P85 A;  4WZ5 C;  4OON A;  3KYZ A;  3PHY A;  3LR0 A;  3SW1 A;  3IXB A;  3FV7 A;  1K4F A;  3ICY A;  2G7U A;  2ZLY A;  3ZQ5 A;  4KZ6 A;  2QYB A;  2FH5 A;  1ZG4 A;  3FWL A;  3PAG A;  3ITA A;  3MXS A;  4JGO A;  3S7Q A;  3WS2 A;  2Y59 A;  3NDG A;  2HJ9 C;  1D06 A;  2PHY A;  5J7E A;  5DF8 A;  3S7N A;  4R6L A;  1ONH A;  4K91 A;  4EES A;  3W8K A;  4DN0 A;  3HLD A;  5F5Y A;  2PT7 A;  3WS5 A;  4FH4 A;  3S4X A;  1XGJ A;  3V67 A;  4ARZ A;  3FPV A;  3Q82 A;  3VP1 A;  3RXX A;  2DRW A;  1JWP A;  4E3J A;  3NY4 A;  4KQO A;  1LI0 A;  2B18 A;  2XFT A;  4PM5 A;  5K5B A;  3ZVW A;  4BMW A;  5FDH A;  3UE6 A;  3BJN A;  1O7E A;  3UE3 A;  2QPN A;  3H82 B;  4F94 A;  1VB6 A;  3SOI A;  1HLU P;  4EWF A;  3B3X A;  3MS6 A;  4K08 A;  5FAT A;  4QHC A;  3LYX A;  1DJA A;  4D60 A;  4DJ3 A;  3UPO A;  4DE3 A;  4LRZ E;  5E2F A;  1K57 A;  1XKZ A;  2V0U A;  2ZQD A;  2J7V A;  4GKU A;  2P74 A;  5F68 A;  4GOG A;  4UA6 A;  3F1N A;  1Q2Q A;  4KQQ A;  1AXB A;  1VEU B;  3LR5 A;  3CLO A;  4S2P A;  3ZG0 A;  5DFX A;  2R9W A;  3DTM A;  3LID A;  4PM9 A;  3R7W A;  3E4O A;  1DP6 A;  4Z1W A;  5FI2 A;  4P6Z S;  1YLZ A;  4R3B A;  5HWW A;  2W3D A;  4DDS A;  1ZC2 A;  5CGW A;  4H6J A;  3O87 A;  4R70 A;  4HI4 A;  2NUP C;  1ONG A;  1QME A;  2WAE A;  3AGF A;  3OCL A;  1SKO B;  4LV0 A;  3UPN A;  2QKP A;  4NET A;  1A0K A;  2VZW A;  2JCH A;  5FAQ A;  4II7 A;  4FOF A;  4XUX A;  2WUQ A;  5EEC A;  4KG2 A;  3NHQ A;  3C2W A;  1BUE A;  5TFQ A;  1KGG A;  2WKR A;  4FUW A;  3VOL A;  5AQ7 A;  1KDS A;  3ZFZ A;  2VA0 A;  3IHA A;  1H8M A;  3Q81 A;  1KE0 A;  4E3L A;  5CGX A;  1S67 L;  2VEA A;  1K4E A;  5D3O A;  5M19 A;  4HBU A;  2J80 A;  3CUE C;  5HDD A;  2PAV P;  1LT0 A;  3LCE A;  1L3L A;  5F82 A;  4OKP A;  4KZ7 A;  2VGJ A;  4O0P A;  1CQA A;  3H7W A;  2ZL1 A;  3O86 A;  2W3F A;  1Y54 A;  1NLZ A;  4X25 A;  1ERO A;  3NOP C;  4GHI B;  5KMW A;  2ZJ9 A;  1VQQ A;  4BD0 A;  4IUK A;  4GCZ A;  3MQ0 A;  4X1L A;  4IBR A;  4PM7 A;  4Y2F A;  2H0T A;  3EOI A;  3HLW A;  3FC7 A;  3VMA A;  1MBL A;  4HQA A;  2X71 A;  5A93 A;  5AVE A;  1GCE A;  2VGK A;  3UNW A;  1W63 Q;  1OTB A;  