4Y0UA

Crystal structure of 6alpha-hydroxymethylpenicillanate complexed with oxa-58, a carbapenem hydrolyzing class d betalactamase from acinetobacter baumanii.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Active-Site Plasticity Is Essential to Carbapenem Hydrolysis by OXA-58 Class D beta-Lactamase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 73
structure length 242
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4y0uA00
3D4FA 5E2HA 2G2UA 4KZAA 4HBUA 1H8ZA 3A3FA 1U60A 2Y55A 4MNRA 4DKIA 2Z2MB 3CG5A 5KMWA 2Y91A 1L2SA 4OPQA 2ZC5B 5FASA 1PZOA 1ZC2A 2WAEA 3IHAA 4LV3A 3ZVTA 2ZM2A 4EBNA 1W8YA 4GDNA 2EX9A 3LCEA 4OQHA 3C7VA 3HVFA 4RVAA 1W7FA 2QZ6A 2Y2LA 5F82A 1ESUA 1K6RA 4E3IA 1M6KA 2ZC6B 3SH8A 3ZG9B 4LV2A 3PBNA 5HAQA 5D3OA 5EUAA 3UY6A 5FDHA 4U3TA 1ZG6A 4N92A 1K57A 4QB8A 2Y59A 5CGXA 3VFHA 1K25A 1XA7A 4D2OA 1KVMA 4KZ7A 4Q8IA 1ES2A 1FR1A 4O7DA 1KDSA 4N9LA 1PWDA 2WGWA 3LO7A 4GN2A 1NYYA 2X71A 5CTNA 5GLAA 3W4PA 3BFDA 4K91A 1I2WA 3NDGA 4IBXA 3ZG0A 3O88A 4DE1A 2J8YA 2QPNA 2VGJA 4X56A 2XEPA 3OPRA 4ZDXA 4RYEA 1JTGA 2Y2PA 3Q07A 4IEDA 4U0TA 3ZDJA 2Y2IA 1NY0A 4PMAA 2FFYA 2Y2MA 1YMXA 3A3JA 4DXBA 3ZNYA 3IF5A 5TR7A 2R9XA 1EROA 3ZVWA 1E25A 3N8LA 4OKPA 4PM7A 1XGIA 4P87A 3LEZA 3Q7VA 4R0QA 3VMAA 5HW3A 1GCEA 4F94A 3Q82A 3RXWA 2P9VA 4HESA 3BM6A 4BD0A 4R1GA 4RA7A 1JVJA 1CI9A 2EX6A 3OCNA 1N4OA 2WGVA 3G30A 4FD8A 4LV1A 4S2KA 4E3LA 4KZBA 3ZGAB 3HBRA 5GL9A 1H8YA 2PBYA 3AGFA 4OOLA 5EOEA 4KZ6A 3G2ZA 3WRZA 2Q9MA 3WS4A 4S2LA 3ZHHA 4ZJ3A 3FYZA 1IELA 1SDNA 5AQBA 1K54C 1IYSA 3M6BA 3G34A 3ZG5A 3OPHA 1XPBA 1YLWA 1YQSA 3IT9A 1OMEA 4UA9A 2ZLYA 3NIAA 3OPPA 3GMWA 1K55A 4H8RA 4WZ5C 2ZQ7A 4PM5A 5CXWA 3UPOA 3ITBA 4MBKA 4DE2A 5EOOA 3UPNA 1HVBA 3NBLA 3S22A 1W5DA 4Y0UA 1HTZA 3IXHA 4E3JA 4MBHA 1ZG4A 1ESIA 4KZ5A 2J9PA 1HD8A 2V1ZA 4E3KA 1BUEA 1ES4A 3NC8A 4PM8A 3UNWA 1G68A 3Q1FA 3S1YA 1KDWA 4GDBA 4MBFA 4N9KA 4QHCA 5KZHA 5M18A 5E2EA 5E2FA 3FV7A 1FCOA 3G32A 4MLLA 2Y2KA 4EBPA 1KGEA 1VQQA 1MWRA 4R3JA 3O3VA 3VSKA 4XUXA 1O07A 1ES5A 1RGYA 3LY4A 1PI5A 4XUZA 3UDXA 1BLPA 5CERA 3M6HA 2Y2OA 2ZQCA 4JKTA 4OQIA 4DDSA 1IKGA 2R9WA 3HLCA 3GQZA 1MWSA 5FI2A 5DF9A 4KQQA 4DRTA 4YFMA 2P74A 2XD1A 3SS3A 1MPLA 3IWQA 3CMZA 5GLCA 4Y0TA 4BENA 1NRFA 4LV0A 1ONHA 3WS2A 4B88A 1FSWA 3OPLA 4DDYA 1Z6FA 2XGNA 2HP6A 3TG9A 1CI8A 1TEMA 2I72A 4QD4A 5CEDA 4WMCD 1QMEA 2VGKA 4PPRA 2PU2A 2Y4AA 2H0YA 1TVFA 3ISGA 3EQUA 4DXCA 5CHJA 3SOIA 3MZEA 3HLEA 2ZM0A 4N1HA 4P0MA 3S4XA 3WS0A 1XKZA 1XGJA 3BEBA 3SH9A 5DF8A 2UWXA 3MBZA 5I94A 2CC1A 1K38A 1M40A 4MEZA 2OLVA 3A3DA 3IXBA 1PW1A 3G4PA 4DE3A 2E8IA 2ZD8A 4L0LA 4QY5A 4WM9A 1I2SA 2ZC3B 3UN7A 4GKUA 2XFTA 1Q2PA 3A3IA 1K56A 4KG5A 5TFQA 1DJBA 4K0WA 1MWTA 3UDIA 1FCMA 2HDUA 4EWFA 4RX3A 2PU4A 2WZZA 3IF6C 3N8RA 3B3XA 4JXWA 2RCXA 2JCHA 4JF6A 4BQMA 2JC7A 1XX2A 2WK0A 3OZHA 2Y2HA 5HARA 1PWCA 3AGDA 2ZQ9A 3N7WA 4P85A 4KZ4A 1YLTA 5FQ9A 1L0EA 3PTEA 4KZ9A 1ES3A 1JTDA 4Y7PA 3RJUA 3OC2A 3NI9A 3V39A 3HLGA 1K4FA 3MZFA 2ZQ8A 3G31A 3NY4A 5CHMA 5DF7A 2QMIA 5HX9A 1MKIA 1SDEA 5EVID 4EQIA 3UPPA 1H5XA 3A3EA 4OPYA 5DTSA 5F1GA 5FI7A 3FKWA 1ONGA 2XLNA 4OQ0A 1K54A 1GHPA 2IWBA 5FQMA 3HUNA 3N8SA 4R3BA 3QNBA 1MY8A 3DTMA 4GD6A 2JE5A 5A92A 1SCWA 2ZQAA 4WZ5A 4JPMA 5JYOA 4WZ4A 4QU3A 5AQ7A 4Y0OA 2Y2GA 4PM6A 2Y2JA 2EX2A 2GDNA 3JYIA 2WKIA 1KE3A 3Q81A 5GHZA 3MFDA 3P09A 2ZC7A 4OLGA 4A5RA 2V2FF 4GB7A 1GHIA 3G2YA 3AGEA 4WBGA 1PZPA 5FQIA 2X02A 4GD8A 4KZ8A 2C6WB 2J9OA 3V3RA 1BTLA 3GR2A 5CEBA 1VM1A 1BT5A 1KGGA 3TOIA 2EXBA 2XH9A 3IXGA 3MXRA 5M1AA 4IVIA 4OOMA 1JWZA 5FAQA 4KZ3A 3IF6B 1XP4A 3IQAA 3PBOA 4C75A 1FQGA 4OH0A 1I5QA 1DJAA 1JWPA 1S0WA 4K0XA 3GTCA 4X53A 1YMSA 5FI6A 3FKVA 4BJPA 2WKEA 2V20A 1G6AA 3HUOA 1S6RA 1NXYA 4E6XA 4WYYA 4BL2A 5A91A 4OP8A 1NJ4A 5AQAA 1Y54A 1CEGA 3VP0A 3BECA 4GNUA 5GHXA 1FCNA 3V50A 2HDSA 4FH4A 5DTTA 3WS5A 1GHMA 1ZKJA 3VP4A 3HUMA 2JBFA 3N4IA 3BFCA 3BFEA 4S2NC 1J9MA 4ZJ1A 1ALQA 1RP5A 1LL9A 4OVDA 3BFFA 4LCLA 1AXBA 1LI0A 1WYBA 2IWCA 5E43A 1YLYA 4OP5A 3ZNTA 3DWKA 1TDGA 4KG2A 3OCLA 1L0GA 3HLDA 1BLHA 2XD5A 5IHVA 5G18A 1GA0A 4S2JA 5GLDA 1NZOA 4YINA 2WGWB 4BLMA 2EX8A 4S2PA 4ZBEA 4CJNA 1ERMA 5EPHA 1L0FA 1IEMA 1FR6A 2OSUA 3PBSA 3Q7ZA 2XFSA 1IYPA 3PAGA 4R23A 4HBTA 3BLSA 4ID4A 4E3NA 5FQKA 2HPBA 3IWIA 5HFOA 2WADA 1K4EA 3IHBA 3W4OA 1SHVA 1PYYA 3TSGA 3IH9A 2WYXA 1E3UA 4KENB 4JF4A 1DY6A 1PIOA 3E2LA 1K6SA 4FSFA 4EV4A 3NCKA 3MKEA 2Q9NA 2XK1A 3ZG8B 4OPRA 4U0XA 3HLBA 3C4OA 3PAEA 2WGIA 3IF6A 4LCMA 3MKFA 4Z9QA 5EVIB 5FQJA 5A93A 1K56D 1MWUA 2HP9A 4WMCA 4BD1A 3C5AA 2WUQA 3FWLA 3M2JA 5F1FA 2J7VA 4M3KA 1WYCA 2Y2NA 4P6BA 3EQVA 4ZTKA 5HAPA 2XF3A 4C3QA 2HDRA 4E3MA 3VP2A 4WEJA 3BYDA 4OQGA 4OONA 4OLDA 1IKIA 3ZG7B 2DCFA 2C5WB 3LY3A 4JXGA 4B4XA 2OLUA 4KQRA 3W4QA 3C7UA 2WZXA 1L0DA 1YLZA 2ZMAA 3HREA 4R4SA 2A49A 4DE0A 3ZFZA 5GLBA 3FZCA 1WE4A 4S2MA 1EI5A 3W8KA 1ERQA 4X69A 5U47A 4NK3A 2Y2QA 4ZJ2A 1FOFA 2H0TA 4XXRA 1CK3A 5KSCA 2EFUA 4QY6A 5DTKA 1MBLA 1LL5A 1BZAA 1PWGA 4C6YA 2ZC4B 1K57C 1W79A 2XR0A 3UDFA 5JYPA 4PM9A 5E2GA 1N9BA 1CEFA 1QMFA 1SKFA 1DJCA 1NYMA 2BLSA 2XDMA 3C4PA 4X68A 1BLSA 3PBQA 1MXOA 3BLMA 2OV5A 1LHYA 1EWZA 2IWDA 1RCJA 1XA1A 1KE4A 3HL9A 3IXDA 4N1XA 3WRTA 3BFGA 4X6TA 4EBLA 4DF6A 4UHUA 1C3BA 3UE1A 1YLJA 3QHYA 3V3SA 3WS1A 3CJMA 5GHYA 4WELA 4GZBA 4UAAA 3UE0A 5A90A 1KE0A 1KGFA 5HL1A 3E2KA 5EVIA 5KSHA 3WWXA 4NETA 2H5SA 3VOYA 3UO9A 1YM1A 5FQQA 4R4RA 2DNSA 1IYOA 1LLBA 3HLFA 1PW8A 5FAOA 2Z2LB 3ZCZA 4UA6A 5TGFA 5EECA 3BRMA 5EVIC 5M19A 4ZAMA 5DVAA 2EXAA 3N6IA 2A3UA 2WAFA 4HEFA 4JXVA 4KG6A 5BOHA 3M2KA 4KQOA 3SH7A 3P98A 4LENA 5CECA 1YT4A 1NZUA 2XQZA 4QJGA 3ITAA 1W8QA 4FH2A 4OPZA 3MZDA 1JWVA 1Q2QA 2DRWA 3VFFA 1BSGA 2RL3A 4IVKA 4S2NA 3HLWA 1BULA 3V5MA 4JBFA 3NDEA 5FA7A 1K55C 2ZQDA 5HAIA 3CZDA 3SS5A 1BLCA 1FSYA 4UA7A 2HDQA 1PI4A 5FAPA 1TDLA 1KVLA 3O86A 5CHUA 3PBTA 5J8XA 3DW0A 1RGZA 2X01A 2EFXA 2FFFB 3GV9A 5CTMA 3SS4A 3VOZA 4JF5A 1IYQA 4B4ZA 3G35A 4JLFA 4S2IA 2ZM8A 5FATA 3RXXA 1O7EA 3O87A 4IBRA 4E6WA 5CGSA 1GA9A 4JXSA 3VP1A 1E4DA 5EVLA 1YLPA 3IWOA 4CPKA 5F83A 3GSGA 2B5RA 4WEKA 3VSLA 1XXMA 4OOYA 1LI9A 4E3OA 5AQ9A 5CGWA 4BL3A 1E3UD 3DWZA 3I7JA 5EE8A 3IH8A 3PBRA 4GOGA 5FSRA 5L2FA 1HZOA 4S2OA 4EUZA 3Q7VB 3GVBA 2G2WA 2HP5A 3UE3A 4FCFA 3VP3A 2ZJ9A 2P9VB 3MXSA 2WKHA 3QNCA 4RX2A 3GRJA 2BG1A 4X55A 5CRFA 2H10A
chains in the Genus database with same CATH superfamily
