5EM1A

Crystal structure of ragweed allergen amb a 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
127
Chain Sequence
GSGSWQTYVDEHLMDIEGTGQHLASAAIFGTDGNVWASSSFPEFPDEINAIIKEFSEPGALAPTGLFLAGAYMVIQGEPGAVIRGGAGGICITGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
molecule tags Allergen
total genus 31
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5em1A00
3D9YA 1FILA 3T1RA 3CPTA 3T12B 5FEFA 4D60A 3L7HA 2E8JA 1K0KA 3T1SA 1CF0A 1VETB 2PAVP 1HLUP 4ESPA 3MS6A 1D1JA 1VETA 2ACGA 2VK3A 1SKOB 2V8FA 1PFLA 3T1QB 1PNEA 1CQAA 1FIKA 1VEUB 1SKOA 1A0KA 1AWIA 1PRQA 5EV0A 5EM0A 1Y4OA 2JKGA 3UB5P 3NECA 3U4LP 3NULA 1ACFA 2JKFA 4QWOA 4X25A 5FEGA 1Z09A 5EM1A 1J3WA 1YPRA 1SZVA 2PBDP 5EVEA 4FTXA 3CPTB 2V8CA 1VEUA 3MSHA 2ZL1B 5FDSA 4X1MA 4X1LA 4FUWA 1CJFA 2B95A 2HZ5A 3DAVA 1G5UA 2ZL1A 3KYEA 1F2KA 3T1XA 2PRFA 3LGOA 3CHWP 3L9KA 3LEQA 2BTFP
chains in the Genus database with same CATH superfamily
1JNUA 4EQIA 2Y2JA 3ZYTA 2IWBA 1YLPA 3JYIA 3OCLA 4BL3A 3GSGA 1OPXA 1ZC2A 3P7NA 4D60A 3PBNA 2CC1A 2H0TA 2K7SA 5IT5A 1HTZA 1ESUA 4FOFA 2WGWB 3HLEA 1XA7A 4GKUA 5J4EA 3UMDA 2ZQAA 5EUAA 5KZHA 1Z6FA 4NK3A 1DRMA 1GSVA 3NOTC 3A3IA 4WUJA 5DF9A 5DTSA 1SKOA 3P98A 1A0KA 2L1MA 4QJGA 2EX2A 3GVBA 4EBNA 1S4RA 3G32A 2WZZA 4GHIA 2LB5A 3IX4A 2A2LA 1LHYA 3N7WA 3D72A 3PAEA 1G28A 5AQAA 4X25A 3JVUA 4CPKA 1K57A 3LUQA 3MQQA 2W3EA 4OVDA 4R0QA 3BFDA 3O87A 4NG2A 4YINA 3HLDA 1KE0A 1ZHHB 1E25A 3IF5A 3IS2A 3NIAA 4X1LA 3JVVA 2G2WA 3GTCA 5G4ZA 4HY8A 1IFQA 4S2MA 2O99A 3DAVA 3O3VA 1K57C 3LEZA 3NBLA 5L10A 4EW7A 2V20A 4Y15A 3CLOA 2ZQ9A 2XDMA 4E6WA 1HD8A 5L07A 1TD5A 1KDSA 5CX7A 1GHMA 3KSFA 4BMWA 4ZRRA 3H82A 2WK0A 2HGVA 3UNWA 1XJ2A 4P0MA 2ZOIA 3S7PA 1JVJA 2GJ3A 3VP0A 3MXQA 4M3KA 3NOPC 4H8RA 1CK3A 1I2WA 2ZM0A 1W63Q 1O07A 2EWVA 1SKOB 1F98A 4KUKA 4GHIB 3LIDA 2PYPA 1F9IA 3V50A 5J7EA 1N9LA 4KZ6A 4WELA 3WRZA 1FSWA 2K31A 3LIFA 4Y17A 1OMEA 4HIAA 1RP5A 3NHQA 2XD1A 4KQRA 4E3JA 4LRZE 2JKGA 1DJAA 2A49A 2ZJ9A 3BM6A 4OPYA 3NECA 5C5KA 3S22A 2O0YA 4OQIA 2PHYA 2WAFA 1UWNX 5HL6A 2GNXA 5DF7A 5TGFA 3V3SA 3UB7A 2XLNA 3PBRA 4DMZA 4L9FA 3MQOA 4MN6A 2G2UA 2R9XA 3IX8A 4ZJ1A 4UA6A 4QHCA 4GCZA 3PBQA 1ZKJA 2X01A 4DDSA 3C38A 4CLCE 4FH4A 3FZCA 5KSCA 5E2FA 3S7QA 4O01A 1TS7A 2XGNA 4B9OA 2B95A 4WEJA 5EFWA 3KYEA 3G4PA 4FCFA 3PR6A 1YKDA 5EECA 3HL9A 1KVMA 2EWWA 2Y8HA 5TJJA 1PW1A 3E2KA 2NUPC 3T4TA 1O7EA 5TFQA 4BL2A 5DKKA 1XJ3A 3RFBA 3VE3A 4WBGA 5F68A 1ESIA 4YOFA 2Y2GA 3PBSA 3EQVA 2I9VA 2EFUA 3UN7A 4ESPA 3CUEC 3MS6A 2W1RA 4UA7A 2OWJA 5FQIA 1YSQA 1VETA 4DE3A 4CLCC 5HDSA 3K2NA 4MDZA 5FI6A 3BWLA 4MCWA 4MMNA 4ZBEA 4N92A 5CHMA 3MFDA 3IH9A 4IVKA 5KSHA 1ALQA 1STZA 5IU1A 4HI4A 4KZ7A 4S2IA 5EVIB 2M7UA 1PYYA 3NULA 4X69A 3VV4A 5FI2A 1K55C 4JF4A 2L0WA 1XKZA 3KO6A 2QZ6A 2HP9A 1OTAA 1L0FA 2J3TD 2V0WA 4PPRA 4DE0A 2QJ7A 4PM9A 5A90A 4I3AA 4ETXA 3HLWA 2PD8A 3HUMA 3IBRA 3FKWA 4DE2A 4NXFA 1Q2QA 3BLSA 3VMAA 2JC7A 3H7WA 2WAEA 3PXPA 1DP9A 1P9WA 2JBFA 3IWOA 3S7OA 1LI9A 5HW3A 2Y79A 3FPVA 1QMEA 2PT7A 4FD8A 3GECA 4R3JA 2QJ5A 2ZMAA 2H0YA 4L0LA 1NRJA 4GB7A 1K56A 1MZUA 2V2FF 1GSWA 1LL8A 3Q7ZA 5EVID 5CGWA 4R6LA 4NXBA 2Y2LA 3ZHHA 3IXDA 1IYQA 4S2KA 1I5QA 3HLCA 5HDCA 3P09A 3WS2A 5FDHA 1K0KA 5EVLA 1ODVA 1VETB 3CITA 4JXGA 4IHQA 1IEMA 2RL3A 2HV1A 5DVAA 3C2WA 5IHVA 2VX8A 2Y2OA 1TEMA 1XJ4A 4JXSA 3IWQA 3GV9A 2W1TA 3O86A 2BG1A 1MY8A 5DFYA 1IOUA 2XRNA 1L2SA 4BBTA 1NZOA 3G35A 1ES2A 3IXBA 3I7JA 3Q7VB 3ULFA 1RGZA 1BLSA 1PW8A 3UDFA 3IXGA 4S2NA 4XUZA 4E3OA 3MFXA 1J3WA 2ZQ8A 1OTIA 5EVEA 5G4YA 2QPNA 3SOIA 3H7WB 1OTBA 2Y2QA 3LIAA 1OJ5A 