5EM1A

Crystal structure of ragweed allergen amb a 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
127
Chain Sequence
GSGSWQTYVDEHLMDIEGTGQHLASAAIFGTDGNVWASSSFPEFPDEINAIIKEFSEPGALAPTGLFLAGAYMVIQGEPGAVIRGGAGGICITGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Profilin
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
total genus 31
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5em1A00
2HZ5A 3T12B 2BTFP 1YPRA 2PAVP 5EM0A 1SKOB 2ZL1B 4X1LA 2JKGA 5FEFA 5FDSA 2V8FA 3LEQA 4ESPA 1VETB 1K0KA 3MSHA 3CPTA 3CHWP 2E8JA 3D9YA 1VEUA 2PBDP 1PFLA 3T1QB 1Y4OA 5EV0A 4FUWA 3NECA 3NULA 2VK3A 3T1SA 1CF0A 3MS6A 1J3WA 1SZVA 3DAVA 2ZL1A 5EM1A 3L7HA 1CJFA 2PRFA 3LGOA 1FIKA 1G5UA 5EVEA 1VETA 2ACGA 2JKFA 4D60A 3UB5P 1HLUP 4X25A 1PRQA 1ACFA 4QWOA 1PNEA 3U4LP 5FEGA 1SKOA 4FTXA 3CPTB 1AWIA 2V8CA 2B95A 3T1XA 1D1JA 3L9KA 1Z09A 1VEUB 4X1MA 1CQAA 3KYEA 3T1RA 1A0KA 1FILA 1F2KA
chains in the Genus database with same CATH superfamily
2W1TA 1H3QA 3ZVWA 1MWSA 3JVUA 2BTFP 3OPPA 4HHDA 3MKFA 2K31A 1OTEA 5KMWA 1PW1A 4DXBA 1KGFA 5CXWA 4UA9A 3NCKA 2JKGA 2Y55A 5HWVA 5EOOA 1FCMA 2A49A 1DRMA 2L4RA 4IVKA 1VM1A 3ZQ5A 4HP9A 2WKQA 4GNUA 1X0OA 2J3TC 3T1QB 2OAQ1 1IYSA 5U47A 5J3WA 4BWIA 2OLUA 3NOUC 3OC2A 3MZFA 5JYOA 3UMEA 1WYCA 2XR0A 2WKHA 4Y2FA 3T1SA 1MY8A 2W1TB 1S6RA 2Y2IA 4B9OA 4EEUA 1VQQA 4WLAA 1JWPA 1PZOA 2XFSA 3WS1A 1OTDA 3BY9A 2JKRM 3W4OA 1VETA 4JGPA 2HPBA 3S7PA 2INWA 1GSWA 3O3VA 3JPUA 1HLUP 4X25A 3K2NA 2HDSA 4QWOA 2O99A 3CUEC 5E2GA 4MBFA 2XLNA 4YNRA 4FTXA 3CZDA 2B95A 3ITAA 2P7JA 2V1AA 4GD8A 3ZNYA 3UB7A 3IS2A 4PKYG 4P87A 5CECA 2HP9A 4Y15A 1W5DA 2W3DA 5AQ9A 3C7VA 2EA9A 2X01A 5FAPA 3BW6A 3NOPC 5HW3A 2J9PA 3R7WA 2J3TD 1GA9A 3QP6A 5FQ9A 3LIFA 5GL9A 3VP1A 4I3IA 1XP4A 3OCLA 3LEQA 3IWQA 1VETB 2Y59A 1TDGA 4DDSA 2LB9A 4KUKA 4Y3IA 2IWDA 5C5KA 3O5YA 4WUJA 3BFEA 1H8YA 3IXHA 3OOVA 2HGVA 4PKYA 4KZ5A 3T4QA 3OBFA 2UV0E 3C2WA 1NZOA 3VMAA 5KZHA 3IS2B 4DDYA 2BLSA 2WADA 3A0SA 4G3KA 3OPHA 3BLSA 1LHYA 2P9VA 3A0RA 1G6OA 3IXDA 5FQJA 3RJUA 5DF9A 2FZ0A 4M4XA 1C3BA 3A3FA 5J4EA 5DTKA 4ZJ2A 4PM9A 4E3KA 3MKEA 1W8YA 5HL1A 2XF3A 1OT6A 3ZYTA 5L07A 1RGYA 1SKOA 1LSWA 1EI5A 1ALQA 1ONHA 1JTDA 5DFYA 1MBLA 4MMNA 1YAXA 4LV1A 2JN7A 3T1RA 4YOFA 1SCWA 3H7WA 1DP8A 2XSSA 1XJ3A 3P98A 1ESUA 1YT4A 2EX6A 3F1PA 1K4EA 1I5QA 5HD5A 3C8CA 2WK0A 3EEHA 2P9VB 3QP4A 2QMIA 1RCJA 5CEDA 1YLPA 4KQRA 2B02A 4PM6A 4UA6A 3IH9A 5L10A 1MKMA 3N6IA 4GDNA 1JNUA 1S4RA 2FFYA 3GDIA 2EFUA 2PDRA 4O01A 3KSHA 2D02A 3VV4A 3H7WB 3HLWA 4N9LA 2G7UA 1K38A 3BQ8A 2OV5A 5IS1A 3S22A 4WMCD 4O0PA 3C4PA 3IWIA 1KOUA 4EBLA 2DMWA 1W63M 3F1PB 3CG5A 2VLGA 2WUQA 3C4OA 2GX5A 3A0VA 4MN7A 4FOFA 4GZBA 2G2UA 3CWFA 4OPZA 5E2HA 5EPHA 5BOHA 2A24A 3GR2A 3ITBA 2WGVA 5L2FA 4S2NA 2P74A 1ACFA 5HAIA 3TE8A 2K7SA 2VA0A 1AWIA 1S1ZA 4RX3A 4NK3A 3L9KA 5HAQA 3PAGA 4LCLA 3UMDA 1TS0A 1JTGA 2ZMFA 2PHYA 1IKIA 5I94A 3Q7VA 4KG6A 1ERMA 5E2FA 4I38A 3NDGA 4LV2A 5AVFA 1TDLA 4L0LA 1MWUA 3BM6A 4JGOA 3GRJA 4IHQA 3NJAA 4FH4A 4ZJ3A 4HIAA 4QD4A 4X6TA 3IF6A 3NC8A 3FWLA 1O07A 4OOYA 3LR0A 3UPPA 3CUEA 3IX8A 4Z9QA 4KQDA 4WEJA 2A2LA 3ZDJA 2ZC4B 4QU3A 1PYYA 1D7EA 2A24B 2ZQAA 1BLHA 4P6ZM 3PBTA 5FL3A 3ULFA 3OZHA 2GDNA 5GLDA 1XXMA 1TS6A 3VP3A 5EV0A 4UAAA 2V1BA 4EBPA 3LR5A 5J8XA 1NY0A 3Q7VB 5TBMA 4JKTA 1WYBA 1ODVA 1J3WA 3NDEA 4KZAA 3HJIA 5EECA 1E4DA 4R70A 2WKIA 1CJFA 3FYZA 3WS0A 4NG2A 3W2ZA 3IF6B 5EFWA 2PU4A 2HF6A 2VX8A 2HV1A 3QNCA 1G6AA 5G4ZA 4P6BA 2XROA 3SS5A 3CLOA 4DF6A 3SOIA 2PD8A 2KX6A 1MWRA 5FQMA 1NXYA 4NKPA 3N4IA 2I72A 5FAOA 1BUEA 4X69A 3IH8A 1IYOA 