2G2UA 3NECA 3OBFA 2GZAA 4HBUA 1U60A 1L3LA 1T1AA 1ODVA 2Y91A 4JGQA 4I38A 1XJ2A 2PD7A 4ETZA 2ZC5B 5FASA 3OOVA 3CPTB 4LV3A 4EBNA 3LR3A 2EX9A 3LCEA 4OQHA 1TD5A 1ESUA 1K6RA 2ZC6B 3SH8A 1SKOB 3ZG9B 3PBNA 2B02A 5D3OA 4Y13A 5HAQA 3UY6A 4U3TA 3KYZA 4BBTA 2PR5A 1K25A 3S7PA 1N9NA 3A0SA 1KDSA 4N9LA 1NYYA 3LR5A 2O99A 4IBXA 4K08A 2MJ6A 2QPNA 4WUJA 4U0TA 4IEDA 3MQQA 1OTBA 2FFYA 3IX3A 4DXBA 1EROA 1E25A 4OKPA 4P87A 5HW3A 1GCEA 1D7EA 3BM6A 3QP4A 3T4LA 5HSQA 2EX6A 4S2KA 3IS2A 3ZGAB 3AGFA 4KZ6A 1IELA 5AQBA 4WF0A 1K54C 4ZRRA 3B33A 1YLWA 3IT9A 1OMEA 3E4PA 2ZQ7A 4PM5A 1SKOA 5EOOA 4ME4A 1HVBA 1W5DA 1HTZA 4XT2A 2QHKA 3NC8A 4CLCC 3Q1FA 3A0RA 1KDWA 5KZHA 4DJ3A 3LI8A 1FCOA 3G32A 4ETXA 4EBPA 1N9OA 3K3CA 3O3VA 4XUXA 1O07A 3LY4A 3UDXA 5HPFA 4LRYC 3M6HA 4HP4A 5EV0A 4DDSA 4PHTA 2HF6A 2V1AA 2P74A 3CMZA 2GJ3A 4BENA 1NRFA 2W0NA 1ONHA 4EEUA 3OPLA 4DDYA 2HP6A 4Q0JA 2I72A 3UB9A 4BMWA 3ISGA 3UMDA 3ULFA 5IU1A 1F98A 2ZM0A 4P0MA 3FPVA 1XGJA 5DF8A 2PDRA 3MBZA 5I94A 2CC1A 4MEZA 1YSPA 2VZWA 4DE3A 3F1PB 4GKUA 2L0WA 1OTEA 5TFQA 1MWTA 1FCMA 2HDUA 4EWFA 4JGOA 2PU4A 3T50A 3JVUA 2Y79A 5HARA 2O9BA 4KZ4A 3T1RA 1EW0A 3OC2A 3HLGA 3TJZC 2ZQ8A 1S4RA 3NY4A 5CHMA 5DF7A 4HJ4A 5EVID 3BW6A 3UE6A 5EM0A 2IWBA 2XROA 5FQMA 3DTMA 1SCWA 2ZQAA 5AQ7A 3C38A 1D1JA 2VA0A 5CX7A 5GHZA 3F1PA 4OLGA 3P09A 4A5RA 2HZ5A 2K7SA 3AGEA 4WL9A 2C6WB 3V3RA 4AFIA 3QP5A 2EXBA 1P9RA 2XH9A 5M1AA 4OOMA 4QPRA 5FAQA 4KZ3A 2FH5A 2FZ0A 2PYPA 4K0XA 4X53A 5FI6A 5L10A 2V20A 1NXYA 1S1ZA 4BL2A 4OP8A 5AQAA 1CEGA 4G3VA 3N4IA 2PR6A 4JGPA 4ZJ1A 1ALQA 4L9GA 2IWCA 4OP5A 4KG2A 2PRFA 4QWOA 2XD5A 5IHVA 4YNRA 5EFWA 1NZOA 4YINA 2WGWB 4BLMA 1A0KA 1ERMA 2PBDP 3PBSA 2V8CA 4NG2A 5FQKA 5HFOA 1K4EA 1SHVA 1PYYA 2W3FA 1E3UA 1PRQA 5LBRA 4FSFA 2XA7M 1PFLA 3BJNA 1DP8A 4U0XA 1P0ZA 5FQJA 4WMCA 2WUQA 3NOUC 2OWJA 4P6BA 5HAPA 3KSIA 5FL3A 4WEJA 4OQGA 1YLZA 3ZFZA 5GLBA 2VX8A 4S2MA 3W8KA 4X69A 3QP6A 5U47A 1YKDA 3LI9A 2H0TA 3K3DA 2EFUA 1MBLA 1BZAA 1PWGA 1VETB 4X1MA 4P6ZS 4PM9A 3FC7A 1CEFA 3UB6A 1LHYA 1EWZA 4N1XA 3IXDA 1KE4A 1XJ3A 3UE1A 1YLJA 3QHYA 4HJ6A 3E4QA 2J80A 2I9VA 1UWNX 4CLCD 1KE0A 5G4ZA 3VOYA 2H5SA 1YM1A 2DNSA 1LLBA 3MXQA 4UEYA 3BQAA 4GHIB 5TGFA 3BRMA 5M19A 4ZAMA 5DVAA 3N6IA 3F1OB 5BOHA 3M2KA 3SH7A 4LENA 5CECA 1T19A 3ITAA 4OPZA 4DJ2A 2RL3A 3W2ZA 5K5BA 3DTKA 3NDEA 2KDKA 5FA7A 5HAIA 3QP8A 4UQIS 1PI4A 2BASA 1Y28A 1VETA 5FAPA 2P7JA 3PBTA 5J8XA 2X01A 3SS4A 1IYQA 3KSFA 3G35A 4S2IA 4GJ4A 3RXXA 1GA9A 4CPKA 2NUPC 3LICA 4FUWA 2PYRA 4EQ1A 4BL3A 2VGLS 3IH8A 5L2FA 3Q7VB 2ZJ9A 3V67A 2P9VB 3F1OA 1S67L 4F3LB 2K2NA 5CRFA 3D4FA 4KZAA 2ZL1B 4MNRA 1OJ5A 5F68A 4OPQA 1ZC2A 3PXPA 2WAEA 3QP1A 3ZVTA 3KO6A 4EEPA 3LEQA 5J4EA 1ZTUA 2ZBBA 3C7VA 3HVFA 4O01A 2QZ6A 5F82A 5HZHA 5EUAA 5FDHA 4N92A 4LRXC 4QB8A 1XA7A 4D2OA 4KZ7A 1FIKA 4O7DA 4Y17A 1PWDA 4GN2A 3LIBA 3NDGA 3ZG0A 2HV1A 4DE1A 4X56A 2XEPA 4ZDXA 4RYEA 1JTGA 3ZDJA 2Y2IA 4PMAA 2Y2MA 3JPUA 5EVEA 3IF5A 3Q7VA 5DKLA 3H7WB 4F94A 2P9VA 2IA2A 2JKGA 1JVJA 5L07A 4F3LA 4FD8A 1N4OA 3CAXA 4E3LA 5HWTA 4IHQA 2ZL1A 1H8YA 2PBYA 5EOEA 2KOIA 2WKRA 3MSHA 1IYSA 3M6BA 3G34A 3IX4A 2J3TC 1YQSA 1X0OA 1YSQA 3NIAA 3OPPA 3GMWA 4H8RA 4WZ5C 3NHQA 3UPOA 4MBKA 4DE2A 3UPNA 3S22A 1TS7A 4Y0UA 1ESIA 2V1ZA 4HQAA 1OPXA 3S1YA 4BWIA 4N9KA 4QHCA 1T1CA 3FV7A 5FEFA 4MLLA 5HD3A 3H82B 3C8CA 3NOPC 3VSKA 1ES5A 4XUZA 3CUEC 2Y2OA 2Z6DA 1IKGA 3H7WA 2R9WA 3HLCA 3OLOA 4Y5FA 2P08A 3SS3A 1MPLA 1J3WA 1F9IA 3IBRA 4QD4A 3T4SA 4KUKA 4WMCD 3UMEA 4PPRA 2VGKA 2Y4AA 3T1SA 2H0YA 4BBUA 1TVFA 1PNEA 3HLEA 4N1HA 3WS0A 5KIZA 3A0VA 1K38A 1M40A 2OLVA 3A3DA 4X25A 1PW1A 4CLCB 4JGRA 4KG5A 1DJBA 3T12B 5IS1A 3UDIA 1TS6A 3B3XA 1LT0A 2UV0E 2JCHA 2WK0A 3UB8A 1K0KA 1CF0A 1JTDA 5G4YA 4Y7PA 3CWFA 3VOLA 4B9OA 2V9AA 3T4TA 2QMIA 2V0UA 1MKIA 3UPPA 2OAQ1 2XLNA 1K54A 1GHPA 4GS9B 5I5LA 2K31A 3N8SA 3QNBA 4GD6A 3PR6A 4QU3A 3CPTA 2Y2GA 4Y3IA 2PT7A 2EX2A 3JYIA 2R78A 3Q81A 4HOIA 4CLCA 3MFDA 2ZC7A 1LSVA 4GB7A 2HGVA 1PZPA 4WBGA 5FQIA 2X02A 4GD8A 4YWZA 3GR2A 3S7OA 1VM1A 3L9KA 4IVIA 3T4QA 3HJIA 3UB7A 1XP4A 5HDSA 3CLOA 1FQGA 4OH0A 2ACGA 1JWPA 3SZTA 3FKVA 4HHDA 1S6RA 1NRJA 5A91A 1NJ4A 2G7UA 3V50A 3WS5A 1ZKJA 3VP4A 3BFCA 1J9MA 4GS9A 1S4SA 1LI0A 1DRMA 1YLYA 4Y15A 3DWKA 2B18A 1L0GA 4IUKA 1BLHA 2EX8A 4S2PA 5EPHA 5HWVA 3Q7ZA 2XFSA 4HBTA 3BLSA 4ID4A 4E3NA 2HPBA 3IHBA 3IH9A 3BY8A 4KENB 3QP2A 4EV4A 2Q9NA 2XK1A 2W1RA 3PAEA 4LCMA 1MWUA 3C5AA 2J7VA 1WYCA 3KSGA 4ZTKA 2LB9A 4E3MA 3VP2A 5HPIA 3BYDA 5DFXA 3D72A 2B95A 2DCFA 3EOIA 4KQRA 3LFVA 1NLYA 2XA7S 3DTIA 1WE4A 1ERQA 4ZJ2A 4XXRA 1CK3A 4QY6A 5DTKA 1LL5A 4C6YA 2ZC4B 1K57C 1N9BA 1QMFA 2XDMA 3C4PA 3O5YA 3BLMA 2IWDA 1RCJA 3WRTA 3F1NB 2CMNA 3G6OA 4EBLA 2NUTC 4HP9A 1C3BA 2J3WA 4R70A 4GZBA 1KGFA 2D02A 3WWXA 2M7VA 5FDSA 4PAUA 2AVXA 2A3UA 4HEFA 3DAVA 4KQOA 3R7WB 3B47A 2V8FA 4I5SA 1YT4A 1NZUA 2PAVP 2XQZA 4FH2A 3MZDA 3LUQA 3HLWA 1K55C 1D06A 2PD8A 1OTIA 3DW0A 4WN5A 2L1MA 1RGZA 2EFXA 4GW9A 4JF5A 3T4KA 5TJJA 3F1NA 2D01A 1O7EA 3O87A 4IBRA 4NEED 4JXSA 4EETB 5EVLA 3BY9A 2W27A 3VSLA 4E3OA 3ICYA 3LGOA 5EM1A 5HDDA 3HJKA 1HZOA 4S2OA 3GVBA 2G2WA 2HP5A 4O0PA 2KLIA 2BG1A 4X55A 3ZQ5A 3R7WA 5E2HA 2ZMFA 1H8ZA 3A3FA 4DKIA 2VKSA 1PZOA 1T1BA 3IHAA 2ZM2A 1V9YA 4GDNA 4LPZA 1W7FA 2Y2LA 3VV4A 5IT5A 2O0YA 4Q0IA 2VV6A 3VFHA 4YOFA 3C30A 1FR1A 2WGWA 2X71A 3L7HA 3BFDA 1I2WA 3O88A 2VGJA 2Y2PA 3NJAA 1NY0A 5HL6A 1YMXA 3A3JA 5TR7A 4R3AA 3N8LA 4R0QA 3GECA 3Q82A 4HESA 1N9LA 1CI9A 1LL8A 3OCNA 3G30A 3HBRA 5GL9A 4OOLA 4Q0HA 3G2ZA 3MQOA 4MN5A 3WS4A 4ZJ3A 3FYZA 3ZG5A 3OPHA 3IBJA 5AVEA 2ZLYA 2A2LA 3S7NA 4EU0A 2W3HA 3ITBA 1JNUA 4MBHA 1ZG4A 5AJGA 4KZ5A 2J9PA 1DP9A 1ES4A 3UNWA 2V1BA 5M18A 1CJFA 4CQHA 2Y2KA 1H8MA 4NXFA 1VQQA 1MWRA 4WLAA 1SZVA 1RGYA 1PI5A 2ZQCA 4OQIA 4D60A 5FI2A 4KQQA 4DRTA 4YFMA 3IWQA 3LIAA 4LV0A 4GHIA 5F5YA 1FSWA 2XGNA 3TG9A 4MMNA 1CI8A 2PU2A 5J3WA 3EQUA 4DXCA 5CHJA 3UB5P 4HI4A 4O8GA 3TE8A 4GCZA 2UWXA 3NULA 4LRZE 3IXBA 3G4PA 2E8IA 2ZD8A 1IFQA 4L0LA 1I2SA 4HH3A 3MQ0A 3UN7A 2XFTA 3A3IA 5F6AA 4HJ3A 3KYEA 4RX3A 3IF6C 4P6ZM 3U2AA 4JXWA 1NWZA 2RCXA 4JF6A 5HWWA 1STZA 2Y2HA 2O9AA 1PWCA 3AGDA 2ZQ9A 3N7WA 4P85A 2HJ9C 1YLTA 3RH8B 3PTEA 4KZ9A 4EESA 3RJUA 3V39A 3NI9A 3MS6A 5HX9A 4IUHA 4I3AA 4MDZA 4KQDA 4OPYA 5DTSA 5F1GA 1ONGA 2LB5A 3HUNA 3LIFA 4R3BA 1MY8A 5A92A 4WZ5A 4PM6A 2V0WA 2WKIA 1KE3A 2EWVA 1TF1A 3G2YA 2JHEA 2J9OA 1BTLA 4M4XA 1KGGA 3MXRA 1MKMA 3PBOA 3CUEA 5DFYA 1I5QA 1DJAA 1S0WA 4BJPA 2WKEA 1TS0A 3HUOA 4E6XA 4WYYA 1P9WA 3BECA 4GNUA 5GHXA 2HDSA 4FH4A 5DTTA 1GHMA 2W3EA 2E8JA 2JBFA 1W63Q 3BFEA 4FOFA 4S2NC 2EWWA 4LLOB 1LL9A 4OVDA 1DP6A 4LCLA 2JN7A 1WYBA 3ZNTA 1TDGA 1VB6A 3HLDA 1VEUB 5DJUA 5G18A 2QWSA 3IX8A 4S2JA 5GLDA 4DMZA 4L9FA 1GSWA 2W3GA 3MF0A 3KX0X 3IWIA 5J7EA 2WADA 3W4OA 4HH2A 1DY6A 3DTEA 2INWA 3MKEA 3ZG8B 4EXOA 3HLBA 3C4OA 2WGIA 5A93A 1K56D 2VJWA 3FWLA 3IS2B 3H82A 1T18A 4M3KA 4Z1WA 2Y2NA 3EQVA 2XF3A 4C3QA 4MN6A 1IKIA 3ZG7B 4G3KA 4JXGA 4B4XA 3W4QA 2WZXA 1L0DA 2ZMAA 3HREA 4R4SA 2A49A 3FZCA 4XT2B 4NK3A 3GDIA 2YKHA 1VEUA 3B42A 1S1YA 2VEAA 1W79A 3UDFA 5JYPA 4H6JB 1DJCA 1BLSA 2Y8HA 1G5UA 1XA1A 2JKTI 3R4KA 4EERA 2ZOIA 4X6TA 4DF6A 4UHUA 3FPWA 3V3SA 2A24B 3WS1A 3SW1A 4WELA 3UE0A 4LFUA 5HL1A 5KSHA 1IOUA 3HCYA 3UO9A 4HIAA 3HLFA 1PW8A 4UA6A 3EGDC 5EECA 1OJGA 2GNXA 2WAFA 2HJEA 3MR0A 4ESPA 1XFQA 1JWVA 1Q2QA 4NXEA 1BSGA 1W63M 3V5MA 2ZQDA 1Y4OA 2OOLA 3SS5A 2HDQA 1S66L 5CHUA 1KVLA 1TDLA 1UWPX 4MCWA 3LIEA 3LYXA 3DBAA 3EEHA 3H9WA 4H6JA 3E4OA 2FFFB 4B4ZA 4JLFA 2JKFA 2ZM8A 2XRNA 4R6LA 