3F1NB

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1nB01
2VV6A 4R3AA 4GS9B 1T19A 3K3CA 4HH3A 3PHYA 2BASA 4GW9A 4I5SA 3UMDA 3F1PA 1D7EA 2V0UA 2GJ3A 2Z6CA 4JGQA 1D06A 1XJ3A 4KUKA 1GSXA 2W27A 1Y28A 2VV7A 3C2WA 4H6JB 5HWVA 1N9NA 3B33A 4BBTA 5DKKA 1T1CA 4RQ9A 3GDIA 5HD3A 4WLAA 3A0VA 1TS0A 3A0RA 1G28A 4I39A 1F9IA 5DJUA 2D02A 4R38A 3E4PA 2K7SA 5DJTA 3UB9A 1LL8A 4HQAA 4F3LA 3E4OA 5AVFA 5TBMB 1MZUA 1S67L 1JNUA 1S4SA 1TS6A 3LIAA 4HP4A 4DJ3A 2QKPA 5HZHA 3VOLA 2HV1A 2VV8A 3F1NA 3KX0X 2PD7A 3VE3A 4H6JA 2VLGA 3NOTC 1P0ZA 4NXFA 1OT6A 2QJ7A 3H82B 2ZBBA 4R70A 3F1PB 1P97A 5HD5A 3FC7A 3HJIA 1BYWA 2PYRA 3LIEA 4GHIB 2OOLA 3ZQ5A 4E04A 1T1AA 4HY8A 2QJ5A 1DP8A 1X0OA 2YKHA 3IS2B 1GSVA 1DP6A 4NXBA 5F6AA 1OTEA 1F98A 3CLOA 4XT2A 3P7NA 4JGOA 4HOIA 3D72A 4EW7A 4WL9A 4LLOB 4I3JA 3LIFA 5I5LA 5A8BA 2QWSA 4BBVA 4JGRA 2PYPA 1N9LA 3EEHA 2M1CA 3A0SA 5F68A 3EWKA 2R78A 1WA9A 4L9FA 2L4RA 5G4ZA 4R6LA 3VE4A 2OWHA 4HH2A 2Z6DA 3LI9A 2YKFA 4XT2B 2V9AA 5EFWA 3RTYA 1OTBA 3IBRA 4PKYA 2V0WA 2ZOHA 5HDCA 5HDDA 2PD8A 4HHDA 1LT0A 2INWA 5IU1A 4EERA 4EETB 1DP9A 3H9WA 1S1ZA 1VB6A 2A24A 2QHKA 3H82A 3PYPA 4YWZA 1OTDA 2VEAA 1LSXA 3BY9A 3LIDA 4NXGA 3BWLA 2EA9A 4I38A 2P7JA 2JN7A 3LIBA 1OTAA 5AVEA 3K3DA 2JHEA 3T50A 5KIZA 3UMEA 4K08A 4DJ2A 1EW0A 1V9YA 3LICA 1S1YA 3F1OA 3LYXA 4HJ6A 3RH8B 1XJ6A 5HSQA 2KDKA 2ZOIA 1GSWA 1T18A 3MXQA 4HNBA 2WKRA 5HWTA 3LI8A 5J3WA 1ODVA 2PR5A 4EEUA 1NWZA 5F5YA 1N9OA 2J80A 1OTIA 2W0NA 2KX6A 1KOUA 3H7WA 3NOUC 4GCZA 3H7WB 4HJ4A 4HIAA 3UB7A 1T1BA 1XJ2A 2H28A 3E4QA 3MQQA 4I3AA 4GHIA 5J7EA 3SW1A 3UB8A 4EESA 1LSVA 1UGUA 3CWFA 2PDRA 4WUJA 3MFXA 3G6OA 1XJ4A 2B02A 3HJKA 4MN6A 3UB6A 2WKQA 4HI4A 1DRMA 1UWPX 1OT9A 4HP9A 4EQ1A 3NJAA 2PHYA 3F1NB 4JGPA 3GECA 4EXOA 4KUOA 2V1BA 4LRXC 1XFQA 3MR0A 4L9EA 4NXEA 4L9GA 2V1AA 1TS8A 5HDSA 5HWWA 4WN5A 2PR6A 4WF0A 4HJ3A 3IS2A 2OWJA 2D01A 2WKPA 4LPZA 3OLOA 3CAXA 3LUQA 5TBMA 4BBUA 4F3LB 2L1MA 4KQDA 1XFNA 1LSWA 2L0WA 1TS7A 4GS9A 5F69A 3F1OB 4M4XA 1OJ5A 3NHQA 2CMNA 1V9ZA 1S4RA 2I9VA 3ULFA 3FG8A 3MQOA 5G4YA 4LRZE 3ICYA 5IS1A 3NOPC 5J4EA 4B9OA 4EEPA 3C8CA 4MN5A 3UE6A 3BY8A 1S66L 1OJGA 1UWNX 3MJQA 4PKYG 4LRYC 4I3IA 5DKLA 2A24B
chains in the Genus database with same CATH superfamily
3DAVA 5IT5A 4R3AA 1T19A 4HBTA 5GL9A 4JGQA 3VFHA 1J9MA 5DKKA 4OOMA 1ERMA 2EX9A 4MN7A 2P74A 3VSLA 1LI0A 2QYBA 1YLWA 3C7VA 3UB9A 2G2WA 2XK1A 4X25A 2OLVA 1TS6A 4IHQA 1CEFA 3Q7ZA 2R9WA 2UWXA 4OKPA 1P0ZA 4R3JA 3CI6A 4WYYA 2H5SA 4UA9A 4CQHA 2OOLA 4P6ZM 5GLCA 4GKUA 1JVJA 3QHYA 4WL9A 4LLOB 1IOUA 1Q2QA 1VETB 5JYPA 3S1YA 1NYYA 2INWA 4EETB 1YLTA 3LIDA 2HDRA 3T50A 1BLPA 3K3DA 4ID4A 1XJ6A 4X53A 1NWZA 2OAP1 3C38A 2W1TA 2XF3A 1EWZA 2PU4A 3WWXA 1ALQA 4AFIA 3CWFA 3IX3A 3FYZA 2EWVA 1H8MA 4WZ5A 2J3TC 4PM5A 1ZHHB 2GDNA 4LPZA 5C5KA 4QU3A 2K2NA 4D2OA 1CJFA 2WAEA 3ICYA 2WZXA 4Q0IA 3TOIA 2VX8A 1S66L 3EQUA 5FI7A 2VV6A 3T4JA 4HH3A 4B93A 3TSGA 4DDYA 1PFLA 1Y28A 2G7UA 4NG2A 1BLCA 1ZTUA 4B4ZA 4ZAMA 5CEDA 4R38A 1NYMA 3OC2A 2WK0A 2IWCA 5TBMB 4X6TA 3MQ0A 1JNUA 4DJ3A 2QKPA 5CX7A 2OSUA 3QP1A 4S2KA 4WM9A 3HLFA 1H8YA 3CUEA 4JGOA 5J8XA 2JE5A 2ZQCA 4JKTA 4EU0A 3AGEA 5EM1A 3DTKA 4KQRA 4YNRA 1N4OA 3MXRA 4L9FA 4DRTA 3VE4A 4UAAA 2Y79A 5FQQA 3OZHA 5CGXA 2HP6A 2VEAA 1L0DA 1YSQA 2P7JA 3ZNYA 3C4OA 2VGLM 1Y54A 2VGKA 4JPMA 4O8GA 3F1OA 1PIOA 1C3BA 1T18A 4HNBA 3HREA 1YLYA 2W0NA 1K55C 1ES5A 3UB8A 1XA7A 4OPYA 2Y2MA 3MFDA 3T4KA 3Q81A 2ZLYA 5GLAA 3IS2A 2VGJA 4BBUA 1YSPA 3JVUA 1MWSA 2WKEA 2Y2IA 3MKFA 4IJGA 2J3WA 5FI2A 2Y2NA 5FA7A 5A92A 4C6YA 1KGEA 3LR4A 2W27A 5GHXA 1NZOA 3O86A 4Q8IA 4JXVA 4MLLA 4QD4A 3E4PA 3Q7VA 5DJTA 3WS1A 3NC8A 2J9PA 1H8ZA 1E4DA 2VK3A 1W7FA 4U3TA 1HTZA 4XUXA 3G32A 3PBSA 2J9OA 2QJ5A 1M40A 3C7UA 5FEGA 2HP9A 1DP6A 1RCJA 2LB5A 4OQ0A 5HAQA 1VM1A 1WA9A 3ZCZA 1NLZA 4FTXA 4LV1A 1MBLA 5HDDA 1NLYA 2PD8A 1BSGA 1LT0A 3HCYA 3W4PA 4FUWA 4U0TA 2XR0A 2A2LA 4PM7A 3V39A 1G6OA 5KIZA 3B47A 3NBLA 3VP3A 1S1YA 2O9BA 2WKRA 2ZMVA 5FAQA 3N7WA 3BLSA 1ES4A 3W2ZA 1OTIA 3UPNA 3MMHA 2KX6A 1KOUA 4HJ4A 3WS2A 3E4QA 3WS5A 2E8JA 4GZBA 3NECA 2R9XA 1MWRA 4IUHA 3GECA 2IWDA 5HDSA 5HWWA 4PM9A 1F2KA 2OV5A 2DMWA 4PMAA 3LUQA 3FZCA 4Y0OA 4GS9A 3W4OA 3BLMA 3A3JA 3IF5A 3O3VA 2H10A 4KUKA 3QP6A 4PM8A 2HDQA 3WS4A 1MWUA 2BTFP 1K4EA 2VZWA 2OAQ1 5E2FA 1NZUA 4HQAA 3PBQA 5AVFA 3V3RA 3I7JA 3VFFA 5FDSA 4HP4A 1IELA 1XGJA 1YMSA 2KOIA 1YT4A 3KSGA 2Y2KA 1XX2A 2VLGA 4C3QA 5HL6A 4JF5A 1XA1A 3BFDA 4MBFA 4CPKA 2Y2JA 3R7WA 1K55A 2DRWA 3QNCA 3W8KA 4DE0A 5HX9A 2QWSA 2ZMAA 1N9LA 5A93A 3BFFA 4C75A 5HDCA 2WUQA 3D3OA 3UN7A 1DP9A 2QHKA 4YWZA 4CLCA 5AQ7A 2M7VA 1TDLA 1JWVA 4P85A 2WKIA 1PYYA 2WGIA 4LCLA 1NRJA 4U0XA 4O7DA 5JYOA 1NRFA 1W8YA 4LFUA 4E3NA 2G2UA 3H7WB 2O9CA 1GA9A 2V20A 1AWIA 3BECA 5HARA 2AVXA 2I72A 4FH2A 4EBPA 2ZQ9A 3UPOA 2Q9NA 4RYEA 3ITAA 5GHYA 2CC1A 3G30A 2WGVA 4XXRA 2Y2PA 2I9VA 1HZOA 3NOPC 3RXXA 4EEPA 3C8CA 4IEDA 1K38A 3GR2A 3RXWA 4Z1WA 2XROA 2JBFA 2V8CA 3V50A 1U60A 3ZG8B 5EM0A 1MY8A 3JYIA 2K7SA 5FATA 1ERQA 4IUKA 1OMEA 1S67L 3OPHA 3GV9A 3BJNA 3CPTB 1GA0A 3E98A 3GMWA 2B95A 5CTNA 2QJ7A 3S7QA 2HDSA 