1S4RA

Structure of a reaction intermediate in the photocycle of pyp extracted by a svd-driven analysis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Protein kinetics: Structures of intermediates and reaction mechanism from time-resolved x-ray data
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s4rA00
3MXQA 4EETB 2EA9A 4L9GA 5HDCA 4LRYC 5F5YA 2I9VA 4PKYG 1OTAA 3CWFA 2YKHA 1OT6A 3NOPC 1S4SA 3F1OB 1G28A 1XJ2A 5F69A 4EERA 2CMNA 4HJ3A 3BWLA 4HP4A 4L9FA 2PHYA 2R78A 1F98A 1XJ3A 4BBUA 3LYXA 5KIZA 4JGRA 3C8CA 5DKLA 4XT2A 1OTDA 2VV7A 1XJ4A 2V0UA 1OTBA 1Y28A 2QJ7A 2VEAA 1VB6A 5EFWA 1S1ZA 4HIAA 2A24B 4I5SA 1UGUA 2PR5A 3IS2B 3NHQA 4HY8A 1D06A 1MZUA 4GS9B 1TS7A 3EEHA 2PD8A 4LPZA 5DJTA 4LLOB 2H28A 5J3WA 2B02A 3F1NB 3ZQ5A 3LI9A 5TBMB 1LSXA 3LIFA 4KUKA 3G6OA 3E4QA 3LIBA 2W27A 4PKYA 1T1CA 3NOTC 1KOUA 3LI8A 4WF0A 2VV8A 3IBRA 5J7EA 5HD5A 1EW0A 1UWNX 4WL9A 2PD7A 3F1OA 4HH2A 3LUQA 3UB6A 1XFQA 3UMEA 1OT9A 4KQDA 4YWZA 3RH8B 4EESA 4F3LB 3C2WA 3MJQA 1OJ5A 1D7EA 5HWTA 5DJUA 5AVEA 1X0OA 3H7WA 4NXGA 4GW9A 2OWJA 4EQ1A 2P7JA 2M1CA 4BBVA 2J80A 1LSWA 4I3IA 3ICYA 2A24A 1UWPX 3BY9A 3F1PB 4L9EA 1TS0A 4EEPA 4WLAA 2L0WA 2L1MA 2D02A 3A0RA 1LL8A 3NJAA 2JHEA 3GDIA 3K3CA 1GSWA 3F1NA 3LICA 1V9ZA 5TBMA 5DKKA 4R3AA 4I39A 4HJ4A 3FG8A 4LRXC 1XFNA 2ZOIA 4GCZA 5G4ZA 3VE4A 1V9YA 1S66L 1T1AA 5HWVA 1JNUA 2OWHA 2D01A 2ZBBA 4HP9A 3BY8A 1N9NA 3VOLA 5HWWA 1T18A 4M4XA 4I3AA 4B9OA 4E04A 1T1BA 2VLGA 4H6JA 3VE3A 5F6AA 3ULFA 3MR0A 2PYPA 3PHYA 3NOUC 3LIDA 2ZOHA 1DP9A 3MQOA 3H82B 4R70A 3K3DA 4DJ2A 3SW1A 3MQQA 4GHIB 4WN5A 1LSVA 2YKFA 3CLOA 2V1BA 1OTIA 4JGOA 3E4OA 4I3JA 2OOLA 5HD3A 2QKPA 4HHDA 2QHKA 1GSVA 5HDDA 2KDKA 1OJGA 4MN6A 4K08A 5IS1A 4JGQA 3LIAA 3RTYA 2WKRA 3UMDA 2WKQA 2INWA 1DRMA 2KX6A 4HH3A 5IU1A 1OTEA 4JGPA 1F9IA 4HI4A 3B33A 3IS2A 1BYWA 2V9AA 3FC7A 4GS9A 1P0ZA 2V1AA 3H9WA 2BASA 5G4YA 5J4EA 1S4RA 3UB8A 2PYRA 2GJ3A 5I5LA 2Z6DA 2WKPA 2Z6CA 3LIEA 1NWZA 1DP6A 2HV1A 3D72A 1T19A 5HSQA 3EWKA 4NXBA 3KX0X 2PR6A 1WA9A 3HJIA 1TS6A 4HNBA 3UB7A 4MN5A 4EEUA 3H7WB 3H82A 4R38A 2PDRA 1TS8A 1DP8A 2QWSA 4GHIA 4DJ3A 2L4RA 5F68A 3HJKA 4HQAA 3T50A 5A8BA 4NXFA 3A0SA 4NXEA 3A0VA 3MFXA 5HZHA 4EW7A 4I38A 1ODVA 4F3LA 4RQ9A 3OLOA 1P97A 2W0NA 5AVFA 3E4PA 3P7NA 1S1YA 2QJ5A 4XT2B 5HDSA 2V0WA 2K7SA 3UE6A 1GSXA 4EXOA 3PYPA 4HOIA 4WUJA 3GECA 3CAXA 1LT0A 3F1PA 1XJ6A 4LRZE 4BBTA 3UB9A 2JN7A 4KUOA 1N9OA 4R6LA 2VV6A 1S67L 1N9LA 4HJ6A 4H6JB
chains in the Genus database with same CATH superfamily
4GDNA 2HDQA 5FI2A 3NI9A 2FH5A 2JKRM 2I9VA 2XR0A 5E2GA 4C6YA 1KGFA 3B3XA 1OTAA 3BW6A 2YKHA 1OT6A 3TE8A 4OPYA 4LFUA 3F1OB 3BLMA 4XUXA 5EVIA 1XJ2A 3IX4A 5DFXA 2ACGA 4N1HA 3IT9A 4HJ3A 1IOUA 2LB5A 4KZ3A 2Q9MA 4JKTA 3NCKA 4WMCD 5AQ9A 5DF7A 1SKOB 2R78A 3TJZC 1F98A 1FCMA 3HVFA 3PBRA 4E3NA 1H8YA 4XUZA 4BBUA 5KIZA 4LV2A 4Y17A 1XJ4A 3ZYTA 3V3SA 3GV9A 3MQ0A 2J8YA 1O7EA 2A24B 4I5SA 3DAVA 3WS5A 2PR5A 5FEFA 2GDNA 2X02A 1RGYA 1YAXA 1MZUA 3BECA 4MBKA 4U0TA 2PU4A 3IF5A 4LLOB 5J3WA 2WK0A 5TBMB 1LSXA 1BLSA 5M19A 4X68A 3BQ8A 3MZDA 4Q0IA 3IX8A 2ZJ9A 4RA7A 3ZVWA 2XD5A 2VGLS 4PKYA 1U60A 4OQ0A 3UE0A 1KOUA 1GHIA 3LR0A 4WYYA 1FSYA 1J3WA 3LI8A 3JVVA 4QY5A 3PAEA 4YOFA 3LEZA 2ZMAA 3OBFA 3F1OA 3V50A 4Q0HA 3UMEA 4IUKA 4YWZA 2O9BA 1D7EA 3MKFA 4X6TA 1K54C 5EM1A 5HWTA 2IA2A 2A2LA 1X0OA 2M7UA 3A3JA 4OQHA 4GW9A 3Q07A 4EQ1A 2HDSA 2M1CA 2ZQCA 2WGWA 2A24A 1UWPX 3BY9A 4LCLA 3F1PB 1NLYA 1Q2QA 1S0WA 1H3QA 5K5BA 4KG2A 2P74A 2IWBA 2WGIA 3K3CA 3U2AA 4D60A 5TBMA 2UV0E 4EUVA 4OQIA 2OAQ1 3MXRA 3PAGA 1LLBA 3BLSA 3VSLA 3ITAA 5KSHA 4HEFA 4IEDA 3OC2A 1E3UD 2XH9A 1PWDA 5FAPA 1HD8A 3VE4A 4UQIM 1YSPA 3Q82A 4Y3IA 1K4EA 1S66L 1MWUA 3ZHHA 4C75A 1T1AA 5TFQA 2WUQA 1JNUA 4KQOA 3T1XA 4MBHA 4N9KA 1N9NA 3V3RA 1YQSA 3Q7VB 1J9MA 4M4XA 3Q81A 4JXGA 3N8SA 2EX2A 3G2ZA 2XF3A 5F6AA 2HF6A 1OPXA 4GZBA 1NLZA 2WAEA 3NOUC 3MQOA 3HLGA 1PI4A 5HAPA 1WE4A 3SW1A 5CXWA 4OPRA 1G68A 2WKHA 1IKIA 2XSSA 1MY8A 2YKFA 4B93A 3VP4A 1MC0A 1STZA 1OTIA 3PBOA 4I3JA 4HBUA 2OOLA 5HD3A 1L3LA 3C30A 5FQKA 2ZD8A 3VMAA 2QHKA 2EX6A 4RX3A 4QJGA 1YT4A 4KZBA 3NBLA 1JWPA 2Z2MB 5CHMA 2OSUA 3A3IA 3LIAA 3ZNTA 3RTYA 5D3OA 2W1TA 1H0MA 2DRWA 2JKTI 1I5QA 4PMAA 2KX6A 4HH3A 4GD6A 4JGPA 1K25A 4A5RA 2FZ0A 4OH0A 4DE2A 3IH9A 3M6HA 1BLPA 4Y0OA 5FQMA 4LGWA 5J4EA 3UB8A 2PYRA 3Q7VA 4S2NA 5L07A 1NWZA 3IF6B 4HBTA 4WMCA 5LBRA 3KX0X 3O5YA 1FCNA 2PR6A 4OP8A 2J9OA 1CEFA 2MJ6A 1PWGA 2RCXA 1NRJA 3VFHA 4OLGA 2XK1A 5A90A 1M40A 3G4PA 3EGXC 3ISGA 3CUEA 3MF0A 1ERQA 5A8BA 4WZ5A 3E98A 3A0VA 5HZHA 1ODVA 4II7A 2W0NA 3E4PA 4QD4A 1PFLA 1GCEA 4MBFA 1Z09A 4FH2A 2OLVA 1BTLA 1VQQA 1GSXA 4O0PA 1YLTA 4JLFA 3WS4A 3R7WB 5EUAA 3IXGA 4IHQA 1YLZA 5E2FA 1LT0A 3S22A 2J3TD 4ETZA 3T1RA 2V8CA 2JN7A 4KUOA 3PBSA 3TG9A 2DCFA 4R6LA 2G2UA 4DXBA 1N9LA 1DJCA 2ZC7A 2W3FA 4B4XA 4DF6A 2OAP1 1N9BA 3KYQA 3IF6A 1BULA 1ZTUA 4CLCB 4EETB 4U3TA 2EA9A 5GL9A 4OPZA 1DJAA 3T4JA 4L0LA 4P87A 3L7HA 3NOPC 3S7NA 4WEKA 1SDNA 4UHUA 5F69A 4EERA 3BWLA 3AGEA 2ZM0A 4RYEA 4OOLA 3LR5A 4MN7A 5GLBA 4L9FA 4PM5A 1D1JA 2LB9A 3PXPA 4ZJ1A 4R4SA 4E3OA 3OCLA 5FL3A 3LYXA 5EECA 3OCNA 