1OTAA 2KX6A 4I3JA 1E4DA 2A24A 3GSGA 1OT6A 1LI9A 4I3IA 5AQ9A 5CGWA 3DWZA 3PBRA 4GOGA 5FSRA 5DJTA 3UE3A 2QJ7A 3MXSA 2WKHA 3GRJA 2JKRI 3LR0A 2Q0OA 2Y55A 3LIDA 2Z2MB 3CG5A 5KMWA 1L2SA 2QJ5A 3MJQA 4BBVA 2VV7A 3T1XA 4R38A 1W8YA 4ARZB 4RVAA 4E3IA 1M6KA 4LV2A 3CHWP 1ZG6A 1K57A 1ZHHB 3JVVA 2Y59A 5CGXA 1KVMA 4Q8IA 1ES2A 1UGUA 4NKPA 1BYWA 3LO7A 5GLAA 3W4PA 5CTNA 4K91A 2W3DA 2J3TD 3C2WA 4KUOA 2J8YA 4HNBA 3OPRA 3Q07A 3ZNYA 2R9XA 3ZVWA 4X1LA 3VMAA 4PM7A 1XGIA 3LEZA 1H0MA 1LSXA 3RXWA 2VK3A 4BD0A 4R1GA 4RA7A 2OAP1 1MC0A 2WGVA 4LV1A 3U4LP 4KZBA 3PYPA 3MMHA 1GSXA 3WRZA 2DMWA 2Q9MA 4S2LA 3ZHHA 4GLQA 1SDNA 1Z09A 1XPBA 4ARZA 3FG8A 4UA9A 1HLUP 1G28A 1K55A 2VV8A 5HDCA 5CXWA 1LSWA 2VLGA 3NBLA 3IXHA 4E3JA 4PKYG 1FILA 1HD8A 4E3KA 1BUEA 4PM8A 1G68A 4GDBA 4MBFA 5E2EA 5E2FA 1KGEA 4R3JA 4Y2FA 5TBMB 3EWKA 4DN0A 1BLPA 5CERA 1V9ZA 4JKTA 4CLCE 3GQZA 1MWSA 3T4JA 5DF9A 2XD1A 5GLCA 4Y0TA 4NXBA 3WS2A 4B88A 1Z6FA 1TEMA 1YPRA 5CEDA 1QMEA 1P97A 2Z6CA 5AVFA 3SOIA 3EEAA 3MZEA 3S4XA 1XKZA 3BEBA 3SH9A 4B93A 3E0YA 3E98A 4RQ9A 4QY5A 4WM9A 1YAXA 2ZC3B 3BWLA 3T1QB 1Q2PA 1K56A 4K0WA 3D3OA 5TBMA 3KSHA 5DKKA 5A8BA 2WZZA 3N8RA 4I39A 5F69A 1OTDA 1TS8A 4BQMA 2JC7A 1XX2A 3OZHA 4II7A 5FQ9A 1L0EA 1ES3A 3MZFA 1K4FA 1OT9A 3G31A 2P04A 1SDEA 4EQIA 1H5XA 3A3EA 5FI7A 3FKWA 4OQ0A 5HD5A 3T4OA 3VE4A 2JE5A 4JPMA 5JYOA 4WZ4A 1XJ6A 4Y0OA 3D9YA 2Y2JA 2GDNA 2JKTM 2V2FF 1GHIA 4KZ8A 1WA9A 5CEBA 3TRCA 1BT5A 3TOIA 3IXGA 1JWZA 3S7QA 2WKQA 3IF6B 1NLZA 3IQAA 4C75A 2M7UA 3GTCA 1YMSA 3RTYA 1G6AA 1F5MA 2PHYA 1Y54A 3EGXC 3VP0A 1FCNA 3PHYA 2QKPA 3KYQA 2W1TB 3HUMA 2BTFP 2EA9A 1RP5A 3BFFA 3LR4A 1AXBA 1H3QA 5E43A 1XJ4A 3OCLA 2H28A 1GA0A 1G6OA 3P01A 4ZBEA 4CJNA 1L0FA 1IEMA 1FR6A 2OSUA 3PAGA 1IYPA 4R23A 2O9CA 3TSGA 2WYXA 4JF4A 1PIOA 3E2LA 3MFXA 1K6SA 2GX5A 3NCKA 2ZOHA 4OPRA 5FEGA 2YKFA 3IF6A 4Z9QA 3MKFA 5EVIB 2HP9A 4BD1A 3M2JA 5F1FA 4EUVA 2HDRA 3ZYTA 5L09A 2L4RA 5MC7A 2JKRM 1XFNA 4OONA 4LGWA 4OLDA 2C5WB 3LY3A 2OLUA 2W1TA 3C7UA 3K2NA 4FTXA 4DE0A 4E04A 1EI5A 1VHMA 4HY8A 2Y2QA 3VE3A 1FOFA 5KSCA 4PKYA 1ACFA 2XR0A 3CITA 5E2GA 1SKFA 1KOUA 1NYMA 2BLSA 4X68A 3PBQA 1MXOA 2OV5A 3HL9A 5C5KA 3BFGA 4IJGA 3CJMA 5GHYA 4UAAA 5A90A 3RFBA 3E2KA 5EVIA 4NETA 2OWHA 5FQQA 4MN7A 4EW7A 3CI6A 4R4RA 4UQIM 1IYOA 3BQ8A 5FAOA 3ZCZA 2Z2LB 2M1CA 5EVIC 4L9EA 2ZMVA 2EXAA 4JXVA 4KG6A 5L8MA 3P98A 3TW8A 1MZUA 3P7NA 4QJGA 3NOTC 1W8QA 2DRWA 3VFFA 4IVKA 4S2NA 1BULA 4JBFA 3CZDA 1BLCA 1FSYA 4UA7A 2VGLM 1CQAA 3O86A 2WKPA 3GV9A 5CTMA 3VOZA 1GSVA 5FATA 4E6WA 5CGSA 3VP1A 1YLPA 3IWOA 5F83A 2B5RA 4WEKA 1XXMA 4OOYA 4G3WA 1E3UD 3I7JA 5EE8A 1AWIA 4EUZA 2QYBA 4FCFA 3VP3A 1F2KA 3QNCA 4RX2A 2XSSA 2H10A 4NXGA
chains in the Genus database with same CATH topology
3D4FA 5E2HA 2G2UA 4KZAA 4HBUA 1H8ZA 3A3FA 1U60A 2Y55A 4MNRA 4DKIA 2Z2MB 3CG5A 5KMWA 2Y91A 1L2SA 4OPQA 2ZC5B 5FASA 1PZOA 1ZC2A 2WAEA 3IHAA 4LV3A 3ZVTA 2ZM2A 4EBNA 1W8YA 4GDNA 2EX9A 3LCEA 4OQHA 3C7VA 3HVFA 4RVAA 1W7FA 2QZ6A 2Y2LA 5F82A 1ESUA 1K6RA 4E3IA 1M6KA 2ZC6B 3SH8A 3ZG9B 4LV2A 3PBNA 5HAQA 5D3OA 5EUAA 3UY6A 5FDHA 4U3TA 1ZG6A 4N92A 1K57A 4QB8A 2Y59A 5CGXA 3VFHA 1K25A 1XA7A 4D2OA 1KVMA 4KZ7A 4Q8IA 1ES2A 1FR1A 4O7DA 1KDSA 4N9LA 1PWDA 2WGWA 3LO7A 4GN2A 1NYYA 2X71A 5CTNA 5GLAA 3W4PA 3BFDA 4K91A 1I2WA 3NDGA 4IBXA 3ZG0A 3O88A 4DE1A 2J8YA 2QPNA 2VGJA 4X56A 2XEPA 3OPRA 4ZDXA 4RYEA 1JTGA 2Y2PA 3Q07A 4IEDA 4U0TA 3ZDJA 2Y2IA 1NY0A 4PMAA 2FFYA 2Y2MA 1YMXA 3A3JA 4DXBA 3ZNYA 3IF5A 5TR7A 2R9XA 1EROA 3ZVWA 1E25A 3N8LA 4OKPA 4PM7A 1XGIA 4P87A 3LEZA 3Q7VA 4R0QA 3VMAA 5HW3A 1GCEA 4F94A 3Q82A 3RXWA 2P9VA 4HESA 3BM6A 4BD0A 4R1GA 4RA7A 1JVJA 1CI9A 2EX6A 3OCNA 1N4OA 2WGVA 3G30A 4FD8A 4LV1A 4S2KA 4E3LA 4KZBA 3ZGAB 3HBRA 5GL9A 1H8YA 2PBYA 3AGFA 4OOLA 5EOEA 4KZ6A 3G2ZA 3WRZA 2Q9MA 3WS4A 4S2LA 3ZHHA 4ZJ3A 3FYZA 1IELA 1SDNA 5AQBA 1K54C 1IYSA 3M6BA 3G34A 3ZG5A 3OPHA 1XPBA 1YLWA 1YQSA 3IT9A 1OMEA 4UA9A 2ZLYA 3NIAA 3OPPA 3GMWA 1K55A 4H8RA 4WZ5C 2ZQ7A 4PM5A 5CXWA 3UPOA 3ITBA 4MBKA 4DE2A 5EOOA 3UPNA 1HVBA 3NBLA 3S22A 1W5DA 4Y0UA 1HTZA 3IXHA 4E3JA 4MBHA 1ZG4A 1ESIA 4KZ5A 2J9PA 1HD8A 2V1ZA 4E3KA 1BUEA 1ES4A 3NC8A 4PM8A 3UNWA 1G68A 3Q1FA 3S1YA 1KDWA 4GDBA 4MBFA 4N9KA 4QHCA 5KZHA 5M18A 5E2EA 5E2FA 3FV7A 1FCOA 3G32A 4MLLA 2Y2KA 4EBPA 1KGEA 1VQQA 1MWRA 4R3JA 3O3VA 3VSKA 4XUXA 1O07A 1ES5A 1RGYA 3LY4A 1PI5A 4XUZA 3UDXA 1BLPA 5CERA 3M6HA 2Y2OA 2ZQCA 4JKTA 4OQIA 4DDSA 1IKGA 2R9WA 3HLCA 3GQZA 1MWSA 5FI2A 5DF9A 4KQQA 4DRTA 4YFMA 2P74A 2XD1A 3SS3A 1MPLA 3IWQA 3CMZA 5GLCA 4Y0TA 4BENA 1NRFA 4LV0A 1ONHA 3WS2A 4B88A 1FSWA 3OPLA 4DDYA 1Z6FA 2XGNA 2HP6A 3TG9A 1CI8A 1TEMA 2I72A 4QD4A 5CEDA 4WMCD 1QMEA 2VGKA 4PPRA 2PU2A 2Y4AA 2H0YA 1TVFA 3ISGA 3EQUA 4DXCA 5CHJA 3SOIA 3MZEA 3HLEA 2ZM0A 4N1HA 4P0MA 3S4XA 3WS0A 1XKZA 1XGJA 3BEBA 3SH9A 5DF8A 2UWXA 3MBZA 5I94A 2CC1A 1K38A 1M40A 4MEZA 2OLVA 3A3DA 3IXBA 1PW1A 3G4PA 4DE3A 2E8IA 2ZD8A 4L0LA 4QY5A 4WM9A 1I2SA 2ZC3B 3UN7A 4GKUA 2XFTA 1Q2PA 3A3IA 1K56A 4KG5A 5TFQA 1DJBA 4K0WA 1MWTA 3UDIA 1FCMA 2HDUA 4EWFA 4RX3A 2PU4A 2WZZA 3IF6C 3N8RA 3B3XA 4JXWA 2RCXA 2JCHA 4JF6A 4BQMA 2JC7A 1XX2A 2WK0A 3OZHA 2Y2HA 5HARA 1PWCA 3AGDA 2ZQ9A 3N7WA 4P85A 4KZ4A 1YLTA 5FQ9A 1L0EA 3PTEA 4KZ9A 1ES3A 1JTDA 4Y7PA 3RJUA 3OC2A 3NI9A 3V39A 3HLGA 1K4FA 3MZFA 2ZQ8A 3G31A 3NY4A 5CHMA 5DF7A 2QMIA 5HX9A 1MKIA 1SDEA 5EVID 4EQIA 3UPPA 1H5XA 3A3EA 4OPYA 5DTSA 5F1GA 5FI7A 3FKWA 1ONGA 2XLNA 4OQ0A 1K54A 1GHPA 2IWBA 5FQMA 3HUNA 3N8SA 4R3BA 3QNBA 1MY8A 3DTMA 4GD6A 2JE5A 5A92A 1SCWA 2ZQAA 4WZ5A 4JPMA 5JYOA 4WZ4A 4QU3A 5AQ7A 4Y0OA 2Y2GA 4PM6A 2Y2JA 2EX2A 2GDNA 3JYIA 2WKIA 1KE3A 3Q81A 5GHZA 3MFDA 3P09A 2ZC7A 4OLGA 4A5RA 2V2FF 4GB7A 1GHIA 3G2YA 3AGEA 4WBGA 1PZPA 5FQIA 2X02A 4GD8A 4KZ8A 2C6WB 2J9OA 3V3RA 1BTLA 3GR2A 5CEBA 1VM1A 1BT5A 1KGGA 3TOIA 2EXBA 2XH9A 3IXGA 3MXRA 5M1AA 4IVIA 4OOMA 1JWZA 5FAQA 4KZ3A 3IF6B 1XP4A 3IQAA 3PBOA 4C75A 1FQGA 4OH0A 1I5QA 1DJAA 1JWPA 1S0WA 4K0XA 3GTCA 4X53A 1YMSA 5FI6A 3FKVA 4BJPA 2WKEA 2V20A 1G6AA 3HUOA 1S6RA 1NXYA 4E6XA 4WYYA 4BL2A 5A91A 4OP8A 1NJ4A 5AQAA 1Y54A 1CEGA 3VP0A 3BECA 4GNUA 5GHXA 1FCNA 3V50A 2HDSA 4FH4A 5DTTA 3WS5A 1GHMA 1ZKJA 3VP4A 3HUMA 2JBFA 3N4IA 3BFCA 3BFEA 4S2NC 1J9MA 4ZJ1A 1ALQA 1RP5A 1LL9A 4OVDA 3BFFA 4LCLA 1AXBA 1LI0A 1WYBA 2IWCA 5E43A 1YLYA 4OP5A 3ZNTA 3DWKA 1TDGA 4KG2A 3OCLA 1L0GA 3HLDA 1BLHA 2XD5A 5IHVA 5G18A 1GA0A 4S2JA 5GLDA 1NZOA 4YINA 2WGWB 4BLMA 2EX8A 4S2PA 4ZBEA 4CJNA 1ERMA 5EPHA 1L0FA 1IEMA 1FR6A 2OSUA 3PBSA 3Q7ZA 2XFSA 1IYPA 3PAGA 4R23A 4HBTA 3BLSA 4ID4A 4E3NA 5FQKA 2HPBA 3IWIA 5HFOA 2WADA 1K4EA 3IHBA 3W4OA 1SHVA 1PYYA 3TSGA 3IH9A 2WYXA 1E3UA 4KENB 4JF4A 1DY6A 1PIOA 3E2LA 1K6SA 4FSFA 4EV4A 3NCKA 3MKEA 2Q9NA 2XK1A 3ZG8B 4OPRA 4U0XA 3HLBA 3C4OA 3PAEA 2WGIA 3IF6A 4LCMA 3MKFA 4Z9QA 5EVIB 5FQJA 5A93A 1K56D 1MWUA 2HP9A 4WMCA 4BD1A 3C5AA 2WUQA 3FWLA 3M2JA 5F1FA 2J7VA 4M3KA 1WYCA 2Y2NA 4P6BA 3EQVA 4ZTKA 5HAPA 2XF3A 4C3QA 2HDRA 4E3MA 3VP2A 4WEJA 