4E6XA 1K54A 5FQJA 1F98A 3P7NA 5TFQA 2B5RA 2UV0E 4IVIA 3EEHA 2WZZA 2Z6DA 1FIKA 4RVAA 2GZAA 2V0WA 5FAPA 3PR6A 4EERA 2P08A 3IF6B 1BUEA 3OPLA 5A90A 4OQIA 4NXGA 2EA9A 2JN7A 5FL3A 3UMEA 1LL5A 2WYXA 3IXGA 2Q0OA 1STZA 3MXQA 3LI8A 1DJBA 1N9OA 4MBKA 1N9BA 3A3IA 5FAOA 3NOUC 5EUAA 5EE8A 5EVLA 3FPVA 4EV4A 4EESA 1ACFA 3RJUA 1S0WA 3UB5P 2XH9A 1SHVA 3MR0A 5FASA 3GTCA 1GHMA 2KLIA 2XDMA 1MKIA 2L1MA 1BZAA 4KZ3A 2FH5A 3JVVA 3ZDJA 2Y8HA 3UDXA 4S2MA 4GW9A 2XA7S 5DFYA 2O0YA 3O5YA 3BFCA 3C5AA 1MWTA 3HUMA 2XSSA 3NI9A 3P98A 3IWQA 4ETZA 2ZMFA 4OONA 1MZUA 3UE0A 4WMCD 3U4LP 2XD1A 1PZOA 1L0EA 4H6JA 4JF4A 4MBHA 4P6BA 3BFEA 4YOFA 4N1XA 4QPRA 2JKTM 1CI8A 2M1CA 3A0SA 2JC7A 4OP5A 1FSWA 2K31A 2ZD8A 2ZM2A 4KG6A 4CLCD 1VB6A 2A24A 3PYPA 1ES3A 5EPHA 2X01A 3SS4A 4LV0A 5EOEA 2JHEA 3FPWA 4ZBEA 5J3WA 4RA7A 4EBNA 2J80A 1K4FA 4GJ4A 1YMXA 3MQQA 3ZVWA 3IX8A 1LSVA 5AJGA 3IH9A 3O87A 4HI4A 2X02A 1YLPA 3HLEA 4JGPA 2V2FF 4QWOA 4LRXC 5E2GA 1SKOB 1FCMA 2W3GA 2EXBA 1NY0A 2WKPA 4Z9QA 1IYOA 3MZEA 3BEBA 2WKHA 1BULA 4K91A 1KE3A 1K56D 1V9ZA 3PAEA 3V67A 1CI9A 3A0RA 4GS9B 3BQAA 2BASA 3S7PA 2HDUA 1MC0A 4I5SA 2V0UA 4Y7PA 3UDIA 1D06A 1K54C 4DXCA 3TW8A 3ZVTA 3C4PA 5HD3A 1G68A 4CLCB 4KZ9A 5EV0A 4WEKA 3S7OA 1LL8A 2ZL1B 2Y2GA 1L2SA 5FI6A 5HD5A 1BYWA 4ETXA 1X0OA 1GSVA 5KMWA 3Q1FA 1BTLA 1FOFA 3TG9A 3A3EA 2XRNA 2PT7A 3EEAA 2PYPA 2X71A 2HP5A 5CEBA 2WGWB 4DE2A 2XA7M 1GCEA 1IYSA 1I2SA 3LR3A 4NKPA 5FSRA 4S2NA 4HJ6A 4HBUA 2KDKA 5HWTA 4EQIA 3UE3A 1KDWA 3T4OA 2GX5A 1G5UA 4Q0HA 3HUNA 1VETA 2ZM8A 3SW1A 2IA2A 1PWCA 3IHBA 4EXOA 2JKRM 1S6RA 4L9EA 3KSHA 1F5MA 3OLOA 1P9WA 1PW8A 1J3WA 3FG8A 3MQOA 4B9OA 3N8RA 4R0QA 3LCEA 5BOHA 3CZDA 4ARZB 3BQ8A 4BJPA 2Z6CA 4R1GA 1ZG4A 2W1RA 4YINA 1T1CA 4ZJ1A 4GDBA 3T1SA 3T4TA 4B4XA 4F3LA 3VP1A 3QP8A 2PBYA 2ZC4B 1EROA 2HV1A 1NJ4A 3GRJA 4E3LA 3DTMA 2J7VA 1OT6A 1E3UA 2ACGA 3BM6A 4HEFA 3HJIA 4GN2A 4OPZA 3IQAA 3D4FA 3D9YA 3T4LA 3ZGAB 3LR5A 3CPTA 5HPIA 2R78A 3A3FA 2L4RA 1ESIA 5FQMA 5FEFA 3H9WA 5DF8A 1ESUA 3BWLA 3ZNTA 4YFMA 3DW0A 3CUEC 3RH8B 3O88A 4DF6A 4RX3A 3L7HA 2ZOIA 3M2KA 4BMWA 1O7EA 2ZC7A 2PR5A 5F5YA 3P09A 3UB7A 5EVID 2QPNA 4BL2A 1ONGA 2B02A 3RFBA 2PAVP 3SH7A 1YLZA 3F1NB 4OPRA 4OQHA 1PWGA 2V1AA 4KZAA 3M6BA 5EVEA 4IVKA 2VGLS 3BW6A 1OJ5A 4QHCA 2ZM0A 1KVLA 4LRZE 3IWOA 1RP5A 5EVIC 4GD6A 3MJQA 5E2EA 2A24B 4E3OA 4WBGA 3UMDA 2GJ3A 3G31A 2VV7A 3ITBA 1PW1A 1BT5A 2MJ6A 3WS0A 5CGSA 4Y0UA 3IXBA 4OOYA 3DBAA 3DTIA 3T4QA 3VE3A 3EQVA 4DMZA 1H5XA 4S2OA 4PM6A 1P97A 4UHUA 4GHIB 4ARZA 2A3UA 2O9AA 5F6AA 5CGWA 4FD8A 1XPBA 4LV3A 4ZTKA 3SH8A 1MPLA 2YKFA 4IBRA 1OTBA 2QMIA 4Q0JA 2HJ9C 4Y5FA 5DTKA 3H82A 1OTDA 2Y4AA 4RX2A 5DTSA 4DKIA 5DVAA 3B42A 1EW0A 3MKEA 1SDNA 5L2FA 4GLQA 4DN0A 1FR6A 4Y0TA 1JTGA 3UB6A 1SKFA 3PBRA 4NXEA 1W79A 1KDSA 4L9GA 5FQIA 3JPUA 1I2WA 2PR6A 3MBZA 3CAXA 1TEMA 1XXMA 4QB8A 5F69A 2CMNA 2EWWA 2VA0A 4Y17A 5CRFA 4WELA 5EECA 3ZHHA 3BYDA 4I3IA 4S2PA 1W63M 4BL3A 4CLCC 3IXDA 1FCNA 3CG5A 3DTEA 4GOGA 5FDHA 4I39A 1G6AA 2XFSA 2V1ZA 3SS3A 3VP4A 1FILA 5DF7A 4FCFA 1DJCA 1IKGA 3ZG9B 1YKDA 2RL3A 4UA6A 4MMNA 4EWFA 1JWPA 2ZC6B 1K6RA 2XD5A 2NUTC 3H82B 3UE1A 3F1PB 4WZ5C 3DWKA 3PBOA 1OTEA 3N8LA 3IXHA 3CLOA 4OLDA 1FCOA 1YQSA 2PU2A 3HLDA 3IT9A 4BBVA 4X69A 4JLFA 5HFOA 4HH2A 5EFWA 3RTYA 5FQ9A 5HPFA 1M6KA 3KSIA 4LENA 3VP0A 2JKTI 5TGFA 1OTAA 1QMFA 5CECA 1LL9A 4UA7A 1TD5A 1GSWA 5EOOA 4I3AA 4UEYA 4EUVA 3M6HA 3MFXA 3VP2A 3HJKA 3DWZA 5DF9A 1OT9A 2PHYA 1FSYA 4E3KA 4WN5A 1HLUP 3G2ZA 2BG1A 4HJ3A 5GLDA 1K57C 3FWLA 4KQDA 4KZBA 3KYZA 3E2KA 3VSKA 3TE8A 5HW3A 4D60A 3IBJA 3Q07A 4BWIA 3F1PA 2ZJ9A 2A49A 2Y2QA 5F1FA 5HWVA 4H6JB 1CF0A 3SH9A 4N9KA 4A5RA 1TS0A 3MXSA 4UQIS 3LY4A 3UNWA 3WRZA 1BLSA 4X55A 2Z2LB 4K0WA 4MCWA 3F1NA 5HAIA 2C5WB 3LEQA 5CHJA 4R4SA 4BD1A 4KQOA 1ZC2A 2YKHA 4G3VA 4Y2FA 1K0KA 1H3QA 4EW7A 3LIFA 1Z09A 5D3OA 2HF6A 4S2LA 5F68A 3EWKA 3KYEA 4R6LA 2OWHA 4BQMA 1HVBA 2EXAA 3MF0A 2PRFA 3S22A 3IF6C 4O01A 3HL9A 1L0GA 3W4QA 5F83A 2Y55A 4I38A 4BD0A 1V9YA 3CHWP 3GQZA 2M7UA 1PNEA 1KVMA 4EEUA 3ISGA 4ZJ3A 5U47A 4O0PA 1UGUA 2PDRA 1UWPX 4HP9A 2QZ6A 1OPXA 4KUOA 1SDEA 1JTDA 1VEUA 1CQAA 2D01A 1XFNA 3F1OB 4ESPA 3GVBA 3IHAA 5G4YA 3T4SA 3SZTA 4QJGA 4PKYG 4LRYC 3GSGA 4DE1A 3K3CA 3T1XA 3HLGA 2JKFA 2EX2A 4Y13A 3AGFA 2O99A 4KENB 4Y3IA 5GHZA 3T1RA 1YM1A 4H8RA 3Q82A 5DJUA 3HBRA 3G2YA 3CJMA 2ZQDA 3SOIA 3IH8A 3OCLA 5AQAA 3LIAA 2ZC3B 4S2IA 5EVIB 5KSCA 4G3WA 1ONHA 1VQQA 1K25A 3G35A 3ZQ5A 1T1AA 4HY8A 3NY4A 2H0YA 4HOIA 2EFXA 3D72A 5G18A 3ZYTA 3K2NA 3UY6A 5L10A 3IBRA 2WGWA 3V3SA 4XUZA 2FFFB 1VHMA 3BRMA 5IU1A 1DJAA 4L0LA 3HLWA 2P9VA 4EBLA 2RCXA 2FFYA 2XGNA 4P87A 4N9LA 1RGYA 1FQGA 4GCZA 2XLNA 2H28A 3HVFA 3LFVA 5TR7A 5KZHA 3G6OA 4EQ1A 4LCMA 1ZKJA 4KG5A 3NDEA 4K0XA 3UPPA 2OWJA 3LO7A 4P0MA 3IF6A 2L0WA 4JXGA 2W3FA 4MN5A 1UWNX 4FOFA 1D7EA 4EUZA 1KE0A 3IWIA 5AQBA 1AXBA 5F82A 1N9NA 4OPQA 2C6WB 1PWDA 4NEED 4ZJ2A 4BBTA 4RQ9A 1G28A 4M3KA 2PBDP 4JF6A 3FKWA 4E3IA 2GNXA 2DCFA 3ZG5A 2Y59A 5HZHA 4P6ZS 3IX4A 4LGWA 4GDNA 3FV7A 5E43A 2J3TD 3NOTC 4MDZA 4X1LA 3FC7A 4JBFA 3OPRA 3WRTA 4R4RA 3IS2B 5HAPA 5IHVA 1IYPA 