4WF0A 4IBXA 4LCMA 3E4PA 2ZBBA 1P9RA 2QWSA 3FV7A 3MBZA 4S2NC 3A3EA 3HUNA 1G5UA 3N6IA 3BEBA 2XH9A 3QNBA 3CG5A 3T1XA 1KE4A 2DRWA 4JGRA 4NETA 4KZ8A 5FL3A 1D7EA 4F3LA 3IT9A 2V9AA 2XA7S 2ZQ7A 3SS5A 3O5YA 1X0OA 1YAXA 5GHZA 2XD5A 2VZWA 5EPHA 2I72A 1PWDA 4ID4A 4O7DA 4N9KA 3T1SA 1OJGA 1YLWA 5AJGA 3U2AA 1HLUP 3CJMA 4R70A 4EV4A 4ME4A 1NLZA 1YLTA 2A24A 5GLAA 3MXSA 3A3DA 2INWA 3KSIA 4M4XA 3D4FA 4S2JA 1L0DA 1C3BA 1Y4OA 2O9BA 3KYZA 2GX5A 1XA1A 2HP6A 3EEAA 1OTDA 4BLMA 3IHBA 5E2HA 2JKFA 3SH8A 3V67A 3HVFA 5GL9A 1KGGA 3G34A 3UB9A 1TDGA 4FTXA 4S2PA 5CERA 3CPTB 3ZCZA 5FQKA 5FDSA 1S67L 5HX9A 4FUWA 4X6TA 4GS9B 3PYPA 4P6ZS 4MEZA 3M6BA 1MPLA 3MF0A 4F3LB 4PKYG 4HHDA 1NY0A 3LGOA 3BYDA 3FC7A 2B5RA 2ZD8A 2XF3A 4BJPA 2XR0A 5HWWA 2MJ6A 3MJQA 4P85A 3W2ZA 1PI4A 1MBLA 5I94A 2GDNA 4Y0TA 4HP4A 2E8JA 4ARZA 1Y54A 4WN5A 4UEYA 3KX0X 2KDKA 5CECA 5M18A 3T4QA 1CI9A 4O0PA 2WZXA 2FZ0A 2B18A 2XSSA 1PNEA 1CQAA 2WKQA 1VEUB 2WKIA 1L3LA 5FQMA 5A93A 3AGDA 4BD0A 2PD7A 5CHJA 5EM0A 2ZQCA 4NXEA 5FQQA 1ES5A 4LLOB 4EESA 5U47A 3MZFA 4JXVA 4EUVA 4HESA 2VKSA 1TF1A 3HLGA 2VV7A 4RX3A 3SW1A 2O9CA 3VP2A 4EUZA 1OT6A 4OPZA 2BLSA 4KG5A 1IKGA 1YLYA 1S4SA 5HWTA 2W0NA 3UDXA 5DJUA 2Q9MA 4DDYA 1F2KA 3ZQ5A 1MWSA 4FH2A 2FFFB 2ZOHA 4GDNA 2H5SA 3CHWP 4R3BA 1IKIA 3UB6A 3UPPA 4YFMA 4ARZB 1JWVA 3BECA 4Y0OA 2ZM2A 4XT2A 3VP1A 1XJ6A 1W8QA 1S1ZA 2G7UA 3UE6A 4EBLA 1MWTA 1PI5A 5HARA 1GA0A 3C4PA 4Y5FA 1VHMA 5FQJA 5HPFA 5E2GA 2ZMFA 3RJUA 5L2FA 3A0RA 4OPQA 1LSVA 2E8IA 3BW6A 3VOYA 4OKPA 1XFNA 4N1XA 1VB6A 4QY6A 3DWKA 4HH3A 1P0ZA 4Y7PA 2J80A 2VGJA 2IWCA 1SDNA 3QP4A 3KSGA 1OTEA 2EA9A 2P74A 4GJ4A 1EI5A 5HSQA 1YT4A 5AVEA 5HAIA 1FCNA 3DW0A 4EETB 3NDGA 4WEKA 4DXCA 2VGLS 1FCMA 1FSYA 2VGKA 3HREA 4GNUA 4LV1A 2XK1A 5FQ9A 1ERMA 3TSGA 3ITBA 4RYEA 2J3TC 4E3LA 4I39A 1SCWA 1RGYA 3DWZA 4QU3A 1TS8A 3NY4A 4OOYA 5FAPA 3F1OA 1MKIA 2HZ5A 1M40A 2XFTA 4GLQA 1Q2PA 1XPBA 4NXGA 5EVIA 4YWZA 4MN5A 1J9MA 1K38A 2QHKA 1DP6A 3LEQA 3NCKA 4B4XA 1LT0A 4XT2B 1YMSA 1EROA 2X71A 3BJNA 2O9AA 1BULA 1JTGA 4MN7A 5EVIC 3BQ8A 4PM5A 4KZAA 1HVBA 4OQ0A 1SHVA 2OAP1 3VSKA 5HD3A 4HQAA 1NYYA 3BLMA 5A8BA 3TW8A 4WZ5A 4GD6A 5GLBA 1G6OA 1T1CA 2VK3A 4WYYA 2V8FA 1LL9A 3A0SA 1TS6A 3KYQA 4KQQA 3SS4A 2M7VA 4G3VA 3OPLA 2QMIA 3FWLA 3H9WA 3M2KA 2HF6A 4UQIM 3ICYA 2D02A 3C4OA 3DTMA 1FOFA 4OLDA 1MKMA 1GA9A 3VP4A 2ZLYA 3G2ZA 1CEGA 3T4KA 4GN2A 3F1OB 2DNSA 4PKYA 2Y55A 3N8SA 3SH9A 5CTMA 5CGXA 1LLBA 1SDEA 4DN0A 3C5AA 3GDIA 3W4OA 1PIOA 3Q7VA 1XFQA 4B88A 1SKFA 3E98A 3NDEA 3MZEA 4EQ1A 3WWXA 1FR6A 3NJAA 2ZC5B 3L9KA 4OPRA 2BTFP 3TOIA 4L9GA 5CHUA 5DKLA 3N8RA 4U0XA 5EOEA 1TDLA 4N9LA 4K0XA 1XXMA 1DP8A 2WYXA 3QP1A 1BLPA 2PU2A 1MWUA 1Y28A 2HDUA 4C75A 1K6SA 5HL1A 1PZPA 2ZC3B 2EFXA 3OPRA 2Y4AA 3OLOA 4LENA 3CMZA 1KGFA 3WS0A 2OWHA 4HH2A 5A91A 1BLHA 2P9VA 2OV5A 2D01A 4XXRA 4MBKA 4L9EA 4Z1WA 3K3CA 4DF6A 2KLIA 3IF6A 5DTTA 3DTKA 1XGJA 2OOLA 3C7UA 2Y2MA 1N9OA 5AVFA 5AQBA 3CI6A 3ZFZA 4QWOA 3QP2A 3LR4A 3Q1FA 5HWVA 4ZJ2A 4Y3IA 3EGDC 1SZVA 1W8YA 4EERA 2WGIA 1H0MA 5FSRA 3M2JA 2ZC7A 2HDQA 1N4OA 4CJNA 4R1GA 3S7NA 1L0GA 2VV6A 3E4OA 4Z9QA 4U3TA 1BLCA 5FI7A 3UPOA 2W3HA 3G30A 4JGQA 2VV8A 3D9YA 4HNBA 1D06A 1FILA 3MMHA 5DFXA 3LYXA 4KZ3A 3G6OA 4IUKA 3CPTA 3VSLA 3AGEA 4OOMA 5FATA 1BTLA 4Y13A 4EXOA 4RX2A 1IYPA 3ZG5A 4GS9A 3ZVWA 3ZVTA 1E3UA 3WS1A 3ZG7B 3K3DA 1CF0A 1G68A 1W7FA 3BFFA 4MLLA 5AQ9A 5CTNA 3HBRA 2P9VB 4DXBA 3VOZA 2J3WA 2JKRI 1NLYA 5CEBA 3ISGA 1S66L 3IF6B 5A92A 3QNCA 2FH5A 2HPBA 1RCJA 4S2LA 2Y91A 1AXBA 4ZAMA 5EV0A 1LL5A 3BFGA 3UE1A 4LFUA 5F69A 1GSXA 5CXWA 4DKIA 1FQGA 2Y2IA 3T4LA 