4BL3A 5FAOA 3C8CA 3HLWA 2VV7A 3CMZA 5HAQA 3CG5A 3V67A 2HP9A 3WRTA 2QJ7A 4EUZA 3GRJA 2XA7S 4IJGA 1E3UA 4HIAA 3SS3A 2Y55A 3R7WA 4N9LA 1TS7A 2HDUA 1MKIA 3Q7ZA 1VETB 3MXSA 3PBNA 2B02A 2GNXA 5FQIA 3CPTB 2G2WA 4JXVA 5JYOA 4RX2A 2W27A 3HREA 3C5AA 1BSGA 4CLCA 4KZ6A 1TD5A 3BFEA 4WF0A 4U0XA 2P9VB 2JKTM 4UA6A 5HD5A 1EW0A 4WL9A 1ZC2A 4NETA 5HPIA 4OPQA 4DMZA 4X25A 1RGZA 1OT9A 1SZVA 4EESA 4BLMA 5GHYA 4F3LB 3MJQA 3OPLA 1OJ5A 4X53A 5DTKA 4B4ZA 3IXBA 1PW8A 2V20A 5KMWA 1YM1A 4FCFA 4KZ4A 3SS4A 1YMSA 3T4OA 5CEDA 3H7WA 3ZG8B 1IFQA 2RL3A 1YLWA 2XROA 1TEMA 3VOZA 4BBVA 3KYZA 1W5DA 4K0XA 4I3IA 3IWQA 2HP6A 5FDHA 4XXRA 5M1AA 2EX9A 4PM7A 3ZG5A 4DKIA 1AXBA 1Y4OA 5GLAA 2WYXA 4DDSA 3GDIA 1IYSA 5DF8A 4BWIA 5FSRA 4LCMA 2E8JA 3B47A 3LICA 1V9ZA 2J3TC 3S4XA 3O86A 4GJ4A 3CPTA 4QHCA 3W8KA 4I39A 3FG8A 1ZHHB 2Y2IA 3FZCA 2EXBA 1Q2PA 4GCZA 5GLDA 3BM6A 1OMEA 4OONA 2P9VA 4OQGA 4S2KA 2IWDA 4OKPA 4WEJA 4E6XA 1G5UA 2R9XA 2BTFP 4UAAA 3IH8A 1T18A 1FR6A 5EM0A 1T1BA 2VLGA 4H6JA 2V1ZA 3M2KA 3C4OA 1A0KA 2Y2JA 3PHYA 2XD1A 2ZOHA 3H82B 4R70A 5A91A 2V8FA 4N92A 3UO9A 2H0YA 1MPLA 5HPFA 3C7UA 3CZDA 1XKZA 2W1RA 5IHVA 4JGOA 2ZQAA 4DRTA 2K2NA 5AJGA 4IVKA 4PHTA 4DE0A 4QPRA 3WS0A 4HHDA 2M7VA 3K2NA 4GDBA 4JBFA 1SKOA 3UE1A 1GSVA 2PT7A 2O0YA 1M6KA 2QPNA 3LGOA 3KSIA 4MN6A 3VOYA 4K08A 1HZOA 4ZAMA 1KDSA 2WKRA 2EFXA 2WKQA 3TRCA 2INWA 1DRMA 4LENA 3G35A 4P6ZM 4G3VA 1F9IA 2PRFA 5FA7A 1XXMA 4ID4A 1BYWA 2V9AA 1IYQA 2Q0OA 2OV5A 1P0ZA 1PW1A 2ZLYA 3DTEA 4X56A 3ITBA 3S7PA 2ZQDA 4R3JA 1L0DA 4KQQA 5EE8A 5I5LA 1E4DA 3MZFA 1DP6A 2HV1A 4EV4A 2Y8HA 2BLSA 5BOHA 3HJIA 1TS6A 4B88A 4MN5A 3BFFA 3H82A 1KDWA 3IWIA 4JPMA 2HZ5A 3CI6A 3N4IA 4IVIA 2QYBA 1NJ4A 5A92A 1WYBA 3UDXA 4HQAA 2VK3A 5HAIA 4EBPA 3MFDA 2PBYA 3LR3A 1CF0A 3A0SA 4I38A 3QNCA 5FAQA 3UB5P 3HLEA 3R4KA 5AVFA 4AFIA 3QP1A 4CLCD 4S2NC 3FWLA 3HUMA 1BLCA 2KOIA 3CJMA 2QJ5A 4YNRA 2HDRA 5HDSA 1N4OA 5FASA 2K7SA 3UE6A 2BG1A 1TF1A 3MKEA 1FQGA 1BT5A 2PAVP 3LY3A 3N8RA 2P08A 3E0YA 3UY6A 3VFFA 1PNEA 3F1PA 3W4OA 4P0MA 1XJ6A 1SDEA 3CUEC 4WZ5C 1NRFA 2XQZA 4ZBEA 2IWCA 4F94A 5FQ9A 4FOFA 1SCWA 1NZUA 1EI5A 4HJ6A 4IUHA 3JYIA 1EROA 2Y2LA 4PPRA 3DW0A 3MXQA 2O9AA 3AGFA 1CI9A 5F82A 4X55A 3UDIA 5HARA 2WKIA 1LHYA 5IT5A 1CK3A 3IHAA 1K55A 1S4SA 2VGLM 3HCYA 2Q9NA 4WM9A 5U47A 5E43A 5E2HA 1H8MA 3ZNYA 1K6RA 1K4FA 3IXDA 1PRQA 3WRZA 1H8ZA 4E3LA 4EU0A 4GD8A 3GVBA 1IEMA 4CQHA 1VEUB 2ZL1B 3UNWA 4QWOA 3ZDJA 1ZG6A 3S7QA 4YFMA 4JXSA 1IELA 1F5MA 3WS1A 5EOOA 3GQZA 3IF6C 5DKLA 3DTIA 1O07A 2JKRI 1OTBA 1Y28A 4KZ8A 1Y54A 3P09A 2VEAA 1VB6A 4O01A 1LL9A 3ZVTA 5FEGA 1W8QA 1UGUA 4DN0A 3IS2B 4E6WA 4OVDA 4HY8A 1D06A 4EQIA 3C7VA 4GS9B 4LV1A 3EEHA 5DJTA 4CJNA 3O3VA 2W3DA 1ES2A 4P85A 1ONGA 3ZQ5A 3LI9A 3LIFA 5HL1A 4KUKA 4R0QA 3FKWA 4GKUA 3E2KA 4BMWA 3T12B 4FH4A 1T1CA 1I2WA 1GA9A 1GHMA 2ZM2A 5TGFA 1KE4A 2ZC3B 2VV8A 1K56D 2K31A 3IX3A 3N8LA 4DDYA 1WYCA 4E3KA 3IBRA 3QP8A 3PTEA 1JVJA 4NKPA 1UWNX 2PD7A 3UN7A 4HH2A 3LUQA 5DTTA 2VKSA 3UB6A 1NXYA 5L8MA 2HPBA 3T4LA 1FCOA 3RH8B 3WWXA 1IYOA 3T1SA 3C2WA 1ALQA 2VGJA 5HFOA 3QP6A 2GX5A 4C3QA 1E25A 1VEUA 4UEYA 5DJUA 5AVEA 1KE0A 2O9CA 2ZL1A 4ME4A 3LO7A 1K0KA 3NECA 1F2KA 3JVUA 2JKFA 2GZAA 4CLCC 5HW3A 2OWJA 3UE3A 3KSHA 2J80A 3IWOA 4K91A 3RFBA 4P6BA 2X71A 3DTKA 5CECA 4WELA 4L9EA 3MSHA 1LI9A 4EEPA 4PM9A 2HJ9C 4WLAA 3IXHA 1MWSA 2L0WA 2L1MA 3A0RA 3OZHA 3NJAA 1ACFA 3FPVA 1TVFA 3EOIA 1IKGA 4QY6A 3DTMA 2W3HA 4FD8A 1ESUA 1W8YA 1NZOA 1C3BA 1MWTA 5CGWA 2XGNA 3BRMA 4ZDXA 5FDSA 1ONHA 1L0GA 3HUNA 2ZOIA 3MZEA 5DVAA 4MMNA 4QB8A 5EVIB 5HWVA 2ZBBA 2D01A 3KO6A 2Y2MA 3QNBA 4I3AA 4B9OA 4E04A 3AGDA 3VE3A 3UPPA 3A3DA 3ULFA 3C4PA 3MR0A 4OOMA 4Z1WA 3Q1FA 3W2ZA 2PYPA 2WGVA 4KZ7A 1SHVA 3MBZA 4G3WA 4BENA 3NDGA 1CQAA 1DP9A 5CX7A 2XFSA 2Y4AA 3G32A 1BUEA 3K3DA 4DJ2A 4JF5A 1L0EA 5EOEA 1W7FA 3IQAA 1LSVA 1TDGA 3CLOA 3EQUA 3LFVA 2V1BA 2ZC6B 3VP1A 3P01A 3SOIA 2ZM8A 3E4OA 5EVLA 3N7WA 1CEGA 4PM8A 4X1MA 3ZCZA 2QKPA 3VP3A 3BFGA 3DBAA 5JYPA 5HDDA 2KDKA 1OJGA 4YINA 2I72A 4UQIS 4QU3A 2JE5A 5IS1A 4RVAA 1KE3A 4S2LA 4KQRA 2VA0A 3ZG9B 3UMDA 2JBFA 4S2PA 4GNUA 2ZQ8A 4FTXA 2NUTC 1S6RA 4ZRRA 3FC7A 1ZKJA 4ZJ2A 3HLDA 1CI8A 2V1AA 2WZZA 4NK3A 3G2YA 3H9WA 1MWRA 1S4RA 1VETA 1P9RA 4Q8IA 1PZOA 2Z6DA 2WKPA 2Y2OA 3D72A 1T19A 5FI7A 2Z2LB 3EWKA 4NXBA 1JTDA 1WA9A 4K0WA 1FIKA 2V2FF 3UB7A 3VV4A 3GR2A 4EWFA 3WS2A 5F1FA 2PDRA 3S1YA 2EWVA 3SH9A 5CERA 4MEZA 3BYDA 3RXXA 4O8GA 1LL5A 1MXOA 1ES3A 2WGWB 4NG2A 2C6WB 3MFXA 4F3LA 4RQ9A 5F1GA 4BD0A 1P97A 2ZC4B 2Y2KA 3LEQA 1HLUP 3P7NA 1S1YA 5KZHA 4GLQA 3ZFZA 3BFCA 1QMEA 3D3OA 2Y2QA 1YLYA 5AQAA 3QHYA 4XT2B 2H10A 4M3KA 2HGVA 4ZJ3A 4MNRA 1G6AA 4JF4A 2V0WA 2Y59A 5M18A 2DMWA 4ESPA 4EXOA 2Y2NA 3PYPA 2Y2HA 3LY4A 3UDFA 1K56A 4WUJA 1ERMA 3GECA 1XP4A 2PBDP 3CAXA 3V39A 3HLFA 3HUOA 1GHPA 3B42A 4IBXA 1FILA 2ZQ9A 4UA9A 4DE1A 2XA7M 4Y7PA 1XA7A 2VV6A 1S67L 3NC8A 3IHBA 5MC7A 2G7UA 5KSCA 1AWIA 3T1QB 5GHZA 3T4TA 4GB7A 2WADA 3KYEA 2R9WA 1NY0A 5CHUA 4L9GA 5HDCA 4LRYC 5F5YA 4PKYG 2JCHA 4Q0JA 5CGSA 3CWFA 3SZTA 1PWCA 3FPWA 3A3EA 4KZ5A 3VP0A 5DTSA 1G28A 2VGKA 4DE3A 4OP5A 3E2LA 2B18A 2CMNA 2WZXA 4KENB 4R23A 2CC1A 