4PPRA 4WZ4A 4ZRRA 2JCHA 5K5BA 3C30A 2V9AA 2BLSA 4S2JA 1PRQA 5AQ9A 4UQIM 4QY5A 1I5QA 4X56A 3MZFA 1S1ZA 3QP5A 5L8MA 3AGDA 1CK3A 5M19A 3R4KA 4K08A 3LICA 1D1JA 4KZ5A 4ME4A 1ODVA 4PHTA 5CERA 4F94A 5J7EA 1TF1A 1XJ4A 5L07A 4DXBA 3VOYA 2ZQ8A 1IYQA 4LV2A 3LR0A 1LSWA 5GLBA 1LI9A 3CMZA 1H0MA 2Z2MB 3UE6A 5MC7A 1IKIA 1OJGA 5DKLA 5M1AA 3G4PA 3MZDA 3PHYA 1E25A 3U2AA 4N92A 3B33A 3A0VA 2EX8A 2JKRI 4E3MA 2D02A 4DE3A 3E4OA 4R3BA 1S4SA 2W3DA 3HLBA 3VOLA 2VV8A 2IWBA 4X1MA 4JXSA 3LIEA 4E04A 3EOIA 4NXBA 4OH0A 1WE4A 3T1QB 4HESA 5I5LA 2WAFA 2W3EA 4GD8A 1MKMA 2WADA 3LI9A 3PXPA 3EGDC 4PKYA 1PI5A 2Y91A 3UO9A 3QP2A 3LEZA 4MNRA 1QMEA 2J8YA 1KGFA 3LIBA 3OCNA 4KQQA 4DJ2A 3B3XA 3G34A 3MSHA 5HSQA 5CHMA 1XGIA 3LGOA 1SCWA 1TVFA 3OPPA 4G3KA 4HIAA 4GHIA 4WUJA 4FH4A 5DFXA 4MN6A 1DRMA 2Y2LA 3NJAA 1W5DA 4IBXA 4NETA 1E3UD 4Y15A 5DTTA 3T12B 1TS7A 2H0TA 3NDGA 2Y2OA 4GNUA 4CLCE 3ZG7B 1A0KA 3BY8A 1PI4A 1K6SA 1P9RA 1BLHA 3PBNA 2ZL1A 1GSXA 1Q2PA 3N6IA 1VEUB 3C2WA 4KZ6A 2P9VB 3GDIA 4KZ7A 2FZ0A 3S4XA 3NULA 3N8SA 1GHIA 3TJZC 3QP4A 2ZC5B 3PAGA 3UDFA 4GB7A 1YPRA 4NXFA 1WYBA 4R70A 2NUPC 3ZFZA 2PYRA 1YAXA 3NIAA 5EVIA 1Y4OA 1DP8A 4XT2A 4OP8A 2HJEA 4WEJA 2P04A 5CTMA 4PAUA 3VOZA 1KE4A 2HGVA 4JGRA 4KZ8A 5F1GA 4WMCA 5A91A 4MEZA 4XT2B 3A3DA 3PBTA 1IFQA 1SKOA 4HHDA 1K57A 4JXWA 1PZPA 1LSXA 3BY9A 3PTEA 2V8FA 1LHYA 4OOLA 1LLBA 3LY3A 3P01A 1W63Q 3VV4A 5CHUA 2W3HA 4OQGA 3H7WA 2JKGA 4DDSA 1O07A 1IEMA 2WKQA 3HLCA 3L9KA 5A8BA 1GHPA 3EGXC 2EFUA 2V1BA 5E2HA 4OVDA 5FQKA 4WF0A 2DNSA 4M4XA 3MS6A 4CJNA 3OBFA 4BENA 5J4EA 1EI5A 2W1TB 4FSFA 5HL1A 1XJ3A 2XQZA 4KZ4A 3CITA 3R7WB 4WLAA 1F9IA 4II7A 5KSHA 2ZQ7A 1K56A 4BLMA 3KYQA 1FR1A 1XP4A 1NXYA 1KGGA 2Y2HA 3ZG0A 3BFGA 3KX0X 2PD7A 2ZBBA 3N4IA 1ZG6A 5CXWA 4E3JA 1ES2A 1L3LA 4ZDXA 2LB9A 1W8QA 1XKZA 1RGZA 3M2JA 4I3JA 4QY6A 2XEPA 5I94A 4R23A 2B18A 5G4ZA 4B88A 1YLJA 3KO6A 2ZOHA 2EX6A 2HPBA 1TDGA 2HZ5A 2OLUA 3SS5A 3VMAA 3E2LA 5AVEA 3LYXA 2E8IA 1HD8A 2Q9MA 1WYCA 3NCKA 4NK3A 1MXOA 3QNBA 3KSFA 3Q7VB 5L09A 1T1BA 1XJ2A 1DY6A 5TJJA 3E0YA 2VKSA 4X68A 4OLGA 3FKVA 1SZVA 1CEGA 1XFQA 2XFTA 1Z6FA 3TRCA 4KG2A 3HUOA 1TS8A 4E6WA 3V5MA 4S2NC 5TBMA 4F3LB 3OOVA 1JWZA 3NHQA 1S4RA 5LBRA 3S7NA 3ULFA 2VJWA 5IS1A 5M18A 2ZQAA 4N1HA 1L0FA
chains in the Genus database with same CATH topology
5IT5A 4R3AA 4Z1WA 1T19A 2XROA 4FOFA 3UMDA 1D7EA 4JGQA 2GJ3A 2VV7A 1N9NA 4BBTA 4NEED 5DKKA 4RQ9A 4OOMA 4MN7A 1G28A 2MJ6A 2QYBA 2K7SA 3UB9A 4IUKA 1S67L 3DBAA 1TS6A 4IHQA 2GNXA 5HZHA 4P6ZS 3T4QA 3BJNA 3VE3A 2J3TD 3E98A 3EQVA 3NOTC 1P0ZA 4DMZA 4MDZA 2QJ7A 3CI6A 1P97A 3FC7A 4GHIB 3S7QA 4ARZA 4CQHA 2OOLA 4P6ZM 3IS2B 2O9AA 5F6AA 1F98A 3P7NA 4WL9A 4LLOB 4ZRRA 3EEHA 1IOUA 5K5BA 2Z6DA 3C30A 2YKFA 2V9AA 1OTBA 2GZAA 2V0WA 4Q0JA 2HJ9C 4Y5FA 2INWA 4UQIM 3PR6A 4EETB 4EERA 1S1ZA 5L8MA 2P08A 3H82A 1OTDA 3LIDA 4NXGA 2EA9A 2JN7A 3T50A 5FL3A 3K3DA 3R4KA 4K08A 3UMEA 3B42A 1EW0A 3LICA 1XJ6A 3MXQA 1STZA 4GLQA 4DN0A 3LI8A 4ME4A 1ODVA 4PHTA 1NWZA 2OAP1 1N9OA 3C38A 2W1TA 3NOUC 3FPVA 5J7EA 4AFIA 4EESA 3CWFA 1TF1A 1XJ4A 2EWVA 3UB6A 1H8MA 3PBRA 2J3TC 3MR0A 4NXEA 4L9GA 2KLIA 2PR6A 1ZHHB 4LPZA 5C5KA 3CAXA 3LR0A 2L1MA 1LSWA 5F69A 2CMNA 2K2NA 2EWWA 2VA0A 4Q0IA 3ICYA 3UE6A 2FH5A 2VX8A 3JVVA 4WELA 5MC7A 1S66L 1OJGA 3EQUA 5DKLA 4I3IA 2Y8HA 2VV6A 1W63M 3T4JA 4HH3A 3PHYA 4B93A 4GW9A 2XA7S 5DFYA 2O0YA 3O5YA 1Y28A 2G7UA 3U2AA 4CLCC 3B33A 3A0VA 1ZTUA 4I39A 2XSSA 2JKRI 2D02A 4R38A 3OC2A 3E4OA 4ETZA 2ZMFA 5TBMB 1MZUA 3MQ0A 1JNUA 1S4SA 1YKDA 2W3DA 4MMNA 4DJ3A 2QKPA 5CX7A 3VOLA 2VV8A 4H6JA 2NUTC 3H82B 3F1PB 3LIEA 4E04A 3PBOA 3EOIA 4YOFA 4NXBA 1OTEA 3CLOA 3CUEA 4JGOA 4QPRA 2JKTM 4EU0A 5I5LA 4BBVA 4YNRA 2M1CA 2W3EA 3A0SA 4L9FA 3VE4A 2Y79A 1MKMA 3LI9A 4HH2A 5EFWA 3RTYA 3PXPA 3EGDC 4PKYA 2K31A 4CLCD 1VB6A 2A24A 3PYPA 5HPFA 2VEAA 3KSIA 1YSQA 2JKTI 2P7JA 2VGLM 1OTAA 3LIBA 3OCNA 2JHEA 4DJ2A 3FPWA 4O8GA 3F1OA 5HSQA 1TD5A 1GSWA 1T18A 4HNBA 5J3WA 2J80A 2W0NA 4G3KA 4GJ4A 4HIAA 4I3AA 3MQQA 4UEYA 4GHIA 4EUVA 3UB8A 1LSVA 4WUJA 5AJGA 3MFXA 5DFXA 3HJKA 4MN6A 4HI4A 1DRMA 5DF9A 1OT9A 3NJAA 2PHYA 4JGPA 3T4KA 4LRXC 2W3GA 4WN5A 4HJ3A 3IS2A 2WKPA 4BBUA 1YSPA 4KQDA 3JVUA 1TS7A 3KYZA 1V9ZA 3TE8A 4IJGA 4CLCE 2J3WA 3V67A 3BY8A 3A0RA 1P9RA 3IBJA 4GS9B 3BQAA 2BASA 4I5SA 3S7PA 1MC0A 3F1PA 2V0UA 3LR4A 3PBNA 4BWIA 1D06A 1GSXA 2W27A 5HWVA 3C2WA 4H6JB 3TW8A 5HD3A 3GDIA 1TS0A 2FZ0A 4CLCB 4UQIS 3E4PA 4WEKA 5DJTA 3S7OA 1LL8A 3TJZC 4MCWA 3F1NA 4NXFA 4R70A 2NUPC 5HD5A 1BYWA 2PYRA 4KQOA 3PBSA 1YAXA 4ETXA 2QJ5A 1DP8A 1X0OA 2YKHA 1GSVA 1DP6A 4XT2A 2HJEA 2LB5A 4G3VA 4Y2FA 4WEJA 2P04A 2XRNA 4PAUA 1H3QA 4EW7A 2PT7A 3LIFA 3EEAA 2HGVA 4JGRA 2PYPA 2HF6A 5F68A 3EWKA 1WA9A 4R6LA 2OWHA 1NLZA 4XT2B 3PBTA 1IFQA 3MF0A 5HDDA 1NLYA 2PD8A 2XA7M 4HHDA 1LT0A 3HCYA 3LR3A 4O01A 2A2LA 1LSXA 3BY9A 4I38A 1G6OA 4NKPA 5KIZA 3B47A 1V9YA 4HJ6A 1S1YA 4OOLA 2M7UA 2KDKA 5HWTA 2O9BA 3P01A 1W63Q 2WKRA 3VV4A 3UE3A 4EEUA 2ZMVA 2W3HA 3T4OA 2GX5A 3W2ZA 1OTIA 4Q0HA 3MMHA 2KX6A 1KOUA 3H7WA 4HJ4A 3E4QA 3SW1A 4O0PA 1UGUA 2IA2A 2PDRA 4IUHA 2WKQA 1UWPX 4HP9A 5A8BA 