3F1NB

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1nB01
1TS7A 4HI4A 3FG8A 3F1NA 4M4XA 3KX0X 4YWZA 4L9EA 4LRXC 3A0SA 2QHKA 3H7WA 3UB9A 4EW7A 3UE6A 3NOTC 4I3IA 5AVEA 1OTBA 4RQ9A 3K3DA 1V9ZA 4I39A 3CWFA 4EQ1A 4GCZA 1ODVA 4HP4A 2PDRA 4EERA 4XT2B 5DKLA 2PYRA 3UB6A 3LYXA 4GW9A 2JN7A 1D7EA 1DRMA 4WF0A 2QWSA 2PR5A 3VE4A 3SW1A 1UWPX 4KUKA 2WKQA 4WLAA 2V1BA 2P7JA 5KIZA 4PKYA 4HJ4A 4LLOB 3LIFA 3IBRA 3HJKA 2D02A 4NXGA 3T50A 3UB7A 3GDIA 2INWA 4HIAA 2L0WA 3EEHA 4I5SA 5HD3A 2HV1A 3BY9A 1LSXA 2Z6DA 5J3WA 3F1OB 3LIDA 3LUQA 1LL8A 1OTIA 4L9FA 2ZOHA 1OJ5A 1LSVA 4LPZA 1XJ2A 3RH8B 5G4YA 3P7NA 4JGPA 5HDSA 3IS2B 3NOPC 4K08A 3C8CA 5G4ZA 3NJAA 1S1YA 4HH2A 3A0VA 4R6LA 2YKHA 3LI8A 1N9OA 1TS0A 2ZBBA 3MFXA 2QKPA 5IU1A 3UB8A 1S1ZA 4EEPA 5TBMB 4XT2A 5HD5A 4R70A 4MN6A 4NXBA 1T1CA 4WL9A 3H9WA 3F1PB 4WN5A 3HJIA 1OT9A 5J7EA 2CMNA 2V9AA 1KOUA 3ULFA 3ICYA 4HJ3A 4GS9B 5DJUA 2OWJA 2L1MA 3RTYA 2QJ5A 3GECA 2Z6CA 2PD7A 4KUOA 4H6JA 3LIEA 1XJ3A 3F1NB 1UGUA 1X0OA 1DP9A 2OOLA 5HSQA 5EFWA 4B9OA 2OWHA 1VB6A 5J4EA 1XJ4A 5F68A 5I5LA 2R78A 4NXEA 4BBUA 1TS8A 3UMEA 1OTDA 2K7SA 1OT6A 2BASA 3F1OA 3B33A 3LIBA 1S67L 2V0UA 3C2WA 3CLOA 3BWLA 1NWZA 4GHIA 2KX6A 4LRYC 2J80A 1S4SA 1S4RA 2JHEA 5AVFA 1MZUA 3NOUC 4I3AA 1XJ6A 2WKRA 1JNUA 1GSVA 3MQQA 4NXFA 1Y28A 3MR0A 2PYPA 4HNBA 3E4QA 1DP8A 4LRZE 1P0ZA 2GJ3A 2V1AA 5TBMA 1OTAA 2A24B 4HJ6A 1F98A 2VV8A 2EA9A 1D06A 4JGRA 1LSWA 2WKPA 3PHYA 2PHYA 5A8BA 5HWWA 2H28A 5F6AA 4JGQA 3F1PA 2YKFA 2VEAA 4EETB 2ZOIA 1OJGA 3EWKA 3NHQA 3H82B 1T18A 1XFNA 4BBVA 4F3LB 4DJ2A 2VV6A 4EXOA 4KQDA 3A0RA 2L4RA 2VV7A 4JGOA 3G6OA 1TS6A 2D01A 3FC7A 4R38A 3ZQ5A 3LI9A 4HP9A 2QJ7A 5F69A 5HDDA 1GSXA 4I3JA 3PYPA 2W0NA 3H7WB 3VOLA 4HHDA 1GSWA 4L9GA 2PD8A 1T1BA 5HWVA 4MN5A 1OTEA 5HZHA 1UWNX 4H6JB 5HDCA 3LICA 4BBTA 2M1CA 3D72A 1F9IA 4WUJA 3MQOA 3IS2A 2A24A 4PKYG 5IS1A 3E4OA 4HOIA 3E4PA 4EESA 2V0WA 2I9VA 1P97A 2W27A 1BYWA 1WA9A 3LIAA 2VLGA 4DJ3A 3MJQA 5DKKA 3UMDA 5F5YA 1S66L 2PR6A 3K3CA 3BY8A 3VE3A 5HWTA 3MXQA 4R3AA 3H82A 4E04A 4EEUA 1V9YA 4GHIB 2KDKA 5DJTA 4HH3A 1G28A 4F3LA 4I38A 1T1AA 1N9LA 1EW0A 2B02A 1N9NA 4HQAA 1T19A 1XFQA 3CAXA 4GS9A 1DP6A 1LT0A 4HY8A 3OLOA
chains in the Genus database with same CATH superfamily
1TS7A 1M6KA 5FDHA 3ZVTA 4RX2A 3FG8A 1RGYA 1K0KA 1K38A 3OCLA 3UNWA 4XUXA 4L9EA 3GTCA 2PU2A 4QHCA 2QHKA 3CG5A 1KE4A 2W3GA 2XFTA 3NOTC 4FTXA 5AVEA 1OTBA 2PBDP 3E0YA 2Y91A 4I39A 3EGDC 3CI6A 3CWFA 2O9CA 3AGEA 1PZPA 3V50A 4BL2A 1ODVA 4HP4A 4UA6A 2PYRA 3LYXA 4Y2FA 4OOYA 4GW9A 5DTSA 4ZDXA 1H0MA 4LV3A 5DF8A 3MZFA 1CF0A 1IKGA 3MXRA 2XA7S 3C7UA 1DRMA 2OAQ1 4E3KA 4WF0A 5F1GA 1KGEA 3S4XA 1TEMA 1XX2A 2HJ9C 2P74A 5CGSA 3QP1A 4WLAA 1S0WA 2XR0A 1H5XA 3WS4A 5CHJA 1I5QA 1LI0A 3VOZA 1BULA 3HREA 5EVIA 4AFIA 3E2LA 1O7EA 2INWA 1IFQA 4WBGA 2L0WA 3EEHA 4BMWA 4E6WA 1OMEA 1LSXA 1BTLA 3VFHA 3NECA 1ERQA 1L3LA 3DAVA 4EUZA 3F1OB 1ES3A 3DW0A 1YLPA 2O9BA 4GDBA 3O3VA 1OTIA 5LBRA 3M6BA 4BD1A 3HBRA 3VFFA 1OJ5A 4D60A 4LPZA 1XJ2A 1RP5A 3HLDA 5G4YA 3M6HA 4G3KA 3L7HA 2HF6A 3NOPC 5FAPA 3C8CA 5FQMA 3NJAA 4MCWA 5FDSA 4HH2A 4R6LA 5A90A 4K0XA 3LO7A 3VP2A 3T4TA 2ZBBA 4UEYA 3ZNYA 5CGXA 5TBMB 1GHIA 3UO9A 1MY8A 1JTDA 5EVLA 4WL9A 3MQ0A 4WN5A 2JC7A 3HJIA 5J7EA 2CMNA 1PYYA 3ZG0A 4X68A 5DJUA 2QJ5A 3T1XA 1D1JA 5AQBA 5CHUA 2UV0E 3HLBA 4HESA 4BQMA 2OOLA 1G6OA 1S6RA 4UQIM 5J4EA 4QWOA 3JPUA 4OP5A 3WS5A 4KENB 2R78A 3NDEA 5TJJA 3IWIA 5DVAA 2XD1A 3UMEA 3IBJA 2Y2NA 1OTDA 3PBRA 1EROA 1OT6A 3F1OA 3LIBA 4E3MA 3QNBA 1FSYA 2ZC5B 2V0UA 2A3UA 1E3UD 3SS3A 3EOIA 4C3QA 5JYOA 3ZFZA 2KX6A 3BFGA 4LRYC 3ZDJA 1S4SA 4MLLA 4Y0TA 5AVFA 1K54C 4I3AA 3GMWA 3G2ZA 1NRJA 3M2KA 1IOUA 2M7UA 5C5KA 3HL9A 1GSVA 4G3WA 5EOOA 3MBZA 1HLUP 1CEFA 1EI5A 4FSFA 5EECA 3E4QA 1DP8A 5FAQA 2JKRI 4LRZE 3C5AA 2JKRM 1ACFA 5TBMA 1NXYA 1ALQA 1F98A 5DF9A 2FZ0A 2EWVA 3NY4A 2EA9A 1D06A 4OLGA 4E6XA 2H0TA 3W2ZA 3OOVA 2J3TC 1BZAA 1J9MA 1LI9A 1IYSA 5A8BA 5DTKA 2RCXA 1G6AA 5FL3A 3SH7A 1PRQA 3FWLA 2VEAA 4R1GA 2ZQ7A 2WKIA 5TFQA 1K4FA 4Q0HA 4KZ8A 3UDXA 4QJGA 3NHQA 3H82B 3UE3A 1XFNA 1Q2QA 3HLFA 3UE0A 3P98A 4YFMA 3E98A 3HUOA 2Q0OA 5IHVA 1TVFA 1IYOA 2D01A 4R38A 3ZQ5A 3BFDA 1BT5A 4E3OA 3A3JA 5CGWA 3LI9A 3T12B 5HARA 2ZC6B 4EV4A 5F69A 3DBAA 1GSXA 3BFFA 4GKUA 4R3JA 3W4OA 1MPLA 4Q8IA 4JKTA 1DJAA 2HGVA 3CMZA 3KSGA 3ZG9B 4S2MA 3VP4A 3ZG8B 4L9GA 3A3IA 2PD8A 4DXCA 2JBFA 2Y2HA 3AGDA 5K5BA 1T1BA 3CHWP 1Y54A 2ZQAA 3PBTA 1ZG4A 4PM5A 5L2FA 4O01A 4WELA 2CC1A 1PNEA 4BBTA 3KO6A 2M1CA 3A3EA 2HDRA 4II7A 1KE3A 4OONA 3T1RA 1PI5A 4RVAA 4U0XA 1SZVA 1E4DA 1XP4A 2P08A 2WZZA 4RX3A 1CI8A 4PKYG 1GHMA 2WGVA 2WAFA 3TJZC 4PHTA 1VQQA 3GR2A 1E3UA 3T4KA 2O0YA 3IXDA 3S7NA 5A92A 2W1TB 3GQZA 4QU3A 5HW3A 5GHYA 1PI4A 5FEFA 3FKVA 3IQAA 3K3CA 5JYPA 3VE3A 2WUQA 3MXQA 1K4EA 1NLYA 3H82A 5CHMA 3PBQA 4WZ5C 4GHIB 3UPPA 1NZUA 4QD4A 2C6WB 1T1AA 1VM1A 1PIOA 2W3DA 4EWFA 2XRNA 5DFYA 1KVMA 1N9NA 1NY0A 1ZG6A 4FUWA 3CAXA 2ZJ9A 4LV1A 1DP6A 1LT0A 3TE8A 1K6RA 4JF4A 1SKOB 2Y79A 1NLZA 2PRFA 4YINA 4MEZA 4YWZA 4Z1WA 1L0DA 4LRXC 3A0SA 3RFBA 3IWQA 4R23A 3UB9A 1YLYA 4IVKA 3UE6A 4YNRA 