4Y0UA

Crystal structure of 6alpha-hydroxymethylpenicillanate complexed with oxa-58, a carbapenem hydrolyzing class d betalactamase from acinetobacter baumanii.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Active-Site Plasticity Is Essential to Carbapenem Hydrolysis by OXA-58 Class D beta-Lactamase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 73
structure length 242
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4y0uA00
2Y2QA 3LEZA 5E2HA 3NDGA 3SS3A 4KG2A 2R9XA 1VQQA 1BLCA 5HAPA 2JC7A 4CJNA 5FASA 1FQGA 1N9BA 4KZAA 4LCLA 1BLHA 3BFFA 1ES4A 1K57C 3BYDA 4KZ9A 4WEJA 4X55A 3UDXA 3BLMA 3G30A 1H8YA 4OQIA 5EVIB 2WKEA 4XXRA 3BM6A 2V1ZA 4DF6A 4DXBA 4RYEA 3FKVA 3ZG7B 5HX9A 1XA1A 1XX2A 4IBRA 4OKPA 4K0XA 1TDLA 1JVJA 1YLYA 2H0TA 1C3BA 4B88A 4A5RA 5FQMA 1JWPA 4BL2A 1MWUA 1KVMA 2XH9A 3NC8A 4OOLA 3ISGA 1S6RA 3N8LA 4R4RA 3UDIA 4OP5A 4OP8A 1I2SA 1WE4A 3IH9A 4O7DA 1BT5A 3AGFA 3VSKA 4IVIA 2XGNA 3W8KA 4C6YA 3HL9A 4GOGA 1LLBA 1YM1A 1BLPA 2EX2A 3VP1A 2QPNA 2WK0A 3HREA 4PM5A 4QD4A 1FSYA 4UHUA 3O86A 4GN2A 2J8YA 4EUZA 1MWTA 1E3UD 2G2UA 2QZ6A 2WZXA 3IXHA 1KE0A 3PBRA 4DE1A 4E3MA 3PBOA 2HPBA 3BFGA 4KZBA 1KDWA 1YLTA 3G4PA 4KQRA 1DJBA 4UAAA 2B5RA 4KG6A 2HDUA 4LENA 5F1FA 4WZ4A 1W7FA 3WS0A 3DTMA 4WMCD 2Y2HA 2OSUA 4E3OA 4JF4A 4E3IA 4E6XA 1PIOA 4Z9QA 3Q07A 2HP9A 4IBXA 1IKGA 2ZQ7A 3S4XA 2ZQ9A 3QNBA 1RGYA 1BSGA 2C6WB 3G2ZA 3G35A 3Q82A 5I94A 2Y2GA 3S1YA 1K4EA 4S2JA 4NK3A 4JKTA 3IWQA 1K54C 2WUQA 4R23A 1ERMA 3UE0A 4EV4A 3ITBA 3V39A 3W4PA 2Q9NA 3C7VA 3HLBA 3HLFA 2H10A 1K56D 3IHAA 1ERQA 5GL9A 2Y59A 4PPRA 1KGFA 1GHPA 1K6SA 5AQ7A 1KDSA 1NYMA 5F83A 3MXRA 4EBPA 1EI5A 5FI2A 4C3QA 1E4DA 3GMWA 1LL5A 2XD1A 1BULA 1HZOA 3NBLA 3I7JA 4X53A 3A3FA 3UPPA 1QMFA 4JXSA 3Q7VB 3IH8A 1MWSA 2EX6A 5GLAA 1FSWA 4M3KA 1FR6A 2HP6A 5KMWA 1SHVA 3C5AA 1KVLA 3UDFA 2Y91A 2XEPA 3QHYA 4OOYA 4Y7PA 4ID4A 4KENB 1K57A 4X69A 5CERA 3ZG9B 1PZPA 1JWZA 3CJMA 1AXBA 1DJCA 1XP4A 4JLFA 4GB7A 3GTCA 4LV0A 5E43A 1MBLA 3OPRA 3ZVWA 5G18A 4KZ6A 3HLEA 3O3VA 5CHJA 4K91A 4EQIA 1I5QA 5CGXA 3VP0A 3GSGA 4HEFA 4QU3A 2DCFA 2Y2LA 1ESUA 2A49A 4N92A 3Q7ZA 1TDGA 2Q9MA 4OPYA 4E3LA 3SOIA 4FSFA 3ZNYA 3LY4A 2XD5A 2ZC3B 4OONA 3VP2A 3IF5A 3DW0A 3D4FA 1PI5A 2ZQCA 2Y2NA 3PBTA 1O07A 5FQIA 5FQJA 3WRTA 4OPRA 5A90A 3SS4A 2DNSA 4U3TA 4ZJ1A 5CRFA 3GVBA 4MBHA 4JXVA 3PBNA 5GLDA 1WYBA 4RA7A 3IWIA 2XFSA 4KZ5A 4U0TA 1CI8A 1IELA 2H5SA 4HBTA 2XF3A 4PM7A 4P85A 5DTKA 1KE4A 3ZG0A 3PBSA 5CXWA 1BUEA 1FCNA 1XPBA 5EVID 2HDSA 4OQ0A 2J9PA 1W79A 4EWFA 2UWXA 4GZBA 5JYOA 1HD8A 4KQQA 2VGKA 3M2KA 2ZM2A 5CHUA 1L2SA 1SDNA 2WKHA 1NZOA 3CZDA 2H0YA 4JXGA 2HDQA 3WWXA 5M18A 3G32A 4OH0A 3HVFA 4GD6A 4RVAA 3WS2A 3SH7A 1PYYA 5FQKA 4WMCA 2ZD8A 5EOEA 4OOMA 4R4SA 5CEDA 2FFYA 2X71A 1M6KA 4LCMA 1JWVA 3IT9A 3IF6A 3M6HA 1ONGA 4ZDXA 4N1HA 4KZ4A 1K54A 4K0WA 1KE3A 4YINA 5BOHA 5D3OA 2QMIA 1H5XA 3V5MA 4HESA 2HDRA 1LI0A 4B4ZA 1RP5A 1XXMA 3BEBA 1LI9A 3P98A 4JF6A 1K56A 1YQSA 2GDNA 3GV9A 1XKZA 2OLUA 2R9WA 1Q2PA 3OPHA 5J8XA 4DE0A 1LHYA 1VM1A 1CI9A 4JPMA 1NY0A 2EX8A 4S2IA 2EFUA 2WGWA 3QNCA 4JF5A 5DTTA 1DY6A 2Y2PA 5AQBA 4BQMA 3GQZA 1ESIA 4H8RA 4N9LA 3NI9A 3O87A 5EVLA 2ZMAA 3NY4A 3G31A 5M19A 2CC1A 3TOIA 2X02A 4R0QA 4WM9A 2Y2MA 4WZ5A 1OMEA 4ZTKA 2WGIA 4EBNA 1XGIA 3IF6C 5FAQA 3JYIA 4IEDA 4XUXA 1TEMA 1I2WA 5EECA 5A91A 4D2OA 4L0LA 4S2KA 2EX9A 3GRJA 4HBUA 2XQZA 3UY6A 2ZQAA 2E8IA 4S2OA 5DVAA 4OLGA 3G34A 4BJPA 3MXSA 1YLJA 2RL3A 3A3DA 1ZG4A 1PI4A 3A3EA 3DWZA 5GLCA 3RXXA 3SS5A 2Y4AA 2ZC5B 3PTEA 4S2MA 4ZJ3A 3VP4A 4S2LA 4EBLA 1FOFA 4WELA 3HUOA 2PU2A 4BL3A 1K6RA 2P9VA 2JBFA 1QMEA 2DRWA 3WRZA 3HLGA 2ZQDA 1IKIA 4NETA 1GCEA 2Y2KA 3ZNTA 5IHVA 4ZBEA 3HBRA 4GDBA 1NZUA 2Y2IA 5FQ9A 5A93A 4YFMA 3EQUA 1L0EA 3ZG5A 3IXGA 3UPNA 5L2FA 1JTGA 4WZ5C 2IWCA 2FFFB 1ONHA 2ZC6B 4BD0A 3PBQA 4GD8A 4E3KA 3FZCA 3OZHA 1SCWA 4FH2A 2WGWB 4WYYA 1ES3A 2WZZA 1MKIA 3CMZA 3IXDA 3IWOA 2ZM0A 1PW8A 4PM9A 3LCEA 5CTMA 5HARA 1YLWA 3E2LA 4P0MA 5CTNA 1L0GA 1GHIA 3MKFA 4PMAA 4KZ7A 4N9KA 2EXAA 3V3SA 4JXWA 4DDSA 4WEKA 4X6TA 5GHYA 4UA9A 1O7EA 4QY6A 1GA0A 4KG5A 4S2NC 2VGJA 2ZQ8A 1U60A 5FSRA 3MZEA 3RJUA 1XGJA 2WADA 3N8RA 4OPZA 5TGFA 3WS1A 4KZ3A 4PM6A 5HFOA 3A3JA 3FKWA 2WGVA 2ZJ9A 1HVBA 2Z2MB 1K55A 