3EGXC 4EXOA 3GECA 1OPXA 4KUOA 2V1BA 2JKRM 4L9EA 3KSHA 5HDSA 5HWWA 1F5MA 4WF0A 2DMWA 2D01A 3OLOA 3LUQA 1P9WA 1XFNA 4GS9A 3F1OB 4M4XA 3FG8A 3MQOA 5G4YA 3T4SA 3OBFA 5J4EA 4B9OA 4PKYG 4LRYC 2W1TB 3K3CA 4ARZB 3BQ8A 4FSFA 4BJPA 2Z6CA 1XJ3A 4KUKA 2O99A 4Y3IA 2W1RA 2VZWA 1T1CA 3CITA 3R7WB 4WLAA 2OAQ1 1F9IA 5DJUA 4II7A 3T4TA 5KSHA 4HQAA 4F3LA 3PBQA 5AVFA 3OCLA 3KYQA 3LIAA 4HP4A 2KOIA 3KSGA 2HV1A 3KX0X 2PD7A 4G3WA 2VLGA 5HL6A 1OT6A 2ZBBA 3HJIA 3ZQ5A 1T1AA 4HY8A 2LB9A 3R7WA 4HOIA 3D72A 3ZYTA 4I3JA 2QWSA 3T4LA 1N9LA 3K2NA 2B18A 3LR5A 5HPIA 2R78A 2L4RA 5G4ZA 3IBRA 3KO6A 2ZOHA 5HDCA 1VHMA 3D3OA 5IU1A 1DP9A 3H9WA 4L0LA 2QHKA 4YWZA 4CLCA 2M7VA 3BWLA 5AVEA 3LYXA 3CUEC 3RH8B 2ZOIA 4BMWA 1NRJA 2PR5A 3KSFA 5F5YA 4GCZA 3UB7A 3H7WB 2O9CA 1T1BA 1XJ2A 2H28A 3LFVA 3G6OA 2B02A 5TJJA 3E0YA 3RFBA 2VKSA 4EQ1A 3F1NB 1XFQA 3TRCA 2V1AA 1TS8A 2VGLS 2OWJA 5TBMA 3BW6A 4F3LB 2L0WA 3OOVA 3NHQA 1OJ5A 2I9VA 1S4RA 5LBRA 3S7NA 3ULFA 4LRZE 2VJWA 5IS1A 3NOPC 4EEPA 3C8CA 2W3FA 4MN5A 1UWNX 3MJQA 2A24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV6 A;  4R3A A;  4GS9 B;  1T19 A;  3K3C A;  4HH3 A;  3PHY A;  2BAS A;  4GW9 A;  4I5S A;  3UMD A;  3F1P A;  1D7E A;  2V0U A;  2GJ3 A;  2Z6C A;  4JGQ A;  1D06 A;  1XJ3 A;  4KUK A;  1GSX A;  2W27 A;  1Y28 A;  2VV7 A;  3C2W A;  4H6J B;  5HWV A;  1N9N A;  3B33 A;  4BBT A;  5DKK A;  1T1C A;  4RQ9 A;  3GDI A;  5HD3 A;  4WLA A;  3A0V A;  1TS0 A;  3A0R A;  1G28 A;  4I39 A;  1F9I A;  5DJU A;  2D02 A;  4R38 A;  3E4P A;  2K7S A;  5DJT A;  3UB9 A;  1LL8 A;  4HQA A;  4F3L A;  3E4O A;  5AVF A;  5TBM B;  1MZU A;  1S67 L;  1JNU A;  1S4S A;  1TS6 A;  3LIA A;  4HP4 A;  4DJ3 A;  2QKP A;  5HZH A;  3VOL A;  2HV1 A;  2VV8 A;  3F1N A;  3KX0 X;  2PD7 A;  3VE3 A;  4H6J A;  2VLG A;  3NOT C;  1P0Z A;  4NXF A;  1OT6 A;  2QJ7 A;  3H82 B;  2ZBB A;  4R70 A;  3F1P B;  1P97 A;  5HD5 A;  3FC7 A;  3HJI A;  1BYW A;  2PYR A;  3LIE A;  4GHI B;  2OOL A;  3ZQ5 A;  4E04 A;  1T1A A;  4HY8 A;  2QJ5 A;  1DP8 A;  1X0O A;  2YKH A;  3IS2 B;  1GSV A;  1DP6 A;  4NXB A;  5F6A A;  1OTE A;  1F98 A;  3CLO A;  4XT2 A;  3P7N A;  4JGO A;  4HOI A;  3D72 A;  4EW7 A;  4WL9 A;  4LLO B;  4I3J A;  3LIF A;  5I5L A;  5A8B A;  2QWS A;  4BBV A;  4JGR A;  2PYP A;  1N9L A;  3EEH A;  2M1C A;  3A0S A;  5F68 A;  3EWK A;  2R78 A;  1WA9 A;  4L9F A;  2L4R A;  5G4Z A;  4R6L A;  3VE4 A;  2OWH A;  4HH2 A;  2Z6D A;  3LI9 A;  2YKF A;  4XT2 B;  2V9A A;  5EFW A;  3RTY A;  1OTB A;  3IBR A;  4PKY A;  2V0W A;  2ZOH A;  5HDC A;  5HDD A;  2PD8 A;  4HHD A;  1LT0 A;  2INW A;  5IU1 A;  4EER A;  4EET B;  1DP9 A;  3H9W A;  1S1Z A;  1VB6 A;  2A24 A;  2QHK A;  3H82 A;  3PYP A;  4YWZ A;  1OTD A;  2VEA A;  1LSX A;  3BY9 A;  3LID A;  4NXG A;  3BWL A;  2EA9 A;  4I38 A;  2P7J A;  2JN7 A;  3LIB A;  1OTA A;  5AVE A;  3K3D A;  2JHE A;  3T50 A;  5KIZ A;  3UME A;  4K08 A;  4DJ2 A;  1EW0 A;  1V9Y A;  3LIC A;  1S1Y A;  3F1O A;  3LYX A;  4HJ6 A;  3RH8 B;  1XJ6 A;  5HSQ A;  2KDK A;  2ZOI A;  1GSW A;  1T18 A;  3MXQ A;  4HNB A;  2WKR A;  5HWT A;  3LI8 A;  5J3W A;  1ODV A;  2PR5 A;  4EEU A;  1NWZ A;  5F5Y A;  1N9O A;  2J80 A;  1OTI A;  2W0N A;  2KX6 A;  1KOU A;  3H7W A;  3NOU C;  4GCZ A;  3H7W B;  4HJ4 A;  4HIA A;  3UB7 A;  1T1B A;  1XJ2 A;  2H28 A;  3E4Q A;  3MQQ A;  4I3A A;  4GHI A;  5J7E A;  3SW1 A;  3UB8 A;  4EES A;  1LSV A;  1UGU A;  3CWF A;  2PDR A;  4WUJ A;  3MFX A;  3G6O A;  1XJ4 A;  2B02 A;  3HJK A;  4MN6 A;  3UB6 A;  2WKQ A;  4HI4 A;  1DRM A;  1UWP X;  1OT9 A;  4HP9 A;  4EQ1 A;  3NJA A;  2PHY A;  3F1N B;  4JGP A;  3GEC A;  4EXO A;  4KUO A;  2V1B A;  4LRX C;  1XFQ A;  3MR0 A;  4L9E A;  4NXE A;  4L9G A;  2V1A A;  1TS8 A;  5HDS A;  5HWW A;  4WN5 A;  2PR6 A;  4WF0 A;  4HJ3 A;  3IS2 A;  2OWJ A;  2D01 A;  2WKP A;  4LPZ A;  3OLO A;  3CAX A;  3LUQ A;  5TBM A;  4BBU A;  4F3L B;  2L1M A;  4KQD A;  1XFN A;  1LSW A;  2L0W A;  1TS7 A;  4GS9 A;  5F69 A;  3F1O B;  4M4X A;  1OJ5 A;  3NHQ A;  2CMN A;  1V9Z A;  1S4R A;  2I9V A;  3ULF A;  3FG8 A;  3MQO A;  5G4Y A;  4LRZ E;  3ICY A;  5IS1 A;  3NOP C;  5J4E A;  4B9O A;  4EEP A;  3C8C A;  4MN5 A;  3UE6 A;  3BY8 A;  1S66 L;  1OJG A;  1UWN X;  3MJQ A;  4PKY G;  4LRY C;  4I3I A;  5DKL A;  2A24 B; 
#chains in the Genus database with same CATH topology