2Y8H A;  3S22 A;  5HWT A;  1BUL A;  4I5S A;  4R38 A;  5E2H A;  3EWK A;  2OAQ 1;  1ODV A;  4ETZ A;  2M7V A;  4FSF A;  2JKT M;  4BBV A;  4JF5 A;  2WGI A;  2V8F A;  1HVB A;  1FCM A;  4OPR A;  3RXW A;  2ZOH A;  3ZG9 B;  5AQB A;  4C6Y A;  1DRM A;  4OP8 A;  5E2E A;  2P9V A;  3KYE A;  3W2Z A;  2Q9M A;  1AWI A;  1NYM A;  4R3J A;  3OBF A;  1Q2P A;  3QP5 A;  3KSF A;  3UMD A;  1G6A A;  4ZDX A;  1LSV A;  1V9Y A;  4GD6 A;  2JHE A;  1RCJ A;  5HW3 A;  4ARZ B;  1CEF A;  3C5A A;  4QPR A;  5I5L A;  1G28 A;  2WKQ A;  4BQM A;  4Y15 A;  5HAR A;  3QNC A;  4GZB A;  3MZF A;  5AVF A;  1GHP A;  3T1Q B;  5LBR A;  4I3A A;  3PBS A;  2OWH A;  4ZJ1 A;  2Y2N A;  1W7F A;  1NYY A;  4I39 A;  1BSG A;  5HWV A;  1CJF A;  1MWS A;  3P01 A;  4WMC D;  5A8B A;  5G4Y A;  2HJE A;  4E6X A;  4XT2 A;  2RCX A;  2DCF A;  1QMF A;  3MXQ A;  1I5Q A;  3IWI A;  2JKG A;  4DKI A;  2HDR A;  1N4O A;  1P97 A;  2VV8 A;  3TE8 A;  4HP9 A;  4OLD A;  1XJ3 A;  3UB6 A;  1GA0 A;  2Y2H A;  3F1N B;  1W5D A;  5EVI D;  4N9K A;  1ESU A;  1T1C A;  1LLB A;  4ZJ3 A;  3ZG5 A;  3N6I A;  2H28 A;  4MBH A;  2YKF A;  4WMC A;  3MXR A;  1K54 C;  4GJ4 A;  5HFO A;  5AJG A;  3C4P A;  2G2U A;  1FCN A;  4GN2 A;  1IFQ A;  1JTD A;  1OT9 A;  4H6J B;  4S2N A;  1K56 A;  3AGD A;  3IWQ A;  3MKF A;  4YOF A;  1VET A;  3CMZ A;  4R4S A;  4XUZ A;  5FQK A;  3QHY A;  4X55 A;  1GSW A;  5TJJ A;  5DFY A;  4X56 A;  5EVI A;  3G2Y A;  1SZV A;  3FPW A;  4S2M A;  5HD3 A;  2W1T A;  2J3T D;  1K55 C;  3A3I A;  1XJ4 A;  3BFG A;  2O9B A;  4EU0 A;  3B47 A;  1IYQ A;  1H8Y A;  4JGR A;  3P7N A;  4YFM A;  3S7O A;  2G2W A;  3PAE A;  2BTF P;  3PYP A;  2QZ6 A;  5DTS A;  1F2K A;  3H7W B;  2ZL1 B;  3VP4 A;  2DNS A;  3G2Z A;  4IED A;  4EW7 A;  5EOO A;  5HDC A;  4PM6 A;  5HAI A;  1L2S A;  1ZG6 A;  3T4T A;  1O07 A;  4LV2 A;  4WBG A;  4CLC A;  1KVL A;  4E3N A;  3IT9 A;  4IBX A;  2ZOI A;  4OQG A;  3D3O A;  3UE1 A;  2EXA A;  4MN7 A;  2JKT I;  2B5R A;  1YPR A;  3HLG A;  3T4Q A;  4MMN A;  4O7D A;  4WL9 A;  1YKD A;  4WEL A;  3WS0 A;  3NIA A;  2KDK A;  3NJA A;  2PD8 A;  4HIA A;  3L9K A;  3IXH A;  3TOI A;  1YLW A;  