3BYDA 4OQGA 4OONA 4OLDA 1IKIA 3ZG7B 2DCFA 2C5WB 3LY3A 4JXGA 4B4XA 2OLUA 4KQRA 3W4QA 3C7UA 2WZXA 1L0DA 1YLZA 2ZMAA 3HREA 4R4SA 2A49A 4DE0A 3ZFZA 5GLBA 3FZCA 1WE4A 4S2MA 1EI5A 3W8KA 1ERQA 4X69A 5U47A 4NK3A 2Y2QA 4ZJ2A 1FOFA 2H0TA 4XXRA 1CK3A 5KSCA 2EFUA 4QY6A 5DTKA 1MBLA 1LL5A 1BZAA 1PWGA 4C6YA 2ZC4B 1K57C 1W79A 2XR0A 3UDFA 5JYPA 4PM9A 5E2GA 1N9BA 1CEFA 1QMFA 1SKFA 1DJCA 1NYMA 2BLSA 2XDMA 3C4PA 4X68A 1BLSA 3PBQA 1MXOA 3BLMA 2OV5A 1LHYA 1EWZA 2IWDA 1RCJA 1XA1A 1KE4A 3HL9A 3IXDA 4N1XA 3WRTA 3BFGA 4X6TA 4EBLA 4DF6A 4UHUA 1C3BA 3UE1A 1YLJA 3QHYA 3V3SA 3WS1A 3CJMA 5GHYA 4WELA 4GZBA 4UAAA 3UE0A 5A90A 1KE0A 1KGFA 5HL1A 3E2KA 5EVIA 5KSHA 3WWXA 4NETA 2H5SA 3VOYA 3UO9A 1YM1A 5FQQA 4R4RA 2DNSA 1IYOA 1LLBA 3HLFA 1PW8A 5FAOA 2Z2LB 3ZCZA 4UA6A 5TGFA 5EECA 3BRMA 5EVIC 5M19A 4ZAMA 5DVAA 2EXAA 3N6IA 2A3UA 2WAFA 4HEFA 4JXVA 4KG6A 5BOHA 3M2KA 4KQOA 3SH7A 3P98A 4LENA 5CECA 1YT4A 1NZUA 2XQZA 4QJGA 3ITAA 1W8QA 4FH2A 4OPZA 3MZDA 1JWVA 1Q2QA 2DRWA 3VFFA 1BSGA 2RL3A 4IVKA 4S2NA 3HLWA 1BULA 3V5MA 4JBFA 3NDEA 5FA7A 1K55C 2ZQDA 5HAIA 3CZDA 3SS5A 1BLCA 1FSYA 4UA7A 2HDQA 1PI4A 5FAPA 1TDLA 1KVLA 3O86A 5CHUA 3PBTA 5J8XA 3DW0A 1RGZA 2X01A 2EFXA 2FFFB 3GV9A 5CTMA 3SS4A 3VOZA 4JF5A 1IYQA 4B4ZA 3G35A 4JLFA 4S2IA 2ZM8A 5FATA 3RXXA 1O7EA 3O87A 4IBRA 4E6WA 5CGSA 1GA9A 4JXSA 3VP1A 1E4DA 5EVLA 1YLPA 3IWOA 4CPKA 5F83A 3GSGA 2B5RA 4WEKA 3VSLA 1XXMA 4OOYA 1LI9A 4E3OA 5AQ9A 5CGWA 4BL3A 1E3UD 3DWZA 3I7JA 5EE8A 3IH8A 3PBRA 4GOGA 5FSRA 5L2FA 1HZOA 4S2OA 4EUZA 3Q7VB 3GVBA 2G2WA 2HP5A 3UE3A 4FCFA 3VP3A 2ZJ9A 2P9VB 3MXSA 2WKHA 3QNCA 4RX2A 3GRJA 2BG1A 4X55A 5CRFA 2H10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4F A;  5E2H A;  2G2U A;  4KZA A;  4HBU A;  1H8Z A;  3A3F A;  1U60 A;  2Y55 A;  4MNR A;  4DKI A;  2Z2M B;  3CG5 A;  5KMW A;  2Y91 A;  1L2S A;  4OPQ A;  2ZC5 B;  5FAS A;  1PZO A;  1ZC2 A;  2WAE A;  3IHA A;  4LV3 A;  3ZVT A;  2ZM2 A;  4EBN A;  1W8Y A;  4GDN A;  2EX9 A;  3LCE A;  4OQH A;  3C7V A;  3HVF A;  4RVA A;  1W7F A;  2QZ6 A;  2Y2L A;  5F82 A;  1ESU A;  1K6R A;  4E3I A;  1M6K A;  2ZC6 B;  3SH8 A;  3ZG9 B;  4LV2 A;  3PBN A;  5HAQ A;  5D3O A;  5EUA A;  3UY6 A;  5FDH A;  4U3T A;  1ZG6 A;  4N92 A;  1K57 A;  4QB8 A;  2Y59 A;  5CGX A;  3VFH A;  1K25 A;  1XA7 A;  4D2O A;  1KVM A;  4KZ7 A;  4Q8I A;  1ES2 A;  1FR1 A;  4O7D A;  1KDS A;  4N9L A;  1PWD A;  2WGW A;  3LO7 A;  4GN2 A;  1NYY A;  2X71 A;  5CTN A;  5GLA A;  3W4P A;  3BFD A;  4K91 A;  1I2W A;  3NDG A;  4IBX A;  3ZG0 A;  3O88 A;  4DE1 A;  2J8Y A;  2QPN A;  2VGJ A;  4X56 A;  2XEP A;  3OPR A;  4ZDX A;  4RYE A;  1JTG A;  2Y2P A;  3Q07 A;  4IED A;  4U0T A;  3ZDJ A;  2Y2I A;  1NY0 A;  4PMA A;  2FFY A;  2Y2M A;  1YMX A;  3A3J A;  4DXB A;  3ZNY A;  3IF5 A;  5TR7 A;  2R9X A;  1ERO A;  3ZVW A;  1E25 A;  3N8L A;  4OKP A;  4PM7 A;  1XGI A;  4P87 A;  3LEZ A;  3Q7V A;  4R0Q A;  3VMA A;  5HW3 A;  1GCE A;  4F94 A;  3Q82 A;  3RXW A;  2P9V A;  4HES A;  3BM6 A;  4BD0 A;  4R1G A;  4RA7 A;  1JVJ A;  1CI9 A;  2EX6 A;  3OCN A;  1N4O A;  2WGV A;  3G30 A;  4FD8 A;  4LV1 A;  4S2K A;  4E3L A;  4KZB A;  3ZGA B;  3HBR A;  5GL9 A;  1H8Y A;  2PBY A;  3AGF A;  4OOL A;  5EOE A;  4KZ6 A;  3G2Z A;  3WRZ A;  2Q9M A;  3WS4 A;  4S2L A;  3ZHH A;  4ZJ3 A;  3FYZ A;  1IEL A;  1SDN A;  5AQB A;  1K54 C;  1IYS A;  3M6B A;  3G34 A;  3ZG5 A;  3OPH A;  1XPB A;  1YLW A;  1YQS A;  3IT9 A;  1OME A;  4UA9 A;  2ZLY A;  3NIA A;  3OPP A;  3GMW A;  1K55 A;  4H8R A;  4WZ5 C;  2ZQ7 A;  4PM5 A;  5CXW A;  3UPO A;  3ITB A;  4MBK A;  4DE2 A;  5EOO A;  3UPN A;  1HVB A;  3NBL A;  3S22 A;  1W5D A;  4Y0U A;  1HTZ A;  3IXH A;  4E3J A;  4MBH A;  1ZG4 A;  1ESI A;  4KZ5 A;  2J9P A;  1HD8 A;  2V1Z A;  4E3K A;  1BUE A;  1ES4 A;  3NC8 A;  4PM8 A;  3UNW A;  1G68 A;  3Q1F A;  3S1Y A;  1KDW A;  4GDB A;  4MBF A;  4N9K A;  4QHC A;  5KZH A;  5M18 A;  5E2E A;  5E2F A;  3FV7 A;  1FCO A;  3G32 A;  4MLL A;  2Y2K A;  4EBP A;  1KGE A;  1VQQ A;  1MWR A;  4R3J A;  3O3V A;  3VSK A;  4XUX A;  1O07 A;  1ES5 A;  1RGY A;  3LY4 A;  1PI5 A;  4XUZ A;  3UDX A;  1BLP A;  5CER A;  3M6H A;  2Y2O A;  2ZQC A;  4JKT A;  4OQI A;  4DDS A;  1IKG A;  2R9W A;  3HLC A;  3GQZ A;  1MWS A;  5FI2 A;  5DF9 A;  4KQQ A;  4DRT A;  4YFM A;  2P74 A;  2XD1 A;  3SS3 A;  1MPL A;  3IWQ A;  3CMZ A;  5GLC A;  4Y0T A;  4BEN A;  1NRF A;  4LV0 A;  1ONH A;  3WS2 A;  4B88 A;  1FSW A;  3OPL A;  4DDY A;  1Z6F A;  2XGN A;  2HP6 A;  3TG9 A;  1CI8 A;  1TEM A;  2I72 A;  4QD4 A;  5CED A;  4WMC D;  1QME A;  2VGK A;  4PPR A;  2PU2 A;  2Y4A A;  2H0Y A;  1TVF A;  3ISG A;  3EQU A;  4DXC A;  5CHJ A;  3SOI A;  3MZE A;  3HLE A;  2ZM0 A;  4N1H A;  4P0M A;  3S4X A;  3WS0 A;  1XKZ A;  1XGJ A;  3BEB A;  3SH9 A;  5DF8 A;  2UWX A;  3MBZ A;  5I94 A;  2CC1 A;  1K38 A;  1M40 A;  4MEZ A;  2OLV A;  3A3D A;  3IXB A;  1PW1 A;  3G4P A;  4DE3 A;  2E8I A;  2ZD8 A;  4L0L A;  4QY5 A;  4WM9 A;  1I2S A;  2ZC3 B;  3UN7 A;  4GKU A;  2XFT A;  1Q2P A;  3A3I A;  1K56 A;  4KG5 A;  5TFQ A;  1DJB A;  4K0W A;  1MWT A;  3UDI A;  1FCM A;  2HDU A;  4EWF A;  4RX3 A;  2PU4 A;  2WZZ A;  3IF6 C;  3N8R A;  3B3X A;  4JXW A;  2RCX A;  2JCH A;  4JF6 A;  4BQM A;  2JC7 A;  1XX2 A;  2WK0 A;  3OZH A;  2Y2H A;  5HAR A;  1PWC A;  3AGD A;  2ZQ9 A;  3N7W A;  4P85 A;  4KZ4 A;  1YLT A;  5FQ9 A;  1L0E A;  3PTE A;  4KZ9 A;  1ES3 A;  1JTD A;  4Y7P A;  3RJU A;  3OC2 A;  3NI9 A;  3V39 A;  3HLG A;  1K4F A;  3MZF A;  2ZQ8 A;  3G31 A;  3NY4 A;  5CHM A;  5DF7 A;  2QMI A;  5HX9 A;  1MKI A;  1SDE A;  5EVI D;  4EQI A;  3UPP A;  1H5X A;  3A3E A;  4OPY A;  5DTS A;  5F1G A;  5FI7 A;  3FKW A;  1ONG A;  2XLN A;  4OQ0 A;  1K54 A;  1GHP A;  2IWB A;  5FQM A;  3HUN A;  3N8S A;  4R3B A;  3QNB A;  1MY8 A;  3DTM A;  4GD6 A;  2JE5 A;  5A92 A;  1SCW A;  2ZQA A;  4WZ5 A;  4JPM A;  5JYO A;  4WZ4 A;  4QU3 A;  5AQ7 A;  4Y0O A;  2Y2G A;  4PM6 A;  2Y2J A;  2EX2 A;  2GDN A;  3JYI A;  2WKI A;  1KE3 A;  3Q81 A;  5GHZ A;  3MFD A;  3P09 A;  2ZC7 A;  4OLG A;  4A5R A;  2V2F F;  4GB7 A;  1GHI A;  3G2Y A;  3AGE A;  4WBG A;  1PZP A;  5FQI A;  2X02 A;  4GD8 A;  4KZ8 A;  2C6W B;  2J9O A;  3V3R A;  1BTL A;  3GR2 A;  5CEB A;  1VM1 A;  1BT5 A;  1KGG A;  3TOI A;  2EXB A;  2XH9 A;  3IXG A;  3MXR A;  5M1A A;  4IVI A;  4OOM A;  1JWZ A;  5FAQ A;  4KZ3 A;  3IF6 B;  1XP4 A;  3IQA A;  3PBO A;  4C75 A;  1FQG A;  4OH0 A;  1I5Q A;  1DJA A;  1JWP A;  1S0W A;  4K0X A;  3GTC A;  4X53 A;  1YMS A;  5FI6 A;  3FKV A;  4BJP A;  2WKE A;  2V20 A;  1G6A A;  3HUO A;  1S6R A;  1NXY A;  4E6X A;  4WYY A;  4BL2 A;  5A91 A;  4OP8 A;  1NJ4 A;  5AQA A;  1Y54 A;  1CEG A;  3VP0 A;  3BEC A;  4GNU A;  5GHX A;  1FCN A;  3V50 A;  2HDS A;  4FH4 A;  5DTT A;  3WS5 A;  1GHM A;  1ZKJ A;  3VP4 A;  3HUM A;  2JBF A;  3N4I A;  3BFC A;  3BFE A;  4S2N C;  1J9M A;  4ZJ1 A;  1ALQ A;  1RP5 A;  1LL9 A;  4OVD A;  3BFF A;  4LCL