5EM1A

Crystal structure of ragweed allergen amb a 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
127
Chain Sequence
b'GSGSWQTYVDEHLMDIEGTGQHLASAAIFGTDGNVWASSSFPEFPDEINAIIKEFSEPGALAPTGLFLAGAYMVIQGEPGAVIRGGAGGICITGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
molecule tags Allergen
source organism Ambrosia artemisiifolia
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
total genus 31
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5em1A00
1ACFA 3LEQA 2PRFA 5EM1A 5EV0A 3T1XA 4X1MA 5EM0A 1CQAA 3CHWP 3D9YA 3L9KA 4X25A 1K0KA 1VEUB 1PFLA 4ESPA 2PBDP 4QWOA 4FTXA 2JKGA 2E8JA 2V8FA 3T1QB 3UB5P 2ZL1B 1A0KA 4D60A 1CF0A 4X1LA 3T12B 3CPTA 1FILA 3NULA 1PRQA 1Y4OA 2PAVP 2JKFA 5FDSA 1F2KA 3L7HA 2B95A 1J3WA 3U4LP 2VK3A 3DAVA 4FUWA 3MSHA 1D1JA 5FEGA 1VETA 3LGOA 1SKOB 2HZ5A 1VEUA 1SZVA 1G5UA 2ACGA 3T1RA 3NECA 3CPTB 1PNEA 1VETB 3MS6A 1HLUP 2V8CA 2BTFP 1YPRA 5EVEA 1AWIA 1CJFA 2ZL1A 3KYEA 3T1SA 1Z09A 5FEFA 1SKOA 1FIKA
chains in the Genus database with same CATH superfamily
2V1BA 3VP4A 3W4QA 5HPFA 1RCJA 5TR7A 5DJUA 3PBTA 1D7EA 1ES4A 4HH3A 1ZKJA 4HESA 1G6OA 4FH2A 4P85A 1FQGA 2J8YA 2Z2MB 1HTZA 4KZAA 4JF6A 1K54C 2FZ0A 2WAEA 3T4SA 4QPRA 3D3OA 5HZHA 1MWUA 1XP4A 3T1QB 5IU1A 4P6ZS 1PRQA 3MBZA 3TW8A 2ZOHA 3PYPA 2J7VA 3PBQA 1J9MA 2HP9A 5FI2A 1Q2PA 1WE4A 1WYBA 5IS1A 2OLUA 2V0UA 2EFXA 3B47A 3MZEA 3O5YA 4UA9A 4WMCA 3W2ZA 3WS0A 4BENA 2OV5A 2OWJA 5BOHA 4C3QA 4HI4A 4EETB 4R23A 2G7UA 3LO7A 4QY6A 3MS6A 1YQSA 1ES5A 1BTLA 1CJFA 1G6AA 5EOOA 1YT4A 2J9PA 3IWQA 4KZ8A 3MQQA 2MJ6A 2XLNA 3V3RA 5GHZA 4GZBA 5EPHA 3MQOA 4MN7A 4E3NA 1RP5A 2VGKA 4JXSA 5CGSA 1MKMA 1ACFA 5G4YA 1K0KA 4IUKA 2YKHA 3HJIA 2QKPA 1CF0A 2FFYA 4UEYA 3T50A 4GW9A 3IXHA 2Y8HA 4WZ4A 3NECA 2WKQA 1VQQA 3BFCA 2O9BA 3UB9A 2H28A 1GA0A 1NLYA 5FEFA 2K31A 3IWOA 4R3AA 2W0NA 1P9WA 4QY5A 1E3UD 2VGLM 4PM7A 4NG2A 2KLIA 1XFNA 4Y5FA 3T4JA 1YSPA 2W1TA 3AGFA 4BWIA 3V3SA 1L3LA 3IH8A 3N4IA 1DJAA 3Q82A 4EQ1A 3CG5A 2KX6A 5FATA 3SS3A 4E3LA 2G2UA 4ESPA 4PPRA 3CPTA 1CEFA 4E6XA 1GHPA 3OPHA 4DXCA 4P0MA 3G30A 2ZOIA 4ARZA 4DE3A 3OLOA 4XT2A 4OQ0A 1P97A 2WKPA 4HY8A 2VEAA 2ZC6B 3WS2A 5HARA 1UWPX 5DJTA 2PYPA 4GB7A 2WKHA 3ZNYA 5KSCA 2LB9A 2OLVA 4Q0IA 2HDRA 2ZC7A 3MFDA 3RFBA 1NZUA 1ODVA 3P98A 5HAIA 4S2IA 3IX3A 2Y91A 4OOLA 5DFXA 3ZQ5A 4Q8IA 3T1SA 3JVVA 4MBKA 2D02A 4R3JA 1S66L 4LLOB 1IEMA 3O86A 3P09A 5CHJA 1DP6A 4HNBA 4U3TA 3HLGA 2ZLYA 1OT6A 1SKFA 1XX2A 1W5DA 4NXFA 3RJUA 1D1JA 1VETA 3VMAA 5AQ9A 2EXBA 3IS2B 3GV9A 4PM8A 2PR6A 3H82B 3N7WA 2XFSA 3CLOA 3N6IA 3CHWP 1XA1A 2VV7A 4I5SA 3MR0A 2V8FA 1KVLA 2JC7A 4ZDXA 3PTEA 1STZA 1XJ2A 3MKEA 3PHYA 3E2LA 2JN7A 3KO6A 3KYEA 2Y2JA 5HW3A 4CLCC 2XEPA 1UWNX 2XROA 1XJ6A 5L2FA 4JGPA 4E3JA 2IWDA 3DWZA 1JTGA 4JBFA 2VZWA 2VGLS 4K08A 2EX9A 5F68A 1W79A 2V8CA 1Y54A 4HOIA 5L07A 2PRFA 2D01A 4ETZA 1S0WA 3EWKA 1PFLA 2EWWA 3G2ZA 3R4KA 4WEJA 1OTDA 1QMFA 2UV0E 1OTEA 1P9RA 4Z9QA 1LSXA 2GZAA 3IQAA 3MZFA 3ZVTA 3WRTA 4UAAA 1V9ZA 3UN7A 4NXBA 4YINA 3RXXA 1T18A 1ZTUA 5DF7A 2O9AA 4EU0A 1PI5A 3S1YA 5HWVA 1YLTA 4DMZA 4NKPA 5EVIC 3KYQA 2XK1A 3PBRA 1I2WA 5J3WA 3HBRA 4KG5A 1OT9A 3OPLA 4FOFA 5DF8A 4O8GA 2O9CA 3E4QA 1KDWA 5C5KA 4DRTA 2HV1A 5JYOA 1MBLA 5IT5A 2A24A 4EBLA 3C2WA 3WS5A 2WK0A 4Y0TA 3R7WB 4LPZA 3VP1A 5CECA 1EI5A 2HZ5A 1VEUA 4GNUA 5FAPA 3UB8A 1W7FA 4OQIA 4G3KA 3QHYA 4S2PA 2VX8A 3PBNA 3VP3A 4WM9A 1OTIA 1I5QA 4D60A 1MKIA 2OOLA 3IX8A 2JKFA 1TVFA 2GDNA 1GA9A 1OPXA 1IYPA 2W27A 3BFDA 3LUQA 1ZHHB 3JVUA 4JF5A 3ZNTA 2G2WA 3BWLA 5E43A 5A91A 1GSWA 3C8CA 5FQIA 3OC2A 3UPNA 3LFVA 1YMSA 3QP5A 4EQIA 