5EM1A

Crystal structure of ragweed allergen amb a 8
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
127
Chain Sequence
GSGSWQTYVDEHLMDIEGTGQHLASAAIFGTDGNVWASSSFPEFPDEINAIIKEFSEPGALAPTGLFLAGAYMVIQGEPGAVIRGGAGGICITGQAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
pubmed doi rcsb
source organism Ambrosia artemisiifolia
molecule tags Allergen
total genus 31
structure length 127
sequence length 135
ec nomenclature
pdb deposition date 2015-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 5em1A00
1SKOA 2PBDP 1YPRA 3D9YA 5FEGA 2JKGA 5FEFA 2HZ5A 1G5UA 1D1JA 1FIKA 4X25A 1Y4OA 1VETA 1ACFA 1Z09A 3T1SA 1HLUP 2ZL1A 3NECA 1K0KA 4D60A 2V8FA 3MS6A 3DAVA 1A0KA 4QWOA 1VEUA 1SKOB 3MSHA 5FDSA 1FILA 4FTXA 2ACGA 1VETB 2PRFA 4X1LA 2ZL1B 1CF0A 3CPTA 1VEUB 1PFLA 5EV0A 3KYEA 1AWIA 4FUWA 3U4LP 5EVEA 3NULA 1CQAA 2B95A 2VK3A 3LGOA 5EM0A 4X1MA 3T1QB 1CJFA 2V8CA 1F2KA 3CPTB 3L7HA 3LEQA 2E8JA 1PRQA 2BTFP 3CHWP 3T1XA 2JKFA 1PNEA 3UB5P 3T1RA 3T12B 3L9KA 5EM1A 4ESPA 1J3WA 1SZVA 2PAVP
chains in the Genus database with same CATH superfamily
1XFQA 2XK1A 3OBFA 1T1CA 2JCHA 3UDFA 5DF8A 3G32A 3RXXA 2PT7A 3OPRA 1CK3A 3LI9A 3FKVA 3WS0A 4ETZA 2P9VB 1A0KA 1DJCA 5CECA 2WKIA 2PBYA 3V3SA 4BL2A 4FH4A 2WKPA 1S6RA 1XX2A 3H7WA 4E6XA 5JYPA 5JYOA 1KE3A 1FILA 3OCNA 1W63Q 2DMWA 3NY4A 5G4YA 1CI9A 4N1HA 4JKTA 2I9VA 5FI2A 2LB5A 4S2PA 4X1LA 2JBFA 4C75A 3LI8A 1ES5A 1G28A 1VEUB 4OVDA 4ZJ2A 2W3EA 3KSHA 1MWUA 5EVIC 1SHVA 4FH2A 3U4LP 1DJAA 2B95A 3A0VA 2EX9A 3H82B 3GDIA 4JF6A 3IH8A 3OPHA 2RL3A 2P7JA 4XT2B 1N9NA 3A3FA 1RGZA 2Y79A 3UE3A 4Z1WA 2B02A 5EUAA 4EW7A 2XROA 2HJEA 4P0MA 3HBRA 3PXPA 2Y2LA 3IHBA 3RJUA 4JXGA 5CHUA 4PPRA 1ES4A 2V2FF 4CLCA 3MZFA 2IWCA 1OJ5A 1OTEA 4KQQA 4WL9A 1FCOA 1YLTA 2KLIA 1KVMA 5E43A 1LL9A 4M3KA 3UPPA 3TG9A 2QMIA 1KGFA 5EVID 4BL3A 4RVAA 2G2WA 3HLWA 2ZOIA 4GS9A 1FIKA 3Q1FA 2Y2HA 2JN7A 4GD6A 3O5YA 1DY6A 1JTDA 2W3HA 4Y5FA 5EECA 2Y91A 5HL1A 1TDLA 1LL5A 3EQVA 4ZJ1A 4Z9QA 2V9AA 2ZQCA 3E4PA 1KGEA 1RP5A 5HDCA 3IXBA 4HBUA 3M6HA 5M18A 5AVEA 1PWCA 3OLOA 5EV0A 3W8KA 2D01A 5CGSA 2GZAA 5FQIA 4F3LB 1W8YA 4LGWA 1ZG4A 5A92A 2WKQA 1ONHA 2VKSA 1IELA 3CLOA 1IKGA 4K0WA 2MJ6A 4I5SA 3HLGA 4ME4A 3D72A 3WS2A 4HNBA 3SW1A 1I2WA 1W7FA 2WGIA 1XJ2A 2X02A 1W8QA 2HDRA 2HGVA 4I38A 3ISGA 3MXQA 2G2UA 1XKZA 3TE8A 4S2JA 4G3VA 3HJKA 2Y2PA 4EEUA 3UB9A 4UAAA 2PYPA 4GKUA 3LIEA 5FL3A 1K55C 2W0NA 2Y2QA 1GHPA 3C7VA 4MN7A 4Y0TA 3QHYA 3Q7VB 1T18A 2L4RA 5TGFA 2B18A 2DCFA 3GMWA 3C7UA 1HTZA 5HARA 1YSPA 1ALQA 3PR6A 3U2AA 5FDSA 5AQAA 1K56A 4PKYG 4MBKA 2A3UA 1TS6A 3E98A 1H8ZA 4IEDA 2P08A 1MC0A 3ZGAB 3CPTA 3WRTA 3NI9A 1O07A 4K08A 2V20A 4HHDA 2WYXA 2RCXA 5HDDA 4NG2A 3VP0A 3IXHA 3DTIA 1FCNA 4G3WA 5J7EA 3FYZA 3E4OA 2ZMVA 4OKPA 3TRCA 2WK0A 3NC8A 4HJ3A 2BTFP 2VJWA 5EFWA 1L3LA 1ODVA 4MN6A 3C30A 4KG2A 2W1TA 4DMZA 3CG5A 4XUZA 4MBFA 3ZG9B 2Z6CA 1L2SA 4MCWA 4Y15A 5HWVA 4OLGA 4E6WA 4XXRA 4WUJA 4OPQA 1WE4A 1G68A 5HX9A 2ZM8A 3UMDA 1KE4A 4QHCA 3V39A 1LI9A 2VGLS 2O0YA 2QWSA 1D06A 3GRJA 4RA7A 5J3WA 3N6IA 2X71A 3QP6A 2M7VA 5GLAA 1W5DA 1SKOB 2H28A 3BWLA 1TS7A 5FATA 3KYQA 1K54A 1X0OA 4PM6A 2XR0A 1N9BA 1I2SA 5KMWA 2HDQA 3W4PA 5DF7A 4WBGA 4FTXA 4KQRA 2J7VA 4KG6A 3LICA 3UMEA 3PBOA 4QD4A 4GCZA 5HD3A 3D4FA 3DTEA 4WZ4A 3RXWA 3IXDA 1YSQA 1M40A 1MZUA 3UE6A 5F68A 1BYWA 5FI7A 5A91A 4S2NC 3MXSA 3P98A 1KGGA 3M6BA 3HLDA 2EA9A 2OOLA 2VA0A 4UA7A 2W27A 3A0SA 3Q7ZA 3CMZA 3O3VA 1GHMA 2KDKA 5FDHA 3ZG8B 1GCEA 3F1NB 2GNXA 1MBLA 3DTMA 1LSWA 1DRMA 3ZG5A 3FPWA 4Q0JA 4S2IA 4HI4A 3LIBA 3WS4A 1JWPA 5DKLA 5L2FA 3G35A 1K57A 4R3BA 