4Y0UA

Crystal structure of 6alpha-hydroxymethylpenicillanate complexed with oxa-58, a carbapenem hydrolyzing class d betalactamase from acinetobacter baumanii.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Active-Site Plasticity Is Essential to Carbapenem Hydrolysis by OXA-58 Class D beta-Lactamase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 73
structure length 242
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4y0uA00
3V5MA 4RA7A 3G4PA 4X55A 1KDWA 4E3JA 1DY6A 1YM1A 2EX9A 3SS4A 4BD1A 3VFHA 3MKFA 1L0EA 3IF6B 4KG5A 4OPRA 1FOFA 3N6IA 1YLYA 3LY3A 3ISGA 4P85A 3MXSA 1ERQA 1IEMA 4KZBA 4E3KA 1PI4A 4PPRA 4E6WA 3OZHA 3M2JA 4N9KA 3W4QA 1RGZA 5JYPA 3BLMA 5DVAA 2H0YA 2V1ZA 4FCFA 3FZCA 4JKTA 4OQ0A 2EXBA 2XD1A 3GTCA 1YLTA 1BT5A 1DJBA 1O07A 3NIAA 3UPPA 2Y2PA 4KZ6A 3RXWA 4OP5A 1XPBA 5EVID 3P98A 1K55C 2FFYA 3BLSA 4WELA 4ID4A 2I72A 1IKGA 1JTDA 3P09A 4X56A 3MZEA 4X6TA 4HBTA 5TFQA 2GDNA 5J8XA 2BG1A 1L0DA 4OOYA 3LO7A 3OC2A 5BOHA 2ZC3B 1FCMA 5FQKA 5GHXA 1K4FA 4DDYA 4WZ4A 3IWIA 4GDBA 4P6BA 2J8YA 5CTMA 3Q7VB 4JXGA 4XUXA 4R0QA 5A90A 3FYZA 5GLCA 4WYYA 3S1YA 3Q82A 2WKEA 4PM6A 4A5RA 2P9VA 3BYDA 2WAFA 3IWQA 5FATA 4BL3A 1YLPA 5F1GA 3PBQA 5L2FA 1JWZA 2Y2HA 4F94A 1HZOA 2XEPA 3IT9A 4IVIA 4WM9A 4R4RA 1C3BA 1TEMA 4Y0OA 4LV1A 2XK1A 4RX2A 2Q9NA 3IHAA 1MWTA 2G2WA 2JC7A 4NK3A 4OKPA 1NZUA 3SOIA 2XFTA 4HBUA 3VMAA 3CJMA 1K4EA 3TOIA 3ZFZA 2ZQ9A 5E2EA 1GHMA 5HFOA 4KZ5A 4DF6A 5DTTA 1H8YA 1I5QA 1NXYA 3GR2A 4PM9A 4B88A 4ZDXA 1K55A 3UE3A 5KZHA 3G30A 1ES2A 3QHYA 1E25A 5GLDA 5M19A 1PYYA 2IWDA 5FQMA 4BL2A 2BLSA 4N9LA 1H8ZA 4E3LA 4OLDA 2ZC4B 3Q7VA 3SS3A 3HREA 4ZBEA 3BECA 4PM5A 3ZVWA 3GMWA 4P87A 5FDHA 3IHBA 5CHUA 3UNWA 4WMCD 1FCOA 1JTGA 1GCEA 2H0TA 2B5RA 4UA7A 1NY0A 1Y54A 3ZDJA 3HUMA 4U0XA 5CRFA 3C7VA 1K56A 1KGEA 3BRMA 3M2KA 5DF9A 1YLZA 4GDNA 1BULA 3M6BA 4WZ5A 4MNRA 1PW8A 2V2FF 1Q2PA 3BM6A 3N8LA 2WGIA 4OQGA 5D3OA 1U60A 3NC8A 2WZZA 1XP4A 4MBKA 3IXBA 3ZVTA 4QY6A 5CGWA 1PWDA 2RL3A 2EFXA 2ZQDA 3PTEA 5FQQA 2VGJA 3BFEA 2EX6A 1TVFA 2WK0A 4JXSA 3N4IA 4WBGA 1YT4A 3VOZA 1BSGA 1ZG4A 1E3UD 3UE1A 2C5WB 2PU2A 2Y2JA 3HUNA 4KG2A 4CJNA 1IELA 2XF3A 5A93A 5EOOA 3UE0A 1PW1A 1S6RA 2DRWA 2WZXA 4IVKA 3VP2A 3QNBA 4DE0A 4S2KA 5FASA 4K0WA 5EE8A 3PBOA 4LV0A 2J9PA 1WYBA 2ZC6B 3OPPA 3Q7ZA 4H8RA 1H5XA 3VP1A 1GA9A 4B4ZA 2WGVA 3V50A 3ZG5A 1PWCA 1SHVA 2P9VB 1BTLA 3O88A 2ZJ9A 1E4DA 3JYIA 1KE0A 1PZPA 1TDGA 3C4PA 4JPMA 5HW3A 2Y2LA 4KZ8A 4QJGA 1XGIA 2IWBA 5CERA 1MKIA 3OCLA 5FA7A 2Y55A 3PBSA 1RP5A 3G35A 3SS5A 4O7DA 2E8IA 3MXRA 1FSWA 1W8YA 4LCMA 5FQJA 3WS5A 4DE3A 3V3RA 1CI9A 3N7WA 4DDSA 3ITBA 1XX2A 1SKFA 4RX3A 4ZTKA 4JXVA 3GVBA 4KENB 4QY5A 1BLPA 1YLJA 1L2SA 1RCJA 3VSKA 1HVBA 1JWPA 2WGWA 3HLDA 3A3EA 5GHZA 4E3NA 3IWOA 3MKEA 1MXOA 3VFFA 3WS4A 1IYPA 4DRTA 1KDSA 3BFCA 3G32A 5HAIA 3S22A 4E3MA 1W7FA 3AGFA 2XR0A 3HLGA 3WS1A 2HPBA 4OONA 1AXBA 2XLNA 4OH0A 4IEDA 4UHUA 3IQAA 2XQZA 4EBPA 5HX9A 3CG5A 4KZ9A 2QMIA 4OQHA 1KE3A 4WEKA 4Y7PA 1IKIA 1DJCA 3WS2A 1XXMA 4KZ7A 3SH7A 3BFFA 1CK3A 4RYEA 2XFSA 5EPHA 2X02A 4WZ5C 4X69A 3HVFA 1EWZA 3GV9A 4GNUA 1N9BA 2HDRA 4JF6A 5M18A 1LL9A 1KGGA 5I94A 3ZCZA 1YMSA 2ZC7A 3QNCA 4YFMA 3LCEA 1BLHA 4LV2A 2XGNA 3LEZA 1PZOA 1XGJA 1BZAA 5DTSA 5TR7A 4Y0UA 4Z9QA 5HL1A 1G6AA 1SDEA 4M3KA 4S2OA 4EQIA 5A92A 3G31A 3HLEA 2J7VA 4EUZA 1WYCA 5EVIC 2Y2GA 2HP9A 1YQSA 3M6HA 4IBXA 4OPYA 4JLFA 1MWUA 3VP0A 1CI8A 3VOYA 2P74A 1EROA 3GQZA 4BQMA 3N8SA 4LENA 3ZHHA 3DW0A 4EBLA 4KQQA 1W5DA 1NJ4A 1ONGA 2A49A 4N1XA 4HEFA 3GSGA 2H10A 5FI6A 3W8KA 3A3IA 1FQGA 4ZJ2A 4C75A 3RJUA 4GD8A 3VP4A 3A3FA 5AQBA 3Q81A 2RCXA 2ZC5B 3VSLA 1L0GA 3VP3A 5CEDA 4GN2A 4ZAMA 5F82A 2DNSA 1FSYA 2HDQA 1SCWA 1CEFA 4FD8A 4BD0A 3UDIA 3AGEA 3HLWA 1L0FA 4DXBA 3NDGA 3MFDA 3B3XA 2ZQ8A 5IHVA 1BLCA 3O3VA 4DE1A 3A3DA 4KZ3A 1K25A 1KVLA 4QHCA 2XH9A 1VM1A 3IH8A 4R4SA 5CXWA 4KZ4A 5JYOA 1ESUA 1VQQA 1MBLA 1DJAA 2OLVA 1K6SA 2WGWB 4GZBA 3ZNTA 3G2ZA 1ES3A 3DWZA 4JXWA 4MLLA 3ZNYA 1SDNA 4KZAA 4GD6A 4FH4A 2ZM2A 2EXAA 3PBTA 4XXRA 5G18A 2R9XA 4HESA 3FKWA 4OOLA 3N8RA 3UPNA 4DXCA 1K54C 5EVIA 5FAQA 4N92A 1LLBA 3PBNA 4OP8A 2EX8A 5HAPA 2ZQAA 1BUEA 4GOGA 1QMFA 2Y2KA 3BEBA 2JBFA 3ZG7B 3CMZA 3NDEA 2WYXA 1S0WA 1ES4A 1NRFA 3D4FA 2EFUA 3HLCA 5M1AA 1KE4A 3E2KA 2WAEA 4QD4A 1ES5A 2Y2MA 3C7UA 4K91A 2EX2A 4P0MA 1GHIA 3E2LA 2ZMAA 4MEZA 4MBHA 2WKHA 4OQIA 1CEGA 1ESIA 4OLGA 2X01A 2JCHA 3SH8A 4DKIA 1K56D 4KQRA 1LHYA 1K38A 5DTKA 2XD5A 3IF6C 1FR6A 3DWKA 4S2JA 1IYSA 1W79A 5CHMA 5CTNA 3ZG8B 4D2OA 3BFDA 4S2NC 4X68A 3NI9A 5E2HA 5EVLA 5FQIA 3ZGAB 4YINA 1KVMA 5KMWA 4N1HA 3PBRA 1IYQA 4R23A 1EI5A 1Z6FA 4UA9A 5DF8A 1XA1A 3UDXA 3HUOA 4WEJA 3IXGA 3IXDA 4GKUA 4BJPA 3V3SA 5AQ9A 3I7JA 3SH9A 1MY8A 3FKVA 2J9OA 3Q1FA 4S2IA 3UO9A 5E43A 5FQ9A 3G2YA 1K54A 3HBRA 1BLSA 1WE4A 1W8QA 2OLUA 5EECA 1LI0A 4KG6A 4R3JA 4GB7A 5GLAA 2QPNA 3AGDA 2HDUA 3HLFA 3OPLA 3BFGA 3CZDA 2A3UA 4FH2A 4QB8A 4R1GA 5E2FA 1MWSA 1M40A 3GRJA 4KQOA 5TGFA 2G2UA 1MWRA 2R9WA 1K57C 3C4OA 5CGXA 5EUAA 4BLMA 4B4XA 4S2PA 4WMCA 5GL9A 4C6YA 2C6WB 3V39A 2Y91A 5HARA 1PWGA 4OPZA 1HTZA 2Z2MB 5F1FA 3IF6A 5FI7A 1FCNA 4X53A 5CGSA 1YMXA 3MZFA 4S2NA 3TG9A 3WRTA 1TDLA 4R3BA 4XUZA 3UN7A 2QZ6A 3WS0A 3S4XA 3Q07A 5CEBA 1KGFA 4PMAA 4MBFA 1XKZA 4E3OA 1NZOA 3HL9A 2HDSA 5EVIB 3PAEA 3NY4A 3PAGA 4UAAA 1MPLA 2OV5A 4EV4A 1E3UA 4PM7A 1NYMA 1ZG6A 2PU4A 3LY4A 1N4OA 3FWLA 3UPOA 2Y2OA 4L0LA 1RGYA 1PI5A 5A91A 3OCNA 3ITAA 2Q9MA 1I2SA 1LL5A 4JF5A 4NETA 2ZM8A 4Y0TA 3OPHA 4U3TA 1Q2QA 4UA6A 4E3IA 4EWFA 5FAPA 1JWVA 2Y59A 1HD8A 3IH9A 1NYYA 4FSFA 3NCKA 5GLBA 4DE2A 3W4PA 4E6XA 1GHPA 3ZG0A 5CHJA 5CECA 4IBRA 4PM8A 1JVJA 3UDFA 2JE5A 1K57A 4EBNA 2HP5A 4LV3A 5EOEA 1LI9A 4K0XA 1ALQA 3DTMA 3NBLA 3O86A 4ZJ3A 2ZM0A 2Z2LB 3O87A 3OPRA 3TSGA 2HP6A 4OPQA 5FAOA 4Q8IA 2H5SA 2WKIA 1K6RA 1ZC2A 2XDMA 4S2LA 5AQAA 3WWXA 2IWCA 1ONHA 2DCFA 4RVAA 1GA0A 2X71A 5U47A 3IXHA 1FR1A 5KSHA 5F83A 3W4OA 3IF5A 2FFFB 4S2MA 3EQUA 5DF7A 3EQVA 3MZDA 4JBFA 2WUQA 1I2WA 2Y2IA 2V20A 4U0TA 2Y2QA 3HLBA 3RXXA 5AQ7A 4C3QA 2VGKA 2ZQCA 1IYOA 1O7EA 3C5AA 2ZQ7A 1M6KA 4CPKA 2Y2NA 2PBYA 4LCLA 1ZKJA 3FV7A 1PIOA 1XA7A 2WADA 3MBZA 3WRZA 3G34A 4OOMA 2ZLYA 4QU3A 3ZG9B 4ZJ1A 5E2GA 5FSRA 1J9MA 4BENA 5HAQA 4JF4A 2CC1A 2UWXA 5GHYA 5KSCA 1QMEA 1YLWA 3A3JA 4OVDA 2OSUA 2ZD8A 5FI2A 1ERMA 3UY6A 1G68A 1OMEA 2Y4AA
chains in the Genus database with same CATH superfamily