1YMXA 2HDUA 1CK3A 2ZQAA 1BULA 1YKDA 3WWXA 4BJPA 4LRYC 3KSFA 4Q0HA 4OVDA 3ZG8B 3TOIA 2R78A 1VM1A 3IF6C 4BBTA 4X1MA 3BLSA 4ZJ3A 1WA9A 1PWCA 4FTXA 2HJ9C 1E25A 5E2EA 2RCXA 4ZRRA 1ALQA 2Z6CA 2CMNA 2NUTC 1K6RA 2O0YA 3PXPA 2BTFP 4ME4A 3N8LA 2KOIA 2ZQCA 3Q7VA 1S4RA 4LV1A 4NK3A 4Y0OA 4I3AA 2EXAA 5AQBA 2PAVP 4DE2A 5FAOA 2P9VB 3GECA 1K38A 2X02A 3FKVA 5HWTA 3BLMA 4U0TA 4LGWA 3C7UA 4K0WA 4WYYA 2GX5A 4RX3A 2WKIA 5GHYA 4LRXC 3NBLA 1G68A 4D2OA 3PAGA 3UE1A 1GHIA 5TJJA 3UPPA 5GLCA 4CLCB 4OPQA 3IXGA 1IYQA 1X0OA 2H0TA 3EEAA 3ZCZA 4UA7A 2UWXA 4CJNA 1VB6A 2B02A 1OJ5A 4ZBEA 3HLCA 4M4XA 3N8RA 1S4SA 1W63Q 3RTYA 3F1OA 1IKGA 4B93A 1TD5A 4IBRA 3KSHA 1G5UA 1HVBA 2L1MA 4UQIM 4RQ9A 2XGNA 3IHAA 4JXGA 1LL9A 5FQQA 1K54A 3K2NA 3SZTA 1N9LA 3Q1FA 2X71A 3H7WA 3E0YA 1NZOA 4PKYA 4HBTA 2OSUA 4X68A 3W8KA 3DTKA 3HLEA 5FL3A 4HP4A 4U0XA 2EFUA 3MZDA 4JF4A 1EROA 5EUAA 3G32A 5DVAA 1S1YA 4GJ4A 1LT0A 1JWZA 2XD1A 4IJGA 4QU3A 4OPRA 3CAXA 4GHIB 4DDSA 1ES2A 1KE3A 3QNCA 4MN6A 5DKKA 1D06A 2Q9MA 4YNRA 4DE1A 5A93A 1WYCA 1BLSA 2HDSA 2BLSA 5GLAA 1HZOA 3PAEA 2AVXA 2M7VA 2B95A 1RGZA 4GN2A 5KMWA 3NDEA 3FC7A 1NJ4A 5F69A 3G4PA 1DY6A 1BLPA 2OAQ1 4KZ6A 5EV0A 2PDRA 5HD3A 4L9FA 4WEKA 4R1GA 4KZ3A 3LCEA 1K6SA 4DXBA 1G28A 2H5SA 2DRWA 3BQ8A 4JLFA 2L4RA 3HJKA 2IWBA 4AFIA 3AGEA 5L10A 4G3VA 2M7UA 1FR6A 3NHQA 3A0SA 4BD1A 3VOZA 2ZJ9A 1KGFA 4EUVA 1N4OA 5FASA 4NEED 4NXEA 1TDGA 4MEZA 2XR0A 5L8MA 2WAFA 3NIAA 5CRFA 3CMZA 2Y2NA 5FAQA 3SW1A 4X69A 3EEHA 4HJ3A 5G4ZA 4E3MA 1K4EA 4Y2FA 1K57C 4KG2A 1ERQA 4UHUA 3UMDA 2B5RA 1NRJA 3P01A 3GMWA 4XXRA 2WKRA 5U47A 3KSGA 3VP2A 5F82A 3EQUA 2ACGA 5CTNA 4Q0JA 4PM9A 3CWFA 1AWIA 4KENB 1IELA 3SH9A 3UDIA 1CQAA 5HFOA 4ARZB 3UMEA 2A49A 1MXOA 4OKPA 5TBMA 1BUEA 2J80A 4WELA 2HGVA 2PR5A 1ES3A 3BY9A 1PWGA 3A3EA 1H8ZA 1JNUA 2WADA 4EW7A 3PBSA 3IF5A 3VSKA 3BQAA 5DF9A 1A0KA 3MF0A 3I7JA 1H0MA 4KQQA 5A92A 2ZQ7A 4IEDA 3UPOA 1W8QA 3Q07A 5DTSA 1L0DA 4O0PA 4I38A 2EX2A 5AJGA 5FA7A 1XPBA 4G3WA 4O01A 1BLHA 5EM1A 2WYXA 1DP9A 1YLZA 1VEUB 4ZJ2A 1DJCA 5CEBA 5HDSA 4E6WA 2Y2IA 1ESUA 4R38A 5I5LA 1KE4A 3HLWA 1ONGA 2Q9NA 1YM1A 5F5YA 2O99A 4LENA 1QMEA 1Y28A 2Y55A 1IFQA 3OZHA 3LIFA 3B3XA 1FIKA 2V1ZA 1JWPA 1GSXA 4L9GA 5CXWA 3EQVA 4EBNA 5FI6A 2Y4AA 3C4OA 3ZFZA 2R9WA 3UE6A 3U2AA 3LR4A 5K5BA 2ZMVA 3V39A 3E2KA 3UDFA 3IBRA 4BL2A 4DF6A 3IHBA 5M18A 4GS9A 1KE0A 5GLDA 5IHVA 4YFMA 2HF6A 4FSFA 4B88A 5EOEA 5CHMA 5AQ7A 2BASA 2ZM8A 3P7NA 2Y2LA 3SOIA 3O87A 4HJ6A 1XFQA 1Y4OA 3B33A 5FQKA 2H0YA 5GLBA 3R7WA 1PNEA 4BLMA 2J9OA 4PM5A 4XUXA 4DJ2A 4E04A 3M2KA 3FWLA 3T1XA 3A0VA 2P74A 2ZM2A 2QYBA 4WLAA 4MCWA 3DTEA 2E8JA 3HUMA 3OBFA 2Y2PA 4ZAMA 3HUNA 5TBMB 2EA9A 1PZPA 2W3DA 3Q81A 1PW8A 4S2KA 4PAUA 3T4KA 1PYYA 3S7NA 3S4XA 3KX0X 3GVBA 3NI9A 4A5RA 1KGEA 1DP8A 4LV2A 1TS7A 2P9VA 2JKRI 3BFGA 2WKEA 2ZM0A 1KDSA 4Y17A 2A24B 2W3GA 3GRJA 1TS0A 1XJ3A 4JGOA 1LI9A 2Y2KA 1S1ZA 5EVIA 3QP2A 1C3BA 3L9KA 2XA7M 2JKGA 4EEPA 4BQMA 4GCZA 1FCOA 2VGJA 3KYZA 5GHXA 1FCNA 3NOUC 4OLGA 1CEGA 1F5MA 1ERMA 3QNBA 1SKOA 1MWRA 4F3LA 4OOYA 3VE4A 3DBAA 3ZVWA 2Y2OA 3Q7VB 2JKTM 3LI9A 3PR6A 2X01A 3S22A 4UA6A 2JHEA 5AVEA 1NRFA 2OAP1 2Y2HA 2XF3A 4QJGA 3FG8A 4OQHA 4MBHA 3UO9A 1KGGA 2JKTI 3A3DA 3NCKA 1RGYA 3FYZA 3IS2A 2XDMA 5TFQA 3UB6A 3IT9A 4X56A 3TG9A 3FV7A 2IWCA 4UQIS 3C7VA 5DTTA 4X53A 3UE3A 5HAPA 2HP6A 1BLCA 2ZQDA 4RX2A 5FDSA 3S7PA 1K55C 3DWKA 4OQGA 2P08A 3BM6A 3LEZA 4GDNA 3IXBA 1DRMA 2ZQ9A 4R70A 3UY6A 1T19A 4S2LA 5EE8A 3FPWA 1ZG6A 4DJ3A 1BSGA 2HDQA 3TJZC 1GSVA 3RH8B 3ZG5A 4K91A 4OPYA 2W3EA 3S7OA 3CUEA 1N9NA 3GTCA 5CEDA 1S6RA 4EESA 4HHDA 2PU4A 3HUOA 1JWVA 