1YLWA 2ZOHA 5EM1A 2XH9A 5GLBA 4BD0A 2QPNA 2W3DA 2J3WA 4OLDA 4H6JA 3QP4A 3G4PA 4X56A 1HZOA 2WKHA 2PBDP 4IBXA 5TBMA 1H8YA 5KZHA 2HZ5A 1V9ZA 1MXOA 1H3QA 3GVBA 3VOYA 1VETA 4UEYA 4F94A 3NECA 4DKIA 4D60A 3MS6A 4GOGA 1XA1A 4IJGA 1L0EA 2NUTC 5J4EA 2VGJA 4NEED 5CHJA 3FKWA 1RGYA 1LL8A 1K38A 5AQBA 3BQAA 3E4QA 1Z6FA 4R3JA 2YKHA 2PR5A 4PM9A 1S4RA 3VFHA 2XQZA 4BMWA 4KZBA 4Y0OA 4R6LA 3BQ8A 4LV2A 1L0FA 3OZHA 4I3AA 4YWZA 3T1QB 4EXOA 4LCMA 5DTTA 1BUEA 3UDIA 4X68A 1H5XA 3BLSA 1P97A 4WMCA 3VOZA 1EI5A 3L7HA 2V1ZA 4WZ5A 2WZXA 4UA9A 1XGIA 3IS2B 3OC2A 4LPZA 3T1XA 1ESUA 3AGDA 4PHTA 1KOUA 5HPFA 3S22A 2EXBA 3UB5P 3V67A 3F1OA 3CJMA 2Q0OA 2NUPC 3QP5A 5FASA 4MEZA 2ZM2A 1YM1A 3MBZA 1ERMA 3ZG0A 4BBTA 1YPRA 4NXEA 3D9YA 2XDMA 4A5RA 1OTBA 2XSSA 1LSXA 4M4XA 4ARZA 4OQ0A 1J9MA 5K5BA 1GSXA 2C5WB 4DE1A 3VSLA 1BTLA 4HY8A 3UB6A 1STZA 2IWBA 5HAIA 3S7NA 2WGWB 3FPVA 4QWOA 2PYRA 2HP6A 4S2LA 3ZHHA 3T4TA 3DW0A 5L09A 2PD8A 2XD5A 3MSHA 5HWWA 4PAUA 5HAQA 2ZQDA 5HFOA 3OPLA 2Y2MA 1ZHHB 2XGNA 1YLPA 3HUMA 3BECA 4GN2A 3GQZA 1NY0A 3VP1A 1GSWA 1YLJA 2V1BA 4JBFA 4YFMA 2IWDA 4ETXA 3B3XA 4LCLA 5IT5A 4GJ4A 1PYYA 4OONA 3HLCA 1ZKJA 3GECA 2GJ3A 3KSGA 4GHIB 5F83A 3SOIA 5DFYA 1FR6A 3C2WA 2Y2JA 1PRQA 5U47A 2L0WA 5HZHA 2WZZA 1NZUA 4ID4A 4EBPA 5KSCA 3PBRA 3SZTA 3RTYA 3HUOA 3PAEA 1PZPA 3SH8A 4X53A 2J9PA 5FAQA 1I5QA 4DE0A 2ZC5B 4CLCE 3MZDA 3UB7A 5HPIA 5IHVA 1TVFA 1PW8A 3LUQA 3G2YA 5EVIA 3CUEC 1WYCA 3DTKA 4KZ6A 3MKFA 2EFXA 4QY6A 2QZ6A 5FSRA 2DRWA 4R3AA 2Q9NA 3DAVA 3QP2A 5F1GA 3B33A 4E3JA 1T1BA 4B93A 1L0DA 3K3DA 2VLGA 1QMFA 2JKTI 3IWQA 3T4LA 1S4SA 2ZL1B 2A2LA 1YLYA 3GR2A 3I7JA 1E3UD 3E2KA 3IF6B 1XXMA 2A24B 4L9EA 5CTMA 3GSGA 3IT9A 2K2NA 4JLFA 2VK3A 3WWXA 3F1PB 5CHMA 2VV8A 2V1AA 4I3JA 1G6AA 4LENA 5G18A 2ZBBA 2H5SA 4MDZA 2UWXA 1F98A 5MC7A 3R7WB 4B9OA 3UE0A 1KDSA 3KYZA 3C38A 2OSUA 1NYYA 4KZ5A 1BZAA 4U0TA 2VEAA 1T1AA 4DJ3A 3QNCA 4UQIM 4Q8IA 5L8MA 5F69A 3A3JA 4ZTKA 4HBTA 3T50A 5HW3A 5AQ7A 1YLZA 5F6AA 3BM6A 5IS1A 3W4OA 4IUKA 1K0KA 1NWZA 2E8IA 3ZCZA 4LRYC 1MKMA 4OP8A 1N4OA 2ZC7A 5M1AA 4O0PA 5L07A 4EBLA 1TD5A 1O7EA 2ZM0A 3LCEA 2EX6A 3N8RA 3UE1A 2WKEA 5AVFA 4KUOA 1DP9A 4H8RA 4QU3A 2VV7A 5E2FA 4JPMA 2VGLM 3FWLA 3S7PA 3G31A 2JKRI 5L10A 3H7WB 1TDGA 4DN0A 4GLQA 2HF6A 3AGFA 5FQ9A 3VE4A 1PWDA 1IYOA 3LR4A 1XGJA 2UV0E 1D7EA 2WKRA 3BLMA 2M1CA 4Y13A 4PMAA 2PR6A 3GV9A 3CI6A 3CHWP 5DVAA 5BOHA 3IQAA 5CERA 2ZQ8A 4KUKA 1WYBA 2GDNA 1YMSA 4UQIS 1E4DA 3T4OA 4B4ZA 5M19A 4ESPA 2JE5A 2W1RA 2Z2LB 2HP9A 2HP5A 3BRMA 2XRNA 3LY4A 5FEGA 5DF9A 4CLCB 4WLAA 1PIOA 3EEHA 4GZBA 4Y17A 3P7NA 4X6TA 1G6OA 4E3OA 2Y8HA 3OOVA 2FFYA 3O88A 5G4ZA 2EXAA 4R4RA 1HVBA 4MLLA 4GNUA 3HJIA 1YQSA 4MBHA 5TFQA 3EQUA 2VV6A 4GS9B 4HP9A 1BSGA 4JXWA 4X69A 4IHQA 4JGQA 4Y2FA 4EV4A 4QJGA 2PRFA 1UGUA 2VZWA 4DDYA 4KZ8A 4HJ6A 3ULFA 1PFLA 4KZ3A 3VSKA 1IYSA 3VMAA 4U3TA 4PM5A 4OQIA 3BY9A 2R78A 2PHYA 2INWA 3EGDC 4PKYA 3T4QA 1KE0A 3ZG7B 4OOLA 3DWKA 3EEAA 2XA7S 4Q0HA 2W3GA 3LR0A 3T4SA 2H0TA 1BLCA 1WA9A 4IVKA 4O7DA 3MFDA 1JNUA 2K7SA 2PDRA 4WYYA 4NKPA 2JC7A 2CC1A 5HD5A 1S67L 4P6BA 2VGKA 4I3IA 2EWVA 1P9RA 2P9VA 3N8SA 2YKFA 4WN5A 1GHIA 2W3FA 1K57C 2V0WA 1LT0A 1IKIA 1KDWA 3JYIA 4JGRA 3KSIA 5FEFA 3VP2A 5KSHA 4BD1A 4X25A 4WELA 4DE3A 5HL6A 4WEKA 5EVLA 3BFCA 3PHYA 4P6ZM 4S2NA 1V9YA 3O87A 1VEUA 4KENB 3GTCA 1DP6A 2PD7A 4L0LA 2J3TC 2OLVA 1XFNA 3MR0A 3SH7A 3H82A 3OCLA 5F1FA 3IH9A 1MWTA 1EROA 4IVIA 4XT2A 1FR1A 2H0YA 4JGOA 2CMNA 4C6YA 1DJBA 2AVXA 2XFSA 2G7UA 3E0YA 5AJGA 4JXVA 4EQIA 1TEMA 2A49A 3VP3A 1AWIA 2HJ9C 4LV3A 4YOFA 3BFEA 5GHXA 2HV1A 4L9FA 2OLUA 3PAGA 4LV1A 4WEJA 4IBRA 