A;  1AXB A;  1LI0 A;  1WYB A;  2IWC A;  5E43 A;  1YLY A;  4OP5 A;  3ZNT A;  3DWK A;  1TDG A;  4KG2 A;  3OCL A;  1L0G A;  3HLD A;  1BLH A;  2XD5 A;  5IHV A;  5G18 A;  1GA0 A;  4S2J A;  5GLD A;  1NZO A;  4YIN A;  2WGW B;  4BLM A;  2EX8 A;  4S2P A;  4ZBE A;  4CJN A;  1ERM A;  5EPH A;  1L0F A;  1IEM A;  1FR6 A;  2OSU A;  3PBS A;  3Q7Z A;  2XFS A;  1IYP A;  3PAG A;  4R23 A;  4HBT A;  3BLS A;  4ID4 A;  4E3N A;  5FQK A;  2HPB A;  3IWI A;  5HFO A;  2WAD A;  1K4E A;  3IHB A;  3W4O A;  1SHV A;  1PYY A;  3TSG A;  3IH9 A;  2WYX A;  1E3U A;  4KEN B;  4JF4 A;  1DY6 A;  1PIO A;  3E2L A;  1K6S A;  4FSF A;  4EV4 A;  3NCK A;  3MKE A;  2Q9N A;  2XK1 A;  3ZG8 B;  4OPR A;  4U0X A;  3HLB A;  3C4O A;  3PAE A;  2WGI A;  3IF6 A;  4LCM A;  3MKF A;  4Z9Q A;  5EVI B;  5FQJ A;  5A93 A;  1K56 D;  1MWU A;  2HP9 A;  4WMC A;  4BD1 A;  3C5A A;  2WUQ A;  3FWL A;  3M2J A;  5F1F A;  2J7V A;  4M3K A;  1WYC A;  2Y2N A;  4P6B A;  3EQV A;  4ZTK A;  5HAP A;  2XF3 A;  4C3Q A;  2HDR A;  4E3M A;  3VP2 A;  4WEJ A;  3BYD A;  4OQG A;  4OON A;  4OLD A;  1IKI A;  3ZG7 B;  2DCF A;  2C5W B;  3LY3 A;  4JXG A;  4B4X A;  2OLU A;  4KQR A;  3W4Q A;  3C7U A;  2WZX A;  1L0D A;  1YLZ A;  2ZMA A;  3HRE A;  4R4S A;  2A49 A;  4DE0 A;  3ZFZ A;  5GLB A;  3FZC A;  1WE4 A;  4S2M A;  1EI5 A;  3W8K A;  1ERQ A;  4X69 A;  5U47 A;  4NK3 A;  2Y2Q A;  4ZJ2 A;  1FOF A;  2H0T A;  4XXR A;  1CK3 A;  5KSC A;  2EFU A;  4QY6 A;  5DTK A;  1MBL A;  1LL5 A;  1BZA A;  1PWG A;  4C6Y A;  2ZC4 B;  1K57 C;  1W79 A;  2XR0 A;  3UDF A;  5JYP A;  4PM9 A;  5E2G A;  1N9B A;  1CEF A;  1QMF A;  1SKF A;  1DJC A;  1NYM A;  2BLS A;  2XDM A;  3C4P A;  4X68 A;  1BLS A;  3PBQ A;  1MXO A;  3BLM A;  2OV5 A;  1LHY A;  1EWZ A;  2IWD A;  1RCJ A;  1XA1 A;  1KE4 A;  3HL9 A;  3IXD A;  4N1X A;  3WRT A;  3BFG A;  4X6T A;  4EBL A;  4DF6 A;  4UHU A;  1C3B A;  3UE1 A;  1YLJ A;  3QHY A;  3V3S A;  3WS1 A;  3CJM A;  5GHY A;  4WEL A;  4GZB A;  4UAA A;  3UE0 A;  5A90 A;  1KE0 A;  1KGF A;  5HL1 A;  3E2K A;  5EVI A;  5KSH A;  3WWX A;  4NET A;  2H5S A;  3VOY A;  3UO9 A;  1YM1 A;  5FQQ A;  4R4R A;  2DNS A;  1IYO A;  1LLB A;  3HLF A;  1PW8 A;  5FAO A;  2Z2L B;  3ZCZ A;  4UA6 A;  5TGF A;  5EEC A;  3BRM A;  5EVI C;  5M19 A;  4ZAM A;  5DVA A;  2EXA A;  3N6I A;  2A3U A;  2WAF A;  4HEF A;  4JXV A;  4KG6 A;  5BOH A;  3M2K A;  4KQO A;  3SH7 A;  3P98 A;  4LEN A;  5CEC A;  1YT4 A;  1NZU A;  2XQZ A;  4QJG A;  3ITA A;  1W8Q A;  4FH2 A;  4OPZ A;  3MZD A;  1JWV A;  1Q2Q A;  2DRW A;  3VFF A;  1BSG A;  2RL3 A;  4IVK A;  4S2N A;  3HLW A;  1BUL A;  3V5M A;  4JBF A;  3NDE A;  5FA7 A;  1K55 C;  2ZQD A;  5HAI A;  3CZD A;  3SS5 A;  1BLC A;  1FSY A;  4UA7 A;  2HDQ A;  1PI4 A;  5FAP A;  1TDL A;  1KVL A;  3O86 A;  5CHU A;  3PBT A;  5J8X A;  3DW0 A;  1RGZ A;  2X01 A;  2EFX A;  2FFF B;  3GV9 A;  5CTM A;  3SS4 A;  3VOZ A;  4JF5 A;  1IYQ A;  4B4Z A;  3G35 A;  4JLF A;  4S2I A;  2ZM8 A;  5FAT A;  3RXX A;  1O7E A;  3O87 A;  4IBR A;  4E6W A;  5CGS A;  1GA9 A;  4JXS A;  3VP1 A;  1E4D A;  5EVL A;  1YLP A;  3IWO A;  4CPK A;  5F83 A;  3GSG A;  2B5R A;  4WEK A;  3VSL A;  1XXM A;  4OOY A;  1LI9 A;  4E3O A;  5AQ9 A;  5CGW A;  4BL3 A;  1E3U D;  3DWZ A;  3I7J A;  5EE8 A;  3IH8 A;  3PBR A;  4GOG A;  5FSR A;  5L2F A;  1HZO A;  4S2O A;  4EUZ A;  3Q7V B;  3GVB A;  2G2W A;  2HP5 A;  3UE3 A;  4FCF A;  3VP3 A;  2ZJ9 A;  2P9V B;  3MXS A;  2WKH A;  3QNC A;  4RX2 A;  3GRJ A;  2BG1 A;  4X55 A;  5CRF A;  2H10 A; 
#chains in the Genus database with same CATH topology
 2G2U A;  3NEC A;  3OBF A;  2GZA A;  4HBU A;  1U60 A;  1L3L A;  1T1A A;  1ODV A;  2Y91 A;  4JGQ A;  4I38 A;  1XJ2 A;  2PD7 A;  4ETZ A;  2ZC5 B;  5FAS A;  3OOV A;  3CPT B;  4LV3 A;  4EBN A;  3LR3 A;  2EX9 A;  3LCE A;  4OQH A;  1TD5 A;  1ESU A;  1K6R A;  2ZC6 B;  3SH8 A;  1SKO B;  3ZG9 B;  3PBN A;  2B02 A;  5D3O A;  4Y13 A;  5HAQ A;  3UY6 A;  4U3T A;  3KYZ A;  4BBT A;  2PR5 A;  1K25 A;  3S7P A;  1N9N A;  3A0S A;  1KDS A;  4N9L A;  1NYY A;  3LR5 A;  2O99 A;  4IBX A;  4K08 A;  2MJ6 A;  2QPN A;  4WUJ A;  4U0T A;  4IED A;  3MQQ A;  1OTB A;  2FFY A;  3IX3 A;  4DXB A;  1ERO A;  1E25 A;  4OKP A;  4P87 A;  5HW3 A;  1GCE A;  1D7E A;  3BM6 A;  3QP4 A;  3T4L A;  5HSQ A;  2EX6 A;  4S2K A;  3IS2 A;  3ZGA B;  3AGF A;  4KZ6 A;  1IEL A;  5AQB A;  4WF0 A;  1K54 C;  4ZRR A;  3B33 A;  1YLW A;  3IT9 A;  1OME A;  3E4P A;  2ZQ7 A;  4PM5 A;  1SKO A;  5EOO A;  4ME4 A;  1HVB A;  1W5D A;  1HTZ A;  4XT2 A;  2QHK A;  3NC8 A;  4CLC C;  3Q1F A;  3A0R A;  1KDW A;  5KZH A;  4DJ3 A;  3LI8 A;  1FCO A;  3G32 A;  4ETX A;  4EBP A;  1N9O A;  3K3C A;  3O3V A;  4XUX A;  1O07 A;  3LY4 A;  3UDX A;  5HPF A;  4LRY C;  3M6H A;  4HP4 A;  5EV0 A;  4DDS A;  4PHT A;  2HF6 A;  2V1A A;  2P74 A;  3CMZ A;  2GJ3 A;  4BEN A;  1NRF A;  2W0N A;  1ONH A;  4EEU A;  3OPL A;  4DDY A;  2HP6 A;  4Q0J A;  2I72 A;  3UB9 A;  4BMW A;  3ISG A;  3UMD A;  3ULF A;  5IU1 A;  1F98 A;  2ZM0 A;  4P0M A;  3FPV A;  1XGJ A;  5DF8 A;  2PDR A;  3MBZ A;  5I94 A;  2CC1 A;  4MEZ A;  1YSP A;  2VZW A;  4DE3 A;  3F1P B;  4GKU A;  2L0W A;  1OTE A;  5TFQ A;  1MWT A;  1FCM A;  2HDU A;  4EWF A;  4JGO A;  2PU4 A;  3T50 A;  3JVU A;  2Y79 A;  5HAR A;  2O9B A;  4KZ4 A;  3T1R A;  1EW0 A;  3OC2 A;  3HLG A;  3TJZ C;  2ZQ8 A;  1S4R A;  3NY4 A;  5CHM A;  5DF7 A;  4HJ4 A;  5EVI D;  3BW6 A;  3UE6 A;  5EM0 A;  2IWB A;  2XRO A;  5FQM A;  3DTM A;  1SCW A;  2ZQA A;  5AQ7 A;  3C38 A;  1D1J A;  2VA0 A;  5CX7 A;  5GHZ A;  3F1P A;  4OLG A;  3P09 A;  4A5R A;  2HZ5 A;  2K7S A;  3AGE A;  4WL9 A;  2C6W B;  3V3R A;  4AFI A;  3QP5 A;  2EXB A;  1P9R A;  2XH9 A;  5M1A A;  4OOM A;  4QPR A;  5FAQ A;  4KZ3 A;  2FH5 A;  2FZ0 A;  2PYP A;  4K0X A;  4X53 A;  5FI6 A;  5L10 A;  2V20 A;  1NXY A;  1S1Z A;  4BL2 A;  4OP8 A;  5AQA A;  1CEG A;  4G3V A;  3N4I A;  2PR6 A;  4JGP A;  4ZJ1 A;  1ALQ A;  4L9G A;  2IWC A;  4OP5 A;  4KG2 A;  2PRF A;  4QWO A;  2XD5 A;  5IHV A;  4YNR A;  5EFW A;  1NZO A;  4YIN A;  2WGW B;  4BLM A;  1A0K A;  1ERM A;  2PBD P;  3PBS A;  2V8C A;  4NG2 A;  5FQK A;  5HFO A;  1K4E A;  1SHV A;  1PYY A;  2W3F A;  1E3U A;  1PRQ A;  5LBR A;  4FSF A;  2XA7 M;  1PFL A;  3BJN A;  1DP8 A;  4U0X A;  1P0Z A;  5FQJ A;  4WMC A;  2WUQ A;  3NOU C;  2OWJ A;  4P6B A;  5HAP A;  3KSI A;  5FL3 A;  4WEJ A;  4OQG A;  1YLZ A;  3ZFZ A;  5GLB A;  2VX8 A;  4S2M A;  3W8K A;  4X69 A;  3QP6 A;  5U47 A;  1YKD A;  3LI9 A;  2H0T A;  3K3D A;  2EFU A;  1MBL A;  1BZA A;  1PWG A;  1VET B;  4X1M A;  4P6Z S;  4PM9 A;  3FC7 A;  1CEF A;  3UB6 A;  1LHY A;  1EWZ A;  4N1X A;  3IXD A;  1KE4 A;  1XJ3 A;  3UE1 A;  1YLJ A;  3QHY A;  4HJ6 A;  3E4Q A;  2J80 A;  2I9V A;  1UWN X;  4CLC D;  1KE0 A;  5G4Z A;  3VOY A;  2H5S A;  1YM1 A;  2DNS A;  1LLB A;  3MXQ A;  4UEY A;  3BQA A;  4GHI B;  5TGF A;  3BRM A;  5M19 A;  4ZAM A;  5DVA A;  