5FI6A 2H5SA 3HBRA 3NULA 5E2EA 2QZ6A 4HP4A 3L9KA 4S2MA 3MMHA 3UPNA 1ZG4A 1K57C 2PHYA 1YLPA 1NYMA 3O88A 1XJ3A 3S7OA 5G18A 4JGRA 2XDMA 2WAFA 2JC7A 4XT2A 2W1TB 1OTDA 2V0UA 4ETXA 3RJUA 1EWZA 1W63Q 1FOFA 3EQVA 3KSGA 1ES5A 2WKEA 3D4FA 5EFWA 3NDEA 1S1ZA 5AQBA 2P04A 3NHQA 1K55C 3D9YA 2VJWA 2O99A 4KZ9A 4ARZB 5DF9A 2PD8A 4LPZA 5A93A 1ES4A 1K54A 1VHMA 2H28A 2EXAA 2XRNA 4S2OA 3F1NB 5CRFA 1YLJA 1YKDA 3G6OA 3OPRA 1TDLA 5CGXA 3W4QA 3E4QA 3LIBA 3P98A 4FSFA 3O87A 5CEBA 4MLLA 3NOTC 3GMWA 2UWXA 5FQQA 5EPHA 4UA7A 2W3GA 3FKVA 2VX8A 3OPPA 3UPOA 1PZPA 5J7EA 5EV0A 4E3JA 3M2JA 3T4KA 2Y2GA 1FR1A 2XEPA 3FYZA 1K57A 1XFQA 1BLHA 4JF6A 3HLBA 4ZTKA 4KQDA 1PYYA 3T4QA 2W3EA 5C5KA 2HP5A 3ZG7B 4S2IA 2X01A 3VSKA 3RXWA 4O7DA 4E3MA 3GTCA 2FFYA 1KVMA 4CPKA 4MDZA 4PM6A 1QMFA 1DJBA 4NXGA 3BQAA 4GN2A 2JKGA 5EVID 3C38A 3M6BA 1IYPA 5I94A 4R3BA 4Y15A 1W79A 2P7JA 4IBRA 1LSWA 3ICYA 4NEED 4KZAA 2Y79A 1TS0A 4BQMA 1KGGA 2Y2PA 1YMXA 4ARZA 1P9WA 2D02A 1LL8A 2JHEA 4PAUA 3V5MA 1GSWA 4Y2FA 1I2SA 3QP4A 3F1NA 1HTZA 5DKKA 4WBGA 4GOGA 3QP5A 2PU2A 5GHXA 5GLCA 4R3AA 4HJ4A 2HJEA 3OOVA 1RCJA 4LRXC 1XFNA 2C5WB 3PBTA 3CHWP 2XLNA 4JXWA 3OPHA 4CLCE 5G4ZA 5HX9A 1V9YA 5CTMA 1KVLA 2FFFB 1GA0A 2OWHA 4MCWA 4HP9A 3BY8A 3BJNA 1H5XA 3VOLA 5HWWA 2OLUA 4WZ4A 3MS6A 1HVBA 1ESIA 3PR6A 3PBQA 1JWZA 1SKFA 1DY6A 2VZWA 3LIDA 3BFDA 3EEAA 2ZC5B 2B5RA 2EFUA 1YPRA 5L2FA 3MQQA 1XX2A 5DFYA 3BEBA 4GHIB 1MBLA 1JWVA 4WN5A 1LI0A 1CJFA 2H0TA 1XA1A 1FSWA 2DNSA 3LR4A 5L09A 3LCEA 3TOIA 3W4PA 4Y13A 4BL2A 3FV7A 3GSGA 1L2SA 4BJPA 3A3FA 3TW8A 5TJJA 4OOYA 4JGQA 1L0FA 1YSQA 1JTGA 3KSFA 3CITA 1K38A 3TSGA 1Z6FA 5IU1A 2J3WA 1OTEA 4HI4A 3B33A 3IS2A 4EBLA 2QMIA 3ZG0A 2XFTA 1XGJA 4GS9A 4EBNA 3DWKA 2EWWA 1NYYA 2BASA 5G4YA 4HESA 2GJ3A 2Y91A 3QP2A 1PI5A 1MKMA 4R1GA 2Z6CA 3LIEA 5HSQA 5F83A 1VM1A 2J7VA 4HNBA 1KGEA 4EEUA 2EX8A 4DXCA 4Y0UA 3H7WB 5TR7A 3HLCA 4R38A 2B95A 5HL6A 1TS8A 1XPBA 4R4RA 1DP8A 1XGIA 2QWSA 4GHIA 3DWZA 4DJ3A 4H8RA 4LV0A 2L4RA 5F68A 3HJKA 3JPUA 2A49A 3SS5A 3I7JA 1G6OA 4OLDA 3T50A 4KG6A 4NXFA 3G34A 4Y0TA 4NXEA 2ZMVA 4EW7A 5EVIC 1RP5A 4KG5A 3SH7A 3OLOA 3ZGAB 2AVXA 4E3IA 1PIOA 4P6ZS 2ZQ7A 3NY4A 1W63M 4BD1A 2ZMFA 3SH8A 5EVEA 3G30A 4Y5FA 4N1XA 4S2JA 3HL9A 5CTNA 4HOIA 3T4SA 5CHJA 2NUPC 4X69A 5FQJA 5L10A 3IBJA 1K6SA 3NIAA 3VP2A 4D2OA 4G3KA 4LV3A 5J8XA 4LRZE 2E8IA 4BBTA 3UB9A 1N9OA 4Z9QA 3N6IA 2J9PA 5AQ7A 2A3UA 3EGDC 3G31A 4H6JB 5FATA 3U4LP 2KLIA 1BZAA 4X1LA 4FUWA
chains in the Genus database with same CATH topology
3T4TA 1ZTUA 3MXQA 4CLCB 4EETB 2O9AA 2EA9A 4L9GA 2FH5A 5HDCA 2JKRM 4LRYC 5F5YA 2I9VA 4PKYG 3T4JA 4L0LA 4Q0JA 1OTAA 5IT5A 3CWFA 3BW6A 2YKHA 1OT6A 3FPWA 3NOPC 3TE8A 3S7NA 1S4SA 2VGLM 3F1OB 3HCYA 1G28A 4WEKA 1XJ2A 1H8MA 5F69A 4EERA 2B18A 5DFXA 2CMNA 4HJ3A 1IOUA 3BWLA 2LB5A 4OOLA 4EU0A 3LR5A 4MN7A 4HP4A 4L9FA 2LB9A 3MMHA 4CQHA 3PXPA 2PHYA 2R78A 3TJZC 1F98A 3PBRA 1XJ3A 3S7OA 4BBUA 3S7QA 3OCLA 5FL3A 3LYXA 3OCNA 1F5MA 5KIZA 4JGRA 3C8CA 5DKLA 4XT2A 2W1TB 1OTDA 2VV7A 1XJ4A 2JKRI 2V0UA 4ETXA 1OTBA 1Y28A 3V67A 1W63Q 3EQVA 3KSGA 3ZYTA 2QJ7A 2VEAA 1VB6A 2XA7S 4O01A 4IJGA 3MQ0A 5EFWA 1S1ZA 4HIAA 2A24B 4I5SA 3R7WA 1UGUA 2PR5A 4DN0A 3IS2B 2P04A 3NHQA 4HY8A 1D06A 1YAXA 2VJWA 1MZUA 2O99A 4GS9B 4ARZB 1TS7A 5DF9A 3EEHA 2PD8A 4LPZA 5DJTA 4LLOB 1VHMA 2W3DA 2H28A 5J3WA 2XRNA 3PBNA 2B02A 2GNXA 3F1NB 3ZQ5A 3LI9A 5TBMB 1LSXA 3LIFA 1YKDA 4KUKA 3BQ8A 3G6OA 4Q0IA 4BMWA 3E4QA 3LIBA 4FSFA 2VGLS 2W27A 4PKYA 1T1CA 3NOTC 1KOUA 3LR0A 4CLCA 1TD5A 3LI8A 2VV8A 4WF0A 3JVVA 2K31A 2W3GA 2VX8A 3IBRA 2JKTM 5J7EA 4NKPA 5HD5A 4YOFA 1EW0A 1UWNX 4WL9A 3T4KA 2PD7A 5HPIA 3OBFA 4DMZA 3F1OA 4HH2A 3LUQA 3UB6A 2VKSA 5L8MA 1XFQA 4Q0HA 3UMEA 1OT9A 4IUKA 4KQDA 4YWZA 3T4LA 3T4QA 2W3EA 5C5KA 3RH8B 4EESA 4F3LB 3C2WA 3MJQA 2O9BA 1OJ5A 1D7EA 2GX5A 5HWTA 2IA2A 2A2LA 4UEYA 5DJUA 5AVEA 2O9CA 4ME4A 1X0OA 4MDZA 3T4OA 2M7UA 3H7WA 3JVUA 4NXGA 3BQAA 2GZAA 1IFQA 4GW9A 4CLCC 2XROA 3C38A 2OWJA 4EQ1A 3UE3A 2P7JA 3KSHA 2M1CA 4BBVA 2J80A 1LSWA 3KYZA 3RFBA 4I3IA 3ICYA 2A24A 1UWPX 4WELA 3BY9A 4NEED 2Y79A 3F1PB 4L9EA 1TS0A 1NLYA 4EEPA 2HJ9C 4WLAA 4ARZA 1H3QA 5K5BA 2L0WA 2L1MA 1P9WA 2D02A 3A0RA 1LL8A 3NJAA 2JHEA 4PAUA 3GDIA 3K3CA 3FPVA 1GSWA 4BWIA 4Y2FA 3U2AA 3F1NA 3EOIA 3B47A 3LICA 1V9ZA 2J3TC 5TBMA 4EUVA 5DKKA 4GJ4A 2OAQ1 2W3HA 4R3AA 4I39A 5KSHA 4HJ4A 3FG8A 2HJEA 1ZHHB 3OOVA 4LRXC 1XFNA 3PBTA 3OC2A 2ZOIA 4GCZA 4CLCE 5G4ZA 3VE4A 4UQIM 1YSPA 4Y3IA 1V9YA 4MMNA 1S66L 1T1AA 5HWVA 1JNUA 2OWHA 2D01A 2ZBBA 4KQOA 4MCWA 4WEJA 4HP9A 3BY8A 1N9NA 3BJNA 3VOLA 5HWWA 3KO6A 1T18A 4M4XA 4I3AA 4B9OA 4E04A 1T1BA 2VLGA 4H6JA 3VE3A 3PR6A 3PBQA 5F6AA 2HF6A 1OPXA 3ULFA 3MR0A 4OOMA 4Z1WA 1NLZA 3W2ZA 2PYPA 3PHYA 4G3WA 3NOUC 2VZWA 3LIDA 2ZOHA 1DP9A 3MQOA 3EEAA 3H82B 5CX7A 4R70A 3K3DA 4DJ2A 3SW1A 3MQQA 5DFYA 4GHIB 5HPFA 2XSSA 4WN5A 1LSVA 2YKFA 4B93A 3CLOA 3EQUA 2W1RA 3LFVA 3LR4A 1MC0A 1STZA 2V1BA 1OTIA 4JGOA 3P01A 2K2NA 3E4OA 5AJGA 4PHTA 3PBOA 4I3JA 4QPRA 2OOLA 5HD3A 3C30A 2QKPA 4HHDA 2M7VA 2QHKA 4BJPA 3K2NA 1GSVA 2PT7A 3DBAA 2O0YA 5HDDA 2KDKA 3TW8A 5TJJA 1OJGA 4UQIS 3KSIA 4MN6A 4K08A 5IS1A 