3IF6C 3CPTB 2Q9MA 2P74A 4CQHA 3ZYTA 3SS5A 1ZG6A 2ZC6B 1Y28A 2OWJA 2J3TD 3HLFA 1L0GA 5GHYA 5TR7A 4BENA 2H10A 5GLDA 2B5RA 1CEGA 3L9KA 2ZMAA 4E3LA 5GHZA 1F9IA 2KX6A 1RCJA 2QJ7A 4HJ4A 1ZTUA 4L9GA 2J8YA 2W1TB 3BJNA 4CJNA 1G5UA 3MFXA 5EOOA 3FV7A 1K25A 4R4SA 3PBNA 4P6ZS 1Z09A 2Z2MB 2HDSA 3EWKA 3IBRA 2XF3A 2XD1A 4JF5A 2OWHA 4UHUA 2Y2NA 3RFBA 5HAPA 4OOYA 3PBQA 4S2MA 1XA7A 3IXGA 2D02A 4AFIA 4F3LA 2Y2KA 4R70A 1PZOA 1UWNX 4GB7A 3WS5A 3Q82A 4O01A 1NLZA 5IU1A 3PBSA 1Q2QA 3BEBA 1CF0A 3C4OA 1SKFA 2FFFB 1DP8A 3S7QA 4KQOA 5TJJA 4GDNA 3UDXA 4S2KA 2PU2A 1ZC2A 2M7UA 4FUWA 5EOEA 1BLHA 2O9CA 3R4KA 5C5KA 3RH8B 4QB8A 2EWWA 3VV4A 4BJPA 3VP4A 1ERQA 1U60A 2XEPA 2PU4A 1NLYA 5CGWA 3Q81A 1NRFA 4RX2A 4KZ9A 3N7WA 3NHQA 3S7OA 4Y3IA 1IEMA 3OPPA 3G2ZA 3B42A 4UA6A 1VM1A 1BLPA 3EGXC 3QNBA 3Q07A 5I94A 1W79A 3D3OA 3ZNTA 1OT6A 3T4KA 3ZNYA 2EX8A 5F82A 3S1YA 3A0RA 3Q7VA 3V5MA 1ES2A 4X55A 4DE2A 3P09A 4ZJ3A 1XP4A 4YNRA 3C5AA 3VOLA 3IBJA 4RYEA 5GL9A 2JKGA 4K0XA 2FZ0A 1Y4OA 3BW6A 4II7A 2ZC4B 5CTNA 1HLUP 5E2GA 1PW1A 3K2NA 3NOUC 2V8FA 4H6JB 3UB8A 3HL9A 4CLCC 5FQJA 4LLOB 3N4IA 5E2HA 5TBMB 4FCFA 1MWRA 4LRXC 2Y2GA 1XJ3A 1FQGA 4KQDA 2XFTA 1VETB 2WADA 3C4PA 1OTIA 3G30A 4FD8A 4OH0A 3HLBA 4DDSA 4P87A 5DJUA 3A3DA 5AQ9A 5LBRA 1Q2PA 1XJ4A 1E3UA 3NIAA 4HH2A 5DFXA 1GSVA 2ZD8A 5CGXA 1JWZA 4OPZA 4Y7PA 5DJTA 4EETB 1JVJA 3CUEA 3JVUA 1H8MA 3MJQA 3UPOA 3IF5A 4DXBA 4CLCD 3K3CA 1NYMA 1QMEA 1BLSA 2O99A 3SS4A 2GX5A 3HLEA 3MQQA 3T1RA 3SS3A 3UO9A 4BWIA 1K4EA 4WF0A 2R9XA 4KZAA 3H9WA 1SZVA 2HPBA 1SKOA 2JHEA 3NDGA 2QJ5A 3WS1A 4NXGA 2ZMFA 4OPRA 2ZC3B 3M2JA 4FSFA 3F1OB 4NXFA 3KX0X 4EWFA 3DBAA 5DTSA 1LI0A 2BLSA 2J9OA 4I39A 1S1ZA 3QP1A 3G34A 1CEFA 1PWGA 3IX4A 1JTGA 4BLMA 1YKDA 5FA7A 4DXCA 4ARZB 3NOTC 2VX8A 4KG5A 1K6SA 4ZDXA 5FAPA 4OPYA 3CZDA 3LIAA 3QP8A 4DF6A 3IWOA 3BY8A 3F1NA 2V0UA 3KYEA 5DKKA 1OTAA 1E25A 1K4FA 2I72A 3NCKA 5EM0A 4B4XA 2OV5A 1OJGA 1CJFA 3LR3A 1AXBA 4N9LA 2O9BA 1LLBA 1YMXA 4GW9A 2BG1A 5D3OA 1S66L 1KVLA 1TF1A 4XUXA 3IX3A 1XPBA 3ZDJA 1PNEA 4D2OA 3EOIA 5A8BA 3T12B 3TOIA 3LO7A 4EBNA 4LFUA 1VB6A 2R9WA 1TS8A 4Q0IA 4OOMA 2PAVP 5HSQA 2WGVA 1K55A 2OAP1 1T19A 4E04A 5FQQA 3ICYA 2O9AA 3MZEA 3NDEA 1FSWA 2XA7M 4EUZA 1XJ6A 1D1JA 2LB9A 5EE8A 2QYBA 4QY5A 1MY8A 3ITAA 1JWVA 4N1XA 1IYQA 4JXSA 4EUVA 4K91A 3MKEA 1TS0A 1EW0A 1K56D 3NOPC 3ZVWA 4N9KA 5EVIB 2WAEA 3UNWA 1IYPA 4KZ4A 5HWTA 1GA9A 2ZJ9A 2ZQAA 4MN5A 3VFFA 4FOFA 3CAXA 3UN7A 4YINA 3ITBA 4HESA 2Z6DA 3TSGA 1IOUA 3NULA 1CQAA 4N92A 1N9LA 3IS2A 1C3BA 4X1MA 2J80A 3NJAA 1PI4A 1YAXA 4PM7A 3LR5A 3UPNA 4HOIA 4MMNA 1W63M 4LV0A 5J8XA 5CXWA 1K6RA 4PM8A 1F2KA 1K54C 4OQGA 1MWSA 3C8CA 2ZQ7A 3ZVTA 4EU0A 3LFVA 2WUQA 3TJZC 4HH3A 3FZCA 1YT4A 2JKFA 1NXYA 4E3NA 1ES3A 3V3RA 4B88A 3MF0A 3IWIA 3BFGA 4EQ1A 1ONGA 2WGWA 1J3WA 4E3KA 5F5YA 4GDBA 4IUHA 3MQ0A 3MQOA 3ZFZA 3BFDA 3A3IA 4WM9A 1ACFA 3LIDA 1SCWA 3T1SA 5GLCA 4EESA 2FH5A 1BT5A 3P01A 2WAFA 3M2KA 3FG8A 3VE3A 5A90A 5I5LA 2ZLYA 1MKIA 2IA2A 5E2EA 4NK3A 5CX7A 3IHAA 5A93A 1NZOA 3B47A 5CRFA 2XLNA 3PBTA 1LHYA 2OAQ1 2JKTM 2Y4AA 4GHIA 5CEBA 1BULA 4NETA 3UY6A 1ESIA 2ZQ9A 5EVEA 4OQHA 4MNRA 3A3EA 4P85A 3LGOA 4GD8A 3MMHA 4RX3A 1OPXA 4DJ2A 3PYPA 3W4QA 2BASA 3KSFA 3S4XA 4ZBEA 4ZAMA 4EERA 1S1YA 4BBVA 2Y2OA 5FQMA 2V8CA 3T4JA 5KIZA 1OMEA 2KOIA 1SDEA 3LEQA 4Y0UA 2E8JA 1M6KA 3HUNA 2EX2A 2HDUA 4R1GA 3LYXA 4R38A 3NBLA 4EEPA 3HVFA 4JF4A 1FOFA 1OT9A 2K31A 3BYDA 4HP4A 2Y2IA 2Y55A 3HCYA 1OTDA 4RQ9A 1F5MA 2QKPA 4E3MA 4G3KA 2L1MA 3TW8A 4R0QA 4WZ5C 1N9OA 4E3IA 3IX8A 1NRJA 1S0WA 2ZL1A 2DNSA 5CEDA 3G6OA 1H0MA 5DTKA 3ZQ5A 3BFFA 3MXRA 3IF6A 4LRZE 2Y59A 4O8GA 2A24A 3LIFA 3F1PA 5FQKA 2ACGA 1PI5A 1SDNA 2C6WB 2QHKA 1IFQA 1P0ZA 3V50A 1MPLA 1CI8A 1Y54A 3SH9A 4HEFA 3R7WA 1FCMA 3PTEA 4ZRRA 4BQMA 2X01A 2EFUA 2JKRM 3CWFA 1UWPX 4HIAA 5FAOA 3CITA 3LEZA 1HD8A 4WMCD 4C3QA 1VQQA 3JVVA 3KO6A 4S2OA 1LSVA 4CPKA 1NJ4A 4R23A 4U0XA 4DRTA 3W2ZA 2P04A 3N8LA 1VHMA 3DWZA 5EPHA 3WRZA 4QPRA 3JPUA 3HREA 1FSYA 4NXBA 4JGPA 1EWZA 4BBUA 5FI6A 5HDSA 4HQAA 4OP5A 3O86A 1P9WA 3E2LA 3AGEA 3LY3A 4KZ7A 1GA0A 3FC7A