4E3NA 3UE1A 3ZVTA 2WAFA 2HP5A 4QJGA 1WYCA 3FWLA 1Y54A 3N6IA 5FAOA 4CPKA 1EROA 4JBFA 4RX3A 1DJAA 4FCFA 3VFHA 5FDHA 3VFFA 1G6AA 4XUZA 1RCJA 4LV3A 3VP3A 1E3UA 2EFXA 5TFQA 3TSGA 1Q2QA 5EVIC 1GA9A 2P9VB 3MFDA 3MKEA 3N4IA 3M6BA 1ES5A 4DKIA 1PW1A 4GKUA 1HTZA 4Y0OA 5DTSA 1MPLA 5CGSA 4KQOA 2OLVA 3V50A 3PAEA 3OPLA 3TG9A 4BENA 4LV2A 1L0FA 5EE8A 1ZKJA 5HL1A 4RX2A 4DDYA 5F1GA 3SH9A 1CEGA 1TVFA 2XK1A 4X56A 4BD1A 3ZDJA 1PWDA 1W8YA 2V20A 1FCOA 1KGEA 5GHXA 3MZDA 3VSLA 2IWBA 1K55C 4Y0UA 5EOOA 3HUNA 3BLSA 3S22A 5GHZA 3C4PA 1ALQA 2Y2OA 4PM8A 1MY8A 5CGWA 3HLDA 2XLNA 1YT4A 4U0XA 3LO7A 4C75A 5CEBA 1FCMA 3CG5A 5FI7A 4E3JA 3AGEA 3Q1FA 2J7VA 3ZGAB 3IQAA 3P09A 2P74A 4QHCA 3GR2A 3UN7A 3G2YA 4B4XA 3C7UA 3VOZA 4MBKA 3BRMA 1M40A 3Q7VA 4MBFA 2ZLYA 5DF7A 1IEMA 5FA7A 1L0DA 1BZAA 5E2FA 4MNRA 1YLZA 3UPOA 5EVIA 4QY5A 5GLBA 3M2JA 4N1XA 3LY3A 3UE3A 2IWDA 2Y2JA 5E2GA 1PZOA 1IYQA 3OPPA 2ZC7A 4F94A 1IYPA 3N8SA 3HUMA 1E25A 3C4OA 3HLWA 1SKFA 4QB8A 3UO9A 3NIAA 3ZG8B 5A92A 5E2EA 4WBGA 4FH4A 5DF9A 2G2WA 2C5WB 5EPHA 3ZHHA 2ZM8A 5CECA 1NRFA 1Z6FA 3A3IA 3EQVA 4MEZA 4UA7A 1ZG6A 4S2PA 3OCNA 1G68A 3VOYA 3ZFZA 4S2NA 2WKIA 1J9MA 3IF6B 4GDNA 1W8QA 1BTLA 2ZC4B 2EXBA 2J9OA 4R3BA 2V2FF 3AGDA 2Z2LB 4E6WA 4IVKA 1NJ4A 4UA6A 5FAPA 1PWCA 1IYSA 1K38A 1GHMA 3Q81A 3FV7A 3HLCA 5F82A 5AQ9A 1W5DA 1H8ZA 2XDMA 1NYYA 3PAGA 1MXOA 4OQHA 4ZJ2A 4X68A 2PBYA 2JE5A 5KSHA 2JCHA 1MWRA 3WS4A 4FD8A 3OC2A 1SDEA 3N7WA 5M1AA 3BFCA 1S0WA 2BLSA 4GNUA 4Q8IA 4Y0TA 1XA7A 2A3UA 3BFEA 4DRTA 3VMAA 3NDEA 3WS5A 1K4FA 3BECA 4DE2A 5HW3A 5JYPA 4R3JA 1NXYA 1PWGA 2I72A 2X01A 1ZC2A 3DWKA 3UNWA 5KSCA 3NCKA 3W4QA 1EWZA 4ZAMA 1N4OA 1K25A 2XR0A 1ES2A 4BLMA 3FYZA 3IHBA 5FQQA 1KGGA 2XFTA 4LV1A 5FATA 5U47A 4R1GA 2RCXA 5HAQA 1BLSA 1YLPA 2WYXA 1CK3A 1IYOA 1YMXA 5AQAA 3V3RA 4DE3A 3MBZA 5EUAA 4KZ8A 2BG1A 3BFDA 3O88A 4DXCA 5CHMA 2WAEA 3IXBA 3RXWA 3MZFA 2PU4A 4OQGA 4OLDA 2OV5A 3ITAA 4OVDA 1YMSA 4P6BA 2Y55A 4MLLA 5FI6A 3W4OA 1CEFA 5TR7A 5HAIA 1LL9A 4OPQA 3E2KA 4P87A 1RGZA 3OCLA 3B3XA 3ZCZA 1JTDA 5KZHA 1FR1A 5DF8A 3SH8A
chains in the Genus database with same CATH superfamily
3S7QA 5E2HA 4KG2A 1H0MA 1BLCA 1N9BA 1ES4A 4O0PA 1H8YA 2J3WA 4OQIA 2WKEA 4XXRA 2VV6A 5EVEA 4DF6A 4DXBA 3F1PA 4PKYA 1LL8A 4B9OA 4BL2A 2XH9A 1S6RA 4OP8A 3HL9A 4GOGA 1LLBA 1BLPA 1OTAA 5FEFA 3VP1A 2WK0A 1FSYA 4UHUA 3PBRA 4E3MA 2W3FA 3BY8A 2K2NA 2JKGA 4EEPA 5FDSA 3LUQA 4NXFA 4LGWA 4WZ4A 3DTMA 4E3OA 1PIOA 4Z9QA 3Q07A 2HP9A 4NK3A 4JKTA 3IWQA 4XT2A 3UE0A 2KOIA 4CLCA 3C7VA 2H10A 1K56D 5GL9A 4X1LA 2Y59A 4PPRA 1MKMA 1Y4OA 3QP2A 1SKOB 1EI5A 5FI2A 1E4DA 2W1TB 1S4RA 4Q0IA 3A3FA 3UPPA 1QMFA 4O8GA 1FSWA 2HP6A 1KVLA 4RQ9A 2Y91A 3QHYA 4OOYA 4ID4A 3W2ZA 4GB7A 5E43A 2CMNA 1TS8A 4QU3A 2Y2LA 3KSGA 1ESUA 3Q7ZA 3CWFA 1TDGA 2Q9MA 5F6AA 3SOIA 4FSFA 2XD5A 4NKPA 4OONA 2ZQCA 1VB6A 4DMZA 2FZ0A 4ZJ1A 3VE4A 4JGRA 4MBHA 4RA7A 3IWIA 2XFSA 4LRXC 2XF3A 4PM7A 3RH8B 3TE8A 3IX4A 3ZG0A 5EVID 1OT9A 1W79A 3KYZA 2UWXA 3OLOA 5JYOA 5HL6A 3F1OB 1SDNA 2WKHA 3CZDA 2HDQA 4LFUA 4GD6A 3DTIA 5FQKA 4OOMA 4R4SA 3MXQA 3IT9A 5F69A 4YINA 1H5XA 4HESA 1LI0A 3BEBA 3NULA 4JF6A 3GV9A 2R9WA 3OPHA 2XA7M 5J8XA 4WUJA 1LHYA 2EX8A 3QNCA 5IS1A 2Y2PA 4BQMA 2PHYA 1LSXA 3F1NA 2PT7A 3H82B 3NHQA 4N9LA 2O9BA 2V0WA 3NI9A 3G31A 4R0QA 4WM9A 2Y2MA 3IS2B 4ZTKA 2DMWA 1OTEA 3MSHA 2EX9A 2VK3A 3CUEA 4S2OA 3KSIA 3G34A 3UB8A 2RL3A 3BQAA 3SS5A 4S2MA 3VP4A 4WELA 2PU2A 4BL3A 4NXGA 4ETXA 1K6RA 2P9VA 1OPXA 2DRWA 1W63Q 2ZQDA 1IKIA 3ZNTA 3CAXA 4ZBEA 4DJ2A 4PKYG 1NZUA 4X25A 3ZG5A 3IXGA 3K3DA 4WZ5C 2PYRA 2FFFB 4BD0A 3PBQA 3FZCA 3OZHA 1SCWA 2WGWB 4WYYA 5CTMA 2L1MA 2Y8HA 3QP8A 3E2LA 5CEDA 2W3HA 1L0GA 2GNXA 4PMAA 2EXAA 3V3SA 1MC0A 1LT0A 4WEKA 5GHYA 4UA9A 3SW1A 1O7EA 4BMWA 5DJTA 1VEUA 3BW6A 3MZEA 4CLCD 3D9YA 2WGVA 3A0RA 3QP1A 2O0YA 3D72A 5G4YA 3N6IA 4CPKA 1EROA 1XJ3A 4FCFA 3VFHA 3VFFA 5FDHA 1G6AA 3R4KA 1RCJA 2WKQA 3N4IA 4ARZB 1PW1A 1HTZA 2OLVA 3BWLA 3OPLA 5HL1A 4L9EA 4Z1WA 1CEGA 2XK1A 4F3LB 4BD1A 2VKSA 3UE6A 1PWDA 4HJ6A 3C4PA 4PM8A 1MY8A 5CGWA 1YT4A 3L7HA 3LO7A 4JGPA 1FCMA 3CG5A 5FI7A 3BY9A 3KSHA 5DKKA 2J7VA 1DP9A 3HJIA 2OWJA 4B4XA 3VOZA 2INWA 4MBKA 2VEAA 1M40A 4MBFA 2ZLYA 1IEMA 1XFNA 3NOPC 3EEAA 1IYQA 3OPPA 3HUMA 1E25A 1S66L 2QWSA 3CPTA 