3ULF A;  3FKW A;  3LIE A;  5GLB A;  2Y2P A;  4S2O A;  2A24 A;  3M2J A;  1YLT A;  2Y2L A;  2W0N A;  4M4X A;  2PBY A;  1UWN X;  1F9I A;  3GTC A;  5DTK A;  3RTY A;  3CJM A;  3BFD A;  4S2L A;  3O3V A;  5EV0 A;  1XXM A;  2Z6C A;  4QU3 A;  1XP4 A;  1ACF A;  2JBF A;  3JPU A;  1TS6 A;  5CED A;  5HL1 A;  5FQQ A;  3A3D A;  1VM1 A;  4RA7 A;  3KO6 A;  3MJQ A;  1S6R A;  3I7J A;  1FR1 A;  3PBR A;  1P9W A;  3WS1 A;  5J8X A;  4OOY A;  2PYR A;  4IHQ A;  3BRM A;  4HP4 A;  2PR6 A;  3BY9 A;  2O0Y A;  1YSQ A;  4WZ4 A;  5FEF A;  2V1Z A;  5HPI A;  4JGQ A;  4S2I A;  1L0E A;  2HDS A;  2WGW A;  3FG8 A;  2CC1 A;  2E8J A;  2XD1 A;  3N4I A;  1ERQ A;  4OVD A;  3LEZ A;  2ZM2 A;  4XT2 B;  3WRZ A;  3SH9 A;  3VP0 A;  1TS8 A;  1TDG A;  2I72 A;  1K57 C;  5FEG A;  3OC2 A;  1OT6 A;  4PKY G;  3D4F A;  4UA9 A;  3NC8 A;  3DAV A;  1TS7 A;  1CI8 A;  1PI4 A;  2Y2K A;  3BLS A;  1JWV A;  1J3W A;  2JKR I;  4WYY A;  3DW0 A;  3IXG A;  3DWZ A;  4KZ3 A;  5KSC A;  3CPT A;  3Q7V A;  4BEN A;  2JN7 A;  4B4Z A;  3G6O A;  5HL6 A;  5EVL A;  1MKI A;  4NK3 A;  1IKI A;  3V39 A;  4R1G A;  1S66 L;  3W4Q A;  1TF1 A;  5CX7 A;  2CMN A;  4N1X A;  2EFX A;  4EBL A;  1PWG A;  3K3D A;  3ZHH A;  4BBT A;  1FQG A;  3UDI A;  4Q0H A;  4X6T A;  1VET B;  3L7H A;  4LLO B;  1Y4O A;  3LR4 A;  5F6A A;  2JC7 A;  3S1Y A;  3W4P A;  1T18 A;  2VK3 A;  5EVI B;  3P09 A;  2ZMV A;  4JLF A;  4LGW A;  3G35 A;  5FSR A;  3A3F A;  2W1T B;  1TVF A;  1MY8 A;  1SDN A;  1J9M A;  1KVM A;  2Y91 A;  3G32 A;  4EBN A;  2GX5 A;  1KGF A;  3VFF A;  3NUL A;  1VHM A;  3R4K A;  5AQ9 A;  3N8R A;  4OPY A;  4QB8 A;  1YQS A;  2D02 A;  1WA9 A;  4PAU A;  2WK0 A;  2FZ0 A;  3LR3 A;  3T4K A;  2EA9 A;  2V8C A;  1E3U D;  1G6O A;  4P0M A;  4I3J A;  4NKP A;  4IVI A;  4QY5 A;  3MMH A;  5F69 A;  3IF5 A;  1KOU A;  5FQ9 A;  3SS4 A;  1OPX A;  1OME A;  4EBP A;  1MZU A;  2ZQ8 A;  5MC7 A;  4DE1 A;  4Y0T A;  2J9O A;  5EFW A;  3NOT C;  3HLB A;  1CF0 A;  1OJ5 A;  2X01 A;  3T4S A;  1N9N A;  4Y13 A;  3DTI A;  1K6S A;  4UHU A;  2KOI A;  1U60 A;  1IYS A;  4A5R A;  1E3U A;  2XSS A;  4YWZ A;  1BLS A;  5KSH A;  4C3Q A;  