chains in the Genus database with same CATH topology
1SKOA 2PBDP 1YPRA 3D9YA 5FEGA 2JKGA 5FEFA 2HZ5A 1G5UA 1D1JA 1FIKA 4X25A 1Y4OA 1VETA 1ACFA 1Z09A 3T1SA 1HLUP 2ZL1A 3NECA 1K0KA 4D60A 2V8FA 3MS6A 3DAVA 1A0KA 4QWOA 1VEUA 1SKOB 3MSHA 5FDSA 1FILA 4FTXA 2ACGA 1VETB 2PRFA 4X1LA 2ZL1B 1CF0A 3CPTA 1VEUB 1PFLA 5EV0A 3KYEA 1AWIA 4FUWA 3U4LP 5EVEA 3NULA 1CQAA 2B95A 2VK3A 3LGOA 5EM0A 4X1MA 3T1QB 1CJFA 2V8CA 1F2KA 3CPTB 3L7HA 3LEQA 2E8JA 1PRQA 2BTFP 3CHWP 3T1XA 2JKFA 1PNEA 3UB5P 3T1RA 3T12B 3L9KA 5EM1A 4ESPA 1J3WA 1SZVA 2PAVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKO A;  2PBD P;  1YPR A;  3D9Y A;  5FEG A;  2JKG A;  5FEF A;  2HZ5 A;  1G5U A;  1D1J A;  1FIK A;  4X25 A;  1Y4O A;  1VET A;  1ACF A;  1Z09 A;  3T1S A;  1HLU P;  2ZL1 A;  3NEC A;  1K0K A;  4D60 A;  2V8F A;  3MS6 A;  3DAV A;  1A0K A;  4QWO A;  1VEU A;  1SKO B;  3MSH A;  5FDS A;  1FIL A;  4FTX A;  2ACG A;  1VET B;  2PRF A;  4X1L A;  2ZL1 B;  1CF0 A;  3CPT A;  1VEU B;  1PFL A;  5EV0 A;  3KYE A;  1AWI A;  4FUW A;  3U4L P;  5EVE A;  3NUL A;  1CQA A;  2B95 A;  2VK3 A;  3LGO A;  5EM0 A;  4X1M A;  3T1Q B;  1CJF A;  2V8C A;  1F2K A;  3CPT B;  3L7H A;  3LEQ A;  2E8J A;  1PRQ A;  2BTF P;  3CHW P;  3T1X A;  2JKF A;  1PNE A;  3UB5 P;  3T1R A;  3T12 B;  3L9K A;  5EM1 A;  4ESP A;  1J3W A;  1SZV A;  2PAV P; 
#chains in the Genus database with same CATH topology
 1XFQ A;  2XK1 A;  3OBF A;  1T1C A;  2JCH A;  3UDF A;  5DF8 A;  3G32 A;  3RXX A;  2PT7 A;  3OPR A;  1CK3 A;  3LI9 A;  3FKV A;  3WS0 A;  4ETZ A;  2P9V B;  1A0K A;  1DJC A;  5CEC A;  2WKI A;  2PBY A;  3V3S A;  4BL2 A;  4FH4 A;  2WKP A;  1S6R A;  1XX2 A;  3H7W A;  4E6X A;  5JYP A;  5JYO A;  1KE3 A;  1FIL A;  3OCN A;  1W63 Q;  2DMW A;  3NY4 A;  5G4Y A;  1CI9 A;  4N1H A;  4JKT A;  2I9V A;  5FI2 A;  2LB5 A;  4S2P A;  4X1L A;  2JBF A;  4C75 A;  3LI8 A;  1ES5 A;  1G28 A;  1VEU B;  4OVD A;  4ZJ2 A;  2W3E A;  3KSH A;  1MWU A;  5EVI C;  1SHV A;  4FH2 A;  3U4L P;  1DJA A;  2B95 A;  3A0V A;  2EX9 A;  3H82 B;  3GDI A;  4JF6 A;  3IH8 A;  3OPH A;  2RL3 A;  2P7J A;  4XT2 B;  1N9N A;  3A3F A;  1RGZ A;  2Y79 A;  3UE3 A;  4Z1W A;  2B02 A;  5EUA A;  4EW7 A;  2XRO A;  2HJE A;  4P0M A;  3HBR A;  3PXP A;  2Y2L A;  3IHB A;  3RJU A;  4JXG A;  5CHU A;  4PPR A;  1ES4 A;  2V2F F;  4CLC A;  3MZF A;  2IWC A;  1OJ5 A;  1OTE A;  4KQQ A;  4WL9 A;  1FCO A;  1YLT A;  2KLI A;  1KVM A;  5E43 A;  1LL9 A;  4M3K A;  3UPP A;  3TG9 A;  2QMI A;  1KGF A;  5EVI D;  4BL3 A;  4RVA A;  2G2W A;  3HLW A;  2ZOI A;  4GS9 A;  1FIK A;  3Q1F A;  2Y2H A;  2JN7 A;  4GD6 A;  3O5Y A;  1DY6 A;  1JTD A;  2W3H A;  4Y5F A;  5EEC A;  2Y91 A;  5HL1 A;  1TDL A;  1LL5 A;  3EQV A;  4ZJ1 A;  4Z9Q A;  2V9A A;  2ZQC A;  3E4P A;  1KGE A;  1RP5 A;  5HDC A;  3IXB A;  4HBU A;  3M6H A;  5M18 A;  5AVE A;  1PWC A;  3OLO A;  5EV0 A;  3W8K A;  2D01 A;  5CGS A;  2GZA A;  5FQI A;  4F3L B;  1W8Y A;  4LGW A;  1ZG4 A;  5A92 A;  2WKQ A;  1ONH A;  2VKS A;  1IEL A;  3CLO A;  1IKG A;  4K0W A;  2MJ6 A;  4I5S A;  3HLG A;  4ME4 A;  3D72 A;  3WS2 A;  4HNB A;  3SW1 