1UWPX 3P01A 2ZQ7A 3QP1A 1XFQA 3T12B 2B18A 5F6AA 1GSXA 4FCFA 5TBMB 2EWWA 2Y79A 3ZGAB 3QP8A 4DXCA 3TJZC 4NEED 2W3GA 1LI0A 1PWDA 1F5MA 4HEFA 3EOIA 3HLCA 3DBAA 3CMZA 4EERA 1LL5A 5GHZA 3T4KA 5EOEA 3UE0A 3E2KA 2JHEA 2D01A 4NXBA 2Z2MB 3SH7A 1HTZA 5AJGA 1AXBA 1F98A 1PFLA 3HBRA 1ESIA 2OWHA 5HAPA 5L09A 4B88A 3VFFA 3D3OA 1ES2A 4OOMA 3T4LA 1EW0A 3LIDA 1TF1A 2XK1A 2PT7A 5EE8A 5TGFA 4OONA 1SZVA 4WZ5C 3UB9A 3L7HA 3PR6A 5HPFA 3BRMA 4IBRA 4Z1WA 2G2WA 1XJ2A 3UE1A 1V9ZA 3PBNA 2JKFA 3UB5P 2EWVA 3PTEA 3ZG9B 4LRZE 3SS3A 4EBNA 5DKLA 4IBXA 3FKVA 1S0WA 5EVIC 1GHIA 4GW9A 4KZ4A 4IVIA 4F94A 1V9YA 5HDSA 3G2ZA 1BULA 3UNWA 5DJTA 1ZHHB 2VV6A 3AGEA 3S7NA 3BFCA 3VSLA 2WKRA 3OPLA 3G35A 3FZCA 4R0QA 1BTLA 3FG8A 4OP5A 4HH2A 1KE3A 1PIOA 3UPNA 3F1NB 5CHMA 1LSVA 2GZAA 1WA9A 3SS4A 3QHYA 4JF6A 4ESPA 1RGZA 5DKKA 3KO6A 3WS5A 3WS2A 3B3XA 2ZD8A 4JXSA 4HY8A 4G3VA 5DTSA 1Y28A 4OH0A 3W4QA 1YM1A 3ZHHA 3N8RA 4O8GA 1PW8A 4BBUA 3VE3A 1F9IA 4Q0JA 2Y2PA 3Q82A 5A93A 3OPRA 1YQSA 4DJ3A 3UDFA 4HBTA 1IYQA 5EVID 2QPNA 2XQZA 3DTEA 5HDDA 2JKRI 5CTNA 4JBFA 3GTCA 5FQQA 2NUPC 1JWZA 1NLZA 3EGDC 3KX0X 5GLCA 2H0YA 3RTYA 3S4XA 2XDMA 4E3IA 3NI9A 3PYPA 3RXWA 4Y17A 4YINA 3LI8A 3QP2A 2ZM2A 2K2NA 1FR1A 5G4YA 1MPLA 2X02A 4Y13A 1W63Q 5M1AA 1YPRA 4U0TA 4FSFA 3LO7A 1S4SA 1S67L 3ZG8B 2PBYA 1BLSA 1KGEA 2XFTA 4BJPA 4Q0HA 3B33A 2ZM0A 5J7EA 2O9AA 2WZXA 3K3CA 5FI7A 3H9WA 4PPRA 3PAEA 2PYRA 1CEGA 3HJKA 3BYDA 5FEFA 2V2FF 2V8FA 1TS7A 4HQAA 4NXFA 3NIAA 5CHUA 3CHWP 4CPKA 1NYMA 4Q0IA 5HL6A 2J3WA 3O88A 2QWSA 2V20A 2X71A 4N92A 1DP9A 3UB8A 4XT2B 1H0MA 4OQHA 1TVFA 4KENB 4OPYA 3LUQA 2DNSA 3HVFA 1K54C 4IUHA 2IWBA 1ZTUA 1N9LA 1VHMA 4EW7A 2PRFA 3M2KA 2XD5A 2WGWA 5EVEA 4EEPA 2PD7A 1TD5A 4GDBA 4MN6A 2VZWA 1XX2A 4U0XA 3WRTA 2KLIA 4CLCC 2WYXA 5CGWA 1DP6A 1OT9A 3LR3A 4BENA 1O7EA 3JVVA 2ZOIA 4LV0A 1GHPA 4PM7A 5CERA 4E6WA 4MBHA 3EEAA 1U60A 3TRCA 4ZJ1A 2XA7M 1YLZA 1NJ4A 3E4OA 2PAVP 3AGDA 4MDZA 5A90A 2XH9A 3MMHA 3LIEA 2Y4AA 2KOIA 2GJ3A 2VV8A 2ZOHA 3UY6A 2NUTC 1MKIA 1Q2PA 2Y2KA 3MBZA 5TJJA 4WEKA 2WGWB 3T4OA 1K56D 1XGIA 2ZC7A 5K5BA 5EVIA 2RL3A 2ZMVA 3NY4A 4HH3A 4DRTA 2WKPA 4FH2A 3HLDA 2O0YA 1L0DA 1K6SA 1E3UD 4WL9A 3NECA 3CITA 3LYXA 5KSHA 3FV7A 4NETA 4CLCD 5HSQA 3RXXA 2HDUA 2WAFA 1OTIA 2EXBA 1XJ4A 3SH8A 3GQZA 3G6OA 4O7DA 2ZQDA 2CC1A 3BQAA 2M1CA 4MN5A 5L8MA 3O87A 2HJ9C 1PRQA 3AGFA 4S2PA 1E25A 5EVIB 5FQIA 1K55C 1BYWA 1TEMA 4RX2A 3FPVA 3S7QA 5GLAA 4E04A 1LLBA 2P08A 4QPRA 2Y2LA 3VOYA 2YKFA 2E8IA 3MXRA 4ME4A 3IX4A 4I3AA 4L9GA 4H8RA 5EVLA 3BWLA 1XA7A 2M7VA 1XPBA 3KSGA 3HL9A 4BQMA 1H5XA 3C7UA 3M6BA 3HUMA 5E43A 3O86A 4OLGA 1PZPA 5A92A 3CPTA 4E3LA 5FATA 3SH9A 2E8JA 3GECA 1K57C 4KZ9A 1W79A 4F3LA 4S2IA 2HJEA 5FASA 5F1FA 1Y4OA 4GS9A 2VGKA 4HI4A 5CX7A 4FUWA 5HARA 4LLOB 4JF5A 2PU2A 4ARZB 4JXVA 3G30A 1Q2QA 5KIZA 1NRJA 4ETZA 3BY8A 2W3HA 1N4OA 1KE0A 4WZ4A 4AFIA 5M18A 4Y0OA 5DFXA 2C6WB 4BBVA 2OOLA 4CLCE 3IBJA 3DTKA 4RQ9A 2JKTM 1G5UA 1BLCA 4ETXA 4LV3A 4R4SA 5HD3A 1W8QA 5LBRA 4B93A 3E2LA 2JCHA 2GNXA 2WGIA 4DE2A 3CPTB 4WELA 1SDEA 2FFFB 3M6HA 3KYZA 3N7WA 4LCMA 2J7VA 4Y5FA 4F3LB 5A8BA 4EQ1A 2H10A 4GS9B 4HBUA 2W27A 2EX8A 1FOFA 2P04A 4HESA 2HP6A 5IHVA 5KSCA 4MCWA 1E3UA 5EUAA 5EM0A 4E3MA 4EU0A 1YLYA 3R4KA 2Y2JA 5GLBA 1GCEA 1YMXA 3IHAA 4X1LA 3VP4A 1HZOA 1K4FA 4OKPA 4MNRA 3IQAA 3HCYA 2HDQA 1STZA 5DTTA 4BMWA 5DVAA 2W1RA 1OJGA 3WS4A 4I5SA 3D9YA 5CTMA 2VGLM 4B4XA 5CGXA 1KE4A 1QMFA 2Z2LB 3T4JA 1L0GA 1L0FA 1IOUA 1FCOA 4R3JA 5AVEA 4N1HA 3MZDA 2Y2HA 3LR4A 4WMCA 4P6ZS 4UQIM 4JPMA 3Q7ZA 4UEYA 5TFQA 4LPZA 5DJUA 3N8LA 3FKWA 4OLDA 3D72A 4G3WA 