3G34 A;  4WLA A;  3VP2 A;  1PWC A;  3PTE A;  1OTI A;  3ZCZ A;  1WE4 A;  3T1X A;  2XRN A;  2IA2 A;  2HP9 A;  2L0W A;  1YLY A;  2I9V A;  3NCK A;  3G4P A;  3GVB A;  4F3L B;  3IS2 B;  3T4O A;  4N9L A;  5U47 A;  4Q0I A;  3SH7 A;  3VSL A;  3E4P A;  3HUN A;  1DP8 A;  1NJ4 A;  4KUK A;  3E2K A;  3S7P A;  1GHI A;  4MBK A;  3IF6 B;  4Y17 A;  1WYB A;  1WYC A;  4RQ9 A;  5L09 A;  1F5M A;  5HX9 A;  3MFX A;  4WF0 A;  4QY6 A;  3PBN A;  4OP5 A;  3LY3 A;  1OTE A;  1YM1 A;  3BFF A;  4P6Z M;  2BAS A;  1RP5 A;  4ME4 A;  1ES2 A;  2Y2G A;  1LI9 A;  1MC0 A;  1W8Y A;  2J8Y A;  5HZH A;  3GSG A;  2VGL S;  5EM0 A;  3PBT A;  4UA7 A;  1ZTU A;  3UB7 A;  3V50 A;  4LV3 A;  3IXD A;  3WS4 A;  3BW6 A;  2OLU A;  4BD1 A;  4E3I A;  5EOE A;  4GB7 A;  4R0Q A;  1PRQ A;  1DP9 A;  3T50 A;  3SH8 A;  3OCN A;  4WN5 A;  1ES4 A;  5FI6 A;  1K6R A;  2D01 A;  2Y4A A;  4GDB A;  2MJ6 A;  3BEC A;  3NI9 A;  3ZDJ A;  2Y2Q A;  3Q7V B;  1BLH A;  3LIC A;  3F1O A;  3QP1 A;  2L1M A;  1MWR A;  3ZVT A;  4S2N C;  1HTZ A;  4NXB A;  2V2F F;  1ESI A;  5KIZ A;  2P08 A;  1XFN A;  5HDS A;  3NEC A;  5TGF A;  2HGV A;  5EVI C;  3FKV A;  4E04 A;  4HOI A;  4CLC E;  3V3S A;  3HUO A;  1I2W A;  3MFD A;  2Y55 A;  5JYO A;  1JVJ A;  2XEP A;  5HAQ A;  5IU1 A;  3BY8 A;  1TEM A;  3AGE A;  3LIF A;  5M1A A;  2W3E A;  5CHU A;  2O9C A;  2V9A A;  1FSY A;  2GJ3 A;  2EX9 A;  5TBM A;  4PM8 A;  1K56 D;  4UQI S;  4DJ2 A;  3PBO A;  1S1Z A;  2WKE A;  2ZQ7 A;  3UB9 A;  5F1G A;  3RH8 B;  2IWB A;  4Y0O A;  4DF6 A;  2HV1 A;  4RVA A;  3QP4 A;  2J3T C;  4WEK A;  1E25 A;  3M6B A;  1SHV A;  4IVK A;  3R7W B;  1K38 A;  1XPB A;  2EX2 A;  4KG5 A;  2PBD P;  2XDM A;  2EXB A;  4DDY A;  3NOU C;  2PU2 A;  3BM6 A;  3TG9 A;  4QD4 A;  3SS5 A;  3TW8 A;  1PYY A;  2WAD A;  2WAF A;  1HD8 A;  4CPK A;  5FDS A;  3PBQ A;  3ZGA B;  1H3Q A;  3A0R A;  4CLC D;  4EET B;  5C5K A;  2XA7 S;  2WKH A;  4CJN A;  3QNB A;  4Y0U A;  2OAP 1;  3KSH A;  1TDL A;  3CZD A;  3IQA A;  4S2J A;  2O9A A;  3VOZ A;  3T4J A;  3VE3 A;  1YLJ A;  3E0Y A;  4MLL A;  3IX8 A;  4JF4 A;  3MZD A;  4Y3I A;  2V1B A;  1NY0 A;  4JXW A;  3PR6 A;  