3F1NB

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
VCQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1nB01
3UMEA 1GSVA 2YKHA 2M1CA 4EXOA 1G28A 4GS9A 5F69A 3LIBA 3LYXA 1LL8A 3F1PA 1LSXA 1JNUA 4RQ9A 2WKPA 3UB9A 5EFWA 3UMDA 4WL9A 4EW7A 2L0WA 1WA9A 4HJ6A 3A0RA 4XT2B 3HJIA 4H6JA 3F1PB 3F1OA 3LIEA 2BASA 3LIAA 2W27A 4I39A 5DKLA 2QJ5A 2P7JA 4LRYC 3B33A 1ODVA 1V9YA 4LRZE 5TBMB 1XJ4A 5HWTA 4NXFA 4JGRA 2GJ3A 1LSVA 2L4RA 2I9VA 3LUQA 2PHYA 4HJ3A 5HDCA 3NJAA 3A0VA 3H82B 3LIFA 4F3LA 1DP6A 3VE4A 1S67L 4R70A 4JGQA 3UB7A 4E04A 5DJUA 1VB6A 4HOIA 5F5YA 4PKYG 4HP4A 4HI4A 4I3JA 1OTEA 4EEPA 4F3LB 2ZBBA 1S1ZA 1XFNA 1XFQA 2QKPA 5DKKA 3PYPA 5DJTA 4EESA 3P7NA 2A24A 4HH3A 3IS2A 3MQOA 1OT9A 4HY8A 3BY8A 2HV1A 1LSWA 3BWLA 4MN5A 4PKYA 4LLOB 2A24B 2V1BA 3IS2B 3ICYA 4M4XA 3G6OA 4HQAA 3K3DA 4XT2A 4YWZA 2KX6A 3EWKA 4I5SA 1P0ZA 2D01A 4WUJA 3OLOA 2VV7A 1OJGA 4BBUA 3LI9A 5HWWA 4KQDA 5TBMA 5J7EA 5HWVA 1DP9A 3NHQA 4EETB 3D72A 2CMNA 5J3WA 3MFXA 4KUKA 3MR0A 1N9LA 2Z6DA 3H82A 1F98A 4GCZA 1TS7A 4DJ2A 3F1NB 4I38A 1T19A 2QWSA 4NXBA 2JHEA 3E4OA 3RH8B 2PR6A 3LI8A 5J4EA 3HJKA 2PD8A 1NWZA 4B9OA 3BY9A 1BYWA 1DP8A 1TS6A 4EQ1A 1TS0A 3CAXA 2JN7A 2ZOIA 5HZHA 2W0NA 4LPZA 3UB6A 3IBRA 2K7SA 4HH2A 3ZQ5A 5AVEA 3C2WA 4WLAA 5HDDA 1UGUA 3LIDA 3T50A 1UWPX 4JGPA 1GSXA 1OTIA 2WKRA 3NOTC 3GDIA 3FG8A 4I3IA 4HJ4A 3K3CA 4L9EA 5A8BA 4WN5A 3EEHA 4LRXC 4R3AA 4GW9A 4KUOA 2B02A 4GHIA 5AVFA 1OT6A 2Z6CA 2R78A 4HP9A 2KDKA 5F6AA 5HSQA 1EW0A 2OWJA 5IU1A 4HIAA 4DJ3A 1F9IA 4EEUA 2OWHA 4GHIB 1T18A 1KOUA 2L1MA 3MJQA 5IS1A 3F1NA 3KX0X 1UWNX 2YKFA 3H7WB 2PD7A 4HHDA 2J80A 1S4RA 4L9GA 2V1AA 5I5LA 1TS8A 2PYRA 5KIZA 1T1CA 2PYPA 3GECA 4GS9B 3UB8A 3E4QA 3SW1A 4R6LA 3LICA 1OTAA 5F68A 3ULFA 3CLOA 3RTYA 1D7EA 4R38A 3UE6A 3H9WA 3E4PA 1XJ3A 4K08A 1XJ6A 1T1BA 2V0WA 2VEAA 4H6JB 5HD5A 3F1OB 4JGOA 3A0SA 3C8CA 5G4YA 2VV8A 2D02A 1N9OA 1S4SA 2VV6A 3MQQA 1OJ5A 3PHYA 2ZOHA 1OTBA 3CWFA 1S66L 2EA9A 3VOLA 1S1YA 4BBTA 2PDRA 1XJ2A 4EERA 1D06A 2V9AA 5HD3A 1MZUA 2OOLA 1OTDA 2PR5A 1DRMA 3MXQA 3NOUC 1LT0A 2INWA 4NXEA 2QHKA 1Y28A 3FC7A 1T1AA 1P97A 4L9FA 5HDSA 2WKQA 2V0UA 4I3AA 2VLGA 2H28A 4BBVA 1V9ZA 4WF0A 3VE3A 3H7WA 2QJ7A 1N9NA 4HNBA 4NXGA 3NOPC 1X0OA 5G4ZA 4MN6A 1GSWA
chains in the Genus database with same CATH superfamily
1JTDA 1GSVA 1YSQA 3M2KA 4E3MA 1G28A 3G30A 2ZMVA 5F69A 3E98A 1PNEA 2PRFA 5AQBA 5CHUA 3UMDA 5CHJA 3KSHA 2HGVA 4N9KA 4KZ4A 4HJ6A 4QY5A 4XT2B 2V2FF 3A3IA 1HVBA 3E0YA 3RJUA 4PMAA 1ZHHB 4I39A 5DKLA 4S2LA 3VP0A 2P7JA 3EEAA 1ODVA 1AWIA 5E2EA 1IFQA 2VK3A 1ACFA 3NECA 5TBMB 4OP5A 2Q0OA 2GJ3A 1GHIA 2L4RA 3TG9A 4P6BA 3G4PA 3ZGAB 4S2PA 2PHYA 2Q9MA 3MZEA 1MBLA 2ZM0A 2GNXA 3ZG8B 3HLWA 1W8QA 2Y2JA 3ZNTA 2WZZA 3WS5A 1D1JA 2Y8HA 1BLHA 1VB6A 2V1ZA 4HOIA 4H8RA 3ZG9B 3A3DA 4PKYG 4Y0TA 3MF0A 4HP4A 2ZC5B 3QP2A 3T12B 3OPLA 3IQAA 3N8RA 1S1ZA 4FSFA 1XFNA 1XFQA 2JC7A 5L8MA 2QKPA 2Z2LB 3HL9A 4S2JA 3GV9A 1TVFA 5DJTA 1ZG4A 2G2UA 2J3WA 1Y4OA 3P7NA 3QP6A 4HH3A 5CERA 3G32A 3T4QA 5EVID 1W5DA 3VOYA 4ETZA 1IKGA 1NY0A 3BY8A 3KO6A 1LSWA 3IF5A 4LLOB 1L0FA 3KYQA 1TD5A 3IS2B 4M4XA 3G6OA 4HQAA 4BD1A 2KX6A 3Q82A 4O8GA 4HBUA 4GNUA 1SHVA 1MWSA 4IBRA 1P0ZA 5KSHA 3IT9A 1E4DA 2W1TA 2W3EA 3FWLA 3LI9A 3TOIA 3FKVA 3IWIA 1MC0A 5CGXA 3OPHA 4KUKA 1YLJA 4WZ4A 4JF6A 4GCZA 1TS7A 4E3KA 4KZ5A 3PAEA 4QD4A 4BD0A 1O7EA 4I38A 1YLYA 4R4RA 5D3OA 5CGWA 2QWSA 3BM6A 3C4PA 2XEPA 3RH8B 4QU3A 3LI8A 5J4EA 3IXHA 1BLSA 2PD8A 5AQ9A 3BFFA 3BY9A 4KG2A 5CX7A 1IKIA 3MMHA 1TS0A 5MC7A 2VKSA 3S7PA 4K0XA 2ZOIA 2W0NA 3NC8A 1E25A 1KDSA 5E2GA 4BMWA 2HDQA 4OOLA 3IBRA 4DRTA 1PI5A 4D60A 4QJGA 4UA9A 5BOHA 5HDDA 3UDFA 3LIDA 4JGPA 5EVIC 5EVEA 3OC2A 3GDIA 1JTGA 4DE3A 3IX8A 1K4FA 1ALQA 2XK1A 2DNSA 4R3BA 1NLZA 3PBOA 3WRTA 2P9VA 3K3CA 1VETB 2R9XA 3EEHA 1ZTUA 1NJ4A 3O5YA 3AGEA 4R3AA 5FSRA 4EWFA 2ZMFA 4GW9A 2H0TA 4KUOA 3DWZA 5DFYA 2B02A 5AVFA 5EOEA 1M6KA 3LEQA 2KDKA 5F6AA 2W3HA 1PZPA 4WYYA 1L2SA 4IBXA 2WKHA 3MZDA 5KZHA 5DF8A 2OLVA 5FAPA 5CTNA 5FI2A 2IWDA 3H7WB 4X56A 4UA7A 2HJEA 3JVVA 1VM1A 5GHXA 4Y3IA 1IYSA 1LLBA 5JYPA 1F2KA 3UB8A 3W4QA 1G6OA 4PM8A 4FCFA 4S2MA 1OTAA 5F68A 3ULFA 1STZA 3M2JA 3DW0A 2EFXA 1CI8A 3H9WA 4NKPA 5FI6A 1XJ6A 1BLCA 4MCWA 2WGVA 2ZL1A 3O86A 5CEDA 4H6JB 4DXCA 4JGOA 3SZTA 1M40A 3G31A 4O7DA 2D02A 2IA2A 2JKFA 3MQQA 3PHYA 1BSGA 3IHAA 1ES3A 1Z09A 5EVIA 5HW3A 3VOLA 3QP4A 5AQAA 2EXAA 3ZVTA 4ZTKA 3HLCA 1XJ2A 4IHQA 1D06A 1K55C 5GLAA 1C3BA 1YLPA 1KE3A 1XPBA 5HL6A 2O9CA 4A5RA 1MZUA 1OTDA 5FDSA 4E3IA 1G6AA 2ZC7A 3CPTA 1MWUA 3QP1A 3KYEA 4GD8A 3CJMA 3PAGA 2XGNA 1Y28A 2C6WB 2X01A 5FQJA 2WKQA 4I3AA 4O0PA 1L3LA 4IJGA 1G5UA 4QB8A 3UDIA 4L0LA 5AJGA 3ZFZA 4CLCD 3OPRA 3C4OA 2Y4AA 2JKGA 3C7UA 2XD5A 3VSKA 4P6ZM 4LFUA 3DTKA 3GQZA 1LHYA 2XA7M 2A49A 2LB9A 3PR6A 2M1CA 1EROA 4GS9A 5CEBA 3PBTA 2NUTC 2Y2KA 2ZM8A 3LIBA 3LYXA 4NG2A 2J9OA 2Y2MA 1XGJA 1FSWA 4N1XA 1OPXA 4ESPA 3PBQA 5DTKA 3L9KA 1HTZA 2V20A 4B93A 4BL3A 3VP3A 2XF3A 1WYCA 1CQAA 1PFLA 4PPRA 1BT5A 3ZYTA 3LR4A 4WZ5A 2L0WA 3A0RA 1N9BA 2VZWA 3IX4A 3F1PB 2G2WA 2BASA 5M18A 4JBFA 3EQUA 2HDUA 1IYQA 4LRYC 