4FH4A 3CI6A 3ZHHA 3EQVA 3A3IA 1ZG6A 3ZFZA 2WKIA 1J9MA 3TRCA 1W8QA 1BTLA 2J9OA 5HD5A 1NRJA 3LR3A 3PR6A 4IVKA 5FAPA 3UMEA 1GHMA 2V1BA 2VZWA 4OQHA 4G3WA 4X68A 4CLCE 2PBYA 2JCHA 1MWRA 3WS4A 5G4ZA 3OC2A 4GNUA 3NDEA 4Y17A 4DE2A 1NXYA 2X01A 4IHQA 3NCKA 1EWZA 4ZAMA 4MDZA 1N4OA 1ES2A 5FQQA 1GSVA 2XFTA 5F5YA 1BLSA 2PBDP 1SZVA 5AQAA 1NLZA 4NXEA 1T1AA 2K31A 4DXCA 5CHMA 1BYWA 2J3TD 3MZFA 5F68A 3IBRA 4MLLA 4EETB 3W4OA 5TR7A 5HAIA 4D60A 4P87A 1FR1A 1VETA 3SS3A 1VQQA 2JC7A 4LPZA 4CJNA 5FASA 1FQGA 3U2AA 4KZAA 1BLHA 3PXPA 5FL3A 3UDXA 3G30A 3K2NA 3DBAA 4FOFA 4GJ4A 3ZYTA 4RYEA 5L07A 2OAQ1 1XA1A 4K0XA 1TDLA 1JVJA 3CLOA 4B88A 4A5RA 2PR5A 1JWPA 1OT6A 4HIAA 4OOLA 1Z09A 4EEUA 1SKOA 1BT5A 4IVIA 2XGNA 2W1TA 4PM5A 3B42A 2OWHA 5HDDA 2D02A 4IUHA 4EUZA 1MWTA 2G2UA 4DE1A 3BFGA 4KZBA 4HQAA 3G4PA 4KQRA 4UAAA 4KG6A 4MMNA 4LRZE 1LSWA 3EEHA 5HWVA 4WMCD 2Y2HA 2OSUA 4JF4A 4E6XA 2VLGA 4X1MA 1IKGA 1RGYA 3H7WA 2Y2GA 1K4EA 4S2JA 4PAUA 1DP8A 2WUQA 1ERMA 3OOVA 3V39A 3B47A 3IHAA 1ERQA 2LB5A 1KGFA 2BASA 1K6SA 1NYMA 4EBPA 4C3QA 3GMWA 1HZOA 3IBJA 4JXSA 3F1OA 1MWSA 4M3KA 1UWPX 4Y7PA 1K57A 4X69A 2ZOIA 3GTCA 3OPRA 4KZ6A 3HLEA 3O3VA 5CHJA 4K91A 2M7VA 3EWKA 3VP0A 3GSGA 5I5LA 4N92A 3T4QA 1T18A 4E3LA 3VP2A 2L0WA 4I3AA 1PI5A 3PBTA 5FQIA 5A90A 2WKPA 5K5BA 4U3TA 1ACFA 1WYBA 4U0TA 1IELA 4G3KA 4G3VA 3H82A 3UB5P 1BUEA 2HDSA 3IS2A 2PAVP 2VGKA 3M2KA 2P08A 3ICYA 1L2SA 3TJZC 3G32A 4OH0A 2P04A 2W0NA 2UV0E 1OJ5A 3SH7A 2ZD8A 3P7NA 4LCMA 1JWVA 3M6HA 1K54A 1IOUA 5BOHA 2A24B 5D3OA 2Z6CA 4P6ZS 2IA2A 1K0KA 1XXMA 2JKRM 1D06A 1YQSA 1VETB 1VM1A 1CI9A 4JPMA 4S2IA 2WGWA 4JF5A 1CJFA 5DTTA 5AQBA 1ESIA 3O87A 2BTFP 3NY4A 2PR6A 2CC1A 1STZA 4WZ5A 5HSQA 1ODVA 4EBNA 5FAQA 3JYIA 1TEMA 2J80A 3QP5A 5HDCA 2PRFA 3QP6A 4HBUA 2XQZA 3E4PA 4GW9A 1YLJA 1G6OA 1X0OA 2QJ5A 1PI4A 3DWZA 2M7UA 5GLCA 2HV1A 4ZJ3A 4S2LA 3HUOA 5HWWA 4EW7A 4EESA 3FG8A 1QMEA 3WRZA 4ARZA 3HLGA 3JPUA 2GZAA 2Y2KA 2Y2IA 5A93A 4YFMA 3UPNA 5L2FA 3T1QB 4GD8A 3LYXA 4Y2FA 4F3LA 1ES3A 2WZZA 1F98A 3CMZA 3IXDA 4ZDXA 1PW8A 3LCEA 4P0MA 3MKFA 4N9KA 1ZTUA 4JXWA 4DDSA 2OOLA 3CHWP 4X6TA 3MQOA 3UB6A 3RTYA 3H7WB 2ZQ8A 3G6OA 4MN7A 4PM6A 4KUKA 2Z2MB 3T4SA 3UE1A 2WAFA 2WKRA 1WYCA 4JBFA 1DJAA 3HCYA 3H9WA 2V9AA 3TSGA 3NOUC 5EVIC 3M6BA 1ES5A 4GKUA 4KUOA 5CGSA 2ZOHA 1L0FA 4MN6A 4BBVA 4DDYA 5F1GA 3ZDJA 4UQIS 1W8YA 2V20A 1FCOA 4Y0UA 2QHKA 2Q0OA 1ALQA 4U0XA 3T1RA 1UWNX 4EXOA 4ZRRA 3T4OA 4R3AA 2B02A 5AJGA 2P74A 4QHCA 3BRMA 1PFLA 5DF7A 5EM0A 1N9NA 5FA7A 4WL9A 1BZAA 3UPOA 4QY5A 3FC7A 5E2GA 2ZC7A 4F94A 3C4OA 1SKFA 3UO9A 3NIAA 4AFIA 5E2EA 4WBGA 4R38A 4HI4A 2B95A 4UA7A 4MEZA 4S2PA 3OCNA 4HY8A 4S2NA 4HOIA 4GDNA 1T19A 4R3BA 2V2FF 4E6WA 2Z2LB 5EV0A 1PWCA 1TF1A 3HLCA 1W5DA 1H8ZA 2XDMA 1NYYA 3B33A 1G5UA 2JE5A 1V9ZA 1G28A 4Q8IA 4Y0TA 1XA7A 3VMAA 3WS5A 2Y79A 3UNWA 3S7PA 1K25A 5U47A 1DRMA 1YLPA 2WYXA 4P6ZM 3BFDA 3O88A 2WAEA 1P9RA 2PU4A 4GHIA 4CLCC 4QPRA 4P6BA 5L09A 1CQAA 3E4OA 4OPQA 3E2KA 1RGZA 1XJ2A 2PD7A 1PRQA 2NUTC 4WN5A 3LEZA 3NDGA 5HAPA 3LR5A 2KLIA 3ZQ5A 4BBTA 3BFFA 3BYDA 1XFQA 3BLMA 3BM6A 2V1ZA 3ZG7B 3T12B 1F9IA 1C3BA 2NUPC 2A2LA 2PD8A 4R4RA 4OP5A 3VSKA 4O7DA 3AGFA 4GS9B 4C6YA 5MC7A 1YM1A 3HREA 4GLQA 4QD4A 5KIZA 3O86A 2QZ6A 3IXHA 1KE0A 2PYPA 1YLTA 1DJBA 3UB9A 1NLYA 2B5RA 2FH5A 2HDUA 4LENA 4H6JB 4Y5FA 4IBXA 2ZQ7A 3S4XA 2ZQ9A 1IFQA 4BBUA 3QP4A 4R23A 3W4PA 2Q9NA 3HLBA 3HLFA 3E0YA 1GHPA 1KDSA 2QYBA 3IH8A 4YOFA 2EX6A 4UQIM 1SHVA 3C5AA 4HNBA 5CERA 4KENB 1PZPA 1DJCA 4JLFA 3ZVWA 1MBLA 4EQIA 4ETZA 3VV4A 1I5QA 5CGXA 3CUEC 2DCFA 2J3TC 3C30A 4EERA 4OPYA 2A24A 2JKFA 2ZC3B 5DJUA 3DW0A 3D4FA 2Y2NA 1O07A 4HH3A 5FQJA 3WRTA 1D1JA 4OPRA 1N9LA 3SS4A 2V0UA 4JXVA 3PBNA 5GLDA 4KZ5A 4HBTA 2ZL1B 5DTKA 3LR4A 3MFXA 1KE4A 5J7EA 4OQ0A 2M1CA 3DAVA 4GZBA 1HD8A 4KQQA 2ZM2A 5CHUA 1NZOA 3WWXA 4IUKA 3HVFA 1W63M 2VV7A 3WS2A 1PYYA 5HPFA 3LICA 5EOEA 2FFYA 4NXBA 4GHIB 4KZ4A 1KE3A 1A0KA 2HDRA 4B4ZA 2HF6A 1RP5A 3A0VA 1LI9A 3P98A 1K56A 1S67L 3LGOA 2GDNA 3KX0X 1Q2PA 1AWIA 2HGVA 2ZMFA 3GQZA 4H8RA 4UEYA 5L10A 2ZBBA 5EVLA 2ZMAA 5M19A 2W1RA 2X02A 1OMEA 5TBMB 2KDKA 2WGIA 3IF6C 4IEDA 4XUXA 4D2OA 5A91A 4L0LA 4S2KA 1OTDA 3UY6A 2GX5A 4HHDA 4OLGA 4BJPA 3MXSA 3A3DA 2O9CA 1ZG4A 3A3EA 3GDIA 2Y4AA 2ZC5B 