3N6I A;  3F1O B;  5BOH A;  3M2K A;  3SH7 A;  4LEN A;  5CEC A;  1T19 A;  3ITA A;  4OPZ A;  4DJ2 A;  2RL3 A;  3W2Z A;  5K5B A;  3DTK A;  3NDE A;  2KDK A;  5FA7 A;  5HAI A;  3QP8 A;  4UQI S;  1PI4 A;  2BAS A;  1Y28 A;  1VET A;  5FAP A;  2P7J A;  3PBT A;  5J8X A;  2X01 A;  3SS4 A;  1IYQ A;  3KSF A;  3G35 A;  4S2I A;  4GJ4 A;  3RXX A;  1GA9 A;  4CPK A;  2NUP C;  3LIC A;  4FUW A;  2PYR A;  4EQ1 A;  4BL3 A;  2VGL S;  3IH8 A;  5L2F A;  3Q7V B;  2ZJ9 A;  3V67 A;  2P9V B;  3F1O A;  1S67 L;  4F3L B;  2K2N A;  5CRF A;  3D4F A;  4KZA A;  2ZL1 B;  4MNR A;  1OJ5 A;  5F68 A;  4OPQ A;  1ZC2 A;  3PXP A;  2WAE A;  3QP1 A;  3ZVT A;  3KO6 A;  4EEP A;  3LEQ A;  5J4E A;  1ZTU A;  2ZBB A;  3C7V A;  3HVF A;  4O01 A;  2QZ6 A;  5F82 A;  5HZH A;  5EUA A;  5FDH A;  4N92 A;  4LRX C;  4QB8 A;  1XA7 A;  4D2O A;  4KZ7 A;  1FIK A;  4O7D A;  4Y17 A;  1PWD A;  4GN2 A;  3LIB A;  3NDG A;  3ZG0 A;  2HV1 A;  4DE1 A;  4X56 A;  2XEP A;  4ZDX A;  4RYE A;  1JTG A;  3ZDJ A;  2Y2I A;  4PMA A;  2Y2M A;  3JPU A;  5EVE A;  3IF5 A;  3Q7V A;  5DKL A;  3H7W B;  4F94 A;  2P9V A;  2IA2 A;  2JKG A;  1JVJ A;  5L07 A;  4F3L A;  4FD8 A;  1N4O A;  3CAX A;  4E3L A;  5HWT A;  4IHQ A;  2ZL1 A;  1H8Y A;  2PBY A;  5EOE A;  2KOI A;  2WKR A;  3MSH A;  1IYS A;  3M6B A;  3G34 A;  3IX4 A;  2J3T C;  1YQS A;  1X0O A;  1YSQ A;  3NIA A;  3OPP A;  3GMW A;  4H8R A;  4WZ5 C;  3NHQ A;  3UPO A;  4MBK A;  4DE2 A;  3UPN A;  3S22 A;  1TS7 A;  4Y0U A;  1ESI A;  2V1Z A;  4HQA A;  1OPX A;  3S1Y A;  4BWI A;  4N9K A;  4QHC A;  1T1C A;  3FV7 A;  5FEF A;  4MLL A;  5HD3 A;  3H82 B;  3C8C A;  3NOP C;  3VSK A;  1ES5 A;  4XUZ A;  3CUE C;  2Y2O A;  2Z6D A;  1IKG A;  3H7W A;  2R9W A;  3HLC A;  3OLO A;  4Y5F A;  2P08 A;  3SS3 A;  1MPL A;  1J3W A;  1F9I A;  3IBR A;  4QD4 A;  3T4S A;  4KUK A;  4WMC D;  3UME A;  4PPR A;  2VGK A;  2Y4A A;  3T1S A;  2H0Y A;  4BBU A;  1TVF A;  1PNE A;  3HLE A;  4N1H A;  3WS0 A;  5KIZ A;  3A0V A;  1K38 A;  1M40 A;  2OLV A;  3A3D A;  4X25 A;  1PW1 A;  4CLC B;  4JGR A;  4KG5 A;  1DJB A;  3T12 B;  5IS1 A;  3UDI A;  1TS6 A;  3B3X A;  1LT0 A;  2UV0 E;  2JCH A;  2WK0 A;  3UB8 A;  1K0K A;  1CF0 A;  1JTD A;  5G4Y A;  4Y7P A;  3CWF A;  3VOL A;  4B9O A;  2V9A A;  3T4T A;  2QMI A;  2V0U A;  1MKI A;  3UPP A;  2OAQ 1;  2XLN A;  1K54 A;  1GHP A;  4GS9 B;  5I5L A;  2K31 A;  3N8S A;  3QNB A;  4GD6 A;  3PR6 A;  4QU3 A;  3CPT A;  2Y2G A;  4Y3I A;  2PT7 A;  2EX2 A;  3JYI A;  2R78 A;  3Q81 A;  4HOI A;  4CLC A;  3MFD A;  2ZC7 A;  1LSV A;  4GB7 A;  2HGV A;  1PZP A;  4WBG A;  5FQI A;  2X02 A;  4GD8 A;  4YWZ A;  3GR2 A;  3S7O A;  1VM1 A;  3L9K A;  4IVI A;  3T4Q A;  3HJI A;  3UB7 A;  1XP4 A;  5HDS A;  3CLO A;  1FQG A;  4OH0 A;  2ACG A;  1JWP A;  3SZT A;  3FKV A;  4HHD A;  1S6R A;  1NRJ A;  5A91 A;  1NJ4 A;  2G7U A;  3V50 A;  3WS5 A;  1ZKJ A;  3VP4 A;  3BFC A;  1J9M A;  4GS9 A;  1S4S A;  1LI0 A;  1DRM A;  1YLY A;  4Y15 A;  3DWK A;  2B18 A;  1L0G A;  4IUK A;  1BLH A;  2EX8 A;  4S2P A;  5EPH A;  5HWV A;  3Q7Z A;  2XFS A;  4HBT A;  3BLS A;  4ID4 A;  4E3N A;  2HPB A;  3IHB A;  3IH9 A;  3BY8 A;  4KEN B;  3QP2 A;  4EV4 A;  2Q9N A;  2XK1 A;  2W1R A;  3PAE A;  4LCM A;  1MWU A;  3C5A A;  2J7V A;  1WYC A;  3KSG A;  4ZTK A;  2LB9 A;  4E3M A;  3VP2 A;  5HPI A;  3BYD A;  5DFX A;  3D72 A;  2B95 A;  2DCF A;  3EOI A;  4KQR A;  3LFV A;  1NLY A;  2XA7 S;  3DTI A;  1WE4 A;  1ERQ A;  4ZJ2 A;  4XXR A;  1CK3 A;  4QY6 A;  5DTK A;  1LL5 A;  4C6Y A;  2ZC4 B;  1K57 C;  1N9B A;  1QMF A;  2XDM A;  3C4P A;  3O5Y A;  3BLM A;  2IWD A;  1RCJ A;  3WRT A;  3F1N B;  2CMN A;  3G6O A;  4EBL A;  2NUT C;  4HP9 A;  1C3B A;  2J3W A;  4R70 A;  4GZB A;  1KGF A;  2D02 A;  3WWX A;  2M7V A;  5FDS A;  4PAU A;  2AVX A;  2A3U A;  4HEF A;  3DAV A;  4KQO A;  3R7W B;  3B47 A;  2V8F A;  4I5S A;  1YT4 A;  1NZU A;  2PAV P;  2XQZ A;  4FH2 A;  3MZD A;  3LUQ A;  3HLW A;  1K55 C;  1D06 A;  2PD8 A;  1OTI A;  3DW0 A;  4WN5 A;  2L1M A;  1RGZ A;  2EFX A;  4GW9 A;  4JF5 A;  3T4K A;  5TJJ A;  3F1N A;  2D01 A;  1O7E A;  3O87 A;  4IBR A;  4NEE D;  4JXS A;  4EET B;  5EVL A;  3BY9 A;  2W27 A;  3VSL A;  4E3O A;  3ICY A;  3LGO A;  5EM1 A;  5HDD A;  3HJK A;  1HZO A;  4S2O A;  3GVB A;  2G2W A;  2HP5 A;  4O0P A;  2KLI A;  2BG1 A;  4X55 A;  3ZQ5 A;  3R7W A;  5E2H A;  2ZMF A;  1H8Z A;  3A3F A;  4DKI A;  2VKS A;  1PZO A;  1T1B A;  3IHA A;  2ZM2 A;  1V9Y A;  4GDN A;  4LPZ A;  1W7F A;  2Y2L A;  3VV4 A;  5IT5 A;  2O0Y A;  4Q0I A;  2VV6 A;  3VFH A;  4YOF A;  3C30 A;  1FR1 A;  2WGW A;  2X71 A;  3L7H A;  3BFD A;  1I2W A;  3O88 A;  2VGJ A;  2Y2P A;  3NJA A;  1NY0 A;  5HL6 A;  1YMX A;  3A3J A;  5TR7 A;  4R3A A;  3N8L A;  4R0Q A;  3GEC A;  3Q82 A;  4HES A;  1N9L A;  1CI9 A;  1LL8 A;  3OCN A;  3G30 A;  3HBR A;  5GL9 A;  4OOL A;  4Q0H A;  3G2Z A;  3MQO A;  4MN5 A;  3WS4 A;  4ZJ3 A;  3FYZ A;  3ZG5 A;  3OPH A;  3IBJ A;  5AVE A;  2ZLY A;  2A2L A;  3S7N A;  4EU0 A;  2W3H A;  3ITB A;  1JNU A;  4MBH A;  1ZG4 A;  5AJG A;  4KZ5 A;  2J9P A;  1DP9 A;  1ES4 A;  3UNW A;  2V1B A;  5M18 A;  1CJF A;  4CQH A;  2Y2K A;  1H8M A;  4NXF A;  1VQQ A;  1MWR A;  4WLA A;  1SZV A;  1RGY A;  1PI5 A;  2ZQC A;  4OQI A;  4D60 A;  5FI2 A;  4KQQ A;  4DRT A;  4YFM A;  3IWQ A;  3LIA A;  4LV0 A;  4GHI A;  5F5Y A;  1FSW A;  2XGN A;  3TG9 A;  4MMN A;  1CI8 A;  2PU2 A;  5J3W A;  3EQU A;  4DXC A;  5CHJ A;  3UB5 P;  4HI4 A;  4O8G A;  3TE8 A;  4GCZ A;  2UWX A;  3NUL A;  4LRZ E;  3IXB A;  3G4P A;  2E8I A;  2ZD8 A;  1IFQ A;  4L0L A;  1I2S A;  4HH3 A;  3MQ0 A;  3UN7 A;  2XFT A;  3A3I A;  5F6A A;  4HJ3 A;  3KYE A;  4RX3 A;  3IF6 C;  4P6Z M;  3U2A A;  4JXW A;  1NWZ A;  2RCX A;  4JF6 A;  5HWW A;  1STZ A;  2Y2H A;  2O9A A;  1PWC A;  3AGD A;  2ZQ9 A;  3N7W A;  4P85 A;  2HJ9 C;  1YLT A;  3RH8 B;  3PTE A;  4KZ9 A;  4EES A;  3RJU A;  3V39 A;  3NI9 A;  3MS6 A;  5HX9 A;  4IUH A;  4I3A A;  4MDZ A;  4KQD A;  4OPY A;  5DTS A;  5F1G A;  1ONG A;  2LB5 A;  3HUN A;  3LIF A;  4R3B A;  1MY8 A;  5A92 A;  4WZ5 A;  4PM6 A;  2V0W A;  2WKI A;  1KE3 A;  2EWV A;  1TF1 A;  3G2Y A;  2JHE A;  2J9O A;  1BTL A;  4M4X A;  1KGG A;  3MXR A;  1MKM A;  3PBO A;  3CUE A;  5DFY A;  1I5Q A;  1DJA A;  1S0W A;  4BJP A;  2WKE A;  1TS0 A;  3HUO A;  4E6X A;  4WYY A;  1P9W A;  3BEC A;  4GNU A;  5GHX A;  2HDS A;  4FH4 A;  5DTT A;  1GHM A;  2W3E A;  2E8J A;  2JBF A;  1W63 Q;  3BFE A;  4FOF A;  4S2N C;  2EWW A;  4LLO B;  1LL9 A;  4OVD A;  1DP6 A;  4LCL A;  2JN7 A;  1WYB A;  3ZNT A;  1TDG A;  1VB6 A;  3HLD A;  1VEU B;  5DJU A;  5G18 A;  2QWS A;  3IX8 A;  4S2J A;  5GLD A;  4DMZ A;  4L9F A;  1GSW A;  2W3G A;  3MF0 A;  3KX0 X;  3IWI A;  5J7E A;  2WAD A;  3W4O A;  4HH2 A;  1DY6 A;  3DTE A;  2INW A;  3MKE A;  3ZG8 B;  4EXO A;  3HLB A;  3C4O A;  2WGI A;  5A93 A;  1K56 D;  2VJW A;  3FWL A;  3IS2 B;  3H82 A;  1T18 A;  4M3K A;  4Z1W