3B33A 1K57A 3Q1FA 1K38A 4LRZE 2RL3A 3LR3A 3IBJA 3RFBA 1L0DA 2H5SA 4PHTA 4G3VA 4KZ7A 4HJ3A 1L0GA 1TEMA 3UE3A 1DY6A 4ZAMA 1I5QA 5HARA 3VMAA 4Z9QA 2XR0A 3V3RA 3D9YA 3VE4A 3NDGA 4PM5A 2O99A 1EI5A 5F5YA 3PTEA 2FZ0A 2GX5A 2Y2PA 1MWRA 4O01A 2XD1A 5FEFA 4CLCC 3V50A 3OBFA 3C30A 5FQIA 2UV0E 4XUXA 4JXWA 5DVAA 4IEDA 3PBSA 3IS2A 4FUWA 2B18A 2FH5A 4N9LA 1OT9A 4HY8A 3QP5A 4KZ3A 5GHYA 4K91A 4CJNA 1WYBA 3ITAA 3DWKA 2JBFA 4PKYA 1L0EA 2H10A 5TGFA 4DXBA 2HP5A 3K3DA 4MBHA 4YWZA 1QMFA 4Q0IA 1YQSA 4MDZA 4WUJA 2W3GA 3OLOA 2J8YA 1P9RA 1OJGA 5HWWA 1K6RA 3U2AA 1DP9A 3BECA 3HUOA 1DJBA 4EETB 3ZG5A 3D72A 2ZD8A 5J3WA 3SS5A 2K2NA 3HLFA 5F1FA 4HBTA 3H82A 3PBNA 3EGDC 4DJ2A 5HL1A 4UA6A 3JYIA 4LV0A 1W79A 3OPPA 4N92A 5CHMA 1KGFA 3VFHA 4C3QA 4AFIA 2JHEA 3E4OA 2WZXA 2PR6A 3ZCZA 5M1AA 4ARZA 3T4LA 3FPWA 5GLBA 4G3KA 4LENA 1JWPA 3CAXA 4Y0OA 4S2OA 4UHUA 1K54C 2JN7A 3CUEA 2P74A 5GHZA 4UQIM 4CLCA 1RP5A 1SKOB 1MXOA 4HEFA 3ZQ5A 2EFUA 1NYMA 2PBDP 3EGXC 5AVEA 3C2WA 3BJNA 4WLAA 3NIAA 3WS1A 1UWPX 3BLSA 4Y7PA 1WE4A 3WS4A 5E2FA 1GSXA 2NUPC 3HVFA 5L2FA 2XA7S 5FL3A 2Y59A 2PBYA 4P0MA 1E3UA 2Y2IA 1IEMA 2KOIA 1GCEA 4HJ4A 2B95A 1NZUA 3L7HA 1FOFA 4L9EA 2ZQ8A 4X1LA 1I2SA 3FKWA 3UPOA 3V67A 2DCFA 1K6SA 4R0QA 1OT6A 2R78A 4DDYA 4NETA 4HP9A 3MBZA 2PAVP 1BULA 1EW0A 5IU1A 2EXBA 3TRCA 4S2KA 4QPRA 1KGGA 2OWHA 4MMNA 4E6WA 1KOUA 2L1MA 3MJQA 5IS1A 3F1NA 3KX0X 5G18A 1BLPA 1ERQA 4HHDA 4RX2A 2J80A 3N6IA 2GDNA 1XP4A 5TR7A 4FOFA 3SH9A 4DMZA 3VOZA 5KIZA 3T1SA 1H8MA 3R7WB 4C75A 4LV1A 4QWOA 1DJAA 4BENA 1KGEA 3GMWA 2O9AA 3CLOA 3IWQA 1O07A 2A3UA 4BL2A 4R38A 1K54A 1LL9A 4EQIA 4GZBA 3E4PA 1XJ3A 1RGZA 1ES5A 1XXMA 3NULA 3BW6A 2V0WA 2VEAA 3HLBA 3A0SA 2XFTA 3SS3A 3C8CA 4GD6A 2VV8A 1N9OA 3BYDA 4WEJA 1OJ5A 2Y2GA 2ZOHA 4ZDXA 1S0WA 3ZHHA 4YINA 4GB7A 2JCHA 5EPHA 1S1YA 4YOFA 3S7OA 4BBTA 2Z2MB 5A90A 4OOYA 3R4KA 5E43A 3ZNYA 4U0XA 4E3JA 1DRMA 5DTTA 3A3JA 4KG6A 1Z6FA 2INWA 4KZ6A 3JVUA 2R9WA 3FPVA 2OSUA 1ONGA 3SH8A 5FDHA 4LV2A 4L9FA 4DE2A 1HD8A 2VLGA 1JWZA 3Q7VB 4OQGA 4Y13A 2QJ7A 1N9NA 1ONHA 1ZC2A 2WAEA 2VGLM 4ZJ2A 2I72A 3LR0A 4HNBA 4U0TA 1W8YA 1NZOA 5LBRA 3RXXA 5G4ZA 3BFCA 3IWOA 4MN6A 3S22A 5EM1A 2AVXA 3ISGA 4X53A 4MEZA 4CQHA 3VP1A 3LO7A 3W4OA 5L09A 4OPQA 5DFXA 4KZ9A 1LL8A 1QMEA 3BFGA 3F1PA 4R4SA 4RQ9A 2FFYA 3PXPA 2WKPA 4LV3A 3UB9A 5EFWA 1CJFA 4X25A 4WL9A 2WADA 1TDGA 1RCJA 3Q07A 1H8ZA 1PWGA 5CXWA 2QPNA 3O87A 4FH4A 4RA7A 1WA9A 2Y2HA 5HX9A 3NY4A 2UWXA 1YSPA 3F1OA 1XA7A 2ZQ7A 3T1XA 4ME4A 2QZ6A 4GDBA 3T4OA 4P85A 4EBNA 3IHBA 1SDEA 4WZ5C 1MY8A 2Y91A 3P09A 3S7NA 2W1RA 2W1TB 1VQQA 2ZC4B 1XX2A 1CK3A 4ETXA 1I2WA 1NXYA 2WKEA 1XJ4A 5EV0A 1PI4A 3ITBA 3C7VA 1NRFA 3K2NA 1K57C 3LUQA 4OQHA 5HDCA 3ZG0A 3NJAA 4OQIA 3LIFA 1ZG6A 3VV4A 3GSGA 2WK0A 2WYXA 4GOGA 3O88A 4R70A 4JGQA 3TE8A 5EECA 3EOIA 2J9PA 3M6BA 4ZJ1A 4F94A 2WGWB 4Z1WA 3W2ZA 4HI4A 4I3JA 4EEPA 3DTIA 4F3LB 5L07A 2ZBBA 3IXDA 1FCNA 2B5RA 2E8JA 3UDXA 4KZAA 4R3JA 4MBFA 1PZOA 1MWTA 3HLGA 4FH2A 3G35A 3A3FA 4OPYA 5JYOA 5HAPA 1KE0A 2CC1A 2J7VA 3QP8A 4S2NC 1PYYA 3A3EA 3FYZA 5HPIA 4UAAA 2IWBA 2HV1A 4MN5A 3UE1A 4E3LA 2A24B 2V1BA 2X71A 4GN2A 3VP4A 1J9MA 4XT2A 1E3UD 4BJPA 2FFFB 2P9VB 3M6HA 3EWKA 2XQZA 4I5SA 1FSYA 1YKDA 2D01A 3KSFA 3UB5P 3P98A 4KQDA 5TBMA 1XA1A 5HWVA 5J7EA 2ZQCA 3WWXA 2VA0A 5TJJA 2CMNA 4DE1A 3MR0A 3UY6A 2J3TC 1F98A 5CECA 3DBAA 3NDEA 1ERMA 3KYZA 1HLUP 4Q0JA 3LFVA 5AQ7A 1HZOA 1ZKJA 1S6RA 2DMWA 3HJKA 3IH8A 3MKEA 1NWZA 4EUVA 2E8IA 4G3WA 1BZAA 3T4KA 4DE0A 4RYEA 5EVLA 4BQMA 4DN0A 1TS6A 2P04A 4EQ1A 4JKTA 3CZDA 4OH0A 5DF9A 5HZHA 4JLFA 2LB5A 1SDNA 4JXSA 2OLUA 4C6YA 4HH2A 4XXRA 2M7VA 5GLDA 3CUEC 1LL5A 2VGLS 3AGFA 5HAIA 2GZAA 2JKTI 2HZ5A 3NOTC 4S2NA 4Y0UA 4GJ4A 5EVIB 3NI9A 3VP2A 2HP9A 5EOOA 4KZBA 3UO9A 4DF6A 3DAVA 4KQRA 4LCLA 3HUNA 3T4SA 3HLDA 5HAQA 4WELA 2ACGA 4MLLA 2H0YA 1VEUB 4E3OA 1VHMA 1YMSA 5FQMA 4CPKA 3CPTB 1CEGA 1YMXA 4LGWA 3QNCA 3IF6B 5FQKA 4Q8IA 3U4LP 2OWJA 4DJ3A 2XSSA 3R7WA 1F9IA 3GTCA 4GHIB 1T18A 2X02A 3GR2A 1UWNX 2YKFA 2PD7A 1GHMA 5L10A 3IXGA 1S4RA 4L9GA 4NEED 1H8YA 1TS8A 2PYRA 3I7JA 1NYYA 5EE8A 2VGJA 5FQ9A 2PYPA 4GS9B 1K56A 5F82A 3SW1A 3LICA 4OVDA 4WMCA 2PU4A 1D7EA 5E2HA 5EM0A 1U60A 1YLWA 5I94A 2W3DA 1AXBA 5HFOA 5HD5A 1JWVA 2Y2LA 1ESUA 2VJWA 2XROA 4KQOA 3G2YA 4OOMA 3V39A 4FTXA 3DTMA 2JKRI 2VV6A 1PW8A 3CITA 3D3OA 3UPPA 1NRJA 2WUQA 1S66L 2EX2A 3CWFA 5FQQA 3S4XA 2EA9A 4OPZA 1GA9A 1IYOA 1VETA 4EERA 2V9AA 3RXWA 5K5BA 1W63M 3OCNA 4QY6A 4B4XA 2RCXA 4P6ZS 1KE4A 3T1QB 3UPNA 2Y2QA 2PR5A 2JKTM 2WKIA 3Q7VA 1FIKA 1K0KA 4XUZA 3NOUC 2QMIA 2Y79A 4KENB 4B88A 2QHKA 4Y5FA 4OLDA 3FC7A 2ZQDA 3MKFA 1P97A 5HDSA 3BQAA 5FEGA 2V0UA 2O0YA 3G2ZA 2W3FA 4GLQA 3N4IA 1PWDA 1V9ZA 4WF0A 3H7WA 2ZMAA 5F83A 2MJ6A 4MBKA 3LY4A 4NXGA 3NOPC 1XGIA 4ZJ3A 3LGOA 4QHCA 2WGIA 2M7UA 4FD8A 3UMEA 2YKHA 4ZRRA 4EXOA 2DRWA 3MFDA 1CF0A 4OONA 2ZM2A 1LSXA 5CTMA 1JNUA 2WAFA 5FATA 4PM6A 3WRZA 2KLIA 2VGKA 4EW7A 3MS6A 5CGSA 4Y15A 4EV4A 2JE5A 3AGDA 3ZDJA 3HJIA 2HDRA 4H6JA 2VX8A 3LIEA 3IH9A 1K25A 4GKUA 3LIAA 2W27A 3SOIA 1N4OA 1YLZA 2OAQ1 2QJ5A 1TDLA 2IWCA 1DJCA 3NBLA 5KMWA 1V9YA 3BRMA 4CLCE 