4S2JA 3PBOA 3TOIA 3E4PA 4LGWA 3UE6A 1IEMA 3S1YA 4E3NA 3ZCZA 4BD1A 4DE1A 3IHBA 3TW8A 4CLCB 1DJCA 5HFOA 4M3KA 3UDIA 3U4LP 2EFXA 3N8SA 1MZUA 4KZ3A 4I39A 3F1NA 3KSIA 2Y2MA 3BLMA 4X1MA 3GVBA 1G28A 4P0MA 3GSGA 1N9NA 1T1CA 3LY3A 3MFXA 3BEBA 3IF5A 1A0KA 1IFQA 4A5RA 3GMWA 4EUVA 4C75A 3UE3A 1FSYA 3ZG5A 2Y2NA 1LL8A 3BJNA 3V67A 4EXOA 1OTAA 3V5MA 3DW0A 3U2AA 3LCEA 1EWZA 4R38A 4WF0A 1IYPA 4RYEA 4C6YA 3VP0A 2ZM8A 3HUOA 3IWOA 3IX3A 3T50A 5D3OA 3MXSA 4OPRA 4PM5A 3C38A 3VOLA 1GA0A 4X53A 3A3IA 4HP4A 4IJGA 4CJNA 3MJQA 4Y0UA 2ZC5B 3SZTA 4L9FA 3P09A 2Q9MA 5F68A 4EETB 1TS8A 2J8YA 4KZBA 3QNBA 2QKPA 3E98A 4RVAA 4DKIA 1H8MA 1LI9A 3E4QA 4D2OA 2PR6A 2ZLYA 2ZJ9A 3Q07A 4BLMA 4HJ3A 4HNBA 2R9XA 2H28A 4OP8A 1CK3A 2A3UA 3LICA 2Y8HA 4KQQA 4GN2A 1M40A 4BL2A 1NLYA 1I2WA 4D60A 4JXWA 4H6JA 2IWCA 1P97A 2OLVA 4UA7A 5FEGA 1EROA 3ZNTA 2EX9A 4OQGA 1SHVA 2V8CA 4ZTKA 2XRNA 4EESA 1ZG6A 5DF8A 2ZQ8A 3VP2A 3IBRA 4GKUA 2QYBA 1PI4A 1D06A 2PYPA 1P0ZA 3W8KA 5GHXA 4WBGA 3ISGA 1NWZA 4S2NC 2R9WA 4E3OA 3WWXA 5A91A 3ZG7B 4PM8A 3Q81A 4GCZA 4XT2A 2ZC3B 5F5YA 5FDSA 4MBKA 1YLTA 2VJWA 3A3EA 5FSRA 3C30A 2VEAA 3VFHA 3CI6A 1OPXA 4H6JB 1N9BA 5I5LA 2QJ5A 1LL9A 4S2LA 1K25A 1NRFA 2KDKA 2HDRA 2BASA 1ZG4A 3FC7A 4QHCA 2VV7A 1ONGA 2DCFA 4GB7A 3IF6C 5AQ7A 3IXBA 1VB6A 3HLFA 1JVJA 3S7OA 3LEZA 5M19A 1PWGA 1XGJA 1KDSA 3PHYA 4K91A 4JGQA 5EM1A 4JGRA 2QHKA 1HVBA 5CHJA 3W4PA 1K6RA 4N9KA 1WE4A 5GHYA 3ZG0A 1T1BA 4KQOA 2HP5A 5HPIA 4DMZA 1ZKJA 2L0WA 4EQIA 3MFDA 5TR7A 4BD0A 4OQ0A 3B42A 4GD6A 4ZRRA 1ES5A 1D1JA 3H82A 3BFDA 5CRFA 5FI6A 4JF4A 3EQUA 4KZ8A 3D4FA 1RP5A 3A3DA 4R6LA 4X55A 4DE0A 3MQOA 4IEDA 4QB8A 2Y2QA 2WZZA 2V0WA 1OJ5A 3T4SA 2I9VA 3UDXA 4II7A 1XJ6A 4R3BA 3VSKA 1IELA 4GHIA 4WZ5A 3UB6A 2YKHA 3UO9A 4Y0TA 1YLWA 5HWTA 3DWKA 3CAXA 5F1GA 1VEUA 4HJ6A 2B5RA 2LB5A 1YKDA 3R7WB 3Q1FA 3EWKA 1UGUA 2EX2A 2OWJA 5F83A 4XUZA 5F69A 3B47A 4K08A 4Q8IA 1S66L 3H82B 4B4ZA 4MLLA 1FR6A 5FAQA 5FA7A 4EUZA 3LY4A 1ZC2A 3G31A 3G32A 1UWNX 1PWCA 5HDCA 1SKFA 4K0XA 4S2KA 3HLGA 4YWZA 3LGOA 5IT5A 1FIKA 3ZFZA 4KZ7A 4R1GA 1W7FA 3DWZA 3OCNA 3NOTC 4GHIB 2OAP1 1BLPA 2VKSA 1GHMA 4QJGA 2CMNA 1VEUB 3RFBA 1CQAA 3PBRA 3MQ0A 1G68A 5JYPA 3EQVA 4GLQA 4EWFA 1XFNA 1YMSA 1F2KA 4KZ6A 4S2MA 1FCNA 1N9OA 1S1YA 1MXOA 2Y2GA 5DF7A 3VE4A 3T4TA 2XEPA 1SKOB 2J9OA 3G34A 2WKEA 1BZAA 1M6KA 3V39A 2XA7S 4HOIA 4YFMA 2IA2A 3M2JA 4ARZA 1QMEA 1LT0A 4RA7A 4L9EA 1YLJA 4DJ2A 3G4PA 2JE5A 4HJ4A 4LENA 2O9CA 4R23A 2Y2OA 1XA1A 1YSPA 1Z6FA 2PR5A 4NXGA 2W3EA 5E2EA 4OPQA 2BG1A 4U3TA 1SDNA 3UPOA 1L0EA 3F1OA 5HX9A 2H0TA 1KGGA 3HREA 3V50A 4OQIA 2H5SA 1GSVA 1KVLA 2VK3A 1ES3A 3DTMA 1BSGA 1XKZA 1P9WA 1CI8A 4Y7PA 3LFVA 5F82A 3DAVA 2ZL1A 1OMEA 3A3JA 3LI9A 4P85A 4ZBEA 1T19A 1BT5A 2JKTI 1MWTA 2JBFA 3NHQA 3G2YA 3MQQA 5FQKA 2XGNA 1ERQA 2J80A 2ZQCA 1DJBA 3KSFA 4WN5A 1Z09A 2FH5A 4PAUA 2XD1A 5CGSA 1I2SA 4EV4A 4KUOA 1JWVA 3F1OB 3PBQA 1FILA 4DE3A 2HZ5A 3WRZA 3MF0A 5AQAA 2ZMAA 5MC7A 4FD8A 2O9BA 3BFGA 3C5AA 2R78A 2ZBBA 5G18A 2EXAA 2ZL1B 2M7UA 4K0WA 5FI2A 1OTBA 3NBLA 3E0YA 2Y91A 1K56A 2W3FA 1NZUA 4C3QA 4ZAMA 4OOLA 1K54A 3HLEA 3HUNA 3RH8B 1K0KA 3MSHA 1FSWA 2ZC6B 4R4RA 3HLBA 2PBDP 4R3AA 4N1XA 3KYQA 1IKGA 2ZQ9A 3NULA 4CLCA 3V3RA 1CEFA 2V0UA 3UN7A 5IU1A 1CF0A 3MS6A 2Z6DA 3CJMA 3MXQA 4WYYA 4ID4A 1L3LA 4CQHA 1P9RA 4LRXC 4E6XA 4DN0A 3SW1A 4XXRA 4LFUA 3FPWA 2ACGA 1KDWA 4GJ4A 1H8ZA 1MC0A 4ZDXA 2UWXA 3JYIA 5CEBA 3TSGA 3IT9A 3DTIA 1KVMA 2L1MA 4X56A 3T1XA 1T1AA 1YSQA 4E3JA 2WAEA 3PXPA 3EGXC 4XUXA 3KYEA 2QZ6A 4KG5A 1ES4A 4JXGA 3PBSA 3BECA 2V9AA 1CI9A 2V1ZA 4X68A 4QY6A 4GOGA 1PI5A 2C5WB 1NYYA 4WM9A 3MR0A 1DJAA 2MJ6A 4LRYC 2Q0OA 2Q9NA 4KG2A 1HD8A 4BBTA 4IUKA 2W0NA 4MEZA 3MZEA 3V3SA 1T18A 4PHTA 3LIBA 4OVDA 1J9MA 3P7NA 4PMAA 2RCXA 3LIAA 2OSUA 1Y54A 3I7JA 4I3JA 3QP5A 3IXGA 5FDHA 2VGLS 1K55A 4S2OA 3OLOA 3ICYA 5HZHA 4UHUA 2VGJA 4UQIS 2JC7A 1L2SA 4BL3A 3K3DA 3GV9A 1FQGA 1DY6A 1PNEA 2AVXA 5HWWA 1LSXA 3TG9A 2Z6CA 2DRWA 3VOZA 4QY5A 4JLFA 4NXEA 3BFFA 2QJ7A 3ZVTA 5AQBA 1K57A