 3DAV A;  5IT5 A;  4R3A A;  1T19 A;  4HBT A;  5GL9 A;  4JGQ A;  3VFH A;  1J9M A;  5DKK A;  4OOM A;  1ERM A;  2EX9 A;  4MN7 A;  2P74 A;  3VSL A;  1LI0 A;  2QYB A;  1YLW A;  3C7V A;  3UB9 A;  2G2W A;  2XK1 A;  4X25 A;  2OLV A;  1TS6 A;  4IHQ A;  1CEF A;  3Q7Z A;  2R9W A;  2UWX A;  4OKP A;  1P0Z A;  4R3J A;  3CI6 A;  4WYY A;  2H5S A;  4UA9 A;  4CQH A;  2OOL A;  4P6Z M;  5GLC A;  4GKU A;  1JVJ A;  3QHY A;  4WL9 A;  4LLO B;  1IOU A;  1Q2Q A;  1VET B;  5JYP A;  3S1Y A;  1NYY A;  2INW A;  4EET B;  1YLT A;  3LID A;  2HDR A;  3T50 A;  1BLP A;  3K3D A;  4ID4 A;  1XJ6 A;  4X53 A;  1NWZ A;  2OAP 1;  3C38 A;  2W1T A;  2XF3 A;  1EWZ A;  2PU4 A;  3WWX A;  1ALQ A;  4AFI A;  3CWF A;  3IX3 A;  3FYZ A;  2EWV A;  1H8M A;  4WZ5 A;  2J3T C;  4PM5 A;  1ZHH B;  2GDN A;  4LPZ A;  5C5K A;  4QU3 A;  2K2N A;  4D2O A;  1CJF A;  2WAE A;  3ICY A;  2WZX A;  4Q0I A;  3TOI A;  2VX8 A;  1S66 L;  3EQU A;  5FI7 A;  2VV6 A;  3T4J A;  4HH3 A;  4B93 A;  3TSG A;  4DDY A;  1PFL A;  1Y28 A;  2G7U A;  4NG2 A;  1BLC A;  1ZTU A;  4B4Z A;  4ZAM A;  5CED A;  4R38 A;  1NYM A;  3OC2 A;  2WK0 A;  2IWC A;  5TBM B;  4X6T A;  3MQ0 A;  1JNU A;  4DJ3 A;  2QKP A;  5CX7 A;  2OSU A;  3QP1 A;  4S2K A;  4WM9 A;  3HLF A;  1H8Y A;  3CUE A;  4JGO A;  5J8X A;  2JE5 A;  2ZQC A;  4JKT A;  4EU0 A;  3AGE A;  5EM1 A;  3DTK A;  4KQR A;  4YNR A;  1N4O A;  3MXR A;  4L9F A;  4DRT A;  3VE4 A;  4UAA A;  2Y79 A;  5FQQ A;  3OZH A;  5CGX A;  2HP6 A;  2VEA A;  1L0D A;  1YSQ A;  2P7J A;  3ZNY A;  3C4O A;  2VGL M;  1Y54 A;  2VGK A;  4JPM A;  4O8G A;  3F1O A;  1PIO A;  1C3B A;  1T18 A;  4HNB A;  3HRE A;  1YLY A;  2W0N A;  1K55 C;  1ES5 A;  3UB8 A;  1XA7 A;  4OPY A;  2Y2M A;  3MFD A;  3T4K A;  3Q81 A;  2ZLY A;  5GLA A;  3IS2 A;  2VGJ A;  4BBU A;  1YSP A;  3JVU A;  1MWS A;  2WKE A;  2Y2I A;  3MKF A;  4IJG A;  2J3W A;  5FI2 A;  2Y2N A;  5FA7 A;  5A92 A;  4C6Y A;  1KGE A;  3LR4 A;  2W27 A;  5GHX A;  1NZO A;  3O86 A;  4Q8I A;  4JXV A;  4MLL A;  4QD4 A;  3E4P A;  3Q7V A;  5DJT A;  3WS1 A;  3NC8 A;  2J9P A;  1H8Z A;  1E4D A;  2VK3 A;  1W7F A;  4U3T A;  1HTZ A;  4XUX A;  3G32 A;  3PBS A;  2J9O A;  2QJ5 A;  1M40 A;  3C7U A;  5FEG A;  2HP9 A;  1DP6 A;  1RCJ A;  2LB5 A;  4OQ0 A;  5HAQ A;  1VM1 A;  1WA9 A;  3ZCZ A;  1NLZ A;  4FTX A;  4LV1 A;  1MBL A;  5HDD A;  1NLY A;  2PD8 A;  1BSG A;  1LT0 A;  3HCY A;  3W4P A;  4FUW A;  4U0T A;  2XR0 A;  2A2L A;  4PM7 A;  3V39 A;  1G6O A;  5KIZ A;  3B47 A;  3NBL A;  3VP3 A;  1S1Y A;  2O9B A;  2WKR A;  2ZMV A;  5FAQ A;  3N7W A;  3BLS A;  1ES4 A;  3W2Z A;  1OTI A;  3UPN A;  3MMH A;  2KX6 A;  1KOU A;  4HJ4 A;  3WS2 A;  3E4Q A;  3WS5 A;  2E8J A;  4GZB A;  3NEC A;  2R9X A;  1MWR A;  4IUH A;  3GEC A;  2IWD A;  5HDS A;  5HWW A;  4PM9 A;  1F2K A;  2OV5 A;  2DMW A;  4PMA A;  3LUQ A;  3FZC A;  4Y0O A;  4GS9 A;  3W4O A;  3BLM A;  3A3J A;  3IF5 A;  3O3V A;  2H10 A;  4KUK A;  3QP6 A;  4PM8 A;  2HDQ A;  3WS4 A;  1MWU A;  2BTF P;  1K4E A;  2VZW A;  2OAQ 1;  5E2F A;  1NZU A;  4HQA A;  3PBQ A;  5AVF A;  3V3R A;  3I7J A;  3VFF A;  5FDS A;  4HP4 A;  1IEL A;  1XGJ A;  1YMS A;  2KOI A;  1YT4 A;  3KSG A;  2Y2K A;  1XX2 A;  2VLG A;  4C3Q A;  5HL6 A;  4JF5 A;  1XA1 A;  3BFD A;  4MBF A;  4CPK A;  2Y2J A;  3R7W A;  1K55 A;  2DRW A;  3QNC A;  3W8K A;  4DE0 A;  5HX9 A;  2QWS A;  2ZMA A;  1N9L A;  5A93 A;  3BFF A;  4C75 A;  5HDC A;  2WUQ A;  3D3O A;  3UN7 A;  1DP9 A;  2QHK A;  4YWZ A;  4CLC A;  5AQ7 A;  2M7V A;  1TDL A;  1JWV A;  4P85 A;  2WKI A;  1PYY A;  2WGI A;  4LCL A;  1NRJ A;  4U0X A;  4O7D A;  5JYO A;  1NRF A;  1W8Y A;  4LFU A;  4E3N A;  2G2U A;  3H7W B;  2O9C A;  1GA9 A;  2V20 A;  1AWI A;  3BEC A;  5HAR A;  2AVX A;  2I72 A;  4FH2 A;  4EBP A;  2ZQ9 A;  3UPO A;  2Q9N A;  4RYE A;  3ITA A;  5GHY A;  2CC1 A;  3G30 A;  2WGV A;  4XXR A;  2Y2P A;  2I9V A;  1HZO A;  3NOP C;  3RXX A;  4EEP A;  3C8C A;  4IED A;  1K38 A;  3GR2 A;  3RXW A;  4Z1W A;  2XRO A;  2JBF A;  2V8C A;  3V50 A;  1U60 A;  3ZG8 B;  5EM0 A;  1MY8 A;  3JYI A;  2K7S A;  5FAT A;  1ERQ A;  4IUK A;  1OME A;  1S67 L;  3OPH A;  3GV9 A;  3BJN A;  3CPT B;  1GA0 A;  3E98 A;  3GMW A;  2B95 A;  5CTN A;  2QJ7 A;  3S7Q A;  2HDS A;  4E6X A;  1K54 A;  5FQJ A;  1F98 A;  3P7N A;  5TFQ A;  2B5R A;  2UV0 E;  4IVI A;  3EEH A;  2WZZ A;  2Z6D A;  1FIK A;  4RVA A;  2GZA A;  2V0W A;  5FAP A;  3PR6 A;  4EER A;  2P08 A;  3IF6 B;  1BUE A;  3OPL A;  5A90 A;  4OQI A;  4NXG A;  2EA9 A;  2JN7 A;  5FL3 A;  3UME A;  1LL5 A;  2WYX A;  3IXG A;  2Q0O A;  1STZ A;  3MXQ A;  3LI8 A;  1DJB A;  1N9O A;  4MBK A;  1N9B A;  3A3I A;  5FAO A;  3NOU C;  5EUA A;  5EE8 A;  5EVL A;  3FPV A;  4EV4 A;  4EES A;  1ACF A;  3RJU A;  1S0W A;  3UB5 P;  2XH9 A;  1SHV A;  3MR0 A;  5FAS A;  3GTC A;  1GHM A;  2KLI A;  2XDM A;  1MKI A;  2L1M A;  1BZA A;  4KZ3 A;  2FH5 A;  3JVV A;  3ZDJ A;  2Y8H A;  3UDX A;  4S2M A;  4GW9 A;  2XA7 S;  5DFY A;  2O0Y A;  3O5Y A;  3BFC A;  3C5A A;  1MWT A;  3HUM A;  2XSS A;  3NI9 A;  3P98 A;  3IWQ A;  4ETZ A;  2ZMF A;  4OON A;  1MZU A;  3UE0 A;  4WMC D;  3U4L P;  2XD1 A;  1PZO A;  1L0E A;  4H6J A;  4JF4 A;  4MBH A;  4P6B A;  3BFE A;  4YOF A;  4N1X A;  4QPR A;  2JKT M;  1CI8 A;  2M1C A;  3A0S A;  2JC7 A;  4OP5 A;  1FSW A;  2K31 A;  2ZD8 A;  2ZM2 A;  4KG6 A;  4CLC D;  1VB6 A;  2A24 A;  3PYP A;  1ES3 A;  5EPH A;  2X01 A;  3SS4 A;  4LV0 A;  5EOE A;  2JHE A;  3FPW A;  4ZBE A;  5J3W A;  4RA7 A;  4EBN A;  2J80 A;  1K4F A;  4GJ4 A;  1YMX A;  3MQQ A;  3ZVW A;  3IX8 A;  1LSV A;  5AJG A;  3IH9 A;  3O87 A;  4HI4 A;  2X02 A;  1YLP A;  3HLE A;  4JGP A;  2V2F F;  4QWO A;  4LRX C;  5E2G A;  1SKO B;  1FCM A;  2W3G A;  2EXB A;  1NY0 A;  2WKP A;  4Z9Q A;  1IYO A;  3MZE A;  3BEB A;  2WKH A;  1BUL A;  4K91 A;  1KE3 A;  1K56 