5HWTA 4NXFA 4JGRA 4WBGA 2A2LA 3N7WA 2XH9A 1Q2PA 1LSVA 3S1YA 2I9VA 1K4EA 3W8KA 3A0VA 3BFDA 4M3KA 2WGWA 3H82B 1NLYA 3BQ8A 2O9BA 4EBPA 3UN7A 4IVKA 2JKRM 2BTFP 5FA7A 4F3LA 1DP6A 3TJZC 4JXGA 1YLTA 4IVIA 2ZLYA 1W63Q 1S67L 4OKPA 3UB7A 1PRQA 4E04A 5DJUA 2EX6A 4ARZB 1FCMA 3SS4A 4PM9A 2XFSA 3BFEA 1OTEA 3UNWA 1FR6A 5HPFA 4LCMA 5DKKA 3B42A 4JF4A 1SKFA 4R1GA 4EBLA 3N8SA 1GA0A 3PYPA 3CMZA 3Q7ZA 4PM7A 2HDSA 3MZFA 4EESA 3MXRA 1YAXA 4CLCB 2A24A 2Q9NA 5CRFA 1CEFA 4Q0HA 2Y2NA 3MQOA 2BG1A 1ESIA 1P9WA 3P01A 3GRJA 3BWLA 2G7UA 4OPRA 3BEBA 4JF5A 3KSIA 3E2LA 1KDWA 3IF6C 3N8LA 3C38A 4RVAA 3ICYA 3MQ0A 2HF6A 2XDMA 1W7FA 3OCLA 1MKMA 1BTLA 1EWZA 1FR1A 2XRNA 3ZG7B 2VV7A 1PW1A 2P08A 2EX9A 4BBUA 5M19A 3W4PA 1MKIA 3IX3A 3NHQA 1TF1A 4E6XA 1SZVA 3MFXA 1MPLA 5IT5A 1H0MA 1N9LA 2Z6DA 3OZHA 5FI7A 4X6TA 3EQVA 4OP8A 4UQIS 4BWIA 3T4TA 1IELA 5IHVA 3F1NB 1Q2QA 1T19A 4MNRA 3E2KA 3QNBA 1YT4A 3Q81A 4NXBA 2J3TD 1FQGA 5FAOA 4NK3A 4B9OA 3OOVA 3QHYA 1H3QA 2K31A 1BYWA 1IYPA 1DP8A 4BLMA 2ZQAA 2V8CA 3DTEA 5FAQA 1K56D 4EU0A 1OMEA 2HP6A 1A0KA 1F5MA 3PBRA 4WMCD 3HUMA 4LPZA 3UB6A 1PWCA 2K7SA 3T4JA 4IUKA 3TSGA 4PAUA 4P87A 4K0WA 4KQQA 4EUZA 3GVBA 3FV7A 3SH7A 2ZJ9A 3WS0A 1UGUA 3T50A 1J3WA 1IOUA 3ZVWA 3LY3A 1OTIA 2WKRA 5GLCA 5FASA 3G34A 4UEYA 4OLGA 1ES2A 1VEUA 3FG8A 1PIOA 4I3IA 2BLSA 4YFMA 5EUAA 1LI9A 4S2IA 3IF6A 5TFQA 5A8BA 4WN5A 4LRXC 4WM9A 4MN7A 2ZC3B 4X69A 3UE0A 1JVJA 4Y2FA 4GHIA 2EX8A 2Z6CA 1FCOA 4JXVA 4OQ0A 1Y54A 3TW8A 4DKIA 4U3TA 5HSQA 2QYBA 3LCEA 3MXSA 3B3XA 4HIAA 3O3VA 3HREA 4EEUA 3NCKA 1BUEA 5F1GA 3FZCA 5GL9A 1RGYA 2C5WB 4YNRA 2HPBA 2V1AA 3HCYA 2OV5A 5I5LA 1GHPA 5A93A 1GSWA 4B4ZA 1CI9A 1T1CA 3GECA 3E4QA 2V8FA 3IXBA 2OAP1 4R6LA 3CG5A 3RTYA 2ZC6B 3V5MA 3HLEA 4DDSA 4E3NA 1SKOA 2PU2A 2Y55A 3UE6A 4X55A 4K08A 5DF7A 1LI0A 1T1BA 1XKZA 3CHWP 3F1OB 2Y2OA 4X1MA 4HESA 5G4YA 4N1HA 4Y17A 1S4SA 5DTSA 5C5KA 1K55A 1OTBA 5A91A 3JPUA 3D4FA 4KZ8A 2ZQ9A 3BLMA 4II7A 5KSCA 3LEZA 1H5XA 3HBRA 4GDNA 2ZL1B 2PDRA 2PT7A 1G68A 4D2OA 5HD3A 5J8XA 3WS2A 3T1RA 1FILA 2HJ9C 4ZBEA 2OOLA 4X68A 3MXQA 3VSLA 2XLNA 3B47A 1LT0A 1YM1A 4NXEA 3VFFA 4IUHA 3LR5A 3MSHA 1T1AA 2EWWA 3CI6A 5U47A 4WEKA 2H28A 3C5AA 3KSGA 4BBVA 3VE3A 1ES4A 3S7QA 1KVLA 1YPRA 2EWVA 4RX3A 4JPMA 3V3SA 1KVMA 5A92A 1X0OA 4ID4A 1SCWA 4R23A 4KG5A
chains in the Genus database with same CATH topology
3UMEA 1GSVA 2LB9A 2YKHA 3PR6A 1YSQA 4ZRRA 2M1CA 4EXOA 4CQHA 1G28A 4GS9A 5DFXA 3PBTA 2NUTC 2ZMVA 5F69A 3LIBA 3LYXA 1LL8A 3F1PA 1LSXA 3E98A 1JNUA 1OPXA 3PBQA 4RQ9A 3PXPA 2WKPA 3UB9A 5EFWA 3UMDA 2KLIA 3KSHA 4WL9A 4B93A 4EW7A 2HGVA 3ZYTA 3LR4A 2L0WA 1WA9A 4HJ6A 3A0RA 4XT2B 2VZWA 3HJIA 1YSPA 4H6JA 3F1PB 3E0YA 3F1OA 2VX8A 3LIEA 4ME4A 2BASA 1ZHHB 2W27A 3LIAA 3T4OA 4I39A 2OAQ1 5DKLA 2QJ5A 3S7NA 3EQUA 2W1RA 2P7JA 4LRYC 2W1TB 3B33A 3EEAA 1ODVA 4ETXA 1V9YA 1IFQA 4LRZE 3LR3A 5TBMB 4CLCE 1XJ4A 3IBJA 5HWTA 4NXFA 4JGRA 3RFBA 2GJ3A 2A2LA 1LSVA 2L4RA 3K2NA 4PHTA 4G3VA 2I9VA 3LUQA 2PHYA 4HJ3A 5HDCA 2GNXA 3NJAA 3A0VA 3UE3A 3H82B 1NLYA 3BQ8A 2O9BA 3LIFA 2JKRM 3VV4A 4F3LA 1DP6A 3TJZC 3VE4A 1W63Q 1S67L 4R70A 4JGQA 2Y8HA 3UB7A 4E04A 5DJUA 1VB6A 3TE8A 4HOIA 2O99A 3EOIA 4ARZB 5F5YA 4PKYG 3MF0A 4HP4A 4Z1WA 3W2ZA 4HI4A 4I3JA 2FZ0A 1OTEA 4EEPA 4F3LB 2ZBBA 1S1ZA 2GX5A 1XFNA 1XFQA 4FSFA 5L8MA 4O01A 5HPFA 2QKPA 5DKKA 3B42A 4CLCC 3PYPA 3OBFA 5DJTA 3C30A 2J3WA 4EESA 3P7NA 1YAXA 4CLCB 2A24A 3PBSA 3IS2A 4HH3A 4Q0HA 2B18A 2FH5A 3T4QA 3MQOA 1OT9A 4HY8A 1P9WA 4ETZA 3P01A 3BY8A 5HPIA 3KO6A 2HV1A 1LSWA 3BWLA 2G7UA 4MN5A 4PKYA 4LLOB 2A24B 3KSIA 2V1BA 3KYQA 1TD5A 3IS2B 3C38A 3ICYA 4M4XA 3G6OA 4HQAA 3K3DA 4XT2A 3MQ0A 2HF6A 4YWZA 2KX6A 4BJPA 4O8GA 3OCLA 1MKMA 4Q0IA 3EWKA 4I5SA 1P0ZA 5KSHA 1YKDA 2D01A 2XRNA 4MDZA 4WUJA 2W3GA 3KSFA 3OLOA 2VV7A 2W1TA 1P9RA 2W3EA 2P08A 1OJGA 4BBUA 3LI9A 5HWWA 4KQDA 5TBMA 5J7EA 5HWVA 3U2AA 1DP9A 3NHQA 1TF1A 4EETB 3D72A 2VA0A 5TJJA 1MC0A 2CMNA 5J3WA 3MFXA 4KUKA 3MR0A 2K2NA 5IT5A 1N9LA 2Z6DA 3H82A 2J3TC 3PBNA 3EQVA 3EGDC 1F98A 4GCZA 4UQIS 1TS7A 4DJ2A 3DBAA 4BWIA 3T4TA 3KYZA 3F1NB 4I38A 4Q0JA 1T19A 3LFVA 2QWSA 4NXBA 2J3TD 4AFIA 2JHEA 3E4OA 3RH8B 2PR6A 3LI8A 5J4EA 2DMWA 3HJKA 4ARZA 2PD8A 1NWZA 4EUVA 4B9OA 3BY9A 3OOVA 4G3WA 3T4LA 5CX7A 1H3QA 2K31A 3T4KA 4DN0A 1BYWA 3FPWA 3MMHA 1DP8A 4G3KA 1TS6A 2P04A 4EQ1A 1TS0A 5MC7A 2VKSA 3CAXA 3S7PA 5DF9A 2JN7A 2ZOIA 5HZHA 4EU0A 3CUEA 2LB5A 2W0NA 1F5MA 3PBRA 4UQIM 4CLCA 4BMWA 4LPZA 3UB6A 4OOLA 3IBRA 2K7SA 3T4JA 4HH2A 4IUKA 3ZQ5A 4PAUA 2M7VA 3EGXC 5AVEA 3CUEC 3C2WA 3BJNA 4WLAA 5HDDA 1UGUA 3LIDA 3T50A 1IOUA 1UWPX 2VGLS 4JGPA 1GSXA 2GZAA 2NUPC 1OTIA 2WKRA 2JKTI 3NOTC 4UEYA 2XA7S 4GJ4A 5FL3A 3OC2A 3GDIA 3FG8A 4I3IA 2KOIA 4HJ4A 1NLZA 3PBOA 3K3CA 4L9EA 5A8BA 3T4SA 4WN5A 3EEHA 4LRXC 1ZTUA 4WELA 4MN7A 3O5YA 4R3AA 3V67A 2ZMFA 4GW9A 4KUOA 5DFYA 1VHMA 2B02A 4Y2FA 4GHIA 5AVFA 1OT6A 2Z6CA 2R78A 4HP9A 2KDKA 3TW8A 5F6AA 5HSQA 2W3HA 2QYBA 1EW0A 2OWJA 5IU1A 4HIAA 4DJ3A 3TRCA 2XSSA 3R7WA 4QPRA 1F9IA 4EEUA 2OWHA 4MMNA 4GHIB 1T18A 1KOUA 2L1MA 3MJQA 5IS1A 3F1NA 3KX0X 1UWNX 2YKFA 3H7WB 2PD7A 4HHDA 2HJEA 3JVVA 