4RA7A 1OTAA 1DY6A 4BD1A 3MKFA 1L0EA 4BWIA 3IF6B 1FOFA 3LY3A 3A0VA 3ISGA 3UE6A 3MXSA 1ERQA 4KZBA 4E3KA 4Y3IA 3OZHA 3M2JA 3BLMA 2H0YA 2V1ZA 3E98A 3FZCA 3GTCA 1YLTA 2Y2PA 1XPBA 2H28A 1K55C 2I72A 4X56A 5TFQA 3O5YA 1D06A 2BG1A 2ZBBA 2VKSA 3LO7A 2W3DA 1FCMA 5FQKA 5GHXA 1K4FA 4DDYA 4WZ4A 4P6BA 3DTIA 4XUXA 2K7SA 3S7PA 1DP9A 1N9OA 3BQAA 4KUKA 4WYYA 4PM6A 4AFIA 2P9VA 3BYDA 4I3JA 4BL3A 5F1GA 3PBQA 1HZOA 4HP9A 4IVIA 4LV1A 2Q9NA 3IHAA 4LLOB 1NZUA 2GJ3A 3LFVA 4R38A 4JGPA 1I5QA 1NXYA 3TE8A 3H9WA 4ZDXA 1K55A 5KZHA 2V8CA 5M19A 4G3WA 2BLSA 2YKFA 4OLDA 3SS3A 3HREA 4GHIB 4PM5A 5FDHA 3IHBA 2KOIA 1FCOA 1JTGA 4ETXA 2B5RA 2K2NA 4UA7A 4U0XA 2WKPA 3IS2A 4MNRA 3N8LA 5G4ZA 5D3OA 3PHYA 3NC8A 1XP4A 2ZL1B 1UGUA 4QY6A 2RL3A 3PTEA 5FQQA 2VGJA 3T4KA 1BSGA 1E3UD 4UQIM 1PNEA 1TS7A 2DMWA 3NECA 4CJNA 4LFUA 5EOOA 4DE0A 4K0WA 3PBOA 2D01A 1WYBA 2ZC6B 3Q7ZA 3VP1A 3IBJA 2V8FA 4WLAA 3MF0A 1PZPA 5HW3A 5FEGA 4QJGA 1XGIA 1MKIA 1VHMA 1VEUA 3PBSA 3CUEC 3G35A 2QJ5A 2XSSA 3LI9A 1IFQA 5FQJA 5A8BA 5DKKA 3WS5A 1T1BA 3U2AA 4RX3A 4ZTKA 1BLPA 1YLJA 3VSKA 3C2WA 1UWPX 1S1YA 2W27A 4E3NA 2W1RA 1MXOA 4NXGA 4DRTA 1VETB 2B95A 3HLGA 3LR5A 4IEDA 3IQAA 3LIAA 2XQZA 3CG5A 4KZ9A 3HJKA 4OQHA 4WEKA 3WS2A 3F1NB 2Y79A 2NUTC 1SKOB 2Z6CA 2VV8A 1LL9A 2ZC7A 3CUEA 3LCEA 5I5LA 3FG8A 2XGNA 1PZOA 1XGJA 5TR7A 2L4RA 4Z9QA 1G6AA 4M3KA 4S2OA 4MCWA 4EUZA 2Y2GA 2HP9A 4ZRRA 3VP0A 1OT6A 3VOYA 2P74A 4EBLA 4LENA 4KQQA 1W5DA 1ONGA 2HZ5A 4C75A 4DJ3A 4ZJ2A 3RJUA 3CI6A 3A3FA 3Q81A 2RCXA 4DN0A 4EXOA 4GN2A 4ARZB 2ZMVA 1CEFA 2JN7A 2M7UA 4BD0A 3RFBA 3BY9A 2KX6A 3O3VA 1K25A 1TS0A 2XH9A 1VM1A 3NJAA 2OLVA 1VQQA 4GZBA 1DJAA 4Y15A 4EEPA 4GLQA 4JXWA 1KOUA 2EXAA 3VV4A 4WF0A 3N8RA 4M4XA 1LLBA 4XT2A 2Y2KA 3CMZA 3KX0X 1ES4A 3D4FA 3KSIA 2P08A 4MDZA 3PYPA 2WKHA 3UB6A 2W1TB 4OLGA 1K56D 2EA9A 3A0SA 3KYEA 3IF6C 2PR6A 3DWKA 1IYSA 3ZG8B 3NI9A 1KVMA 3PBRA 1IYQA 1Z6FA 3ZQ5A 2JKGA 1XA1A 3E4OA 3UDXA 3HUOA 4WEJA 2VV7A 4YWZA 3IXDA 3V3SA 4S2IA 5E43A 3HBRA 3IBRA 1PRQA 4KG6A 4R3JA 2QPNA 4FH2A 4QB8A 2B02A 3GECA 5E2FA 3GRJA 4KQOA 1N9LA 3C4OA 5CGXA 2A24A 3T1RA 3MFXA 4OPZA 3IF6A 5FI7A 3MZFA 2R78A 3TG9A 3WRTA 1TDLA 4R3BA 4Y17A 3UN7A 3DAVA 5AVEA 1XKZA 4E3OA 1NZOA 4CLCC 5L09A 1N4OA 2Q9MA 2GNXA 4UA6A 4E3IA 2EWVA 1JWVA 2Y59A 3IH9A 1NYYA 1HLUP 3BWLA 1EW0A 3UMDA 5CHJA 3C30A 4IBRA 1T18A 1JVJA 2INWA 2JE5A 4LV3A 4ZJ3A 4OPQA 2XDMA 3RTYA 5AQAA 2VEAA 1GA0A 2X71A 4HOIA 4UEYA 4BBUA 5F83A 3MZDA 1I2WA 1IYOA 1O7EA 2O9AA 1XJ2A 5AJGA 2WADA 3BJNA 3G34A 2ZLYA 3JPUA 3B47A 3ZG9B 4CLCE 1QMEA 2V1AA 5FI2A 3EWKA 3UY6A 1GSVA 2VK3A 1ZHHB 2V0WA 3G4PA 4GHIA 1KDWA 4X55A 1YM1A 2EX9A 3SS4A 4B93A 3VFHA 4R6LA 4E04A 3T50A 4OPRA 1F98A 3TRCA 1IEMA 3L7HA 1G5UA 4E6WA 3EEAA 2Q0OA 4N9KA 1RGZA 3A0RA 4FCFA 3QP1A 4JKTA 3S7OA 2ZL1A 1BT5A 4KZ6A 2QJ7A 4WELA 3P09A 4JGRA 2GDNA 5J8XA 5DFXA 1MZUA 4OOYA 2OWHA 3OC2A 5BOHA 2ZC3B 3E4QA 4Z1WA 3Q7VB 3K3CA 3ICYA 4R0QA 5A90A 3FYZA 5GLCA 3S1YA 3Q82A 5FATA 3BQ8A 1FIKA 1W63Q 4R4RA 1TEMA 4R70A 2XK1A 4RX2A 5L8MA 3B42A 2OAP1 4OKPA 4HBUA 1K4EA 3ZFZA 4DF6A 4PM9A 1FILA 5FQMA 3T4JA 1VETA 4LRZE 4ZBEA 3ZVWA 3GMWA 1H3QA 3T4QA 2M1CA 1G6OA 2Y8HA 4WMCD 1GCEA 1OTEA 3F1NA 3HUMA 1SKOA 3C7VA 3CLOA 3M2KA 3MXQA 4WZ5A 4OQGA 1V9YA 3SW1A 2EX6A 1TVFA 4YNRA 4JXSA 3N4IA 4WBGA 3LIFA 3S7NA 5IT5A 2Z6DA 2Y2JA 4KG2A 1IELA 2XF3A 1L3LA 5A93A 3UE0A 1PW1A 2DRWA 2WZXA 3VP2A 1MKMA 3OPPA 4H8RA 4B4ZA 4GW9A 3V50A 3ZG5A 1PWCA 1SHVA 2WKQA 2ZJ9A 2Y2LA 4KZ8A 5DFYA 2IWBA 2VGLM 5FA7A 3SS5A 5MC7A 1FSWA 1Z09A 4LCMA 2UV0E 5AVFA 4DE3A 3V3RA 3GVBA 4QY5A 5FDSA 1OPXA 1HVBA 1JWPA 2B18A 5GHZA 4IJGA 1GSWA 3OOVA 1YKDA 3S22A 1W7FA 2PR5A 3AGFA 2XR0A 3WS1A 2HPBA 1AXBA 2XLNA 3P7NA 4UHUA 4IUHA 1K0KA 5CX7A 1DJCA 4KZ7A 3SH7A 3BFFA 4FTXA 5FL3A 5EPHA 3C8CA 2ZOIA 5M18A 4IUKA 2CMNA 5I94A 2MJ6A 1YPRA 4I3AA 4YFMA 3R7WB 1BLHA 4EQIA 5A92A 3HLEA 3IX3A 2J7VA 1WYCA 4IBXA 3V67A 1EROA 3GQZA 4BQMA 5L10A 3E0YA 4N1XA 3R4KA 3W8KA 1FQGA 3VP4A 4L9FA 3LIEA 5HL6A 2ZC5B 3VSLA 1L0GA 5CEDA 2DNSA 4LPZA 2HDQA 1L0FA 1PFLA 5G4YA 3B3XA 5IHVA 1BLCA 4DE1A 4KZ3A 4QHCA 1KVLA 3LGOA 1S4RA 4KZ4A 1MBLA 1K6SA 4L9EA 3ZNYA 1SDNA 2R9XA 4HESA 3H7WA 4DXCA 2FZ0A 2PD7A 3H82B 2EX8A 5HAPA 4GOGA 1QMFA 3EEHA 2JBFA 2LB9A 2EFUA 3HLCA 3JVVA 3E2KA 4QD4A 1ES5A 1GHIA 3E2LA 2ZMAA 3MR0A 4MEZA 4OQIA 1ESIA 4KQRA 1LHYA 1K38A 2XD5A 1FR6A 4S2JA 4D2OA 5CHMA 3BFDA 4S2NC 4X68A 5FQIA 3ZGAB 2V1BA 4N1HA 1EI5A 4UA9A 5DF8A 1OT9A 3F1OA 4JGQA 3IXGA 4GKUA 1MY8A 4ETZA 2K31A 3Q1FA 3UO9A 4O8GA 1A0KA 2OLUA 3LR4A 3E4PA 5TBMB 1LI0A 5GLAA 3AGDA 3HLFA 4HIAA 4Y13A 2A3UA 4X25A 4R1GA 5F68A 1M40A 4NXFA 1OTDA 2R9WA 5EUAA 4NXBA 5GL9A 2JKRI 3NOPC 2Y91A 1PWGA 4UQIS 1HTZA 2Z2MB 5J3WA 5F1FA 1XJ3A 4X53A 5CGSA 4S2NA 3JVUA 2HF6A 3LR3A 1NLZA 4PMAA 4MBFA 3HL9A 5J4EA 3CITA 3NY4A 1MC0A 2OV5A 4EV4A 1E3UA 1NLYA 3KO6A 1NYMA 4HP4A 3NHQA 3LY4A 1XFQA 3ITAA 1I2SA 2ZM8A 2PBDP 4Y0TA 3OPHA 4U3TA 1Q2QA 1P97A 2P7JA 5FAPA 2ACGA 3ZG0A 3UDFA 4X1MA 2HP5A 1LI9A 1ALQA 2ZM0A 1LT0A 3FPWA 1K6RA 1ZC2A 3WWXA 4RVAA 1FR1A 2W3HA 1NRJA 2FFFB 4S2MA 2P04A 2WUQA 2Y2IA 3RXXA 3HLBA 5AQ7A 2VGKA 1OTBA 2ZQCA 4BBVA 2ZQ7A 4LCLA 1ZKJA 3FV7A 4MN6A 1PIOA 4OOMA 2LB5A 5FSRA 4JF4A 2CC1A 5GHYA 4F3LB 5KSCA 5K5BA 3QP8A 4OVDA 2ZD8A 4HH3A 3QP6A 1ERMA 4BMWA 5HPIA 2Y4AA 3V5MA 4E3JA 2XA7M 3N6IA 1YLYA 4EU0A 4I3IA 4PPRA 3W4QA 2I9VA 5DVAA 3S7QA 4OQ0A 1S4SA 5EM1A 1DJBA 3NIAA 3UPPA 5IU1A 4Q0JA 5EVID 3P98A 3EGXC 2FFYA 2J3WA 4CLCD 1IKGA 1JTDA 4X6TA 4HBTA 1D7EA 2AVXA 4HI4A 4PHTA 4JGOA 3DTEA 3IWIA 2J8YA 4JXGA 4B9OA 3UB7A 5HWWA 1AWIA 2WKEA 3IWQA 2WAFA 5EVEA 2W0NA 5L2FA 1JWZA 2Y2HA 2XEPA 1C3BA 4Q0IA 4Y0OA 1MWTA 2G2WA 3HJIA 4EQ1A 4NK3A 3VMAA 3CJMA 3TOIA 1GHMA 3DTKA 2G7UA 1H8YA 3QP5A 4B88A 4WL9A 4MMNA 3G30A 3QHYA 1PYYA 2IWDA 4N9LA 4BBTA 1H8ZA 4E3LA 2OAQ1 2ZC4B 4P87A 2KDKA 3T12B 3UMEA 5CHUA 5L07A 1NY0A 2O9BA 1K56A 2VLGA 1KGEA 5DF9A 1YLZA 1BULA 3BY8A 1U60A 4MBKA 3IXBA 1BYWA 5CGWA 2ZQDA 3R7WA 2WK0A 3T4SA 3VOZA 3UE1A 1F2KA 5LBRA 2J3TC 3MQ0A 4IVKA 3QNBA 4S2KA 4LV0A 3FC7A 2J9PA 1LSXA 1GA9A 4GJ4A 1BTLA 1E4DA 1WA9A 4HY8A 3C4PA 4KUOA 2OWJA 5CERA 3EOIA 2Y55A 1RP5A 2E8IA 4O01A 2GX5A 3UB9A 4II7A 5HDSA 4HJ6A 1CI9A 4DDSA 3ITBA 4JXVA 1L2SA 2V0UA 4PKYA 3HLDA 3IWOA 3MKEA 2EWWA 2O9CA 4EEUA 1KDSA 3ZYTA 4E3MA 3H82A 2JKFA 2PT7A 2OOLA 4P6ZM 2PYPA 3K2NA 4EBPA 5HX9A 2JKTI 1KE3A 1IKIA 1XXMA 4KQDA 1CK3A 2XFSA 4WZ5C 3QP4A 4X69A 3HVFA 1N9BA 2ZMFA 1KGGA 4GS9B 3LEZA 3VE3A 5DTSA 1SDEA 2W3EA 1F5MA 1JNUA 3LYXA 3LI8A 4RQ9A 3M6HA 1YQSA 4Q0HA 4OPYA 4JLFA 3K3DA 3N8SA 3DW0A 2VV6A 1LSVA 4HQAA 3GSGA 3A3IA 4ESPA 5AQBA 3TW8A 4ZAMA 1T19A 1FSYA 1SCWA 2XRNA 4FD8A 3UDIA 3AGEA 1DP6A 3IH8A 5CXWA 5JYOA 1ESUA 2VZWA 3ZNTA 2WGWB 3G2ZA 1ES3A 3DWZA 4KZAA 4GD6A 2ZM2A 1P9WA 5HD5A 3PBTA 4XXRA 1D1JA 2BASA 3UPNA 5FAQA 3UB8A 4P6ZS 4N92A 3PBNA 4OP8A 1S1ZA 1BUEA 3MS6A 3ZG7B 2WYXA 1S0WA 3HCYA 4X1LA 1KE4A 3C7UA 4Y5FA 1H8MA 4ARZA 4EETB 1CEGA 3KSGA 3SH8A 4O0PA 5HPFA 1UWNX 2JKRM 1W79A 1N9NA 5E2HA 5EVLA 4YINA 5KMWA 4R23A 3F1PB 3D72A 5AQ9A 3LEQA 2J9OA 2W3FA 3G2YA 1OJGA 1WE4A 1S66L 5FEFA 2PRFA 5EECA 4I39A 4GB7A 3L9KA 2HDUA 3OPLA 4DJ2A 4EW7A 4F3LA 1MWSA 2W1TA 5TGFA 2BTFP 1K57C 2VA0A 4BLMA 3PR6A 4S2PA 4WMCA 1ODVA 5HARA 4MN5A 1FCNA 1YMXA 3Q07A 1KGFA 2QWSA 4HNBA 5DKLA 5EVIB 1MPLA 4CLCB 2ZOHA 1T1CA 1ZG6A 2PU4A 2QYBA 3FWLA 2Y2OA 1RGYA 1PI5A 5KIZA 1DRMA 5A91A 3OCNA 4NEED 2VGLS 1HD8A 4FSFA 1OTIA 3NCKA 4PAUA 4DE2A 3MQOA 3W4PA 4E6XA 1GHPA 1K57A 4EBNA 4WN5A 5EOEA 4K0XA 3O87A 3OPRA 3SZTA 2H5SA 2WKIA 4I38A 