4JGQA 3LIAA 1YSQA 2VA0A 3RTYA 3KSFA 3CITA 2WKRA 2W1TA 3UMDA 2JKTI 2WKQA 3TRCA 2INWA 1DRMA 2KX6A 4HH3A 4P6ZM 5IU1A 2J3WA 1OTEA 4JGPA 4G3VA 1F9IA 4HI4A 2FZ0A 3B33A 2NUTC 3IS2A 4ZRRA 1BYWA 2V9AA 3FC7A 4GS9A 1P0ZA 2V1AA 2EWWA 3H9WA 3S7PA 2BASA 5G4YA 5J4EA 1S4RA 3UB8A 2PYRA 2GJ3A 1P9RA 5I5LA 1MKMA 2Z6DA 2WKPA 2Z6CA 3LIEA 1NWZA 1DP6A 2HV1A 3D72A 1T19A 5HSQA 3EWKA 4NXBA 5LBRA 2Y8HA 3KX0X 3O5YA 2PR6A 1WA9A 3HJIA 1TS6A 4HNBA 2MJ6A 3UB7A 4MN5A 3VV4A 4EEUA 1NRJA 3H7WB 3H82A 4R38A 2PDRA 5HL6A 1TS8A 2EWVA 1DP8A 3CI6A 2QWSA 4GHIA 4DJ3A 4O8GA 2QYBA 2L4RA 3EGXC 5F68A 3HJKA 4HQAA 3CUEA 3MF0A 1G6OA 3T50A 5A8BA 3E98A 3LR3A 4NXFA 3A0SA 4NXEA 3A0VA 3MFXA 5HZHA 2ZMVA 4I38A 4EW7A 1ODVA 4F3LA 4RQ9A 3OLOA 4II7A 1P97A 2W0NA 3R4KA 5AVFA 3E4PA 4AFIA 4CLCD 3P7NA 1S1YA 4P6ZS 4GLQA 3D3OA 2KOIA 2QJ5A 1W63M 2ZMFA 4XT2B 4YNRA 2HGVA 4Y5FA 5HDSA 2V0WA 2K7SA 3UE6A 1GSXA 2DMWA 4O0PA 4EXOA 1TF1A 3PYPA 4HOIA 3R7WB 4WUJA 3T4SA 3GECA 2P08A 3CAXA 4IHQA 2NUPC 3E0YA 3IBJA 1LT0A 3F1PA 2J3TD 4G3KA 1XJ6A 4ETZA 3B42A 3CUEC 4LRZE 4BBTA 3UB9A 2JN7A 4KUOA 3PBSA 1N9OA 4R6LA 2XA7M 2VV6A 1S67L 1N9LA 4FOFA 3EGDC 4HJ6A 4H6JB 4IUHA 2W3FA 5MC7A 2KLIA 2G7UA 2OAP1 3KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXQ A;  4EET B;  2EA9 A;  4L9G A;  5HDC A;  4LRY C;  5F5Y A;  2I9V A;  4PKY G;  1OTA A;  3CWF A;  2YKH A;  1OT6 A;  3NOP C;  1S4S A;  3F1O B;  1G28 A;  1XJ2 A;  5F69 A;  4EER A;  2CMN A;  4HJ3 A;  3BWL A;  4HP4 A;  4L9F A;  2PHY A;  2R78 A;  1F98 A;  1XJ3 A;  4BBU A;  3LYX A;  5KIZ A;  4JGR A;  3C8C A;  5DKL A;  4XT2 A;  1OTD A;  2VV7 A;  1XJ4 A;  2V0U A;  1OTB A;  1Y28 A;  2QJ7 A;  2VEA A;  1VB6 A;  5EFW A;  1S1Z A;  4HIA A;  2A24 B;  4I5S A;  1UGU A;  2PR5 A;  3IS2 B;  3NHQ A;  4HY8 A;  1D06 A;  1MZU A;  4GS9 B;  1TS7 A;  3EEH A;  2PD8 A;  4LPZ A;  5DJT A;  4LLO B;  2H28 A;  5J3W A;  2B02 A;  3F1N B;  3ZQ5 A;  3LI9 A;  5TBM B;  1LSX A;  3LIF A;  4KUK A;  3G6O A;  3E4Q A;  3LIB A;  2W27 A;  4PKY A;  1T1C A;  3NOT C;  1KOU A;  3LI8 A;  4WF0 A;  2VV8 A;  3IBR A;  5J7E A;  5HD5 A;  1EW0 A;  1UWN X;  4WL9 A;  2PD7 A;  3F1O A;  4HH2 A;  3LUQ A;  3UB6 A;  1XFQ A;  3UME A;  1OT9 A;  4KQD A;  4YWZ A;  3RH8 B;  4EES A;  4F3L B;  3C2W A;  3MJQ A;  1OJ5 A;  1D7E A;  5HWT A;  5DJU A;  5AVE A;  1X0O A;  3H7W A;  4NXG A;  4GW9 A;  2OWJ A;  4EQ1 A;  2P7J A;  2M1C A;  4BBV A;  2J80 A;  1LSW A;  4I3I A;  3ICY A;  2A24 A;  1UWP X;  3BY9 A;  3F1P B;  4L9E A;  1TS0 A;  4EEP A;  4WLA A;  2L0W A;  2L1M A;  2D02 A;  3A0R A;  1LL8 A;  3NJA A;  2JHE A;  3GDI A;  3K3C A;  1GSW A;  3F1N A;  3LIC A;  1V9Z A;  5TBM A;  5DKK A;  4R3A A;  4I39 A;  4HJ4 A;  3FG8 A;  4LRX C;  1XFN A;  2ZOI A;  4GCZ A;  5G4Z A;  3VE4 A;  1V9Y A;  1S66 L;  1T1A A;  5HWV A;  1JNU A;  2OWH A;  2D01 A;  2ZBB A;  4HP9 A;  3BY8 A;  1N9N A;  3VOL A;  5HWW A;  1T18 A;  4M4X A;  4I3A A;  4B9O A;  4E04 A;  1T1B A;  2VLG A;  4H6J A;  3VE3 A;  5F6A A;  3ULF A;  3MR0 A;  2PYP A;  3PHY A;  3NOU C;  3LID A;  2ZOH A;  1DP9 A;  3MQO A;  3H82 B;  4R70 A;  3K3D A;  4DJ2 A;  3SW1 A;  3MQQ A;  4GHI B;  4WN5 A;  1LSV A;  2YKF A;  3CLO A;  2V1B A;  1OTI A;  4JGO A;  3E4O A;  4I3J A;  2OOL A;  5HD3 A;  2QKP A;  4HHD A;  2QHK A;  1GSV A;  5HDD A;  2KDK A;  1OJG A;  4MN6 A;  4K08 A;  5IS1 A;  4JGQ A;  3LIA A;  3RTY A;  2WKR A;  3UMD A;  2WKQ A;  2INW A;  1DRM A;  2KX6 A;  4HH3 A;  5IU1 A;  1OTE A;  4JGP A;  1F9I A;  4HI4 A;  3B33 A;  3IS2 A;  1BYW A;  2V9A A;  3FC7 A;  4GS9 A;  1P0Z A;  2V1A A;  3H9W A;  2BAS A;  5G4Y A;  5J4E A;  1S4R A;  3UB8 A;  2PYR A;  2GJ3 A;  5I5L A;  2Z6D A;  2WKP A;  2Z6C A;  3LIE A;  1NWZ A;  1DP6 A;  2HV1 A;  3D72 A;  1T19 A;  5HSQ A;  3EWK A;  4NXB A;  3KX0 X;  2PR6 A;  1WA9 A;  3HJI A;  1TS6 A;  4HNB A;  3UB7 A;  4MN5 A;  4EEU A;  3H7W B;  3H82 A;  4R38 A;  2PDR A;  1TS8 A;  1DP8 A;  2QWS A;  4GHI A;  4DJ3 A;  2L4R A;  5F68 A;  3HJK A;  4HQA A;  3T50 A;  5A8B A;  4NXF A;  3A0S A;  4NXE A;  3A0V A;  3MFX A;  5HZH A;  4EW7 A;  4I38 A;  1ODV A;  4F3L A;  4RQ9 A;  3OLO A;  1P97 A;  2W0N A;  5AVF A;  3E4P A;  3P7N A;  1S1Y A;  2QJ5 A;  4XT2 B;  5HDS A;  2V0W A;  2K7S A;  3UE6 A;  1GSX A;  4EXO A;  3PYP A;  4HOI A;  4WUJ A;  3GEC A;  3CAX A;  1LT0 A;  3F1P A;  1XJ6 A;  4LRZ E;  4BBT A;  3UB9 A;  2JN7 A;  4KUO A;  1N9O A;  4R6L A;  2VV6 A;  1S67 L;  1N9L A;  4HJ6 A;  4H6J B; 
#chains in the Genus database with same CATH topology