chains in the Genus database with same CATH topology
2HZ5A 3T12B 2BTFP 1YPRA 2PAVP 5EM0A 1SKOB 2ZL1B 4X1LA 2JKGA 5FEFA 5FDSA 2V8FA 3LEQA 4ESPA 1VETB 1K0KA 3MSHA 3CPTA 3CHWP 2E8JA 3D9YA 1VEUA 2PBDP 1PFLA 3T1QB 1Y4OA 5EV0A 4FUWA 3NECA 3NULA 2VK3A 3T1SA 1CF0A 3MS6A 1J3WA 1SZVA 3DAVA 2ZL1A 5EM1A 3L7HA 1CJFA 2PRFA 3LGOA 1FIKA 1G5UA 5EVEA 1VETA 2ACGA 2JKFA 4D60A 3UB5P 1HLUP 4X25A 1PRQA 1ACFA 4QWOA 1PNEA 3U4LP 5FEGA 1SKOA 4FTXA 3CPTB 1AWIA 2V8CA 2B95A 3T1XA 1D1JA 3L9KA 1Z09A 1VEUB 4X1MA 1CQAA 3KYEA 3T1RA 1A0KA 1FILA 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZ5 A;  3T12 B;  2BTF P;  1YPR A;  2PAV P;  5EM0 A;  1SKO B;  2ZL1 B;  4X1L A;  2JKG A;  5FEF A;  5FDS A;  2V8F A;  3LEQ A;  4ESP A;  1VET B;  1K0K A;  3MSH A;  3CPT A;  3CHW P;  2E8J A;  3D9Y A;  1VEU A;  2PBD P;  1PFL A;  3T1Q B;  1Y4O A;  5EV0 A;  4FUW A;  3NEC A;  3NUL A;  2VK3 A;  3T1S A;  1CF0 A;  3MS6 A;  1J3W A;  1SZV A;  3DAV A;  2ZL1 A;  5EM1 A;  3L7H A;  1CJF A;  2PRF A;  3LGO A;  1FIK A;  1G5U A;  5EVE A;  1VET A;  2ACG A;  2JKF A;  4D60 A;  3UB5 P;  1HLU P;  4X25 A;  1PRQ A;  1ACF A;  4QWO A;  1PNE A;  3U4L P;  5FEG A;  1SKO A;  4FTX A;  3CPT B;  1AWI A;  2V8C A;  2B95 A;  3T1X A;  1D1J A;  3L9K A;  1Z09 A;  1VEU B;  4X1M A;  1CQA A;  3KYE A;  3T1R A;  1A0K A;  1FIL A;  1F2K A; 
#chains in the Genus database with same CATH topology
 2W1T A;  1H3Q A;  3ZVW A;  1MWS A;  3JVU A;  2BTF P;  3OPP A;  4HHD A;  3MKF A;  2K31 A;  1OTE A;  5KMW A;  1PW1 A;  4DXB A;  1KGF A;  5CXW A;  4UA9 A;  3NCK A;  2JKG A;  2Y55 A;  5HWV A;  5EOO A;  1FCM A;  2A49 A;  1DRM A;  2L4R A;  4IVK A;  1VM1 A;  3ZQ5 A;  4HP9 A;  2WKQ A;  4GNU A;  1X0O A;  2J3T C;  3T1Q B;  2OAQ 1;  1IYS A;  5U47 A;  5J3W A;  4BWI A;  2OLU A;  3NOU C;  3OC2 A;  3MZF A;  5JYO A;  3UME A;  1WYC A;  2XR0 A;  2WKH A;  4Y2F A;  3T1S A;  1MY8 A;  2W1T B;  1S6R A;  2Y2I A;  4B9O A;  4EEU A;  1VQQ A;  4WLA A;  1JWP A;  1PZO A;  2XFS A;  3WS1 A;  1OTD A;  3BY9 A;  2JKR M;  3W4O A;  1VET A;  4JGP A;  2HPB A;  3S7P A;  2INW A;  1GSW A;  3O3V A;  3JPU A;  1HLU P;  4X25 A;  3K2N A;  2HDS A;  4QWO A;  2O99 A;  3CUE C;  5E2G A;  4MBF A;  2XLN A;  4YNR A;  4FTX A;  3CZD A;  2B95 A;  3ITA A;  2P7J A;  2V1A A;  4GD8 A;  3ZNY A;  3UB7 A;  3IS2 A;  4PKY G;  4P87 A;  5CEC A;  2HP9 A;  4Y15 A;  1W5D A;  2W3D A;  5AQ9 A;  3C7V A;  2EA9 A;  2X01 A;  5FAP A;  3BW6 A;  3NOP C;  5HW3 A;  2J9P A;  3R7W A;  2J3T D;  1GA9 A;  3QP6 A;  5FQ9 A;  3LIF A;  5GL9 A;  3VP1 A;  4I3I A;  1XP4 A;  3OCL A;  3LEQ A;  3IWQ A;  1VET B;  2Y59 A;  1TDG A;  4DDS A;  2LB9 A;  4KUK A;  4Y3I A;  2IWD A;  5C5K A;  3O5Y A;  4WUJ A;  3BFE A;  1H8Y A;  3IXH A;  3OOV A;  2HGV A;  4PKY A;  4KZ5 A;  3T4Q A;  3OBF A;  2UV0 E;  3C2W A;  1NZO A;  3VMA A;  5KZH A;  3IS2 B;  4DDY A;  2BLS A;  2WAD A;  3A0S A;  4G3K A;  3OPH A;  3BLS A;  1LHY A;  2P9V A;  3A0R A;  1G6O A;  3IXD A;  5FQJ A;  3RJU A;  5DF9 A;  2FZ0 A;  4M4X A;  1C3B A;  3A3F A;  5J4E A;  5DTK A;  4ZJ2 A;  4PM9 A;  4E3K A;  3MKE A;  1W8Y A;  5HL1 A;  2XF3 A;  1OT6 A;  3ZYT A;  5L07 A;  1RGY A;  1SKO