1V9ZA 5FQQA 5EVEA 4EQ1A 1YLJA 1IEMA 2BLSA 4GCZA 3HLWA 3VSLA 1QMFA 2PDRA 3UY6A 4XT2B 3D3OA 2Q9NA 4A5RA 1BLPA 1W63M 3IF6B 3MKFA 2JN7A 3K2NA 5EVID 2H5SA 3MS6A 2PR5A 2ZMAA 2WKQA 2V1BA 3IXBA 3QP8A 4DE3A 3LIFA 3IBRA 3IF6C 3HJKA 5EPHA 1YMXA 4OQGA 2J3WA 4NXGA 1ESUA 4C75A 2VZWA 5GHXA 2W1TA 3GDIA 1XA7A 4E3LA 3DTKA 4HIAA 4F94A 4KZAA 5E2GA 4IVIA 4L0LA 3VP0A 5DFXA 1U60A 3BY9A 2QZ6A 4NG2A 4E3NA 4IJGA 4JXWA 4EUVA 2JKTM 1PZOA 3G31A 4Z9QA 2EX6A 4NKPA 3ZCZA 2G2UA 1W8YA 1L0FA 3AGFA 4L9FA 2WK0A 5F83A 1CI9A 1FILA 4OQHA 2Y2QA 3TSGA 5L09A 3G32A 3IHBA 4N92A 3RH8B 2VKSA 1SKOA 1VETB 3P7NA 3IS2B 4PMAA 4G3VA 1JWVA 4K08A 1SDEA 3OPPA 3T4QA 4B93A 4GD6A 4DN0A 2WZXA 4BD0A 4NK3A 4X53A 2YKHA 1KGFA 1I2SA 2EXBA 4D2OA 2XFSA 5IU1A 3UB8A 4FOFA 4EEPA 1K25A 1LLBA 1ESIA 3BFEA 3SS4A 4XT2A 3O87A 4LV0A 5HD5A 4E3JA 2XEPA 4R70A 3G4PA 4NETA 5FI6A 4Q0IA 3WRZA 3NDGA 1XA1A 1ONGA 3DTEA 4N9KA 3P01A 4DE2A 3G2YA 2OWJA 1XGIA 2L1MA 2WADA 3GSGA 2Y2KA 3GECA 2Z6CA 2PD7A 4H6JA 4JBFA 4CJNA 3LIEA 3HUNA 5M1AA 4DDSA 4UHUA 3F1NB 2IWCA 1X0OA 4GLQA 1MKMA 1DP9A 2JCHA 1YLZA 3PR6A 1FOFA 2OWHA 5EM0A 1VB6A 3U2AA 1XJ4A 5F68A 5I5LA 2V2FF 4BL3A 1MWSA 3QP2A 2Y2IA 3B33A 2XROA 3N4IA 2H10A 5EM1A 1LL5A 2HP5A 3KSHA 4GDNA 5GLBA 5HAQA 3PAGA 5U47A 3CLOA 1NWZA 4O7DA 1VETA 1C3BA 4EQIA 1S4RA 1MZUA 2Y2PA 2KLIA 3QNCA 3PBNA 2JKGA 4OLDA 2JE5A 1XJ6A 4Y17A 4CLCB 3B3XA 5CXWA 1Y28A 2R9XA 1RGZA 3ITBA 1H8ZA 1JVJA 1NZOA 1HD8A 4IHQA 1P0ZA 2GJ3A 3MMHA 5F82A 4CLCC 4FH4A 3B47A 4JGRA 1LSWA 5HL6A 2W1RA 1DY6A 3NI9A 5F6AA 4KZ7A 4EBLA 4R0QA 2YKFA 3C7VA 5TR7A 2ZOIA 1OJGA 3Q1FA 2VK3A 4MN7A 4ARZB 2ZM8A 2UWXA 4F3LB 3BJNA 4DJ2A 3NULA 3A0RA 2VV7A 1L0GA 5CECA 1H3QA 2OAP1 2ZM2A 4KQRA 3RXWA 4KG6A 3EEAA 3C38A 4LCMA 4ETZA 5E2HA 4U3TA 4Y0UA 4FCFA 3CITA 4YOFA 4GB7A 5AQ9A 1EWZA 2ZC7A 4I3JA 2HP9A 5HAIA 2W0NA 4OPRA 4NEED 4OH0A 3VOLA 2J3TD 5GHZA 4M3KA 1GSWA 5FAOA 3S1YA 4JF6A 2Y55A 3V5MA 4IEDA 2P9VB 2GX5A 5E2EA 5HWVA 3BYDA 3MZDA 4MN5A 4CLCA 1WYCA 1Y4OA 2W3HA 4Y3IA 4OVDA 4O8GA 2Y2OA 3UDIA 5HPIA 2H0YA 1F9IA 3MQOA 4BENA 4X1MA 1J3WA 4ESPA 1P9WA 1GCEA 2PU4A 2LB5A 4GNUA 1TF1A 3R7WB 3UE1A 3IT9A 1CJFA 2VA0A 2Z2LB 2V0WA 4OOMA 2I9VA 1K56A 4HBTA 2W27A 1BYWA 3JVUA 1PWDA 3UMDA 3DWKA 3OCNA 1N9BA 4MNRA 2PR6A 4S2NC 2GNXA 5HWTA 1NRFA 2ZC4B 3ZVWA 3T1QB 4Y7PA 4ARZA 3ZGAB 1W63Q 1G28A 4F3LA 5KSHA 1YQSA 4Y0OA 4DE1A 2B02A 1Z09A 3G35A 2ZC3B 4E3IA 1Q2PA 1PFLA 2O99A 4EBPA 3OLOA 4HI4A 2ZM0A 4DF6A 4R3BA 4M4XA 1KVLA 1BUEA 2Q9MA 4BLMA 3BEBA 2OSUA 3T4JA 3T4OA 2A2LA 3HLEA 5E43A 3UPOA 4R4RA 4S2IA 4RQ9A 3K3DA 2DRWA 2VGKA 3R4KA 1K54A 3N8RA 5F1FA 1DJCA 3CPTB 2DMWA 3U4LP 4RA7A 5FQJA 2XDMA 2HZ5A 5KZHA 4ZBEA 3C4PA 4GN2A 4P85A 2ZQCA 4QY5A 1YLWA 1N4OA 2G2WA 1XXMA 3Q81A 3SZTA 1YPRA 2AVXA 4HBUA 3R7WA 3VE4A 1UWPX 4KUKA 2ZMVA 4PKYA 1W7FA 4LLOB 4UQIS 3T50A 1YM1A 3UB7A 5BOHA 3WS0A 4P6ZS 1TD5A 1HVBA 2Z2MB 1ES5A 4UAAA 4S2JA 4N1XA 3W8KA 2VGLM 4DRTA 3BQ8A 4OPYA 2WGWB 1VEUB 2P04A 3Q82A 3A3FA 3C30A 4DDYA 4I5SA 2XGNA 3TOIA 2J8YA 5HD3A 2HV1A 3FPVA 2Z6DA 3JVVA 5J3WA 4MBFA 4DMZA 4ME4A 1KDSA 3FKWA 4Y5FA 3LUQA 1LL8A 1FIKA 3N8SA 3VP1A 3CZDA 2ZOHA 4KZ9A 1M40A 1LSVA 1XGJA 4DE0A 5CEDA 4KG2A 2ZL1B 1TDGA 1NYMA 3KSFA 2FFYA 5HDSA 1K57C 5G4ZA 3TG9A 3OPLA 5CTMA 3MKEA 1S1YA 2EXAA 4IUKA 1CQAA 2EFXA 3GVBA 4FH2A 1N9OA 3CJMA 4LFUA 1TS0A 2X01A 4MMNA 3MFXA 2QKPA 4PAUA 1S1ZA 5HX9A 4GZBA 3CPTA 3N6IA 1YT4A 4DXBA 4MN6A 5GL9A 5KMWA 1MBLA 4ZJ1A 2OLUA 1G5UA 4P6BA 3OBFA 1ZC2A 4ZJ2A 1T1CA 5EUAA 3F1PB 1OT9A 4JXVA 2V9AA 1KOUA 1HTZA 4GS9B 3BECA 4N1HA 1ZTUA 2XA7M 1YLTA 4IBXA 4KUOA 1XKZA 4O0PA 1MWUA 3VV4A 4OQ0A 5HL1A 3QP4A 3ZG5A 5HSQA 4B9OA 3QP6A 4WMCA 1MXOA 1P9RA 4WZ5A 3DTMA 4WYYA 5FI2A 2K7SA 2BASA 3RXXA 1W79A 3LY4A 2QPNA 3BM6A 1S67L 5FQKA 3PBSA 3WS1A 2ACGA 2W3EA 3BWLA 2ZL1A 4GHIA 4WEJA 5FQIA 1FR1A 3IHAA 3W4PA 2J80A 2HP6A 1PW1A 2ZLYA 3BQAA 1DJBA 2B18A 4XXRA 1JNUA 4GJ4A 3MQQA 4NXFA 3V3RA 1ES2A 3GV9A 5GLAA 2WAEA 3OC2A 5EE8A 2PYPA 4HNBA 3LEQA 4B88A 2V8CA 2V1AA 3ZNTA 1OTAA 2A24B 3L9KA 2E8IA 4HJ6A 4K0WA 4X25A 3V39A 1MWTA 4N9LA 2VV8A 3BLMA 4BWIA 4KZ5A 2RL3A 3CUEC 4JF5A 3PHYA 1HZOA 2FH5A 2XLNA 2XH9A 1LHYA 2H28A 4ZRRA 5EVIC 4JGQA 1L0EA 1O07A 1IKIA 1W8QA 3F1PA 1YMSA 1H8YA 3HLCA 3LCEA 3EQVA 1MWRA 3QHYA 3LY3A 1T18A 3IF6A 2OLVA 4U0TA 5FA7A 4BBVA 3SH9A 3Q7VB 1JWZA 2NUTC 4EXOA 4P87A 1IYQA 2HDQA 5L10A 4JGOA 3G6OA 3FC7A 1FCMA 4KZ6A 4X69A 1ZHHB 2WGIA 1GA0A 4K91A 1KDWA 1ONHA 2QJ7A 2B5RA 1BLHA 4QPRA 3LFVA 5HDDA 1KE0A 2HPBA 4CLCD 2WYXA 5FEGA 3PYPA 1SKFA 3O86A 3H7WB 3VP3A 4HHDA 5CX7A 3NCKA 1F5MA 1AWIA 1PWGA 4PM6A 2WKEA 4IUHA 2K2NA 4X6TA 2V8FA 3MSHA 2Y4AA 5EOEA 5HZHA 5FSRA 4S2OA 3CUEA 5HDCA 2X71A 1K56D 3LICA 5CERA 3NBLA 2IA2A 3D4FA 4WUJA 3IS2A 3DWZA 2A24A 3SOIA 5CTNA 3KSIA 4OOLA 5AJGA 3G30A 5IS1A 2XD5A 5EV0A 4HOIA 1Z6FA 1NJ4A 1GA9A 4S2PA 4EESA 1P97A 1WA9A 2QMIA 4DJ3A 5L07A 5DKKA 1S66L 3WRTA 1FR6A 3BY8A 2GDNA 4KG5A 3WWXA 4E04A 3C4OA 4EEUA 4CQHA 3KYZA 4HH3A 4I38A 3Q7VA 2DNSA 1N9LA 5TGFA 3SH8A 1SCWA 3V3SA 1XFQA 2DCFA 5FASA 1IELA 5DF7A 3ISGA 4WZ4A 2LB9A 4EU0A 3F1NA 3N8LA 3OPRA 4KZBA 3UB5P 1IYPA 3KX0X 