D;  1V9Z A;  3PAE A;  3V67 A;  1CI9 A;  3A0R A;  4GS9 B;  3BQA A;  2BAS A;  3S7P A;  2HDU A;  1MC0 A;  4I5S A;  2V0U A;  4Y7P A;  3UDI A;  1D06 A;  1K54 C;  4DXC A;  3TW8 A;  3ZVT A;  3C4P A;  5HD3 A;  1G68 A;  4CLC B;  4KZ9 A;  5EV0 A;  4WEK A;  3S7O A;  1LL8 A;  2ZL1 B;  2Y2G A;  1L2S A;  5FI6 A;  5HD5 A;  1BYW A;  4ETX A;  1X0O A;  1GSV A;  5KMW A;  3Q1F A;  1BTL A;  1FOF A;  3TG9 A;  3A3E A;  2XRN A;  2PT7 A;  3EEA A;  2PYP A;  2X71 A;  2HP5 A;  5CEB A;  2WGW B;  4DE2 A;  2XA7 M;  1GCE A;  1IYS A;  1I2S A;  3LR3 A;  4NKP A;  5FSR A;  4S2N A;  4HJ6 A;  4HBU A;  2KDK A;  5HWT A;  4EQI A;  3UE3 A;  1KDW A;  3T4O A;  2GX5 A;  1G5U A;  4Q0H A;  3HUN A;  1VET A;  2ZM8 A;  3SW1 A;  2IA2 A;  1PWC A;  3IHB A;  4EXO A;  2JKR M;  1S6R A;  4L9E A;  3KSH A;  1F5M A;  3OLO A;  1P9W A;  1PW8 A;  1J3W A;  3FG8 A;  3MQO A;  4B9O A;  3N8R A;  4R0Q A;  3LCE A;  5BOH A;  3CZD A;  4ARZ B;  3BQ8 A;  4BJP A;  2Z6C A;  4R1G A;  1ZG4 A;  2W1R A;  4YIN A;  1T1C A;  4ZJ1 A;  4GDB A;  3T1S A;  3T4T A;  4B4X A;  4F3L A;  3VP1 A;  3QP8 A;  2PBY A;  2ZC4 B;  1ERO A;  2HV1 A;  1NJ4 A;  3GRJ A;  4E3L A;  3DTM A;  2J7V A;  1OT6 A;  1E3U A;  2ACG A;  3BM6 A;  4HEF A;  3HJI A;  4GN2 A;  4OPZ A;  3IQA A;  3D4F A;  3D9Y A;  3T4L A;  3ZGA B;  3LR5 A;  3CPT A;  5HPI A;  2R78 A;  3A3F A;  2L4R A;  1ESI A;  5FQM A;  5FEF A;  3H9W A;  5DF8 A;  1ESU A;  3BWL A;  3ZNT A;  4YFM A;  3DW0 A;  3CUE C;  3RH8 B;  3O88 A;  4DF6 A;  4RX3 A;  3L7H A;  2ZOI A;  3M2K A;  4BMW A;  1O7E A;  2ZC7 A;  2PR5 A;  5F5Y A;  3P09 A;  3UB7 A;  5EVI D;  2QPN A;  4BL2 A;  1ONG A;  2B02 A;  3RFB A;  2PAV P;  3SH7 A;  1YLZ A;  3F1N B;  4OPR A;  4OQH A;  1PWG A;  2V1A A;  4KZA A;  3M6B A;  5EVE A;  4IVK A;  2VGL S;  3BW6 A;  1OJ5 A;  4QHC A;  2ZM0 A;  1KVL A;  4LRZ E;  3IWO A;  1RP5 A;  5EVI C;  4GD6 A;  3MJQ A;  5E2E A;  2A24 B;  4E3O A;  4WBG A;  3UMD A;  2GJ3 A;  3G31 A;  2VV7 A;  3ITB A;  1PW1 A;  1BT5 A;  2MJ6 A;  3WS0 A;  5CGS A;  4Y0U A;  3IXB A;  4OOY A;  3DBA A;  3DTI A;  3T4Q A;  3VE3 A;  3EQV A;  4DMZ A;  1H5X A;  4S2O A;  4PM6 A;  1P97 A;  4UHU A;  4GHI B;  4ARZ A;  2A3U A;  2O9A A;  5F6A A;  5CGW A;  4FD8 A;  1XPB A;  4LV3 A;  4ZTK A;  3SH8 A;  1MPL A;  2YKF A;  4IBR A;  1OTB A;  2QMI A;  4Q0J A;  2HJ9 C;  4Y5F A;  5DTK A;  3H82 A;  1OTD A;  2Y4A A;  4RX2 A;  5DTS A;  4DKI A;  5DVA A;  3B42 A;  1EW0 A;  3MKE A;  1SDN A;  5L2F A;  4GLQ A;  4DN0 A;  1FR6 A;  4Y0T A;  1JTG A;  3UB6 A;  1SKF A;  3PBR A;  4NXE A;  1W79 A;  1KDS A;  4L9G A;  5FQI A;  3JPU A;  1I2W A;  2PR6 A;  3MBZ A;  3CAX A;  1TEM A;  1XXM A;  4QB8 A;  5F69 A;  2CMN A;  2EWW A;  2VA0 A;  4Y17 A;  5CRF A;  4WEL A;  5EEC A;  3ZHH A;  3BYD A;  4I3I A;  4S2P A;  1W63 M;  4BL3 A;  4CLC C;  3IXD A;  1FCN A;  3CG5 A;  3DTE A;  4GOG A;  5FDH A;  4I39 A;  1G6A A;  2XFS A;  2V1Z A;  3SS3 A;  3VP4 A;  1FIL A;  5DF7 A;  4FCF A;  1DJC A;  1IKG A;  3ZG9 B;  1YKD A;  2RL3 A;  4UA6 A;  4MMN A;  4EWF A;  1JWP A;  2ZC6 B;  1K6R A;  2XD5 A;  2NUT C;  3H82 B;  3UE1 A;  3F1P B;  4WZ5 C;  3DWK A;  3PBO A;  1OTE A;  3N8L A;  3IXH A;  3CLO A;  4OLD A;  1FCO A;  1YQS A;  2PU2 A;  3HLD A;  3IT9 A;  4BBV A;  4X69 A;  4JLF A;  5HFO A;  4HH2 A;  5EFW A;  3RTY A;  5FQ9 A;  5HPF A;  1M6K A;  3KSI A;  4LEN A;  3VP0 A;  2JKT I;  5TGF A;  1OTA A;  1QMF A;  5CEC A;  1LL9 A;  4UA7 A;  1TD5 A;  1GSW A;  5EOO A;  4I3A A;  4UEY A;  4EUV A;  3M6H A;  3MFX A;  3VP2 A;  3HJK A;  3DWZ A;  5DF9 A;  1OT9 A;  2PHY A;  1FSY A;  4E3K A;  4WN5 A;  1HLU P;  3G2Z A;  2BG1 A;  4HJ3 A;  5GLD A;  1K57 C;  3FWL A;  4KQD A;  4KZB A;  3KYZ A;  3E2K A;  3VSK A;  3TE8 A;  5HW3 A;  4D60 A;  3IBJ A;  3Q07 A;  4BWI A;  3F1P A;  2ZJ9 A;  2A49 A;  2Y2Q A;  5F1F A;  5HWV A;  4H6J B;  1CF0 A;  3SH9 A;  4N9K A;  4A5R A;  1TS0 A;  3MXS A;  4UQI S;  3LY4 A;  3UNW A;  3WRZ A;  1BLS A;  4X55 A;  2Z2L B;  4K0W A;  4MCW A;  3F1N A;  5HAI A;  2C5W B;  3LEQ A;  5CHJ A;  4R4S A;  4BD1 A;  4KQO A;  1ZC2 A;  2YKH A;  4G3V A;  4Y2F A;  1K0K A;  1H3Q A;  4EW7 A;  3LIF A;  1Z09 A;  5D3O A;  2HF6 A;  4S2L A;  5F68 A;  3EWK A;  3KYE A;  4R6L A;  2OWH A;  4BQM A;  1HVB A;  2EXA A;  3MF0 A;  2PRF A;  3S22 A;  3IF6 C;  4O01 A;  3HL9 A;  1L0G A;  3W4Q A;  5F83 A;  2Y55 A;  4I38 A;  4BD0 A;  1V9Y A;  3CHW P;  3GQZ A;  2M7U A;  1PNE A;  1KVM A;  4EEU A;  3ISG A;  4ZJ3 A;  5U47 A;  4O0P A;  1UGU A;  2PDR A;  1UWP X;  4HP9 A;  2QZ6 A;  1OPX A;  4KUO A;  1SDE A;  1JTD A;  1VEU A;  1CQA A;  2D01 A;  1XFN A;  3F1O B;  4ESP A;  3GVB A;  3IHA A;  5G4Y A;  3T4S A;  3SZT A;  4QJG A;  4PKY G;  4LRY C;  3GSG A;  4DE1 A;  3K3C A;  3T1X A;  3HLG A;  2JKF A;  2EX2 A;  4Y13 A;  3AGF A;  2O99 A;  4KEN B;  4Y3I A;  5GHZ A;  3T1R A;  1YM1 A;  4H8R A;  3Q82 A;  5DJU A;  3HBR A;  3G2Y A;  3CJM A;  2ZQD A;  3SOI A;  3IH8 A;  3OCL A;  5AQA A;  3LIA A;  2ZC3 B;  4S2I A;  5EVI B;  5KSC A;  4G3W A;  1ONH A;  1VQQ A;  1K25 A;  3G35 A;  3ZQ5 A;  1T1A A;  4HY8 A;  3NY4 