2P7JA 5J8XA 2Q0OA 4EUZA 1DJBA 3DAVA 4EWFA 5EFWA 4ZJ1A 1XGIA 4X55A 3W4PA 1O7EA 2J3TD 3EGXC 1K56A 4WZ5C 4KZ7A 3WS4A 1W8YA 4R4SA 2XD5A 4S2NA 3D9YA 4JPMA 1MY8A 2J3TC 2WGWB 2KDKA 2V9AA 4KZ5A 1XA7A 4Y13A 4S2MA 1H3QA 2Y2QA 1J3WA 3SH7A 2DCFA 3MSHA 4N1XA 1PWDA 3HLDA 1L2SA 1OTAA 3IXDA 4P6BA 2PYRA 1W63M 4CLCE 4IVIA 4X6TA 2GJ3A 4DN0A 2JBFA 3NOTC 1MC0A 2EWVA 4KZ4A 5EVID 3T1RA 3LYXA 1KOUA 3HVFA 3C5AA 2FH5A 5FQMA 1FSYA 5HWWA 1XJ4A 1E4DA 3D72A 3MQ0A 4BBVA 3A3IA 1SDNA 4CLCA 2RL3A 3HL9A 4BL3A 3BFEA 4M3KA 2ZC3B 1YLJA 4JXWA 3VFHA 3CUEC 5AQAA 4HP9A 4JGRA 5F6AA 2WGWA 3F1NB 5DTKA 2E8IA 4X25A 5FSRA 3T4LA 5JYPA 3OCNA 3E98A 4GD8A 2DNSA 2XSSA 4K0XA 4R4RA 2VK3A 4MMNA 1CI9A 2K7SA 4Y0UA 2V20A 1V9YA 3F1NA 3LICA 4XUZA 5HDCA 1OTBA 3M6BA 1NLZA 1K55A 1IYOA 3ICYA 2Y2GA 4EEUA 1L0GA 1FR1A 5CHUA 1MPLA 4LRZE 2QJ5A 3H7WB 1NY0A 1OMEA 3BYDA 4BD0A 4KZ9A 4EERA 5EM0A 4MBFA 1N9BA 1VHMA 5KSHA 3LY4A 2INWA 1FCMA 4EXOA 4KUOA 4H6JB 3LR3A 1K57A 4WN5A 4XT2B 2EX6A 3LGOA 1SKOB 3CZDA 2XA7S 4IVKA 1P0ZA 2OWHA 2BG1A 4RYEA 3LEQA 3F1OB 3FKWA 1GHMA 1YAXA 2Y59A 3CJMA 3GQZA 3QP6A 4O7DA 4ZTKA 2ZD8A 4WF0A 3L7HA 4P87A 3ITAA 4MN5A 2CC1A 5F1FA 4MNRA 5HL6A 4Y3IA 1H8MA 3TE8A 5HAQA 1IYSA 1S67L 4ID4A 3VE3A 1EW0A 3NDGA 3OPPA 4S2NC 2I9VA 3LIBA 4GS9B 2XQZA 4I39A 3LR5A 5AVFA 1YLWA 3EGDC 2PU2A 3FPVA 1YLYA 1T1BA 4LV0A 1NYMA 3IBJA 2HP5A 5A90A 3NJAA 1N9OA 3ZG7B 3Q7ZA 5J7EA 1I2SA 4PKYG 3TSGA 2JKRM 3K3CA 3S7QA 1LL8A 4GOGA 4CPKA 3TRCA 5J4EA 2PT7A 4OP5A 2PHYA 5EVIB 3UDXA 2L0WA 3QP1A 4BMWA 4GD6A 5HL1A 4IHQA 4CLCD 3IX4A 3MXQA 3E4OA 3MKFA 1ZG4A 3HLFA 2V0WA 4KG6A 1BYWA 3C38A 4MLLA 4PHTA 4DDYA 3LIDA 3HREA 1SDEA 5KZHA 3ZDJA 2C5WB 3ZHHA 1KVMA 5FDHA 4JKTA 4OOMA 5HD5A 3BRMA 1YLPA 4PMAA 3IWIA 5EECA 3MXRA 3UB7A 4MDZA 1LL5A 1IOUA 5E2FA 5MC7A 4P6ZM 2JCHA 3BECA 4RVAA 3ISGA 2HJEA 3AGDA 4HH2A 3DW0A 4YWZA 2GNXA 2VKSA 5HSQA 2NUPC 3F1PA 4NXGA 3ZYTA 5CGXA 1O07A 3JPUA 3HLBA 5HPIA 4FUWA 2WZXA 3NOPC 1F98A 5L09A 2PBYA 2EX8A 2PD7A 1K56D 2QPNA 2Z2LB 4Z1WA 1TS6A 4R6LA 5F1GA 4WMCD 2A3UA 2PBDP 2WGVA 4LFUA 1XGJA 4GHIA 5E2GA 4WBGA 3W4OA 3VP0A 2R9XA 4F94A 3V50A 1FSWA 1XKZA 1LLBA 4OPZA 2LB5A 1BZAA 3K3DA 1F9IA 1E3UA 3EOIA 1Z6FA 2C6WB 3G31A 4QB8A 4EBPA 3LIEA 3MMHA 4WUJA 1PIOA 2XFTA 4B4ZA 4OP8A 1FILA 4PM6A 1PI4A 5FQ9A 1U60A 5A8BA 3PBOA 2I72A 1M40A 4ETXA 1JTDA 4E3IA 1EWZA 3G2YA 3QP8A 2YKFA 3MXSA 4BBUA 3SS5A 4N1HA 3GSGA 1F2KA 2XRNA 3H9WA 2Y79A 3M2JA 5E2HA 5D3OA 3H82A 3CPTB 1MWSA 2ZL1A 1LSVA 1ESIA 3G35A 1TEMA 2VA0A 5M1AA 3ZG9B 4GDBA 2ZL1B 2W3FA 5DFYA 4DKIA 2W1TB 3OOVA 4E3KA 3V67A 4QD4A 3U4LP 5HX9A 4JGQA 2PD8A 3T4TA 2WUQA 1T1AA 1Q2QA 4LCMA 3HCYA 3F1PB 3B42A 2K2NA 4OH0A 3GDIA 3G6OA 4F3LB 5KIZA 4R0QA 4B4XA 2Z6DA 1L0FA 1PW1A 1YSQA 1K25A 4FH4A 4KQOA 5G18A 2V1AA 1H5XA 2ZMFA 4LV3A 3CI6A 4H8RA 2QJ7A 3ITBA 3CITA 1BT5A 2ZMAA 1NXYA 4N92A 4Y15A 2WGIA 2VJWA 4C6YA 5M19A 4WL9A 4I3IA 2QHKA 4LCLA 2ZC4B 2QMIA 3O88A 2ZBBA 3ULFA 2HPBA 5I94A 2DMWA 3BJNA 2WZZA 2M1CA 1H8YA 3FZCA 3ZG0A 3OPRA 3MJQA 4X1LA 3M6HA 3VSLA 3G34A 3MFXA 1LHYA 1SZVA 5CGWA 3WRZA 1HLUP 1L0EA 3IH9A 3QP4A 4R3BA 4OLDA 5GL9A 3BW6A 3C30A 5CERA 2FFFB 3T12B 3NULA 5TGFA 4IUHA 2IA2A 1ZC2A 3ZGAB 4FCFA 5FQJA 1PZOA 1AXBA 5F83A 3VOLA 4HQAA 3VFFA 2W1RA 3BFFA 4B9OA 3O3VA 3C4PA 4E3OA 4EV4A 1TF1A 1XXMA 3UNWA 3SH8A 3T4OA 1Z09A 4N9KA 2JE5A 4WZ5A 1IKIA 1CI8A 5CTMA 2VV8A 4QWOA 3UB5P 4HJ4A 2QZ6A 3LIAA 1LI0A 4GLQA 1SHVA 1HD8A 4RA7A 3IF6A 3SS4A 4Y7PA 2XH9A 1VETB 1FOFA 1UGUA 1T1CA 3LR0A 4KQDA 4NETA 3DTMA 4GKUA 3WS1A 2VV6A 1MZUA 3V5MA 2A2LA 1MWTA 2VLGA 5HDDA 2Y2MA 4KUKA 5FEGA 3BEBA 3N8SA 4KZBA 2QWSA 5EVEA 1JVJA 4HIAA 4KQRA 3DTIA 1TDLA 3GR2A 3D4FA 5DKLA 4I3JA 2H10A 3NY4A 1ONHA 4H6JA 4II7A 3A3JA 2ZQ8A 4L0LA 1GCEA 1OJGA 4QHCA 3LI8A 3RXWA 3VOYA 3E4PA 3T4QA 3NC8A 3A0RA 5CX7A 1YPRA 4C75A 3OCLA 3A3FA 3LY3A 3IF6B 4IBXA 3VV4A 4HBUA 1M6KA 4OONA 4FD8A 1TS8A 3UE0A 5EVLA 3KSIA 1NWZA 4YOFA 4JXVA 4CQHA 2B18A 4HEFA 1NYYA 2J3WA 4N9LA 2V2FF 5FI7A 1SCWA 3JYIA 4S2OA 4DE0A 1K4FA 3BY8A 1LSWA 5LBRA 2W3HA 4S2JA 2ZC5B 4L9EA 2P04A