1RCJA 1SHVA 1FCOA 3OZHA 4Y13A 1AXBA 3H7WA 4EW7A 4I3IA 3IF5A 2E8JA 3MZEA 3T4SA 2EX8A 3N7WA 4Q0JA 2V20A 2VX8A 4ZTKA 4EERA 4ZAMA 5DKLA 3UB6A 3UPNA 3S7PA 2QYBA 2Y2GA 3VOYA 1D7EA 4MDZA 4LV2A 2XSSA 3O5YA 5D3OA 4ID4A 2IWDA 3IX3A 5FI7A 2QWSA 1W5DA 4PM8A 3SW1A 5J8XA 1L2SA 2P7JA 2WKHA 5KIZA 4P6ZM 4HJ4A 1K55C 2D02A 4WM9A 4JXSA 2G7UA 3HVFA 1QMEA 3LEZA 2HDUA 4X56A 4ZJ3A 4X55A 4FD8A 5HPFA 4UA9A 2Y59A 5M18A 2EFUA 3EGXC 1VHMA 2Y2MA 4JLFA 1OPXA 1K6SA 2K31A 3LIDA 1BSGA 4LGWA 1CEGA 3IH9A 4OP8A 3TRCA 3GRJA 2I72A 4GD8A 3ZHHA 3BW6A 3LR5A 3FYZA 3HLGA 1I2WA 5HAPA 4JGPA 2MJ6A 1FSWA 4OQIA 5FATA 4Y15A 3A0VA 5GLDA 3Q7ZA 2ZQDA 1BLSA 3LI8A 1FCNA 4XUZA 4S2LA 3PBOA 2GZAA 1WYBA 2VGJA 4CLCE 2PT7A 1CK3A 3JYIA 5DTTA 3ZG7B 3VMAA 3G34A 4KQQA 5IT5A 4NXBA 1K55A 3MFDA 2JKFA 4IBRA 2C5WB 3BLSA 2J9PA 1JTGA 3NIAA 5CRFA 2P9VA 3H9WA 3IX8A 4WMCD 2BG1A 3ULFA 3ICYA 4HJ3A 4JPMA 5KSCA 2EX9A 4ETXA 1LL9A 3IX4A 3RTYA 3FZCA 3A3DA 4LCLA 2PAVP 3QP5A 1XJ3A 1MC0A 4MBHA 3S22A 3KYQA 1UGUA 4S2KA 4B4ZA 3S7QA 3W4QA 5EFWA 3HCYA 4QY6A 1XPBA 4S2NA 1E25A 3IXGA 1JWPA 2J7VA 3BRMA 3EQUA 4NXEA 4BBUA 1TS8A 3MXSA 4OPQA 4R4SA 3E2KA 1NYYA 3S7OA 2XF3A 5MC7A 3LR3A 2FFFB 3C2WA 4EBNA 2EWWA 1MKIA 2J9OA 1BLCA 2R9WA 2JHEA 4H8RA 3T4LA 3NOUC 2WKRA 3OPHA 3LR4A 3LGOA 4QB8A 3BFCA 4GOGA 3MR0A 1A0KA 3I7JA 1WE4A 2VJWA 5HFOA 1TDLA 4OKPA 5A93A 1H8MA 2V1ZA 3IH8A 1G68A 2Y8HA 4UA7A 2ZMFA 1PWCA 2NUPC 2WKPA 4KZ3A 5GLCA 2XQZA 1ES4A 2PHYA 3DTIA 5HWWA 4MBKA 4BJPA 5I94A 4EETB 3EWKA 5CEBA 3SS5A 3RJUA 2EX2A 3T1SA 3D9YA 2A49A 2VV6A 4KQDA 5AQAA 2L4RA 1TS6A 3LR0A 2ZQ9A 2ZQ8A 3ITAA 3ZYTA 5AQ7A 4HP9A 3PXPA 4HEFA 4PPRA 1ERMA 3V67A 3WS2A 2WGWA 1VEUA 3Q07A 4B4XA 1YSQA 3M2JA 2W3FA 4CPKA 4LENA 3NC8A 4OPZA 3UN7A 1K57A 1OTEA 4P0MA 2PBYA 3KYEA 4KZ4A 3PTEA 1UWNX 4H6JB 2O9AA 2Y2JA 4KQOA 5A91A 3D72A 1STZA 3PAEA 2Y2LA 2ZD8A 2B95A 3VSKA 3IXHA 4X1LA 2HDSA 2XK1A 1SDNA 3E4OA 1GHPA 3E4PA 2M7VA 2VGLS 3TW8A 5E2FA 2JKTI 5L8MA 2KOIA 3LIAA 4WEKA 2VLGA 3IWOA 5EVIB 3MJQA 5FQ9A 2IWBA 5F5YA 1KGGA 1YKDA 3B42A 1ZKJA 2OV5A 4JXGA 2BTFP 4R3AA 3FV7A 1F2KA 1PW8A 3O88A 3MF0A 1V9YA 5DJTA 2KDKA 3UDFA 5M19A 3FPWA 4C6YA 4PM9A 4DKIA 4PM7A 1EW0A 1YAXA 1FQGA 5G18A 4HQAA 2X02A 1T19A 3P09A 4RYEA 4GS9A 2HJEA 1YSPA 3HUMA 4HY8A
chains in the Genus database with same CATH topology
1TS7A 4HI4A 2Y79A 2LB9A 3FG8A 4EU0A 3F1NA 1NLZA 4M4XA 3OCLA 3KX0X 4YWZA 4Z1WA 4L9EA 4LRXC 3T4JA 3A0SA 3T4OA 2QHKA 2A2LA 3RFBA 2W3GA 3H7WA 3UB9A 4EW7A 3UE6A 3NOTC 4I3IA 5AVEA 4YNRA 1OTBA 3E0YA 4RQ9A 3K3DA 1V9ZA 3EGDC 4I39A 3CI6A 3T4SA 3CWFA 2O9CA 4EQ1A 4Q0JA 2VX8A 4GCZA 3R4KA 2DMWA 1ODVA 4HP4A 2PDRA 4EERA 4XT2B 5DKLA 2PYRA 3D3OA 3UB6A 3LYXA 4Y2FA 4GW9A 2QYBA 3S7PA 1W63M 2JN7A 3K2NA 1D7EA 4MDZA 2XA7S 1DRMA 2XSSA 3O5YA 2OAQ1 4WF0A 2HJ9C 2QWSA 3R7WA 2PR5A 3VE4A 3SW1A 1UWPX 4KUKA 2WKQA 4WLAA 2ZMVA 2V1BA 2P7JA 5KIZA 4PKYA 4P6ZM 4HJ4A 4LLOB 3LIFA 3IBRA 3HJKA 2D02A 4UQIS 2J3WA 4NXGA 3T50A 2G7UA 3UB7A 2VZWA 4P6ZS 2W1TA 1TD5A 3GDIA 4AFIA 2VGLM 2INWA 3BQ8A 4HIAA 2P04A 1IFQA 5HPFA 3C30A 2L0WA 3EEHA 4I5SA 4L0LA 4BMWA 5DFXA 5HD3A 2HV1A 3BY9A 1LSXA 3EGXC 3FPVA 4IJGA 2Z6DA 3JVVA 5J3WA 4EUVA 1VHMA 2JKTM 1OPXA 4DMZA 4ME4A 3F1OB 2K31A 3LIDA 4Y5FA 4NKPA 3LUQA 2O9BA 1LL8A 3TRCA 1OTIA 5LBRA 4L9FA 2ZOHA 3BW6A 1OJ5A 1LSVA 3LR5A 4LPZA 1XJ2A 3RH8B 5G4YA 2VKSA 3KSFA 3P7NA 4G3KA 4JGPA 5HDSA 2MJ6A 3IS2B 4G3VA 2HF6A 3NOPC 4K08A 3T4QA 3C8CA 4B93A 5G4ZA 4DN0A 3NJAA 4MCWA 1S1YA 4HH2A 3A0VA 4R6LA 2YKHA 4IUKA 3T4TA 3LI8A 1N9OA 1TS0A 2ZBBA 4MMNA 3MFXA 2QKPA 3PBOA 4PAUA 5IU1A 2GZAA 4UEYA 4CLCE 3UB8A 1S1ZA 4FOFA 4EEPA 2PT7A 5TBMB 4XT2A 5HD5A 4R70A 4MN6A 5IT5A 4NXBA 3OBFA 1T1CA 4Q0IA 4WL9A 3MQ0A 3H9WA 3F1PB 4WN5A 3HJIA 1OT9A 5J7EA 3P01A 2CMNA 2V9AA 1KOUA 3ULFA 3ICYA 4HJ3A 4GS9B 4ETXA 2OWJA 5DJUA 2L1MA 3RTYA 1ZTUA 2QJ5A 2XA7M 3GECA 2Z6CA 2PD7A 4KUOA 4H6JA 3LIEA 4O0PA 1XJ3A 1MC0A 3KYQA 3VV4A 3F1NB 1UGUA 1X0OA 4GLQA 1MKMA 1DP9A 3S7QA 2OOLA 1G6OA 3PR6A 5EFWA 5HSQA 3HCYA 4B9OA 2OWHA 4UQIM 1VB6A 3U2AA 5J4EA 1XJ4A 5F68A 5I5LA 1P9RA 2R78A 5TJJA 3EQUA 4NXEA 4BBUA 1TS8A 3UMEA 3IBJA 1OTDA 3PBRA 2K7SA 1OT6A 2BASA 3F1OA 3B33A 2XROA 3LIBA 3S7OA 3KSHA 1S67L 3PBSA 2W3EA 5MC7A 3LR3A 2V0UA 3C2WA 3CLOA 3BWLA 1NWZA 3EOIA 2EWWA 4GHIA 4WEJA 2KX6A 4LRYC 2J80A 1S4SA 1S4RA 2JHEA 5AVFA 3T4LA 1MZUA 3NOUC 2KLIA 3BQAA 4I3AA 3PBNA 1XJ6A 4CLCB 2B18A 1NRJA 1IOUA 2WKRA 2M7UA 3LR4A 1JNUA 5C5KA 4GJ4A 1GSVA 3MQQA 4NXFA 1Y28A 4G3WA 3MR0A 2VJWA 3OC2A 4FSFA 2PYPA 4HNBA 3E4QA 1DP8A 1H8MA 2JKRI 4LRZE 4IHQA 1P0ZA 2GJ3A 2JKRM 2V1AA 3MMHA 5TBMA 1OTAA 2A24B 4HJ6A 4CLCC 1F98A 5DF9A 2FZ0A 2EWVA 2Y8HA 2VV8A 2EA9A 4BWIA 1D06A 3B47A 2ZMFA 4JGRA 3CUEC 1LSWA 2NUPC 3W2ZA 3OOVA 2J3TC 2WKPA 5HL6A 3PHYA 2PHYA 5A8BA 2FH5A 2W1RA 5HWWA 2H28A 4ZRRA 5F6AA 4JGQA 5FL3A 3F1PA 2YKFA 2VEAA 4BJPA 4EETB 2ZOIA 1OJGA 3EWKA 4Q0HA 3EQVA 3NHQA 3H82B 3UE3A 1T18A 4MN7A 4ARZB 1XFNA 4BBVA 4F3LB 3BJNA 4DJ2A 2NUTC 2VV6A 3E98A 4KQDA 4EXOA 3A0RA 2L4RA 2VV7A 4JGOA 3G6OA 1H3QA 1TS6A 2OAP1 2D01A 3FC7A 3LR0A 4R38A 3ZQ5A 3EEAA 3C38A 4ETZA 1ZHHB 3ZYTA 3LI9A 4HP9A 