4G3KA 2IWCA 1ONHA 2DCFA 5KSHA 3W4OA 3EQUA 5DF7A 3EQVA 3P01A 4HHDA 5F69A 1M6KA 1Y28A 2PD8A 1GSXA 1XA7A 3WRZA 3MBZA 4BENA 3CHWP 3A3JA 1P9RA 3U4LP 1VB6A 1OMEA 3LIDA 4KG5A 2VX8A 1TF1A 4FUWA 4EESA 3KYZA 1ACFA 4P85A 1T1AA 1PI4A 3D9YA 5JYPA 2EXBA 2XD1A 3GDIA 1O07A 3RXWA 4OP5A 2GZAA 2O99A 3NULA 3BLSA 4ID4A 3MZEA 5HD3A 1SZVA 1L0DA 3G6OA 2KLIA 5TJJA 4WUJA 4GDBA 5CTMA 4QPRA 4GCZA 4A5RA 1DP8A 3KSFA 1YLPA 2V9AA 3T4TA 2XROA 4F94A 3IT9A 5HWVA 4WM9A 3CAXA 4Y2FA 1TS8A 3CPTB 2JC7A 3SOIA 2XFTA 2ZQ9A 5E2EA 5HFOA 4KZ5A 5DTTA 3GR2A 3UE3A 3B33A 1ES2A 4H6JB 3OLOA 2O0YA 1E25A 5GLDA 4BL2A 3Q7VA 4L9GA 3BECA 1CQAA 3MSHA 3UNWA 2H0TA 1Y54A 3ZDJA 5CRFA 3BRMA 4GDNA 3M6BA 1PW8A 2V2FF 1Q2PA 3BM6A 2WGIA 1S67L 3LR0A 2WZZA 4ME4A 3ZVTA 2VJWA 3VE4A 4K08A 1PWDA 2EFXA 2PDRA 3BFEA 4GS9A 5EV0A 1YT4A 1ZG4A 4HH2A 2C5WB 2PU2A 2QHKA 3HUNA 4DMZA 1XFNA 2JHEA 2D02A 2E8JA 1S6RA 5FASA 5EE8A 1H5XA 4LGWA 2WGVA 5IS1A 2P9VB 3O88A 3JYIA 4EUVA 2JKTM 1KE0A 1TDGA 4JPMA 2PAVP 3OCLA 1ZTUA 3MMHA 4O7DA 1X0OA 3MXRA 1W8YA 2L0WA 3N7WA 1XX2A 1SKFA 3KSHA 4KENB 1RCJA 2WGWA 3A3EA 2PYRA 4EERA 3VFFA 5F5YA 3WS4A 1IYPA 3G32A 3BFCA 5HAIA 1XJ4A 4OONA 4OH0A 4CQHA 2QMIA 4Y7PA 5HDDA 1YAXA 4RYEA 2X02A 4FOFA 1EWZA 3GV9A 4GNUA 2HDRA 4JF6A 3IS2B 3ZCZA 1YMSA 2J80A 3QNCA 3NOTC 4LV2A 1BZAA 4Y0UA 5HL1A 1Y4OA 3KYQA 3G31A 3OBFA 3F1PA 5EVIC 5F6AA 3H7WB 1MWUA 1CI8A 2XA7S 5HDCA 3ZHHA 1NJ4A 2A49A 2HGVA 4HEFA 2H10A 1STZA 5FI6A 2J3TD 4GD8A 4IHQA 3LICA 3VP3A 1LL8A 5F82A 5HZHA 3FPVA 1VEUB 3HLWA 5EFWA 3T1QB 3EGDC 4DXBA 3NDGA 3MFDA 4NG2A 2ZQ8A 1YSQA 3A3DA 4LRXC 4R4SA 3T1SA 4MLLA 3IX8A 4FH4A 3F1OB 5G18A 4OOLA 3FKWA 1OJ5A 3W2ZA 3D3OA 1K54C 4R3AA 5EVIA 2NUPC 5HSQA 4CLCA 2ZQAA 3BEBA 1W63M 3NDEA 1NRFA 1XJ6A 4LRYC 4NKPA 4YOFA 5M1AA 2WAEA 2Y2MA 4K91A 2EX2A 2QKPA 4P0MA 1TS6A 5HWTA 4MBHA 3C38A 2X01A 2JCHA 4DKIA 5DTKA 3IX4A 5CTNA 3RH8B 2A2LA 1H0MA 1LSWA 4BJPA 2HV1A 3I7JA 3SH9A 3FKVA 2M7VA 5FQ9A 1K54A 1BLSA 2HJEA 3BW6A 1W8QA 3ULFA 3T4OA 3BFGA 3CZDA 3LIBA 4G3VA 3T1XA 3PXPA 1J3WA 4D60A 2G2UA 1MWRA 4PKYG 5EM0A 4B4XA 1F9IA 4C6YA 1NWZA 2C6WB 4I5SA 3V39A 4NXEA 3NOUC 4XUZA 1CJFA 2YKHA 2QZ6A 3WS0A 3S4XA 5CEBA 3UB5P 5DJTA 2HDSA 2HJ9C 3PAEA 2PHYA 3PAGA 4UAAA 4XT2B 1G28A 1YSPA 4PM7A 5J7EA 1V9ZA 3QP2A 3UPOA 4L0LA 5TBMA 1LL5A 4NETA 4JF5A 4EWFA 5GLBA 2FH5A 3DBAA 4MN7A 3MQQA 5CECA 4PM8A 2W3GA 3DTMA 3O86A 3NBLA 2Z2LB 3TSGA 2HP6A 2IA2A 5FAOA 4Q8IA 2WKRA 3T4LA 4S2LA 1TD5A 3LUQA 5U47A 3IXHA 3IF5A 4JBFA 2V20A 4U0TA 3CPTA 2Y2QA 4HJ4A 4QWOA 4C3QA 3C5AA 5C5KA 1P0ZA 3MJQA 4HJ3A 4CPKA 2Y2NA 3CWFA 2PBYA 5DJUA 4QU3A 4ZJ1A 1IOUA 1CF0A 2L1MA 4H6JA 5E2GA 1J9MA 5HAQA 3VOLA 2UWXA 1YLWA 3TJZC 2OSUA 1G68A 2A24B
chains in the Genus database with same CATH topology
3V5MA 4RA7A 3G4PA 4X55A 1KDWA 4E3JA 1DY6A 1YM1A 2EX9A 3SS4A 4BD1A 3VFHA 3MKFA 1L0EA 3IF6B 4KG5A 4OPRA 1FOFA 3N6IA 1YLYA 3LY3A 3ISGA 4P85A 3MXSA 1ERQA 1IEMA 4KZBA 4E3KA 1PI4A 4PPRA 4E6WA 3OZHA 3M2JA 4N9KA 3W4QA 1RGZA 5JYPA 3BLMA 5DVAA 2H0YA 2V1ZA 4FCFA 3FZCA 4JKTA 4OQ0A 2EXBA 2XD1A 3GTCA 1YLTA 1BT5A 1DJBA 1O07A 3NIAA 3UPPA 2Y2PA 4KZ6A 3RXWA 4OP5A 1XPBA 5EVID 3P98A 1K55C 2FFYA 3BLSA 4WELA 4ID4A 2I72A 1IKGA 1JTDA 3P09A 4X56A 3MZEA 4X6TA 4HBTA 5TFQA 2GDNA 5J8XA 2BG1A 1L0DA 4OOYA 3LO7A 3OC2A 5BOHA 2ZC3B 1FCMA 5FQKA 5GHXA 1K4FA 4DDYA 4WZ4A 3IWIA 4GDBA 4P6BA 2J8YA 5CTMA 3Q7VB 4JXGA 4XUXA 4R0QA 5A90A 3FYZA 5GLCA 4WYYA 3S1YA 3Q82A 2WKEA 4PM6A 4A5RA 2P9VA 3BYDA 2WAFA 3IWQA 5FATA 4BL3A 1YLPA 5F1GA 3PBQA 5L2FA 1JWZA 2Y2HA 4F94A 1HZOA 2XEPA 3IT9A 4IVIA 4WM9A 4R4RA 1C3BA 1TEMA 4Y0OA 4LV1A 2XK1A 4RX2A 2Q9NA 3IHAA 1MWTA 2G2WA 2JC7A 4NK3A 4OKPA 1NZUA 3SOIA 2XFTA 4HBUA 3VMAA 3CJMA 1K4EA 3TOIA 3ZFZA 2ZQ9A 5E2EA 1GHMA 5HFOA 4KZ5A 4DF6A 5DTTA 1H8YA 1I5QA 1NXYA 3GR2A 4PM9A 4B88A 4ZDXA 1K55A 3UE3A 5KZHA 3G30A 1ES2A 3QHYA 1E25A 5GLDA 5M19A 1PYYA 2IWDA 5FQMA 4BL2A 2BLSA 4N9LA 1H8ZA 4E3LA 4OLDA 2ZC4B 3Q7VA 3SS3A 3HREA 4ZBEA 3BECA 4PM5A 3ZVWA 3GMWA 4P87A 5FDHA 3IHBA 5CHUA 3UNWA 4WMCD 1FCOA 1JTGA 1GCEA 2H0TA 2B5RA 4UA7A 1NY0A 1Y54A 3ZDJA 3HUMA 4U0XA 5CRFA 3C7VA 1K56A 1KGEA 3BRMA 3M2KA 5DF9A 1YLZA 4GDNA 1BULA 3M6BA 4WZ5A 4MNRA 1PW8A 2V2FF 1Q2PA 3BM6A 3N8LA 2WGIA 4OQGA 5D3OA 1U60A 3NC8A 2WZZA 1XP4A 4MBKA 3IXBA 3ZVTA 4QY6A 5CGWA 1PWDA 2RL3A 2EFXA 2ZQDA 3PTEA 5FQQA 2VGJA 3BFEA 2EX6A 1TVFA 2WK0A 4JXSA 3N4IA 4WBGA 1YT4A 3VOZA 1BSGA 1ZG4A 1E3UD 3UE1A 2C5WB 2PU2A 2Y2JA 3HUNA 4KG2A 4CJNA 1IELA 2XF3A 5A93A 5EOOA 3UE0A 1PW1A 1S6RA 2DRWA 2WZXA 4IVKA 3VP2A 3QNBA 4DE0A 4S2KA 5FASA 4K0WA 5EE8A 3PBOA 4LV0A 2J9PA 1WYBA 2ZC6B 3OPPA 3Q7ZA 4H8RA 1H5XA 3VP1A 1GA9A 4B4ZA 2WGVA 3V50A 3ZG5A 1PWCA 1SHVA 2P9VB 1BTLA 3O88A 2ZJ9A 1E4DA 3JYIA 1KE0A 1PZPA 1TDGA 3C4PA 4JPMA 5HW3A 2Y2LA 4KZ8A 4QJGA 1XGIA 2IWBA 5CERA 1MKIA 3OCLA 5FA7A 2Y55A 3PBSA 1RP5A 3G35A 3SS5A 4O7DA 2E8IA 3MXRA 1FSWA 1W8YA 4LCMA 5FQJA 3WS5A 4DE3A 3V3RA 1CI9A 3N7WA 4DDSA 3ITBA 1XX2A 1SKFA 4RX3A 4ZTKA 4JXVA 3GVBA 4KENB 4QY5A 1BLPA 1YLJA 1L2SA 1RCJA 3VSKA 1HVBA 1JWPA 2WGWA 3HLDA 3A3EA 5GHZA 4E3NA 3IWOA 3MKEA 1MXOA 3VFFA 3WS4A 1IYPA 4DRTA 1KDSA 3BFCA 3G32A 5HAIA 3S22A 4E3MA 1W7FA 3AGFA 2XR0A 3HLGA 3WS1A 2HPBA 4OONA 1AXBA 2XLNA 4OH0A 4IEDA 4UHUA 3IQAA 2XQZA 4EBPA 5HX9A 3CG5A 4KZ9A 2QMIA 4OQHA 1KE3A 4WEKA 4Y7PA 1IKIA 1DJCA 3WS2A 1XXMA 4KZ7A 3SH7A 3BFFA 1CK3A 4RYEA 2XFSA 5EPHA 2X02A 4WZ5C 4X69A 3HVFA 1EWZA 3GV9A 4GNUA 1N9BA 2HDRA 4JF6A 5M18A 1LL9A 1KGGA 5I94A 3ZCZA 1YMSA 2ZC7A 3QNCA 4YFMA 3LCEA 1BLHA 4LV2A 2XGNA 3LEZA 1PZOA 1XGJA 1BZAA 5DTSA 5TR7A 4Y0UA 4Z9QA 5HL1A 1G6AA 1SDEA 4M3KA 4S2OA 4EQIA 5A92A 3G31A 3HLEA 2J7VA 4EUZA 1WYCA 5EVIC 2Y2GA 2HP9A 1YQSA 3M6HA 4IBXA 4OPYA 4JLFA 1MWUA 3VP0A 1CI8A 3VOYA 2P74A 1EROA 3GQZA 4BQMA 3N8SA 4LENA 3ZHHA 3DW0A 4EBLA 4KQQA 1W5DA 1NJ4A 1ONGA 2A49A 4N1XA 4HEFA 3GSGA 2H10A 5FI6A 3W8KA 3A3IA 1FQGA 4ZJ2A 4C75A 3RJUA 4GD8A 3VP4A 3A3FA 5AQBA 3Q81A 2RCXA 2ZC5B 3VSLA 1L0GA 3VP3A 5CEDA 4GN2A 4ZAMA 5F82A 2DNSA 1FSYA 2HDQA 1SCWA 1CEFA 4FD8A 4BD0A 3UDIA 3AGEA 3HLWA 1L0FA 4DXBA 3NDGA 3MFDA 3B3XA 2ZQ8A 5IHVA 1BLCA 3O3VA 4DE1A 3A3DA 4KZ3A 1K25A 1KVLA 4QHCA 2XH9A 1VM1A 3IH8A 4R4SA 5CXWA 4KZ4A 5JYOA 1ESUA 1VQQA 1MBLA 1DJAA 2OLVA 1K6SA 2WGWB 4GZBA 3ZNTA 3G2ZA 1ES3A 3DWZA 4JXWA 4MLLA 3ZNYA 1SDNA 4KZAA 4GD6A 4FH4A 2ZM2A 2EXAA 3PBTA 4XXRA 5G18A 2R9XA 4HESA 3FKWA 4OOLA 3N8RA 3UPNA 4DXCA 1K54C 5EVIA 5FAQA 4N92A 1LLBA 3PBNA 4OP8A 2EX8A 5HAPA 2ZQAA 1BUEA 4GOGA 1QMFA 2Y2KA 3BEBA 2JBFA 3ZG7B 3CMZA 3NDEA 2WYXA 1S0WA 1ES4A 1NRFA 3D4FA 2EFUA 3HLCA 5M1AA 1KE4A 3E2KA 2WAEA 4QD4A 1ES5A 2Y2MA 3C7UA 4K91A 2EX2A 4P0MA 1GHIA 3E2LA 2ZMAA 4MEZA 4MBHA 2WKHA 4OQIA 1CEGA 1ESIA 4OLGA 2X01A 2JCHA 3SH8A 4DKIA 1K56D 4KQRA 1LHYA 1K38A 5DTKA 2XD5A 3IF6C 1FR6A 3DWKA 4S2JA 1IYSA 1W79A 5CHMA 5CTNA 3ZG8B 4D2OA 3BFDA 4S2NC 4X68A 3NI9A 5E2HA 5EVLA 5FQIA 3ZGAB 4YINA 1KVMA 5KMWA 4N1HA 3PBRA 1IYQA 4R23A 1EI5A 1Z6FA 4UA9A 5DF8A 1XA1A 3UDXA 3HUOA 4WEJA 3IXGA 