2J80A 4YNRA 1S4RA 4L9GA 2V1AA 4NEED 4Y3IA 3HCYA 4FOFA 4DMZA 5I5LA 1TS8A 2PYRA 5KIZA 1H8MA 3R7WB 1T1CA 2PYPA 3GECA 4GS9B 3UB8A 3E4QA 2OAP1 3SW1A 4R6LA 1G6OA 3LICA 1OTAA 5F68A 3ULFA 1STZA 2O9AA 3CLOA 3RTYA 1D7EA 4R38A 3UE6A 3H9WA 2W3DA 3E4PA 4NKPA 1XJ3A 4K08A 1XJ6A 1T1BA 3BW6A 2V0WA 4MCWA 2VEAA 4H6JB 5HD5A 3F1OB 2VJWA 3A0SA 4JGOA 2XROA 4KQOA 3C8CA 5G4YA 2VV8A 2D02A 4OOMA 1N9OA 2IA2A 1S4SA 4WEJA 2JKRI 2VV6A 3CITA 3MQQA 1OJ5A 3PHYA 3D3OA 2ZOHA 5C5KA 1OTBA 1NRJA 3CWFA 1S66L 2EA9A 3VOLA 1S1YA 4II7A 4YOFA 3S7OA 4BBTA 2PDRA 1XJ2A 4IHQA 4EERA 1D06A 2V9AA 5K5BA 1W63M 2PT7A 3OCNA 5HD3A 4P6ZS 3R4KA 5HL6A 2O9CA 1MZUA 2HJ9C 2OOLA 1OTDA 2PR5A 2JKTM 1DRMA 3MXQA 3NOUC 3B47A 1LT0A 2Y79A 2INWA 4NXEA 4IUHA 3JVUA 3FPVA 2QHKA 4Y5FA 1Y28A 3FC7A 3LR5A 1T1AA 1P97A 2EWWA 4L9FA 3BQAA 5HDSA 2WKQA 3CI6A 2V0UA 2O0YA 4I3AA 4O0PA 2W3FA 4GLQA 4IJGA 4WEKA 2VLGA 2H28A 3KSGA 4L0LA 4BBVA 5AJGA 1V9ZA 4WF0A 3VE3A 3H7WA 3S7QA 4CLCD 2QJ7A 2MJ6A 1N9NA 2EWVA 2VGLM 3LR0A 4HNBA 4NXGA 3NOPC 4P6ZM 5LBRA 1X0OA 5G4ZA 2M7UA 2XA7M 4MN6A 1GSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UME A;  1GSV A;  2YKH A;  2M1C A;  4EXO A;  1G28 A;  4GS9 A;  5F69 A;  3LIB A;  3LYX A;  1LL8 A;  3F1P A;  1LSX A;  1JNU A;  4RQ9 A;  2WKP A;  3UB9 A;  5EFW A;  3UMD A;  4WL9 A;  4EW7 A;  2L0W A;  1WA9 A;  4HJ6 A;  3A0R A;  4XT2 B;  3HJI A;  4H6J A;  3F1P B;  3F1O A;  3LIE A;  2BAS A;  3LIA A;  2W27 A;  4I39 A;  5DKL A;  2QJ5 A;  2P7J A;  4LRY C;  3B33 A;  1ODV A;  1V9Y A;  4LRZ E;  5TBM B;  1XJ4 A;  5HWT A;  4NXF A;  4JGR A;  2GJ3 A;  1LSV A;  2L4R A;  2I9V A;  3LUQ A;  2PHY A;  4HJ3 A;  5HDC A;  3NJA A;  3A0V A;  3H82 B;  3LIF A;  4F3L A;  1DP6 A;  3VE4 A;  1S67 L;  4R70 A;  4JGQ A;  3UB7 A;  4E04 A;  5DJU A;  1VB6 A;  4HOI A;  5F5Y A;  4PKY G;  4HP4 A;  4HI4 A;  4I3J A;  1OTE A;  4EEP A;  4F3L B;  2ZBB A;  1S1Z A;  1XFN A;  1XFQ A;  2QKP A;  5DKK A;  3PYP A;  5DJT A;  4EES A;  3P7N A;  2A24 A;  4HH3 A;  3IS2 A;  3MQO A;  1OT9 A;  4HY8 A;  3BY8 A;  2HV1 A;  1LSW A;  3BWL A;  4MN5 A;  4PKY A;  4LLO B;  2A24 B;  2V1B A;  3IS2 B;  3ICY A;  4M4X A;  3G6O A;  4HQA A;  3K3D A;  4XT2 A;  4YWZ A;  2KX6 A;  3EWK A;  4I5S A;  1P0Z A;  2D01 A;  4WUJ A;  3OLO A;  2VV7 A;  1OJG A;  4BBU A;  3LI9 A;  5HWW A;  4KQD A;  5TBM A;  5J7E A;  5HWV A;  1DP9 A;  3NHQ A;  4EET B;  3D72 A;  2CMN A;  5J3W A;  3MFX A;  4KUK A;  3MR0 A;  1N9L A;  2Z6D A;  3H82 A;  1F98 A;  4GCZ A;  1TS7 A;  4DJ2 A;  3F1N B;  4I38 A;  1T19 A;  2QWS A;  4NXB A;  2JHE A;  3E4O A;  3RH8 B;  2PR6 A;  3LI8 A;  5J4E A;  3HJK A;  2PD8 A;  1NWZ A;  4B9O A;  3BY9 A;  1BYW A;  1DP8 A;  1TS6 A;  4EQ1 A;  1TS0 A;  3CAX A;  2JN7 A;  2ZOI A;  5HZH A;  2W0N A;  4LPZ A;  3UB6 A;  3IBR A;  2K7S A;  4HH2 A;  3ZQ5 A;  5AVE A;  3C2W A;  4WLA A;  5HDD A;  1UGU A;  3LID A;  3T50 A;  1UWP X;  4JGP A;  1GSX A;  1OTI A;  2WKR A;  3NOT C;  3GDI A;  3FG8 A;  4I3I A;  4HJ4 A;  3K3C A;  4L9E A;  5A8B A;  4WN5 A;  3EEH A;  4LRX C;  4R3A A;  4GW9 A;  4KUO A;  2B02 A;  4GHI A;  5AVF A;  1OT6 A;  2Z6C A;  2R78 A;  4HP9 A;  2KDK A;  5F6A A;  5HSQ A;  1EW0 A;  2OWJ A;  5IU1 A;  4HIA A;  4DJ3 A;  1F9I A;  4EEU A;  2OWH A;  4GHI B;  1T18 A;  1KOU A;  2L1M A;  3MJQ A;  5IS1 A;  3F1N A;  3KX0 X;  1UWN X;  2YKF A;  3H7W B;  2PD7 A;  4HHD A;  2J80 A;  1S4R A;  4L9G A;  2V1A A;  5I5L A;  1TS8 A;  2PYR A;  5KIZ A;  1T1C A;  2PYP A;  3GEC A;  4GS9 B;  3UB8 A;  3E4Q A;  3SW1 A;  4R6L A;  3LIC A;  1OTA A;  5F68 A;  3ULF A;  3CLO A;  3RTY A;  1D7E A;  4R38 A;  3UE6 A;  3H9W A;  3E4P A;  1XJ3 A;  4K08 A;  1XJ6 A;  1T1B A;  2V0W A;  2VEA A;  4H6J B;  5HD5 A;  3F1O B;  4JGO A;  3A0S A;  3C8C A;  5G4Y A;  2VV8 A;  2D02 A;  1N9O A;  1S4S A;  2VV6 A;  3MQQ A;  1OJ5 A;  3PHY A;  2ZOH A;  1OTB A;  3CWF A;  1S66 L;  2EA9 A;  3VOL A;  1S1Y A;  4BBT A;  2PDR A;  1XJ2 A;  4EER A;  1D06 A;  2V9A A;  5HD3 A;  1MZU A;  2OOL A;  1OTD A;  2PR5 A;  1DRM A;  3MXQ A;  3NOU C;  1LT0 A;  2INW A;  4NXE A;  2QHK A;  1Y28 A;  3FC7 A;  1T1A A;  1P97 A;  4L9F A;  5HDS A;  2WKQ A;  2V0U A;  4I3A A;  2VLG A;  2H28 A;  4BBV A;  1V9Z A;  4WF0 A;  3VE3 A;  3H7W A;  2QJ7 A;  1N9N A;  4HNB A;  4NXG A;  3NOP C;  1X0O A;  5G4Z A;  4MN6 A;  1GSW A; 
#chains in the Genus database with same CATH topology