3E4Q A;  2Y79 A;  3IF6 C;  1PNE A;  4JPM A;  5HAP A;  4JF6 A;  4K0X A;  2J3W A;  3Q1F A;  2AVX A;  5A91 A;  1M6K A;  4JXG A;  1KE4 A;  4N1H A;  5AQA A;  3HLF A;  2PR5 A;  3CHW P;  4B4X A;  5HSQ A;  3GDI A;  3MQQ A;  4P6B A;  3BFC A;  4XXR A;  2ZC5 B;  2WKI A;  3OPL A;  2A49 A;  3RJU A;  2PRF A;  4JKT A;  4IUH A;  1I2S A;  5CEC A;  2WGV A;  3ZG7 B;  1CI9 A;  5J4E A;  3MBZ A;  4DE2 A;  4ETX A;  1OTD A;  4LRY C;  4MBF A;  2Q0O A;  3OLO A;  4WEJ A;  5FQM A;  2ZMA A;  2V0W A;  4EXO A;  4HJ4 A;  1S4R A;  1K54 A;  3JYI A;  2P9V B;  2QWS A;  2O99 A;  3TRC A;  4NG2 A;  3LIA A;  2WZX A;  4G3K A;  4ZAM A;  3VFH A;  1BT5 A;  3SZT A;  2VV7 A;  2OOL A;  2ZC4 B;  3DWK A;  3EQU A;  1K25 A;  2IWD A;  4OOM A;  5L2F A;  5FI7 A;  4JXV A;  5G18 A;  1SKF A;  4YNR A;  3ZG8 B;  1Y28 A;  2ZQ9 A;  3ZNY A;  5EPH A;  2XLN A;  3LUQ A;  1K0K A;  2ZM0 A;  1PZP A;  4FD8 A;  5F1F A;  1K55 A;  2HP5 A;  1PW8 A;  3KYQ A;  5KZH A;  1JNU A;  4KZ9 A;  3U2A A;  4C75 A;  3C38 A;  4L9F A;  3HVF A;  5CHJ A;  5FQI A;  3KSG A;  4ZBE A;  3CI6 A;  1PFL A;  2VX8 A;  3BYD A;  4BL2 A;  1BZA A;  5FL3 A;  3RFB A;  3OPH A;  5GLC A;  2R9X A;  5FAP A;  1D1J A;  3DTE A;  1KDW A;  2XQZ A;  4PKY A;  2B02 A;  3BLM A;  2V1A A;  1N9O A;  5E43 A;  1GSV A;  4H8R A;  3NBL A;  4O01 A;  3N7W A;  1XGI A;  2UV0 E;  4LV1 A;  4Q8I A;  2XK1 A;  1EI5 A;  2K7S A;  3LFV A;  2ZC7 A;  3VOY A;  3LGO A;  1H0M A;  1UWP X;  5DKL A;  5GLD A;  1H8Z A;  4QJG A;  1IOU A;  2HZ5 A;  4EQI A;  4GLQ A;  3UE0 A;  5GL9 A;  1FSW A;  4E3M A;  4LPZ A;  1LL8 A;  4EEP A;  3GV9 A;  2ZC6 B;  4KZB A;  4OOL A;  3LIB A;  3M2K A;  4MDZ A;  4PPR A;  3V3R A;  4HJ6 A;  3HLE A;  2K31 A;  1IYP A;  5DJU A;  4G3W A;  4KUO A;  4S2K A;  4BJP A;  1MXO A;  3MKE A;  2C6W B;  4PHT A;  2XD5 A;  2ZC3 B;  3A3E A;  3D72 A;  1LSX A;  1MKM A;  1YMX A;  2M7U A;  4BLM A;  4GS9 A;  2QJ5 A;  2Z2L B;  3HLC A;  2W1R A;  3A0S A;  3TJZ C;  3UN7 A;  1EWZ A;  3PXP A;  3OPP A;  2GZA A;  4U0X A;  3VV4 A;  1Z09 A;  3HJK A;  1L0G A;  3IHB A;  5CRF A;  3ITB A;  3FYZ A;  1Z6F A;  3G30 A;  1IYO A;  1G5U A;  2OWJ A;  