2EX8A 5HAPA 4JXWA 2EX6A 1W5DA 3B42A 3BFEA 1YLJA 4RA7A 4BBVA 4BQMA 1TS0A 4IEDA 4KZBA 1U60A 2V1ZA 3LIBA 3NOUC 1WYBA 1M6KA 3AGFA 1VEUA 5HDDA 4ETZA 4FSFA 5JYOA 4JLFA 3FG8A 5HZHA 4LPZA 3V3RA 1KE3A 2Y2HA 4AFIA 3W4PA 2FFYA 3CWFA 4E3MA 2ZL1A 4JBFA 1ZG4A 4DJ2A 1DJCA 4R4RA 5EOOA 5GLCA 3IXHA 2HDSA 5TBMA 1PZOA 2C5WB 3LIEA 4P6BA 1S1YA 3OPHA 5TR7A 4R4SA 3BY8A 4OOLA 4EEPA 2JN7A 4GD8A 3HCYA 2YKFA 4KZ5A 2M1CA 1BT5A 4HJ6A 5F1FA 2ZM8A 2VA0A 2HJEA 1KVLA 3T4OA 1NYMA 5HPIA 3HUOA 4KG2A 4I3JA 3MR0A 3PHYA 2UV0E 1OT9A 3T4SA 2XROA 2Y2PA 4E3IA 4F94A 4WL9A 2AVXA 3IQAA 4R3AA 3SS3A 4NKPA 2Z2LB 4E6XA 3S1YA 2XQZA 4I38A 5L8MA 4ZDXA 1PWGA 4IUHA 4GDBA 4PHTA 4G3KA 1K4FA 2J8YA 5FEGA 1E3UD 1IYOA 3EQUA 1Z09A 2W3FA 4II7A 2OLVA 5M19A 2W3GA 1LI0A 4ZTKA 1KOUA 5LBRA 4BWIA 2ZL1B 3HJKA 1IELA 3Q81A 4QD4A 1BUEA 4S2OA 5TBMB 4LV0A 2HJ9C 2W3DA 2IWDA 4Y2FA 1L0EA 4LV3A 1V9YA 4KQOA 2WKRA 5F5YA 1XGIA 3TE8A 1H8MA 3G2YA 1DY6A 1XX2A 1H3QA 3BY9A 3T1RA 4GW9A 3UO9A 5IS1A 1FCOA 3UDIA 3LCEA 1XP4A 1YLZA 4NEED 2Z2MB 3OPPA 1WE4A 3P01A 3BQAA 1GCEA 5DTKA 3EEHA 2C6WB 1UWPX 1N9NA 4Y0UA 3V5MA 3LI8A 4JGOA 1D1JA 4IJGA 3B3XA 3LR3A 2P7JA 4HBUA 4LV2A 3T4JA 3UMEA 4U0TA 5CEDA 2Y2KA 3F1PA 4PAUA 2CMNA 2XFSA 3ZG0A 1PRQA 2PR6A 1LSXA 2WUQA 3EGXC 3LFVA 3QP6A 1MWRA 4K0WA 5HAQA 4OQGA 4UA9A 1ES3A 1YQSA 5FA7A 3OZHA 4YNRA 3RXWA 5EM1A 4BBUA 1W63M 3ZG9B 4E04A 1MC0A 2J7VA 4Q0HA 1EWZA 3WRTA 4OONA 3WS5A 4KG6A 4Q0JA 4X1MA 1T1AA 2WKPA 5KIZA 4X56A 5L09A 3DTIA 1FR1A 1ES4A 3EWKA 4BENA 5GHYA 4R38A 1K6RA 1NZUA 1NWZA 4KZ9A 4HOIA 5CRFA 2V1AA 1BSGA 3W8KA 4DE1A 3UPNA 4IBRA 1S6RA 5JYPA 4LGWA 4OH0A 1BZAA 2KOIA 3T12B 3MKFA 1WYCA 4RQ9A 3L7HA 3LO7A 3GR2A 2R78A 4XUXA 3CZDA 5BOHA 2W27A 3O88A 3ZDJA 3R7WA 2Q0OA 3PBTA 4N1HA 2QYBA 3F1PB 3HLBA 3DBAA 5EE8A 3A0VA 2L4RA 2DMWA 3GQZA 4HEFA 2EXBA 2ZQDA 3IS2B 4R23A 4EEUA 1H5XA 4WZ4A 1JWPA 1S0WA 3LR5A 4WMCA 2A3UA 4G3WA 3HLFA 4JF5A 4X55A 1ACFA 4B93A 3HJIA 5J3WA 4JF6A 2X02A 1YPRA 2R9WA 5DJTA 1K25A 3LY4A 3NC8A 3BFCA 3DTEA 2Y2NA 4MBFA 3RTYA 3H82B 5KMWA 3IHAA 3MSHA 2YKHA 3CUEA 1N9BA 4WZ5C 4K08A 5GHXA 5F82A 4UAAA 4CLCA 3MXRA 1CJFA 4E3KA 2ZC6B 4X53A 5I5LA 2K2NA 3ZNTA 1T1BA 1T19A 5K5BA 1GHPA 1H8YA 4H6JA 1W79A 1JWZA 2Y59A 4DJ3A 2PRFA 4KUOA 4EBPA 3C7VA 2UWXA 1F5MA 1K55A 4PM6A 4PMAA 1H8ZA 3VFHA 3A3JA 2H10A 2KX6A 4OLGA 3C8CA 3R7WB 2QKPA 3VP3A 2PBYA 2PAVP 4X68A 1UGUA 3SZTA 3VOLA 5F1GA 3QHYA 3RXXA 4PM8A 3OBFA 2VLGA 1I2SA 4JGPA 2WKEA 1NRFA 3PTEA 3SH7A 2P04A 4B4ZA 4IVIA 2EXAA 3QP8A 3NI9A 3TJZC 3B33A 2HDRA 4D2OA 2XA7M 1YM1A 1CEFA 1ERQA 1HZOA 4EWFA 2J9PA 1YSPA 2WADA 4LRXC 5M1AA 1BYWA 1CI8A 1YMXA 3Q82A 3R4KA 2PBDP 1PWCA 4CLCB 3A3FA 3TG9A 3N4IA 3PBOA 4PM7A 4OP8A 3VE4A 3ITAA 1TVFA 1DJBA 1GHIA 3LI9A 3F1NA 4H6JB 4HP9A 3MZDA 3E4QA 2JE5A 3B47A 3E2LA 3IF6C 3IH8A 2JKTI 4WMCD 2ZMVA 3S4XA 4WLAA 5AQ7A 2BASA 3E0YA 4UQIS 3BRMA 4HBTA 2Z6CA 3ZG8B 4A5RA 1K54A 3IBJA 2JCHA 3LY3A 3MQ0A 1K4EA 2PU4A 5HD5A 3WS4A 5CGSA 2IA2A 2VJWA 3OOVA 1EW0A 3C30A 4CLCD 1KGEA 3OCNA 5F83A 2JHEA 4P6ZM 1NXYA 3IWIA 1VQQA 2LB9A 1PFLA 3TRCA 4QB8A 1K54C 3GMWA 4GOGA 1FIKA 5G18A 4OP5A 2V0UA 4O8GA 4ZJ3A 2OLUA 2Q9NA 1G6AA 5F6AA 3MKEA 1WA9A 3U4LP 4QY5A 3UE0A 2GZAA 2Z6DA 3KSHA 4C3QA 5D3OA 2NUTC 3EOIA 4OQHA 2J9OA 4LCLA 3GRJA 2VEAA 4I5SA 5GLDA 3F1NB 2V1BA 4JPMA 4Q8IA 3Q07A 3UB8A 3UE3A 3QP5A 1VM1A 3D3OA 5E43A 2PR5A 1KDWA 2EX9A 5DF8A 4DRTA 4GZBA 3ZGAB 1JTDA 2ZC4B 4EU0A 3RH8B 2W1TB 1ZG6A 5MC7A 3LR0A 4KZ4A 5J8XA 5FEFA 3JPUA 2HP5A 1V9ZA 5FASA 2P08A 3N8LA 1K56D 5E2EA 2WGVA 4UHUA 4K91A 3IX3A 1ZTUA 4CQHA 3G31A 5FAOA 2ACGA 2WGWA 1MXOA 3UY6A 4LRYC 1ONHA 3T50A 4HJ4A 2JKTM 3T1QB 2OAQ1 4HJ3A 1E4DA 4RVAA 1AWIA 4QPRA 2RCXA 2H28A 4Q0IA 4I3IA 3OC2A 3V39A 3PAGA 3UB5P 3FKVA 2XEPA 4MNRA 4MBHA 2PYRA 3FPWA 2OSUA 3FYZA 1T18A 4KQDA 3CAXA 1ONGA 4P87A 5FAQA 2V8CA 4JKTA 4WM9A 1NJ4A 1IYSA 5HFOA 2B02A 4E3NA 2DCFA 4KENB 4BD1A 3W4QA 2WKHA 1LSWA 3ZNYA 1P97A 3LICA 4C6YA 2PDRA 2A24B 3VFFA 1QMFA 2VGLM 3M6HA 2JKRM