3PTEA 1FOFA 3DTEA 2JBFA 4HP9A 4NETA 5IHVA 4GDBA 5FQ9A 1JTGA 2IWCA 1ONHA 3KSFA 4B93A 4E3KA 4FH2A 5EVIA 3UE3A 2W3GA 2ZM0A 1YLWA 5CTNA 4KZ7A 3S7OA 3IX3A 5FEGA 4QY6A 1GA0A 5HZHA 1S1ZA 2XSSA 1ZHHB 3WS1A 5TGFA 4KZ3A 3A3JA 1GSXA 3FKWA 2V1AA 2LB9A 4E3NA 3ZVTA 2Z6DA 2HP5A 5FAOA 3T4JA 4LV3A 3VP3A 3LIFA 1E3UA 1L3LA 2EFXA 3LIAA 3OBFA 3MFDA 3MKEA 5DTSA 1YPRA 1D7EA 4BENA 4K08A 4YNRA 5EE8A 2H28A 4RX2A 3NECA 3HJKA 2VV8A 1KGEA 5GHXA 3MZDA 1K55C 5EFWA 3D3OA 5EOOA 3BLSA 3S22A 5GHZA 1P0ZA 2VJWA 3U4LP 3JVVA 1S4SA 2XLNA 2E8JA 2GJ3A 4I3IA 4C75A 5CEBA 4ME4A 3BQ8A 2PDRA 3AGEA 3LR0A 4HJ3A 5HD3A 1HLUP 3IQAA 2W3EA 3UN7A 3GR2A 3LIDA 3G2YA 3C7UA 3Q7VA 1EW0A 1L0DA 4MNRA 1YLZA 1P97A 5GLBA 4PHTA 2IWDA 1PZOA 4MCWA 1IYPA 3N8SA 3HLWA 3SZTA 3ZG8B 5A92A 5HDSA 5J4EA 2W27A 5DF9A 2C5WB 5EPHA 2ZM8A 2L4RA 3T1XA 3VOYA 2EWVA 5LBRA 2ZC4B 1OTBA 2EXBA 3LIEA 3AGDA 1NJ4A 1K38A 3MS6A 3FV7A 5AQ9A 3PAGA 1MXOA 3K3CA 5KSHA 3N7WA 3BFCA 1S0WA 3E4QA 5HW3A 1K4FA 3BECA 5JYPA 1XJ4A 1PWGA 2I72A 5KSCA 3W4QA 4IJGA 2QKPA 3FYZA 1KGGA 4LV1A 4MN5A 5FATA 4HH2A 2RCXA 5HAQA 4BWIA 1CK3A 3MBZA 5EUAA 4KZ8A 2BG1A 2YKFA 1F2KA 3O5YA 4GS9A 3RFBA 4OQGA 1LSVA 1YMSA 5FI6A 2Y55A 1JNUA 2JKRI 4YWZA 4ESPA 3OCLA 5KZHA 1YSPA 3B3XA 3ZCZA 5DF8A 3SH8A 2Y2QA 2R9XA 3FPVA 4H6JA 4LCLA 1K57C 4WEJA 3C2WA 4KZ9A 4X55A 5EVIB 3FKVA 5HX9A 2XRNA 2G7UA 1XX2A 4IBRA 4OKPA 1YLYA 2H0TA 5FQMA 1MWUA 1KVMA 3NC8A 1DP6A 3ISGA 3N8LA 3UDIA 5AVFA 1I2SA 1WE4A 3IH9A 3W8KA 3GECA 3MQQA 2EX2A 2QPNA 1TS0A 4NEED 1F5MA 3UB7A 4GN2A 2J8YA 4NG2A 5CX7A 2WZXA 1E3UD 1P9WA 3PBOA 5DKLA 2HPBA 1KDWA 5F1FA 1W7FA 3WS0A 5J3WA 4E3IA 3QNBA 1BSGA 2C6WB 3G2ZA 3G35A 3LIBA 3Q82A 5I94A 3S1YA 3LEQA 1KOUA 3F1PB 1K54C 4GCZA 4E04A 4EV4A 3ITBA 3IX8A 3MJQA 5HWTA 2ZL1A 1N9OA 1OJGA 5AQ7A 3C38A 5F83A 3MXRA 1LL5A 2XD1A 1BULA 3NBLA 3I7JA 4EU0A 4X53A 3Q7VB 5GLAA 3C8CA 2ZMVA 1WA9A 1H3QA 2O9AA 1FR6A 5KMWA 2JHEA 3UDFA 2XEPA 3PYPA 3R7WA 4L9FA 3ZG9B 1JWZA 3CJMA 1AXBA 1XP4A 4LV0A 5G18A 4Y13A 1YAXA 4HEFA 2A49A 2VA0A 3S7NA 3ZNYA 3LY4A 1T1CA 3KYQA 2VGLS 4DJ3A 3IF5A 3T1SA 3ULFA 4XT2B 4Y15A 1YKDA 1YSQA 2DNSA 5CRFA 4CLCB 3GVBA 3ZGAB 1CI8A 2H5SA 4P85A 4CQHA 4QWOA 3PBSA 5CXWA 1FCNA 1XPBA 2J9PA 4EWFA 5TBMA 2B18A 1MZUA 2H0YA 4LLOB 4FTXA 4JXGA 5L8MA 5M18A 3TW8A 4RVAA 5EM1A 4WMCA 4JGOA 2X71A 5IU1A 1M6KA 1V9YA 3E98A 1ONGA 3IF6A 4N1HA 4K0WA 5C5KA 4M4XA 2QMIA 3V5MA 4O01A 3T4LA 1UGUA 1XKZA 2OLUA 3V67A 4DE0A 1NY0A 2EFUA 1DY6A 2JKTM 2V8FA 3UMDA 3EGXC 3VE3A 3TOIA 4I3JA 4I5SA 1XGIA 3P01A 2VX8A 5EECA 1I2WA 1NWZA 2I9VA 3GRJA 4L9GA 2ZQAA 2E8IA 5DVAA 3RXXA 4EBLA 4HP4A 4EUVA 4II7A 1VHMA 1GCEA 3HBRA 3EQUA 1L0EA 1TS6A 4WF0A 2ZC6B 4R6LA 3T4KA 5HPIA 4PM9A 1MKIA 3IWOA 5HARA 1S1YA 2HZ5A 1GHIA 3F1NB 4JGQA 3MQ0A 2HJ9C 1TD5A 4KG5A 3LFVA 4S2NC 2VGJA 2AVXA 1U60A 5FSRA 3RJUA 1XGJA 2WADA 3MR0A 3N8RA 4OPZA 5HFOA 3EGDC 2ZJ9A 1HVBA 1K55A 3DTKA 4QJGA 3FWLA 1Y54A 4RX3A 3NJAA 4XUZA 5TFQA 1Q2QA 1GA9A 2P9VB 1H8MA 3KYEA 3LI8A 3CITA 1Y28A 4DKIA 4KQDA 1GSWA 2JKTI 4Y0OA 1MPLA 4HJ4A 4KQOA 3V50A 3PAEA 3T50A 3R7WB 3TG9A 4LV2A 1ZKJA 4Q0JA 3SH9A 1TVFA 1FILA 4X56A 2HJEA 2JN7A 3VSLA 2QJ7A 2IWBA 3A0SA 1PNEA 3HUNA 2XROA 3KO6A 1TS7A 5DFXA 2Y2OA 3HLDA 1VEUB 3EOIA 4E3JA 3Q1FA 5A8BA 4FUWA 3P09A 4DN0A 3BJNA 5E2FA 2OAP1 2V8CA 3LI9A 3VOLA 3M2JA 4N1XA 3LY3A 2Y2JA 2W3DA 5AVEA 2VGLM 1FIKA 2R78A 4QB8A 3JVUA 1XJ6A 3L9KA 2G2WA 1CF0A 3T4TA 5CECA 2O99A 1NRFA 1Z6FA 3NOTC 1G68A 3MMHA 4Y3IA 5IT5A 1J3WA 3IF6B 4I39A 4EQ1A 3MF0A 4Q0HA 2YKHA 2ACGA 4WLAA 4UA6A 1IYSA 5TJJA 3Q81A 5F82A 4ZJ2A 3PHYA 4R70A 4FD8A 1SDEA 2EWWA 2MJ6A 5M1AA 2BLSA 2A3UA 3BFEA 4DRTA 4R3JA 2KX6A 1ZC2A 3DWKA 4LRYC 2K7SA 2P7JA 2XR0A 4BLMA 3IHBA 3FPWA 4R1GA 2XA7S 1OTIA 1IYOA 1YMXA 3V3RA 4DE3A 2D01A 3IXBA 3RXWA 3CPTB 2OV5A 4OLDA 3ITAA 4OVDA 1CEFA 1LL9A 2EA9A 4I38A 5DFYA 1JTDA 1T1BA
chains in the Genus database with same CATH topology