3P98 A;  3K2N A;  4X1M A;  4CLC B;  4MNR A;  3IX4 A;  3EGD C;  4E3O A;  1NRJ A;  4WZ5 A;  2V20 A;  2PU4 A;  5CHM A;  1NXY A;  1UGU A;  3UME A;  5GHX A;  2H0Y A;  2X02 A;  4EUV A;  3HL9 A;  2M1C A;  3LI8 A;  4P87 A;  1XX2 A;  3HRE A;  5CTM A;  5L8M A;  4GD8 A;  3DBA A;  4JBF A;  4LFU A;  3NDE A;  2HF6 A;  4MEZ A;  5EVE A;  3LY4 A;  3H9W A;  1PZO A;  2C5W B;  3N8L A;  3VP3 A;  2A24 B;  3CIT A;  2ZQC A;  1NWZ A;  3C7V A;  4ZRR A;  2VKS A;  3GQZ A;  4RYE A;  4MN5 A;  5DTT A;  2VV6 A;  1OJG A;  1RGZ A;  4NEE D;  4Z9Q A;  4ESP A;  4HES A;  1XA1 A;  1ERM A;  2JE5 A;  2KX6 A;  5F83 A;  4AFI A;  5CEB A; 
#chains in the Genus database with same CATH homology
 1D06 A;  2PHY A;  2PDR A;  4MN7 A;  5J7E A;  3LIF A;  4BBU A;  2JKT I;  3S7N A;  2ZMF A;  4R6L A;  1V9Z A;  4HNB A;  2W3E A;  4EES A;  1P9R A;  1W63 M;  4DN0 A;  3T4Q A;  4NXF A;  4HHD A;  4MMN A;  2O9C A;  5F5Y A;  2PT7 A;  2V9A A;  2GNX A;  2GJ3 A;  4WL9 A;  3V67 A;  1YKD A;  4WEL A;  5TBM A;  4ARZ A;  2KDK A;  3NJA A;  3FPV A;  2PD8 A;  4HIA A;  4UQI S;  4DJ2 A;  3PBO A;  1S1Z A;  3ULF A;  2XRO A;  3LIE A;  4KQO A;  4CQH A;  2B18 A;  1T1B A;  3UB9 A;  2A2L A;  3RH8 B;  3MR0 A;  5K5B A;  2HV1 A;  1BYW A;  2A24 A;  4BMW A;  2J3T C;  4WEK A;  2W0N A;  3UB8 A;  4M4X A;  3UE6 A;  3BJN A;  1UWN X;  3UE3 A;  1F9I A;  3R7W B;  3H82 B;  1VB6 A;  4NXG A;  3RTY A;  4GW9 A;  2Z6C A;  4K08 A;  5IT5 A;  3LYX A;  3NOU C;  4EER A;  2PYP A;  1TS6 A;  4DJ3 A;  2NUT C;  4NXE A;  3BQ8 A;  3TW8 A;  3IBR A;  1LSW A;  3KO6 A;  3MJQ A;  4LRX C;  4LRZ E;  3PBQ A;  3PBR A;  1P9W A;  1H3Q A;  3A0R A;  2V0U A;  4CLC D;  2PYR A;  4IHQ A;  4EET B;  5C5K A;  3KSI A;  2XA7 S;  4HP4 A;  2OAP 1;  5F68 A;  3KSH A;  4UEY A;  2PR6 A;  3BY9 A;  2O9A A;  3O5Y A;  2O0Y A;  1YSQ A;  3F1N A;  3T4J A;  3VE3 A;  3LR5 A;  3EEA A;  3E0Y A;  3HJI A;  5HPI A;  3CLO A;  2EWV A;  4JGQ A;  2PD7 A;  5J3W A;  5DFX A;  3F1P A;  4Y3I A;  2V1B A;  3FG8 A;  3PR6 A;  3E4Q A;  2Y79 A;  3LID A;  3R7W A;  3E4O A;  1DP6 A;  4Z1W A;  4KQD A;  4P6Z S;  4XT2 B;  1TS8 A;  4I3I A;  5HWW A;  2J3W