chains in the Genus database with same CATH topology
3D9YA 1FILA 3T1RA 3CPTA 3T12B 5FEFA 4D60A 3L7HA 2E8JA 1K0KA 3T1SA 1CF0A 1VETB 2PAVP 1HLUP 4ESPA 3MS6A 1D1JA 1VETA 2ACGA 2VK3A 1SKOB 2V8FA 1PFLA 3T1QB 1PNEA 1CQAA 1FIKA 1VEUB 1SKOA 1A0KA 1AWIA 1PRQA 5EV0A 5EM0A 1Y4OA 2JKGA 3UB5P 3NECA 3U4LP 3NULA 1ACFA 2JKFA 4QWOA 4X25A 5FEGA 1Z09A 5EM1A 1J3WA 1YPRA 1SZVA 2PBDP 5EVEA 4FTXA 3CPTB 2V8CA 1VEUA 3MSHA 2ZL1B 5FDSA 4X1MA 4X1LA 4FUWA 1CJFA 2B95A 2HZ5A 3DAVA 1G5UA 2ZL1A 3KYEA 1F2KA 3T1XA 2PRFA 3LGOA 3CHWP 3L9KA 3LEQA 2BTFP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9Y A;  1FIL A;  3T1R A;  3CPT A;  3T12 B;  5FEF A;  4D60 A;  3L7H A;  2E8J A;  1K0K A;  3T1S A;  1CF0 A;  1VET B;  2PAV P;  1HLU P;  4ESP A;  3MS6 A;  1D1J A;  1VET A;  2ACG A;  2VK3 A;  1SKO B;  2V8F A;  1PFL A;  3T1Q B;  1PNE A;  1CQA A;  1FIK A;  1VEU B;  1SKO A;  1A0K A;  1AWI A;  1PRQ A;  5EV0 A;  5EM0 A;  1Y4O A;  2JKG A;  3UB5 P;  3NEC A;  3U4L P;  3NUL A;  1ACF A;  2JKF A;  4QWO A;  4X25 A;  5FEG A;  1Z09 A;  5EM1 A;  1J3W A;  1YPR A;  1SZV A;  2PBD P;  5EVE A;  4FTX A;  3CPT B;  2V8C A;  1VEU A;  3MSH A;  2ZL1 B;  5FDS A;  4X1M A;  4X1L A;  4FUW A;  1CJF A;  2B95 A;  2HZ5 A;  3DAV A;  1G5U A;  2ZL1 A;  3KYE A;  1F2K A;  3T1X A;  2PRF A;  3LGO A;  3CHW P;  3L9K A;  3LEQ A;  2BTF P; 
#chains in the Genus database with same CATH topology
 1JNU A;  4EQI A;  2Y2J A;  3ZYT A;  2IWB A;  1YLP A;  3JYI A;  3OCL A;  4BL3 A;  3GSG A;  1OPX A;  1ZC2 A;  3P7N A;  4D60 A;  3PBN A;  2CC1 A;  2H0T A;  2K7S A;  5IT5 A;  1HTZ A;  1ESU A;  4FOF A;  2WGW B;  3HLE A;  1XA7 A;  4GKU A;  5J4E A;  3UMD A;  2ZQA A;  5EUA A;  5KZH A;  1Z6F A;  4NK3 A;  1DRM A;  1GSV A;  3NOT C;  3A3I A;  4WUJ A;  5DF9 A;  5DTS A;  1SKO A;  3P98 A;  1A0K A;  2L1M A;  4QJG A;  2EX2 A;  3GVB A;  4EBN A;  1S4R A;  3G32 A;  2WZZ A;  4GHI A;  2LB5 A;  3IX4 A;  2A2L A;  1LHY A;  3N7W A;  3D72 A;  3PAE A;  1G28 A;  5AQA A;  4X25 A;  3JVU A;  4CPK A;  1K57 A;  3LUQ A;  3MQQ A;  2W3E A;  4OVD A;  4R0Q A;  3BFD A;  3O87 A;  4NG2 A;  4YIN A;  3HLD A;  1KE0 A;  1ZHH B;  1E25 A;  3IF5 A;  3IS2 A;  3NIA A;  4X1L A;  3JVV A;  2G2W A;  3GTC A;  5G4Z A;  4HY8 A;  1IFQ A;  4S2M A;  2O99 A;  3DAV A;  3O3V A;  1K57 C;  3LEZ A;  3NBL A;  5L10 A;  4EW7 A;  2V20 A;  4Y15 A;  3CLO A;  2ZQ9 A;  2XDM A;  4E6W A;  1HD8 A;  5L07 A;  1TD5 A;  1KDS A;  5CX7 A;  1GHM A;  3KSF A;  4BMW A;  4ZRR A;  3H82 A;  2WK0 A;  2HGV A;  3UNW A;  1XJ2 A;  4P0M A;  2ZOI A;  3S7P A;  1JVJ A;  2GJ3 A;  3VP0 A;  3MXQ A;  4M3K A;  3NOP C;  4H8R A;  1CK3 A;  1I2W A;  2ZM0 A;  1W63 Q;  1O07 A;  2EWV A;  1SKO B;  1F98 A;  4KUK A;  4GHI B;  3LID A;  2PYP A;  1F9I A;  3V50 A;  5J7E A;  1N9L A;  4KZ6 A;  4WEL A;  3WRZ A;  1FSW A;  2K31 A;  3LIF A;  4Y17 A;  1OME A;  4HIA A;  1RP5 A;  3NHQ A;  2XD1 A;  4KQR A;  4E3J A;  4LRZ E;  2JKG A;  1DJA A;  2A49 A;  2ZJ9 A;  3BM6 A;  4OPY A;  3NEC A;  5C5K A;  3S22 A;  2O0Y A;  4OQI A;  2PHY A;  2WAF A;  1UWN X;  5HL6 A;  2GNX A;  5DF7 A;  5TGF A;  3V3S A;  3UB7 A;  2XLN A;  3PBR A;  4DMZ A;  4L9F A;  3MQO A;  4MN6 A;  2G2U A;  2R9X