 4GDN A;  2HDQ A;  5FI2 A;  3NI9 A;  2FH5 A;  2JKR M;  2I9V A;  2XR0 A;  5E2G A;  4C6Y A;  1KGF A;  3B3X A;  1OTA A;  3BW6 A;  2YKH A;  1OT6 A;  3TE8 A;  4OPY A;  4LFU A;  3F1O B;  3BLM A;  4XUX A;  5EVI A;  1XJ2 A;  3IX4 A;  5DFX A;  2ACG A;  4N1H A;  3IT9 A;  4HJ3 A;  1IOU A;  2LB5 A;  4KZ3 A;  2Q9M A;  4JKT A;  3NCK A;  4WMC D;  5AQ9 A;  5DF7 A;  1SKO B;  2R78 A;  3TJZ C;  1F98 A;  1FCM A;  3HVF A;  3PBR A;  4E3N A;  1H8Y A;  4XUZ A;  4BBU A;  5KIZ A;  4LV2 A;  4Y17 A;  1XJ4 A;  3ZYT A;  3V3S A;  3GV9 A;  3MQ0 A;  2J8Y A;  1O7E A;  2A24 B;  4I5S A;  3DAV A;  3WS5 A;  2PR5 A;  5FEF A;  2GDN A;  2X02 A;  1RGY A;  1YAX A;  1MZU A;  3BEC A;  4MBK A;  4U0T A;  2PU4 A;  3IF5 A;  4LLO B;  5J3W A;  2WK0 A;  5TBM B;  1LSX A;  1BLS A;  5M19 A;  4X68 A;  3BQ8 A;  3MZD A;  4Q0I A;  3IX8 A;  2ZJ9 A;  4RA7 A;  3ZVW A;  2XD5 A;  2VGL S;  4PKY A;  1U60 A;  4OQ0 A;  3UE0 A;  1KOU A;  1GHI A;  3LR0 A;  4WYY A;  1FSY A;  1J3W A;  3LI8 A;  3JVV A;  4QY5 A;  3PAE A;  4YOF A;  3LEZ A;  2ZMA A;  3OBF A;  3F1O A;  3V50 A;  4Q0H A;  3UME A;  4IUK A;  4YWZ A;  2O9B A;  1D7E A;  3MKF A;  4X6T A;  1K54 C;  5EM1 A;  5HWT A;  2IA2 A;  2A2L A;  1X0O A;  2M7U A;  3A3J A;  4OQH A;  4GW9 A;  3Q07 A;  4EQ1 A;  2HDS A;  2M1C A;  2ZQC A;  2WGW A;  2A24 A;  1UWP X;  3BY9 A;  4LCL A;  3F1P B;  1NLY A;  1Q2Q A;  1S0W A;  1H3Q A;  5K5B A;  4KG2 A;  2P74 A;  2IWB A;  2WGI A;  3K3C A;  3U2A A;  4D60 A;  5TBM A;  2UV0 E;  4EUV A;  4OQI A;  2OAQ 1;  3MXR A;  3PAG A;  1LLB A;  3BLS A;  3VSL A;  3ITA A;  5KSH A;  4HEF A;  4IED A;  3OC2 A;  1E3U D;  2XH9 A;  1PWD A;  5FAP A;  1HD8 A;  3VE4 A;  4UQI M;  1YSP A;  3Q82 A;  4Y3I A;  1K4E A;  1S66 L;  1MWU A;  3ZHH A;  4C75 A;  1T1A A;  5TFQ A;  2WUQ A;  1JNU A;  4KQO A;  3T1X A;  4MBH A;  4N9K A;  1N9N A;  3V3R A;  1YQS A;  3Q7V B;  1J9M A;  4M4X A;  3Q81 A;  4JXG A;  3N8S A;  2EX2 A;  3G2Z A;  2XF3 A;  5F6A A;  2HF6 A;  1OPX A;  4GZB A;  1NLZ A;  2WAE A;  3NOU C;  3MQO A;  3HLG A;  1PI4 A;  5HAP A;  1WE4 A;  3SW1 A;  5CXW A;  4OPR A;  1G68 A;  2WKH A;  1IKI A;  2XSS A;  1MY8 A;  2YKF A;  4B93 A;  3VP4 A;  1MC0 A;  1STZ A;  1OTI A;  3PBO A;  4I3J A;  4HBU A;  2OOL A;  5HD3 A;  1L3L A;  3C30 A;  5FQK A;  2ZD8 A;  3VMA A;  2QHK A;  2EX6 A;  4RX3 A;  4QJG A;  1YT4 A;  4KZB A;  3NBL A;  1JWP A;  2Z2M B;  5CHM A;  2OSU A;  3A3I A;  3LIA A;  3ZNT A;  3RTY A;  5D3O A;  2W1T A;  1H0M A;  2DRW A;  2JKT I;  1I5Q A;  4PMA A;  2KX6 A;  4HH3 A;  4GD6 A;  4JGP A;  1K25 A;  4A5R A;  2FZ0 A;  4OH0 A;  4DE2 A;  3IH9 A;  3M6H A;  1BLP A;  4Y0O A;  5FQM A;  4LGW A;  5J4E A;  3UB8 A;  2PYR A;  3Q7V A;  4S2N A;  5L07 A;  1NWZ A;  3IF6 B;  4HBT A;  4WMC A;  5LBR A;  3KX0 X;  3O5Y A;  1FCN A;  2PR6 A;  4OP8 A;  2J9O A;  1CEF A;  2MJ6 A;  1PWG A;  2RCX A;  1NRJ A;  3VFH A;  4OLG A;  2XK1 A;  5A90 A;  1M40 A;  3G4P A;  3EGX C;  3ISG A;  3CUE A;  3MF0 A;  1ERQ A;  5A8B A;  4WZ5 A;  3E98 A;  3A0V A;  5HZH A;  1ODV A;  4II7 A;  2W0N A;  3E4P A;  4QD4 A;  1PFL A;  1GCE A;  4MBF A;  1Z09 A;  4FH2 A;  2OLV A;  1BTL A;  1VQQ A;  1GSX A;  4O0P A;  1YLT A;  4JLF A;  3WS4 A;  3R7W B;  5EUA A;  3IXG A;  4IHQ A;  1YLZ A;  5E2F A;  1LT0 A;  3S22 A;  2J3T D;  4ETZ A;  3T1R A;  2V8C A;  2JN7 A;  4KUO A;  3PBS A;  3TG9 A;  2DCF A;  4R6L A;  2G2U A;  4DXB A;  1N9L A;  1DJC A;  2ZC7 A;  2W3F A;  4B4X A;  4DF6 A;  2OAP 1;  1N9B A;  3KYQ A;  3IF6 A;  1BUL A;  1ZTU A;  4CLC B;  4EET B;  4U3T A;  2EA9 A;  5GL9 A;  4OPZ A;  1DJA A;  3T4J A;  4L0L A;  4P87 A;  3L7H A;  3NOP C;  3S7N A;  4WEK A;  1SDN A;  4UHU A;  5F69 A;  4EER A;  3BWL A;  3AGE A;  2ZM0 A;  4RYE A;  4OOL A;  3LR5 A;  4MN7 A;  5GLB A;  4L9F A;  4PM5 A;  1D1J A;  2LB9 A;  3PXP A;  4ZJ1 A;  4R4S A;  4E3O A;  3OCL A;  5FL3 A;  3LYX A;  5EEC A;  3OCN A;  4BL3 A;  5FAO A;  3C8C A;  3HLW A;  2VV7 A;  3CMZ A;  5HAQ A;  3CG5 A;  3V67 A;  2HP9 A;  3WRT A;  2QJ7 A;  4EUZ A;  3GRJ A;  2XA7 S;  4IJG A;  1E3U A;  4HIA A;  3SS3 A;  2Y55 A;  3R7W A;  4N9L A;  1TS7 A;  2HDU A;  1MKI A;  3Q7Z A;  1VET B;  3MXS A;  3PBN A;  2B02 A;  2GNX A;  5FQI A;  3CPT B;  2G2W A;  4JXV A;  5JYO A;  4RX2 A;  2W27 A;  3HRE A;  3C5A A;  1BSG A;  4CLC A;  4KZ6 A;  1TD5 A;  3BFE A;  4WF0 A;  4U0X A;  2P9V B;  2JKT M;  4UA6 A;  5HD5 A;  1EW0 A;  4WL9 A;  1ZC2 A;  4NET A;  5HPI A;  4OPQ A;  4DMZ A;  4X25 A;  1RGZ A;  1OT9 A;  1SZV A;  4EES A;  4BLM A;  5GHY A;  4F3L B;  3MJQ A;  3OPL A;  1OJ5 A;  4X53 A;  5DTK A;  4B4Z A;  3IXB A;  1PW8 A;  2V20 A;  5KMW A;  1YM1 A;  4FCF A;  4KZ4 A;  3SS4 A;  1YMS A;  3T4O A;  5CED A;  3H7W A;  3ZG8 B;  1IFQ A;  2RL3 A;  1YLW A;  2XRO A;  1TEM A;  3VOZ A;  4BBV A;  3KYZ A;  1W5D A;  4K0X A;  4I3I A;  3IWQ A;  2HP6 A;  5FDH A;  4XXR A;  5M1A A;  2EX9 A;  4PM7 A;  3ZG5 A;  4DKI A;  1AXB A;  1Y4O A;  5GLA A;  2WYX A;  4DDS A;  3GDI A;  1IYS A;  5DF8 A;  4BWI A;  5FSR A;  4LCM A;  2E8J A;  3B47 A;  3LIC A;  1V9Z A;  2J3T C;  3S4X A;  3O86 A;  4GJ4 A;  3CPT A;  4QHC A;  3W8K A;  4I39 A;  3FG8 A;  1ZHH B;  2Y2I A;  3FZC A;  2EXB A;  1Q2P A;  4GCZ A;  5GLD A;  3BM6 A;  1OME A;  4OON A;  2P9V A;  4OQG A;  4S2K A;  2IWD A;  4OKP A;  4WEJ A;  4E6X A;  1G5U A;  2R9X A;  2BTF P;  4UAA A;  3IH8 A;  1T18 A;  1FR6 A;  5EM0 A;  1T1B A;  2VLG A;  4H6J A;  2V1Z A;  3M2K A;  3C4O A;  1A0K A;  2Y2J A;  3PHY A;  2XD1 A;  2ZOH A;  3H82 B;  4R70 A;  5A91 A;  2V8F A;  4N92 A;  3UO9 A;  2H0Y A;  1MPL A;  5HPF A;  3C7U A;  3CZD A;  1XKZ A;  2W1R A;  5IHV A;  4JGO A;  2ZQA A;  4DRT A;  2K2N A;  5AJG A;  4IVK A;  4PHT A;  4DE0 A;  4QPR A;  3WS0 A;  4HHD A;  2M7V A;  