 1JTD A;  1GSV A;  1YSQ A;  3M2K A;  4E3M A;  1G28 A;  3G30 A;  2ZMV A;  5F69 A;  3E98 A;  1PNE A;  2PRF A;  5AQB A;  5CHU A;  3UMD A;  5CHJ A;  3KSH A;  2HGV A;  4N9K A;  4KZ4 A;  4HJ6 A;  4QY5 A;  4XT2 B;  2V2F F;  3A3I A;  1HVB A;  3E0Y A;  3RJU A;  4PMA A;  1ZHH B;  4I39 A;  5DKL A;  4S2L A;  3VP0 A;  2P7J A;  3EEA A;  1ODV A;  1AWI A;  5E2E A;  1IFQ A;  2VK3 A;  1ACF A;  3NEC A;  5TBM B;  4OP5 A;  2Q0O A;  2GJ3 A;  1GHI A;  2L4R A;  3TG9 A;  4P6B A;  3G4P A;  3ZGA B;  4S2P A;  2PHY A;  2Q9M A;  3MZE A;  1MBL A;  2ZM0 A;  2GNX A;  3ZG8 B;  3HLW A;  1W8Q A;  2Y2J A;  3ZNT A;  2WZZ A;  3WS5 A;  1D1J A;  2Y8H A;  1BLH A;  1VB6 A;  2V1Z A;  4HOI A;  4H8R A;  3ZG9 B;  3A3D A;  4PKY G;  4Y0T A;  3MF0 A;  4HP4 A;  2ZC5 B;  3QP2 A;  3T12 B;  3OPL A;  3IQA A;  3N8R A;  1S1Z A;  4FSF A;  1XFN A;  1XFQ A;  2JC7 A;  5L8M A;  2QKP A;  2Z2L B;  3HL9 A;  4S2J A;  3GV9 A;  1TVF A;  5DJT A;  1ZG4 A;  2G2U A;  2J3W A;  1Y4O A;  3P7N A;  3QP6 A;  4HH3 A;  5CER A;  3G32 A;  3T4Q A;  5EVI D;  1W5D A;  3VOY A;  4ETZ A;  1IKG A;  1NY0 A;  3BY8 A;  3KO6 A;  1LSW A;  3IF5 A;  4LLO B;  1L0F A;  3KYQ A;  1TD5 A;  3IS2 B;  4M4X A;  3G6O A;  4HQA A;  4BD1 A;  2KX6 A;  3Q82 A;  4O8G A;  4HBU A;  4GNU A;  1SHV A;  1MWS A;  4IBR A;  1P0Z A;  5KSH A;  3IT9 A;  1E4D A;  2W1T A;  2W3E A;  3FWL A;  3LI9 A;  3TOI A;  3FKV A;  3IWI A;  1MC0 A;  5CGX A;  3OPH A;  4KUK A;  1YLJ A;  4WZ4 A;  4JF6 A;  4GCZ A;  1TS7 A;  4E3K A;  4KZ5 A;  3PAE A;  4QD4 A;  4BD0 A;  1O7E A;  4I38 A;  1YLY A;  4R4R A;  5D3O A;  5CGW A;  2QWS A;  3BM6 A;  3C4P A;  2XEP A;  3RH8 B;  4QU3 A;  3LI8 A;  5J4E A;  3IXH A;  1BLS A;  2PD8 A;  5AQ9 A;  3BFF A;  3BY9 A;  4KG2 A;  5CX7 A;  1IKI A;  3MMH A;  1TS0 A;  5MC7 A;  2VKS A;  3S7P A;  4K0X A;  2ZOI A;  2W0N A;  3NC8 A;  1E25 A;  1KDS A;  5E2G A;  4BMW A;  2HDQ A;  4OOL A;  3IBR A;  4DRT A;  1PI5 A;  4D60 A;  4QJG A;  4UA9 A;  5BOH A;  5HDD A;  3UDF A;  3LID A;  4JGP A;  5EVI C;  5EVE A;  3OC2 A;  3GDI A;  1JTG A;  4DE3 A;  3IX8 A;  1K4F A;  1ALQ A;  2XK1 A;  2DNS A;  4R3B A;  1NLZ A;  3PBO A;  3WRT A;  2P9V A;  3K3C A;  1VET B;  2R9X A;  3EEH A;  1ZTU A;  1NJ4 A;  3O5Y A;  3AGE A;  4R3A A;  5FSR A;  4EWF A;  2ZMF A;  4GW9 A;  2H0T A;  4KUO A;  3DWZ A;  5DFY A;  2B02 A;  5AVF A;  5EOE A;  1M6K A;  3LEQ A;  2KDK A;  5F6A A;  2W3H A;  1PZP A;  4WYY A;  1L2S A;  4IBX A;  2WKH A;  3MZD A;  5KZH A;  5DF8 A;  2OLV A;  5FAP A;  5CTN A;  5FI2 A;  2IWD A;  3H7W B;  4X56 A;  4UA7 A;  2HJE A;  3JVV A;  1VM1 A;  5GHX A;  4Y3I A;  1IYS A;  1LLB A;  5JYP A;  1F2K A;  3UB8 A;  3W4Q A;  1G6O A;  4PM8 A;  4FCF A;  4S2M A;  1OTA A;  5F68 A;  3ULF A;  1STZ A;  3M2J A;  3DW0 A;  2EFX A;  1CI8 A;  3H9W A;  4NKP A;  5FI6 A;  1XJ6 A;  1BLC A;  4MCW A;  2WGV A;  2ZL1 A;  3O86 A;  5CED A;  4H6J B;  4DXC A;  4JGO A;  3SZT A;  1M40 A;  3G31 A;  4O7D A;  2D02 A;  2IA2 A;  2JKF A;  3MQQ A;  3PHY A;  1BSG A;  3IHA A;  1ES3 A;  1Z09 A;  5EVI A;  5HW3 A;  3VOL A;  3QP4 A;  5AQA A;  2EXA A;  3ZVT A;  4ZTK A;  3HLC A;  1XJ2 A;  4IHQ A;  1D06 A;  1K55 C;  5GLA A;  1C3B A;  1YLP A;  1KE3 A;  1XPB A;  5HL6 A;  2O9C A;  4A5R A;  1MZU A;  1OTD A;  5FDS A;  4E3I A;  1G6A A;  2ZC7 A;  3CPT A;  1MWU A;  3QP1 A;  3KYE A;  4GD8 A;  3CJM A;  3PAG A;  2XGN A;  1Y28 A;  2C6W B;  2X01 A;  5FQJ A;  2WKQ A;  4I3A A;  4O0P A;  1L3L A;  4IJG A;  1G5U A;  4QB8 A;  3UDI A;  4L0L A;  5AJG A;  3ZFZ A;  4CLC D;  3OPR A;  3C4O A;  2Y4A A;  2JKG A;  3C7U A;  2XD5 A;  3VSK A;  4P6Z M;  4LFU A;  3DTK A;  3GQZ A;  1LHY A;  2XA7 M;  2A49 A;  2LB9 A;  3PR6 A;  2M1C A;  1ERO A;  4GS9 A;  5CEB A;  3PBT A;  2NUT C;  2Y2K A;  2ZM8 A;  3LIB A;  3LYX A;  4NG2 A;  2J9O A;  2Y2M A;  1XGJ A;  1FSW A;  4N1X A;  1OPX A;  4ESP A;  3PBQ A;  5DTK A;  3L9K A;  1HTZ A;  2V20 A;  4B93 A;  4BL3 A;  3VP3 A;  2XF3 A;  1WYC A;  1CQA A;  1PFL A;  4PPR A;  1BT5 A;  3ZYT A;  3LR4 A;  4WZ5 A;  2L0W A;  3A0R A;  1N9B A;  2VZW A;  3IX4 A;  3F1P B;  2G2W A;  2BAS A;  5M18 A;  4JBF A;  3EQU A;  2HDU A;  1IYQ A;  4LRY C;  3B33 A;  1K57 A;  3Q1F A;  1K38 A;  4LRZ E;  2RL3 A;  3LR3 A;  3IBJ A;  3RFB A;  1L0D A;  2H5S A;  4PHT A;  4G3V A;  4KZ7 A;  4HJ3 A;  1L0G A;  1TEM A;  3UE3 A;  1DY6 A;  4ZAM A;  1I5Q A;  5HAR A;  3VMA A;  4Z9Q A;  2XR0 A;  3V3R A;  3D9Y A;  3VE4 A;  3NDG A;  4PM5 A;  2O99 A;  1EI5 A;  5F5Y A;  3PTE A;  2FZ0 A;  2GX5 A;  2Y2P A;  1MWR A;  4O01 A;  2XD1 A;  5FEF A;  4CLC C;  3V50 A;  3OBF A;  3C30 A;  5FQI A;  2UV0 E;  4XUX A;  4JXW A;  5DVA A;  4IED A;  3PBS A;  3IS2 A;  4FUW A;  2B18 A;  2FH5 A;  4N9L A;  1OT9 A;  4HY8 A;  3QP5 A;  4KZ3 A;  5GHY A;  4K91 A;  4CJN A;  1WYB A;  3ITA A;  3DWK A;  2JBF A;  4PKY A;  1L0E A;  2H10 A;  5TGF A;  4DXB A;  2HP5 A;  3K3D A;  4MBH A;  4YWZ A;  1QMF A;  4Q0I A;  1YQS A;  4MDZ A;  4WUJ A;  2W3G A;  3OLO A;  2J8Y A;  1P9R A;  1OJG A;  5HWW A;  1K6R A;  3U2A A;  1DP9 A;  3BEC A;  3HUO A;  1DJB A;  4EET B;  3ZG5 A;  3D72 A;  2ZD8 A;  5J3W A;  3SS5 A;  2K2N A;  3HLF A;  5F1F A;  4HBT A;  3H82 A;  3PBN A;  3EGD C;  4DJ2 A;  5HL1 A;  4UA6 A;  3JYI A;  4LV0 A;  1W79 A;  3OPP A;  4N92 A;  5CHM A;  1KGF A;  3VFH A;  4C3Q A;  4AFI A;  2JHE A;  3E4O A;  2WZX A;  2PR6 A;  3ZCZ A;  5M1A A;  4ARZ A;  3T4L A;  3FPW A;  5GLB A;  4G3K A;  4LEN A;  1JWP A;  3CAX A;  4Y0O A;  4S2O A;  4UHU A;  1K54 C;  2JN7 A;  3CUE A;  2P74 A;  5GHZ A;  4UQI M;  4CLC A;  1RP5 A;  1SKO B;  1MXO A;  4HEF A;  3ZQ5 A;  2EFU A;  1NYM A;  2PBD P;  3EGX C;  5AVE A;  3C2W A;  3BJN A;  4WLA A;  3NIA A;  3WS1 A;  1UWP X;  3BLS A;  4Y7P A;  1WE4 A;  3WS4 A;  5E2F A;  1GSX A;  2NUP C;  3HVF A;  5L2F A;  2XA7 S;  5FL3 A;  