A;  3IX8 A;  4ZJ1 A;  4UA6 A;  4QHC A;  4GCZ A;  3PBQ A;  1ZKJ A;  2X01 A;  4DDS A;  3C38 A;  4CLC E;  4FH4 A;  3FZC A;  5KSC A;  5E2F A;  3S7Q A;  4O01 A;  1TS7 A;  2XGN A;  4B9O A;  2B95 A;  4WEJ A;  5EFW A;  3KYE A;  3G4P A;  4FCF A;  3PR6 A;  1YKD A;  5EEC A;  3HL9 A;  1KVM A;  2EWW A;  2Y8H A;  5TJJ A;  1PW1 A;  3E2K A;  2NUP C;  3T4T A;  1O7E A;  5TFQ A;  4BL2 A;  5DKK A;  1XJ3 A;  3RFB A;  3VE3 A;  4WBG A;  5F68 A;  1ESI A;  4YOF A;  2Y2G A;  3PBS A;  3EQV A;  2I9V A;  2EFU A;  3UN7 A;  4ESP A;  3CUE C;  3MS6 A;  2W1R A;  4UA7 A;  2OWJ A;  5FQI A;  1YSQ A;  1VET A;  4DE3 A;  4CLC C;  5HDS A;  3K2N A;  4MDZ A;  5FI6 A;  3BWL A;  4MCW A;  4MMN A;  4ZBE A;  4N92 A;  5CHM A;  3MFD A;  3IH9 A;  4IVK A;  5KSH A;  1ALQ A;  1STZ A;  5IU1 A;  4HI4 A;  4KZ7 A;  4S2I A;  5EVI B;  2M7U A;  1PYY A;  3NUL A;  4X69 A;  3VV4 A;  5FI2 A;  1K55 C;  4JF4 A;  2L0W A;  1XKZ A;  3KO6 A;  2QZ6 A;  2HP9 A;  1OTA A;  1L0F A;  2J3T D;  2V0W A;  4PPR A;  4DE0 A;  2QJ7 A;  4PM9 A;  5A90 A;  4I3A A;  4ETX A;  3HLW A;  2PD8 A;  3HUM A;  3IBR A;  3FKW A;  4DE2 A;  4NXF A;  1Q2Q A;  3BLS A;  3VMA A;  2JC7 A;  3H7W A;  2WAE A;  3PXP A;  1DP9 A;  1P9W A;  2JBF A;  3IWO A;  3S7O A;  1LI9 A;  5HW3 A;  2Y79 A;  3FPV A;  1QME A;  2PT7 A;  4FD8 A;  3GEC A;  4R3J A;  2QJ5 A;  2ZMA A;  2H0Y A;  4L0L A;  1NRJ A;  4GB7 A;  1K56 A;  1MZU A;  2V2F F;  1GSW A;  1LL8 A;  3Q7Z A;  5EVI D;  5CGW A;  4R6L A;  4NXB A;  2Y2L A;  3ZHH A;  3IXD A;  1IYQ A;  4S2K A;  1I5Q A;  3HLC A;  5HDC A;  3P09 A;  3WS2 A;  5FDH A;  1K0K A;  5EVL A;  1ODV A;  1VET B;  3CIT A;  4JXG A;  4IHQ A;  1IEM A;  2RL3 A;  2HV1 A;  5DVA A;  3C2W A;  5IHV A;  2VX8 A;  2Y2O A;  1TEM A;  1XJ4 A;  4JXS A;  3IWQ A;  3GV9 A;  2W1T A;  3O86 A;  2BG1 A;  1MY8 A;  5DFY A;  1IOU A;  2XRN A;  1L2S A;  4BBT A;  1NZO A;  3G35 A;  1ES2 A;  3IXB A;  3I7J A;  3Q7V B;  3ULF A;  1RGZ A;  1BLS A;  1PW8 A;  3UDF A;  3IXG A;  4S2N A;  4XUZ A;  4E3O A;  3MFX A;  1J3W A;  2ZQ8 A;  1OTI A;  5EVE A;  5G4Y A;  2QPN A;  3SOI A;  3H7W B;  1OTB A;  2Y2Q A;  3LIA A;  1OJ5 A;  4WF0 A;  4IBX A;  4LCM A;  3E4P A;  2ZBB A;  1P9R A;  2QWS A;  3FV7 A;  3MBZ A;  4S2N C;  3A3E A;  3HUN A;  1G5U A;  3N6I A;  3BEB A;  2XH9 A;  3QNB A;  3CG5 A;  3T1X A;  1KE4 A;  2DRW A;  4JGR A;  4NET A;  4KZ8 A;  5FL3 A;  1D7E A;  4F3L A;  3IT9 A;  2V9A A;  2XA7 S;  2ZQ7 A;  3SS5 A;  3O5Y A;  1X0O A;  1YAX A;  5GHZ A;  2XD5 A;  2VZW A;  5EPH A;  2I72 A;  1PWD A;  4ID4 A;  4O7D A;  4N9K A;  3T1S A;  1OJG A;  1YLW A;  5AJG A;  3U2A A;  1HLU P;  3CJM A;  4R70 A;  4EV4 A;  4ME4 A;  1NLZ A;  1YLT A;  2A24 A;  5GLA A;  3MXS A;  3A3D A;  2INW A;  3KSI A;  4M4X A;  3D4F A;  4S2J A;  1L0D A;  1C3B A;  1Y4O A;  2O9B A;  3KYZ A;  2GX5 A;  1XA1 A;  2HP6 A;  3EEA A;  1OTD A;  4BLM A;  3IHB A;  5E2H A;  2JKF A;  3SH8 A;  3V67 A;  3HVF A;  5GL9 A;  1KGG A;  3G34 A;  3UB9 A;  1TDG A;  4FTX A;  4S2P A;  5CER A;  3CPT B;  3ZCZ A;  5FQK A;  5FDS A;  1S67 L;  5HX9 A;  4FUW A;  4X6T A;  4GS9 B;  3PYP A;  4P6Z S;  4MEZ A;  3M6B A;  1MPL A;  3MF0 A;  4F3L B;  4PKY G;  4HHD A;  1NY0 A;  3LGO A;  3BYD A;  3FC7 A;  2B5R A;  2ZD8 A;  2XF3 A;  4BJP A;  2XR0 A;  5HWW A;  2MJ6 A;  3MJQ A;  4P85 A;  3W2Z A;  1PI4 A;  1MBL A;  5I94 A;  2GDN A;  4Y0T A;  4HP4 A;  2E8J A;  4ARZ A;  1Y54 A;  4WN5 A;  4UEY A;  3KX0 X;  2KDK A;  5CEC A;  5M18 A;  3T4Q A;  1CI9 A;  4O0P A;  2WZX A;  2FZ0 A;  2B18 A;  2XSS A;  1PNE A;  1CQA A;  2WKQ A;  1VEU B;  2WKI A;  