A;  2Y2N A;  3EQV A;  2XF3 A;  4C3Q A;  4MN6 A;  1IKI A;  3ZG7 B;  4G3K A;  4JXG A;  4B4X A;  3W4Q A;  2WZX A;  1L0D A;  2ZMA A;  3HRE A;  4R4S A;  2A49 A;  3FZC A;  4XT2 B;  4NK3 A;  3GDI A;  2YKH A;  1VEU A;  3B42 A;  1S1Y A;  2VEA A;  1W79 A;  3UDF A;  5JYP A;  4H6J B;  1DJC A;  1BLS A;  2Y8H A;  1G5U A;  1XA1 A;  2JKT I;  3R4K A;  4EER A;  2ZOI A;  4X6T A;  4DF6 A;  4UHU A;  3FPW A;  3V3S A;  2A24 B;  3WS1 A;  3SW1 A;  4WEL A;  3UE0 A;  4LFU A;  5HL1 A;  5KSH A;  1IOU A;  3HCY A;  3UO9 A;  4HIA A;  3HLF A;  1PW8 A;  4UA6 A;  3EGD C;  5EEC A;  1OJG A;  2GNX A;  2WAF A;  2HJE A;  3MR0 A;  4ESP A;  1XFQ A;  1JWV A;  1Q2Q A;  4NXE A;  1BSG A;  1W63 M;  3V5M A;  2ZQD A;  1Y4O A;  2OOL A;  3SS5 A;  2HDQ A;  1S66 L;  5CHU A;  1KVL A;  1TDL A;  1UWP X;  4MCW A;  3LIE A;  3LYX A;  3DBA A;  3EEH A;  3H9W A;  4H6J A;  3E4O A;  2FFF B;  4B4Z A;  4JLF A;  2JKF A;  2ZM8 A;  2XRN A;  4R6L A;  1OTA A;  2KX6 A;  4I3J A;  1E4D A;  2A24 A;  3GSG A;  1OT6 A;  1LI9 A;  4I3I A;  5AQ9 A;  5CGW A;  3DWZ A;  3PBR A;  4GOG A;  5FSR A;  5DJT A;  3UE3 A;  2QJ7 A;  3MXS A;  2WKH A;  3GRJ A;  2JKR I;  3LR0 A;  2Q0O A;  2Y55 A;  3LID A;  2Z2M B;  3CG5 A;  5KMW A;  1L2S A;  2QJ5 A;  3MJQ A;  4BBV A;  2VV7 A;  3T1X A;  4R38 A;  1W8Y A;  4ARZ B;  4RVA A;  4E3I A;  1M6K A;  4LV2 A;  3CHW P;  1ZG6 A;  1K57 A;  1ZHH B;  3JVV A;  2Y59 A;  5CGX A;  1KVM A;  4Q8I A;  1ES2 A;  1UGU A;  4NKP A;  1BYW A;  3LO7 A;  5GLA A;  3W4P A;  5CTN A;  4K91 A;  2W3D A;  2J3T D;  3C2W A;  4KUO A;  2J8Y A;  4HNB A;  3OPR A;  3Q07 A;  3ZNY A;  2R9X A;  3ZVW A;  4X1L A;  3VMA A;  4PM7 A;  1XGI A;  3LEZ A;  1H0M A;  1LSX A;  3RXW A;  2VK3 A;  4BD0 A;  4R1G A;  4RA7 A;  2OAP 1;  1MC0 A;  2WGV A;  4LV1 A;  3U4L P;  4KZB A;  3PYP A;  3MMH A;  1GSX A;  3WRZ A;  2DMW A;  2Q9M A;  4S2L A;  3ZHH A;  4GLQ A;  1SDN A;  1Z09 A;  1XPB A;  4ARZ A;  3FG8 A;  4UA9 A;  1HLU P;  1G28 A;  1K55 A;  2VV8 A;  5HDC A;  5CXW A;  1LSW A;  2VLG A;  3NBL A;  3IXH A;  4E3J A;  4PKY G;  1FIL A;  1HD8 A;  4E3K A;  1BUE A;  4PM8 A;  1G68 A;  4GDB A;  4MBF A;  5E2E A;  5E2F A;  1KGE A;  4R3J A;  4Y2F A;  5TBM B;  3EWK A;  4DN0 A;  1BLP A;  5CER A;  1V9Z A;  4JKT A;  4CLC E;  3GQZ A;  1MWS A;  3T4J A;  5DF9 A;  2XD1 A;  5GLC A;  4Y0T A;  4NXB A;  3WS2 A;  4B88 A;  1Z6F A;  1TEM A;  1YPR A;  5CED A;  1QME A;  1P97 A;  2Z6C A;  5AVF A;  3SOI A;  3EEA A;  3MZE A;  3S4X A;  1XKZ A;  3BEB A;  3SH9 A;  4B93 A;  3E0Y A;  3E98 A;  4RQ9 A;  4QY5 A;  4WM9 A;  1YAX A;  2ZC3 B;  3BWL A;  3T1Q B;  1Q2P A;  1K56 A;  4K0W A;  3D3O A;  5TBM A;  3KSH A;  5DKK A;  5A8B A;  2WZZ A;  3N8R A;  4I39 A;  5F69 A;  1OTD A;  1TS8 A;  4BQM A;  2JC7 A;  1XX2 A;  3OZH A;  4II7 A;  5FQ9 A;  1L0E A;  1ES3 A;  3MZF A;  1K4F A;  1OT9 A;  3G31 A;  2P04 A;  1SDE A;  4EQI A;  1H5X A;  3A3E A;  5FI7 A;  3FKW A;  4OQ0 A;  5HD5 A;  3T4O A;  3VE4 A;  2JE5 A;  4JPM A;  5JYO A;  4WZ4 A;  1XJ6 A;  4Y0O A;  3D9Y A;  2Y2J A;  2GDN A;  2JKT M;  2V2F F;  1GHI A;  4KZ8 A;  1WA9 A;  5CEB A;  3TRC A;  1BT5 A;  3TOI A;  3IXG A;  1JWZ A;  3S7Q A;  2WKQ A;  3IF6 B;  1NLZ A;  3IQA A;  4C75 A;  2M7U A;  3GTC A;  1YMS A;  3RTY A;  1G6A A;  1F5M A;  2PHY A;  1Y54 A;  3EGX C;  3VP0 A;  1FCN A;  3PHY A;  2QKP A;  3KYQ A;  2W1T B;  3HUM A;  2BTF P;  2EA9 A;  1RP5 A;  3BFF A;  3LR4 A;  1AXB A;  1H3Q A;  5E43 A;  1XJ4 A;  3OCL A;  2H28 A;  1GA0 A;  1G6O A;  3P01 A;  4ZBE A;  4CJN A;  1L0F A;  1IEM A;  1FR6 A;  2OSU A;  3PAG A;  1IYP A;  4R23 A;  2O9C A;  3TSG A;  2WYX A;  4JF4 A;  1PIO A;  3E2L A;  3MFX A;  1K6S A;  2GX5 A;  3NCK A;  2ZOH A;  4OPR A;  5FEG A;  2YKF A;  3IF6 A;  4Z9Q A;  3MKF A;  5EVI B;  2HP9 A;  4BD1 A;  3M2J A;  5F1F A;  4EUV A;  2HDR A;  3ZYT A;  5L09 A;  2L4R A;  5MC7 A;  2JKR M;  1XFN A;  4OON A;  4LGW A;  4OLD A;  2C5W B;  3LY3 A;  2OLU A;  2W1T A;  3C7U A;  3K2N A;  4FTX A;  4DE0 A;  4E04 A;  1EI5 A;  1VHM A;  4HY8 A;  2Y2Q A;  3VE3 A;  1FOF A;  5KSC A;  4PKY A;  1ACF A;  2XR0 A;  3CIT A;  5E2G A;  1SKF A;  1KOU A;  1NYM A;  2BLS A;  4X68 A;  3PBQ A;  1MXO A;  2OV5 A;  3HL9 A;  5C5K A;  3BFG A;  4IJG A;  3CJM A;  5GHY A;  4UAA A;  5A90 A;  3RFB A;  3E2K A;  5EVI A;  4NET A;  2OWH A;  5FQQ A;  4MN7 A;  4EW7 A;  3CI6 A;  4R4R A;  4UQI M;  1IYO A;  3BQ8 A;  5FAO A;  3ZCZ A;  2Z2L B;  2M1C A;  5EVI C;  4L9E A;  2ZMV A;  2EXA A;  4JXV A;  4KG6 A;  5L8M A;  3P98 A;  3TW8 A;  1MZU A;  3P7N A;  4QJG A;  3NOT C;  1W8Q A;  2DRW A;  3VFF A;  4IVK A;  4S2N A;  1BUL A;  4JBF A;  3CZD A;  1BLC A;  1FSY A;  4UA7 A;  2VGL M;  1CQA A;  3O86 A;  2WKP A;  3GV9 A;  5CTM A;  3VOZ A;  1GSV A;  5FAT A;  4E6W A;  5CGS A;  3VP1 A;  1YLP A;  3IWO A;  5F83 A;  2B5R A;  4WEK A;  1XXM A;  4OOY A;  4G3W A;  1E3U D;  3I7J A;  5EE8 A;  1AWI A;  4EUZ A;  2QYB A;  4FCF A;  3VP3 A;  1F2K A;  3QNC A;  4RX2 A;  2XSS A;  2H10 A;  4NXG A; 
#chains in the Genus database with same CATH homology
 3D4F A;  5E2H A;  2G2U A;  4KZA A;  4HBU A;  1H8Z A;  3A3F A;  1U60 A;  2Y55 A;  4MNR A;  4DKI A;  2Z2M B;  3CG5 A;  5KMW A;  2Y91 A;  1L2S A;  4OPQ A;  2ZC5 B;  5FAS A;  1PZO A;  1ZC2 A;  2WAE A;  3IHA A;  4LV3 A;  3ZVT A;  2ZM2 A;  4EBN A;  1W8Y A;  4GDN A;  2EX9 A;  3LCE A;  4OQH A;  3C7V A;  3HVF A;  4RVA A;  1W7F A;  2QZ6 A;  2Y2L A;  5F82 A;  1ESU A;  1K6R A;  4E3I A;  1M6K A;  2ZC6 B;  3SH8 A;  3ZG9 B;  4LV2 A;  3PBN A;  5HAQ A;  5D3O A;  5EUA A;  3UY6 A;  5FDH A;  4U3T A;  1ZG6 A;  4N92 A;  1K57 A;  4QB8 A;  2Y59 A;  5CGX A;  3VFH A;  1K25 A;  1XA7 A;  4D2O A;  1KVM A;  4KZ7 A;  4Q8I A;  1ES2 A;  1FR1 A;  4O7D A;  1KDS A;  4N9L A;  1PWD A;  2WGW A;  3LO7 A;  4GN2 A;  1NYY A;  2X71 A;  5CTN A;  5GLA A;  3W4P A;  3BFD A;  4K91 A;  1I2W A;  3NDG A;  4IBX A;  3ZG0 A;  3O88 A;  4DE1 A;  2J8Y A;  2QPN A;  2VGJ A;  4X56 A;  2XEP A;  3OPR A;  4ZDX A;  4RYE A;  1JTG A;  2Y2P A;  3Q07 A;  4IED A;  4U0T A;  3ZDJ A;  2Y2I A;  1NY0 A;  4PMA A;  2FFY A;  2Y2M A;  1YMX A;  3A3J A;  4DXB A;  3ZNY A;  3IF5 A;  5TR7 A;  2R9X A;  1ERO A;  3ZVW A;  1E25 A;  3N8L A;  4OKP A;  4PM7 A;  1XGI A;  4P87 A;  3LEZ A;  3Q7V A;  4R0Q A;  3VMA A;  5HW3 A;  1GCE A;  4F94 A;  3Q82 A;  3RXW A;  2P9V A;  4HES A;  3BM6 A;  4BD0 A;  4R1G A;  4RA7 A;  1JVJ A;  1CI9 A;  2EX6 A;  3OCN A;  1N4O A;  2WGV A;  3G30 A;  4FD8 A;  4LV1 A;  4S2K A;  4E3L A;  4KZB A;  3ZGA B;  3HBR A;  5GL9 A;  1H8Y A;  2PBY A;  3AGF A;  4OOL A;  5EOE A;  4KZ6 A;  3G2Z A;  3WRZ A;  2Q9M A;  3WS4 A;  4S2L A;  3ZHH A;  4ZJ3 A;  3FYZ A;  1IEL A;  1SDN A;  5AQB A;  1K54 C;  1IYS A;  3M6B A;  3G34 A;  3ZG5 A;  3OPH A;  1XPB A;  1YLW A;  1YQS A;  3IT9 A;  1OME A;  4UA9 A;  2ZLY A;  3NIA A;  3OPP A;  3GMW A;  1K55 A;  4H8R A;  4WZ5 C;  2ZQ7 A;  4PM5 A;  5CXW A;  3UPO A;  3ITB A;  4MBK A;  