3K2N A;  4GDB A;  4JBF A;  1SKO A;  3UE1 A;  1GSV A;  2PT7 A;  2O0Y A;  1M6K A;  2QPN A;  3LGO A;  3KSI A;  4MN6 A;  3VOY A;  4K08 A;  1HZO A;  4ZAM A;  1KDS A;  2WKR A;  2EFX A;  2WKQ A;  3TRC A;  2INW A;  1DRM A;  4LEN A;  3G35 A;  4P6Z M;  4G3V A;  1F9I A;  2PRF A;  5FA7 A;  1XXM A;  4ID4 A;  1BYW A;  2V9A A;  1IYQ A;  2Q0O A;  2OV5 A;  1P0Z A;  1PW1 A;  2ZLY A;  3DTE A;  4X56 A;  3ITB A;  3S7P A;  2ZQD A;  4R3J A;  1L0D A;  4KQQ A;  5EE8 A;  5I5L A;  1E4D A;  3MZF A;  1DP6 A;  2HV1 A;  4EV4 A;  2Y8H A;  2BLS A;  5BOH A;  3HJI A;  1TS6 A;  4B88 A;  4MN5 A;  3BFF A;  3H82 A;  1KDW A;  3IWI A;  4JPM A;  2HZ5 A;  3CI6 A;  3N4I A;  4IVI A;  2QYB A;  1NJ4 A;  5A92 A;  1WYB A;  3UDX A;  4HQA A;  2VK3 A;  5HAI A;  4EBP A;  3MFD A;  2PBY A;  3LR3 A;  1CF0 A;  3A0S A;  4I38 A;  3QNC A;  5FAQ A;  3UB5 P;  3HLE A;  3R4K A;  5AVF A;  4AFI A;  3QP1 A;  4CLC D;  4S2N C;  3FWL A;  3HUM A;  1BLC A;  2KOI A;  3CJM A;  2QJ5 A;  4YNR A;  2HDR A;  5HDS A;  1N4O A;  5FAS A;  2K7S A;  3UE6 A;  2BG1 A;  1TF1 A;  3MKE A;  1FQG A;  1BT5 A;  2PAV P;  3LY3 A;  3N8R A;  2P08 A;  3E0Y A;  3UY6 A;  3VFF A;  1PNE A;  3F1P A;  3W4O A;  4P0M A;  1XJ6 A;  1SDE A;  3CUE C;  4WZ5 C;  1NRF A;  2XQZ A;  4ZBE A;  2IWC A;  4F94 A;  5FQ9 A;  4FOF A;  1SCW A;  1NZU A;  1EI5 A;  4HJ6 A;  4IUH A;  3JYI A;  1ERO A;  2Y2L A;  4PPR A;  3DW0 A;  3MXQ A;  2O9A A;  3AGF A;  1CI9 A;  5F82 A;  4X55 A;  3UDI A;  5HAR A;  2WKI A;  1LHY A;  5IT5 A;  1CK3 A;  3IHA A;  1K55 A;  1S4S A;  2VGL M;  3HCY A;  2Q9N A;  4WM9 A;  5U47 A;  5E43 A;  5E2H A;  1H8M A;  3ZNY A;  1K6R A;  1K4F A;  3IXD A;  1PRQ A;  3WRZ A;  1H8Z A;  4E3L A;  4EU0 A;  4GD8 A;  3GVB A;  1IEM A;  4CQH A;  1VEU B;  2ZL1 B;  3UNW A;  4QWO A;  3ZDJ A;  1ZG6 A;  3S7Q A;  4YFM A;  4JXS A;  1IEL A;  1F5M A;  3WS1 A;  5EOO A;  3GQZ A;  3IF6 C;  5DKL A;  3DTI A;  1O07 A;  2JKR I;  1OTB A;  1Y28 A;  4KZ8 A;  1Y54 A;  3P09 A;  2VEA A;  1VB6 A;  4O01 A;  1LL9 A;  3ZVT A;  5FEG A;  1W8Q A;  1UGU A;  4DN0 A;  3IS2 B;  4E6W A;  4OVD A;  4HY8 A;  1D06 A;  4EQI A;  3C7V A;  4GS9 B;  4LV1 A;  3EEH A;  5DJT A;  4CJN A;  3O3V A;  2W3D A;  1ES2 A;  4P85 A;  1ONG A;  3ZQ5 A;  3LI9 A;  3LIF A;  5HL1 A;  4KUK A;  4R0Q A;  3FKW A;  4GKU A;  3E2K A;  4BMW A;  3T12 B;  4FH4 A;  1T1C A;  1I2W A;  1GA9 A;  1GHM A;  2ZM2 A;  5TGF A;  1KE4 A;  2ZC3 B;  2VV8 A;  1K56 D;  2K31 A;  3IX3 A;  3N8L A;  4DDY A;  1WYC A;  4E3K A;  3IBR A;  3QP8 A;  3PTE A;  1JVJ A;  4NKP A;  1UWN X;  2PD7 A;  3UN7 A;  4HH2 A;  3LUQ A;  5DTT A;  2VKS A;  3UB6 A;  1NXY A;  5L8M A;  2HPB A;  3T4L A;  1FCO A;  3RH8 B;  3WWX A;  1IYO A;  3T1S A;  3C2W A;  1ALQ A;  2VGJ A;  5HFO A;  3QP6 A;  2GX5 A;  4C3Q A;  1E25 A;  1VEU A;  4UEY A;  5DJU A;  5AVE A;  1KE0 A;  2O9C A;  2ZL1 A;  4ME4 A;  3LO7 A;  1K0K A;  3NEC A;  1F2K A;  3JVU A;  2JKF A;  2GZA A;  4CLC C;  5HW3 A;  2OWJ A;  3UE3 A;  3KSH A;  2J80 A;  3IWO A;  4K91 A;  3RFB A;  4P6B A;  2X71 A;  3DTK A;  5CEC A;  4WEL A;  4L9E A;  3MSH A;  1LI9 A;  4EEP A;  4PM9 A;  2HJ9 C;  4WLA A;  3IXH A;  1MWS A;  2L0W A;  2L1M A;  3A0R A;  3OZH A;  3NJA A;  1ACF A;  3FPV A;  1TVF A;  3EOI A;  1IKG A;  4QY6 A;  3DTM A;  2W3H A;  4FD8 A;  1ESU A;  1W8Y A;  1NZO A;  1C3B A;  1MWT A;  5CGW A;  2XGN A;  3BRM A;  4ZDX A;  5FDS A;  1ONH A;  1L0G A;  3HUN A;  2ZOI A;  3MZE A;  5DVA A;  4MMN A;  4QB8 A;  5EVI B;  5HWV A;  2ZBB A;  2D01 A;  3KO6 A;  2Y2M A;  3QNB A;  4I3A A;  4B9O A;  4E04 A;  3AGD A;  3VE3 A;  3UPP A;  3A3D A;  3ULF A;  3C4P A;  3MR0 A;  4OOM A;  4Z1W A;  3Q1F A;  3W2Z A;  2PYP A;  2WGV A;  4KZ7 A;  1SHV A;  3MBZ A;  4G3W A;  4BEN A;  3NDG A;  1CQA A;  1DP9 A;  5CX7 A;  2XFS A;  2Y4A A;  3G32 A;  1BUE A;  3K3D A;  4DJ2 A;  4JF5 A;  1L0E A;  5EOE A;  1W7F A;  3IQA A;  1LSV A;  1TDG A;  3CLO A;  3EQU A;  3LFV A;  2V1B A;  2ZC6 B;  3VP1 A;  3P01 A;  3SOI A;  2ZM8 A;  3E4O A;  5EVL A;  3N7W A;  1CEG A;  4PM8 A;  4X1M A;  3ZCZ A;  2QKP A;  3VP3 A;  3BFG A;  3DBA A;  5JYP A;  5HDD A;  2KDK A;  1OJG A;  4YIN A;  2I72 A;  4UQI S;  4QU3 A;  2JE5 A;  5IS1 A;  4RVA A;  1KE3 A;  4S2L A;  4KQR A;  2VA0 A;  3ZG9 B;  3UMD A;  2JBF A;  4S2P A;  4GNU A;  2ZQ8 A;  4FTX A;  2NUT C;  1S6R A;  4ZRR A;  3FC7 A;  1ZKJ A;  4ZJ2 A;  3HLD A;  1CI8 A;  2V1A A;  2WZZ A;  4NK3 A;  3G2Y A;  3H9W A;  1MWR A;  1S4R A;  1VET A;  1P9R A;  4Q8I A;  1PZO A;  2Z6D A;  2WKP A;  2Y2O A;  3D72 A;  1T19 A;  5FI7 A;  2Z2L B;  3EWK A;  4NXB A;  1JTD A;  1WA9 A;  4K0W A;  1FIK A;  2V2F F;  3UB7 A;  3VV4 A;  3GR2 A;  4EWF A;  3WS2 A;  5F1F A;  2PDR A;  3S1Y A;  2EWV A;  3SH9 A;  5CER A;  4MEZ A;  3BYD A;  3RXX A;  4O8G A;  1LL5 A;  1MXO A;  1ES3 A;  2WGW B;  4NG2 A;  2C6W B;  3MFX A;  4F3L A;  4RQ9 A;  5F1G A;  4BD0 A;  1P97 A;  2ZC4 B;  2Y2K A;  3LEQ A;  1HLU P;  3P7N A;  1S1Y A;  5KZH A;  4GLQ A;  3ZFZ A;  3BFC A;  1QME A;  3D3O A;  2Y2Q A;  1YLY A;  5AQA A;  3QHY A;  4XT2 B;  2H10 A;  4M3K A;  2HGV A;  4ZJ3 A;  4MNR A;  1G6A A;  4JF4 