2Y2QA 3LEZA 5E2HA 3NDGA 3SS3A 4KG2A 2R9XA 1VQQA 1BLCA 5HAPA 2JC7A 4CJNA 5FASA 1FQGA 1N9BA 4KZAA 4LCLA 1BLHA 3BFFA 1ES4A 1K57C 3BYDA 4KZ9A 4WEJA 4X55A 3UDXA 3BLMA 3G30A 1H8YA 4OQIA 5EVIB 2WKEA 4XXRA 3BM6A 2V1ZA 4DF6A 4DXBA 4RYEA 3FKVA 3ZG7B 5HX9A 1XA1A 1XX2A 4IBRA 4OKPA 4K0XA 1TDLA 1JVJA 1YLYA 2H0TA 1C3BA 4B88A 4A5RA 5FQMA 1JWPA 4BL2A 1MWUA 1KVMA 2XH9A 3NC8A 4OOLA 3ISGA 1S6RA 3N8LA 4R4RA 3UDIA 4OP5A 4OP8A 1I2SA 1WE4A 3IH9A 4O7DA 1BT5A 3AGFA 3VSKA 4IVIA 2XGNA 3W8KA 4C6YA 3HL9A 4GOGA 1LLBA 1YM1A 1BLPA 2EX2A 3VP1A 2QPNA 2WK0A 3HREA 4PM5A 4QD4A 1FSYA 4UHUA 3O86A 4GN2A 2J8YA 4EUZA 1MWTA 1E3UD 2G2UA 2QZ6A 2WZXA 3IXHA 1KE0A 3PBRA 4DE1A 4E3MA 3PBOA 2HPBA 3BFGA 4KZBA 1KDWA 1YLTA 3G4PA 4KQRA 1DJBA 4UAAA 2B5RA 4KG6A 2HDUA 4LENA 5F1FA 4WZ4A 1W7FA 3WS0A 3DTMA 4WMCD 2Y2HA 2OSUA 4E3OA 4JF4A 4E3IA 4E6XA 1PIOA 4Z9QA 3Q07A 2HP9A 4IBXA 1IKGA 2ZQ7A 3S4XA 2ZQ9A 3QNBA 1RGYA 1BSGA 2C6WB 3G2ZA 3G35A 3Q82A 5I94A 2Y2GA 3S1YA 1K4EA 4S2JA 4NK3A 4JKTA 3IWQA 1K54C 2WUQA 4R23A 1ERMA 3UE0A 4EV4A 3ITBA 3V39A 3W4PA 2Q9NA 3C7VA 3HLBA 3HLFA 2H10A 1K56D 3IHAA 1ERQA 5GL9A 2Y59A 4PPRA 1KGFA 1GHPA 1K6SA 5AQ7A 1KDSA 1NYMA 5F83A 3MXRA 4EBPA 1EI5A 5FI2A 4C3QA 1E4DA 3GMWA 1LL5A 2XD1A 1BULA 1HZOA 3NBLA 3I7JA 4X53A 3A3FA 3UPPA 1QMFA 4JXSA 3Q7VB 3IH8A 1MWSA 2EX6A 5GLAA 1FSWA 4M3KA 1FR6A 2HP6A 5KMWA 1SHVA 3C5AA 1KVLA 3UDFA 2Y91A 2XEPA 3QHYA 4OOYA 4Y7PA 4ID4A 4KENB 1K57A 4X69A 5CERA 3ZG9B 1PZPA 1JWZA 3CJMA 1AXBA 1DJCA 1XP4A 4JLFA 4GB7A 3GTCA 4LV0A 5E43A 1MBLA 3OPRA 3ZVWA 5G18A 4KZ6A 3HLEA 3O3VA 5CHJA 4K91A 4EQIA 1I5QA 5CGXA 3VP0A 3GSGA 4HEFA 4QU3A 2DCFA 2Y2LA 1ESUA 2A49A 4N92A 3Q7ZA 1TDGA 2Q9MA 4OPYA 4E3LA 3SOIA 4FSFA 3ZNYA 3LY4A 2XD5A 2ZC3B 4OONA 3VP2A 3IF5A 3DW0A 3D4FA 1PI5A 2ZQCA 2Y2NA 3PBTA 1O07A 5FQIA 5FQJA 3WRTA 4OPRA 5A90A 3SS4A 2DNSA 4U3TA 4ZJ1A 5CRFA 3GVBA 4MBHA 4JXVA 3PBNA 5GLDA 1WYBA 4RA7A 3IWIA 2XFSA 4KZ5A 4U0TA 1CI8A 1IELA 2H5SA 4HBTA 2XF3A 4PM7A 4P85A 5DTKA 1KE4A 3ZG0A 3PBSA 5CXWA 1BUEA 1FCNA 1XPBA 5EVID 2HDSA 4OQ0A 2J9PA 1W79A 4EWFA 2UWXA 4GZBA 5JYOA 1HD8A 4KQQA 2VGKA 3M2KA 2ZM2A 5CHUA 1L2SA 1SDNA 2WKHA 1NZOA 3CZDA 2H0YA 4JXGA 2HDQA 3WWXA 5M18A 3G32A 4OH0A 3HVFA 4GD6A 4RVAA 3WS2A 3SH7A 1PYYA 5FQKA 4WMCA 2ZD8A 5EOEA 4OOMA 4R4SA 5CEDA 2FFYA 2X71A 1M6KA 4LCMA 1JWVA 3IT9A 3IF6A 3M6HA 1ONGA 4ZDXA 4N1HA 4KZ4A 1K54A 4K0WA 1KE3A 4YINA 5BOHA 5D3OA 2QMIA 1H5XA 3V5MA 4HESA 2HDRA 1LI0A 4B4ZA 1RP5A 1XXMA 3BEBA 1LI9A 3P98A 4JF6A 1K56A 1YQSA 2GDNA 3GV9A 1XKZA 2OLUA 2R9WA 1Q2PA 3OPHA 5J8XA 4DE0A 1LHYA 1VM1A 1CI9A 4JPMA 1NY0A 2EX8A 4S2IA 2EFUA 2WGWA 3QNCA 4JF5A 5DTTA 1DY6A 2Y2PA 5AQBA 4BQMA 3GQZA 1ESIA 4H8RA 4N9LA 3NI9A 3O87A 5EVLA 2ZMAA 3NY4A 3G31A 5M19A 2CC1A 3TOIA 2X02A 4R0QA 4WM9A 2Y2MA 4WZ5A 1OMEA 4ZTKA 2WGIA 4EBNA 1XGIA 3IF6C 5FAQA 3JYIA 4IEDA 4XUXA 1TEMA 1I2WA 5EECA 5A91A 4D2OA 4L0LA 4S2KA 2EX9A 3GRJA 4HBUA 2XQZA 3UY6A 2ZQAA 2E8IA 4S2OA 5DVAA 4OLGA 3G34A 4BJPA 3MXSA 1YLJA 2RL3A 3A3DA 1ZG4A 1PI4A 3A3EA 3DWZA 5GLCA 3RXXA 3SS5A 2Y4AA 2ZC5B 3PTEA 4S2MA 4ZJ3A 3VP4A 4S2LA 4EBLA 1FOFA 4WELA 3HUOA 2PU2A 4BL3A 1K6RA 2P9VA 2JBFA 1QMEA 2DRWA 3WRZA 3HLGA 2ZQDA 1IKIA 4NETA 1GCEA 2Y2KA 3ZNTA 5IHVA 4ZBEA 3HBRA 4GDBA 1NZUA 2Y2IA 5FQ9A 5A93A 4YFMA 3EQUA 1L0EA 3ZG5A 3IXGA 3UPNA 5L2FA 1JTGA 4WZ5C 2IWCA 2FFFB 1ONHA 2ZC6B 4BD0A 3PBQA 4GD8A 4E3KA 3FZCA 3OZHA 1SCWA 4FH2A 2WGWB 4WYYA 1ES3A 2WZZA 1MKIA 3CMZA 3IXDA 3IWOA 2ZM0A 1PW8A 4PM9A 3LCEA 5CTMA 5HARA 1YLWA 3E2LA 4P0MA 5CTNA 1L0GA 1GHIA 3MKFA 4PMAA 4KZ7A 4N9KA 2EXAA 3V3SA 4JXWA 4DDSA 4WEKA 4X6TA 5GHYA 4UA9A 1O7EA 4QY6A 1GA0A 4KG5A 4S2NC 2VGJA 2ZQ8A 1U60A 5FSRA 3MZEA 3RJUA 1XGJA 2WADA 3N8RA 4OPZA 5TGFA 3WS1A 4KZ3A 4PM6A 5HFOA 3A3JA 3FKWA 2WGVA 2ZJ9A 1HVBA 2Z2MB 1K55A 4E3NA 3UE1A 3ZVTA 2WAFA 2HP5A 4QJGA 1WYCA 3FWLA 1Y54A 3N6IA 5FAOA 4CPKA 1EROA 4JBFA 4RX3A 1DJAA 4FCFA 3VFHA 5FDHA 3VFFA 1G6AA 4XUZA 1RCJA 4LV3A 3VP3A 1E3UA 2EFXA 5TFQA 3TSGA 1Q2QA 5EVIC 1GA9A 2P9VB 3MFDA 3MKEA 3N4IA 3M6BA 1ES5A 4DKIA 1PW1A 4GKUA 1HTZA 4Y0OA 5DTSA 1MPLA 5CGSA 4KQOA 2OLVA 3V50A 3PAEA 3OPLA 3TG9A 4BENA 4LV2A 1L0FA 5EE8A 1ZKJA 5HL1A 4RX2A 4DDYA 5F1GA 3SH9A 1CEGA 1TVFA 2XK1A 4X56A 4BD1A 3ZDJA 1PWDA 1W8YA 2V20A 1FCOA 1KGEA 5GHXA 3MZDA 3VSLA 2IWBA 1K55C 4Y0UA 5EOOA 3HUNA 3BLSA 3S22A 5GHZA 3C4PA 1ALQA 2Y2OA 4PM8A 1MY8A 5CGWA 3HLDA 2XLNA 1YT4A 4U0XA 3LO7A 4C75A 5CEBA 1FCMA 3CG5A 5FI7A 4E3JA 3AGEA 3Q1FA 2J7VA 3ZGAB 3IQAA 3P09A 2P74A 4QHCA 3GR2A 3UN7A 3G2YA 4B4XA 3C7UA 3VOZA 4MBKA 3BRMA 1M40A 3Q7VA 4MBFA 2ZLYA 5DF7A 1IEMA 5FA7A 1L0DA 1BZAA 5E2FA 4MNRA 1YLZA 3UPOA 5EVIA 