A;  1I2W A;  1W7F A;  2WGI A;  1XJ2 A;  2X02 A;  1W8Q A;  2HDR A;  2HGV A;  4I38 A;  3ISG A;  3MXQ A;  2G2U A;  1XKZ A;  3TE8 A;  4S2J A;  4G3V A;  3HJK A;  2Y2P A;  4EEU A;  3UB9 A;  4UAA A;  2PYP A;  4GKU A;  3LIE A;  5FL3 A;  1K55 C;  2W0N A;  2Y2Q A;  1GHP A;  3C7V A;  4MN7 A;  4Y0T A;  3QHY A;  3Q7V B;  1T18 A;  2L4R A;  5TGF A;  2B18 A;  2DCF A;  3GMW A;  3C7U A;  1HTZ A;  5HAR A;  1YSP A;  1ALQ A;  3PR6 A;  3U2A A;  5FDS A;  5AQA A;  1K56 A;  4PKY G;  4MBK A;  2A3U A;  1TS6 A;  3E98 A;  1H8Z A;  4IED A;  2P08 A;  1MC0 A;  3ZGA B;  3CPT A;  3WRT A;  3NI9 A;  1O07 A;  4K08 A;  2V20 A;  4HHD A;  2WYX A;  2RCX A;  5HDD A;  4NG2 A;  3VP0 A;  3IXH A;  3DTI A;  1FCN A;  4G3W A;  5J7E A;  3FYZ A;  3E4O A;  2ZMV A;  4OKP A;  3TRC A;  2WK0 A;  3NC8 A;  4HJ3 A;  2BTF P;  2VJW A;  5EFW A;  1L3L A;  1ODV A;  4MN6 A;  3C30 A;  4KG2 A;  2W1T A;  4DMZ A;  3CG5 A;  4XUZ A;  4MBF A;  3ZG9 B;  2Z6C A;  1L2S A;  4MCW A;  4Y15 A;  5HWV A;  4OLG A;  4E6W A;  4XXR A;  4WUJ A;  4OPQ A;  1WE4 A;  1G68 A;  5HX9 A;  2ZM8 A;  3UMD A;  1KE4 A;  4QHC A;  3V39 A;  1LI9 A;  2VGL S;  2O0Y A;  2QWS A;  1D06 A;  3GRJ A;  4RA7 A;  5J3W A;  3N6I A;  2X71 A;  3QP6 A;  2M7V A;  5GLA A;  1W5D A;  1SKO B;  2H28 A;  3BWL A;  1TS7 A;  5FAT A;  3KYQ A;  1K54 A;  1X0O A;  4PM6 A;  2XR0 A;  1N9B A;  1I2S A;  5KMW A;  2HDQ A;  3W4P A;  5DF7 A;  4WBG A;  4FTX A;  4KQR A;  2J7V A;  4KG6 A;  3LIC A;  3UME A;  3PBO A;  4QD4 A;  4GCZ A;  5HD3 A;  3D4F A;  3DTE A;  4WZ4 A;  3RXW A;  3IXD A;  1YSQ A;  1M40 A;  1MZU A;  3UE6 A;  5F68 A;  1BYW A;  5FI7 A;  5A91 A;  4S2N C;  3MXS A;  3P98 A;  1KGG A;  3M6B A;  3HLD A;  2EA9 A;  2OOL A;  2VA0 A;  4UA7 A;  2W27 A;  3A0S A;  3Q7Z A;  3CMZ A;  3O3V A;  1GHM A;  2KDK A;  5FDH A;  3ZG8 B;  1GCE A;  3F1N B;  2GNX A;  1MBL A;  3DTM A;  1LSW A;  1DRM A;  3ZG5 A;  3FPW A;  4Q0J A;  4S2I A;  4HI4 A;  3LIB A;  3WS4 A;  1JWP A;  5DKL A;  5L2F A;  3G35 A;  1K57 A;  4R3B A;  1YLW A;  2ZOH A;  5EM1 A;  2XH9 A;  5GLB A;  4BD0 A;  2QPN A;  2W3D A;  2J3W A;  4OLD A;  4H6J A;  3QP4 A;  3G4P A;  4X56 A;  1HZO A;  2WKH A;  2PBD P;  4IBX A;  5TBM A;  1H8Y A;  5KZH A;  2HZ5 A;  1V9Z A;  1MXO A;  1H3Q A;  3GVB A;  3VOY A;  1VET A;  4UEY A;  4F94 A;  3NEC A;  4DKI A;  4D60 A;  3MS6 A;  4GOG A;  1XA1 A;  4IJG A;  1L0E A;  2NUT C;  5J4E A;  2VGJ A;  4NEE D;  5CHJ A;  3FKW A;  1RGY A;  1LL8 A;  1K38 A;  5AQB A;  3BQA A;  3E4Q A;  1Z6F A;  4R3J A;  2YKH A;  2PR5 A;  4PM9 A;  1S4R A;  3VFH A;  2XQZ A;  4BMW A;  4KZB A;  4Y0O A;  4R6L A;  3BQ8 A;  4LV2 A;  1L0F A;  3OZH A;  4I3A A;  4YWZ A;  3T1Q B;  4EXO A;  4LCM A;  5DTT A;  1BUE A;  3UDI A;  4X68 A;  1H5X A;  3BLS A;  1P97 A;  4WMC A;  3VOZ A;  1EI5 A;  3L7H A;  2V1Z A;  4WZ5 A;  2WZX A;  4UA9 A;  1XGI A;  3IS2 B;  3OC2 A;  4LPZ A;  3T1X A;  1ESU A;  3AGD A;  4PHT A;  1KOU A;  5HPF A;  3S22 A;  2EXB A;  3UB5 P;  3V67 A;  3F1O A;  3CJM A;  2Q0O A;  2NUP C;  3QP5 A;  5FAS A;  4MEZ A;  2ZM2 A;  1YM1 A;  3MBZ A;  1ERM A;  3ZG0 A;  4BBT A;  1YPR A;  4NXE A;  3D9Y A;  2XDM A;  4A5R A;  1OTB A;  2XSS A;  1LSX A;  4M4X A;  4ARZ A;  4OQ0 A;  1J9M A;  5K5B A;  1GSX A;  2C5W B;  4DE1 A;  3VSL A;  1BTL A;  4HY8 A;  3UB6 A;  1STZ A;  2IWB A;  5HAI A;  3S7N A;  2WGW B;  3FPV A;  4QWO A;  2PYR A;  2HP6 A;  4S2L A;  3ZHH A;  3T4T A;  3DW0 A;  5L09 A;  2PD8 A;  2XD5 A;  3MSH A;  5HWW A;  4PAU A;  5HAQ A;  2ZQD A;  5HFO A;  3OPL A;  2Y2M A;  1ZHH B;  2XGN A;  1YLP A;  3HUM A;  3BEC A;  4GN2 A;  3GQZ A;  