A;  2H0Y A;  4HOI A;  2EFX A;  3D72 A;  5G18 A;  3ZYT A;  3K2N A;  3UY6 A;  5L10 A;  3IBR A;  2WGW A;  3V3S A;  4XUZ A;  2FFF B;  1VHM A;  3BRM A;  5IU1 A;  1DJA A;  4L0L A;  3HLW A;  2P9V A;  4EBL A;  2RCX A;  2FFY A;  2XGN A;  4P87 A;  4N9L A;  1RGY A;  1FQG A;  4GCZ A;  2XLN A;  2H28 A;  3HVF A;  3LFV A;  5TR7 A;  5KZH A;  3G6O A;  4EQ1 A;  4LCM A;  1ZKJ A;  4KG5 A;  3NDE A;  4K0X A;  3UPP A;  2OWJ A;  3LO7 A;  4P0M A;  3IF6 A;  2L0W A;  4JXG A;  2W3F A;  4MN5 A;  1UWN X;  4FOF A;  1D7E A;  4EUZ A;  1KE0 A;  3IWI A;  5AQB A;  1AXB A;  5F82 A;  1N9N A;  4OPQ A;  2C6W B;  1PWD A;  4NEE D;  4ZJ2 A;  4BBT A;  4RQ9 A;  1G28 A;  4M3K A;  2PBD P;  4JF6 A;  3FKW A;  4E3I A;  2GNX A;  2DCF A;  3ZG5 A;  2Y59 A;  5HZH A;  4P6Z S;  3IX4 A;  4LGW A;  4GDN A;  3FV7 A;  5E43 A;  2J3T D;  3NOT C;  4MDZ A;  4X1L A;  3FC7 A;  4JBF A;  3OPR A;  3WRT A;  4R4R A;  3IS2 B;  5HAP A;  5IHV A;  1IYP A;  4PPR A;  4WZ4 A;  4ZRR A;  2JCH A;  5K5B A;  3C30 A;  2V9A A;  2BLS A;  4S2J A;  1PRQ A;  5AQ9 A;  4UQI M;  4QY5 A;  1I5Q A;  4X56 A;  3MZF A;  1S1Z A;  3QP5 A;  5L8M A;  3AGD A;  1CK3 A;  5M19 A;  3R4K A;  4K08 A;  3LIC A;  1D1J A;  4KZ5 A;  4ME4 A;  1ODV A;  4PHT A;  5CER A;  4F94 A;  5J7E A;  1TF1 A;  1XJ4 A;  5L07 A;  4DXB A;  3VOY A;  2ZQ8 A;  1IYQ A;  4LV2 A;  3LR0 A;  1LSW A;  5GLB A;  1LI9 A;  3CMZ A;  1H0M A;  2Z2M B;  3UE6 A;  5MC7 A;  1IKI A;  1OJG A;  5DKL A;  5M1A A;  3G4P A;  3MZD A;  3PHY A;  1E25 A;  3U2A A;  4N92 A;  3B33 A;  3A0V A;  2EX8 A;  2JKR I;  4E3M A;  2D02 A;  4DE3 A;  3E4O A;  4R3B A;  1S4S A;  2W3D A;  3HLB A;  3VOL A;  2VV8 A;  2IWB A;  4X1M A;  4JXS A;  3LIE A;  4E04 A;  3EOI A;  4NXB A;  4OH0 A;  1WE4 A;  3T1Q B;  4HES A;  5I5L A;  2WAF A;  2W3E A;  4GD8 A;  1MKM A;  2WAD A;  3LI9 A;  3PXP A;  3EGD C;  4PKY A;  1PI5 A;  2Y91 A;  3UO9 A;  3QP2 A;  3LEZ A;  4MNR A;  1QME A;  2J8Y A;  1KGF A;  3LIB A;  3OCN A;  4KQQ A;  4DJ2 A;  3B3X A;  3G34 A;  3MSH A;  5HSQ A;  5CHM A;  1XGI A;  3LGO A;  1SCW A;  1TVF A;  3OPP A;  4G3K A;  4HIA A;  4GHI A;  4WUJ A;  4FH4 A;  5DFX A;  4MN6 A;  1DRM A;  2Y2L A;  3NJA A;  1W5D A;  4IBX A;  4NET A;  1E3U D;  4Y15 A;  5DTT A;  3T12 B;  1TS7 A;  2H0T A;  3NDG A;  2Y2O A;  4GNU A;  4CLC E;  3ZG7 B;  1A0K A;  3BY8 A;  1PI4 A;  1K6S A;  1P9R A;  1BLH A;  3PBN A;  2ZL1 A;  1GSX A;  1Q2P A;  3N6I A;  1VEU B;  3C2W A;  4KZ6 A;  2P9V B;  3GDI A;  4KZ7 A;  2FZ0 A;  3S4X A;  3NUL A;  3N8S A;  1GHI A;  3TJZ C;  3QP4 A;  2ZC5 B;  3PAG A;  3UDF A;  4GB7 A;  1YPR A;  4NXF A;  1WYB A;  4R70 A;  2NUP C;  3ZFZ A;  2PYR A;  1YAX A;  3NIA A;  5EVI A;  1Y4O A;  1DP8 A;  4XT2 A;  4OP8 A;  2HJE A;  4WEJ A;  2P04 A;  5CTM A;  4PAU A;  3VOZ A;  1KE4 A;  2HGV A;  4JGR A;  4KZ8 A;  5F1G A;  4WMC A;  5A91 A;  4MEZ A;  4XT2 B;  3A3D A;  3PBT A;  1IFQ A;  1SKO A;  4HHD A;  1K57 A;  4JXW A;  1PZP A;  1LSX A;  3BY9 A;  3PTE A;  2V8F A;  1LHY A;  4OOL A;  1LLB A;  3LY3 A;  3P01 A;  1W63 Q;  3VV4 A;  5CHU A;  2W3H A;  4OQG A;  3H7W A;  2JKG A;  4DDS A;  1O07 A;  1IEM A;  2WKQ A;  3HLC A;  3L9K A;  5A8B A;  1GHP A;  3EGX C;  2EFU A;  2V1B A;  5E2H A;  4OVD A;  5FQK A;  4WF0 A;  2DNS A;  4M4X A;  3MS6 A;  4CJN A;  3OBF A;  4BEN A;  5J4E A;  1EI5 A;  2W1T B;  4FSF A;  5HL1 A;  1XJ3 A;  2XQZ A;  4KZ4 A;  3CIT A;  3R7W B;  4WLA A;  1F9I A;  4II7 A;  5KSH A;  2ZQ7 A;  1K56 A;  4BLM A;  3KYQ A;  1FR1 A;  1XP4 A;  1NXY A;  1KGG A;  2Y2H A;  3ZG0 A;  3BFG A;  3KX0 X;  2PD7 A;  2ZBB A;  3N4I A;  1ZG6 A;  5CXW A;  4E3J A;  1ES2 A;  1L3L A;  4ZDX A;  2LB9 A;  1W8Q A;  1XKZ A;  1RGZ A;  3M2J A;  4I3J A;  4QY6 A;  2XEP A;  5I94 A;  4R23 A;  2B18 A;  5G4Z A;  4B88 A;  1YLJ A;  3KO6 A;  2ZOH A;  2EX6 A;  2HPB A;  1TDG A;  2HZ5 A;  2OLU A;  3SS5 A;  3VMA A;  3E2L A;  5AVE A;  3LYX A;  2E8I A;  1HD8 A;  2Q9M A;  1WYC A;  3NCK A;  4NK3 A;  1MXO A;  3QNB A;  3KSF A;  3Q7V B;  5L09 A;  1T1B A;  1XJ2 A;  1DY6 A;  5TJJ A;  3E0Y A;  2VKS A;  4X68 A;  4OLG A;  3FKV A;  1SZV A;  1CEG A;  1XFQ A;  2XFT A;  1Z6F A;  3TRC A;  4KG2 A;  3HUO A;  1TS8 A;  4E6W A;  3V5M A;  4S2N C;  5TBM A;  4F3L B;  3OOV A;  1JWZ A;  3NHQ A;  1S4R A;  5LBR A;  3S7N A;  3ULF A;  2VJW A;  5IS1 A;  5M18 A;  2ZQA A;  4N1H A;  1L0F A; 
#chains in the Genus database with same CATH homology