4QY5A 5GLBA 3M2JA 4N1XA 3LY3A 3UE3A 2IWDA 2Y2JA 5E2GA 1PZOA 1IYQA 3OPPA 2ZC7A 4F94A 1IYPA 3N8SA 3HUMA 1E25A 3C4OA 3HLWA 1SKFA 4QB8A 3UO9A 3NIAA 3ZG8B 5A92A 5E2EA 4WBGA 4FH4A 5DF9A 2G2WA 2C5WB 5EPHA 3ZHHA 2ZM8A 5CECA 1NRFA 1Z6FA 3A3IA 3EQVA 4MEZA 4UA7A 1ZG6A 4S2PA 3OCNA 1G68A 3VOYA 3ZFZA 4S2NA 2WKIA 1J9MA 3IF6B 4GDNA 1W8QA 1BTLA 2ZC4B 2EXBA 2J9OA 4R3BA 2V2FF 3AGDA 2Z2LB 4E6WA 4IVKA 1NJ4A 4UA6A 5FAPA 1PWCA 1IYSA 1K38A 1GHMA 3Q81A 3FV7A 3HLCA 5F82A 5AQ9A 1W5DA 1H8ZA 2XDMA 1NYYA 3PAGA 1MXOA 4OQHA 4ZJ2A 4X68A 2PBYA 2JE5A 5KSHA 2JCHA 1MWRA 3WS4A 4FD8A 3OC2A 1SDEA 3N7WA 5M1AA 3BFCA 1S0WA 2BLSA 4GNUA 4Q8IA 4Y0TA 1XA7A 2A3UA 3BFEA 4DRTA 3VMAA 3NDEA 3WS5A 1K4FA 3BECA 4DE2A 5HW3A 5JYPA 4R3JA 1NXYA 1PWGA 2I72A 2X01A 1ZC2A 3DWKA 3UNWA 5KSCA 3NCKA 3W4QA 1EWZA 4ZAMA 1N4OA 1K25A 2XR0A 1ES2A 4BLMA 3FYZA 3IHBA 5FQQA 1KGGA 2XFTA 4LV1A 5FATA 5U47A 4R1GA 2RCXA 5HAQA 1BLSA 1YLPA 2WYXA 1CK3A 1IYOA 1YMXA 5AQAA 3V3RA 4DE3A 3MBZA 5EUAA 4KZ8A 2BG1A 3BFDA 3O88A 4DXCA 5CHMA 2WAEA 3IXBA 3RXWA 3MZFA 2PU4A 4OQGA 4OLDA 2OV5A 3ITAA 4OVDA 1YMSA 4P6BA 2Y55A 4MLLA 5FI6A 3W4OA 1CEFA 5TR7A 5HAIA 1LL9A 4OPQA 3E2KA 4P87A 1RGZA 3OCLA 3B3XA 3ZCZA 1JTDA 5KZHA 1FR1A 5DF8A 3SH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2Q A;  3LEZ A;  5E2H A;  3NDG A;  3SS3 A;  4KG2 A;  2R9X A;  1VQQ A;  1BLC A;  5HAP A;  2JC7 A;  4CJN A;  5FAS A;  1FQG A;  1N9B A;  4KZA A;  4LCL A;  1BLH A;  3BFF A;  1ES4 A;  1K57 C;  3BYD A;  4KZ9 A;  4WEJ A;  4X55 A;  3UDX A;  3BLM A;  3G30 A;  1H8Y A;  4OQI A;  5EVI B;  2WKE A;  4XXR A;  3BM6 A;  2V1Z A;  4DF6 A;  4DXB A;  4RYE A;  3FKV A;  3ZG7 B;  5HX9 A;  1XA1 A;  1XX2 A;  4IBR A;  4OKP A;  4K0X A;  1TDL A;  1JVJ A;  1YLY A;  2H0T A;  1C3B A;  4B88 A;  4A5R A;  5FQM A;  1JWP A;  4BL2 A;  1MWU A;  1KVM A;  2XH9 A;  3NC8 A;  4OOL A;  3ISG A;  1S6R A;  3N8L A;  4R4R A;  3UDI A;  4OP5 A;  4OP8 A;  1I2S A;  1WE4 A;  3IH9 A;  4O7D A;  1BT5 A;  3AGF A;  3VSK A;  4IVI A;  2XGN A;  3W8K A;  4C6Y A;  3HL9 A;  4GOG A;  1LLB A;  1YM1 A;  1BLP A;  2EX2 A;  3VP1 A;  2QPN A;  2WK0 A;  3HRE A;  4PM5 A;  4QD4 A;  1FSY A;  4UHU A;  3O86 A;  4GN2 A;  2J8Y A;  4EUZ A;  1MWT A;  1E3U D;  2G2U A;  2QZ6 A;  2WZX A;  3IXH A;  1KE0 A;  3PBR A;  4DE1 A;  4E3M A;  3PBO A;  2HPB A;  3BFG A;  4KZB A;  1KDW A;  1YLT A;  3G4P A;  4KQR A;  1DJB A;  4UAA A;  2B5R A;  4KG6 A;  2HDU A;  4LEN A;  5F1F A;  4WZ4 A;  1W7F A;  3WS0 A;  3DTM A;  4WMC D;  2Y2H A;  2OSU A;  4E3O A;  4JF4 A;  4E3I A;  4E6X A;  1PIO A;  4Z9Q A;  3Q07 A;  2HP9 A;  4IBX A;  1IKG A;  2ZQ7 A;  3S4X A;  2ZQ9 A;  3QNB A;  1RGY A;  1BSG A;  2C6W B;  3G2Z A;  3G35 A;  3Q82 A;  5I94 A;  2Y2G A;  3S1Y A;  1K4E A;  4S2J A;  4NK3 A;  4JKT A;  3IWQ A;  1K54 C;  2WUQ A;  4R23 A;  1ERM A;  3UE0 A;  4EV4 A;  3ITB A;  3V39 A;  3W4P A;  2Q9N A;  3C7V A;  3HLB A;  3HLF A;  2H10 A;  1K56 D;  3IHA A;  1ERQ A;  5GL9 A;  2Y59 A;  4PPR A;  1KGF A;  1GHP A;  1K6S A;  5AQ7 A;  1KDS A;  1NYM A;  5F83 A;  3MXR A;  4EBP A;  1EI5 A;  5FI2 A;  4C3Q A;  1E4D A;  3GMW A;  1LL5 A;  2XD1 A;  1BUL A;  1HZO A;  3NBL A;  3I7J A;  4X53 A;  3A3F A;  3UPP A;  1QMF A;  4JXS A;  3Q7V B;  3IH8 A;  1MWS A;  2EX6 A;  5GLA A;  1FSW A;  4M3K A;  1FR6 A;  2HP6 A;  5KMW A;  1SHV A;  3C5A A;  1KVL A;  3UDF A;  2Y91 A;  2XEP A;  3QHY A;  4OOY A;  4Y7P A;  4ID4 A;  4KEN B;  1K57 A;  4X69 A;  5CER A;  3ZG9 B;  1PZP A;  1JWZ A;  3CJM A;  1AXB A;  1DJC A;  1XP4 A;  4JLF A;  4GB7 A;  3GTC A;  4LV0 A;  5E43 A;  1MBL A;  3OPR A;  3ZVW A;  5G18 A;  4KZ6 A;  3HLE A;  3O3V A;  5CHJ A;  4K91 A;  4EQI A;  1I5Q A;  5CGX A;  3VP0 A;  3GSG A;  4HEF A;  4QU3 A;  2DCF A;  2Y2L A;  1ESU A;  2A49 A;  4N92 A;  3Q7Z A;  1TDG A;  2Q9M A;  4OPY A;  4E3L A;  3SOI A;  4FSF A;  3ZNY A;  3LY4 A;  2XD5 A;  2ZC3 B;  4OON A;  3VP2 A;  3IF5 A;  3DW0 A;  3D4F A;  1PI5 A;  2ZQC A;  2Y2N A;  3PBT A;  1O07 A;  5FQI A;  5FQJ A;  3WRT A;  4OPR A;  5A90 A;  3SS4 A;  2DNS A;  4U3T A;  4ZJ1 A;  5CRF A;  3GVB A;  4MBH A;  4JXV A;  3PBN A;  5GLD A;  1WYB A;  4RA7 A;  3IWI A;  2XFS A;  4KZ5 A;  4U0T A;  1CI8 A;  1IEL A;  2H5S A;  4HBT A;  2XF3 A;  4PM7 