3IXDA 4GKUA 4BJPA 3V3SA 5AQ9A 3I7JA 3SH9A 1MY8A 3FKVA 2J9OA 3Q1FA 4S2IA 3UO9A 5E43A 5FQ9A 3G2YA 1K54A 3HBRA 1BLSA 1WE4A 1W8QA 2OLUA 5EECA 1LI0A 4KG6A 4R3JA 4GB7A 5GLAA 2QPNA 3AGDA 2HDUA 3HLFA 3OPLA 3BFGA 3CZDA 2A3UA 4FH2A 4QB8A 4R1GA 5E2FA 1MWSA 1M40A 3GRJA 4KQOA 5TGFA 2G2UA 1MWRA 2R9WA 1K57C 3C4OA 5CGXA 5EUAA 4BLMA 4B4XA 4S2PA 4WMCA 5GL9A 4C6YA 2C6WB 3V39A 2Y91A 5HARA 1PWGA 4OPZA 1HTZA 2Z2MB 5F1FA 3IF6A 5FI7A 1FCNA 4X53A 5CGSA 1YMXA 3MZFA 4S2NA 3TG9A 3WRTA 1TDLA 4R3BA 4XUZA 3UN7A 2QZ6A 3WS0A 3S4XA 3Q07A 5CEBA 1KGFA 4PMAA 4MBFA 1XKZA 4E3OA 1NZOA 3HL9A 2HDSA 5EVIB 3PAEA 3NY4A 3PAGA 4UAAA 1MPLA 2OV5A 4EV4A 1E3UA 4PM7A 1NYMA 1ZG6A 2PU4A 3LY4A 1N4OA 3FWLA 3UPOA 2Y2OA 4L0LA 1RGYA 1PI5A 5A91A 3OCNA 3ITAA 2Q9MA 1I2SA 1LL5A 4JF5A 4NETA 2ZM8A 4Y0TA 3OPHA 4U3TA 1Q2QA 4UA6A 4E3IA 4EWFA 5FAPA 1JWVA 2Y59A 1HD8A 3IH9A 1NYYA 4FSFA 3NCKA 5GLBA 4DE2A 3W4PA 4E6XA 1GHPA 3ZG0A 5CHJA 5CECA 4IBRA 4PM8A 1JVJA 3UDFA 2JE5A 1K57A 4EBNA 2HP5A 4LV3A 5EOEA 1LI9A 4K0XA 1ALQA 3DTMA 3NBLA 3O86A 4ZJ3A 2ZM0A 2Z2LB 3O87A 3OPRA 3TSGA 2HP6A 4OPQA 5FAOA 4Q8IA 2H5SA 2WKIA 1K6RA 1ZC2A 2XDMA 4S2LA 5AQAA 3WWXA 2IWCA 1ONHA 2DCFA 4RVAA 1GA0A 2X71A 5U47A 3IXHA 1FR1A 5KSHA 5F83A 3W4OA 3IF5A 2FFFB 4S2MA 3EQUA 5DF7A 3EQVA 3MZDA 4JBFA 2WUQA 1I2WA 2Y2IA 2V20A 4U0TA 2Y2QA 3HLBA 3RXXA 5AQ7A 4C3QA 2VGKA 2ZQCA 1IYOA 1O7EA 3C5AA 2ZQ7A 1M6KA 4CPKA 2Y2NA 2PBYA 4LCLA 1ZKJA 3FV7A 1PIOA 1XA7A 2WADA 3MBZA 3WRZA 3G34A 4OOMA 2ZLYA 4QU3A 3ZG9B 4ZJ1A 5E2GA 5FSRA 1J9MA 4BENA 5HAQA 4JF4A 2CC1A 2UWXA 5GHYA 5KSCA 1QMEA 1YLWA 3A3JA 4OVDA 2OSUA 2ZD8A 5FI2A 1ERMA 3UY6A 1G68A 1OMEA 2Y4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5M A;  4RA7 A;  3G4P A;  4X55 A;  1KDW A;  4E3J A;  1DY6 A;  1YM1 A;  2EX9 A;  3SS4 A;  4BD1 A;  3VFH A;  3MKF A;  1L0E A;  3IF6 B;  4KG5 A;  4OPR A;  1FOF A;  3N6I A;  1YLY A;  3LY3 A;  3ISG A;  4P85 A;  3MXS A;  1ERQ A;  1IEM A;  4KZB A;  4E3K A;  1PI4 A;  4PPR A;  4E6W A;  3OZH A;  3M2J A;  4N9K A;  3W4Q A;  1RGZ A;  5JYP A;  3BLM A;  5DVA A;  2H0Y A;  2V1Z A;  4FCF A;  3FZC A;  4JKT A;  4OQ0 A;  2EXB A;  2XD1 A;  3GTC A;  1YLT A;  1BT5 A;  1DJB A;  1O07 A;  3NIA A;  3UPP A;  2Y2P A;  4KZ6 A;  3RXW A;  4OP5 A;  1XPB A;  5EVI D;  3P98 A;  1K55 C;  2FFY A;  3BLS A;  4WEL A;  4ID4 A;  2I72 A;  1IKG A;  1JTD A;  3P09 A;  4X56 A;  3MZE A;  4X6T A;  4HBT A;  5TFQ A;  2GDN A;  5J8X A;  2BG1 A;  1L0D A;  4OOY A;  3LO7 A;  3OC2 A;  5BOH A;  2ZC3 B;  1FCM A;  5FQK A;  5GHX A;  1K4F A;  4DDY A;  4WZ4 A;  3IWI A;  4GDB A;  4P6B A;  2J8Y A;  5CTM A;  3Q7V B;  4JXG A;  4XUX A;  4R0Q A;  5A90 A;  3FYZ A;  5GLC A;  4WYY A;  3S1Y A;  3Q82 A;  2WKE A;  4PM6 A;  4A5R A;  2P9V A;  3BYD A;  2WAF A;  3IWQ A;  5FAT A;  4BL3 A;  1YLP A;  5F1G A;  3PBQ A;  5L2F A;  1JWZ A;  2Y2H A;  4F94 A;  1HZO A;  2XEP A;  3IT9 A;  4IVI A;  4WM9 A;  4R4R A;  1C3B A;  1TEM A;  4Y0O A;  4LV1 A;  2XK1 A;  4RX2 A;  2Q9N A;  3IHA A;  1MWT A;  2G2W A;  2JC7 A;  4NK3 A;  4OKP A;  1NZU A;  3SOI A;  2XFT A;  4HBU A;  3VMA A;  3CJM A;  1K4E A;  3TOI A;  3ZFZ A;  2ZQ9 A;  5E2E A;  1GHM A;  5HFO A;  4KZ5 A;  4DF6 A;  5DTT A;  1H8Y A;  1I5Q A;  1NXY A;  3GR2 A;  4PM9 A;  4B88 A;  4ZDX A;  1K55 A;  3UE3 A;  5KZH A;  3G30 A;  1ES2 A;  3QHY A;  1E25 A;  5GLD A;  5M19 A;  1PYY A;  2IWD A;  5FQM A;  4BL2 A;  2BLS A;  4N9L A;  1H8Z A;  4E3L A;  4OLD A;  2ZC4 B;  3Q7V A;  3SS3 A;  3HRE A;  4ZBE A;  3BEC A;  4PM5 A;  3ZVW A;  3GMW A;  4P87 A;  5FDH A;  3IHB A;  5CHU A;  3UNW A;  4WMC D;  1FCO A;  1JTG A;  1GCE A;  2H0T A;  2B5R A;  4UA7 A;  1NY0 A;  1Y54 A;  3ZDJ A;  3HUM A;  4U0X A;  5CRF A;  3C7V A;  1K56 A;  1KGE A;  3BRM A;  3M2K A;  5DF9 A;  1YLZ A;  4GDN A;  1BUL A;  3M6B A;  4WZ5 A;  4MNR A;  1PW8 A;  2V2F F;  1Q2P A;  3BM6 A;  3N8L A;  2WGI A;  4OQG A;  5D3O A;  1U60 A;  3NC8 A;  2WZZ A;  1XP4 A;  4MBK A;  3IXB A;  3ZVT A;  4QY6 A;  5CGW A;  1PWD A;  2RL3 A;  2EFX A;  2ZQD A;  3PTE A;  5FQQ A;  2VGJ A;  3BFE A;  2EX6 A;  1TVF A;  2WK0 A;  4JXS A;  3N4I A;  4WBG A;  1YT4 A;  3VOZ A;  1BSG A;  1ZG4 A;  1E3U D;  3UE1 A;  2C5W B;  2PU2 A;  2Y2J A;  3HUN A;  4KG2 A;  4CJN A;  1IEL A;  2XF3 A;  5A93 A;  5EOO A;  3UE0 A;  1PW1 A;  1S6R A;  2DRW A;  2WZX A;  4IVK A;  3VP2 A;  3QNB A;  4DE0 A;  4S2K A;  5FAS A;  4K0W A;  5EE8 A;  3PBO A;  4LV0 A;  2J9P A;  1WYB A;  2ZC6 B;  3OPP A;  3Q7Z A;  4H8R A;  1H5X A;  3VP1 A;  1GA9 A;  4B4Z A;  2WGV A;  3V50 A;  3ZG5 A;  1PWC A;  1SHV A;  2P9V B;  1BTL A;  3O88 A;  2ZJ9 A;  1E4D A;  3JYI A;  1KE0 A;  1PZP A;  1TDG A;  3C4P A;  4JPM A;  5HW3 A;  2Y2L A;  4KZ8 A;  4QJG A;  1XGI A;  2IWB A;  5CER A;  1MKI A;  3OCL A;  5FA7 A;  2Y55 A;  3PBS A;  1RP5 A;  3G35 A;  3SS5 A;  4O7D A;  2E8I A;  3MXR A;  1FSW A;  1W8Y A;  4LCM A;  5FQJ A;  3WS5 A;  4DE3 A;  3V3R A;  1CI9 A;  3N7W A;  4DDS A;  3ITB A;  1XX2 A;  1SKF A;  4RX3 A;  4ZTK A;  4JXV A;  3GVB A;  4KEN B;  4QY5 A;  1BLP A;  1YLJ A;  1L2S A;  1RCJ A;  3VSK A;  1HVB A;  1JWP A;  2WGW A;  3HLD A;  3A3E A;  5GHZ A;  4E3N A;  3IWO A;  3MKE A;  1MXO A;  3VFF A;  3WS4 A;  1IYP A;  4DRT A;  1KDS A;  3BFC A;  3G32 A;  5HAI A;  3S22 A;  4E3M A;  1W7F A;  3AGF A;  2XR0 A;  3HLG A;  3WS1 A;  2HPB A;  4OON A;  1AXB A;  2XLN A;  4OH0 A;  4IED A;  4UHU A;  3IQA A;  2XQZ A;  4EBP A;  5HX9 A;  3CG5 A;  4KZ9 A;  2QMI A;  4OQH A;  1KE3 A;  4WEK A;  4Y7P A;  1IKI A;  1DJC A;  3WS2 A;  1XXM A;  4KZ7 A;  3SH7 A;  3BFF A;  1CK3 A;  4RYE A;  2XFS A;  5EPH A;  2X02 A;  4WZ5 C;  4X69 A;  3HVF A;  1EWZ A;  3GV9 A;  4GNU A;  1N9B A;  2HDR A;  4JF6 A;  5M18 A;  1LL9 A;  1KGG A;  5I94 A;  3ZCZ A;  1YMS A;  2ZC7 A;  3QNC A;  4YFM A;  3LCE A;  1BLH A;  4LV2 A;  2XGN A;  3LEZ A;  1PZO A;  1XGJ A;  1BZA A;  5DTS A;  5TR7 A;  4Y0U A;  4Z9Q A;  5HL1 A;  1G6A A;  1SDE A;  4M3K A;  4S2O A;  4EQI A;  5A92 A;  3G31 A;  3HLE A;  2J7V A;  4EUZ A;  1WYC A;  5EVI C;  2Y2G A;  2HP9 A;  1YQS A;  3M6H A;  4IBX A;  4OPY A;  4JLF A;  1MWU A;  3VP0 A;  1CI8 A;  3VOY A;  2P74 A;  1ERO A;  3GQZ A;  4BQM A;  3N8S A;  4LEN A;  3ZHH A;  3DW0 A;  4EBL A;  4KQQ A;  1W5D A;  1NJ4 A;  1ONG A;  2A49 A;  4N1X A;  4HEF A;  3GSG A;  2H10 A;  5FI6 A;  3W8K A;  3A3I A;  1FQG A;  4ZJ2 A;  4C75 A;  3RJU A;  4GD8 A;  3VP4 A;  3A3F A;  5AQB A;  3Q81 A;  2RCX A;  2ZC5 B;  3VSL A;  1L0G A;  3VP3 A;  5CED A;  4GN2 A;  4ZAM A;  5F82 A;  2DNS A;  1FSY A;  2HDQ A;  1SCW A;  1CEF A;  4FD8 A;  4BD0 A;  3UDI A;  3AGE A;  3HLW A;  1L0F A;  4DXB A;  3NDG A;  3MFD A;  3B3X A;  2ZQ8 A;  5IHV A;  1BLC A;  3O3V A;  4DE1 A;  3A3D A;  4KZ3 A;  1K25 A;  1KVL A;  4QHC A;  2XH9 A;  1VM1 A;  3IH8 A;  4R4S A;  5CXW A;  4KZ4 A;  5JYO A;  1ESU A;  1VQQ A;  1MBL A;  1DJA A;  2OLV A;  1K6S A;  2WGW B;  4GZB A;  3ZNT A;  3G2Z A;  1ES3 A;  3DWZ A;  4JXW