1NY0 A;  3VP1 A;  1GSW A;  1YLJ A;  2V1B A;  4JBF A;  4YFM A;  2IWD A;  4ETX A;  3B3X A;  4LCL A;  5IT5 A;  4GJ4 A;  1PYY A;  4OON A;  3HLC A;  1ZKJ A;  3GEC A;  2GJ3 A;  3KSG A;  4GHI B;  5F83 A;  3SOI A;  5DFY A;  1FR6 A;  3C2W A;  2Y2J A;  1PRQ A;  5U47 A;  2L0W A;  5HZH A;  2WZZ A;  1NZU A;  4ID4 A;  4EBP A;  5KSC A;  3PBR A;  3SZT A;  3RTY A;  3HUO A;  3PAE A;  1PZP A;  3SH8 A;  4X53 A;  2J9P A;  5FAQ A;  1I5Q A;  4DE0 A;  2ZC5 B;  4CLC E;  3MZD A;  3UB7 A;  5HPI A;  5IHV A;  1TVF A;  1PW8 A;  3LUQ A;  3G2Y A;  5EVI A;  3CUE C;  1WYC A;  3DTK A;  4KZ6 A;  3MKF A;  2EFX A;  4QY6 A;  2QZ6 A;  5FSR A;  2DRW A;  4R3A A;  2Q9N A;  3DAV A;  3QP2 A;  5F1G A;  3B33 A;  4E3J A;  1T1B A;  4B93 A;  1L0D A;  3K3D A;  2VLG A;  1QMF A;  2JKT I;  3IWQ A;  3T4L A;  1S4S A;  2ZL1 B;  2A2L A;  1YLY A;  3GR2 A;  3I7J A;  1E3U D;  3E2K A;  3IF6 B;  1XXM A;  2A24 B;  4L9E A;  5CTM A;  3GSG A;  3IT9 A;  2K2N A;  4JLF A;  2VK3 A;  3WWX A;  3F1P B;  5CHM A;  2VV8 A;  2V1A A;  4I3J A;  1G6A A;  4LEN A;  5G18 A;  2ZBB A;  2H5S A;  4MDZ A;  2UWX A;  1F98 A;  5MC7 A;  3R7W B;  4B9O A;  3UE0 A;  1KDS A;  3KYZ A;  3C38 A;  2OSU A;  1NYY A;  4KZ5 A;  1BZA A;  4U0T A;  2VEA A;  1T1A A;  4DJ3 A;  3QNC A;  4UQI M;  4Q8I A;  5L8M A;  5F69 A;  3A3J A;  4ZTK A;  4HBT A;  3T50 A;  5HW3 A;  5AQ7 A;  1YLZ A;  5F6A A;  3BM6 A;  5IS1 A;  3W4O A;  4IUK A;  1K0K A;  1NWZ A;  2E8I A;  3ZCZ A;  4LRY C;  1MKM A;  4OP8 A;  1N4O A;  2ZC7 A;  5M1A A;  4O0P A;  5L07 A;  4EBL A;  1TD5 A;  1O7E A;  2ZM0 A;  3LCE A;  2EX6 A;  3N8R A;  3UE1 A;  2WKE A;  5AVF A;  4KUO A;  1DP9 A;  4H8R A;  4QU3 A;  2VV7 A;  5E2F A;  4JPM A;  2VGL M;  3FWL A;  3S7P A;  3G31 A;  2JKR I;  5L10 A;  3H7W B;  1TDG A;  4DN0 A;  4GLQ A;  2HF6 A;  3AGF A;  5FQ9 A;  3VE4 A;  1PWD A;  1IYO A;  3LR4 A;  1XGJ A;  2UV0 E;  1D7E A;  2WKR A;  3BLM A;  2M1C A;  4Y13 A;  4PMA A;  2PR6 A;  3GV9 A;  3CI6 A;  3CHW P;  5DVA A;  5BOH A;  3IQA A;  5CER A;  2ZQ8 A;  4KUK A;  1WYB A;  2GDN A;  1YMS A;  4UQI S;  1E4D A;  3T4O A;  4B4Z A;  5M19 A;  4ESP A;  2JE5 A;  2W1R A;  2Z2L B;  2HP9 A;  2HP5 A;  3BRM A;  2XRN A;  3LY4 A;  5FEG A;  5DF9 A;  4CLC B;  4WLA A;  1PIO A;  3EEH A;  4GZB A;  4Y17 A;  3P7N A;  4X6T A;  1G6O A;  4E3O A;  2Y8H A;  3OOV A;  2FFY A;  3O88 A;  5G4Z A;  2EXA A;  4R4R A;  1HVB A;  4MLL A;  4GNU A;  3HJI A;  1YQS A;  4MBH A;  5TFQ A;  3EQU A;  2VV6 A;  4GS9 B;  4HP9 A;  1BSG A;  4JXW A;  4X69 A;  4IHQ A;  4JGQ A;  4Y2F A;  4EV4 A;  4QJG A;  2PRF A;  1UGU A;  2VZW A;  4DDY A;  4KZ8 A;  4HJ6 A;  3ULF A;  1PFL A;  4KZ3 A;  3VSK A;  1IYS A;  3VMA A;  4U3T A;  4PM5 A;  4OQI A;  3BY9 A;  2R78 A;  2PHY A;  2INW A;  3EGD C;  4PKY A;  3T4Q A;  1KE0 A;  3ZG7 B;  4OOL A;  3DWK A;  3EEA A;  2XA7 S;  4Q0H A;  2W3G A;  3LR0 A;  3T4S A;  2H0T A;  1BLC A;  1WA9 A;  4IVK A;  4O7D A;  3MFD A;  1JNU A;  2K7S A;  2PDR A;  4WYY A;  4NKP A;  2JC7 A;  2CC1 A;  5HD5 A;  1S67 L;  4P6B A;  2VGK A;  4I3I A;  2EWV A;  1P9R A;  2P9V A;  3N8S A;  2YKF A;  4WN5 A;  1GHI A;  2W3F A;  1K57 C;  2V0W A;  1LT0 A;  1IKI A;  1KDW A;  3JYI A;  4JGR A;  3KSI A;  5FEF A;  3VP2 A;  5KSH A;  4BD1 A;  4X25 A;  4WEL A;  4DE3 A;  5HL6 A;  4WEK A;  5EVL A;  3BFC A;  3PHY A;  4P6Z M;  4S2N A;  1V9Y A;  3O87 A;  1VEU A;  4KEN B;  3GTC A;  1DP6 A;  2PD7 A;  4L0L A;  2J3T C;  2OLV A;  1XFN A;  3MR0 A;  3SH7 A;  3H82 A;  3OCL A;  5F1F A;  3IH9 A;  1MWT A;  1ERO A;  4IVI A;  4XT2 A;  1FR1 A;  2H0Y A;  4JGO A;  2CMN A;  4C6Y A;  