A;  2V0W A;  2Y59 A;  5M18 A;  2DMW A;  4ESP A;  4EXO A;  2Y2N A;  3PYP A;  2Y2H A;  3LY4 A;  3UDF A;  1K56 A;  4WUJ A;  1ERM A;  3GEC A;  1XP4 A;  2PBD P;  3CAX A;  3V39 A;  3HLF A;  3HUO A;  1GHP A;  3B42 A;  4IBX A;  1FIL A;  2ZQ9 A;  4UA9 A;  4DE1 A;  2XA7 M;  4Y7P A;  1XA7 A;  2VV6 A;  1S67 L;  3NC8 A;  3IHB A;  5MC7 A;  2G7U A;  5KSC A;  1AWI A;  3T1Q B;  5GHZ A;  3T4T A;  4GB7 A;  2WAD A;  3KYE A;  2R9W A;  1NY0 A;  5CHU A;  4L9G A;  5HDC A;  4LRY C;  5F5Y A;  4PKY G;  2JCH A;  4Q0J A;  5CGS A;  3CWF A;  3SZT A;  1PWC A;  3FPW A;  3A3E A;  4KZ5 A;  3VP0 A;  5DTS A;  1G28 A;  2VGK A;  4DE3 A;  4OP5 A;  3E2L A;  2B18 A;  2CMN A;  2WZX A;  4KEN B;  4R23 A;  2CC1 A;  5FI6 A;  2H5S A;  3HBR A;  3NUL A;  5E2E A;  2QZ6 A;  4HP4 A;  3L9K A;  4S2M A;  3MMH A;  3UPN A;  1ZG4 A;  1K57 C;  2PHY A;  1YLP A;  1NYM A;  3O88 A;  1XJ3 A;  3S7O A;  5G18 A;  4JGR A;  2XDM A;  2WAF A;  2JC7 A;  4XT2 A;  2W1T B;  1OTD A;  2V0U A;  4ETX A;  3RJU A;  1EWZ A;  1W63 Q;  1FOF A;  3EQV A;  3KSG A;  1ES5 A;  2WKE A;  3D4F A;  5EFW A;  3NDE A;  1S1Z A;  5AQB A;  2P04 A;  3NHQ A;  1K55 C;  3D9Y A;  2VJW A;  2O99 A;  4KZ9 A;  4ARZ B;  5DF9 A;  2PD8 A;  4LPZ A;  5A93 A;  1ES4 A;  1K54 A;  1VHM A;  2H28 A;  2EXA A;  2XRN A;  4S2O A;  3F1N B;  5CRF A;  1YLJ A;  1YKD A;  3G6O A;  3OPR A;  1TDL A;  5CGX A;  3W4Q A;  3E4Q A;  3LIB A;  3P98 A;  4FSF A;  3O87 A;  5CEB A;  4MLL A;  3NOT C;  3GMW A;  2UWX A;  5FQQ A;  5EPH A;  4UA7 A;  2W3G A;  3FKV A;  2VX8 A;  3OPP A;  3UPO A;  1PZP A;  5J7E A;  5EV0 A;  4E3J A;  3M2J A;  3T4K A;  2Y2G A;  1FR1 A;  2XEP A;  3FYZ A;  1K57 A;  1XFQ A;  1BLH A;  4JF6 A;  3HLB A;  4ZTK A;  4KQD A;  1PYY A;  3T4Q A;  2W3E A;  5C5K A;  2HP5 A;  3ZG7 B;  4S2I A;  2X01 A;  3VSK A;  3RXW A;  4O7D A;  4E3M A;  3GTC A;  2FFY A;  1KVM A;  4CPK A;  4MDZ A;  4PM6 A;  1QMF A;  1DJB A;  4NXG A;  3BQA A;  4GN2 A;  2JKG A;  5EVI D;  3C38 A;  3M6B A;  1IYP A;  5I94 A;  4R3B A;  4Y15 A;  1W79 A;  2P7J A;  4IBR A;  1LSW A;  3ICY A;  4NEE D;  4KZA A;  2Y79 A;  1TS0 A;  4BQM A;  1KGG A;  2Y2P A;  1YMX A;  4ARZ A;  1P9W A;  2D02 A;  1LL8 A;  2JHE A;  4PAU A;  3V5M A;  1GSW A;  4Y2F A;  1I2S A;  3QP4 A;  3F1N A;  1HTZ A;  5DKK A;  4WBG A;  4GOG A;  3QP5 A;  2PU2 A;  5GHX A;  5GLC A;  4R3A A;  4HJ4 A;  2HJE A;  3OOV A;  1RCJ A;  4LRX C;  1XFN A;  2C5W B;  3PBT A;  3CHW P;  2XLN A;  4JXW A;  3OPH A;  4CLC E;  5G4Z A;  5HX9 A;  1V9Y A;  5CTM A;  1KVL A;  2FFF B;  1GA0 A;  2OWH A;  4MCW A;  4HP9 A;  3BY8 A;  3BJN A;  1H5X A;  3VOL A;  5HWW A;  2OLU A;  4WZ4 A;  3MS6 A;  1HVB A;  1ESI A;  3PR6 A;  3PBQ A;  1JWZ A;  1SKF A;  1DY6 A;  2VZW A;  3LID A;  3BFD A;  3EEA A;  2ZC5 B;  2B5R A;  2EFU A;  1YPR A;  5L2F A;  3MQQ A;  1XX2 A;  5DFY A;  3BEB A;  4GHI B;  1MBL A;  1JWV A;  4WN5 A;  1LI0 A;  1CJF A;  2H0T A;  1XA1 A;  1FSW A;  2DNS A;  3LR4 A;  5L09 A;  3LCE A;  3TOI A;  3W4P A;  4Y13 A;  4BL2 A;  3FV7 A;  3GSG A;  1L2S A;  4BJP A;  3A3F A;  3TW8 A;  5TJJ A;  4OOY A;  4JGQ A;  1L0F A;  1YSQ A;  1JTG A;  3KSF A;  3CIT A;  1K38 A;  3TSG A;  1Z6F A;  5IU1 A;  2J3W A;  1OTE A;  4HI4 A;  3B33 A;  3IS2 A;  4EBL A;  2QMI A;  3ZG0 A;  2XFT A;  1XGJ A;  4GS9 A;  4EBN A;  3DWK A;  2EWW A;  1NYY A;  2BAS A;  5G4Y A;  4HES A;  2GJ3 A;  2Y91 A;  3QP2 A;  1PI5 A;  1MKM A;  4R1G A;  2Z6C A;  3LIE A;  5HSQ A;  5F83 A;  1VM1 A;  2J7V A;  4HNB A;  1KGE A;  4EEU A;  2EX8 A;  4DXC A;  4Y0U A;  3H7W B;  5TR7 A;  3HLC A;  4R38 A;  2B95 A;  5HL6 A;  1TS8 A;  1XPB A;  4R4R A;  1DP8 A;  1XGI A;  2QWS A;  4GHI A;  3DWZ A;  4DJ3 A;  4H8R A;  4LV0 A;  2L4R A;  5F68 A;  3HJK A;  3JPU A;  2A49 A;  3SS5 A;  3I7J A;  1G6O A;  4OLD A;  3T50 A;  4KG6 A;  4NXF A;  3G34 A;  4Y0T A;  4NXE A;  2ZMV A;  4EW7 A;  5EVI C;  1RP5 A;  4KG5 A;  3SH7 A;  3OLO A;  3ZGA B;  2AVX A;  4E3I A;  1PIO A;  4P6Z S;  2ZQ7 A;  3NY4 A;  1W63 M;  4BD1 A;  2ZMF A;  3SH8 A;  5EVE A;  3G30 A;  4Y5F A;  4N1X A;  4S2J A;  3HL9 A;  5CTN A;  4HOI A;  3T4S A;  5CHJ A;  2NUP C;  4X69 A;  5FQJ A;  5L10 A;  3IBJ A;  1K6S A;  3NIA A;  3VP2 A;  4D2O A;  4G3K A;  4LV3 A;  5J8X A;  4LRZ E;  2E8I A;  4BBT A;  3UB9 A;  1N9O A;  4Z9Q A;  3N6I A;  2J9P A;  5AQ7 A;  2A3U A;  3EGD C;  3G31 A;  4H6J B;  5FAT A;  3U4L P;  2KLI A;  1BZA A;  4X1L A;  4FUW A; 
#chains in the Genus database with same CATH homology