A;  4MLL A;  3ZNY A;  1SDN A;  4KZA A;  4GD6 A;  4FH4 A;  2ZM2 A;  2EXA A;  3PBT A;  4XXR A;  5G18 A;  2R9X A;  4HES A;  3FKW A;  4OOL A;  3N8R A;  3UPN A;  4DXC A;  1K54 C;  5EVI A;  5FAQ A;  4N92 A;  1LLB A;  3PBN A;  4OP8 A;  2EX8 A;  5HAP A;  2ZQA A;  1BUE A;  4GOG A;  1QMF A;  2Y2K A;  3BEB A;  2JBF A;  3ZG7 B;  3CMZ A;  3NDE A;  2WYX A;  1S0W A;  1ES4 A;  1NRF A;  3D4F A;  2EFU A;  3HLC A;  5M1A A;  1KE4 A;  3E2K A;  2WAE A;  4QD4 A;  1ES5 A;  2Y2M A;  3C7U A;  4K91 A;  2EX2 A;  4P0M A;  1GHI A;  3E2L A;  2ZMA A;  4MEZ A;  4MBH A;  2WKH A;  4OQI A;  1CEG A;  1ESI A;  4OLG A;  2X01 A;  2JCH A;  3SH8 A;  4DKI A;  1K56 D;  4KQR A;  1LHY A;  1K38 A;  5DTK A;  2XD5 A;  3IF6 C;  1FR6 A;  3DWK A;  4S2J A;  1IYS A;  1W79 A;  5CHM A;  5CTN A;  3ZG8 B;  4D2O A;  3BFD A;  4S2N C;  4X68 A;  3NI9 A;  5E2H A;  5EVL A;  5FQI A;  3ZGA B;  4YIN A;  1KVM A;  5KMW A;  4N1H A;  3PBR A;  1IYQ A;  4R23 A;  1EI5 A;  1Z6F A;  4UA9 A;  5DF8 A;  1XA1 A;  3UDX A;  3HUO A;  4WEJ A;  3IXG A;  3IXD A;  4GKU A;  4BJP A;  3V3S A;  5AQ9 A;  3I7J A;  3SH9 A;  1MY8 A;  3FKV A;  2J9O A;  3Q1F A;  4S2I A;  3UO9 A;  5E43 A;  5FQ9 A;  3G2Y A;  1K54 A;  3HBR A;  1BLS A;  1WE4 A;  1W8Q A;  2OLU A;  5EEC A;  1LI0 A;  4KG6 A;  4R3J A;  4GB7 A;  5GLA A;  2QPN A;  3AGD A;  2HDU A;  3HLF A;  3OPL A;  3BFG A;  3CZD A;  2A3U A;  4FH2 A;  4QB8 A;  4R1G A;  5E2F A;  1MWS A;  1M40 A;  3GRJ A;  4KQO A;  5TGF A;  2G2U A;  1MWR A;  2R9W A;  1K57 C;  3C4O A;  5CGX A;  5EUA A;  4BLM A;  4B4X A;  4S2P A;  4WMC A;  5GL9 A;  4C6Y A;  2C6W B;  3V39 A;  2Y91 A;  5HAR A;  1PWG A;  4OPZ A;  1HTZ A;  2Z2M B;  5F1F A;  3IF6 A;  5FI7 A;  1FCN A;  4X53 A;  5CGS A;  1YMX A;  3MZF A;  4S2N A;  3TG9 A;  3WRT A;  1TDL A;  4R3B A;  4XUZ A;  3UN7 A;  2QZ6 A;  3WS0 A;  3S4X A;  3Q07 A;  5CEB A;  1KGF A;  4PMA A;  4MBF A;  1XKZ A;  4E3O A;  1NZO A;  3HL9 A;  2HDS A;  5EVI B;  3PAE A;  3NY4 A;  3PAG A;  4UAA A;  1MPL A;  2OV5 A;  4EV4 A;  1E3U A;  4PM7 A;  1NYM A;  1ZG6 A;  2PU4 A;  3LY4 A;  1N4O A;  3FWL A;  3UPO A;  2Y2O A;  4L0L A;  1RGY A;  1PI5 A;  5A91 A;  3OCN A;  3ITA A;  2Q9M A;  1I2S A;  1LL5 A;  4JF5 A;  4NET A;  2ZM8 A;  4Y0T A;  3OPH A;  4U3T A;  1Q2Q A;  4UA6 A;  4E3I A;  4EWF A;  5FAP A;  1JWV A;  2Y59 A;  1HD8 A;  3IH9 A;  1NYY A;  4FSF A;  3NCK A;  5GLB A;  4DE2 A;  3W4P A;  4E6X A;  1GHP A;  3ZG0 A;  5CHJ A;  5CEC A;  4IBR A;  4PM8 A;  1JVJ A;  3UDF A;  2JE5 A;  1K57 A;  4EBN A;  2HP5 A;  4LV3 A;  5EOE A;  1LI9 A;  4K0X A;  1ALQ A;  3DTM A;  3NBL A;  3O86 A;  4ZJ3 A;  2ZM0 A;  2Z2L B;  3O87 A;  3OPR A;  3TSG A;  2HP6 A;  4OPQ A;  5FAO A;  4Q8I A;  2H5S A;  2WKI A;  1K6R A;  1ZC2 A;  2XDM A;  4S2L A;  5AQA A;  3WWX A;  2IWC A;  1ONH A;  2DCF A;  4RVA A;  1GA0 A;  2X71 A;  5U47 A;  3IXH A;  1FR1 A;  5KSH A;  5F83 A;  3W4O A;  3IF5 A;  2FFF B;  4S2M A;  3EQU A;  5DF7 A;  3EQV A;  3MZD A;  4JBF A;  2WUQ A;  1I2W A;  2Y2I A;  2V20 A;  4U0T A;  2Y2Q A;  3HLB A;  3RXX A;  5AQ7 A;  4C3Q A;  2VGK A;  2ZQC A;  1IYO A;  1O7E A;  3C5A A;  2ZQ7 A;  1M6K A;  4CPK A;  2Y2N A;  2PBY A;  4LCL A;  1ZKJ A;  3FV7 A;  1PIO A;  1XA7 A;  2WAD A;  3MBZ A;  3WRZ A;  3G34 A;  4OOM A;  2ZLY A;  4QU3 A;  3ZG9 B;  4ZJ1 A;  5E2G A;  5FSR A;  1J9M A;  4BEN A;  5HAQ A;  4JF4 A;  2CC1 A;  2UWX A;  5GHY A;  5KSC A;  1QME A;  1YLW A;  3A3J A;  4OVD A;  2OSU A;  2ZD8 A;  5FI2 A;  1ERM A;  3UY6 A;  1G68 A;  1OME A;  2Y4A A; 
#chains in the Genus database with same CATH topology
 4RA7 A;  1OTA A;  1DY6 A;  4BD1 A;  3MKF A;  1L0E A;  4BWI A;  3IF6 B;  1FOF A;  3LY3 A;  3A0V A;  3ISG A;  3UE6 A;  3MXS A;  1ERQ A;  4KZB A;  4E3K A;  4Y3I A;  3OZH A;  3M2J A;  3BLM A;  2H0Y A;  2V1Z A;  3E98 A;  3FZC A;  3GTC A;  1YLT A;  2Y2P A;  1XPB A;  2H28 A;  1K55 C;  2I72 A;  4X56 A;  5TFQ A;  3O5Y A;  1D06 A;  2BG1 A;  2ZBB A;  2VKS A;  3LO7 A;  2W3D A;  1FCM A;  5FQK A;  5GHX A;  1K4F A;  4DDY A;  4WZ4 A;  4P6B A;  3DTI A;  4XUX A;  2K7S A;  3S7P A;  1DP9 A;  1N9O A;  3BQA A;  4KUK A;  4WYY A;  4PM6 A;  4AFI A;  2P9V A;  3BYD A;  4I3J A;  4BL3 A;  5F1G A;  3PBQ A;  1HZO A;  4HP9 A;  4IVI A;  4LV1 A;  2Q9N A;  3IHA A;  4LLO B;  1NZU A;  2GJ3 A;  3LFV A;  4R38 A;  4JGP A;  1I5Q A;  1NXY A;  3TE8 A;  3H9W A;  4ZDX A;  1K55 A;  5KZH A;  2V8C A;  5M19 A;  4G3W A;  2BLS A;  2YKF A;  4OLD A;  3SS3 A;  3HRE A;  4GHI B;  4PM5 A;  5FDH A;  3IHB A;  2KOI A;  1FCO A;  1JTG A;  4ETX A;  2B5R A;  2K2N A;  4UA7 A;  4U0X A;  2WKP A;  3IS2 A;  4MNR A;  3N8L A;  5G4Z A;  5D3O A;  3PHY A;  3NC8 A;  1XP4 A;  2ZL1 B;  1UGU A;  4QY6 A;  2RL3 A;  3PTE A;  5FQQ A;  2VGJ A;  3T4K A;  1BSG A;  1E3U D;  4UQI M;  1PNE A;  1TS7 A;  2DMW A;  3NEC A;  4CJN A;  4LFU A;  5EOO A;  4DE0 A;  4K0W A;  3PBO A;  2D01 A;  1WYB A;  2ZC6 B;  3Q7Z A;  3VP1 A;  3IBJ A;  2V8F A;  4WLA A;  3MF0 A;  1PZP A;  5HW3 A;  5FEG A;  4QJG A;  1XGI A;  1MKI A;  1VHM A;  1VEU A;  3PBS A;  3CUE C;  3G35 A;  2QJ5 A;  2XSS A;  3LI9 A;  1IFQ A;  5FQJ A;  5A8B A;  5DKK A;  3WS5 A;  1T1B A;  3U2A A;  4RX3 A;  4ZTK A;  1BLP A;  1YLJ A;  3VSK A;  3C2W A;  1UWP X;  1S1Y A;  2W27 A;  4E3N A;  2W1R A;  1MXO A;  4NXG A;  4DRT A;  1VET B;  2B95 A;  3HLG A;  3LR5 A;  4IED A;  3IQA A;  3LIA A;  2XQZ A;  3CG5 A;  4KZ9 A;  3HJK A;  4OQH A;  4WEK A;  3WS2 A;  3F1N B;  2Y79 A;  2NUT C;  1SKO B;  2Z6C A;  2VV8 A;  1LL9 A;  2ZC7 A;  3CUE A;  3LCE A;  5I5L A;  3FG8 A;  2XGN A;  1PZO A;  1XGJ A;  5TR7 A;  2L4R A;  4Z9Q A;  1G6A A;  4M3K A;  4S2O A;  4MCW A;  4EUZ A;  2Y2G A;  2HP9 A;  4ZRR A;  3VP0 A;  1OT6 A;  3VOY A;  2P74 A;  4EBL A;  4LEN A;  4KQQ A;  1W5D A;  1ONG A;  2HZ5 A;  4C75 A;  4DJ3 A;  4ZJ2 A;  3RJU A;  3CI6 A;  3A3F A;  3Q81 A;  2RCX A;  4DN0 A;  4EXO A;  4GN2 A;  4ARZ B;  2ZMV A;  1CEF A;  2JN7 A;  2M7U A;  4BD0 A;  3RFB A;  3BY9 A;  2KX6 A;  3O3V A;  1K25 A;  1TS0 A;  2XH9 A;  1VM1 A;  3NJA A;  2OLV A;  1VQQ A;  4GZB A;  1DJA A;  4Y15 A;  4EEP A;  4GLQ A;  4JXW A;  1KOU A;  2EXA A;  3VV4 A;  4WF0 A;  3N8R A;  4M4X A;  1LLB A;  4XT2 A;  2Y2K A;  3CMZ A;  3KX0 X;  1ES4 A;  3D4F A;  3KSI A;  2P08 A;  4MDZ A;  3PYP A;  2WKH A;  3UB6 A;  2W1T B;  4OLG A;  1K56 D;  2EA9 A;  3A0S A;  3KYE A;  3IF6 C;  2PR6 A;  3DWK A;  1IYS A;  3ZG8 B;  3NI9 A;  1KVM A;  3PBR A;  1IYQ A;  1Z6F A;  3ZQ5 A;  2JKG A;  1XA1 A;  3E4O A;  3UDX A;  3HUO A;  4WEJ A;  2VV7 A;  4YWZ A;  3IXD A;  3V3S A;  4S2I A;  5E43 A;  3HBR A;  3IBR A;  1PRQ A;  4KG6 A;  4R3J A;  2QPN A;  4FH2 A;  4QB8 A;  2B02 A;  3GEC A;  5E2F A;  3GRJ A;  4KQO A;  1N9L A;  3C4O A;  5CGX A;  2A24 A;  3T1R A;  3MFX A;  4OPZ A;  3IF6 A;  5FI7 A;  3MZF A;  2R78 A;  3TG9 A;  3WRT A;  1TDL A;  4R3B A;  4Y17 A;  3UN7 A;  3DAV A;  5AVE A;  1XKZ A;  4E3O A;  1NZO A;  4CLC C;  5L09 A;  