A;  2VGL M;  2W3D A;  3OC2 A;  4H6J A;  1OT6 A;  4PKY G;  1D7E A;  4R70 A;  3CUE A;  2PR5 A;  4G3V A;  2DMW A;  4HI4 A;  5HSQ A;  3GDI A;  2R78 A;  1TS7 A;  3MQQ A;  2NUP C;  3OCL A;  3BWL A;  4Q0J A;  3E98 A;  4GS9 B;  3A0V A;  2QKP A;  4B93 A;  2VZW A;  4II7 A;  4FOF A;  4IUH A;  2JKR I;  3NHQ A;  3C2W A;  2WKR A;  3EEH A;  3VE4 A;  3VOL A;  5J4E A;  2VA0 A;  4ETX A;  1H8M A;  2JN7 A;  3G6O A;  1OTD A;  4LRY C;  5HL6 A;  3B33 A;  4MN6 A;  1S67 L;  1XFQ A;  2VEA A;  1EW0 A;  2EWW A;  3OLO A;  1S66 L;  1TF1 A;  5CX7 A;  2CMN A;  4HJ3 A;  4WEJ A;  4Y5F A;  2J80 A;  1S1Y A;  2V0W A;  4CLC C;  3CUE C;  3K3D A;  4BBT A;  5HDD A;  4EXO A;  1OTA A;  4HJ4 A;  1LT0 A;  3JVV A;  1S4R A;  4L9G A;  4Q0H A;  3LR4 A;  5F6A A;  2QWS A;  4LLO B;  2O99 A;  2QJ7 A;  3TRC A;  4O0P A;  3H7W A;  3LIA A;  4G3K A;  2W3F A;  4I38 A;  1F98 A;  1T18 A;  3C30 A;  2ZMV A;  4R3A A;  1NLZ A;  2VV7 A;  3NOP C;  5HD5 A;  2OOL A;  4GHI B;  3ZYT A;  3EQU A;  4HH3 A;  4IUK A;  2W27 A;  2W1T B;  2VJW A;  4OOM A;  4GCZ A;  3MQ0 A;  2GX5 A;  3JVU A;  1GSX A;  4Y2F A;  3EOI A;  1VHM A;  3FC7 A;  3R4K A;  4YNR A;  4HQA A;  2P04 A;  5AVE A;  1Y28 A;  1W63 Q;  1OTB A;  2D02 A;  2Y8H A;  3EQV A;  3LUQ A;  1WA9 A;  5HWT A;  4I5S A;  4R38 A;  4PAU A;  3BQA A;  2FZ0 A;  3EWK A;  2OAQ 1;  2Z6D A;  3LR3 A;  1ODV A;  4ETZ A;  3T4K A;  2EA9 A;  2M7V A;  1G6O A;  3KYQ A;  1JNU A;  2JKR M;  2KLI A;  4WUJ A;  3U2A A;  4FSF A;  2JKT M;  4BBV A;  3C38 A;  4L9F A;  4I3J A;  4NKP A;  3KSG A;  1S4S A;  3CI6 A;  2LB5 A;  2ZOH A;  3MMH A;  2VX8 A;  5F69 A;  5FL3 A;  1DRM A;  3RFB A;  1KOU A;  3W2Z A;  1OPX A;  3OBF A;  1MZU A;  1STZ A;  5MC7 A;  4UQI M;  5EFW A;  4O8G A;  3NOT C;  1ZHH B;  2L4R A;  3H82 A;  1X0O A;  3KSF A;  3UMD A;  1OJ5 A;  3T4S A;  4DMZ A;  1N9N A;  2B02 A;  4PKY A;  1LSV A;  1TD5 A;  2V1A A;  1N9O A;  1V9Y A;  4EEU A;  2JHE A;  2KOI A;  4ARZ B;  1GSV A;  4QPR A;  4YWZ A;  2XSS A;  4O01 A;  1XJ6 A;  4IJG A;  5I5L A;  1G28 A;  5KSH A;  2WKQ A;  4WLA A;  5DKK A;  2K7S A;  3OOV A;  2W3H A;  3EGX C;  3LFV A;  1OTI A;  3GEC