4DE2 A;  5EOO A;  3UPN A;  1HVB A;  3NBL A;  3S22 A;  1W5D A;  4Y0U A;  1HTZ A;  3IXH A;  4E3J A;  4MBH A;  1ZG4 A;  1ESI A;  4KZ5 A;  2J9P A;  1HD8 A;  2V1Z A;  4E3K A;  1BUE A;  1ES4 A;  3NC8 A;  4PM8 A;  3UNW A;  1G68 A;  3Q1F A;  3S1Y A;  1KDW A;  4GDB A;  4MBF A;  4N9K A;  4QHC A;  5KZH A;  5M18 A;  5E2E A;  5E2F A;  3FV7 A;  1FCO A;  3G32 A;  4MLL A;  2Y2K A;  4EBP A;  1KGE A;  1VQQ A;  1MWR A;  4R3J A;  3O3V A;  3VSK A;  4XUX A;  1O07 A;  1ES5 A;  1RGY A;  3LY4 A;  1PI5 A;  4XUZ A;  3UDX A;  1BLP A;  5CER A;  3M6H A;  2Y2O A;  2ZQC A;  4JKT A;  4OQI A;  4DDS A;  1IKG A;  2R9W A;  3HLC A;  3GQZ A;  1MWS A;  5FI2 A;  5DF9 A;  4KQQ A;  4DRT A;  4YFM A;  2P74 A;  2XD1 A;  3SS3 A;  1MPL A;  3IWQ A;  3CMZ A;  5GLC A;  4Y0T A;  4BEN A;  1NRF A;  4LV0 A;  1ONH A;  3WS2 A;  4B88 A;  1FSW A;  3OPL A;  4DDY A;  1Z6F A;  2XGN A;  2HP6 A;  3TG9 A;  1CI8 A;  1TEM A;  2I72 A;  4QD4 A;  5CED A;  4WMC D;  1QME A;  2VGK A;  4PPR A;  2PU2 A;  2Y4A A;  2H0Y A;  1TVF A;  3ISG A;  3EQU A;  4DXC A;  5CHJ A;  3SOI A;  3MZE A;  3HLE A;  2ZM0 A;  4N1H A;  4P0M A;  3S4X A;  3WS0 A;  1XKZ A;  1XGJ A;  3BEB A;  3SH9 A;  5DF8 A;  2UWX A;  3MBZ A;  5I94 A;  2CC1 A;  1K38 A;  1M40 A;  4MEZ A;  2OLV A;  3A3D A;  3IXB A;  1PW1 A;  3G4P A;  4DE3 A;  2E8I A;  2ZD8 A;  4L0L A;  4QY5 A;  4WM9 A;  1I2S A;  2ZC3 B;  3UN7 A;  4GKU A;  2XFT A;  1Q2P A;  3A3I A;  1K56 A;  4KG5 A;  5TFQ A;  1DJB A;  4K0W A;  1MWT A;  3UDI A;  1FCM A;  2HDU A;  4EWF A;  4RX3 A;  2PU4 A;  2WZZ A;  3IF6 C;  3N8R A;  3B3X A;  4JXW A;  2RCX A;  2JCH A;  4JF6 A;  4BQM A;  2JC7 A;  1XX2 A;  2WK0 A;  3OZH A;  2Y2H A;  5HAR A;  1PWC A;  3AGD A;  2ZQ9 A;  3N7W A;  4P85 A;  4KZ4 A;  1YLT A;  5FQ9 A;  1L0E A;  3PTE A;  4KZ9 A;  1ES3 A;  1JTD A;  4Y7P A;  3RJU A;  3OC2 A;  3NI9 A;  3V39 A;  3HLG A;  1K4F A;  3MZF A;  2ZQ8 A;  3G31 A;  3NY4 A;  5CHM A;  5DF7 A;  2QMI A;  5HX9 A;  1MKI A;  1SDE A;  5EVI D;  4EQI A;  3UPP A;  1H5X A;  3A3E A;  4OPY A;  5DTS A;  5F1G A;  5FI7 A;  3FKW A;  1ONG A;  2XLN A;  4OQ0 A;  1K54 A;  1GHP A;  2IWB A;  5FQM A;  3HUN A;  3N8S A;  4R3B A;  3QNB A;  1MY8 A;  3DTM A;  4GD6 A;  2JE5 A;  5A92 A;  1SCW A;  2ZQA A;  4WZ5 A;  4JPM A;  5JYO A;  4WZ4 A;  4QU3 A;  5AQ7 A;  4Y0O A;  2Y2G A;  4PM6 A;  2Y2J A;  2EX2 A;  2GDN A;  3JYI A;  2WKI A;  1KE3 A;  3Q81 A;  5GHZ A;  3MFD A;  3P09 A;  2ZC7 A;  4OLG A;  4A5R A;  2V2F F;  4GB7 A;  1GHI A;  3G2Y A;  3AGE A;  4WBG A;  1PZP A;  5FQI A;  2X02 A;  4GD8 A;  4KZ8 A;  2C6W B;  2J9O A;  3V3R A;  1BTL A;  3GR2 A;  5CEB A;  1VM1 A;  1BT5 A;  1KGG A;  3TOI A;  2EXB A;  2XH9 A;  3IXG A;  3MXR A;  5M1A A;  4IVI A;  4OOM A;  1JWZ A;  5FAQ A;  4KZ3 A;  3IF6 B;  1XP4 A;  3IQA A;  3PBO A;  4C75 A;  1FQG A;  4OH0 A;  1I5Q A;  1DJA A;  1JWP A;  1S0W A;  4K0X A;  3GTC A;  4X53 A;  1YMS A;  5FI6 A;  3FKV A;  4BJP A;  2WKE A;  2V20 A;  1G6A A;  3HUO A;  1S6R A;  1NXY A;  4E6X A;  4WYY A;  4BL2 A;  5A91 A;  4OP8 A;  1NJ4 A;  5AQA A;  1Y54 A;  1CEG A;  3VP0 A;  3BEC A;  4GNU A;  5GHX A;  1FCN A;  3V50 A;  2HDS A;  4FH4 A;  5DTT A;  3WS5 A;  1GHM A;  1ZKJ A;  3VP4 A;  3HUM A;  2JBF A;  3N4I A;  3BFC A;  3BFE A;  4S2N C;  1J9M A;  4ZJ1 A;  1ALQ A;  1RP5 A;  1LL9 A;  4OVD A;  3BFF A;  4LCL A;  1AXB A;  1LI0 A;  1WYB A;  2IWC A;  5E43 A;  1YLY A;  4OP5 A;  3ZNT A;  3DWK A;  1TDG A;  4KG2 A;  3OCL A;  1L0G A;  3HLD A;  1BLH A;  2XD5 A;  5IHV A;  5G18 A;  1GA0 A;  4S2J A;  5GLD A;  1NZO A;  4YIN A;  2WGW B;  4BLM A;  2EX8 A;  4S2P A;  4ZBE A;  4CJN A;  1ERM A;  5EPH A;  1L0F A;  1IEM A;  1FR6 A;  2OSU A;  3PBS A;  3Q7Z A;  2XFS A;  1IYP A;  3PAG A;  4R23 A;  4HBT A;  3BLS A;  4ID4 A;  4E3N A;  5FQK A;  2HPB A;  3IWI A;  5HFO A;  2WAD A;  1K4E A;  3IHB A;  3W4O A;  1SHV A;  1PYY A;  3TSG A;  3IH9 A;  2WYX A;  1E3U A;  4KEN B;  4JF4 A;  1DY6 A;  1PIO A;  3E2L A;  1K6S A;  4FSF A;  4EV4 A;  3NCK A;  3MKE A;  2Q9N A;  2XK1 A;  3ZG8 B;  4OPR A;  4U0X A;  3HLB A;  3C4O A;  3PAE A;  2WGI A;  3IF6 A;  4LCM A;  3MKF A;  4Z9Q A;  5EVI B;  5FQJ A;  5A93 A;  1K56 D;  1MWU A;  2HP9 A;  4WMC A;  4BD1 A;  3C5A A;  2WUQ A;  3FWL A;  3M2J A;  5F1F A;  2J7V A;  4M3K A;  1WYC A;  2Y2N A;  4P6B A;  3EQV A;  4ZTK A;  5HAP A;  2XF3 A;  4C3Q A;  2HDR A;  4E3M A;  3VP2 A;  4WEJ A;  3BYD A;  4OQG A;  4OON A;  4OLD A;  1IKI A;  3ZG7 B;  2DCF A;  2C5W B;  3LY3 A;  4JXG A;  4B4X A;  2OLU A;  4KQR A;  3W4Q A;  3C7U A;  2WZX A;  1L0D A;  1YLZ A;  2ZMA A;  3HRE A;  4R4S A;  2A49 A;  4DE0 A;  3ZFZ A;  5GLB A;  3FZC A;  1WE4 A;  4S2M A;  1EI5 A;  3W8K A;  1ERQ A;  4X69 A;  5U47 A;  4NK3 A;  2Y2Q A;  4ZJ2 A;  1FOF A;  2H0T A;  4XXR A;  1CK3 A;  5KSC A;  2EFU A;  4QY6 A;  5DTK A;  1MBL A;  1LL5 A;  1BZA A;  1PWG A;  4C6Y A;  2ZC4 B;  1K57 C;  1W79 A;  2XR0 A;  3UDF A;  5JYP A;  4PM9 A;  5E2G A;  1N9B A;  1CEF A;  1QMF A;  1SKF A;  1DJC A;  1NYM A;  2BLS A;  2XDM A;  3C4P A;  4X68 A;  1BLS A;  3PBQ A;  1MXO A;  3BLM A;  2OV5 A;  1LHY A;  1EWZ A;  2IWD A;  1RCJ A;  1XA1 A;  1KE4 A;  3HL9 A;  3IXD A;  4N1X A;  3WRT A;  3BFG A;  4X6T A;  4EBL A;  4DF6 A;  4UHU A;  1C3B A;  3UE1 A;  1YLJ A;  3QHY A;  3V3S A;  3WS1 A;  3CJM A;  5GHY A;  4WEL A;  4GZB A;  4UAA A;  3UE0 A;  5A90 A;  1KE0 A;  1KGF A;  5HL1 A;  3E2K A;  5EVI A;  5KSH A;  3WWX A;  4NET A;  2H5S A;  3VOY A;  3UO9 A;  1YM1 A;  5FQQ A;  4R4R A;  2DNS A;  1IYO A;  1LLB A;  3HLF A;  1PW8 A;  5FAO A;  2Z2L B;  3ZCZ A;  4UA6 A;  5TGF A;  5EEC A;  3BRM A;  5EVI C;  5M19 A;  4ZAM A;  5DVA A;  2EXA A;  3N6I A;  2A3U A;  2WAF A;  4HEF A;  4JXV A;  4KG6 A;  5BOH A;  3M2K A;  4KQO A;  3SH7 A;  3P98 A;  4LEN A;  5CEC A;  1YT4 A;  1NZU A;  2XQZ A;  4QJG A;  3ITA A;  1W8Q A;  4FH2 A;  4OPZ A;  3MZD A;  1JWV A;  1Q2Q A;  2DRW A;  3VFF A;  1BSG A;  2RL3 A;  4IVK A;  4S2N A;  3HLW A;  1BUL A;  3V5M A;  4JBF A;  3NDE A;  5FA7 A;  1K55 C;  2ZQD A;  5HAI A;  3CZD A;  3SS5 A;  1BLC A;  1FSY A;  4UA7 A;  2HDQ A;  1PI4 A;  5FAP A;  1TDL A;  1KVL A;  3O86 A;  5CHU A;  3PBT A;  5J8X A;  3DW0 A;  1RGZ A;  2X01 A;  2EFX A;  2FFF B;  3GV9 A;  5CTM A;  3SS4 A;  3VOZ A;  4JF5 A;  1IYQ A;  4B4Z A;  3G35 A;  4JLF A;  4S2I A;  2ZM8 A;  5FAT A;  3RXX A;  1O7E A;  3O87 A;  4IBR A;  4E6W A;  5CGS A;  1GA9 A;  4JXS A;  3VP1 A;  1E4D A;  5EVL A;  1YLP A;  3IWO A;  4CPK A;  5F83 A;  3GSG A;  2B5R A;  4WEK A;  3VSL A;  1XXM A;  4OOY A;  1LI9 A;  4E3O A;  5AQ9 A;  5CGW A;  4BL3 A;  1E3U D;  3DWZ A;  3I7J A;  5EE8 A;  3IH8 A;  3PBR A;  4GOG A;  5FSR A;  5L2F A;  1HZO A;  4S2O A;  4EUZ A;  3Q7V B;  3GVB A;  2G2W A;  2HP5 A;  3UE3 A;  4FCF A;  3VP3 A;  2ZJ9 A;  2P9V B;  3MXS A;  2WKH A;  3QNC A;  4RX2 A;  3GRJ A;  2BG1 A;  4X55 A;  5CRF A;  2H10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...