1L3L A;  5FQM A;  5A93 A;  3AGD A;  4BD0 A;  2PD7 A;  5CHJ A;  5EM0 A;  2ZQC A;  4NXE A;  5FQQ A;  1ES5 A;  4LLO B;  4EES A;  5U47 A;  3MZF A;  4JXV A;  4EUV A;  4HES A;  2VKS A;  1TF1 A;  3HLG A;  2VV7 A;  4RX3 A;  3SW1 A;  2O9C A;  3VP2 A;  4EUZ A;  1OT6 A;  4OPZ A;  2BLS A;  4KG5 A;  1IKG A;  1YLY A;  1S4S A;  5HWT A;  2W0N A;  3UDX A;  5DJU A;  2Q9M A;  4DDY A;  1F2K A;  3ZQ5 A;  1MWS A;  4FH2 A;  2FFF B;  2ZOH A;  4GDN A;  2H5S A;  3CHW P;  4R3B A;  1IKI A;  3UB6 A;  3UPP A;  4YFM A;  4ARZ B;  1JWV A;  3BEC A;  4Y0O A;  2ZM2 A;  4XT2 A;  3VP1 A;  1XJ6 A;  1W8Q A;  1S1Z A;  2G7U A;  3UE6 A;  4EBL A;  1MWT A;  1PI5 A;  5HAR A;  1GA0 A;  3C4P A;  4Y5F A;  1VHM A;  5FQJ A;  5HPF A;  5E2G A;  2ZMF A;  3RJU A;  5L2F A;  3A0R A;  4OPQ A;  1LSV A;  2E8I A;  3BW6 A;  3VOY A;  4OKP A;  1XFN A;  4N1X A;  1VB6 A;  4QY6 A;  3DWK A;  4HH3 A;  1P0Z A;  4Y7P A;  2J80 A;  2VGJ A;  2IWC A;  1SDN A;  3QP4 A;  3KSG A;  1OTE A;  2EA9 A;  2P74 A;  4GJ4 A;  1EI5 A;  5HSQ A;  1YT4 A;  5AVE A;  5HAI A;  1FCN A;  3DW0 A;  4EET B;  3NDG A;  4WEK A;  4DXC A;  2VGL S;  1FCM A;  1FSY A;  2VGK A;  3HRE A;  4GNU A;  4LV1 A;  2XK1 A;  5FQ9 A;  1ERM A;  3TSG A;  3ITB A;  4RYE A;  2J3T C;  4E3L A;  4I39 A;  1SCW A;  1RGY A;  3DWZ A;  4QU3 A;  1TS8 A;  3NY4 A;  4OOY A;  5FAP A;  3F1O A;  1MKI A;  2HZ5 A;  1M40 A;  2XFT A;  4GLQ A;  1Q2P A;  1XPB A;  4NXG A;  5EVI A;  4YWZ A;  4MN5 A;  1J9M A;  1K38 A;  2QHK A;  1DP6 A;  3LEQ A;  3NCK A;  4B4X A;  1LT0 A;  4XT2 B;  1YMS A;  1ERO A;  2X71 A;  3BJN A;  2O9A A;  1BUL A;  1JTG A;  4MN7 A;  5EVI C;  3BQ8 A;  4PM5 A;  4KZA A;  1HVB A;  4OQ0 A;  1SHV A;  2OAP 1;  3VSK A;  5HD3 A;  4HQA A;  1NYY A;  3BLM A;  5A8B A;  3TW8 A;  4WZ5 A;  4GD6 A;  5GLB A;  1G6O A;  1T1C A;  2VK3 A;  4WYY A;  2V8F A;  1LL9 A;  3A0S A;  1TS6 A;  3KYQ A;  4KQQ A;  3SS4 A;  2M7V A;  4G3V A;  3OPL A;  2QMI A;  3FWL A;  3H9W A;  3M2K A;  2HF6 A;  4UQI M;  3ICY A;  2D02 A;  3C4O A;  3DTM A;  1FOF A;  4OLD A;  1MKM A;  1GA9 A;  3VP4 A;  2ZLY A;  3G2Z A;  1CEG A;  3T4K A;  4GN2 A;  3F1O B;  2DNS A;  4PKY A;  2Y55 A;  3N8S A;  3SH9 A;  5CTM A;  5CGX A;  1LLB A;  1SDE A;  4DN0 A;  3C5A A;  3GDI A;  3W4O A;  1PIO A;  3Q7V A;  1XFQ A;  4B88 A;  1SKF A;  3E98 A;  3NDE A;  3MZE A;  4EQ1 A;  3WWX A;  1FR6 A;  3NJA A;  2ZC5 B;  3L9K A;  4OPR A;  2BTF P;  3TOI A;  4L9G A;  5CHU A;  5DKL A;  3N8R A;  4U0X A;  5EOE A;  1TDL A;  4N9L A;  4K0X A;  1XXM A;  1DP8 A;  2WYX A;  3QP1 A;  1BLP A;  2PU2 A;  1MWU A;  1Y28 A;  2HDU A;  4C75 A;  1K6S A;  5HL1 A;  1PZP A;  2ZC3 B;  2EFX A;  3OPR A;  2Y4A A;  3OLO A;  4LEN A;  3CMZ A;  1KGF A;  3WS0 A;  2OWH A;  4HH2 A;  5A91 A;  1BLH A;  2P9V A;  2OV5 A;  2D01 A;  4XXR A;  4MBK A;  4L9E A;  4Z1W A;  3K3C A;  4DF6 A;  2KLI A;  3IF6 A;  5DTT A;  3DTK A;  1XGJ A;  2OOL A;  3C7U A;  2Y2M A;  1N9O A;  5AVF A;  5AQB A;  3CI6 A;  3ZFZ A;  4QWO A;  3QP2 A;  3LR4 A;  3Q1F A;  5HWV A;  4ZJ2 A;  4Y3I A;  3EGD C;  1SZV A;  1W8Y A;  4EER A;  2WGI A;  1H0M A;  5FSR A;  3M2J A;  2ZC7 A;  2HDQ A;  1N4O A;  4CJN A;  4R1G A;  3S7N A;  1L0G A;  2VV6 A;  3E4O A;  4Z9Q A;  4U3T A;  1BLC A;  5FI7 A;  3UPO A;  2W3H A;  3G30 A;  4JGQ A;  2VV8 A;  3D9Y A;  4HNB A;  1D06 A;  1FIL A;  3MMH A;  5DFX A;  3LYX A;  4KZ3 A;  3G6O A;  4IUK A;  3CPT A;  3VSL A;  3AGE A;  4OOM A;  5FAT A;  1BTL A;  4Y13 A;  4EXO A;  4RX2 A;  1IYP A;  3ZG5 A;  4GS9 A;  3ZVW A;  3ZVT A;  1E3U A;  3WS1 A;  3ZG7 B;  3K3D A;  1CF0 A;  1G68 