A;  1LSW A;  1EI5 A;  1ALQ A;  1ONH A;  1JTD A;  5DFY A;  1MBL A;  4MMN A;  1YAX A;  4LV1 A;  2JN7 A;  3T1R A;  4YOF A;  1SCW A;  3H7W A;  1DP8 A;  2XSS A;  1XJ3 A;  3P98 A;  1ESU A;  1YT4 A;  2EX6 A;  3F1P A;  1K4E A;  1I5Q A;  5HD5 A;  3C8C A;  2WK0 A;  3EEH A;  2P9V B;  3QP4 A;  2QMI A;  1RCJ A;  5CED A;  1YLP A;  4KQR A;  2B02 A;  4PM6 A;  4UA6 A;  3IH9 A;  5L10 A;  1MKM A;  3N6I A;  4GDN A;  1JNU A;  1S4R A;  2FFY A;  3GDI A;  2EFU A;  2PDR A;  4O01 A;  3KSH A;  2D02 A;  3VV4 A;  3H7W B;  3HLW A;  4N9L A;  2G7U A;  1K38 A;  3BQ8 A;  2OV5 A;  5IS1 A;  3S22 A;  4WMC D;  4O0P A;  3C4P A;  3IWI A;  1KOU A;  4EBL A;  2DMW A;  1W63 M;  3F1P B;  3CG5 A;  2VLG A;  2WUQ A;  3C4O A;  2GX5 A;  3A0V A;  4MN7 A;  4FOF A;  4GZB A;  2G2U A;  3CWF A;  4OPZ A;  5E2H A;  5EPH A;  5BOH A;  2A24 A;  3GR2 A;  3ITB A;  2WGV A;  5L2F A;  4S2N A;  2P74 A;  1ACF A;  5HAI A;  3TE8 A;  2K7S A;  2VA0 A;  1AWI A;  1S1Z A;  4RX3 A;  4NK3 A;  3L9K A;  5HAQ A;  3PAG A;  4LCL A;  3UMD A;  1TS0 A;  1JTG A;  2ZMF A;  2PHY A;  1IKI A;  5I94 A;  3Q7V A;  4KG6 A;  1ERM A;  5E2F A;  4I38 A;  3NDG A;  4LV2 A;  5AVF A;  1TDL A;  4L0L A;  1MWU A;  3BM6 A;  4JGO A;  3GRJ A;  4IHQ A;  3NJA A;  4FH4 A;  4ZJ3 A;  4HIA A;  4QD4 A;  4X6T A;  3IF6 A;  3NC8 A;  3FWL A;  1O07 A;  4OOY A;  3LR0 A;  3UPP A;  3CUE A;  3IX8 A;  4Z9Q A;  4KQD A;  4WEJ A;  2A2L A;  3ZDJ A;  2ZC4 B;  4QU3 A;  1PYY A;  1D7E A;  2A24 B;  2ZQA A;  1BLH A;  4P6Z M;  3PBT A;  5FL3 A;  3ULF A;  3OZH A;  2GDN A;  5GLD A;  1XXM A;  1TS6 A;  3VP3 A;  5EV0 A;  4UAA A;  2V1B A;  4EBP A;  3LR5 A;  5J8X A;  1NY0 A;  3Q7V B;  5TBM A;  4JKT A;  1WYB A;  1ODV A;  1J3W A;  3NDE A;  4KZA A;  3HJI A;  5EEC A;  1E4D A;  4R70 A;  2WKI A;  1CJF A;  3FYZ A;  3WS0 A;  4NG2 A;  3W2Z A;  3IF6 B;  5EFW A;  2PU4 A;  2HF6 A;  2VX8 A;  2HV1 A;  3QNC A;  1G6A A;  5G4Z A;  4P6B A;  2XRO A;  3SS5 A;  3CLO A;  4DF6 A;  3SOI A;  2PD8 A;  2KX6 A;  1MWR A;  5FQM A;  1NXY A;  4NKP A;  3N4I A;  2I72 A;  5FAO A;  1BUE A;  4X69 A;  3IH8 A;  1IYO A;  1UWP X;  3P01 A;  2ZQ7 A;  3QP1 A;  1XFQ A;  3T12 B;  2B18 A;  5F6A A;  1GSX A;  4FCF A;  5TBM B;  2EWW A;  2Y79 A;  3ZGA B;  3QP8 A;  4DXC A;  3TJZ C;  4NEE D;  2W3G A;  1LI0 A;  1PWD A;  1F5M A;  4HEF A;  3EOI A;  3HLC A;  3DBA A;  3CMZ A;  4EER A;  1LL5 A;  5GHZ A;  3T4K A;  5EOE A;  3UE0 A;  3E2K A;  2JHE A;  2D01 A;  4NXB A;  2Z2M B;  3SH7 A;  1HTZ A;  5AJG A;  1AXB A;  1F98 A;  1PFL A;  3HBR A;  1ESI A;  2OWH A;  5HAP A;  5L09 A;  4B88 A;  3VFF A;  3D3O A;  1ES2 A;  4OOM A;  3T4L A;  1EW0 A;  3LID A;  1TF1 A;  2XK1 A;  2PT7 A;  5EE8 A;  5TGF A;  4OON A;  1SZV A;  4WZ5 C;  3UB9 A;  3L7H A;  3PR6 A;  5HPF A;  3BRM A;  4IBR A;  4Z1W A;  2G2W A;  1XJ2 A;  3UE1 A;  1V9Z A;  3PBN A;  2JKF A;  3UB5 P;  2EWV A;  3PTE A;  3ZG9 B;  4LRZ E;  3SS3 A;  4EBN A;  5DKL A;  4IBX A;  3FKV A;  1S0W A;  5EVI C;  1GHI A;  4GW9 A;  4KZ4 A;  4IVI A;  4F94 A;  1V9Y A;  5HDS A;  3G2Z A;  1BUL A;  3UNW A;  5DJT A;  1ZHH B;  2VV6 A;  3AGE A;  3S7N A;  3BFC A;  3VSL A;  2WKR A;  3OPL A;  3G35 A;  3FZC A;  4R0Q A;  1BTL A;  3FG8 A;  4OP5 A;  4HH2 A;  1KE3 A;  1PIO A;  3UPN A;  3F1N B;  5CHM A;  1LSV A;  2GZA A;  1WA9 A;  3SS4 A;  3QHY A;  4JF6 A;  4ESP A;  1RGZ A;  5DKK A;  3KO6 A;  3WS5 A;  3WS2 A;  3B3X A;  2ZD8 A;  4JXS A;  4HY8 A;  4G3V A;  5DTS A;  1Y28 A;  4OH0 A;  3W4Q A;  1YM1 A;  3ZHH A;  3N8R A;  4O8G A;  1PW8 A;  4BBU A;  3VE3 A;  1F9I A;  4Q0J A;  2Y2P A;  3Q82 A;  