2QJ7A 3CITA 4QPRA 4YOFA 3DBAA 3LFVA 5F69A 1GSXA 5HDDA 3PXPA 4CLCD 4I3JA 3V67A 3PYPA 2W0NA 3H7WB 1YSQA 4NEED 3VOLA 4HHDA 2J3TD 2W3FA 2HGVA 5CX7A 3KSGA 1F5MA 1GSWA 4L9GA 2PD8A 5K5BA 1T1BA 2GX5A 4IUHA 5HWVA 2K2NA 4MN5A 4CLCA 1OTEA 3PBTA 2W3HA 4Y3IA 4O01A 4WELA 5HZHA 1UWNX 3CUEA 4H6JB 2O9AA 5HDCA 4O8GA 3LICA 5HPIA 4KQOA 4BBTA 2M1CA 3D72A 3KO6A 1STZA 2IA2A 1F9IA 4WUJA 3MQOA 4II7A 1P9WA 3IS2A 2LB5A 1TF1A 3R7WB 2A24A 2P08A 3KSIA 4OOLA 5AJGA 4PKYG 5IS1A 3E4OA 4HOIA 3E4PA 2M7VA 2VA0A 2VGLS 3TJZC 4PHTA 3TW8A 4EESA 2JKTI 2V0WA 4OOMA 2I9VA 3T4KA 2O0YA 5L8MA 1P97A 2W27A 3LIAA 1BYWA 1WA9A 2KOIA 3JVUA 4WEKA 2VLGA 3S7NA 2W1TB 4DJ3A 3MJQA 5DKKA 3UMDA 5F5YA 1YKDA 3OCNA 1S66L 3B42A 2PR6A 3K3CA 3BY8A 2GNXA 3VE3A 5HWTA 3MXQA 4R3AA 1NLYA 3H82A 4E04A 3PBQA 4EEUA 3MF0A 4ARZA 1V9YA 4GHIB 2KDKA 3KYZA 5DJTA 4HH3A 4CQHA 1W63Q 1G28A 4F3LA 4I38A 1T1AA 1N9LA 3FPWA 5KSHA 1EW0A 1YAXA 2W3DA 2B02A 2XRNA 5DFYA 1N9NA 4HQAA 1T19A 1XFQA 3CAXA 4GS9A 2HJEA 1YSPA 2O99A 1DP6A 1LT0A 3TE8A 4HY8A 3OLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS7 A;  4HI4 A;  3FG8 A;  3F1N A;  4M4X A;  3KX0 X;  4YWZ A;  4L9E A;  4LRX C;  3A0S A;  2QHK A;  3H7W A;  3UB9 A;  4EW7 A;  3UE6 A;  3NOT C;  4I3I A;  5AVE A;  1OTB A;  4RQ9 A;  3K3D A;  1V9Z A;  4I39 A;  3CWF A;  4EQ1 A;  4GCZ A;  1ODV A;  4HP4 A;  2PDR A;  4EER A;  4XT2 B;  5DKL A;  2PYR A;  3UB6 A;  3LYX A;  4GW9 A;  2JN7 A;  1D7E A;  1DRM A;  4WF0 A;  2QWS A;  2PR5 A;  3VE4 A;  3SW1 A;  1UWP X;  4KUK A;  2WKQ A;  4WLA A;  2V1B A;  2P7J A;  5KIZ A;  4PKY A;  4HJ4 A;  4LLO B;  3LIF A;  3IBR A;  3HJK A;  2D02 A;  4NXG A;  3T50 A;  3UB7 A;  3GDI A;  2INW A;  4HIA A;  2L0W A;  3EEH A;  4I5S A;  5HD3 A;  2HV1 A;  3BY9 A;  1LSX A;  2Z6D A;  5J3W A;  3F1O B;  3LID A;  3LUQ A;  1LL8 A;  1OTI A;  4L9F A;  2ZOH A;  1OJ5 A;  1LSV A;  4LPZ A;  1XJ2 A;  3RH8 B;  5G4Y A;  3P7N A;  4JGP A;  5HDS A;  3IS2 B;  3NOP C;  4K08 A;  3C8C A;  5G4Z A;  3NJA A;  1S1Y A;  4HH2 A;  3A0V A;  4R6L A;  2YKH A;  3LI8 A;  1N9O A;  1TS0 A;  2ZBB A;  3MFX A;  2QKP A;  5IU1 A;  3UB8 A;  1S1Z A;  4EEP A;  5TBM B;  4XT2 A;  5HD5 A;  4R70 A;  4MN6 A;  4NXB A;  1T1C A;  4WL9 A;  3H9W A;  3F1P B;  4WN5 A;  3HJI A;  1OT9 A;  5J7E A;  2CMN A;  2V9A A;  1KOU A;  3ULF A;  3ICY A;  4HJ3 A;  4GS9 B;  5DJU A;  2OWJ A;  2L1M A;  3RTY A;  2QJ5 A;  3GEC A;  2Z6C A;  2PD7 A;  4KUO A;  4H6J A;  3LIE A;  1XJ3 A;  3F1N B;  1UGU A;  1X0O A;  1DP9 A;  2OOL A;  5HSQ A;  5EFW A;  4B9O A;  2OWH A;  1VB6 A;  5J4E A;  1XJ4 A;  5F68 A;  5I5L A;  2R78 A;  4NXE A;  4BBU A;  1TS8 A;  3UME A;  1OTD A;  2K7S A;  1OT6 A;  2BAS A;  3F1O A;  3B33 A;  3LIB A;  1S67 L;  2V0U A;  3C2W A;  3CLO A;  3BWL A;  1NWZ A;  4GHI A;  2KX6 A;  4LRY C;  2J80 A;  1S4S A;  1S4R A;  2JHE A;  5AVF A;  1MZU A;  3NOU C;  4I3A A;  1XJ6 A;  2WKR A;  1JNU A;  1GSV A;  3MQQ A;  4NXF A;  1Y28 A;  3MR0 A;  2PYP A;  4HNB A;  3E4Q A;  1DP8 A;  4LRZ E;  1P0Z A;  2GJ3 A;  2V1A A;  5TBM A;  1OTA A;  2A24 B;  4HJ6 A;  1F98 A;  2VV8 A;  2EA9 A;  1D06 A;  4JGR A;  1LSW A;  2WKP A;  3PHY A;  2PHY A;  5A8B A;  5HWW A;  2H28 A;  5F6A A;  4JGQ A;  3F1P A;  2YKF A;  2VEA A;  4EET B;  2ZOI A;  1OJG A;  3EWK A;  3NHQ A;  3H82 B;  1T18 A;  1XFN A;  4BBV A;  4F3L B;  4DJ2 A;  2VV6 A;  4EXO A;  4KQD A;  3A0R A;  2L4R A;  2VV7 A;  4JGO A;  3G6O A;  1TS6 A;  2D01 A;  3FC7 A;  4R38 A;  3ZQ5 A;  3LI9 A;  4HP9 A;  2QJ7 A;  5F69 A;  5HDD A;  1GSX A;  4I3J A;  3PYP A;  2W0N A;  3H7W B;  3VOL A;  4HHD A;  1GSW A;  4L9G A;  2PD8 A;  1T1B A;  5HWV A;  4MN5 A;  1OTE A;  5HZH A;  1UWN X;  4H6J B;  5HDC A;  3LIC A;  4BBT A;  2M1C A;  3D72 A;  1F9I A;  4WUJ A;  3MQO A;  3IS2 A;  2A24 A;  4PKY G;  5IS1 A;  3E4O A;  4HOI A;  3E4P A;  4EES A;  2V0W A;  2I9V A;  1P97 A;  2W27 A;  1BYW A;  1WA9 A;  3LIA A;  2VLG A;  4DJ3 A;  3MJQ A;  5DKK A;  3UMD A;  5F5Y A;  1S66 L;  2PR6 A;  3K3C A;  3BY8 A;  3VE3 A;  5HWT A;  3MXQ A;  4R3A A;  3H82 A;  4E04 A;  4EEU A;  1V9Y A;  4GHI B;  2KDK A;  5DJT A;  4HH3 A;  1G28 A;  4F3L A;  4I38 A;  1T1A A;  1N9L A;  1EW0 A;  2B02 A;  1N9N A;  4HQA A;  1T19 A;  1XFQ A;  3CAX A;  4GS9 A;  1DP6 A;  1LT0 A;  4HY8 A;  3OLO A; 
#chains in the Genus database with same CATH topology