1N4O A;  2Q9M A;  2GNX A;  4UA6 A;  4E3I A;  2EWV A;  1JWV A;  2Y59 A;  3IH9 A;  1NYY A;  1HLU P;  3BWL A;  1EW0 A;  3UMD A;  5CHJ A;  3C30 A;  4IBR A;  1T18 A;  1JVJ A;  2INW A;  2JE5 A;  4LV3 A;  4ZJ3 A;  4OPQ A;  2XDM A;  3RTY A;  5AQA A;  2VEA A;  1GA0 A;  2X71 A;  4HOI A;  4UEY A;  4BBU A;  5F83 A;  3MZD A;  1I2W A;  1IYO A;  1O7E A;  2O9A A;  1XJ2 A;  5AJG A;  2WAD A;  3BJN A;  3G34 A;  2ZLY A;  3JPU A;  3B47 A;  3ZG9 B;  4CLC E;  1QME A;  2V1A A;  5FI2 A;  3EWK A;  3UY6 A;  1GSV A;  2VK3 A;  1ZHH B;  2V0W A;  3G4P A;  4GHI A;  1KDW A;  4X55 A;  1YM1 A;  2EX9 A;  3SS4 A;  4B93 A;  3VFH A;  4R6L A;  4E04 A;  3T50 A;  4OPR A;  1F98 A;  3TRC A;  1IEM A;  3L7H A;  1G5U A;  4E6W A;  3EEA A;  2Q0O A;  4N9K A;  1RGZ A;  3A0R A;  4FCF A;  3QP1 A;  4JKT A;  3S7O A;  2ZL1 A;  1BT5 A;  4KZ6 A;  2QJ7 A;  4WEL A;  3P09 A;  4JGR A;  2GDN A;  5J8X A;  5DFX A;  1MZU A;  4OOY A;  2OWH A;  3OC2 A;  5BOH A;  2ZC3 B;  3E4Q A;  4Z1W A;  3Q7V B;  3K3C A;  3ICY A;  4R0Q A;  5A90 A;  3FYZ A;  5GLC A;  3S1Y A;  3Q82 A;  5FAT A;  3BQ8 A;  1FIK A;  1W63 Q;  4R4R A;  1TEM A;  4R70 A;  2XK1 A;  4RX2 A;  5L8M A;  3B42 A;  2OAP 1;  4OKP A;  4HBU A;  1K4E A;  3ZFZ A;  4DF6 A;  4PM9 A;  1FIL A;  5FQM A;  3T4J A;  1VET A;  4LRZ E;  4ZBE A;  3ZVW A;  3GMW A;  1H3Q A;  3T4Q A;  2M1C A;  1G6O A;  2Y8H A;  4WMC D;  1GCE A;  1OTE A;  3F1N A;  3HUM A;  1SKO A;  3C7V A;  3CLO A;  3M2K A;  3MXQ A;  4WZ5 A;  4OQG A;  1V9Y A;  3SW1 A;  2EX6 A;  1TVF A;  4YNR A;  4JXS A;  3N4I A;  4WBG A;  3LIF A;  3S7N A;  5IT5 A;  2Z6D A;  2Y2J A;  4KG2 A;  1IEL A;  2XF3 A;  1L3L A;  5A93 A;  3UE0 A;  1PW1 A;  2DRW A;  2WZX A;  3VP2 A;  1MKM A;  3OPP A;  4H8R A;  4B4Z A;  4GW9 A;  3V50 A;  3ZG5 A;  1PWC A;  1SHV A;  2WKQ A;  2ZJ9 A;  2Y2L A;  4KZ8 A;  5DFY A;  2IWB A;  2VGL M;  5FA7 A;  3SS5 A;  5MC7 A;  1FSW A;  1Z09 A;  4LCM A;  2UV0 E;  5AVF A;  4DE3 A;  3V3R A;  3GVB A;  4QY5 A;  5FDS A;  1OPX A;  1HVB A;  1JWP A;  2B18 A;  5GHZ A;  4IJG A;  1GSW A;  3OOV A;  1YKD A;  3S22 A;  1W7F A;  2PR5 A;  3AGF A;  2XR0 A;  3WS1 A;  2HPB A;  1AXB A;  2XLN A;  3P7N A;  4UHU A;  4IUH A;  1K0K A;  5CX7 A;  1DJC A;  4KZ7 A;  3SH7 A;  3BFF A;  4FTX A;  5FL3 A;  5EPH A;  3C8C A;  2ZOI A;  5M18 A;  4IUK A;  2CMN A;  5I94 A;  2MJ6 A;  1YPR A;  4I3A A;  4YFM A;  3R7W B;  1BLH A;  4EQI A;  5A92 A;  3HLE A;  3IX3 A;  2J7V A;  1WYC A;  4IBX A;  3V67 A;  1ERO A;  3GQZ A;  4BQM A;  5L10 A;  3E0Y A;  4N1X A;  3R4K A;  3W8K A;  1FQG A;  3VP4 A;  4L9F A;  3LIE A;  5HL6 A;  2ZC5 B;  3VSL A;  1L0G A;  5CED A;  2DNS A;  4LPZ A;  2HDQ A;  1L0F A;  1PFL A;  5G4Y A;  3B3X A;  5IHV A;  1BLC A;  4DE1 A;  4KZ3 A;  4QHC A;  1KVL A;  3LGO A;  1S4R A;  4KZ4 A;  1MBL A;  1K6S A;  4L9E A;  3ZNY A;  1SDN A;  2R9X A;  4HES A;  3H7W A;  4DXC A;  2FZ0 A;  2PD7 A;  3H82 B;  2EX8 A;  5HAP A;  4GOG A;  1QMF A;  3EEH A;  2JBF A;  2LB9 A;  2EFU A;  3HLC A;  3JVV A;  3E2K A;  4QD4 A;  1ES5 A;  1GHI A;  3E2L A;  2ZMA A;  3MR0 A;  4MEZ A;  4OQI A;  1ESI A;  4KQR A;  1LHY A;  1K38 A;  2XD5 A;  1FR6 A;  4S2J A;  4D2O A;  5CHM A;  3BFD A;  4S2N C;  4X68 A;  5FQI A;  3ZGA B;  2V1B A;  4N1H A;  1EI5 A;  4UA9 A;  5DF8 A;  1OT9 A;  3F1O A;  4JGQ A;  3IXG A;  4GKU A;  1MY8 A;  4ETZ A;  2K31 A;  3Q1F A;  3UO9 A;  4O8G A;  1A0K A;  2OLU A;  3LR4 A;  3E4P A;  5TBM B;  1LI0 A;  5GLA A;  3AGD A;  3HLF A;  4HIA A;  4Y13 A;  2A3U A;  4X25 A;  4R1G A;  5F68 A;  1M40 A;  4NXF A;  1OTD A;  2R9W A;  5EUA A;  4NXB A;  5GL9 A;  2JKR I;  3NOP C;  2Y91 A;  1PWG A;  4UQI S;  1HTZ A;  2Z2M B;  5J3W A;  5F1F A;  1XJ3 A;  4X53 A;  5CGS A;  4S2N A;  3JVU A;  2HF6 A;  3LR3 A;  1NLZ A;  4PMA A;  4MBF A;  3HL9 A;  5J4E A;  3CIT A;  3NY4 A;  1MC0 A;  2OV5 A;  4EV4 A;  1E3U A;  1NLY A;  3KO6 A;  1NYM A;  4HP4 A;  3NHQ A;  3LY4 A;  1XFQ A;  3ITA A;  1I2S A;  2ZM8 A;  2PBD P;  4Y0T A;  3OPH A;  4U3T A;  1Q2Q A;  1P97 A;  2P7J A;  5FAP A;  2ACG A;  3ZG0 A;  3UDF A;  4X1M A;  2HP5 A;  1LI9 A;  1ALQ A;  2ZM0 A;  1LT0 A;  3FPW A;  1K6R A;  1ZC2 A;  3WWX A;  4RVA A;  1FR1 A;  2W3H A;  1NRJ A;  2FFF B;  4S2M A;  2P04 A;  2WUQ A;  2Y2I A;  3RXX A;  3HLB A;  5AQ7 A;  2VGK A;  1OTB A;  2ZQC A;  4BBV A;  2ZQ7 A;  4LCL A;  1ZKJ A;  3FV7 A;  4MN6 A;  1PIO A;  4OOM A;  2LB5 A;  5FSR A;  4JF4 A;  2CC1 A;  5GHY A;  4F3L B;  5KSC A;  5K5B A;  3QP8 A;  4OVD A;  2ZD8 A;  4HH3 A;  3QP6 A;  1ERM A;  4BMW A;  5HPI A;  2Y4A A;  3V5M A;  4E3J A;  2XA7 M;  3N6I A;  1YLY A;  4EU0 A;  4I3I A;  4PPR A;  3W4Q A;  2I9V A;  5DVA A;  3S7Q A;  4OQ0 A;  1S4S A;  5EM1 A;  1DJB A;  3NIA A;  3UPP A;  5IU1 A;  4Q0J A;  5EVI D;  3P98 A;  3EGX C;  2FFY A;  2J3W A;  4CLC D;  1IKG A;  1JTD A;  4X6T A;  4HBT A;  1D7E A;  2AVX A;  4HI4 A;  4PHT A;  4JGO A;  3DTE A;  3IWI A;  2J8Y A;  4JXG A;  4B9O A;  3UB7 A;  5HWW A;  1AWI A;  2WKE A;  3IWQ A;  2WAF A;  5EVE A;  2W0N A;  5L2F A;  1JWZ A;  2Y2H A;  2XEP A;  1C3B A;  4Q0I A;  4Y0O A;  1MWT A;  2G2W A;  3HJI A;  4EQ1 A;  4NK3 A;  3VMA A;  3CJM A;  3TOI A;  1GHM A;  3DTK A;  2G7U A;  1H8Y A;  3QP5 A;  4B88 A;  4WL9 A;  4MMN A;  3G30 A;  3QHY A;  1PYY A;  2IWD A;  4N9L A;  4BBT A;  1H8Z A;  4E3L A;  2OAQ 1;  2ZC4 B;  4P87 A;  2KDK A;  3T12 B;  3UME A;  5CHU A;  5L07 A;  1NY0 A;  2O9B A;  1K56 A;  2VLG A;  1KGE A;  5DF9 A;  1YLZ A;  1BUL A;  3BY8 A;  1U60 A;  4MBK A;  3IXB A;  1BYW A;  5CGW A;  2ZQD A;  3R7W A;  2WK0 A;  3T4S A;  3VOZ A;  3UE1 A;  1F2K A;  5LBR A;  2J3T C;  3MQ0 A;  4IVK A;  3QNB A;  4S2K A;  4LV0 A;  3FC7 A;  2J9P A;  1LSX A;  1GA9 A;  4GJ4 A;  1BTL A;  1E4D A;  1WA9 A;  4HY8 A;  3C4P A;  4KUO A;  2OWJ A;  5CER A;  3EOI A;  2Y55 A;  1RP5 A;  2E8I A;  4O01 A;  2GX5 A;  3UB9 A;  4II7 A;  5HDS A;  4HJ6 A;  1CI9 A;  4DDS A;  3ITB A;  4JXV A;  1L2S A;  2V0U A;  4PKY A;  3HLD A;  3IWO A;  3MKE A;  2EWW A;  2O9C A;  4EEU A;  1KDS A;  3ZYT A;  4E3M A;  3H82 A;  2JKF A;  2PT7 A;  2OOL A;  4P6Z M;  2PYP A;  3K2N A;  4EBP A;  5HX9 A;  2JKT I;  1KE3 A;  1IKI A;  1XXM A;  4KQD A;  1CK3 A;  2XFS A;  4WZ5 C;  3QP4 A;  4X69 A;  3HVF A;  1N9B A;  2ZMF A;  1KGG A;  4GS9 B;  3LEZ A;  3VE3 A;  5DTS A;  1SDE A;  2W3E A;  1F5M A;  1JNU A;  3LYX A;  3LI8 A;  4RQ9 A;  3M6H A;  1YQS A;  4Q0H A;  4OPY A;  4JLF A;  3K3D A;  3N8S A;  3DW0 A;  2VV6 A;  1LSV A;  4HQA A;  3GSG A;  3A3I A;  4ESP A;  5AQB A;  3TW8 A;  4ZAM A;  1T19 A;  1FSY A;  1SCW A;  2XRN A;  4FD8 A;  3UDI A;  3AGE A;  1DP6 A;  3IH8 A;  5CXW A;  5JYO A;  1ESU A;  2VZW A;  3ZNT A;  2WGW B;  3G2Z A;  1ES3 A;  3DWZ A;  4KZA A;  4GD6 A;  2ZM2 A;  1P9W A;  5HD5 A;  3PBT A;  4XXR A;  1D1J A;  2BAS A;  3UPN A;  5FAQ A;  3UB8 A;  4P6Z S;  4N92 A;  3PBN A;  4OP8 A;  1S1Z A;  1BUE A;  3MS6 A;  3ZG7 B;  2WYX A;  1S0W A;  3HCY A;  4X1L A;  1KE4 