A;  4P85 A;  5DTK A;  1KE4 A;  3ZG0 A;  3PBS A;  5CXW A;  1BUE A;  1FCN A;  1XPB A;  5EVI D;  2HDS A;  4OQ0 A;  2J9P A;  1W79 A;  4EWF A;  2UWX A;  4GZB A;  5JYO A;  1HD8 A;  4KQQ A;  2VGK A;  3M2K A;  2ZM2 A;  5CHU A;  1L2S A;  1SDN A;  2WKH A;  1NZO A;  3CZD A;  2H0Y A;  4JXG A;  2HDQ A;  3WWX A;  5M18 A;  3G32 A;  4OH0 A;  3HVF A;  4GD6 A;  4RVA A;  3WS2 A;  3SH7 A;  1PYY A;  5FQK A;  4WMC A;  2ZD8 A;  5EOE A;  4OOM A;  4R4S A;  5CED A;  2FFY A;  2X71 A;  1M6K A;  4LCM A;  1JWV A;  3IT9 A;  3IF6 A;  3M6H A;  1ONG A;  4ZDX A;  4N1H A;  4KZ4 A;  1K54 A;  4K0W A;  1KE3 A;  4YIN A;  5BOH A;  5D3O A;  2QMI A;  1H5X A;  3V5M A;  4HES A;  2HDR A;  1LI0 A;  4B4Z A;  1RP5 A;  1XXM A;  3BEB A;  1LI9 A;  3P98 A;  4JF6 A;  1K56 A;  1YQS A;  2GDN A;  3GV9 A;  1XKZ A;  2OLU A;  2R9W A;  1Q2P A;  3OPH A;  5J8X A;  4DE0 A;  1LHY A;  1VM1 A;  1CI9 A;  4JPM A;  1NY0 A;  2EX8 A;  4S2I A;  2EFU A;  2WGW A;  3QNC A;  4JF5 A;  5DTT A;  1DY6 A;  2Y2P A;  5AQB A;  4BQM A;  3GQZ A;  1ESI A;  4H8R A;  4N9L A;  3NI9 A;  3O87 A;  5EVL A;  2ZMA A;  3NY4 A;  3G31 A;  5M19 A;  2CC1 A;  3TOI A;  2X02 A;  4R0Q A;  4WM9 A;  2Y2M A;  4WZ5 A;  1OME A;  4ZTK A;  2WGI A;  4EBN A;  1XGI A;  3IF6 C;  5FAQ A;  3JYI A;  4IED A;  4XUX A;  1TEM A;  1I2W A;  5EEC A;  5A91 A;  4D2O A;  4L0L A;  4S2K A;  2EX9 A;  3GRJ A;  4HBU A;  2XQZ A;  3UY6 A;  2ZQA A;  2E8I A;  4S2O A;  5DVA A;  4OLG A;  3G34 A;  4BJP A;  3MXS A;  1YLJ A;  2RL3 A;  3A3D A;  1ZG4 A;  1PI4 A;  3A3E A;  3DWZ A;  5GLC A;  3RXX A;  3SS5 A;  2Y4A A;  2ZC5 B;  3PTE A;  4S2M A;  4ZJ3 A;  3VP4 A;  4S2L A;  4EBL A;  1FOF A;  4WEL A;  3HUO A;  2PU2 A;  4BL3 A;  1K6R A;  2P9V A;  2JBF A;  1QME A;  2DRW A;  3WRZ A;  3HLG A;  2ZQD A;  1IKI A;  4NET A;  1GCE A;  2Y2K A;  3ZNT A;  5IHV A;  4ZBE A;  3HBR A;  4GDB A;  1NZU A;  2Y2I A;  5FQ9 A;  5A93 A;  4YFM A;  3EQU A;  1L0E A;  3ZG5 A;  3IXG A;  3UPN A;  5L2F A;  1JTG A;  4WZ5 C;  2IWC A;  2FFF B;  1ONH A;  2ZC6 B;  4BD0 A;  3PBQ A;  4GD8 A;  4E3K A;  3FZC A;  3OZH A;  1SCW A;  4FH2 A;  2WGW B;  4WYY A;  1ES3 A;  2WZZ A;  1MKI A;  3CMZ A;  3IXD A;  3IWO A;  2ZM0 A;  1PW8 A;  4PM9 A;  3LCE A;  5CTM A;  5HAR A;  1YLW A;  3E2L A;  4P0M A;  5CTN A;  1L0G A;  1GHI A;  3MKF A;  4PMA A;  4KZ7 A;  4N9K A;  2EXA A;  3V3S A;  4JXW A;  4DDS A;  4WEK A;  4X6T A;  5GHY A;  4UA9 A;  1O7E A;  4QY6 A;  1GA0 A;  4KG5 A;  4S2N C;  2VGJ A;  2ZQ8 A;  1U60 A;  5FSR A;  3MZE A;  3RJU A;  1XGJ A;  2WAD A;  3N8R A;  4OPZ A;  5TGF A;  3WS1 A;  4KZ3 A;  4PM6 A;  5HFO A;  3A3J A;  3FKW A;  2WGV A;  2ZJ9 A;  1HVB A;  2Z2M B;  1K55 A;  4E3N A;  3UE1 A;  3ZVT A;  2WAF A;  2HP5 A;  4QJG A;  1WYC A;  3FWL A;  1Y54 A;  3N6I A;  5FAO A;  4CPK A;  1ERO A;  4JBF A;  4RX3 A;  1DJA A;  4FCF A;  3VFH A;  5FDH A;  3VFF A;  1G6A A;  4XUZ A;  1RCJ A;  4LV3 A;  3VP3 A;  1E3U A;  2EFX A;  5TFQ A;  3TSG A;  1Q2Q A;  5EVI C;  1GA9 A;  2P9V B;  3MFD A;  3MKE A;  3N4I A;  3M6B A;  1ES5 A;  4DKI A;  1PW1 A;  4GKU A;  1HTZ A;  4Y0O A;  5DTS A;  1MPL A;  5CGS A;  4KQO A;  2OLV A;  3V50 A;  3PAE A;  3OPL A;  3TG9 A;  4BEN A;  4LV2 A;  1L0F A;  5EE8 A;  1ZKJ A;  5HL1 A;  4RX2 A;  4DDY A;  5F1G A;  3SH9 A;  1CEG A;  1TVF A;  2XK1 A;  4X56 A;  4BD1 A;  3ZDJ A;  1PWD A;  1W8Y A;  2V20 A;  1FCO A;  1KGE A;  5GHX A;  3MZD A;  3VSL A;  2IWB A;  1K55 C;  4Y0U A;  5EOO A;  3HUN A;  3BLS A;  3S22 A;  5GHZ A;  3C4P A;  1ALQ A;  2Y2O A;  4PM8 A;  1MY8 A;  5CGW A;  3HLD A;  2XLN A;  1YT4 A;  4U0X A;  3LO7 A;  4C75 A;  5CEB A;  1FCM A;  3CG5 A;  5FI7 A;  4E3J A;  3AGE A;  3Q1F A;  2J7V A;  3ZGA B;  3IQA A;  3P09 A;  2P74 A;  4QHC A;  3GR2 A;  3UN7 A;  3G2Y A;  4B4X A;  3C7U A;  3VOZ A;  4MBK A;  3BRM A;  1M40 A;  3Q7V A;  4MBF A;  2ZLY A;  5DF7 A;  1IEM A;  5FA7 A;  1L0D A;  1BZA A;  5E2F A;  4MNR A;  1YLZ A;  3UPO A;  5EVI A;  4QY5 A;  5GLB A;  3M2J A;  4N1X A;  3LY3 A;  3UE3 A;  2IWD A;  2Y2J A;  5E2G A;  1PZO A;  1IYQ A;  3OPP A;  2ZC7 A;  4F94 A;  1IYP A;  3N8S A;  3HUM A;  1E25 A;  3C4O A;  3HLW A;  1SKF A;  4QB8 A;  3UO9 A;  3NIA A;  3ZG8 B;  5A92 A;  5E2E A;  4WBG A;  4FH4 A;  5DF9 A;  