 1TS7 A;  1M6K A;  5FDH A;  3ZVT A;  4RX2 A;  3FG8 A;  1RGY A;  1K0K A;  1K38 A;  3OCL A;  3UNW A;  4XUX A;  4L9E A;  3GTC A;  2PU2 A;  4QHC A;  2QHK A;  3CG5 A;  1KE4 A;  2W3G A;  2XFT A;  3NOT C;  4FTX A;  5AVE A;  1OTB A;  2PBD P;  3E0Y A;  2Y91 A;  4I39 A;  3EGD C;  3CI6 A;  3CWF A;  2O9C A;  3AGE A;  1PZP A;  3V50 A;  4BL2 A;  1ODV A;  4HP4 A;  4UA6 A;  2PYR A;  3LYX A;  4Y2F A;  4OOY A;  4GW9 A;  5DTS A;  4ZDX A;  1H0M A;  4LV3 A;  5DF8 A;  3MZF A;  1CF0 A;  1IKG A;  3MXR A;  2XA7 S;  3C7U A;  1DRM A;  2OAQ 1;  4E3K A;  4WF0 A;  5F1G A;  1KGE A;  3S4X A;  1TEM A;  1XX2 A;  2HJ9 C;  2P74 A;  5CGS A;  3QP1 A;  4WLA A;  1S0W A;  2XR0 A;  1H5X A;  3WS4 A;  5CHJ A;  1I5Q A;  1LI0 A;  3VOZ A;  1BUL A;  3HRE A;  5EVI A;  4AFI A;  3E2L A;  1O7E A;  2INW A;  1IFQ A;  4WBG A;  2L0W A;  3EEH A;  4BMW A;  4E6W A;  1OME A;  1LSX A;  1BTL A;  3VFH A;  3NEC A;  1ERQ A;  1L3L A;  3DAV A;  4EUZ A;  3F1O B;  1ES3 A;  3DW0 A;  1YLP A;  2O9B A;  4GDB A;  3O3V A;  1OTI A;  5LBR A;  3M6B A;  4BD1 A;  3HBR A;  3VFF A;  1OJ5 A;  4D60 A;  4LPZ A;  1XJ2 A;  1RP5 A;  3HLD A;  5G4Y A;  3M6H A;  4G3K A;  3L7H A;  2HF6 A;  3NOP C;  5FAP A;  3C8C A;  5FQM A;  3NJA A;  4MCW A;  5FDS A;  4HH2 A;  4R6L A;  5A90 A;  4K0X A;  3LO7 A;  3VP2 A;  3T4T A;  2ZBB A;  4UEY A;  3ZNY A;  5CGX A;  5TBM B;  1GHI A;  3UO9 A;  1MY8 A;  1JTD A;  5EVL A;  4WL9 A;  3MQ0 A;  4WN5 A;  2JC7 A;  3HJI A;  5J7E A;  2CMN A;  1PYY A;  3ZG0 A;  4X68 A;  5DJU A;  2QJ5 A;  3T1X A;  1D1J A;  5AQB A;  5CHU A;  2UV0 E;  3HLB A;  4HES A;  4BQM A;  2OOL A;  1G6O A;  1S6R A;  4UQI M;  5J4E A;  4QWO A;  3JPU A;  4OP5 A;  3WS5 A;  4KEN B;  2R78 A;  3NDE A;  5TJJ A;  3IWI A;  5DVA A;  2XD1 A;  3UME A;  3IBJ A;  2Y2N A;  1OTD A;  3PBR A;  1ERO A;  1OT6 A;  3F1O A;  3LIB A;  4E3M A;  3QNB A;  1FSY A;  2ZC5 B;  2V0U A;  2A3U A;  1E3U D;  3SS3 A;  3EOI A;  4C3Q A;  5JYO A;  3ZFZ A;  2KX6 A;  3BFG A;  4LRY C;  3ZDJ A;  1S4S A;  4MLL A;  4Y0T A;  5AVF A;  1K54 C;  4I3A A;  3GMW A;  3G2Z A;  1NRJ A;  3M2K A;  1IOU A;  2M7U A;  5C5K A;  3HL9 A;  1GSV A;  4G3W A;  5EOO A;  3MBZ A;  1HLU P;  1CEF A;  1EI5 A;  4FSF A;  5EEC A;  3E4Q A;  1DP8 A;  5FAQ A;  2JKR I;  4LRZ E;  3C5A A;  2JKR M;  1ACF A;  5TBM A;  1NXY A;  1ALQ A;  1F98 A;  5DF9 A;  2FZ0 A;  2EWV A;  3NY4 A;  2EA9 A;  1D06 A;  4OLG A;  4E6X A;  2H0T A;  3W2Z A;  3OOV A;  2J3T C;  1BZA A;  1J9M A;  1LI9 A;  1IYS A;  5A8B A;  5DTK A;  2RCX A;  1G6A A;  5FL3 A;  3SH7 A;  1PRQ A;  3FWL A;  2VEA A;  4R1G A;  2ZQ7 A;  2WKI A;  5TFQ A;  1K4F A;  4Q0H A;  4KZ8 A;  3UDX A;  4QJG A;  3NHQ A;  3H82 B;  3UE3 A;  1XFN A;  1Q2Q A;  3HLF A;  3UE0 A;  3P98 A;  4YFM A;  3E98 A;  3HUO A;  2Q0O A;  5IHV A;  1TVF A;  1IYO A;  2D01 A;  4R38 A;  3ZQ5 A;  3BFD A;  1BT5 A;  4E3O A;  3A3J A;  5CGW A;  3LI9 A;  3T12 B;  5HAR A;  2ZC6 B;  4EV4 A;  5F69 A;  3DBA A;  1GSX A;  3BFF A;  4GKU A;  4R3J A;  3W4O A;  1MPL A;  4Q8I A;  4JKT A;  1DJA A;  2HGV A;  3CMZ A;  3KSG A;  3ZG9 B;  4S2M A;  3VP4 A;  3ZG8 B;  4L9G A;  3A3I A;  2PD8 A;  4DXC A;  2JBF A;  2Y2H A;  3AGD A;  5K5B A;  1T1B A;  3CHW P;  1Y54 A;  2ZQA A;  3PBT A;  1ZG4 A;  4PM5 A;  5L2F A;  4O01 A;  4WEL A;  2CC1 A;  1PNE A;  4BBT A;  3KO6 A;  2M1C A;  3A3E A;  2HDR A;  4II7 A;  1KE3 A;  4OON A;  3T1R A;  1PI5 A;  4RVA A;  4U0X A;  1SZV A;  1E4D A;  1XP4 A;  2P08 A;  2WZZ A;  4RX3 A;  1CI8 A;  4PKY G;  1GHM A;  2WGV A;  2WAF A;  3TJZ C;  4PHT A;  1VQQ A;  3GR2 A;  1E3U A;  3T4K A;  2O0Y A;  3IXD A;  3S7N A;  5A92 A;  2W1T B;  3GQZ A;  4QU3 A;  5HW3 A;  5GHY A;  1PI4 A;  5FEF A;  3FKV A;  3IQA A;  3K3C A;  5JYP A;  3VE3 A;  2WUQ A;  3MXQ A;  1K4E A;  1NLY A;  3H82 A;  5CHM A;  3PBQ A;  4WZ5 C;  4GHI B;  3UPP A;  1NZU A;  4QD4 A;  2C6W B;  1T1A A;  1VM1 A;  1PIO A;  2W3D A;  4EWF A;  2XRN A;  5DFY A;  1KVM A;  1N9N A;  1NY0 A;  1ZG6 A;  4FUW A;  3CAX A;  2ZJ9 A;  4LV1 A;  1DP6 A;  1LT0 A;  3TE8 A;  1K6R A;  4JF4 A;  1SKO B;  2Y79 A;  1NLZ A;  2PRF A;  4YIN A;  4MEZ A;  4YWZ A;  4Z1W A;  1L0D A;  4LRX C;  3A0S A;  3RFB A;  3IWQ A;  4R23 A;  3UB9 A;  1YLY A;  4IVK A;  3UE6 A;  4YNR A;  1V9Z A;  5FQQ A;  5EVE A;  4EQ1 A;  1YLJ A;  1IEM A;  2BLS A;  4GCZ A;  3HLW A;  3VSL A;  1QMF A;  2PDR A;  3UY6 A;  4XT2 B;  3D3O A;  2Q9N A;  4A5R A;  1BLP A;  1W63 M;  3IF6 B;  3MKF A;  2JN7 A;  3K2N A;  5EVI D;  2H5S A;  3MS6 A;  2PR5 A;  2ZMA A;  2WKQ A;  2V1B A;  3IXB A;  3QP8 A;  4DE3 A;  3LIF A;  3IBR A;  3IF6 C;  3HJK A;  5EPH A;  1YMX A;  4OQG A;  2J3W A;  4NXG A;  1ESU A;  4C75 A;  2VZW A;  5GHX A;  2W1T A;  3GDI A;  1XA7 A;  4E3L A;  3DTK A;  4HIA A;  4F94 A;  4KZA A;  5E2G A;  4IVI A;  4L0L A;  3VP0 A;  5DFX A;  1U60 A;  3BY9 A;  2QZ6 A;  4NG2 A;  4E3N A;  4IJG A;  4JXW A;  4EUV A;  2JKT M;  1PZO A;  3G31 A;  4Z9Q A;  2EX6 A;  4NKP A;  3ZCZ A;  2G2U A;  1W8Y A;  1L0F A;  3AGF A;  4L9F A;  2WK0 A;  5F83 A;  1CI9 A;  1FIL A;  4OQH A;  2Y2Q A;  3TSG A;  5L09 A;  3G32 A;  3IHB A;  4N92 A;  3RH8 B;  2VKS A;  1SKO A;  1VET B;  3P7N A;  3IS2 B;  4PMA A;  4G3V A;  1JWV A;  4K08 A;  1SDE A;  3OPP A;  3T4Q A;  4B93 A;  4GD6 A;  4DN0 A;  2WZX A;  4BD0 A;  4NK3 A;  4X53 A;  2YKH A;  1KGF A;  1I2S A;  2EXB A;  4D2O A;  2XFS A;  5IU1 A;  3UB8 A;  4FOF A;  4EEP A;  1K25 A;  1LLB A;  1ESI A;  3BFE A;  3SS4 A;  4XT2 A;  3O87 A;  4LV0 A;  5HD5 A;  4E3J A;  2XEP A;  4R70 A;  3G4P A;  4NET A;  5FI6 A;  4Q0I A;  3WRZ A;  3NDG A;  1XA1 A;  1ONG A;  3DTE A;  4N9K A;  3P01 A;  4DE2 A;  3G2Y A;  2OWJ A;  1XGI A;  2L1M A;  2WAD A;  3GSG A;  2Y2K A;  3GEC A;  2Z6C A;  2PD7 A;  4H6J A;  4JBF A;  4CJN A;  3LIE A;  3HUN A;  5M1A A;  4DDS A;  4UHU A;  3F1N B;  2IWC A;  1X0O