A;  1W7F A;  3BFF A;  4MLL A;  5AQ9 A;  5CTN A;  3HBR A;  2P9V B;  4DXB A;  3VOZ A;  2J3W A;  2JKR I;  1NLY A;  5CEB A;  3ISG A;  1S66 L;  3IF6 B;  5A92 A;  3QNC A;  2FH5 A;  2HPB A;  1RCJ A;  4S2L A;  2Y91 A;  1AXB A;  4ZAM A;  5EV0 A;  1LL5 A;  3BFG A;  3UE1 A;  4LFU A;  5F69 A;  1GSX A;  5CXW A;  4DKI A;  1FQG A;  2Y2I A;  3T4L A;  2EX8 A;  5HAP A;  4JXW A;  2EX6 A;  1W5D A;  3B42 A;  3BFE A;  1YLJ A;  4RA7 A;  4BBV A;  4BQM A;  1TS0 A;  4IED A;  4KZB A;  1U60 A;  2V1Z A;  3LIB A;  3NOU C;  1WYB A;  1M6K A;  3AGF A;  1VEU A;  5HDD A;  4ETZ A;  4FSF A;  5JYO A;  4JLF A;  3FG8 A;  5HZH A;  4LPZ A;  3V3R A;  1KE3 A;  2Y2H A;  4AFI A;  3W4P A;  2FFY A;  3CWF A;  4E3M A;  2ZL1 A;  4JBF A;  1ZG4 A;  4DJ2 A;  1DJC A;  4R4R A;  5EOO A;  5GLC A;  3IXH A;  2HDS A;  5TBM A;  1PZO A;  2C5W B;  3LIE A;  4P6B A;  1S1Y A;  3OPH A;  5TR7 A;  4R4S A;  3BY8 A;  4OOL A;  4EEP A;  2JN7 A;  4GD8 A;  3HCY A;  2YKF A;  4KZ5 A;  2M1C A;  1BT5 A;  4HJ6 A;  5F1F A;  2ZM8 A;  2VA0 A;  2HJE A;  1KVL A;  3T4O A;  1NYM A;  5HPI A;  3HUO A;  4KG2 A;  4I3J A;  3MR0 A;  3PHY A;  2UV0 E;  1OT9 A;  3T4S A;  2XRO A;  2Y2P A;  4E3I A;  4F94 A;  4WL9 A;  2AVX A;  3IQA A;  4R3A A;  3SS3 A;  4NKP A;  2Z2L B;  4E6X A;  3S1Y A;  2XQZ A;  4I38 A;  5L8M A;  4ZDX A;  1PWG A;  4IUH A;  4GDB A;  4PHT A;  4G3K A;  1K4F A;  2J8Y A;  5FEG A;  1E3U D;  1IYO A;  3EQU A;  1Z09 A;  2W3F A;  4II7 A;  2OLV A;  5M19 A;  2W3G A;  1LI0 A;  4ZTK A;  1KOU A;  5LBR A;  4BWI A;  2ZL1 B;  3HJK A;  1IEL A;  3Q81 A;  4QD4 A;  1BUE A;  4S2O A;  5TBM B;  4LV0 A;  2HJ9 C;  2W3D A;  2IWD A;  4Y2F A;  1L0E A;  4LV3 A;  1V9Y A;  4KQO A;  2WKR A;  5F5Y A;  1XGI A;  3TE8 A;  1H8M A;  3G2Y A;  1DY6 A;  1XX2 A;  1H3Q A;  3BY9 A;  3T1R A;  4GW9 A;  3UO9 A;  5IS1 A;  1FCO A;  3UDI A;  3LCE A;  1XP4 A;  1YLZ A;  4NEE D;  2Z2M B;  3OPP A;  1WE4 A;  3P01 A;  3BQA A;  1GCE A;  5DTK A;  3EEH A;  2C6W B;  1UWP X;  1N9N A;  4Y0U A;  3V5M A;  3LI8 A;  4JGO A;  1D1J A;  4IJG A;  3B3X A;  3LR3 A;  2P7J A;  4HBU A;  4LV2 A;  3T4J A;  3UME A;  4U0T A;  5CED A;  2Y2K A;  3F1P A;  4PAU A;  2CMN A;  2XFS A;  3ZG0 A;  1PRQ A;  2PR6 A;  1LSX A;  2WUQ A;  3EGX C;  3LFV A;  3QP6 A;  1MWR A;  4K0W A;  5HAQ A;  4OQG A;  4UA9 A;  1ES3 A;  1YQS A;  5FA7 A;  3OZH A;  4YNR A;  3RXW A;  5EM1 A;  4BBU A;  1W63 M;  3ZG9 B;  4E04 A;  1MC0 A;  2J7V A;  4Q0H A;  1EWZ A;  3WRT A;  4OON A;  3WS5 A;  4KG6 A;  4Q0J A;  4X1M A;  1T1A A;  2WKP A;  5KIZ A;  4X56 A;  5L09 A;  3DTI A;  1FR1 A;  1ES4 A;  3EWK A;  4BEN A;  5GHY A;  4R38 A;  1K6R A;  1NZU A;  1NWZ A;  4KZ9 A;  4HOI A;  5CRF A;  2V1A A;  1BSG A;  3W8K A;  4DE1 A;  3UPN A;  4IBR A;  1S6R A;  5JYP A;  4LGW A;  4OH0 A;  1BZA A;  2KOI A;  3T12 B;  3MKF A;  1WYC A;  4RQ9 A;  3L7H A;  3LO7 A;  3GR2 A;  2R78 A;  4XUX A;  3CZD A;  5BOH A;  2W27 A;  3O88 A;  3ZDJ A;  3R7W A;  2Q0O A;  3PBT A;  4N1H A;  2QYB A;  3F1P B;  3HLB A;  3DBA A;  5EE8 A;  3A0V A;  2L4R A;  2DMW A;  3GQZ A;  4HEF A;  2EXB A;  2ZQD A;  3IS2 B;  4R23 A;  4EEU A;  1H5X A;  4WZ4 A;  1JWP A;  1S0W A;  3LR5 A;  4WMC A;  2A3U A;  4G3W A;  3HLF A;  4JF5 A;  4X55 A;  1ACF A;  4B93 A;  3HJI A;  5J3W A;  4JF6 A;  2X02 A;  1YPR A;  2R9W A;  5DJT A;  1K25 A;  3LY4 A;  3NC8 A;  3BFC A;  3DTE A;  2Y2N A;  4MBF A;  3RTY A;  3H82 B;  5KMW A;  3IHA A;  3MSH A;  2YKH A;  3CUE A;  1N9B A;  4WZ5 C;  4K08 A;  5GHX A;  5F82 A;  4UAA A;  4CLC A;  3MXR A;  1CJF A;  4E3K A;  2ZC6 B;  4X53 A;  5I5L