 5IT5 A;  4R3A A;  4Z1W A;  1T19 A;  2XRO A;  4FOF A;  3UMD A;  1D7E A;  4JGQ A;  2GJ3 A;  2VV7 A;  1N9N A;  4BBT A;  4NEE D;  5DKK A;  4RQ9 A;  4OOM A;  4MN7 A;  1G28 A;  2MJ6 A;  2QYB A;  2K7S A;  3UB9 A;  4IUK A;  1S67 L;  3DBA A;  1TS6 A;  4IHQ A;  2GNX A;  5HZH A;  4P6Z S;  3T4Q A;  3BJN A;  3VE3 A;  2J3T D;  3E98 A;  3EQV A;  3NOT C;  1P0Z A;  4DMZ A;  4MDZ A;  2QJ7 A;  3CI6 A;  1P97 A;  3FC7 A;  4GHI B;  3S7Q A;  4ARZ A;  4CQH A;  2OOL A;  4P6Z M;  3IS2 B;  2O9A A;  5F6A A;  1F98 A;  3P7N A;  4WL9 A;  4LLO B;  4ZRR A;  3EEH A;  1IOU A;  5K5B A;  2Z6D A;  3C30 A;  2YKF A;  2V9A A;  1OTB A;  2GZA A;  2V0W A;  4Q0J A;  2HJ9 C;  4Y5F A;  2INW A;  4UQI M;  3PR6 A;  4EET B;  4EER A;  1S1Z A;  5L8M A;  2P08 A;  3H82 A;  1OTD A;  3LID A;  4NXG A;  2EA9 A;  2JN7 A;  3T50 A;  5FL3 A;  3K3D A;  3R4K A;  4K08 A;  3UME A;  3B42 A;  1EW0 A;  3LIC A;  1XJ6 A;  3MXQ A;  1STZ A;  4GLQ A;  4DN0 A;  3LI8 A;  4ME4 A;  1ODV A;  4PHT A;  1NWZ A;  2OAP 1;  1N9O A;  3C38 A;  2W1T A;  3NOU C;  3FPV A;  5J7E A;  4AFI A;  4EES A;  3CWF A;  1TF1 A;  1XJ4 A;  2EWV A;  3UB6 A;  1H8M A;  3PBR A;  2J3T C;  3MR0 A;  4NXE A;  4L9G A;  2KLI A;  2PR6 A;  1ZHH B;  4LPZ A;  5C5K A;  3CAX A;  3LR0 A;  2L1M A;  1LSW A;  5F69 A;  2CMN A;  2K2N A;  2EWW A;  2VA0 A;  4Q0I A;  3ICY A;  3UE6 A;  2FH5 A;  2VX8 A;  3JVV A;  4WEL A;  5MC7 A;  1S66 L;  1OJG A;  3EQU A;  5DKL A;  4I3I A;  2Y8H A;  2VV6 A;  1W63 M;  3T4J A;  4HH3 A;  3PHY A;  4B93 A;  4GW9 A;  2XA7 S;  5DFY A;  2O0Y A;  3O5Y A;  1Y28 A;  2G7U A;  3U2A A;  4CLC C;  3B33 A;  3A0V A;  1ZTU A;  4I39 A;  2XSS A;  2JKR I;  2D02 A;  4R38 A;  3OC2 A;  3E4O A;  4ETZ A;  2ZMF A;  5TBM B;  1MZU A;  3MQ0 A;  1JNU A;  1S4S A;  1YKD A;  2W3D A;  4MMN A;  4DJ3 A;  2QKP A;  5CX7 A;  3VOL A;  2VV8 A;  4H6J A;  2NUT C;  3H82 B;  3F1P B;  3LIE A;  4E04 A;  3PBO A;  3EOI A;  4YOF A;  4NXB A;  1OTE A;  3CLO A;  3CUE A;  4JGO A;  4QPR A;  2JKT M;  4EU0 A;  5I5L A;  4BBV A;  4YNR A;  2M1C A;  2W3E A;  3A0S A;  4L9F A;  3VE4 A;  2Y79 A;  1MKM A;  3LI9 A;  4HH2 A;  5EFW A;  3RTY A;  3PXP A;  3EGD C;  4PKY A;  2K31 A;  4CLC D;  1VB6 A;  2A24 A;  3PYP A;  5HPF A;  2VEA A;  3KSI A;  1YSQ A;  2JKT I;  2P7J A;  2VGL M;  1OTA A;  3LIB A;  3OCN A;  2JHE A;  4DJ2 A;  3FPW A;  4O8G A;  3F1O A;  5HSQ A;  1TD5 A;  1GSW A;  1T18 A;  4HNB A;  5J3W A;  2J80 A;  2W0N A;  4G3K A;  4GJ4 A;  4HIA A;  4I3A A;  3MQQ A;  4UEY A;  4GHI A;  4EUV A;  3UB8 A;  1LSV A;  4WUJ A;  5AJG A;  3MFX A;  5DFX A;  3HJK A;  4MN6 A;  4HI4 A;  1DRM A;  5DF9 A;  1OT9 A;  3NJA A;  2PHY A;  4JGP A;  3T4K A;  4LRX C;  2W3G A;  4WN5 A;  4HJ3 A;  3IS2 A;  2WKP A;  4BBU A;  1YSP A;  4KQD A;  3JVU A;  1TS7 A;  3KYZ A;  1V9Z A;  3TE8 A;  4IJG A;  4CLC E;  2J3W A;  3V67 A;  3BY8 A;  3A0R A;  1P9R A;  3IBJ A;  4GS9 B;  3BQA A;  2BAS A;  4I5S A;  3S7P A;  1MC0 A;  3F1P A;  2V0U A;  3LR4 A;  3PBN A;  4BWI A;  1D06 A;  1GSX A;  2W27 A;  5HWV A;  3C2W A;  4H6J B;  3TW8 A;  5HD3 A;  3GDI A;  1TS0 A;  2FZ0 A;  4CLC B;  4UQI S;  3E4P A;  4WEK A;  5DJT A;  3S7O A;  1LL8 A;  3TJZ C;  4MCW A;  3F1N A;  4NXF A;  4R70 A;  2NUP C;  5HD5 A;  1BYW A;  2PYR A;  4KQO A;  3PBS A;  1YAX A;  4ETX A;  2QJ5 A;  1DP8 A;  1X0O A;  2YKH A;  1GSV A;  1DP6 A;  4XT2 A;  2HJE A;  2LB5 A;  4G3V A;  4Y2F A;  4WEJ A;  2P04 A;  2XRN A;  4PAU A;  1H3Q A;  4EW7 A;  2PT7 A;  3LIF A;  3EEA A;  2HGV A;  4JGR A;  2PYP A;  2HF6 A;  5F68 A;  3EWK A;  1WA9 A;  4R6L A;  2OWH A;  1NLZ A;  4XT2 B;  3PBT A;  1IFQ A;  3MF0 A;  5HDD A;  1NLY A;  2PD8 A;  2XA7 M;  4HHD A;  1LT0 A;  3HCY A;  3LR3 A;  4O01 A;  2A2L A;  1LSX A;  3BY9 A;  4I38 A;  1G6O A;  4NKP A;  5KIZ A;  3B47 A;  1V9Y A;  4HJ6 A;  1S1Y A;  4OOL A;  2M7U A;  2KDK A;  5HWT A;  2O9B A;  3P01 A;  1W63 Q;  2WKR A;  3VV4 A;  3UE3 A;  4EEU A;  2ZMV A;  2W3H A;  3T4O A;  2GX5 A;  3W2Z A;  1OTI A;  4Q0H A;  3MMH A;  2KX6 A;  1KOU A;  3H7W A;  4HJ4 A;  3E4Q A;  3SW1 A;  4O0P A;  1UGU A;  2IA2 A;  2PDR A;  4IUH A;  2WKQ A;  1UWP X;  4HP9 A;  5A8B A;  3EGX C;  4EXO A;  3GEC A;  1OPX A;  4KUO A;  2V1B A;  2JKR M;  4L9E A;  3KSH A;  5HDS A;  5HWW A;  1F5M A;  4WF0 A;  2DMW A;  2D01 A;  3OLO A;  3LUQ A;  1P9W A;  1XFN A;  4GS9 A;  3F1O B;  4M4X A;  3FG8 A;  3MQO A;  5G4Y A;  3T4S A;  3OBF A;  5J4E A;  4B9O A;  4PKY G;  4LRY C;  2W1T B;  3K3C A;  4ARZ B;  3BQ8 A;  4FSF A;  4BJP A;  2Z6C A;  1XJ3 A;  4KUK A;  2O99 A;  4Y3I A;  2W1R A;  2VZW A;  1T1C A;  3CIT A;  3R7W B;  4WLA A;  2OAQ 1;  1F9I A;  5DJU A;  4II7 A;  3T4T A;  5KSH A;  4HQA A;  4F3L A;  3PBQ A;  5AVF A;  3OCL A;  3KYQ A;  3LIA A;  4HP4 A;  2KOI A;  3KSG A;  2HV1 A;  3KX0 X;  2PD7 A;  4G3W A;  2VLG A;  5HL6 A;  1OT6 A;  2ZBB A;  3HJI A;  3ZQ5 A;  1T1A A;  4HY8 A;  2LB9 A;  3R7W A;  4HOI A;  3D72 A;  3ZYT A;  4I3J A;  2QWS A;  3T4L A;  1N9L A;  3K2N A;  2B18 A;  3LR5 A;  5HPI A;  2R78 A;  2L4R A;  5G4Z A;  3IBR A;  3KO6 A;  2ZOH A;  5HDC A;  1VHM A;  3D3O A;  5IU1 A;  1DP9 A;  3H9W A;  4L0L A;  2QHK A;  4YWZ A;  4CLC A;  2M7V A;  3BWL A;  5AVE A;  3LYX A;  3CUE C;  3RH8 B;  2ZOI A;  4BMW A;  1NRJ A;  2PR5 A;  3KSF A;  5F5Y A;  4GCZ A;  3UB7 A;  3H7W B;  2O9C A;  1T1B A;  1XJ2 A;  2H28 A;  3LFV A;  3G6O A;  2B02 A;  5TJJ A;  3E0Y A;  3RFB A;  2VKS A;  4EQ1 A;  3F1N B;  1XFQ A;  3TRC A;  2V1A A;  1TS8 A;  2VGL S;  2OWJ A;  5TBM A;  3BW6 A;  4F3L B;  2L0W A;  3OOV A;  3NHQ A;  1OJ5 A;  2I9V A;  1S4R A;  5LBR A;  3S7N A;  3ULF A;  4LRZ E;  2VJW A;  5IS1 A;  3NOP C;  4EEP A;  3C8C A;  2W3F A;  4MN5 A;  1UWN X;  3MJQ A;  2A24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...