2Y59 A;  2PBY A;  4P0M A;  1E3U A;  2Y2I A;  1IEM A;  2KOI A;  1GCE A;  4HJ4 A;  2B95 A;  1NZU A;  3L7H A;  1FOF A;  4L9E A;  2ZQ8 A;  4X1L A;  1I2S A;  3FKW A;  3UPO A;  3V67 A;  2DCF A;  1K6S A;  4R0Q A;  1OT6 A;  2R78 A;  4DDY A;  4NET A;  4HP9 A;  3MBZ A;  2PAV P;  1BUL A;  1EW0 A;  5IU1 A;  2EXB A;  3TRC A;  4S2K A;  4QPR A;  1KGG A;  2OWH A;  4MMN A;  4E6W A;  1KOU A;  2L1M A;  3MJQ A;  5IS1 A;  3F1N A;  3KX0 X;  5G18 A;  1BLP A;  1ERQ A;  4HHD A;  4RX2 A;  2J80 A;  3N6I A;  2GDN A;  1XP4 A;  5TR7 A;  4FOF A;  3SH9 A;  4DMZ A;  3VOZ A;  5KIZ A;  3T1S A;  1H8M A;  3R7W B;  4C75 A;  4LV1 A;  4QWO A;  1DJA A;  4BEN A;  1KGE A;  3GMW A;  2O9A A;  3CLO A;  3IWQ A;  1O07 A;  2A3U A;  4BL2 A;  4R38 A;  1K54 A;  1LL9 A;  4EQI A;  4GZB A;  3E4P A;  1XJ3 A;  1RGZ A;  1ES5 A;  1XXM A;  3NUL A;  3BW6 A;  2V0W A;  2VEA A;  3HLB A;  3A0S A;  2XFT A;  3SS3 A;  3C8C A;  4GD6 A;  2VV8 A;  1N9O A;  3BYD A;  4WEJ A;  1OJ5 A;  2Y2G A;  2ZOH A;  4ZDX A;  1S0W A;  3ZHH A;  4YIN A;  4GB7 A;  2JCH A;  5EPH A;  1S1Y A;  4YOF A;  3S7O A;  4BBT A;  2Z2M B;  5A90 A;  4OOY A;  3R4K A;  5E43 A;  3ZNY A;  4U0X A;  4E3J A;  1DRM A;  5DTT A;  3A3J A;  4KG6 A;  1Z6F A;  2INW A;  4KZ6 A;  3JVU A;  2R9W A;  3FPV A;  2OSU A;  1ONG A;  3SH8 A;  5FDH A;  4LV2 A;  4L9F A;  4DE2 A;  1HD8 A;  2VLG A;  1JWZ A;  3Q7V B;  4OQG A;  4Y13 A;  2QJ7 A;  1N9N A;  1ONH A;  1ZC2 A;  2WAE A;  2VGL M;  4ZJ2 A;  2I72 A;  3LR0 A;  4HNB A;  4U0T A;  1W8Y A;  1NZO A;  5LBR A;  3RXX A;  5G4Z A;  3BFC A;  3IWO A;  4MN6 A;  3S22 A;  5EM1 A;  2AVX A;  3ISG A;  4X53 A;  4MEZ A;  4CQH A;  3VP1 A;  3LO7 A;  3W4O A;  5L09 A;  4OPQ A;  5DFX A;  4KZ9 A;  1LL8 A;  1QME A;  3BFG A;  3F1P A;  4R4S A;  4RQ9 A;  2FFY A;  3PXP A;  2WKP A;  4LV3 A;  3UB9 A;  5EFW A;  1CJF A;  4X25 A;  4WL9 A;  2WAD A;  1TDG A;  1RCJ A;  3Q07 A;  1H8Z A;  1PWG A;  5CXW A;  2QPN A;  3O87 A;  4FH4 A;  4RA7 A;  1WA9 A;  2Y2H A;  5HX9 A;  3NY4 A;  2UWX A;  1YSP A;  3F1O A;  1XA7 A;  2ZQ7 A;  3T1X A;  4ME4 A;  2QZ6 A;  4GDB A;  3T4O A;  4P85 A;  4EBN A;  3IHB A;  1SDE A;  4WZ5 C;  1MY8 A;  2Y91 A;  3P09 A;  3S7N A;  2W1R A;  2W1T B;  1VQQ A;  2ZC4 B;  1XX2 A;  1CK3 A;  4ETX A;  1I2W A;  1NXY A;  2WKE A;  1XJ4 A;  5EV0 A;  1PI4 A;  3ITB A;  3C7V A;  1NRF A;  3K2N A;  1K57 C;  3LUQ A;  4OQH A;  5HDC A;  3ZG0 A;  3NJA A;  4OQI A;  3LIF A;  1ZG6 A;  3VV4 A;  3GSG A;  2WK0 A;  2WYX A;  4GOG A;  3O88 A;  4R70 A;  4JGQ A;  3TE8 A;  5EEC A;  3EOI A;  2J9P A;  3M6B A;  4ZJ1 A;  4F94 A;  2WGW B;  4Z1W A;  3W2Z A;  4HI4 A;  4I3J A;  4EEP A;  3DTI A;  4F3L B;  5L07 A;  2ZBB A;  3IXD A;  1FCN A;  2B5R A;  2E8J A;  3UDX A;  4KZA A;  4R3J A;  4MBF A;  1PZO A;  1MWT A;  3HLG A;  4FH2 A;  3G35 A;  3A3F A;  4OPY A;  5JYO A;  5HAP A;  1KE0 A;  2CC1 A;  2J7V A;  3QP8 A;  4S2N C;  1PYY A;  3A3E A;  3FYZ A;  5HPI A;  4UAA A;  2IWB A;  2HV1 A;  4MN5 A;  3UE1 A;  4E3L A;  2A24 B;  2V1B A;  2X71 A;  4GN2 A;  3VP4 A;  1J9M A;  4XT2 A;  1E3U D;  4BJP A;  2FFF B;  2P9V B;  3M6H A;  3EWK A;  2XQZ A;  4I5S A;  1FSY A;  1YKD A;  2D01 A;  3KSF A;  3UB5 P;  3P98 A;  4KQD A;  5TBM A;  1XA1 A;  5HWV A;  5J7E A;  2ZQC A;  3WWX A;  2VA0 A;  5TJJ A;  2CMN A;  4DE1 A;  3MR0 A;  3UY6 A;  2J3T C;  1F98 A;  5CEC A;  3DBA A;  3NDE A;  1ERM A;  3KYZ A;  1HLU P;  4Q0J A;  3LFV A;  5AQ7 A;  1HZO A;  1ZKJ A;  1S6R A;  2DMW A;  3HJK A;  3IH8 A;  3MKE A;  1NWZ A;  4EUV A;  2E8I A;  4G3W A;  1BZA A;  3T4K A;  4DE0 A;  4RYE A;  5EVL A;  4BQM A;  4DN0 A;  1TS6 A;  2P04 A;  4EQ1 A;  4JKT A;  3CZD A;  4OH0 A;  5DF9 A;  5HZH A;  4JLF A;  2LB5 A;  1SDN A;  4JXS A;  2OLU A;  4C6Y A;  4HH2 A;  4XXR A;  2M7V A;  5GLD A;  3CUE C;  1LL5 A;  2VGL S;  3AGF A;  5HAI A;  2GZA A;  2JKT I;  2HZ5 A;  3NOT C;  4S2N A;  4Y0U A;  4GJ4 A;  5EVI B;  3NI9 A;  3VP2 A;  2HP9 A;  5EOO A;  4KZB A;  3UO9 A;  4DF6 A;  3DAV A;  4KQR A;  4LCL A;  3HUN A;  3T4S A;  3HLD A;  5HAQ A;  4WEL A;  2ACG A;  4MLL A;  2H0Y A;  1VEU B;  4E3O A;  1VHM A;  1YMS A;  5FQM A;  4CPK A;  3CPT B;  1CEG A;  1YMX A;  4LGW A;  3QNC A;  3IF6 B;  5FQK A;  4Q8I A;  3U4L P;  2OWJ A;  4DJ3 A;  2XSS A;  3R7W A;  1F9I A;  3GTC A;  4GHI B;  1T18 A;  2X02 A;  3GR2 A;  1UWN X;  2YKF A;  2PD7 A;  1GHM A;  5L10 A;  3IXG A;  1S4R A;  4L9G A;  4NEE D;  1H8Y A;  1TS8 A;  2PYR A;  3I7J A;  1NYY A;  5EE8 A;  2VGJ A;  5FQ9 A;  2PYP A;  4GS9 B;  1K56 A;  5F82 A;  3SW1 A;  3LIC A;  4OVD A;  4WMC A;  2PU4 A;  1D7E A;  5E2H A;  5EM0 A;  1U60 A;  1YLW A;  5I94 A;  2W3D A;  1AXB A;  5HFO A;  5HD5 A;  1JWV A;  2Y2L A;  1ESU A;  2VJW A;  2XRO A;  4KQO A;  3G2Y A;  4OOM A;  3V39 A;  4FTX A;  3DTM A;  2JKR I;  2VV6 A;  1PW8 A;  3CIT A;  3D3O A;  3UPP A;  1NRJ A;  2WUQ A;  1S66 L;  2EX2 A;  3CWF A;  5FQQ A;  3S4X A;  2EA9 A;  4OPZ A;  1GA9 A;  1IYO A;  1VET A;  4EER A;  2V9A A;  3RXW A;  5K5B A;  1W63 M;  3OCN A;  4QY6 A;  4B4X A;  2RCX A;  4P6Z S;  1KE4 A;  3T1Q B;  3UPN A;  2Y2Q A;  2PR5 A;  