A;  3C7U A;  4Y5F A;  1H8M A;  4ARZ A;  4EET B;  1CEG A;  3KSG A;  3SH8 A;  4O0P A;  5HPF A;  1UWN X;  2JKR M;  1W79 A;  1N9N A;  5E2H A;  5EVL A;  4YIN A;  5KMW A;  4R23 A;  3F1P B;  3D72 A;  5AQ9 A;  3LEQ A;  2J9O A;  2W3F A;  3G2Y A;  1OJG A;  1WE4 A;  1S66 L;  5FEF A;  2PRF A;  5EEC A;  4I39 A;  4GB7 A;  3L9K A;  2HDU A;  3OPL A;  4DJ2 A;  4EW7 A;  4F3L A;  1MWS A;  2W1T A;  5TGF A;  2BTF P;  1K57 C;  2VA0 A;  4BLM A;  3PR6 A;  4S2P A;  4WMC A;  1ODV A;  5HAR A;  4MN5 A;  1FCN A;  1YMX A;  3Q07 A;  1KGF A;  2QWS A;  4HNB A;  5DKL A;  5EVI B;  1MPL A;  4CLC B;  2ZOH A;  1T1C A;  1ZG6 A;  2PU4 A;  2QYB A;  3FWL A;  2Y2O A;  1RGY A;  1PI5 A;  5KIZ A;  1DRM A;  5A91 A;  3OCN A;  4NEE D;  2VGL S;  1HD8 A;  4FSF A;  1OTI A;  3NCK A;  4PAU A;  4DE2 A;  3MQO A;  3W4P A;  4E6X A;  1GHP A;  1K57 A;  4EBN A;  4WN5 A;  5EOE A;  4K0X A;  3O87 A;  3OPR A;  3SZT A;  2H5S A;  2WKI A;  4I38 A;  4G3K A;  2IWC A;  1ONH A;  2DCF A;  5KSH A;  3W4O A;  3EQU A;  5DF7 A;  3EQV A;  3P01 A;  4HHD A;  5F69 A;  1M6K A;  1Y28 A;  2PD8 A;  1GSX A;  1XA7 A;  3WRZ A;  3MBZ A;  4BEN A;  3CHW P;  3A3J A;  1P9R A;  3U4L P;  1VB6 A;  1OME A;  3LID A;  4KG5 A;  2VX8 A;  1TF1 A;  4FUW A;  4EES A;  3KYZ A;  1ACF A;  4P85 A;  1T1A A;  1PI4 A;  3D9Y A;  5JYP A;  2EXB A;  2XD1 A;  3GDI A;  1O07 A;  3RXW A;  4OP5 A;  2GZA A;  2O99 A;  3NUL A;  3BLS A;  4ID4 A;  3MZE A;  5HD3 A;  1SZV A;  1L0D A;  3G6O A;  2KLI A;  5TJJ A;  4WUJ A;  4GDB A;  5CTM A;  4QPR A;  4GCZ A;  4A5R A;  1DP8 A;  3KSF A;  1YLP A;  2V9A A;  3T4T A;  2XRO A;  4F94 A;  3IT9 A;  5HWV A;  4WM9 A;  3CAX A;  4Y2F A;  1TS8 A;  3CPT B;  2JC7 A;  3SOI A;  2XFT A;  2ZQ9 A;  5E2E A;  5HFO A;  4KZ5 A;  5DTT A;  3GR2 A;  3UE3 A;  3B33 A;  1ES2 A;  4H6J B;  3OLO A;  2O0Y A;  1E25 A;  5GLD A;  4BL2 A;  3Q7V A;  4L9G A;  3BEC A;  1CQA A;  3MSH A;  3UNW A;  2H0T A;  1Y54 A;  3ZDJ A;  5CRF A;  3BRM A;  4GDN A;  3M6B A;  1PW8 A;  2V2F F;  1Q2P A;  3BM6 A;  2WGI A;  1S67 L;  3LR0 A;  2WZZ A;  4ME4 A;  3ZVT A;  2VJW A;  3VE4 A;  4K08 A;  1PWD A;  2EFX A;  2PDR A;  3BFE A;  4GS9 A;  5EV0 A;  1YT4 A;  1ZG4 A;  4HH2 A;  2C5W B;  2PU2 A;  2QHK A;  3HUN A;  4DMZ A;  1XFN A;  2JHE A;  2D02 A;  2E8J A;  1S6R A;  5FAS A;  5EE8 A;  1H5X A;  4LGW A;  2WGV A;  5IS1 A;  2P9V B;  3O88 A;  3JYI A;  4EUV A;  2JKT M;  1KE0 A;  1TDG A;  4JPM A;  2PAV P;  3OCL A;  1ZTU A;  3MMH A;  4O7D A;  1X0O A;  3MXR A;  1W8Y A;  2L0W A;  3N7W A;  1XX2 A;  1SKF A;  3KSH A;  4KEN B;  1RCJ A;  2WGW A;  3A3E A;  2PYR A;  4EER A;  3VFF A;  5F5Y A;  3WS4 A;  1IYP A;  3G32 A;  3BFC A;  5HAI A;  1XJ4 A;  4OON A;  4OH0 A;  4CQH A;  2QMI A;  4Y7P A;  5HDD A;  1YAX A;  4RYE A;  2X02 A;  4FOF A;  1EWZ A;  3GV9 A;  4GNU A;  2HDR A;  4JF6 A;  3IS2 B;  3ZCZ A;  1YMS A;  2J80 A;  3QNC A;  3NOT C;  4LV2 A;  1BZA A;  4Y0U A;  5HL1 A;  1Y4O A;  3KYQ A;  3G31 A;  3OBF A;  3F1P A;  5EVI C;  5F6A A;  3H7W B;  1MWU A;  1CI8 A;  2XA7 S;  5HDC A;  3ZHH A;  1NJ4 A;  2A49 A;  2HGV A;  4HEF A;  2H10 A;  1STZ A;  5FI6 A;  2J3T D;  4GD8 A;  4IHQ A;  3LIC A;  3VP3 A;  1LL8 A;  5F82 A;  5HZH A;  3FPV A;  1VEU B;  3HLW A;  5EFW A;  3T1Q B;  3EGD C;  4DXB A;  3NDG A;  3MFD A;  4NG2 A;  2ZQ8 A;  1YSQ A;  3A3D A;  4LRX C;  4R4S A;  3T1S A;  4MLL A;  3IX8 A;  4FH4 A;  3F1O B;  5G18 A;  4OOL A;  3FKW A;  1OJ5 A;  3W2Z A;  3D3O A;  1K54 C;  4R3A A;  5EVI A;  2NUP C;  5HSQ A;  4CLC A;  2ZQA A;  3BEB A;  1W63 M;  3NDE A;  1NRF A;  1XJ6 A;  4LRY C;  4NKP A;  4YOF A;  5M1A A;  2WAE A;  2Y2M A;  4K91 A;  2EX2 A;  2QKP A;  4P0M A;  1TS6 A;  5HWT A;  4MBH A;  3C38 A;  2X01 A;  2JCH A;  4DKI A;  5DTK A;  3IX4 A;  5CTN A;  3RH8 B;  2A2L A;  1H0M A;  1LSW A;  4BJP A;  2HV1 A;  3I7J A;  3SH9 A;  3FKV A;  2M7V A;  5FQ9 A;  1K54 A;  1BLS A;  2HJE A;  3BW6 A;  1W8Q A;  3ULF A;  3T4O A;  3BFG A;  3CZD A;  3LIB A;  4G3V A;  3T1X A;  3PXP A;  1J3W A;  4D60 A;  2G2U A;  1MWR A;  4PKY G;  5EM0 A;  4B4X A;  1F9I A;  4C6Y A;  1NWZ A;  2C6W B;  4I5S A;  3V39 A;  4NXE A;  3NOU C;  4XUZ A;  1CJF A;  2YKH A;  2QZ6 A;  3WS0 A;  3S4X A;  5CEB A;  3UB5 P;  5DJT A;  2HDS A;  2HJ9 C;  3PAE A;  2PHY A;  3PAG A;  4UAA A;  4XT2 B;  1G28 A;  1YSP A;  4PM7 A;  5J7E A;  1V9Z A;  3QP2 A;  3UPO A;  4L0L A;  5TBM A;  1LL5 A;  4NET A;  4JF5 A;  4EWF A;  5GLB A;  2FH5 A;  3DBA A;  4MN7 A;  3MQQ A;  5CEC A;  4PM8 A;  2W3G A;  3DTM A;  3O86 A;  3NBL A;  2Z2L B;  3TSG A;  2HP6 A;  2IA2 A;  5FAO A;  4Q8I A;  2WKR A;  3T4L A;  4S2L A;  1TD5 A;  3LUQ A;  5U47 A;  3IXH A;  3IF5 A;  4JBF A;  2V20 A;  4U0T A;  3CPT A;  2Y2Q A;  4HJ4 A;  4QWO A;  4C3Q A;  3C5A A;  5C5K A;  1P0Z A;  3MJQ A;  4HJ3 A;  4CPK A;  2Y2N A;  3CWF A;  2PBY A;  5DJU A;  4QU3 A;  4ZJ1 A;  1IOU A;  1CF0 A;  2L1M A;  4H6J A;  5E2G A;  1J9M A;  5HAQ A;  3VOL A;  2UWX A;  1YLW A;  3TJZ C;  2OSU A;  1G68 A;  2A24 B; 
#chains in the Genus database with same CATH homology
 3V5M A;  4RA7 A;  3G4P A;  4X55 A;  1KDW A;  4E3J A;  1DY6 A;  1YM1 A;  2EX9 A;  3SS4 A;  4BD1 A;  3VFH A;  3MKF A;  1L0E A;  3IF6 B;  4KG5 A;  4OPR A;  1FOF A;  3N6I A;  1YLY A;  3LY3 A;  3ISG A;  4P85 A;  3MXS A;  1ERQ A;  1IEM A;  4KZB A;  4E3K A;  1PI4 A;  4PPR A;  4E6W A;  3OZH A;  3M2J A;  4N9K A;  3W4Q A;  1RGZ A;  5JYP A;  3BLM A;  5DVA A;  2H0Y A;  2V1Z A;  4FCF A;  3FZC A;  4JKT A;  4OQ0 A;  2EXB A;  2XD1 A;  3GTC A;  1YLT A;  1BT5 A;  1DJB A;  1O07 A;  3NIA A;  3UPP A;  2Y2P A;  4KZ6 A;  3RXW A;  4OP5 A;  1XPB A;  5EVI D;  3P98 A;  1K55 C;  2FFY A;  3BLS A;  4WEL A;  4ID4 A;  2I72 A;  1IKG A;  1JTD A;  3P09 A;  4X56 A;  3MZE A;  4X6T A;  4HBT A;  5TFQ A;  2GDN A;  5J8X A;  2BG1 A;  1L0D A;  4OOY A;  3LO7 A;  3OC2 A;  5BOH A;  2ZC3 B;  1FCM A;  5FQK A;  5GHX A;  1K4F A;  4DDY A;  4WZ4 A;  3IWI A;  4GDB A;  4P6B A;  2J8Y A;  5CTM A;  3Q7V B;  4JXG A;  4XUX A;  4R0Q A;  5A90 A;  3FYZ A;  5GLC A;  4WYY A;  3S1Y A;  3Q82 A;  2WKE A;  4PM6 A;  4A5R A;  2P9V A;  3BYD A;  2WAF A;  3IWQ A;  5FAT A;  4BL3 A;  1YLP A;  5F1G A;  3PBQ A;  5L2F A;  1JWZ A;  2Y2H A;  4F94 A;  1HZO A;  2XEP A;  3IT9 A;  4IVI A;  4WM9 A;  4R4R A;  1C3B A;  1TEM A;  4Y0O A;  4LV1 A;  2XK1 A;  4RX2 A;  2Q9N A;  3IHA A;  1MWT A;  2G2W A;  2JC7 A;  4NK3 A;  4OKP A;  1NZU A;  3SOI A;  2XFT A;  4HBU A;  3VMA A;  3CJM A;  1K4E A;  3TOI A;  3ZFZ A;  2ZQ9 A;  5E2E A;  1GHM A;  5HFO A;  4KZ5 A;  4DF6 A;  5DTT A;  1H8Y A;  1I5Q A;  1NXY A;  3GR2 A;  4PM9 A;  4B88 A;  4ZDX A;  1K55 A;  3UE3 A;  5KZH A;  3G30 A;  1ES2 A;  3QHY A;  1E25 A;  5GLD A;  5M19 A;  1PYY A;  2IWD A;  5FQM A;  4BL2 A;  2BLS A;  4N9L A;  1H8Z A;  4E3L A;  4OLD A;  2ZC4 B;  3Q7V A;  3SS3 A;  3HRE A;  4ZBE A;  3BEC A;  4PM5 A;  3ZVW A;  3GMW A;  4P87 A;  5FDH A;  3IHB A;  5CHU A;  3UNW A;  