A;  3MF0 A;  2XRN A;  5AVF A;  1T19 A;  1UWP X;  2IA2 A;  5DKL A;  2L0W A;  2I9V A;  5LBR A;  4I3A A;  1IOU A;  3T4L A;  4GLQ A;  3PBS A;  4JGP A;  2OWH A;  4I39 A;  4F3L B;  3IS2 B;  4LPZ A;  3T4O A;  1LL8 A;  4EEP A;  3K3C A;  5HWV A;  4OOL A;  3LIB A;  4MDZ A;  4Q0I A;  4HJ6 A;  3E4P A;  3P01 A;  1DP8 A;  2XA7 M;  4KUK A;  5A8B A;  2K31 A;  3S7P A;  5G4Y A;  5DJU A;  5G4Z A;  2HJE A;  3MQO A;  4RQ9 A;  4G3W A;  4KUO A;  4XT2 A;  4BJP A;  3MXQ A;  1F5M A;  4PHT A;  5IS1 A;  3MFX A;  2LB9 A;  4WF0 A;  3KX0 X;  4BWI A;  3PBN A;  1P97 A;  2VV8 A;  3TE8 A;  4HP9 A;  1OTE A;  3D72 A;  1LSX A;  1XJ3 A;  1MKM A;  3UB6 A;  4P6Z M;  2M7U A;  2BAS A;  2W3G A;  4GS9 A;  1TS0 A;  3F1N B;  4ME4 A;  1MC0 A;  2QJ5 A;  3IBJ A;  5HZH A;  1T1C A;  3F1O B;  4L0L A;  1YAX A;  2VGL S;  2W1R A;  3A0S A;  4MCW A;  3TJZ C;  3PBT A;  3F1P B;  3PXP A;  1ZTU A;  3UB7 A;  2H28 A;  2ZBB A;  2YKF A;  3B42 A;  3BW6 A;  2GZA A;  4F3L A;  3IS2 A;  5DF9 A;  3VV4 A;  4GJ4 A;  5AJG A;  3HJK A;  4B9O A;  1N9L A;  4L9E A;  5HPF A;  1IFQ A;  2OWJ A;  1OT9 A;  4H6J B;  1DP9 A;  1T1A A;  3K2N A;  4CLC B;  3T50 A;  1NLY A;  3EGD C;  3OCN A;  4WN5 A;  1NRJ A;  4YOF A;  2WKP A;  1UGU A;  3HCY A;  2K2N A;  3UME A;  4EUV A;  1GSW A;  5TJJ A;  2M1C A;  3LI8 A;  5DFY A;  2YKH A;  4HY8 A;  2D01 A;  1YSP A;  3FPW A;  2MJ6 A;  4GHI A;  1P0Z A;  5L8M A;  3DBA A;  5HD3 A;  2HF6 A;  2W1T A;  4HH2 A;  2J3T D;  1XJ2 A;  5TBM B;  2P7J A;  2VLG A;  3H9W A;  1XJ4 A;  3LIC A;  2O9B A;  3F1O A;  4EU0 A;  3B47 A;  2L1M A;  4JGR A;  3CAX A;  3P7N A;  3S7O A;  4NXB A;  3LI9 A;  5DJT A;  4EQ1 A;  3C8C A;  3CWF A;  5KIZ A;  3PYP A;  2P08 A;  2QHK A;  2INW A;  1XFN A;  5HDS A;  2A24 B;  3H7W B;  3KYZ A;  3PHY A;  2HGV A;  3LR0 A;  3SW1 A;  4EW7 A;  3CIT A;  5HDC A;  3ICY A;  4E04 A;  1NWZ A;  4ZRR A;  2VKS A;  4HOI A;  3T4T A;  2G7U A;  4MN5 A;  4CLC E;  3ZQ5 A;  4CLC A;  2VV6 A;  2QYB A;  1OJG A;  4NEE D;  2FH5 A;  5IU1 A;  3BY8 A;  2ZOI A;  2KX6 A;  4JGO A;  3S7Q A;  4AFI A;  3D3O A;  2HJ9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...