5A93 A;  3OPR A;  1YQS A;  4DJ3 A;  3UDF A;  4HBT A;  1IYQ A;  5EVI D;  2QPN A;  2XQZ A;  3DTE A;  5HDD A;  2JKR I;  5CTN A;  4JBF A;  3GTC A;  5FQQ A;  2NUP C;  1JWZ A;  1NLZ A;  3EGD C;  3KX0 X;  5GLC A;  2H0Y A;  3RTY A;  3S4X A;  2XDM A;  4E3I A;  3NI9 A;  3PYP A;  3RXW A;  4Y17 A;  4YIN A;  3LI8 A;  3QP2 A;  2ZM2 A;  2K2N A;  1FR1 A;  5G4Y A;  1MPL A;  2X02 A;  4Y13 A;  1W63 Q;  5M1A A;  1YPR A;  4U0T A;  4FSF A;  3LO7 A;  1S4S A;  1S67 L;  3ZG8 B;  2PBY A;  1BLS A;  1KGE A;  2XFT A;  4BJP A;  4Q0H A;  3B33 A;  2ZM0 A;  5J7E A;  2O9A A;  2WZX A;  3K3C A;  5FI7 A;  3H9W A;  4PPR A;  3PAE A;  2PYR A;  1CEG A;  3HJK A;  3BYD A;  5FEF A;  2V2F F;  2V8F A;  1TS7 A;  4HQA A;  4NXF A;  3NIA A;  5CHU A;  3CHW P;  4CPK A;  1NYM A;  4Q0I A;  5HL6 A;  2J3W A;  3O88 A;  2QWS A;  2V20 A;  2X71 A;  4N92 A;  1DP9 A;  3UB8 A;  4XT2 B;  1H0M A;  4OQH A;  1TVF A;  4KEN B;  4OPY A;  3LUQ A;  2DNS A;  3HVF A;  1K54 C;  4IUH A;  2IWB A;  1ZTU A;  1N9L A;  1VHM A;  4EW7 A;  2PRF A;  3M2K A;  2XD5 A;  2WGW A;  5EVE A;  4EEP A;  2PD7 A;  1TD5 A;  4GDB A;  4MN6 A;  2VZW A;  1XX2 A;  4U0X A;  3WRT A;  2KLI A;  4CLC C;  2WYX A;  5CGW A;  1DP6 A;  1OT9 A;  3LR3 A;  4BEN A;  1O7E A;  3JVV A;  2ZOI A;  4LV0 A;  1GHP A;  4PM7 A;  5CER A;  4E6W A;  4MBH A;  3EEA A;  1U60 A;  3TRC A;  4ZJ1 A;  2XA7 M;  1YLZ A;  1NJ4 A;  3E4O A;  2PAV P;  3AGD A;  4MDZ A;  5A90 A;  2XH9 A;  3MMH A;  3LIE A;  2Y4A A;  2KOI A;  2GJ3 A;  2VV8 A;  2ZOH A;  3UY6 A;  2NUT C;  1MKI A;  1Q2P A;  2Y2K A;  3MBZ A;  5TJJ A;  4WEK A;  2WGW B;  3T4O A;  1K56 D;  1XGI A;  2ZC7 A;  5K5B A;  5EVI A;  2RL3 A;  2ZMV A;  3NY4 A;  4HH3 A;  4DRT A;  2WKP A;  4FH2 A;  3HLD A;  2O0Y A;  1L0D A;  1K6S A;  1E3U D;  4WL9 A;  3NEC A;  3CIT A;  3LYX A;  5KSH A;  3FV7 A;  4NET A;  4CLC D;  5HSQ A;  3RXX A;  2HDU A;  2WAF A;  1OTI A;  2EXB A;  1XJ4 A;  3SH8 A;  3GQZ A;  3G6O A;  4O7D A;  2ZQD A;  2CC1 A;  3BQA A;  2M1C A;  4MN5 A;  5L8M A;  3O87 A;  2HJ9 C;  1PRQ A;  3AGF A;  4S2P A;  1E25 A;  5EVI B;  5FQI A;  1K55 C;  1BYW A;  1TEM A;  4RX2 A;  3FPV A;  3S7Q A;  5GLA A;  4E04 A;  1LLB A;  2P08 A;  4QPR A;  2Y2L A;  3VOY A;  2YKF A;  2E8I A;  3MXR A;  4ME4 A;  3IX4 A;  4I3A A;  4L9G A;  4H8R A;  5EVL A;  3BWL A;  1XA7 A;  2M7V A;  1XPB A;  3KSG A;  3HL9 A;  4BQM A;  1H5X A;  3C7U A;  3M6B A;  3HUM A;  5E43 A;  3O86 A;  4OLG A;  1PZP A;  5A92 A;  3CPT A;  4E3L A;  5FAT A;  3SH9 A;  2E8J A;  3GEC A;  1K57 C;  4KZ9 A;  1W79 A;  4F3L A;  4S2I A;  2HJE A;  5FAS A;  5F1F A;  1Y4O A;  4GS9 A;  2VGK A;  4HI4 A;  5CX7 A;  4FUW A;  5HAR A;  4LLO B;  4JF5 A;  2PU2 A;  4ARZ B;  4JXV A;  3G30 A;  1Q2Q A;  5KIZ A;  1NRJ A;  4ETZ A;  3BY8 A;  2W3H A;  1N4O A;  1KE0 A;  4WZ4 A;  4AFI A;  5M18 A;  4Y0O A;  5DFX A;  2C6W B;  4BBV A;  2OOL A;  4CLC E;  3IBJ A;  3DTK A;  4RQ9 A;  2JKT M;  1G5U A;  1BLC A;  4ETX A;  4LV3 A;  4R4S A;  5HD3 A;  1W8Q A;  5LBR A;  4B93 A;  3E2L A;  2JCH A;  2GNX A;  2WGI A;  4DE2 A;  3CPT B;  4WEL A;  1SDE A;  2FFF B;  3M6H A;  3KYZ A;  3N7W A;  4LCM A;  2J7V A;  4Y5F A;  4F3L B;  5A8B A;  4EQ1 A;  2H10 A;  4GS9 B;  4HBU A;  2W27 A;  2EX8 A;  1FOF A;  2P04 A;  4HES A;  2HP6 A;  5IHV A;  5KSC A;  4MCW A;  1E3U A;  5EUA A;  5EM0 A;  4E3M A;  4EU0 A;  1YLY A;  3R4K A;  2Y2J A;  5GLB A;  1GCE A;  1YMX A;  3IHA A;  4X1L A;  3VP4 A;  1HZO A;  1K4F A;  4OKP A;  4MNR A;  3IQA A;  3HCY A;  2HDQ A;  1STZ A;  5DTT A;  4BMW A;  5DVA A;  2W1R A;  1OJG A;  3WS4 A;  4I5S