A;  4GLQ A;  1MKM A;  1DP9 A;  2JCH A;  1YLZ A;  3PR6 A;  1FOF A;  2OWH A;  5EM0 A;  1VB6 A;  3U2A A;  1XJ4 A;  5F68 A;  5I5L A;  2V2F F;  4BL3 A;  1MWS A;  3QP2 A;  2Y2I A;  3B33 A;  2XRO A;  3N4I A;  2H10 A;  5EM1 A;  1LL5 A;  2HP5 A;  3KSH A;  4GDN A;  5GLB A;  5HAQ A;  3PAG A;  5U47 A;  3CLO A;  1NWZ A;  4O7D A;  1VET A;  1C3B A;  4EQI A;  1S4R A;  1MZU A;  2Y2P A;  2KLI A;  3QNC A;  3PBN A;  2JKG A;  4OLD A;  2JE5 A;  1XJ6 A;  4Y17 A;  4CLC B;  3B3X A;  5CXW A;  1Y28 A;  2R9X A;  1RGZ A;  3ITB A;  1H8Z A;  1JVJ A;  1NZO A;  1HD8 A;  4IHQ A;  1P0Z A;  2GJ3 A;  3MMH A;  5F82 A;  4CLC C;  4FH4 A;  3B47 A;  4JGR A;  1LSW A;  5HL6 A;  2W1R A;  1DY6 A;  3NI9 A;  5F6A A;  4KZ7 A;  4EBL A;  4R0Q A;  2YKF A;  3C7V A;  5TR7 A;  2ZOI A;  1OJG A;  3Q1F A;  2VK3 A;  4MN7 A;  4ARZ B;  2ZM8 A;  2UWX A;  4F3L B;  3BJN A;  4DJ2 A;  3NUL A;  3A0R A;  2VV7 A;  1L0G A;  5CEC A;  1H3Q A;  2OAP 1;  2ZM2 A;  4KQR A;  3RXW A;  4KG6 A;  3EEA A;  3C38 A;  4LCM A;  4ETZ A;  5E2H A;  4U3T A;  4Y0U A;  4FCF A;  3CIT A;  4YOF A;  4GB7 A;  5AQ9 A;  1EWZ A;  2ZC7 A;  4I3J A;  2HP9 A;  5HAI A;  2W0N A;  4OPR A;  4NEE D;  4OH0 A;  3VOL A;  2J3T D;  5GHZ A;  4M3K A;  1GSW A;  5FAO A;  3S1Y A;  4JF6 A;  2Y55 A;  3V5M A;  4IED A;  2P9V B;  2GX5 A;  5E2E A;  5HWV A;  3BYD A;  3MZD A;  4MN5 A;  4CLC A;  1WYC A;  1Y4O A;  2W3H A;  4Y3I A;  4OVD A;  4O8G A;  2Y2O A;  3UDI A;  5HPI A;  2H0Y A;  1F9I A;  3MQO A;  4BEN A;  4X1M A;  1J3W A;  4ESP A;  1P9W A;  1GCE A;  2PU4 A;  2LB5 A;  4GNU A;  1TF1 A;  3R7W B;  3UE1 A;  3IT9 A;  1CJF A;  2VA0 A;  2Z2L B;  2V0W A;  4OOM A;  2I9V A;  1K56 A;  4HBT A;  2W27 A;  1BYW A;  3JVU A;  1PWD A;  3UMD A;  3DWK A;  3OCN A;  1N9B A;  4MNR A;  2PR6 A;  4S2N C;  2GNX A;  5HWT A;  1NRF A;  2ZC4 B;  3ZVW A;  3T1Q B;  4Y7P A;  4ARZ A;  3ZGA B;  1W63 Q;  1G28 A;  4F3L A;  5KSH A;  1YQS A;  4Y0O A;  4DE1 A;  2B02 A;  1Z09 A;  3G35 A;  2ZC3 B;  4E3I A;  1Q2P A;  1PFL A;  2O99 A;  4EBP A;  3OLO A;  4HI4 A;  2ZM0 A;  4DF6 A;  4R3B A;  4M4X A;  1KVL A;  1BUE A;  2Q9M A;  4BLM A;  3BEB A;  2OSU A;  3T4J A;  3T4O A;  2A2L A;  3HLE A;  5E43 A;  3UPO A;  4R4R A;  4S2I A;  4RQ9 A;  3K3D A;  2DRW A;  2VGK A;  3R4K A;  1K54 A;  3N8R A;  5F1F A;  1DJC A;  3CPT B;  2DMW A;  3U4L P;  4RA7 A;  5FQJ A;  2XDM A;  2HZ5 A;  5KZH A;  4ZBE A;  3C4P A;  4GN2 A;  4P85 A;  2ZQC A;  4QY5 A;  1YLW A;  1N4O A;  2G2W A;  1XXM A;  3Q81 A;  3SZT A;  1YPR A;  2AVX A;  4HBU A;  3R7W A;  3VE4 A;  1UWP X;  4KUK A;  2ZMV A;  4PKY A;  1W7F A;  4LLO B;  4UQI S;  3T50 A;  1YM1 A;  3UB7 A;  5BOH A;  3WS0 A;  4P6Z S;  1TD5 A;  1HVB A;  2Z2M B;  1ES5 A;  4UAA A;  4S2J A;  4N1X A;  3W8K A;  2VGL M;  4DRT A;  3BQ8 A;  4OPY A;  2WGW B;  1VEU B;  2P04 A;  3Q82 A;  3A3F A;  3C30 A;  4DDY A;  4I5S A;  2XGN A;  3TOI A;  2J8Y A;  5HD3 A;  2HV1 A;  3FPV A;  2Z6D A;  3JVV A;  5J3W A;  4MBF A;  4DMZ A;  4ME4 A;  1KDS A;  3FKW A;  4Y5F A;  3LUQ A;  1LL8 A;  1FIK A;  3N8S A;  3VP1 A;  3CZD A;  2ZOH A;  4KZ9 A;  1M40 A;  1LSV A;  1XGJ A;  4DE0 A;  5CED A;  4KG2 A;  2ZL1 B;  1TDG A;  1NYM A;  3KSF A;  2FFY A;  5HDS A;  1K57 C;  5G4Z A;  3TG9 A;  3OPL A;  5CTM A;  3MKE A;  1S1Y A;  2EXA A;  4IUK A;  1CQA A;  2EFX A;  3GVB A;  4FH2 A;  1N9O A;  3CJM A;  4LFU A;  1TS0 A;  2X01 A;  4MMN A;  3MFX A;  2QKP A;  4PAU A;  1S1Z A;  5HX9 A;  4GZB A;  3CPT A;  3N6I A;  1YT4 A;  4DXB A;  4MN6 A;  5GL9 A;  5KMW A;  1MBL A;  4ZJ1 A;  2OLU A;  1G5U A;  4P6B A;  3OBF A;  1ZC2 A;  4ZJ2 A;  1T1C A;  5EUA A;  3F1P B;  1OT9 A;  4JXV A;  2V9A A;  1KOU A;  1HTZ A;  4GS9 B;  3BEC A;  4N1H A;  1ZTU A;  2XA7 M;  1YLT A;  4IBX A;  4KUO A;  1XKZ A;  4O0P A;  1MWU A;  3VV4 A;  4OQ0 A;  5HL1 A;  3QP4 A;  3ZG5 A;  5HSQ A;  4B9O A;  3QP6 A;  4WMC A;  1MXO A;  1P9R A;  4WZ5 A;  3DTM A;  4WYY A;  5FI2 A;  2K7S A;  2BAS A;  3RXX A;  1W79 A;  3LY4 A;  2QPN A;  3BM6 A;  1S67 L;  5FQK A;  3PBS A;  3WS1 A;  2ACG A;  2W3E A;  3BWL A;  2ZL1 A;  4GHI A;  4WEJ A;  5FQI A;  1FR1 A;  3IHA A;  3W4P A;  2J80 A;  2HP6 A;  1PW1 A;  2ZLY A;  3BQA A;  1DJB A;  2B18 A;  4XXR A;  1JNU A;  4GJ4 A;  3MQQ A;  4NXF A;  3V3R A;  1ES2 A;  3GV9 A;  5GLA A;  2WAE A;  3OC2 A;  5EE8 A;  2PYP A;  4HNB A;  3LEQ A;  4B88 A;  2V8C A;  2V1A A;  3ZNT A;  1OTA A;  2A24 B;  3L9K A;  2E8I A;  4HJ6 A;  4K0W A;  4X25 A;  3V39 A;  1MWT A;  4N9L A;  2VV8 A;  3BLM A;  4BWI A;  4KZ5 A;  2RL3 A;  3CUE C;  4JF5 A;  3PHY A;  1HZO A;  2FH5 A;  2XLN A;  2XH9 A;  1LHY A;  2H28 A;  4ZRR A;  5EVI C;  4JGQ A;  1L0E A;  1O07 A;  1IKI A;  1W8Q A;  3F1P A;  1YMS A;  1H8Y A;  3HLC A;  3LCE A;  3EQV A;  1MWR A;  3QHY A;  3LY3 A;  1T18 A;  3IF6 A;  2OLV A;  4U0T A;  5FA7 A;  4BBV A;  3SH9 A;  3Q7V B;  1JWZ A;  2NUT C;  4EXO A;  4P87 A;  1IYQ A;  2HDQ A;  5L10 A;  4JGO A;  3G6O A;  3FC7 A;  1FCM A;  4KZ6 A;  4X69 A;  1ZHH B;  2WGI A;  1GA0 A;  4K91 A;  1KDW A;  1ONH A;  2QJ7 A;  2B5R A;  1BLH A;  4QPR A;  3LFV A;  5HDD