2JKT M;  2WKI A;  3Q7V A;  1FIK A;  1K0K A;  4XUZ A;  3NOU C;  2QMI A;  2Y79 A;  4KEN B;  4B88 A;  2QHK A;  4Y5F A;  4OLD A;  3FC7 A;  2ZQD A;  3MKF A;  1P97 A;  5HDS A;  3BQA A;  5FEG A;  2V0U A;  2O0Y A;  3G2Z A;  2W3F A;  4GLQ A;  3N4I A;  1PWD A;  1V9Z A;  4WF0 A;  3H7W A;  2ZMA A;  5F83 A;  2MJ6 A;  4MBK A;  3LY4 A;  4NXG A;  3NOP C;  1XGI A;  4ZJ3 A;  3LGO A;  4QHC A;  2WGI A;  2M7U A;  4FD8 A;  3UME A;  2YKH A;  4ZRR A;  4EXO A;  2DRW A;  3MFD A;  1CF0 A;  4OON A;  2ZM2 A;  1LSX A;  5CTM A;  1JNU A;  2WAF A;  5FAT A;  4PM6 A;  3WRZ A;  2KLI A;  2VGK A;  4EW7 A;  3MS6 A;  5CGS A;  4Y15 A;  4EV4 A;  2JE5 A;  3AGD A;  3ZDJ A;  3HJI A;  2HDR A;  4H6J A;  2VX8 A;  3LIE A;  3IH9 A;  1K25 A;  4GKU A;  3LIA A;  2W27 A;  3SOI A;  1N4O A;  1YLZ A;  2OAQ 1;  2QJ5 A;  1TDL A;  2IWC A;  1DJC A;  3NBL A;  5KMW A;  1V9Y A;  3BRM A;  4CLC E;  5HWT A;  4NXF A;  4JGR A;  4WBG A;  2A2L A;  3N7W A;  2XH9 A;  1Q2P A;  1LSV A;  3S1Y A;  2I9V A;  1K4E A;  3W8K A;  3A0V A;  3BFD A;  4M3K A;  2WGW A;  3H82 B;  1NLY A;  3BQ8 A;  2O9B A;  4EBP A;  3UN7 A;  4IVK A;  2JKR M;  2BTF P;  5FA7 A;  4F3L A;  1DP6 A;  3TJZ C;  4JXG A;  1YLT A;  4IVI A;  2ZLY A;  1W63 Q;  1S67 L;  4OKP A;  3UB7 A;  1PRQ A;  4E04 A;  5DJU A;  2EX6 A;  4ARZ B;  1FCM A;  3SS4 A;  4PM9 A;  2XFS A;  3BFE A;  1OTE A;  3UNW A;  1FR6 A;  5HPF A;  4LCM A;  5DKK A;  3B42 A;  4JF4 A;  1SKF A;  4R1G A;  4EBL A;  3N8S A;  1GA0 A;  3PYP A;  3CMZ A;  3Q7Z A;  4PM7 A;  2HDS A;  3MZF A;  4EES A;  3MXR A;  1YAX A;  4CLC B;  2A24 A;  2Q9N A;  5CRF A;  1CEF A;  4Q0H A;  2Y2N A;  3MQO A;  2BG1 A;  1ESI A;  1P9W A;  3P01 A;  3GRJ A;  3BWL A;  2G7U A;  4OPR A;  3BEB A;  4JF5 A;  3KSI A;  3E2L A;  1KDW A;  3IF6 C;  3N8L A;  3C38 A;  4RVA A;  3ICY A;  3MQ0 A;  2HF6 A;  2XDM A;  1W7F A;  3OCL A;  1MKM A;  1BTL A;  1EWZ A;  1FR1 A;  2XRN A;  3ZG7 B;  2VV7 A;  1PW1 A;  2P08 A;  2EX9 A;  4BBU A;  5M19 A;  3W4P A;  1MKI A;  3IX3 A;  3NHQ A;  1TF1 A;  4E6X A;  1SZV A;  3MFX A;  1MPL A;  5IT5 A;  1H0M A;  1N9L A;  2Z6D A;  3OZH A;  5FI7 A;  4X6T A;  3EQV A;  4OP8 A;  4UQI S;  4BWI A;  3T4T A;  1IEL A;  5IHV A;  3F1N B;  1Q2Q A;  1T19 A;  4MNR A;  3E2K A;  3QNB A;  1YT4 A;  3Q81 A;  4NXB A;  2J3T D;  1FQG A;  5FAO A;  4NK3 A;  4B9O A;  3OOV A;  3QHY A;  1H3Q A;  2K31 A;  1BYW A;  1IYP A;  1DP8 A;  4BLM A;  2ZQA A;  2V8C A;  3DTE A;  5FAQ A;  1K56 D;  4EU0 A;  1OME A;  2HP6 A;  1A0K A;  1F5M A;  3PBR A;  4WMC D;  3HUM A;  4LPZ A;  3UB6 A;  1PWC A;  2K7S A;  3T4J A;  4IUK A;  3TSG A;  4PAU A;  4P87 A;  4K0W A;  4KQQ A;  4EUZ A;  3GVB A;  3FV7 A;  3SH7 A;  2ZJ9 A;  3WS0 A;  1UGU A;  3T50 A;  1J3W A;  1IOU A;  3ZVW A;  3LY3 A;  1OTI A;  2WKR A;  5GLC A;  5FAS A;  3G34 A;  4UEY A;  4OLG A;  1ES2 A;  1VEU A;  3FG8 A;  1PIO A;  4I3I A;  2BLS A;  4YFM A;  5EUA A;  1LI9 A;  4S2I A;  3IF6 A;  5TFQ A;  5A8B A;  4WN5 A;  4LRX C;  4WM9 A;  4MN7 A;  2ZC3 B;  4X69 A;  3UE0 A;  1JVJ A;  4Y2F A;  4GHI A;  2EX8 A;  2Z6C A;  1FCO A;  4JXV A;  4OQ0 A;  1Y54 A;  3TW8 A;  4DKI A;  4U3T A;  5HSQ A;  2QYB A;  3LCE A;  3MXS A;  3B3X A;  4HIA A;  3O3V A;  3HRE A;  4EEU A;  3NCK A;  1BUE A;  5F1G A;  3FZC A;  5GL9 A;  1RGY A;  2C5W B;  4YNR A;  2HPB A;  2V1A A;  3HCY A;  2OV5 A;  5I5L A;  1GHP A;  5A93 A;  1GSW A;  4B4Z A;  1CI9 A;  1T1C A;  3GEC A;  3E4Q A;  2V8F A;  3IXB A;  2OAP 1;  4R6L A;  3CG5 A;  3RTY A;  2ZC6 B;  3V5M A;  3HLE A;  4DDS A;  4E3N A;  1SKO A;  2PU2 A;  2Y55 A;  3UE6 A;  4X55 A;  4K08 A;  5DF7 A;  1LI0 A;  1T1B A;  1XKZ A;  3CHW P;  3F1O B;  2Y2O A;  4X1M A;  4HES A;  5G4Y A;  4N1H A;  4Y17 A;  1S4S A;  5DTS A;  5C5K A;  1K55 A;  1OTB A;  5A91 A;  3JPU A;  3D4F A;  4KZ8 A;  2ZQ9 A;  3BLM A;  4II7 A;  5KSC A;  3LEZ A;  1H5X A;  3HBR A;  4GDN A;  2ZL1 B;  2PDR A;  2PT7 A;  1G68 A;  4D2O A;  5HD3 A;  5J8X A;  3WS2 A;  3T1R A;  1FIL A;  2HJ9 C;  4ZBE A;  2OOL A;  4X68 A;  3MXQ A;  3VSL A;  2XLN A;  3B47 A;  1LT0 A;  1YM1 A;  4NXE A;  3VFF A;  4IUH A;  3LR5 A;  3MSH A;  1T1A A;  2EWW A;  3CI6 A;  5U47 A;  4WEK A;  2H28 A;  3C5A A;  3KSG A;  4BBV A;  3VE3 A;  1ES4 A;  3S7Q A;  1KVL A;  1YPR A;  2EWV A;  4RX3 A;  4JPM A;  3V3S A;  1KVM A;  5A92 A;  1X0O A;  4ID4 A;  1SCW A;  4R23 A;  4KG5 A; 
#chains in the Genus database with same CATH homology