4WMC D;  1FCO A;  1JTG A;  1GCE A;  2H0T A;  2B5R A;  4UA7 A;  1NY0 A;  1Y54 A;  3ZDJ A;  3HUM A;  4U0X A;  5CRF A;  3C7V A;  1K56 A;  1KGE A;  3BRM A;  3M2K A;  5DF9 A;  1YLZ A;  4GDN A;  1BUL A;  3M6B A;  4WZ5 A;  4MNR A;  1PW8 A;  2V2F F;  1Q2P A;  3BM6 A;  3N8L A;  2WGI A;  4OQG A;  5D3O A;  1U60 A;  3NC8 A;  2WZZ A;  1XP4 A;  4MBK A;  3IXB A;  3ZVT A;  4QY6 A;  5CGW A;  1PWD A;  2RL3 A;  2EFX A;  2ZQD A;  3PTE A;  5FQQ A;  2VGJ A;  3BFE A;  2EX6 A;  1TVF A;  2WK0 A;  4JXS A;  3N4I A;  4WBG A;  1YT4 A;  3VOZ A;  1BSG A;  1ZG4 A;  1E3U D;  3UE1 A;  2C5W B;  2PU2 A;  2Y2J A;  3HUN A;  4KG2 A;  4CJN A;  1IEL A;  2XF3 A;  5A93 A;  5EOO A;  3UE0 A;  1PW1 A;  1S6R A;  2DRW A;  2WZX A;  4IVK A;  3VP2 A;  3QNB A;  4DE0 A;  4S2K A;  5FAS A;  4K0W A;  5EE8 A;  3PBO A;  4LV0 A;  2J9P A;  1WYB A;  2ZC6 B;  3OPP A;  3Q7Z A;  4H8R A;  1H5X A;  3VP1 A;  1GA9 A;  4B4Z A;  2WGV A;  3V50 A;  3ZG5 A;  1PWC A;  1SHV A;  2P9V B;  1BTL A;  3O88 A;  2ZJ9 A;  1E4D A;  3JYI A;  1KE0 A;  1PZP A;  1TDG A;  3C4P A;  4JPM A;  5HW3 A;  2Y2L A;  4KZ8 A;  4QJG A;  1XGI A;  2IWB A;  5CER A;  1MKI A;  3OCL A;  5FA7 A;  2Y55 A;  3PBS A;  1RP5 A;  3G35 A;  3SS5 A;  4O7D A;  2E8I A;  3MXR A;  1FSW A;  1W8Y A;  4LCM A;  5FQJ A;  3WS5 A;  4DE3 A;  3V3R A;  1CI9 A;  3N7W A;  4DDS A;  3ITB A;  1XX2 A;  1SKF A;  4RX3 A;  4ZTK A;  4JXV A;  3GVB A;  4KEN B;  4QY5 A;  1BLP A;  1YLJ A;  1L2S A;  1RCJ A;  3VSK A;  1HVB A;  1JWP A;  2WGW A;  3HLD A;  3A3E A;  5GHZ A;  4E3N A;  3IWO A;  3MKE A;  1MXO A;  3VFF A;  3WS4 A;  1IYP A;  4DRT A;  1KDS A;  3BFC A;  3G32 A;  5HAI A;  3S22 A;  4E3M A;  1W7F A;  3AGF A;  2XR0 A;  3HLG A;  3WS1 A;  2HPB A;  4OON A;  1AXB A;  2XLN A;  4OH0 A;  4IED A;  4UHU A;  3IQA A;  2XQZ A;  4EBP A;  5HX9 A;  3CG5 A;  4KZ9 A;  2QMI A;  4OQH A;  1KE3 A;  4WEK A;  4Y7P A;  1IKI A;  1DJC A;  3WS2 A;  1XXM A;  4KZ7 A;  3SH7 A;  3BFF A;  1CK3 A;  4RYE A;  2XFS A;  5EPH A;  2X02 A;  4WZ5 C;  4X69 A;  3HVF A;  1EWZ A;  3GV9 A;  4GNU A;  1N9B A;  2HDR A;  4JF6 A;  5M18 A;  1LL9 A;  1KGG A;  5I94 A;  3ZCZ A;  1YMS A;  2ZC7 A;  3QNC A;  4YFM A;  3LCE A;  1BLH A;  4LV2 A;  2XGN A;  3LEZ A;  1PZO A;  1XGJ A;  1BZA A;  5DTS A;  5TR7 A;  4Y0U A;  4Z9Q A;  5HL1 A;  1G6A A;  1SDE A;  4M3K A;  4S2O A;  4EQI A;  5A92 A;  3G31 A;  3HLE A;  2J7V A;  4EUZ A;  1WYC A;  5EVI C;  2Y2G A;  2HP9 A;  1YQS A;  3M6H A;  4IBX A;  4OPY A;  4JLF A;  1MWU A;  3VP0 A;  1CI8 A;  3VOY A;  2P74 A;  1ERO A;  3GQZ A;  4BQM A;  3N8S A;  4LEN A;  3ZHH A;  3DW0 A;  4EBL A;  4KQQ A;  1W5D A;  1NJ4 A;  1ONG A;  2A49 A;  4N1X A;  4HEF A;  3GSG A;  2H10 A;  5FI6 A;  3W8K A;  3A3I A;  1FQG A;  4ZJ2 A;  4C75 A;  3RJU A;  4GD8 A;  3VP4 A;  3A3F A;  5AQB A;  3Q81 A;  2RCX A;  2ZC5 B;  3VSL A;  1L0G A;  3VP3 A;  5CED A;  4GN2 A;  4ZAM A;  5F82 A;  2DNS A;  1FSY A;  2HDQ A;  1SCW A;  1CEF A;  4FD8 A;  4BD0 A;  3UDI A;  3AGE A;  3HLW A;  1L0F A;  4DXB A;  3NDG A;  3MFD A;  3B3X A;  2ZQ8 A;  5IHV A;  1BLC A;  3O3V A;  4DE1 A;  3A3D A;  4KZ3 A;  1K25 A;  1KVL A;  4QHC A;  2XH9 A;  1VM1 A;  3IH8 A;  4R4S A;  5CXW A;  4KZ4 A;  5JYO A;  1ESU A;  1VQQ A;  1MBL A;  1DJA A;  2OLV A;  1K6S A;  2WGW B;  4GZB A;  3ZNT A;  3G2Z A;  1ES3 A;  3DWZ A;  4JXW A;  4MLL A;  3ZNY A;  1SDN A;  4KZA A;  4GD6 A;  4FH4 A;  2ZM2 A;  2EXA A;  3PBT A;  4XXR A;  5G18 A;  2R9X A;  4HES A;  3FKW A;  4OOL A;  3N8R A;  3UPN A;  4DXC A;  1K54 C;  5EVI A;  5FAQ A;  4N92 A;  1LLB A;  3PBN A;  4OP8 A;  2EX8 A;  5HAP A;  2ZQA A;  1BUE A;  4GOG A;  1QMF A;  2Y2K A;  3BEB A;  2JBF A;  3ZG7 B;  3CMZ A;  3NDE A;  2WYX A;  1S0W A;  1ES4 A;  1NRF A;  3D4F A;  2EFU A;  3HLC A;  5M1A A;  1KE4 A;  3E2K A;  2WAE A;  4QD4 A;  1ES5 A;  2Y2M A;  3C7U A;  4K91 A;  2EX2 A;  4P0M A;  1GHI A;  3E2L A;  2ZMA A;  4MEZ A;  4MBH A;  2WKH A;  4OQI A;  1CEG A;  1ESI A;  4OLG A;  2X01 A;  2JCH A;  3SH8 A;  4DKI A;  1K56 D;  4KQR A;  1LHY A;  1K38 A;  5DTK A;  2XD5 A;  3IF6 C;  1FR6 A;  3DWK A;  4S2J A;  1IYS A;  1W79 A;  5CHM A;  5CTN A;  3ZG8 B;  4D2O A;  3BFD A;  4S2N C;  4X68 A;  3NI9 A;  5E2H A;  5EVL A;  5FQI A;  3ZGA B;  4YIN A;  1KVM A;  5KMW A;  4N1H A;  3PBR A;  1IYQ A;  4R23 A;  1EI5 A;  1Z6F A;  4UA9 A;  5DF8 A;  1XA1 A;  3UDX A;  3HUO A;  4WEJ A;  3IXG A;  3IXD A;  4GKU A;  4BJP A;  3V3S A;  5AQ9 A;  3I7J A;  3SH9 A;  1MY8 A;  3FKV A;  2J9O A;  3Q1F A;  4S2I A;  3UO9 A;  5E43 A;  5FQ9 A;  3G2Y A;  1K54 A;  3HBR A;  1BLS A;  1WE4 A;  1W8Q A;  2OLU A;  5EEC A;  1LI0 A;  4KG6 A;  4R3J A;  4GB7 A;  5GLA A;  2QPN A;  3AGD A;  2HDU A;  3HLF A;  3OPL A;  3BFG A;  3CZD A;  2A3U A;  4FH2 A;  4QB8 A;  4R1G A;  5E2F A;  1MWS A;  1M40 A;  3GRJ A;  4KQO A;  5TGF A;  2G2U A;  1MWR A;  2R9W A;  1K57 C;  3C4O A;  5CGX A;  5EUA A;  4BLM A;  4B4X A;  4S2P A;  4WMC A;  5GL9 A;  4C6Y A;  2C6W B;  3V39 A;  2Y91 A;  5HAR A;  1PWG A;  4OPZ A;  1HTZ A;  2Z2M B;  5F1F A;  3IF6 A;  5FI7 A;  1FCN A;  4X53 A;  5CGS A;  1YMX A;  3MZF A;  4S2N A;  3TG9 A;  3WRT A;  1TDL A;  4R3B A;  4XUZ A;  3UN7 A;  2QZ6 A;  3WS0 A;  3S4X A;  3Q07 A;  5CEB A;  1KGF A;  4PMA A;  4MBF A;  1XKZ A;  4E3O A;  1NZO A;  3HL9 A;  2HDS A;  5EVI B;  3PAE A;  3NY4 A;  3PAG A;  4UAA A;  1MPL A;  2OV5 A;  4EV4 A;  1E3U A;  4PM7 A;  1NYM A;  1ZG6 A;  2PU4 A;  3LY4 A;  1N4O A;  3FWL A;  3UPO A;  2Y2O A;  4L0L A;  1RGY A;  1PI5 A;  5A91 A;  3OCN A;  3ITA A;  2Q9M A;  1I2S A;  1LL5 A;  4JF5 A;  4NET A;  2ZM8 A;  4Y0T A;  3OPH A;  4U3T A;  1Q2Q A;  4UA6 A;  4E3I A;  4EWF A;  5FAP A;  1JWV A;  2Y59 A;  1HD8 A;  3IH9 A;  1NYY A;  4FSF A;  3NCK A;  5GLB A;  4DE2 A;  3W4P A;  4E6X A;  1GHP A;  3ZG0 A;  5CHJ A;  5CEC A;  4IBR A;  4PM8 A;  1JVJ A;  3UDF A;  2JE5 A;  1K57 A;  4EBN A;  2HP5 A;  4LV3 A;  5EOE A;  1LI9 A;  4K0X A;  1ALQ A;  3DTM A;  3NBL A;  3O86 A;  4ZJ3 A;  2ZM0 A;  2Z2L B;  3O87 A;  3OPR A;  3TSG A;  2HP6 A;  4OPQ A;  5FAO A;  4Q8I A;  2H5S A;  2WKI A;  1K6R A;  1ZC2 A;  2XDM A;  4S2L A;  5AQA A;  3WWX A;  2IWC A;  1ONH A;  2DCF A;  4RVA A;  1GA0 A;  2X71 A;  5U47 A;  3IXH A;  1FR1 A;  5KSH A;  5F83 A;  3W4O A;  3IF5 A;  2FFF B;  4S2M A;  3EQU A;  5DF7 A;  3EQV A;  3MZD A;  4JBF A;  2WUQ A;  1I2W A;  2Y2I A;  2V20 A;  4U0T A;  2Y2Q A;  3HLB A;  3RXX A;  5AQ7 A;  4C3Q A;  2VGK A;  2ZQC A;  1IYO A;  1O7E A;  3C5A A;  2ZQ7 A;  1M6K A;  4CPK A;  2Y2N A;  2PBY A;  4LCL A;  1ZKJ A;  3FV7 A;  1PIO A;  1XA7 A;  2WAD A;  3MBZ A;  3WRZ A;  3G34 A;  4OOM A;  2ZLY A;  4QU3 A;  3ZG9 B;  4ZJ1 A;  5E2G A;  5FSR A;  1J9M A;  4BEN A;  5HAQ A;  4JF4 A;  2CC1 A;  2UWX A;  5GHY A;  5KSC A;  1QME A;  1YLW A;  3A3J A;  4OVD A;  2OSU A;  2ZD8 A;  5FI2 A;  1ERM A;  3UY6 A;  1G68 A;  1OME A;  2Y4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...