chains in the Genus database with same CATH topology
1ACFA 3LEQA 2PRFA 5EM1A 5EV0A 3T1XA 4X1MA 5EM0A 1CQAA 3CHWP 3D9YA 3L9KA 4X25A 1K0KA 1VEUB 1PFLA 4ESPA 2PBDP 4QWOA 4FTXA 2JKGA 2E8JA 2V8FA 3T1QB 3UB5P 2ZL1B 1A0KA 4D60A 1CF0A 4X1LA 3T12B 3CPTA 1FILA 3NULA 1PRQA 1Y4OA 2PAVP 2JKFA 5FDSA 1F2KA 3L7HA 2B95A 1J3WA 3U4LP 2VK3A 3DAVA 4FUWA 3MSHA 1D1JA 5FEGA 1VETA 3LGOA 1SKOB 2HZ5A 1VEUA 1SZVA 1G5UA 2ACGA 3T1RA 3NECA 3CPTB 1PNEA 1VETB 3MS6A 1HLUP 2V8CA 2BTFP 1YPRA 5EVEA 1AWIA 1CJFA 2ZL1A 3KYEA 3T1SA 1Z09A 5FEFA 1SKOA 1FIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ACF A;  3LEQ A;  2PRF A;  5EM1 A;  5EV0 A;  3T1X A;  4X1M A;  5EM0 A;  1CQA A;  3CHW P;  3D9Y A;  3L9K A;  4X25 A;  1K0K A;  1VEU B;  1PFL A;  4ESP A;  2PBD P;  4QWO A;  4FTX A;  2JKG A;  2E8J A;  2V8F A;  3T1Q B;  3UB5 P;  2ZL1 B;  1A0K A;  4D60 A;  1CF0 A;  4X1L A;  3T12 B;  3CPT A;  1FIL A;  3NUL A;  1PRQ A;  1Y4O A;  2PAV P;  2JKF A;  5FDS A;  1F2K A;  3L7H A;  2B95 A;  1J3W A;  3U4L P;  2VK3 A;  3DAV A;  4FUW A;  3MSH A;  1D1J A;  5FEG A;  1VET A;  3LGO A;  1SKO B;  2HZ5 A;  1VEU A;  1SZV A;  1G5U A;  2ACG A;  3T1R A;  3NEC A;  3CPT B;  1PNE A;  1VET B;  3MS6 A;  1HLU P;  2V8C A;  2BTF P;  1YPR A;  5EVE A;  1AWI A;  1CJF A;  2ZL1 A;  3KYE A;  3T1S A;  1Z09 A;  5FEF A;  1SKO A;  1FIK A; 
#chains in the Genus database with same CATH topology
 2V1B A;  3VP4 A;  3W4Q A;  5HPF A;  1RCJ A;  5TR7 A;  5DJU A;  3PBT A;  1D7E A;  1ES4 A;  4HH3 A;  1ZKJ A;  4HES A;  1G6O A;  4FH2 A;  4P85 A;  1FQG A;  2J8Y A;  2Z2M B;  1HTZ A;  4KZA A;  4JF6 A;  1K54 C;  2FZ0 A;  2WAE A;  3T4S A;  4QPR A;  3D3O A;  5HZH A;  1MWU A;  1XP4 A;  3T1Q B;  5IU1 A;  4P6Z S;  1PRQ A;  3MBZ A;  3TW8 A;  2ZOH A;  3PYP A;  2J7V A;  3PBQ A;  1J9M A;  2HP9 A;  5FI2 A;  1Q2P A;  1WE4 A;  1WYB A;  5IS1 A;  2OLU A;  2V0U A;  2EFX A;  3B47 A;  3MZE A;  3O5Y A;  4UA9 A;  4WMC A;  3W2Z A;  3WS0 A;  4BEN A;  2OV5 A;  2OWJ A;  5BOH A;  4C3Q A;  4HI4 A;  4EET B;  4R23 A;  2G7U A;  3LO7 A;  4QY6 A;  3MS6 A;  1YQS A;  1ES5 A;  1BTL A;  1CJF A;  1G6A A;  5EOO A;  1YT4 A;  2J9P A;  3IWQ A;  4KZ8 A;  3MQQ A;  2MJ6 A;  2XLN A;  3V3R A;  5GHZ A;  4GZB A;  5EPH A;  3MQO A;  4MN7 A;  4E3N A;  1RP5 A;  2VGK A;  4JXS A;  5CGS A;  1MKM A;  1ACF A;  5G4Y A;  1K0K A;  4IUK A;  2YKH A;  3HJI A;  2QKP A;  1CF0 A;  2FFY A;  4UEY A;  3T50 A;  4GW9 A;  3IXH A;  2Y8H A;  4WZ4 A;  3NEC A;  2WKQ A;  1VQQ A;  3BFC A;  2O9B A;  3UB9 A;  2H28 A;  1GA0 A;  1NLY A;  5FEF A;  2K31 A;  3IWO A;  4R3A A;  2W0N A;  1P9W A;  4QY5 A;  1E3U D;  2VGL M;  4PM7 A;  4NG2 A;  2KLI A;  1XFN A;  4Y5F A;  3T4J A;  1YSP A;  2W1T A;  3AGF A;  4BWI A;  3V3S A;  1L3L A;  3IH8 A;  3N4I A;  1DJA A;  3Q82 A;  4EQ1 A;  3CG5 A;  2KX6 A;  5FAT A;  3SS3 A;  4E3L A;  2G2U A;  4ESP A;  4PPR A;  3CPT A;  1CEF A;  4E6X A;  1GHP A;  3OPH A;  4DXC A;  4P0M A;  3G30 A;  2ZOI A;  4ARZ A;  4DE3 A;  3OLO A;  4XT2 A;  4OQ0 A;  1P97 A;  2WKP A;  4HY8 A;  2VEA A;  2ZC6 B;  3WS2 A;  5HAR A;  1UWP X;  5DJT A;  2PYP A;  4GB7 A;  2WKH A;  3ZNY A;  