A;  1KE0 A;  2HPB A;  4CLC D;  2WYX A;  5FEG A;  3PYP A;  1SKF A;  3O86 A;  3H7W B;  3VP3 A;  4HHD A;  5CX7 A;  3NCK A;  1F5M A;  1AWI A;  1PWG A;  4PM6 A;  2WKE A;  4IUH A;  2K2N A;  4X6T A;  2V8F A;  3MSH A;  2Y4A A;  5EOE A;  5HZH A;  5FSR A;  4S2O A;  3CUE A;  5HDC A;  2X71 A;  1K56 D;  3LIC A;  5CER A;  3NBL A;  2IA2 A;  3D4F A;  4WUJ A;  3IS2 A;  3DWZ A;  2A24 A;  3SOI A;  5CTN A;  3KSI A;  4OOL A;  5AJG A;  3G30 A;  5IS1 A;  2XD5 A;  5EV0 A;  4HOI A;  1Z6F A;  1NJ4 A;  1GA9 A;  4S2P A;  4EES A;  1P97 A;  1WA9 A;  2QMI A;  4DJ3 A;  5L07 A;  5DKK A;  1S66 L;  3WRT A;  1FR6 A;  3BY8 A;  2GDN A;  4KG5 A;  3WWX A;  4E04 A;  3C4O A;  4EEU A;  4CQH A;  3KYZ A;  4HH3 A;  4I38 A;  3Q7V A;  2DNS A;  1N9L A;  5TGF A;  3SH8 A;  1SCW A;  3V3S A;  1XFQ A;  2DCF A;  5FAS A;  1IEL A;  5DF7 A;  3ISG A;  4WZ4 A;  2LB9 A;  4EU0 A;  3F1N A;  3N8L A;  3OPR A;  4KZB A;  3UB5 P;  1IYP A;  3KX0 X;  1RCJ A;  1SHV A;  1FCO A;  3OZH A;  4Y13 A;  1AXB A;  3H7W A;  4EW7 A;  4I3I A;  3IF5 A;  2E8J A;  3MZE A;  3T4S A;  2EX8 A;  3N7W A;  4Q0J A;  2V20 A;  2VX8 A;  4ZTK A;  4EER A;  4ZAM A;  5DKL A;  3UB6 A;  3UPN A;  3S7P A;  2QYB A;  2Y2G A;  3VOY A;  1D7E A;  4MDZ A;  4LV2 A;  2XSS A;  3O5Y A;  5D3O A;  4ID4 A;  2IWD A;  3IX3 A;  5FI7 A;  2QWS A;  1W5D A;  4PM8 A;  3SW1 A;  5J8X A;  1L2S A;  2P7J A;  2WKH A;  5KIZ A;  4P6Z M;  4HJ4 A;  1K55 C;  2D02 A;  4WM9 A;  4JXS A;  2G7U A;  3HVF A;  1QME A;  3LEZ A;  2HDU A;  4X56 A;  4ZJ3 A;  4X55 A;  4FD8 A;  5HPF A;  4UA9 A;  2Y59 A;  5M18 A;  2EFU A;  3EGX C;  1VHM A;  2Y2M A;  4JLF A;  1OPX A;  1K6S A;  2K31 A;  3LID A;  1BSG A;  4LGW A;  1CEG A;  3IH9 A;  4OP8 A;  3TRC A;  3GRJ A;  2I72 A;  4GD8 A;  3ZHH A;  3BW6 A;  3LR5 A;  3FYZ A;  3HLG A;  1I2W A;  5HAP A;  4JGP A;  2MJ6 A;  1FSW A;  4OQI A;  5FAT A;  4Y15 A;  3A0V A;  5GLD A;  3Q7Z A;  2ZQD A;  1BLS A;  3LI8 A;  1FCN A;  4XUZ A;  4S2L A;  3PBO A;  2GZA A;  1WYB A;  2VGJ A;  4CLC E;  2PT7 A;  1CK3 A;  3JYI A;  5DTT A;  3ZG7 B;  3VMA A;  3G34 A;  4KQQ A;  5IT5 A;  4NXB A;  1K55 A;  3MFD A;  2JKF A;  4IBR A;  2C5W B;  3BLS A;  2J9P A;  1JTG A;  3NIA A;  5CRF A;  2P9V A;  3H9W A;  3IX8 A;  4WMC D;  2BG1 A;  3ULF A;  3ICY A;  4HJ3 A;  4JPM A;  5KSC A;  2EX9 A;  4ETX A;  1LL9 A;  3IX4 A;  3RTY A;  3FZC A;  3A3D A;  4LCL A;  2PAV P;  3QP5 A;  1XJ3 A;  1MC0 A;  4MBH A;  3S22 A;  3KYQ A;  1UGU A;  4S2K A;  4B4Z A;  3S7Q A;  3W4Q A;  5EFW A;  3HCY A;  4QY6 A;  1XPB A;  4S2N A;  1E25 A;  3IXG A;  1JWP A;  2J7V A;  3BRM A;  3EQU A;  4NXE A;  4BBU A;  1TS8 A;  3MXS A;  4OPQ A;  4R4S A;  3E2K A;  1NYY A;  3S7O A;  2XF3 A;  5MC7 A;  3LR3 A;  2FFF B;  3C2W A;  4EBN A;  2EWW A;  1MKI A;  2J9O A;  1BLC A;  2R9W A;  2JHE A;  4H8R A;  3T4L A;  3NOU C;  2WKR A;  3OPH A;  3LR4 A;  3LGO A;  4QB8 A;  3BFC A;  4GOG A;  3MR0 A;  1A0K A;  3I7J A;  1WE4 A;  2VJW A;  5HFO A;  1TDL A;  4OKP A;  5A93 A;  1H8M A;  2V1Z A;  3IH8 A;  1G68 A;  2Y8H A;  4UA7 A;  2ZMF A;  1PWC A;  2NUP C;  2WKP A;  4KZ3 A;  5GLC A;  2XQZ A;  1ES4 A;  2PHY A;  3DTI A;  5HWW A;  4MBK A;  4BJP A;  5I94 A;  4EET B;  3EWK A;  5CEB A;  3SS5 A;  3RJU A;  2EX2 A;  3T1S A;  3D9Y A;  2A49 A;  2VV6 A;  4KQD A;  5AQA A;  2L4R A;  1TS6 A;  3LR0 A;  2ZQ9 A;  2ZQ8 A;  3ITA A;  3ZYT A;  5AQ7 A;  4HP9 A;  3PXP A;  4HEF A;  4PPR A;  1ERM A;  3V67 A;  3WS2 A;  2WGW A;  1VEU A;  3Q07 A;  4B4X A;  1YSQ A;  3M2J A;  2W3F A;  4CPK A;  4LEN A;  3NC8 A;  4OPZ A;  3UN7 A;  1K57 A;  1OTE A;  4P0M A;  2PBY A;  3KYE A;  4KZ4 A;  3PTE A;  1UWN X;  4H6J B;  2O9A A;  2Y2J A;  4KQO A;  5A91 A;  3D72 A;  1STZ A;  3PAE A;  2Y2L A;  2ZD8 A;  2B95 A;  3VSK A;  3IXH A;  4X1L A;  2HDS A;  2XK1 A;  1SDN A;  3E4O A;  1GHP A;  3E4P A;  2M7V A;  2VGL S;  3TW8 A;  5E2F A;  2JKT I;  5L8M A;  2KOI A;  3LIA A;  4WEK A;  2VLG A;  3IWO A;  5EVI B;  3MJQ A;  5FQ9 A;  2IWB A;  5F5Y A;  1KGG A;  1YKD A;  3B42 A;  1ZKJ A;  2OV5 A;  4JXG A;  2BTF P;  4R3A A;  3FV7 A;  1F2K A;  1PW8 A;  3O88 A;  3MF0 A;  1V9Y A;  5DJT A;  2KDK A;  3UDF A;  5M19 A;  3FPW A;  4C6Y A;  4PM9 A;  4DKI A;  4PM7 A;  1EW0 A;  1YAX A;  1FQG A;  5G18 A;  4HQA A;  2X02 A;  1T19 A;  3P09 A;  4RYE A;  4GS9 A;  2HJE A;  1YSP A;  3HUM A;  4HY8 A; 
#chains in the Genus database with same CATH homology