1DJB A;  2AVX A;  2XFS A;  2G7U A;  3E0Y A;  5AJG A;  4JXV A;  4EQI A;  1TEM A;  2A49 A;  3VP3 A;  1AWI A;  2HJ9 C;  4LV3 A;  4YOF A;  3BFE A;  5GHX A;  2HV1 A;  4L9F A;  2OLU A;  3PAG A;  4LV1 A;  4WEJ A;  4IBR A;  3IF6 C;  3CPT B;  2Q9M A;  2P74 A;  4CQH A;  3ZYT A;  3SS5 A;  1ZG6 A;  2ZC6 B;  1Y28 A;  2OWJ A;  2J3T D;  3HLF A;  1L0G A;  5GHY A;  5TR7 A;  4BEN A;  2H10 A;  5GLD A;  2B5R A;  1CEG A;  3L9K A;  2ZMA A;  4E3L A;  5GHZ A;  1F9I A;  2KX6 A;  1RCJ A;  2QJ7 A;  4HJ4 A;  1ZTU A;  4L9G A;  2J8Y A;  2W1T B;  3BJN A;  4CJN A;  1G5U A;  3MFX A;  5EOO A;  3FV7 A;  1K25 A;  4R4S A;  3PBN A;  4P6Z S;  1Z09 A;  2Z2M B;  2HDS A;  3EWK A;  3IBR A;  2XF3 A;  2XD1 A;  4JF5 A;  2OWH A;  4UHU A;  2Y2N A;  3RFB A;  5HAP A;  4OOY A;  3PBQ A;  4S2M A;  1XA7 A;  3IXG A;  2D02 A;  4AFI A;  4F3L A;  2Y2K A;  4R70 A;  1PZO A;  1UWN X;  4GB7 A;  3WS5 A;  3Q82 A;  4O01 A;  1NLZ A;  5IU1 A;  3PBS A;  1Q2Q A;  3BEB A;  1CF0 A;  3C4O A;  1SKF A;  2FFF B;  1DP8 A;  3S7Q A;  4KQO A;  5TJJ A;  4GDN A;  3UDX A;  4S2K A;  2PU2 A;  1ZC2 A;  2M7U A;  4FUW A;  5EOE A;  1BLH A;  2O9C A;  3R4K A;  5C5K A;  3RH8 B;  4QB8 A;  2EWW A;  3VV4 A;  4BJP A;  3VP4 A;  1ERQ A;  1U60 A;  2XEP A;  2PU4 A;  1NLY A;  5CGW A;  3Q81 A;  1NRF A;  4RX2 A;  4KZ9 A;  3N7W A;  3NHQ A;  3S7O A;  4Y3I A;  1IEM A;  3OPP A;  3G2Z A;  3B42 A;  4UA6 A;  1VM1 A;  1BLP A;  3EGX C;  3QNB A;  3Q07 A;  5I94 A;  1W79 A;  3D3O A;  3ZNT A;  1OT6 A;  3T4K A;  3ZNY A;  2EX8 A;  5F82 A;  3S1Y A;  3A0R A;  3Q7V A;  3V5M A;  1ES2 A;  4X55 A;  4DE2 A;  3P09 A;  4ZJ3 A;  1XP4 A;  4YNR A;  3C5A A;  3VOL A;  3IBJ A;  4RYE A;  5GL9 A;  2JKG A;  4K0X A;  2FZ0 A;  1Y4O A;  3BW6 A;  4II7 A;  2ZC4 B;  5CTN A;  1HLU P;  5E2G A;  1PW1 A;  3K2N A;  3NOU C;  2V8F A;  4H6J B;  3UB8 A;  3HL9 A;  4CLC C;  5FQJ A;  4LLO B;  3N4I A;  5E2H A;  5TBM B;  4FCF A;  1MWR A;  4LRX C;  2Y2G A;  1XJ3 A;  1FQG A;  4KQD A;  2XFT A;  1VET B;  2WAD A;  3C4P A;  1OTI A;  3G30 A;  4FD8 A;  4OH0 A;  3HLB A;  4DDS A;  4P87 A;  5DJU A;  3A3D A;  5AQ9 A;  5LBR A;  1Q2P A;  1XJ4 A;  1E3U A;  3NIA A;  4HH2 A;  5DFX A;  1GSV A;  2ZD8 A;  5CGX A;  1JWZ A;  4OPZ A;  4Y7P A;  5DJT A;  4EET B;  1JVJ A;  3CUE A;  3JVU A;  1H8M A;  3MJQ A;  3UPO A;  3IF5 A;  4DXB A;  4CLC D;  3K3C A;  1NYM A;  1QME A;  1BLS A;  2O99 A;  3SS4 A;  2GX5 A;  3HLE A;  3MQQ A;  3T1R A;  3SS3 A;  3UO9 A;  4BWI A;  1K4E A;  4WF0 A;  2R9X A;  4KZA A;  3H9W A;  1SZV A;  2HPB A;  1SKO A;  2JHE A;  3NDG A;  2QJ5 A;  3WS1 A;  4NXG A;  2ZMF A;  4OPR A;  2ZC3 B;  3M2J A;  4FSF A;  3F1O B;  4NXF A;  3KX0 X;  4EWF A;  3DBA A;  5DTS A;  1LI0 A;  2BLS A;  2J9O A;  4I39 A;  1S1Z A;  3QP1 A;  3G34 A;  1CEF A;  1PWG A;  3IX4 A;  1JTG A;  4BLM A;  1YKD A;  5FA7 A;  4DXC A;  4ARZ B;  3NOT C;  2VX8 A;  4KG5 A;  1K6S A;  4ZDX A;  5FAP A;  4OPY A;  3CZD A;  3LIA A;  3QP8 A;  4DF6 A;  3IWO A;  3BY8 A;  3F1N A;  2V0U A;  3KYE A;  5DKK A;  1OTA A;  1E25 A;  1K4F A;  2I72 A;  3NCK A;  5EM0 A;  4B4X A;  2OV5 A;  1OJG A;  1CJF A;  3LR3 A;  1AXB A;  4N9L A;  2O9B A;  1LLB A;  1YMX A;  4GW9 A;  2BG1 A;  5D3O A;  1S66 L;  1KVL A;  1TF1 A;  4XUX A;  3IX3 A;  1XPB A;  3ZDJ A;  1PNE A;  4D2O A;  3EOI A;  5A8B A;  3T12 B;  3TOI A;  3LO7 A;  4EBN A;  4LFU A;  1VB6 A;  2R9W A;  1TS8 A;  4Q0I A;  4OOM A;  2PAV P;  5HSQ A;  2WGV A;  1K55 A;  2OAP 1;  1T19 A;  4E04 A;  5FQQ A;  3ICY A;  2O9A A;  3MZE A;  3NDE A;  1FSW A;  2XA7 M;  4EUZ A;  1XJ6 A;  1D1J A;  2LB9 A;  5EE8 A;  2QYB