5KSC A;  2LB9 A;  2OLV A;  4Q0I A;  2HDR A;  2ZC7 A;  3MFD A;  3RFB A;  1NZU A;  1ODV A;  3P98 A;  5HAI A;  4S2I A;  3IX3 A;  2Y91 A;  4OOL A;  5DFX A;  3ZQ5 A;  4Q8I A;  3T1S A;  3JVV A;  4MBK A;  2D02 A;  4R3J A;  1S66 L;  4LLO B;  1IEM A;  3O86 A;  3P09 A;  5CHJ A;  1DP6 A;  4HNB A;  4U3T A;  3HLG A;  2ZLY A;  1OT6 A;  1SKF A;  1XX2 A;  1W5D A;  4NXF A;  3RJU A;  1D1J A;  1VET A;  3VMA A;  5AQ9 A;  2EXB A;  3IS2 B;  3GV9 A;  4PM8 A;  2PR6 A;  3H82 B;  3N7W A;  2XFS A;  3CLO A;  3N6I A;  3CHW P;  1XA1 A;  2VV7 A;  4I5S A;  3MR0 A;  2V8F A;  1KVL A;  2JC7 A;  4ZDX A;  3PTE A;  1STZ A;  1XJ2 A;  3MKE A;  3PHY A;  3E2L A;  2JN7 A;  3KO6 A;  3KYE A;  2Y2J A;  5HW3 A;  4CLC C;  2XEP A;  1UWN X;  2XRO A;  1XJ6 A;  5L2F A;  4JGP A;  4E3J A;  2IWD A;  3DWZ A;  1JTG A;  4JBF A;  2VZW A;  2VGL S;  4K08 A;  2EX9 A;  5F68 A;  1W79 A;  2V8C A;  1Y54 A;  4HOI A;  5L07 A;  2PRF A;  2D01 A;  4ETZ A;  1S0W A;  3EWK A;  1PFL A;  2EWW A;  3G2Z A;  3R4K A;  4WEJ A;  1OTD A;  1QMF A;  2UV0 E;  1OTE A;  1P9R A;  4Z9Q A;  1LSX A;  2GZA A;  3IQA A;  3MZF A;  3ZVT A;  3WRT A;  4UAA A;  1V9Z A;  3UN7 A;  4NXB A;  4YIN A;  3RXX A;  1T18 A;  1ZTU A;  5DF7 A;  2O9A A;  4EU0 A;  1PI5 A;  3S1Y A;  5HWV A;  1YLT A;  4DMZ A;  4NKP A;  5EVI C;  3KYQ A;  2XK1 A;  3PBR A;  1I2W A;  5J3W A;  3HBR A;  4KG5 A;  1OT9 A;  3OPL A;  4FOF A;  5DF8 A;  4O8G A;  2O9C A;  3E4Q A;  1KDW A;  5C5K A;  4DRT A;  2HV1 A;  5JYO A;  1MBL A;  5IT5 A;  2A24 A;  4EBL A;  3C2W A;  3WS5 A;  2WK0 A;  4Y0T A;  3R7W B;  4LPZ A;  3VP1 A;  5CEC A;  1EI5 A;  2HZ5 A;  1VEU A;  4GNU A;  5FAP A;  3UB8 A;  1W7F A;  4OQI A;  4G3K A;  3QHY A;  4S2P A;  2VX8 A;  3PBN A;  3VP3 A;  4WM9 A;  1OTI A;  1I5Q A;  4D60 A;  1MKI A;  2OOL A;  3IX8 A;  2JKF A;  1TVF A;  2GDN A;  1GA9 A;  1OPX A;  1IYP A;  2W27 A;  3BFD A;  3LUQ A;  1ZHH B;  3JVU A;  4JF5 A;  3ZNT A;  2G2W A;  3BWL A;  5E43 A;  5A91 A;  1GSW A;  3C8C A;  5FQI A;  3OC2 A;  3UPN A;  3LFV A;  1YMS A;  3QP5 A;  4EQI A;  1YMX A;  2HDU A;  1CK3 A;  2ZQA A;  1BUL A;  1YKD A;  3WWX A;  4BJP A;  4LRY C;  3KSF A;  4Q0H A;  4OVD A;  3ZG8 B;  3TOI A;  2R78 A;  1VM1 A;  3IF6 C;  4BBT A;  4X1M A;  3BLS A;  4ZJ3 A;  1WA9 A;  1PWC A;  4FTX A;  2HJ9 C;  1E25 A;  5E2E A;  2RCX A;  4ZRR A;  1ALQ A;  2Z6C A;  2CMN A;  2NUT C;  1K6R A;  2O0Y A;  3PXP A;  2BTF P;  4ME4 A;  3N8L A;  2KOI A;  2ZQC A;  3Q7V A;  1S4R A;  4LV1 A;  4NK3 A;  4Y0O A;  4I3A A;  2EXA A;  5AQB A;  2PAV P;  4DE2 A;  5FAO A;  2P9V B;  3GEC A;  1K38 A;  2X02 A;  3FKV A;  5HWT A;  3BLM A;  4U0T A;  4LGW A;  3C7U A;  4K0W A;  4WYY A;  2GX5 A;  4RX3 A;  2WKI A;  5GHY A;  4LRX C;  3NBL A;  1G68 A;  4D2O A;  3PAG A;  3UE1 A;  1GHI A;  5TJJ A;  3UPP A;  5GLC A;  4CLC B;  4OPQ A;  3IXG A;  1IYQ A;  1X0O A;  2H0T A;  3EEA A;  3ZCZ A;  4UA7 A;  2UWX A;  4CJN A;  1VB6 A;  2B02 A;  1OJ5 A;  4ZBE A;  3HLC A;  4M4X A;  3N8R A;  1S4S A;  1W63 Q;  3RTY A;  3F1O A;  1IKG A;  4B93 A;  1TD5 A;  4IBR A;  3KSH A;  1G5U A;  1HVB A;  2L1M A;  4UQI M;  4RQ9 A;  2XGN A;  3IHA A;  4JXG A;  1LL9 A;  5FQQ A;  1K54 A;  3K2N A;  3SZT A;  1N9L A;  3Q1F A;  2X71 A;  3H7W A;  3E0Y A;  1NZO A;  4PKY A;  4HBT A;  2OSU A;  4X68 A;  3W8K A;  3DTK A;  3HLE A;  5FL3 A;  4HP4 A;  4U0X A;  2EFU A;  3MZD A;  4JF4 A;  1ERO A;  5EUA A;  3G32 A;  5DVA A;  1S1Y A;  4GJ4 A;  1LT0 A;  1JWZ A;  2XD1 A;  4IJG A;  4QU3 A;  4OPR A;  3CAX A;  4GHI B;  4DDS A;  1ES2 A;  1KE3 A;  3QNC A;  4MN6 A;  5DKK A;  1D06 A;  2Q9M A;  