A;  2K2N A;  3ZNT A;  1T1B A;  1T19 A;  5K5B A;  1GHP A;  1H8Y A;  4H6J A;  1W79 A;  1JWZ A;  2Y59 A;  4DJ3 A;  2PRF A;  4KUO A;  4EBP A;  3C7V A;  2UWX A;  1F5M A;  1K55 A;  4PM6 A;  4PMA A;  1H8Z A;  3VFH A;  3A3J A;  2H10 A;  2KX6 A;  4OLG A;  3C8C A;  3R7W B;  2QKP A;  3VP3 A;  2PBY A;  2PAV P;  4X68 A;  1UGU A;  3SZT A;  3VOL A;  5F1G A;  3QHY A;  3RXX A;  4PM8 A;  3OBF A;  2VLG A;  1I2S A;  4JGP A;  2WKE A;  1NRF A;  3PTE A;  3SH7 A;  2P04 A;  4B4Z A;  4IVI A;  2EXA A;  3QP8 A;  3NI9 A;  3TJZ C;  3B33 A;  2HDR A;  4D2O A;  2XA7 M;  1YM1 A;  1CEF A;  1ERQ A;  1HZO A;  4EWF A;  2J9P A;  1YSP A;  2WAD A;  4LRX C;  5M1A A;  1BYW A;  1CI8 A;  1YMX A;  3Q82 A;  3R4K A;  2PBD P;  1PWC A;  4CLC B;  3A3F A;  3TG9 A;  3N4I A;  3PBO A;  4PM7 A;  4OP8 A;  3VE4 A;  3ITA A;  1TVF A;  1DJB A;  1GHI A;  3LI9 A;  3F1N A;  4H6J B;  4HP9 A;  3MZD A;  3E4Q A;  2JE5 A;  3B47 A;  3E2L A;  3IF6 C;  3IH8 A;  2JKT I;  4WMC D;  2ZMV A;  3S4X A;  4WLA A;  5AQ7 A;  2BAS A;  3E0Y A;  4UQI S;  3BRM A;  4HBT A;  2Z6C A;  3ZG8 B;  4A5R A;  1K54 A;  3IBJ A;  2JCH A;  3LY3 A;  3MQ0 A;  1K4E A;  2PU4 A;  5HD5 A;  3WS4 A;  5CGS A;  2IA2 A;  2VJW A;  3OOV A;  1EW0 A;  3C30 A;  4CLC D;  1KGE A;  3OCN A;  5F83 A;  2JHE A;  4P6Z M;  1NXY A;  3IWI A;  1VQQ A;  2LB9 A;  1PFL A;  3TRC A;  4QB8 A;  1K54 C;  3GMW A;  4GOG A;  1FIK A;  5G18 A;  4OP5 A;  2V0U A;  4O8G A;  4ZJ3 A;  2OLU A;  2Q9N A;  1G6A A;  5F6A A;  3MKE A;  1WA9 A;  3U4L P;  4QY5 A;  3UE0 A;  2GZA A;  2Z6D A;  3KSH A;  4C3Q A;  5D3O A;  2NUT C;  3EOI A;  4OQH A;  2J9O A;  4LCL A;  3GRJ A;  2VEA A;  4I5S A;  5GLD A;  3F1N B;  2V1B A;  4JPM A;  4Q8I A;  3Q07 A;  3UB8 A;  3UE3 A;  3QP5 A;  1VM1 A;  3D3O A;  5E43 A;  2PR5 A;  1KDW A;  2EX9 A;  5DF8 A;  4DRT A;  4GZB A;  3ZGA B;  1JTD A;  2ZC4 B;  4EU0 A;  3RH8 B;  2W1T B;  1ZG6 A;  5MC7 A;  3LR0 A;  4KZ4 A;  5J8X A;  5FEF A;  3JPU A;  2HP5 A;  1V9Z A;  5FAS A;  2P08 A;  3N8L A;  1K56 D;  5E2E A;  2WGV A;  4UHU A;  4K91 A;  3IX3 A;  1ZTU A;  4CQH A;  3G31 A;  5FAO A;  2ACG A;  2WGW A;  1MXO A;  3UY6 A;  4LRY C;  1ONH A;  3T50 A;  4HJ4 A;  2JKT M;  3T1Q B;  2OAQ 1;  4HJ3 A;  1E4D A;  4RVA A;  1AWI A;  4QPR A;  2RCX A;  2H28 A;  4Q0I A;  4I3I A;  3OC2 A;  3V39 A;  3PAG A;  3UB5 P;  3FKV A;  2XEP A;  4MNR A;  4MBH A;  2PYR A;  3FPW A;  2OSU A;  3FYZ A;  1T18 A;  4KQD A;  3CAX A;  1ONG A;  4P87 A;  5FAQ A;  2V8C A;  4JKT A;  4WM9 A;  1NJ4 A;  1IYS A;  5HFO A;  2B02 A;  4E3N A;  2DCF A;  4KEN B;  4BD1 A;  3W4Q A;  2WKH A;  1LSW A;  3ZNY A;  1P97 A;  3LIC A;  4C6Y A;  2PDR A;  2A24 B;  3VFF A;  1QMF A;  2VGL M;  3M6H A;  2JKR M; 
#chains in the Genus database with same CATH homology
 3D9Y A;  1FIL A;  3T1R A;  3CPT A;  3T12 B;  5FEF A;  4D60 A;  3L7H A;  2E8J A;  1K0K A;  3T1S A;  1CF0 A;  1VET B;  2PAV P;  1HLU P;  4ESP A;  3MS6 A;  1D1J A;  1VET A;  2ACG A;  2VK3 A;  1SKO B;  2V8F A;  1PFL A;  3T1Q B;  1PNE A;  1CQA A;  1FIK A;  1VEU B;  1SKO A;  1A0K A;  1AWI A;  1PRQ A;  5EV0 A;  5EM0 A;  1Y4O A;  2JKG A;  3UB5 P;  3NEC A;  3U4L P;  3NUL A;  1ACF A;  2JKF A;  4QWO A;  4X25 A;  5FEG A;  1Z09 A;  5EM1 A;  1J3W A;  1YPR A;  1SZV A;  2PBD P;  5EVE A;  4FTX A;  3CPT B;  2V8C A;  1VEU A;  3MSH A;  2ZL1 B;  5FDS A;  4X1M A;  4X1L A;  4FUW A;  1CJF A;  2B95 A;  2HZ5 A;  3DAV A;  1G5U A;  2ZL1 A;  3KYE A;  1F2K A;  3T1X A;  2PRF A;  3LGO A;  3CHW P;  3L9K A;  3LEQ A;  2BTF P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...