 1TS7 A;  4HI4 A;  2Y79 A;  2LB9 A;  3FG8 A;  4EU0 A;  3F1N A;  1NLZ A;  4M4X A;  3OCL A;  3KX0 X;  4YWZ A;  4Z1W A;  4L9E A;  4LRX C;  3T4J A;  3A0S A;  3T4O A;  2QHK A;  2A2L A;  3RFB A;  2W3G A;  3H7W A;  3UB9 A;  4EW7 A;  3UE6 A;  3NOT C;  4I3I A;  5AVE A;  4YNR A;  1OTB A;  3E0Y A;  4RQ9 A;  3K3D A;  1V9Z A;  3EGD C;  4I39 A;  3CI6 A;  3T4S A;  3CWF A;  2O9C A;  4EQ1 A;  4Q0J A;  2VX8 A;  4GCZ A;  3R4K A;  2DMW A;  1ODV A;  4HP4 A;  2PDR A;  4EER A;  4XT2 B;  5DKL A;  2PYR A;  3D3O A;  3UB6 A;  3LYX A;  4Y2F A;  4GW9 A;  2QYB A;  3S7P A;  1W63 M;  2JN7 A;  3K2N A;  1D7E A;  4MDZ A;  2XA7 S;  1DRM A;  2XSS A;  3O5Y A;  2OAQ 1;  4WF0 A;  2HJ9 C;  2QWS A;  3R7W A;  2PR5 A;  3VE4 A;  3SW1 A;  1UWP X;  4KUK A;  2WKQ A;  4WLA A;  2ZMV A;  2V1B A;  2P7J A;  5KIZ A;  4PKY A;  4P6Z M;  4HJ4 A;  4LLO B;  3LIF A;  3IBR A;  3HJK A;  2D02 A;  4UQI S;  2J3W A;  4NXG A;  3T50 A;  2G7U A;  3UB7 A;  2VZW A;  4P6Z S;  2W1T A;  1TD5 A;  3GDI A;  4AFI A;  2VGL M;  2INW A;  3BQ8 A;  4HIA A;  2P04 A;  1IFQ A;  5HPF A;  3C30 A;  2L0W A;  3EEH A;  4I5S A;  4L0L A;  4BMW A;  5DFX A;  5HD3 A;  2HV1 A;  3BY9 A;  1LSX A;  3EGX C;  3FPV A;  4IJG A;  2Z6D A;  3JVV A;  5J3W A;  4EUV A;  1VHM A;  2JKT M;  1OPX A;  4DMZ A;  4ME4 A;  3F1O B;  2K31 A;  3LID A;  4Y5F A;  4NKP A;  3LUQ A;  2O9B A;  1LL8 A;  3TRC A;  1OTI A;  5LBR A;  4L9F A;  2ZOH A;  3BW6 A;  1OJ5 A;  1LSV A;  3LR5 A;  4LPZ A;  1XJ2 A;  3RH8 B;  5G4Y A;  2VKS A;  3KSF A;  3P7N A;  4G3K A;  4JGP A;  5HDS A;  2MJ6 A;  3IS2 B;  4G3V A;  2HF6 A;  3NOP C;  4K08 A;  3T4Q A;  3C8C A;  4B93 A;  5G4Z A;  4DN0 A;  3NJA A;  4MCW A;  1S1Y A;  4HH2 A;  3A0V A;  4R6L A;  2YKH A;  4IUK A;  3T4T A;  3LI8 A;  1N9O A;  1TS0 A;  2ZBB A;  4MMN A;  3MFX A;  2QKP A;  3PBO A;  4PAU A;  5IU1 A;  2GZA A;  4UEY A;  4CLC E;  3UB8 A;  1S1Z A;  4FOF A;  4EEP A;  2PT7 A;  5TBM B;  4XT2 A;  5HD5 A;  4R70 A;  4MN6 A;  5IT5 A;  4NXB A;  3OBF A;  1T1C A;  4Q0I A;  4WL9 A;  3MQ0 A;  3H9W A;  3F1P B;  4WN5 A;  3HJI A;  1OT9 A;  5J7E A;  3P01 A;  2CMN A;  2V9A A;  1KOU A;  3ULF A;  3ICY A;  4HJ3 A;  4GS9 B;  4ETX A;  2OWJ A;  5DJU A;  2L1M A;  3RTY A;  1ZTU A;  2QJ5 A;  2XA7 M;  3GEC A;  2Z6C A;  2PD7 A;  4KUO A;  4H6J A;  3LIE A;  4O0P A;  1XJ3 A;  1MC0 A;  3KYQ A;  3VV4 A;  3F1N B;  1UGU A;  1X0O A;  4GLQ A;  1MKM A;  1DP9 A;  3S7Q A;  2OOL A;  1G6O A;  3PR6 A;  5EFW A;  5HSQ A;  3HCY A;  4B9O A;  2OWH A;  4UQI M;  1VB6 A;  3U2A A;  5J4E A;  1XJ4 A;  5F68 A;  5I5L A;  1P9R A;  2R78 A;  5TJJ A;  3EQU A;  4NXE A;  4BBU A;  1TS8 A;  3UME A;  3IBJ A;  1OTD A;  3PBR A;  2K7S A;  1OT6 A;  2BAS A;  3F1O A;  3B33 A;  2XRO A;  3LIB A;  3S7O A;  3KSH A;  1S67 L;  3PBS A;  2W3E A;  5MC7 A;  3LR3 A;  2V0U A;  3C2W A;  3CLO A;  3BWL A;  1NWZ A;  3EOI A;  2EWW A;  4GHI A;  4WEJ A;  2KX6 A;  4LRY C;  2J80 A;  1S4S A;  1S4R A;  2JHE A;  5AVF A;  3T4L A;  1MZU A;  3NOU C;  2KLI A;  3BQA A;  4I3A A;  3PBN A;  1XJ6 A;  4CLC B;  2B18 A;  1NRJ A;  1IOU A;  2WKR A;  2M7U A;  3LR4 A;  1JNU A;  5C5K A;  4GJ4 A;  1GSV A;  3MQQ A;  4NXF A;  1Y28 A;  4G3W A;  3MR0 A;  2VJW A;  3OC2 A;  4FSF A;  2PYP A;  4HNB A;  3E4Q A;  1DP8 A;  1H8M A;  2JKR I;  4LRZ E;  4IHQ A;  1P0Z A;  2GJ3 A;  2JKR M;  2V1A A;  3MMH A;  5TBM A;  1OTA A;  2A24 B;  4HJ6 A;  4CLC C;  1F98 A;  5DF9 A;  2FZ0 A;  2EWV A;  2Y8H A;  2VV8 A;  2EA9 A;  4BWI A;  1D06 A;  3B47 A;  2ZMF A;  4JGR A;  3CUE C;  1LSW A;  2NUP C;  3W2Z A;  3OOV A;  2J3T C;  2WKP A;  5HL6 A;  3PHY A;  2PHY A;  5A8B A;  2FH5 A;  2W1R A;  5HWW A;  2H28 A;  4ZRR A;  5F6A A;  4JGQ A;  5FL3 A;  3F1P A;  2YKF A;  2VEA A;  4BJP A;  4EET B;  2ZOI A;  1OJG A;  3EWK A;  4Q0H A;  3EQV A;  3NHQ A;  3H82 B;  3UE3 A;  1T18 A;  4MN7 A;  4ARZ B;  1XFN A;  4BBV A;  4F3L B;  3BJN A;  4DJ2 A;  2NUT C;  2VV6 A;  3E98 A;  4KQD A;  4EXO A;  3A0R A;  2L4R A;  2VV7 A;  4JGO A;  3G6O A;  1H3Q A;  1TS6 A;  2OAP 1;  2D01 A;  3FC7 A;  3LR0 A;  4R38 A;  3ZQ5 A;  3EEA A;  3C38 A;  4ETZ A;  1ZHH B;  3ZYT A;  3LI9 A;  4HP9 A;  2QJ7 A;  3CIT A;  4QPR A;  4YOF A;  3DBA A;  3LFV A;  5F69 A;  1GSX A;  5HDD A;  3PXP A;  4CLC D;  4I3J A;  3V67 A;  3PYP A;  2W0N A;  3H7W B;  1YSQ A;  4NEE D;  3VOL A;  4HHD A;  2J3T D;  2W3F A;  2HGV A;  5CX7 A;  3KSG A;  1F5M A;  1GSW A;  4L9G A;  2PD8 A;  5K5B A;  1T1B A;  2GX5 A;  4IUH A;  5HWV A;  2K2N A;  4MN5 A;  4CLC A;  1OTE A;  3PBT A;  2W3H A;  4Y3I A;  4O01 A;  4WEL A;  5HZH A;  1UWN X;  3CUE A;  4H6J B;  2O9A A;  5HDC A;  4O8G A;  3LIC A;  5HPI A;  4KQO A;  4BBT A;  2M1C A;  3D72 A;  3KO6 A;  1STZ A;  2IA2 A;  1F9I A;  4WUJ A;  3MQO A;  4II7 A;  1P9W A;  3IS2 A;  2LB5 A;  1TF1 A;  3R7W B;  2A24 A;  2P08 A;  3KSI A;  4OOL A;  5AJG A;  4PKY G;  5IS1 A;  3E4O A;  4HOI A;  3E4P A;  2M7V A;  2VA0 A;  2VGL S;  3TJZ C;  4PHT A;  3TW8 A;  4EES A;  2JKT I;  2V0W A;  4OOM A;  2I9V A;  3T4K A;  2O0Y A;  5L8M A;  1P97 A;  2W27 A;  3LIA A;  1BYW A;  1WA9 A;  2KOI A;  3JVU A;  4WEK A;  2VLG A;  3S7N A;  2W1T B;  4DJ3 A;  3MJQ A;  5DKK A;  3UMD A;  5F5Y A;  1YKD A;  3OCN A;  1S66 L;  3B42 A;  2PR6 A;  3K3C A;  3BY8 A;  2GNX A;  3VE3 A;  5HWT A;  3MXQ A;  4R3A A;  1NLY A;  3H82 A;  4E04 A;  3PBQ A;  4EEU A;  3MF0 A;  4ARZ A;  1V9Y A;  4GHI B;  2KDK A;  3KYZ A;  5DJT A;  4HH3 A;  4CQH A;  1W63 Q;  1G28 A;  4F3L A;  4I38 A;  1T1A A;  1N9L A;  3FPW A;  5KSH A;  1EW0 A;  1YAX A;  2W3D A;  2B02 A;  2XRN A;  5DFY A;  1N9N A;  4HQA A;  1T19 A;  1XFQ A;  3CAX A;  4GS9 A;  2HJE A;  1YSP A;  2O99 A;  1DP6 A;  1LT0 A;  3TE8 A;  4HY8 A;  3OLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...