 3T4T A;  1ZTU A;  3MXQ A;  4CLC B;  4EET B;  2O9A A;  2EA9 A;  4L9G A;  2FH5 A;  5HDC A;  2JKR M;  4LRY C;  5F5Y A;  2I9V A;  4PKY G;  3T4J A;  4L0L A;  4Q0J A;  1OTA A;  5IT5 A;  3CWF A;  3BW6 A;  2YKH A;  1OT6 A;  3FPW A;  3NOP C;  3TE8 A;  3S7N A;  1S4S A;  2VGL M;  3F1O B;  3HCY A;  1G28 A;  4WEK A;  1XJ2 A;  1H8M A;  5F69 A;  4EER A;  2B18 A;  5DFX A;  2CMN A;  4HJ3 A;  1IOU A;  3BWL A;  2LB5 A;  4OOL A;  4EU0 A;  3LR5 A;  4MN7 A;  4HP4 A;  4L9F A;  2LB9 A;  3MMH A;  4CQH A;  3PXP A;  2PHY A;  2R78 A;  3TJZ C;  1F98 A;  3PBR A;  1XJ3 A;  3S7O A;  4BBU A;  3S7Q A;  3OCL A;  5FL3 A;  3LYX A;  3OCN A;  1F5M A;  5KIZ A;  4JGR A;  3C8C A;  5DKL A;  4XT2 A;  2W1T B;  1OTD A;  2VV7 A;  1XJ4 A;  2JKR I;  2V0U A;  4ETX A;  1OTB A;  1Y28 A;  3V67 A;  1W63 Q;  3EQV A;  3KSG A;  3ZYT A;  2QJ7 A;  2VEA A;  1VB6 A;  2XA7 S;  4O01 A;  4IJG A;  3MQ0 A;  5EFW A;  1S1Z A;  4HIA A;  2A24 B;  4I5S A;  3R7W A;  1UGU A;  2PR5 A;  4DN0 A;  3IS2 B;  2P04 A;  3NHQ A;  4HY8 A;  1D06 A;  1YAX A;  2VJW A;  1MZU A;  2O99 A;  4GS9 B;  4ARZ B;  1TS7 A;  5DF9 A;  3EEH A;  2PD8 A;  4LPZ A;  5DJT A;  4LLO B;  1VHM A;  2W3D A;  2H28 A;  5J3W A;  2XRN A;  3PBN A;  2B02 A;  2GNX A;  3F1N B;  3ZQ5 A;  3LI9 A;  5TBM B;  1LSX A;  3LIF A;  1YKD A;  4KUK A;  3BQ8 A;  3G6O A;  4Q0I A;  4BMW A;  3E4Q A;  3LIB A;  4FSF A;  2VGL S;  2W27 A;  4PKY A;  1T1C A;  3NOT C;  1KOU A;  3LR0 A;  4CLC A;  1TD5 A;  3LI8 A;  2VV8 A;  4WF0 A;  3JVV A;  2K31 A;  2W3G A;  2VX8 A;  3IBR A;  2JKT M;  5J7E A;  4NKP A;  5HD5 A;  4YOF A;  1EW0 A;  1UWN X;  4WL9 A;  3T4K A;  2PD7 A;  5HPI A;  3OBF A;  4DMZ A;  3F1O A;  4HH2 A;  3LUQ A;  3UB6 A;  2VKS A;  5L8M A;  1XFQ A;  4Q0H A;  3UME A;  1OT9 A;  4IUK A;  4KQD A;  4YWZ A;  3T4L A;  3T4Q A;  2W3E A;  5C5K A;  3RH8 B;  4EES A;  4F3L B;  3C2W A;  3MJQ A;  2O9B A;  1OJ5 A;  1D7E A;  2GX5 A;  5HWT A;  2IA2 A;  2A2L A;  4UEY A;  5DJU A;  5AVE A;  2O9C A;  4ME4 A;  1X0O A;  4MDZ A;  3T4O A;  2M7U A;  3H7W A;  3JVU A;  4NXG A;  3BQA A;  2GZA A;  1IFQ A;  4GW9 A;  4CLC C;  2XRO A;  3C38 A;  2OWJ A;  4EQ1 A;  3UE3 A;  2P7J A;  3KSH A;  2M1C A;  4BBV A;  2J80 A;  1LSW A;  3KYZ A;  3RFB A;  4I3I A;  3ICY A;  2A24 A;  1UWP X;  4WEL A;  3BY9 A;  4NEE D;  2Y79 A;  3F1P B;  4L9E A;  1TS0 A;  1NLY A;  4EEP A;  2HJ9 C;  4WLA A;  4ARZ A;  1H3Q A;  5K5B A;  2L0W A;  2L1M A;  1P9W A;  2D02 A;  3A0R A;  1LL8 A;  3NJA A;  2JHE A;  4PAU A;  3GDI A;  3K3C A;  3FPV A;  1GSW A;  4BWI A;  4Y2F A;  3U2A A;  3F1N A;  3EOI A;  3B47 A;  3LIC A;  1V9Z A;  2J3T C;  5TBM A;  4EUV A;  5DKK A;  4GJ4 A;  2OAQ 1;  2W3H A;  4R3A A;  4I39 A;  5KSH A;  4HJ4 A;  3FG8 A;  2HJE A;  1ZHH B;  3OOV A;  4LRX C;  1XFN A;  3PBT A;  3OC2 A;  2ZOI A;  4GCZ A;  4CLC E;  5G4Z A;  3VE4 A;  4UQI M;  1YSP A;  4Y3I A;  1V9Y A;  4MMN A;  1S66 L;  1T1A A;  5HWV A;  1JNU A;  2OWH A;  2D01 A;  2ZBB A;  4KQO A;  4MCW A;  4WEJ A;  4HP9 A;  3BY8 A;  1N9N A;  3BJN A;  3VOL A;  5HWW A;  3KO6 A;  1T18 A;  4M4X A;  4I3A A;  4B9O A;  4E04 A;  1T1B A;  2VLG A;  4H6J A;  3VE3 A;  3PR6 A;  3PBQ A;  5F6A A;  2HF6 A;  1OPX A;  3ULF A;  3MR0 A;  4OOM A;  4Z1W A;  1NLZ A;  3W2Z A;  2PYP A;  3PHY A;  4G3W A;  3NOU C;  2VZW A;  3LID A;  2ZOH A;  1DP9 A;  3MQO A;  3EEA A;  3H82 B;  5CX7 A;  4R70 A;  3K3D A;  4DJ2 A;  3SW1 A;  3MQQ A;  5DFY A;  4GHI B;  5HPF A;  2XSS A;  4WN5 A;  1LSV A;  2YKF A;  4B93 A;  3CLO A;  3EQU A;  2W1R A;  3LFV A;  3LR4 A;  1MC0 A;  1STZ A;  2V1B A;  1OTI A;  4JGO A;  3P01 A;  2K2N A;  3E4O A;  5AJG A;  4PHT A;  3PBO A;  4I3J A;  4QPR A;  2OOL A;  5HD3 A;  3C30 A;  2QKP A;  4HHD A;  2M7V A;  2QHK A;  4BJP A;  3K2N A;  1GSV A;  2PT7 A;  3DBA A;  2O0Y A;  5HDD A;  2KDK A;  3TW8 A;  5TJJ A;  1OJG A;  4UQI S;  3KSI A;  4MN6 A;  4K08 A;  5IS1 A;  4JGQ A;  3LIA A;  1YSQ A;  2VA0 A;  3RTY A;  3KSF A;  3CIT A;  2WKR A;  2W1T A;  3UMD A;  2JKT I;  2WKQ A;  3TRC A;  2INW A;  1DRM A;  2KX6 A;  4HH3 A;  4P6Z M;  5IU1 A;  2J3W A;  1OTE A;  4JGP A;  4G3V A;  1F9I A;  4HI4 A;  2FZ0 A;  3B33 A;  2NUT C;  3IS2 A;  4ZRR A;  1BYW A;  2V9A A;  3FC7 A;  4GS9 A;  1P0Z A;  2V1A A;  2EWW A;  3H9W A;  3S7P A;  2BAS A;  5G4Y A;  5J4E A;  1S4R A;  3UB8 A;  2PYR A;  2GJ3 A;  1P9R A;  5I5L A;  1MKM A;  2Z6D A;  2WKP A;  2Z6C A;  3LIE A;  1NWZ A;  1DP6 A;  2HV1 A;  3D72 A;  1T19 A;  5HSQ A;  3EWK A;  4NXB A;  5LBR A;  2Y8H A;  3KX0 X;  3O5Y A;  2PR6 A;  1WA9 A;  3HJI A;  1TS6 A;  4HNB A;  2MJ6 A;  3UB7 A;  4MN5 A;  3VV4 A;  4EEU A;  1NRJ A;  3H7W B;  3H82 A;  4R38 A;  2PDR A;  5HL6 A;  1TS8 A;  2EWV A;  1DP8 A;  3CI6 A;  2QWS A;  4GHI A;  4DJ3 A;  4O8G A;  2QYB A;  2L4R A;  3EGX C;  5F68 A;  3HJK A;  4HQA A;  3CUE A;  3MF0 A;  1G6O A;  3T50 A;  5A8B A;  3E98 A;  3LR3 A;  4NXF A;  3A0S A;  4NXE A;  3A0V A;  3MFX A;  5HZH A;  2ZMV A;  4I38 A;  4EW7 A;  1ODV A;  4F3L A;  4RQ9 A;  3OLO A;  4II7 A;  1P97 A;  2W0N A;  3R4K A;  5AVF A;  3E4P A;  4AFI A;  4CLC D;  3P7N A;  1S1Y A;  4P6Z S;  4GLQ A;  3D3O A;  2KOI A;  2QJ5 A;  1W63 M;  2ZMF A;  4XT2 B;  4YNR A;  2HGV A;  4Y5F A;  5HDS A;  2V0W A;  2K7S A;  3UE6 A;  1GSX A;  2DMW A;  4O0P A;  4EXO A;  1TF1 A;  3PYP A;  4HOI A;  3R7W B;  4WUJ A;  3T4S A;  3GEC A;  2P08 A;  3CAX A;  4IHQ A;  2NUP C;  3E0Y A;  3IBJ A;  1LT0 A;  3F1P A;  2J3T D;  4G3K A;  1XJ6 A;  4ETZ A;  3B42 A;  3CUE C;  4LRZ E;  4BBT A;  3UB9 A;  2JN7 A;  4KUO A;  3PBS A;  1N9O A;  4R6L A;  2XA7 M;  2VV6 A;  1S67 L;  1N9L A;  4FOF A;  3EGD C;  4HJ6 A;  4H6J B;  4IUH A;  2W3F A;  5MC7 A;  2KLI A;  2G7U A;  2OAP 1;  3KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...