A;  3D9Y A;  5CTM A;  2VGL M;  4B4X A;  5CGX A;  1KE4 A;  1QMF A;  2Z2L B;  3T4J A;  1L0G A;  1L0F A;  1IOU A;  1FCO A;  4R3J A;  5AVE A;  4N1H A;  3MZD A;  2Y2H A;  3LR4 A;  4WMC A;  4P6Z S;  4UQI M;  4JPM A;  3Q7Z A;  4UEY A;  5TFQ A;  4LPZ A;  5DJU A;  3N8L A;  3FKW A;  4OLD A;  3D72 A;  4G3W A;  4S2J A;  3PBO A;  3TOI A;  3E4P A;  4LGW A;  3UE6 A;  1IEM A;  3S1Y A;  4E3N A;  3ZCZ A;  4BD1 A;  4DE1 A;  3IHB A;  3TW8 A;  4CLC B;  1DJC A;  5HFO A;  4M3K A;  3UDI A;  3U4L P;  2EFX A;  3N8S A;  1MZU A;  4KZ3 A;  4I39 A;  3F1N A;  3KSI A;  2Y2M A;  3BLM A;  4X1M A;  3GVB A;  1G28 A;  4P0M A;  3GSG A;  1N9N A;  1T1C A;  3LY3 A;  3MFX A;  3BEB A;  3IF5 A;  1A0K A;  1IFQ A;  4A5R A;  3GMW A;  4EUV A;  4C75 A;  3UE3 A;  1FSY A;  3ZG5 A;  2Y2N A;  1LL8 A;  3BJN A;  3V67 A;  4EXO A;  1OTA A;  3V5M A;  3DW0 A;  3U2A A;  3LCE A;  1EWZ A;  4R38 A;  4WF0 A;  1IYP A;  4RYE A;  4C6Y A;  3VP0 A;  2ZM8 A;  3HUO A;  3IWO A;  3IX3 A;  3T50 A;  5D3O A;  3MXS A;  4OPR A;  4PM5 A;  3C38 A;  3VOL A;  1GA0 A;  4X53 A;  3A3I A;  4HP4 A;  4IJG A;  4CJN A;  3MJQ A;  4Y0U A;  2ZC5 B;  3SZT A;  4L9F A;  3P09 A;  2Q9M A;  5F68 A;  4EET B;  1TS8 A;  2J8Y A;  4KZB A;  3QNB A;  2QKP A;  3E98 A;  4RVA A;  4DKI A;  1H8M A;  1LI9 A;  3E4Q A;  4D2O A;  2PR6 A;  2ZLY A;  2ZJ9 A;  3Q07 A;  4BLM A;  4HJ3 A;  4HNB A;  2R9X A;  2H28 A;  4OP8 A;  1CK3 A;  2A3U A;  3LIC A;  2Y8H A;  4KQQ A;  4GN2 A;  1M40 A;  4BL2 A;  1NLY A;  1I2W A;  4D60 A;  4JXW A;  4H6J A;  2IWC A;  1P97 A;  2OLV A;  4UA7 A;  5FEG A;  1ERO A;  3ZNT A;  2EX9 A;  4OQG A;  1SHV A;  2V8C A;  4ZTK A;  2XRN A;  4EES A;  1ZG6 A;  5DF8 A;  2ZQ8 A;  3VP2 A;  3IBR A;  4GKU A;  2QYB A;  1PI4 A;  1D06 A;  2PYP A;  1P0Z A;  3W8K A;  5GHX A;  4WBG A;  3ISG A;  1NWZ A;  4S2N C;  2R9W A;  4E3O A;  3WWX A;  5A91 A;  3ZG7 B;  4PM8 A;  3Q81 A;  4GCZ A;  4XT2 A;  2ZC3 B;  5F5Y A;  5FDS A;  4MBK A;  1YLT A;  2VJW A;  3A3E A;  5FSR A;  3C30 A;  2VEA A;  3VFH A;  3CI6 A;  1OPX A;  4H6J B;  1N9B A;  5I5L A;  2QJ5 A;  1LL9 A;  4S2L A;  1K25 A;  1NRF A;  2KDK A;  2HDR A;  2BAS A;  1ZG4 A;  3FC7 A;  4QHC A;  2VV7 A;  1ONG A;  2DCF A;  4GB7 A;  3IF6 C;  5AQ7 A;  3IXB A;  1VB6 A;  3HLF A;  1JVJ A;  3S7O A;  3LEZ A;  5M19 A;  1PWG A;  1XGJ A;  1KDS A;  3PHY A;  4K91 A;  4JGQ A;  5EM1 A;  4JGR A;  2QHK A;  1HVB A;  5CHJ A;  3W4P A;  1K6R A;  4N9K A;  1WE4 A;  5GHY A;  3ZG0 A;  1T1B A;  4KQO A;  2HP5 A;  5HPI A;  4DMZ A;  1ZKJ A;  2L0W A;  4EQI A;  3MFD A;  5TR7 A;  4BD0 A;  4OQ0 A;  3B42 A;  4GD6 A;  4ZRR A;  1ES5 A;  1D1J A;  3H82 A;  3BFD A;  5CRF A;  5FI6 A;  4JF4 A;  3EQU A;  4KZ8 A;  3D4F A;  1RP5 A;  3A3D A;  4R6L A;  4X55 A;  4DE0 A;  3MQO A;  4IED A;  4QB8 A;  2Y2Q A;  2WZZ A;  2V0W A;  1OJ5 A;  3T4S A;  2I9V A;  3UDX A;  4II7 A;  1XJ6 A;  4R3B A;  3VSK A;  1IEL A;  4GHI A;  4WZ5 A;  3UB6 A;  2YKH A;  3UO9 A;  4Y0T A;  1YLW A;  5HWT A;  3DWK A;  3CAX A;  5F1G A;  1VEU A;  4HJ6 A;  2B5R A;  2LB5 A;  1YKD A;  3R7W B;  3Q1F A;  3EWK A;  1UGU A;  2EX2 A;  2OWJ A;  5F83 A;  4XUZ A;  5F69 A;  3B47 A;  4K08 A;  4Q8I A;  1S66 L;  3H82 B;  4B4Z A;  4MLL A;  1FR6 A;  5FAQ A;  5FA7 A;  4EUZ A;  3LY4 A;  1ZC2 A;  3G31 A;  3G32 A;  1UWN X;  1PWC A;  5HDC A;  1SKF A;  4K0X A;  4S2K A;  3HLG A;  4YWZ A;  3LGO A;  5IT5 A;  1FIK A;  3ZFZ A;  4KZ7 A;  4R1G A;  1W7F A;  3DWZ A;  3OCN A;  3NOT C;  4GHI B;  2OAP 1;  1BLP A;  2VKS A;  1GHM A;  4QJG A;  2CMN A;  1VEU B;  3RFB A;  1CQA A;  3PBR A;  3MQ0 A;  1G68 