4YNR A;  4DE1 A;  5A93 A;  1WYC A;  1BLS A;  2HDS A;  2BLS A;  5GLA A;  1HZO A;  3PAE A;  2AVX A;  2M7V A;  2B95 A;  1RGZ A;  4GN2 A;  5KMW A;  3NDE A;  3FC7 A;  1NJ4 A;  5F69 A;  3G4P A;  1DY6 A;  1BLP A;  2OAQ 1;  4KZ6 A;  5EV0 A;  2PDR A;  5HD3 A;  4L9F A;  4WEK A;  4R1G A;  4KZ3 A;  3LCE A;  1K6S A;  4DXB A;  1G28 A;  2H5S A;  2DRW A;  3BQ8 A;  4JLF A;  2L4R A;  3HJK A;  2IWB A;  4AFI A;  3AGE A;  5L10 A;  4G3V A;  2M7U A;  1FR6 A;  3NHQ A;  3A0S A;  4BD1 A;  3VOZ A;  2ZJ9 A;  1KGF A;  4EUV A;  1N4O A;  5FAS A;  4NEE D;  4NXE A;  1TDG A;  4MEZ A;  2XR0 A;  5L8M A;  2WAF A;  3NIA A;  5CRF A;  3CMZ A;  2Y2N A;  5FAQ A;  3SW1 A;  4X69 A;  3EEH A;  4HJ3 A;  5G4Z A;  4E3M A;  1K4E A;  4Y2F A;  1K57 C;  4KG2 A;  1ERQ A;  4UHU A;  3UMD A;  2B5R A;  1NRJ A;  3P01 A;  3GMW A;  4XXR A;  2WKR A;  5U47 A;  3KSG A;  3VP2 A;  5F82 A;  3EQU A;  2ACG A;  5CTN A;  4Q0J A;  4PM9 A;  3CWF A;  1AWI A;  4KEN B;  1IEL A;  3SH9 A;  3UDI A;  1CQA A;  5HFO A;  4ARZ B;  3UME A;  2A49 A;  1MXO A;  4OKP A;  5TBM A;  1BUE A;  2J80 A;  4WEL A;  2HGV A;  2PR5 A;  1ES3 A;  3BY9 A;  1PWG A;  3A3E A;  1H8Z A;  1JNU A;  2WAD A;  4EW7 A;  3PBS A;  3IF5 A;  3VSK A;  3BQA A;  5DF9 A;  1A0K A;  3MF0 A;  3I7J A;  1H0M A;  4KQQ A;  5A92 A;  2ZQ7 A;  4IED A;  3UPO A;  1W8Q A;  3Q07 A;  5DTS A;  1L0D A;  4O0P A;  4I38 A;  2EX2 A;  5AJG A;  5FA7 A;  1XPB A;  4G3W A;  4O01 A;  1BLH A;  5EM1 A;  2WYX A;  1DP9 A;  1YLZ A;  1VEU B;  4ZJ2 A;  1DJC A;  5CEB A;  5HDS A;  4E6W A;  2Y2I A;  1ESU A;  4R38 A;  5I5L A;  1KE4 A;  3HLW A;  1ONG A;  2Q9N A;  1YM1 A;  5F5Y A;  2O99 A;  4LEN A;  1QME A;  1Y28 A;  2Y55 A;  1IFQ A;  3OZH A;  3LIF A;  3B3X A;  1FIK A;  2V1Z A;  1JWP A;  1GSX A;  4L9G A;  5CXW A;  3EQV A;  4EBN A;  5FI6 A;  2Y4A A;  3C4O A;  3ZFZ A;  2R9W A;  3UE6 A;  3U2A A;  3LR4 A;  5K5B A;  2ZMV A;  3V39 A;  3E2K A;  3UDF A;  3IBR A;  4BL2 A;  4DF6 A;  3IHB A;  5M18 A;  4GS9 A;  1KE0 A;  5GLD A;  5IHV A;  4YFM A;  2HF6 A;  4FSF A;  4B88 A;  5EOE A;  5CHM A;  5AQ7 A;  2BAS A;  2ZM8 A;  3P7N A;  2Y2L A;  3SOI A;  3O87 A;  4HJ6 A;  1XFQ A;  1Y4O A;  3B33 A;  5FQK A;  2H0Y A;  5GLB A;  3R7W A;  1PNE A;  4BLM A;  2J9O A;  4PM5 A;  4XUX A;  4DJ2 A;  4E04 A;  3M2K A;  3FWL A;  3T1X A;  3A0V A;  2P74 A;  2ZM2 A;  2QYB A;  4WLA A;  4MCW A;  3DTE A;  2E8J A;  3HUM A;  3OBF A;  2Y2P A;  4ZAM A;  3HUN A;  5TBM B;  2EA9 A;  1PZP A;  2W3D A;  3Q81 A;  1PW8 A;  4S2K A;  4PAU A;  3T4K A;  1PYY A;  3S7N A;  3S4X A;  3KX0 X;  3GVB A;  3NI9 A;  4A5R A;  1KGE A;  1DP8 A;  4LV2 A;  1TS7 A;  2P9V A;  2JKR I;  3BFG A;  2WKE A;  2ZM0 A;  1KDS A;  4Y17 A;  2A24 B;  2W3G A;  3GRJ A;  1TS0 A;  1XJ3 A;  4JGO A;  1LI9 A;  2Y2K A;  1S1Z A;  5EVI A;  3QP2 A;  1C3B A;  3L9K A;  2XA7 M;  2JKG A;  4EEP A;  4BQM A;  4GCZ A;  1FCO A;  2VGJ A;  3KYZ A;  5GHX A;  1FCN A;  3NOU C;  4OLG A;  1CEG A;  1F5M A;  1ERM A;  3QNB A;  1SKO A;  1MWR A;  4F3L A;  4OOY A;  3VE4 A;  3DBA A;  3ZVW A;  2Y2O A;  3Q7V B;  2JKT M;  3LI9 A;  3PR6 A;  2X01 A;  3S22 A;  4UA6 A;  2JHE A;  5AVE A;  1NRF A;  2OAP 1;  2Y2H A;  2XF3 A;  4QJG A;  3FG8 A;  4OQH A;  4MBH A;  3UO9 A;  1KGG A;  2JKT I;  3A3D A;  3NCK A;  1RGY A;  3FYZ A;  3IS2 A;  2XDM A;  5TFQ A;  3UB6 A;  3IT9 A;  4X56 A;  3TG9 A;  3FV7 A;  2IWC A;  4UQI S;  3C7V A;  5DTT A;  4X53 A;  3UE3 A;  5HAP A;  2HP6 A;  1BLC A;  2ZQD A;  4RX2 A;  5FDS A;  3S7P A;  1K55 C;  3DWK A;  4OQG A;  2P08 A;  3BM6 A;  3LEZ A;  4GDN A;  3IXB A;  1DRM A;  2ZQ9 