 3UME A;  1GSV A;  2LB9 A;  2YKH A;  3PR6 A;  1YSQ A;  4ZRR A;  2M1C A;  4EXO A;  4CQH A;  1G28 A;  4GS9 A;  5DFX A;  3PBT A;  2NUT C;  2ZMV A;  5F69 A;  3LIB A;  3LYX A;  1LL8 A;  3F1P A;  1LSX A;  3E98 A;  1JNU A;  1OPX A;  3PBQ A;  4RQ9 A;  3PXP A;  2WKP A;  3UB9 A;  5EFW A;  3UMD A;  2KLI A;  3KSH A;  4WL9 A;  4B93 A;  4EW7 A;  2HGV A;  3ZYT A;  3LR4 A;  2L0W A;  1WA9 A;  4HJ6 A;  3A0R A;  4XT2 B;  2VZW A;  3HJI A;  1YSP A;  4H6J A;  3F1P B;  3E0Y A;  3F1O A;  2VX8 A;  3LIE A;  4ME4 A;  2BAS A;  1ZHH B;  2W27 A;  3LIA A;  3T4O A;  4I39 A;  2OAQ 1;  5DKL A;  2QJ5 A;  3S7N A;  3EQU A;  2W1R A;  2P7J A;  4LRY C;  2W1T B;  3B33 A;  3EEA A;  1ODV A;  4ETX A;  1V9Y A;  1IFQ A;  4LRZ E;  3LR3 A;  5TBM B;  4CLC E;  1XJ4 A;  3IBJ A;  5HWT A;  4NXF A;  4JGR A;  3RFB A;  2GJ3 A;  2A2L A;  1LSV A;  2L4R A;  3K2N A;  4PHT A;  4G3V A;  2I9V A;  3LUQ A;  2PHY A;  4HJ3 A;  5HDC A;  2GNX A;  3NJA A;  3A0V A;  3UE3 A;  3H82 B;  1NLY A;  3BQ8 A;  2O9B A;  3LIF A;  2JKR M;  3VV4 A;  4F3L A;  1DP6 A;  3TJZ C;  3VE4 A;  1W63 Q;  1S67 L;  4R70 A;  4JGQ A;  2Y8H A;  3UB7 A;  4E04 A;  5DJU A;  1VB6 A;  3TE8 A;  4HOI A;  2O99 A;  3EOI A;  4ARZ B;  5F5Y A;  4PKY G;  3MF0 A;  4HP4 A;  4Z1W A;  3W2Z A;  4HI4 A;  4I3J A;  2FZ0 A;  1OTE A;  4EEP A;  4F3L B;  2ZBB A;  1S1Z A;  2GX5 A;  1XFN A;  1XFQ A;  4FSF A;  5L8M A;  4O01 A;  5HPF A;  2QKP A;  5DKK A;  3B42 A;  4CLC C;  3PYP A;  3OBF A;  5DJT A;  3C30 A;  2J3W A;  4EES A;  3P7N A;  1YAX A;  4CLC B;  2A24 A;  3PBS A;  3IS2 A;  4HH3 A;  4Q0H A;  2B18 A;  2FH5 A;  3T4Q A;  3MQO A;  1OT9 A;  4HY8 A;  1P9W A;  4ETZ A;  3P01 A;  3BY8 A;  5HPI A;  3KO6 A;  2HV1 A;  1LSW A;  3BWL A;  2G7U A;  4MN5 A;  4PKY A;  4LLO B;  2A24 B;  3KSI A;  2V1B A;  3KYQ A;  1TD5 A;  3IS2 B;  3C38 A;  3ICY A;  4M4X A;  3G6O A;  4HQA A;  3K3D A;  4XT2 A;  3MQ0 A;  2HF6 A;  4YWZ A;  2KX6 A;  4BJP A;  4O8G A;  3OCL A;  1MKM A;  4Q0I A;  3EWK A;  4I5S A;  1P0Z A;  5KSH A;  1YKD A;  2D01 A;  2XRN A;  4MDZ A;  4WUJ A;  2W3G A;  3KSF A;  3OLO A;  2VV7 A;  2W1T A;  1P9R A;  2W3E A;  2P08 A;  1OJG A;  4BBU A;  3LI9 A;  5HWW A;  4KQD A;  5TBM A;  5J7E A;  5HWV A;  3U2A A;  1DP9 A;  3NHQ A;  1TF1 A;  4EET B;  3D72 A;  2VA0 A;  5TJJ A;  1MC0 A;  2CMN A;  5J3W A;  3MFX A;  4KUK A;  3MR0 A;  2K2N A;  5IT5 A;  1N9L A;  2Z6D A;  3H82 A;  2J3T C;  3PBN A;  3EQV A;  3EGD C;  1F98 A;  4GCZ A;  4UQI S;  1TS7 A;  4DJ2 A;  3DBA A;  4BWI A;  3T4T A;  3KYZ A;  3F1N B;  4I38 A;  4Q0J A;  1T19 A;  3LFV A;  2QWS A;  4NXB A;  2J3T D;  4AFI A;  2JHE A;  3E4O A;  3RH8 B;  2PR6 A;  3LI8 A;  5J4E A;  2DMW A;  3HJK A;  4ARZ A;  2PD8 A;  1NWZ A;  4EUV A;  4B9O A;  3BY9 A;  3OOV A;  4G3W A;  3T4L A;  5CX7 A;  1H3Q A;  2K31 A;  3T4K A;  4DN0 A;  1BYW A;  3FPW A;  3MMH A;  1DP8 A;  4G3K A;  1TS6 A;  2P04 A;  4EQ1 A;  1TS0 A;  5MC7 A;  2VKS A;  3CAX A;  3S7P A;  5DF9 A;  2JN7 A;  2ZOI A;  5HZH A;  4EU0 A;  3CUE A;  2LB5 A;  2W0N A;  1F5M A;  3PBR A;  4UQI M;  4CLC A;  4BMW A;  4LPZ A;  3UB6 A;  4OOL A;  3IBR A;  2K7S A;  3T4J A;  4HH2 A;  4IUK A;  3ZQ5 A;  4PAU A;  2M7V A;  3EGX C;  5AVE A;  3CUE C;  3C2W A;  3BJN A;  4WLA A;  5HDD A;  1UGU A;  3LID A;  3T50 A;  1IOU A;  1UWP X;  2VGL S;  4JGP A;  1GSX A;  2GZA A;  2NUP C;  1OTI A;  2WKR A;  2JKT I;  3NOT C;  4UEY A;  2XA7 S;  4GJ4 A;  5FL3 A;  3OC2 A;  3GDI A;  3FG8 A;  4I3I A;  2KOI A;  4HJ4 A;  1NLZ A;  3PBO A;  3K3C A;  4L9E A;  5A8B A;  3T4S A;  4WN5 A;  3EEH A;  4LRX C;  1ZTU A;  4WEL A;  4MN7 A;  3O5Y A;  4R3A A;  3V67 A;  2ZMF A;  4GW9 A;  4KUO A;  5DFY A;  1VHM A;  2B02 A;  4Y2F A;  4GHI A;  5AVF A;  1OT6 A;  2Z6C A;  2R78 A;  4HP9 A;  2KDK A;  3TW8 A;  5F6A A;  5HSQ A;  2W3H A;  2QYB A;  1EW0 A;  2OWJ A;  5IU1 A;  4HIA A;  4DJ3 A;  3TRC A;  2XSS A;  3R7W A;  4QPR A;  1F9I A;  4EEU A;  2OWH A;  4MMN A;  4GHI B;  1T18 A;  1KOU A;  2L1M A;  3MJQ A;  5IS1 A;  3F1N A;  3KX0 X;  1UWN X;  2YKF A;  3H7W B;  2PD7 A;  4HHD A;  2HJE A;  3JVV A;  2J80 A;  4YNR A;  1S4R A;  4L9G A;  2V1A A;  4NEE D;  4Y3I A;  3HCY A;  4FOF A;  4DMZ A;  5I5L A;  1TS8 A;  2PYR A;  5KIZ A;  1H8M A;  3R7W B;  1T1C A;  2PYP A;  3GEC A;  4GS9 B;  3UB8 A;  3E4Q A;  2OAP 1;  3SW1 A;  4R6L A;  1G6O A;  3LIC A;  1OTA A;  5F68 A;  3ULF A;  1STZ A;  2O9A A;  3CLO A;  3RTY A;  1D7E A;  4R38 A;  3UE6 A;  3H9W A;  2W3D A;  3E4P A;  4NKP A;  1XJ3 A;  4K08 A;  1XJ6 A;  1T1B A;  3BW6 A;  2V0W A;  4MCW A;  2VEA A;  4H6J B;  5HD5 A;  3F1O B;  2VJW A;  3A0S A;  4JGO A;  2XRO A;  4KQO A;  3C8C A;  5G4Y A;  2VV8 A;  2D02 A;  4OOM A;  1N9O A;  2IA2 A;  1S4S A;  4WEJ A;  2JKR I;  2VV6 A;  3CIT A;  3MQQ A;  1OJ5 A;  3PHY A;  3D3O A;  2ZOH A;  5C5K A;  1OTB A;  1NRJ A;  3CWF A;  1S66 L;  2EA9 A;  3VOL A;  1S1Y A;  4II7 A;  4YOF A;  3S7O A;  4BBT A;  2PDR A;  1XJ2 A;  4IHQ A;  4EER A;  1D06 A;  2V9A A;  5K5B A;  1W63 M;  2PT7 A;  3OCN A;  5HD3 A;  4P6Z S;  3R4K A;  5HL6 A;  2O9C A;  1MZU A;  2HJ9 C;  2OOL A;  1OTD A;  2PR5 A;  2JKT M;  1DRM A;  3MXQ A;  3NOU C;  3B47 A;  1LT0 A;  2Y79 A;  2INW A;  4NXE A;  4IUH A;  3JVU A;  3FPV A;  2QHK A;  4Y5F A;  1Y28 A;  3FC7 A;  3LR5 A;  1T1A A;  1P97 A;  2EWW A;  4L9F A;  3BQA A;  5HDS A;  2WKQ A;  3CI6 A;  2V0U A;  2O0Y A;  4I3A A;  4O0P A;  2W3F A;  4GLQ A;  4IJG A;  4WEK A;  2VLG A;  2H28 A;  3KSG A;  4L0L A;  4BBV A;  5AJG A;  1V9Z A;  4WF0 A;  3VE3 A;  3H7W A;  3S7Q A;  4CLC D;  2QJ7 A;  2MJ6 A;  1N9N A;  2EWV A;  2VGL M;  3LR0 A;  4HNB A;  4NXG A;  3NOP C;  4P6Z M;  5LBR A;  1X0O A;  5G4Z A;  2M7U A;  2XA7 M;  4MN6 A;  1GSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...