A;  5JYP A;  3EQV A;  4GLQ A;  4EWF A;  1XFN A;  1YMS A;  1F2K A;  4KZ6 A;  4S2M A;  1FCN A;  1N9O A;  1S1Y A;  1MXO A;  2Y2G A;  5DF7 A;  3VE4 A;  3T4T A;  2XEP A;  1SKO B;  2J9O A;  3G34 A;  2WKE A;  1BZA A;  1M6K A;  3V39 A;  2XA7 S;  4HOI A;  4YFM A;  2IA2 A;  3M2J A;  4ARZ A;  1QME A;  1LT0 A;  4RA7 A;  4L9E A;  1YLJ A;  4DJ2 A;  3G4P A;  2JE5 A;  4HJ4 A;  4LEN A;  2O9C A;  4R23 A;  2Y2O A;  1XA1 A;  1YSP A;  1Z6F A;  2PR5 A;  4NXG A;  2W3E A;  5E2E A;  4OPQ A;  2BG1 A;  4U3T A;  1SDN A;  3UPO A;  1L0E A;  3F1O A;  5HX9 A;  2H0T A;  1KGG A;  3HRE A;  3V50 A;  4OQI A;  2H5S A;  1GSV A;  1KVL A;  2VK3 A;  1ES3 A;  3DTM A;  1BSG A;  1XKZ A;  1P9W A;  1CI8 A;  4Y7P A;  3LFV A;  5F82 A;  3DAV A;  2ZL1 A;  1OME A;  3A3J A;  3LI9 A;  4P85 A;  4ZBE A;  1T19 A;  1BT5 A;  2JKT I;  1MWT A;  2JBF A;  3NHQ A;  3G2Y A;  3MQQ A;  5FQK A;  2XGN A;  1ERQ A;  2J80 A;  2ZQC A;  1DJB A;  3KSF A;  4WN5 A;  1Z09 A;  2FH5 A;  4PAU A;  2XD1 A;  5CGS A;  1I2S A;  4EV4 A;  4KUO A;  1JWV A;  3F1O B;  3PBQ A;  1FIL A;  4DE3 A;  2HZ5 A;  3WRZ A;  3MF0 A;  5AQA A;  2ZMA A;  5MC7 A;  4FD8 A;  2O9B A;  3BFG A;  3C5A A;  2R78 A;  2ZBB A;  5G18 A;  2EXA A;  2ZL1 B;  2M7U A;  4K0W A;  5FI2 A;  1OTB A;  3NBL A;  3E0Y A;  2Y91 A;  1K56 A;  2W3F A;  1NZU A;  4C3Q A;  4ZAM A;  4OOL A;  1K54 A;  3HLE A;  3HUN A;  3RH8 B;  1K0K A;  3MSH A;  1FSW A;  2ZC6 B;  4R4R A;  3HLB A;  2PBD P;  4R3A A;  4N1X A;  3KYQ A;  1IKG A;  2ZQ9 A;  3NUL A;  4CLC A;  3V3R A;  1CEF A;  2V0U A;  3UN7 A;  5IU1 A;  1CF0 A;  3MS6 A;  2Z6D A;  3CJM A;  3MXQ A;  4WYY A;  4ID4 A;  1L3L A;  4CQH A;  1P9R A;  4LRX C;  4E6X A;  4DN0 A;  3SW1 A;  4XXR A;  4LFU A;  3FPW A;  2ACG A;  1KDW A;  4GJ4 A;  1H8Z A;  1MC0 A;  4ZDX A;  2UWX A;  3JYI A;  5CEB A;  3TSG A;  3IT9 A;  3DTI A;  1KVM A;  2L1M A;  4X56 A;  3T1X A;  1T1A A;  1YSQ A;  4E3J A;  2WAE A;  3PXP A;  3EGX C;  4XUX A;  3KYE A;  2QZ6 A;  4KG5 A;  1ES4 A;  4JXG A;  3PBS A;  3BEC A;  2V9A A;  1CI9 A;  2V1Z A;  4X68 A;  4QY6 A;  4GOG A;  1PI5 A;  2C5W B;  1NYY A;  4WM9 A;  3MR0 A;  1DJA A;  2MJ6 A;  4LRY C;  2Q0O A;  2Q9N A;  4KG2 A;  1HD8 A;  4BBT A;  4IUK A;  2W0N A;  4MEZ A;  3MZE A;  3V3S A;  1T18 A;  4PHT A;  3LIB A;  4OVD A;  1J9M A;  3P7N A;  4PMA A;  2RCX A;  3LIA A;  2OSU A;  1Y54 A;  3I7J A;  4I3J A;  3QP5 A;  3IXG A;  5FDH A;  2VGL S;  1K55 A;  4S2O A;  3OLO A;  3ICY A;  5HZH A;  4UHU A;  2VGJ A;  4UQI S;  2JC7 A;  1L2S A;  4BL3 A;  3K3D A;  3GV9 A;  1FQG A;  1DY6 A;  1PNE A;  2AVX A;  5HWW A;  1LSX A;  3TG9 A;  2Z6C A;  2DRW A;  3VOZ A;  4QY5 A;  4JLF A;  4NXE A;  3BFF A;  2QJ7 A;  3ZVT A;  5AQB A;  1K57 A; 
#chains in the Genus database with same CATH homology
 2HZ5 A;  3T12 B;  2BTF P;  1YPR A;  2PAV P;  5EM0 A;  1SKO B;  2ZL1 B;  4X1L A;  2JKG A;  5FEF A;  5FDS A;  2V8F A;  3LEQ A;  4ESP A;  1VET B;  1K0K A;  3MSH A;  3CPT A;  3CHW P;  2E8J A;  3D9Y A;  1VEU A;  2PBD P;  1PFL A;  3T1Q B;  1Y4O A;  5EV0 A;  4FUW A;  3NEC A;  3NUL A;  2VK3 A;  3T1S A;  1CF0 A;  3MS6 A;  1J3W A;  1SZV A;  3DAV A;  2ZL1 A;  5EM1 A;  3L7H A;  1CJF A;  2PRF A;  3LGO A;  1FIK A;  1G5U A;  5EVE A;  1VET A;  2ACG A;  2JKF A;  4D60 A;  3UB5 P;  1HLU P;  4X25 A;  1PRQ A;  1ACF A;  4QWO A;  1PNE A;  3U4L P;  5FEG A;  1SKO A;  4FTX A;  3CPT B;  1AWI A;  2V8C A;  2B95 A;  3T1X A;  1D1J A;  3L9K A;  1Z09 A;  1VEU B;  4X1M A;  1CQA A;  3KYE A;  3T1R A;  1A0K A;  1FIL A;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...