A;  4R70 A;  3UY6 A;  1T19 A;  4S2L A;  5EE8 A;  3FPW A;  1ZG6 A;  4DJ3 A;  1BSG A;  2HDQ A;  3TJZ C;  1GSV A;  3RH8 B;  3ZG5 A;  4K91 A;  4OPY A;  2W3E A;  3S7O A;  3CUE A;  1N9N A;  3GTC A;  5CED A;  1S6R A;  4EES A;  4HHD A;  2PU4 A;  3HUO A;  1JWV A;  2P7J A;  5J8X A;  2Q0O A;  4EUZ A;  1DJB A;  3DAV A;  4EWF A;  5EFW A;  4ZJ1 A;  1XGI A;  4X55 A;  3W4P A;  1O7E A;  2J3T D;  3EGX C;  1K56 A;  4WZ5 C;  4KZ7 A;  3WS4 A;  1W8Y A;  4R4S A;  2XD5 A;  4S2N A;  3D9Y A;  4JPM A;  1MY8 A;  2J3T C;  2WGW B;  2KDK A;  2V9A A;  4KZ5 A;  1XA7 A;  4Y13 A;  4S2M A;  1H3Q A;  2Y2Q A;  1J3W A;  3SH7 A;  2DCF A;  3MSH A;  4N1X A;  1PWD A;  3HLD A;  1L2S A;  1OTA A;  3IXD A;  4P6B A;  2PYR A;  1W63 M;  4CLC E;  4IVI A;  4X6T A;  2GJ3 A;  4DN0 A;  2JBF A;  3NOT C;  1MC0 A;  2EWV A;  4KZ4 A;  5EVI D;  3T1R A;  3LYX A;  1KOU A;  3HVF A;  3C5A A;  2FH5 A;  5FQM A;  1FSY A;  5HWW A;  1XJ4 A;  1E4D A;  3D72 A;  3MQ0 A;  4BBV A;  3A3I A;  1SDN A;  4CLC A;  2RL3 A;  3HL9 A;  4BL3 A;  3BFE A;  4M3K A;  2ZC3 B;  1YLJ A;  4JXW A;  3VFH A;  3CUE C;  5AQA A;  4HP9 A;  4JGR A;  5F6A A;  2WGW A;  3F1N B;  5DTK A;  2E8I A;  4X25 A;  5FSR A;  3T4L A;  5JYP A;  3OCN A;  3E98 A;  4GD8 A;  2DNS A;  2XSS A;  4K0X A;  4R4R A;  2VK3 A;  4MMN A;  1CI9 A;  2K7S A;  4Y0U A;  2V20 A;  1V9Y A;  3F1N A;  3LIC A;  4XUZ A;  5HDC A;  1OTB A;  3M6B A;  1NLZ A;  1K55 A;  1IYO A;  3ICY A;  2Y2G A;  4EEU A;  1L0G A;  1FR1 A;  5CHU A;  1MPL A;  4LRZ E;  2QJ5 A;  3H7W B;  1NY0 A;  1OME A;  3BYD A;  4BD0 A;  4KZ9 A;  4EER A;  5EM0 A;  4MBF A;  1N9B A;  1VHM A;  5KSH A;  3LY4 A;  2INW A;  1FCM A;  4EXO A;  4KUO A;  4H6J B;  3LR3 A;  1K57 A;  4WN5 A;  4XT2 B;  2EX6 A;  3LGO A;  1SKO B;  3CZD A;  2XA7 S;  4IVK A;  1P0Z A;  2OWH A;  2BG1 A;  4RYE A;  3LEQ A;  3F1O B;  3FKW A;  1GHM A;  1YAX A;  2Y59 A;  3CJM A;  3GQZ A;  3QP6 A;  4O7D A;  4ZTK A;  2ZD8 A;  4WF0 A;  3L7H A;  4P87 A;  3ITA A;  4MN5 A;  2CC1 A;  5F1F A;  4MNR A;  5HL6 A;  4Y3I A;  1H8M A;  3TE8 A;  5HAQ A;  1IYS A;  1S67 L;  4ID4 A;  3VE3 A;  1EW0 A;  3NDG A;  3OPP A;  4S2N C;  2I9V A;  3LIB A;  4GS9 B;  2XQZ A;  4I39 A;  3LR5 A;  5AVF A;  1YLW A;  3EGD C;  2PU2 A;  3FPV A;  1YLY A;  1T1B A;  4LV0 A;  1NYM A;  3IBJ A;  2HP5 A;  5A90 A;  3NJA A;  1N9O A;  3ZG7 B;  3Q7Z A;  5J7E A;  1I2S A;  4PKY G;  3TSG A;  2JKR M;  3K3C A;  3S7Q A;  1LL8 A;  4GOG A;  4CPK A;  3TRC A;  5J4E A;  2PT7 A;  4OP5 A;  2PHY A;  5EVI B;  3UDX A;  2L0W A;  3QP1 A;  4BMW A;  4GD6 A;  5HL1 A;  4IHQ A;  4CLC D;  3IX4 A;  3MXQ A;  3E4O A;  3MKF A;  1ZG4 A;  3HLF A;  2V0W A;  4KG6 A;  1BYW A;  3C38 A;  4MLL A;  4PHT A;  4DDY A;  3LID A;  3HRE A;  1SDE A;  5KZH A;  3ZDJ A;  2C5W B;  3ZHH A;  1KVM A;  5FDH A;  4JKT A;  4OOM A;  5HD5 A;  3BRM A;  1YLP A;  4PMA A;  3IWI A;  5EEC A;  3MXR A;  3UB7 A;  4MDZ A;  1LL5 A;  1IOU A;  5E2F A;  5MC7 A;  4P6Z M;  2JCH A;  3BEC A;  4RVA A;  3ISG A;  2HJE A;  3AGD A;  4HH2 A;  3DW0 A;  4YWZ A;  2GNX A;  2VKS A;  5HSQ A;  2NUP C;  3F1P A;  4NXG A;  3ZYT A;  5CGX A;  1O07 A;  3JPU A;  3HLB A;  5HPI A;  4FUW A;  2WZX A;  3NOP C;  1F98 A;  5L09 A;  2PBY A;  2EX8 A;  2PD7 A;  1K56 D;  2QPN A;  2Z2L B;  4Z1W A;  1TS6 A;  4R6L A;  5F1G A;  4WMC D;  2A3U A;  2PBD P;  2WGV A;  4LFU A;  1XGJ A;  4GHI A;  5E2G A;  4WBG A;  3W4O A;  3VP0 A;  2R9X A;  4F94 A;  3V50 A;  1FSW A;  1XKZ A;  1LLB A;  4OPZ A;  2LB5 A;  1BZA A;  3K3D A;  1F9I A;  1E3U A;  3EOI A;  1Z6F A;  2C6W B;  3G31 A;  4QB8 A;  4EBP A;  