A;  4QY5 A;  1MY8 A;  3ITA A;  1JWV A;  4N1X A;  1IYQ A;  4JXS A;  4EUV A;  4K91 A;  3MKE A;  1TS0 A;  1EW0 A;  1K56 D;  3NOP C;  3ZVW A;  4N9K A;  5EVI B;  2WAE A;  3UNW A;  1IYP A;  4KZ4 A;  5HWT A;  1GA9 A;  2ZJ9 A;  2ZQA A;  4MN5 A;  3VFF A;  4FOF A;  3CAX A;  3UN7 A;  4YIN A;  3ITB A;  4HES A;  2Z6D A;  3TSG A;  1IOU A;  3NUL A;  1CQA A;  4N92 A;  1N9L A;  3IS2 A;  1C3B A;  4X1M A;  2J80 A;  3NJA A;  1PI4 A;  1YAX A;  4PM7 A;  3LR5 A;  3UPN A;  4HOI A;  4MMN A;  1W63 M;  4LV0 A;  5J8X A;  5CXW A;  1K6R A;  4PM8 A;  1F2K A;  1K54 C;  4OQG A;  1MWS A;  3C8C A;  2ZQ7 A;  3ZVT A;  4EU0 A;  3LFV A;  2WUQ A;  3TJZ C;  4HH3 A;  3FZC A;  1YT4 A;  2JKF A;  1NXY A;  4E3N A;  1ES3 A;  3V3R A;  4B88 A;  3MF0 A;  3IWI A;  3BFG A;  4EQ1 A;  1ONG A;  2WGW A;  1J3W A;  4E3K A;  5F5Y A;  4GDB A;  4IUH A;  3MQ0 A;  3MQO A;  3ZFZ A;  3BFD A;  3A3I A;  4WM9 A;  1ACF A;  3LID A;  1SCW A;  3T1S A;  5GLC A;  4EES A;  2FH5 A;  1BT5 A;  3P01 A;  2WAF A;  3M2K A;  3FG8 A;  3VE3 A;  5A90 A;  5I5L A;  2ZLY A;  1MKI A;  2IA2 A;  5E2E A;  4NK3 A;  5CX7 A;  3IHA A;  5A93 A;  1NZO A;  3B47 A;  5CRF A;  2XLN A;  3PBT A;  1LHY A;  2OAQ 1;  2JKT M;  2Y4A A;  4GHI A;  5CEB A;  1BUL A;  4NET A;  3UY6 A;  1ESI A;  2ZQ9 A;  5EVE A;  4OQH A;  4MNR A;  3A3E A;  4P85 A;  3LGO A;  4GD8 A;  3MMH A;  4RX3 A;  1OPX A;  4DJ2 A;  3PYP A;  3W4Q A;  2BAS A;  3KSF A;  3S4X A;  4ZBE A;  4ZAM A;  4EER A;  1S1Y A;  4BBV A;  2Y2O A;  5FQM A;  2V8C A;  3T4J A;  5KIZ A;  1OME A;  2KOI A;  1SDE A;  3LEQ A;  4Y0U A;  2E8J A;  1M6K A;  3HUN A;  2EX2 A;  2HDU A;  4R1G A;  3LYX A;  4R38 A;  3NBL A;  4EEP A;  3HVF A;  4JF4 A;  1FOF A;  1OT9 A;  2K31 A;  3BYD A;  4HP4 A;  2Y2I A;  2Y55 A;  3HCY A;  1OTD A;  4RQ9 A;  1F5M A;  2QKP A;  4E3M A;  4G3K A;  2L1M A;  3TW8 A;  4R0Q A;  4WZ5 C;  1N9O A;  4E3I A;  3IX8 A;  1NRJ A;  1S0W A;  2ZL1 A;  2DNS A;  5CED A;  3G6O A;  1H0M A;  5DTK A;  3ZQ5 A;  3BFF A;  3MXR A;  3IF6 A;  4LRZ E;  2Y59 A;  4O8G A;  2A24 A;  3LIF A;  3F1P A;  5FQK A;  2ACG A;  1PI5 A;  1SDN A;  2C6W B;  2QHK A;  1IFQ A;  1P0Z A;  3V50 A;  1MPL A;  1CI8 A;  1Y54 A;  3SH9 A;  4HEF A;  3R7W A;  1FCM A;  3PTE A;  4ZRR A;  4BQM A;  2X01 A;  2EFU A;  2JKR M;  3CWF A;  1UWP X;  4HIA A;  5FAO A;  3CIT A;  3LEZ A;  1HD8 A;  4WMC D;  4C3Q A;  1VQQ A;  3JVV A;  3KO6 A;  4S2O A;  1LSV A;  4CPK A;  1NJ4 A;  4R23 A;  4U0X A;  4DRT A;  3W2Z A;  2P04 A;  3N8L A;  1VHM A;  3DWZ A;  5EPH A;  3WRZ A;  4QPR A;  3JPU A;  3HRE A;  1FSY A;  4NXB A;  4JGP A;  1EWZ A;  4BBU A;  5FI6 A;  5HDS A;  4HQA A;  4OP5 A;  3O86 A;  1P9W A;  3E2L A;  3AGE A;  3LY3 A;  4KZ7 A;  1GA0 A;  3FC7 A; 
#chains in the Genus database with same CATH homology
 1SKO A;  2PBD P;  1YPR A;  3D9Y A;  5FEG A;  2JKG A;  5FEF A;  2HZ5 A;  1G5U A;  1D1J A;  1FIK A;  4X25 A;  1Y4O A;  1VET A;  1ACF A;  1Z09 A;  3T1S A;  1HLU P;  2ZL1 A;  3NEC A;  1K0K A;  4D60 A;  2V8F A;  3MS6 A;  3DAV A;  1A0K A;  4QWO A;  1VEU A;  1SKO B;  3MSH A;  5FDS A;  1FIL A;  4FTX A;  2ACG A;  1VET B;  2PRF A;  4X1L A;  2ZL1 B;  1CF0 A;  3CPT A;  1VEU B;  1PFL A;  5EV0 A;  3KYE A;  1AWI A;  4FUW A;  3U4L P;  5EVE A;  3NUL A;  1CQA A;  2B95 A;  2VK3 A;  3LGO A;  5EM0 A;  4X1M A;  3T1Q B;  1CJF A;  2V8C A;  1F2K A;  3CPT B;  3L7H A;  3LEQ A;  2E8J A;  1PRQ A;  2BTF P;  3CHW P;  3T1X A;  2JKF A;  1PNE A;  3UB5 P;  3T1R A;  3T12 B;  3L9K A;  5EM1 A;  4ESP A;  1J3W A;  1SZV A;  2PAV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...