3LIE A;  3MMH A;  4WUJ A;  1PIO A;  2XFT A;  4B4Z A;  4OP8 A;  1FIL A;  4PM6 A;  1PI4 A;  5FQ9 A;  1U60 A;  5A8B A;  3PBO A;  2I72 A;  1M40 A;  4ETX A;  1JTD A;  4E3I A;  1EWZ A;  3G2Y A;  3QP8 A;  2YKF A;  3MXS A;  4BBU A;  3SS5 A;  4N1H A;  3GSG A;  1F2K A;  2XRN A;  3H9W A;  2Y79 A;  3M2J A;  5E2H A;  5D3O A;  3H82 A;  3CPT B;  1MWS A;  2ZL1 A;  1LSV A;  1ESI A;  3G35 A;  1TEM A;  2VA0 A;  5M1A A;  3ZG9 B;  4GDB A;  2ZL1 B;  2W3F A;  5DFY A;  4DKI A;  2W1T B;  3OOV A;  4E3K A;  3V67 A;  4QD4 A;  3U4L P;  5HX9 A;  4JGQ A;  2PD8 A;  3T4T A;  2WUQ A;  1T1A A;  1Q2Q A;  4LCM A;  3HCY A;  3F1P B;  3B42 A;  2K2N A;  4OH0 A;  3GDI A;  3G6O A;  4F3L B;  5KIZ A;  4R0Q A;  4B4X A;  2Z6D A;  1L0F A;  1PW1 A;  1YSQ A;  1K25 A;  4FH4 A;  4KQO A;  5G18 A;  2V1A A;  1H5X A;  2ZMF A;  4LV3 A;  3CI6 A;  4H8R A;  2QJ7 A;  3ITB A;  3CIT A;  1BT5 A;  2ZMA A;  1NXY A;  4N92 A;  4Y15 A;  2WGI A;  2VJW A;  4C6Y A;  5M19 A;  4WL9 A;  4I3I A;  2QHK A;  4LCL A;  2ZC4 B;  2QMI A;  3O88 A;  2ZBB A;  3ULF A;  2HPB A;  5I94 A;  2DMW A;  3BJN A;  2WZZ A;  2M1C A;  1H8Y A;  3FZC A;  3ZG0 A;  3OPR A;  3MJQ A;  4X1L A;  3M6H A;  3VSL A;  3G34 A;  3MFX A;  1LHY A;  1SZV A;  5CGW A;  3WRZ A;  1HLU P;  1L0E A;  3IH9 A;  3QP4 A;  4R3B A;  4OLD A;  5GL9 A;  3BW6 A;  3C30 A;  5CER A;  2FFF B;  3T12 B;  3NUL A;  5TGF A;  4IUH A;  2IA2 A;  1ZC2 A;  3ZGA B;  4FCF A;  5FQJ A;  1PZO A;  1AXB A;  5F83 A;  3VOL A;  4HQA A;  3VFF A;  2W1R A;  3BFF A;  4B9O A;  3O3V A;  3C4P A;  4E3O A;  4EV4 A;  1TF1 A;  1XXM A;  3UNW A;  3SH8 A;  3T4O A;  1Z09 A;  4N9K A;  2JE5 A;  4WZ5 A;  1IKI A;  1CI8 A;  5CTM A;  2VV8 A;  4QWO A;  3UB5 P;  4HJ4 A;  2QZ6 A;  3LIA A;  1LI0 A;  4GLQ A;  1SHV A;  1HD8 A;  4RA7 A;  3IF6 A;  3SS4 A;  4Y7P A;  2XH9 A;  1VET B;  1FOF A;  1UGU A;  1T1C A;  3LR0 A;  4KQD A;  4NET A;  3DTM A;  4GKU A;  3WS1 A;  2VV6 A;  1MZU A;  3V5M A;  2A2L A;  1MWT A;  2VLG A;  5HDD A;  2Y2M A;  4KUK A;  5FEG A;  3BEB A;  3N8S A;  4KZB A;  2QWS A;  5EVE A;  1JVJ A;  4HIA A;  4KQR A;  3DTI A;  1TDL A;  3GR2 A;  3D4F A;  5DKL A;  4I3J A;  2H10 A;  3NY4 A;  1ONH A;  4H6J A;  4II7 A;  3A3J A;  2ZQ8 A;  4L0L A;  1GCE A;  1OJG A;  4QHC A;  3LI8 A;  3RXW A;  3VOY A;  3E4P A;  3T4Q A;  3NC8 A;  3A0R A;  5CX7 A;  1YPR A;  4C75 A;  3OCL A;  3A3F A;  3LY3 A;  3IF6 B;  4IBX A;  3VV4 A;  4HBU A;  1M6K A;  4OON A;  4FD8 A;  1TS8 A;  3UE0 A;  5EVL A;  3KSI A;  1NWZ A;  4YOF A;  4JXV A;  4CQH A;  2B18 A;  4HEF A;  1NYY A;  2J3W A;  4N9L A;  2V2F F;  5FI7 A;  1SCW A;  3JYI A;  4S2O A;  4DE0 A;  1K4F A;  3BY8 A;  1LSW A;  5LBR A;  2W3H A;  4S2J A;  2ZC5 B;  4L9E A;  2P04 A; 
#chains in the Genus database with same CATH homology
 1ACF A;  3LEQ A;  2PRF A;  5EM1 A;  5EV0 A;  3T1X A;  4X1M A;  5EM0 A;  1CQA A;  3CHW P;  3D9Y A;  3L9K A;  4X25 A;  1K0K A;  1VEU B;  1PFL A;  4ESP A;  2PBD P;  4QWO A;  4FTX A;  2JKG A;  2E8J A;  2V8F A;  3T1Q B;  3UB5 P;  2ZL1 B;  1A0K A;  4D60 A;  1CF0 A;  4X1L A;  3T12 B;  3CPT A;  1FIL A;  3NUL A;  1PRQ A;  1Y4O A;  2PAV P;  2JKF A;  5FDS A;  1F2K A;  3L7H A;  2B95 A;  1J3W A;  3U4L P;  2VK3 A;  3DAV A;  4FUW A;  3MSH A;  1D1J A;  5FEG A;  1VET A;  3LGO A;  1SKO B;  2HZ5 A;  1VEU A;  1SZV A;  1G5U A;  2ACG A;  3T1R A;  3NEC A;  3CPT B;  1PNE A;  1VET B;  3MS6 A;  1HLU P;  2V8C A;  2BTF P;  1YPR A;  5EVE A;  1AWI A;  1CJF A;  2ZL1 A;  3KYE A;  3T1S A;  1Z09 A;  5FEF A;  1SKO A;  1FIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...