2G2W A;  2C5W B;  5EPH A;  3ZHH A;  2ZM8 A;  5CEC A;  1NRF A;  1Z6F A;  3A3I A;  3EQV A;  4MEZ A;  4UA7 A;  1ZG6 A;  4S2P A;  3OCN A;  1G68 A;  3VOY A;  3ZFZ A;  4S2N A;  2WKI A;  1J9M A;  3IF6 B;  4GDN A;  1W8Q A;  1BTL A;  2ZC4 B;  2EXB A;  2J9O A;  4R3B A;  2V2F F;  3AGD A;  2Z2L B;  4E6W A;  4IVK A;  1NJ4 A;  4UA6 A;  5FAP A;  1PWC A;  1IYS A;  1K38 A;  1GHM A;  3Q81 A;  3FV7 A;  3HLC A;  5F82 A;  5AQ9 A;  1W5D A;  1H8Z A;  2XDM A;  1NYY A;  3PAG A;  1MXO A;  4OQH A;  4ZJ2 A;  4X68 A;  2PBY A;  2JE5 A;  5KSH A;  2JCH A;  1MWR A;  3WS4 A;  4FD8 A;  3OC2 A;  1SDE A;  3N7W A;  5M1A A;  3BFC A;  1S0W A;  2BLS A;  4GNU A;  4Q8I A;  4Y0T A;  1XA7 A;  2A3U A;  3BFE A;  4DRT A;  3VMA A;  3NDE A;  3WS5 A;  1K4F A;  3BEC A;  4DE2 A;  5HW3 A;  5JYP A;  4R3J A;  1NXY A;  1PWG A;  2I72 A;  2X01 A;  1ZC2 A;  3DWK A;  3UNW A;  5KSC A;  3NCK A;  3W4Q A;  1EWZ A;  4ZAM A;  1N4O A;  1K25 A;  2XR0 A;  1ES2 A;  4BLM A;  3FYZ A;  3IHB A;  5FQQ A;  1KGG A;  2XFT A;  4LV1 A;  5FAT A;  5U47 A;  4R1G A;  2RCX A;  5HAQ A;  1BLS A;  1YLP A;  2WYX A;  1CK3 A;  1IYO A;  1YMX A;  5AQA A;  3V3R A;  4DE3 A;  3MBZ A;  5EUA A;  4KZ8 A;  2BG1 A;  3BFD A;  3O88 A;  4DXC A;  5CHM A;  2WAE A;  3IXB A;  3RXW A;  3MZF A;  2PU4 A;  4OQG A;  4OLD A;  2OV5 A;  3ITA A;  4OVD A;  1YMS A;  4P6B A;  2Y55 A;  4MLL A;  5FI6 A;  3W4O A;  1CEF A;  5TR7 A;  5HAI A;  1LL9 A;  4OPQ A;  3E2K A;  4P87 A;  1RGZ A;  3OCL A;  3B3X A;  3ZCZ A;  1JTD A;  5KZH A;  1FR1 A;  5DF8 A;  3SH8 A; 
#chains in the Genus database with same CATH topology
 3S7Q A;  5E2H A;  4KG2 A;  1H0M A;  1BLC A;  1N9B A;  1ES4 A;  4O0P A;  1H8Y A;  2J3W A;  4OQI A;  2WKE A;  4XXR A;  2VV6 A;  5EVE A;  4DF6 A;  4DXB A;  3F1P A;  4PKY A;  1LL8 A;  4B9O A;  4BL2 A;  2XH9 A;  1S6R A;  4OP8 A;  3HL9 A;  4GOG A;  1LLB A;  1BLP A;  1OTA A;  5FEF A;  3VP1 A;  2WK0 A;  1FSY A;  4UHU A;  3PBR A;  4E3M A;  2W3F A;  3BY8 A;  2K2N A;  2JKG A;  4EEP A;  5FDS A;  3LUQ A;  4NXF A;  4LGW A;  4WZ4 A;  3DTM A;  4E3O A;  1PIO A;  4Z9Q A;  3Q07 A;  2HP9 A;  4NK3 A;  4JKT A;  3IWQ A;  4XT2 A;  3UE0 A;  2KOI A;  4CLC A;  3C7V A;  2H10 A;  1K56 D;  5GL9 A;  4X1L A;  2Y59 A;  4PPR A;  1MKM A;  1Y4O A;  3QP2 A;  1SKO B;  1EI5 A;  5FI2 A;  1E4D A;  2W1T B;  1S4R A;  4Q0I A;  3A3F A;  3UPP A;  1QMF A;  4O8G A;  1FSW A;  2HP6 A;  1KVL A;  4RQ9 A;  2Y91 A;  3QHY A;  4OOY A;  4ID4 A;  3W2Z A;  4GB7 A;  5E43 A;  2CMN A;  1TS8 A;  4QU3 A;  2Y2L A;  3KSG A;  1ESU A;  3Q7Z A;  3CWF A;  1TDG A;  2Q9M A;  5F6A A;  3SOI A;  4FSF A;  2XD5 A;  4NKP A;  4OON A;  2ZQC A;  1VB6 A;  4DMZ A;  2FZ0 A;  4ZJ1 A;  3VE4 A;  4JGR A;  4MBH A;  4RA7 A;  3IWI A;  2XFS A;  4LRX C;  2XF3 A;  4PM7 A;  3RH8 B;  3TE8 A;  3IX4 A;  3ZG0 A;  5EVI D;  1OT9 A;  1W79 A;  3KYZ A;  2UWX A;  3OLO A;  5JYO A;  5HL6 A;  3F1O B;  1SDN A;  2WKH A;  3CZD A;  2HDQ A;  4LFU A;  4GD6 A;  3DTI A;  5FQK A;  4OOM A;  4R4S A;  3MXQ A;  3IT9 A;  5F69 A;  4YIN A;  1H5X A;  4HES A;  1LI0 A;  3BEB A;  3NUL A;  4JF6 A;  3GV9 A;  2R9W A;  3OPH A;  2XA7 M;  5J8X A;  4WUJ A;  1LHY A;  2EX8 A;  3QNC A;  5IS1 A;  2Y2P A;  4BQM A;  2PHY A;  1LSX A;  3F1N A;  2PT7 A;  3H82 B;  3NHQ A;  4N9L A;  2O9B A;  2V0W A;  3NI9 A;  3G31 A;  4R0Q A;  4WM9 A;  2Y2M A;  3IS2 B;  4ZTK A;  2DMW A;  1OTE A;  3MSH A;  2EX9 A;  2VK3 A;  3CUE A;  4S2O A;  3KSI A;  3G34 A;  3UB8 A;  2RL3 A;  3BQA A;  3SS5 A;  4S2M A;  3VP4 A;  4WEL A;  2PU2 A;  4BL3 A;  4NXG A;  4ETX A;  1K6R A;  2P9V A;  1OPX A;  2DRW A;  1W63 Q;  2ZQD A;  1IKI A;  3ZNT A;  3CAX A;  4ZBE A;  4DJ2 A;  4PKY G;  1NZU A;  4X25 A;  3ZG5 A;  3IXG A;  3K3D A;  4WZ5 C;  2PYR A;  2FFF B;  4BD0 A;  3PBQ A;  3FZC A;  3OZH A;  1SCW A;  2WGW B;  4WYY A;  5CTM A;  2L1M A;  2Y8H A;  3QP8 A;  3E2L A;  5CED A;  2W3H A;  1L0G A;  2GNX A;  4PMA A;  2EXA A;  3V3S A;  1MC0 A;  1LT0 A;  4WEK A;  5GHY A;  4UA9 A;  3SW1 A;  1O7E A;  4BMW A;  5DJT A;  1VEU A;  3BW6 A;  3MZE A;  4CLC D;  3D9Y A;  2WGV A;  3A0R A;  3QP1 A;  2O0Y A;  3D72 A;  5G4Y A;  3N6I A;  4CPK A;  1ERO A;  1XJ3 A;  4FCF A;  3VFH A;  3VFF A;  5FDH A;  1G6A A;  3R4K A;  1RCJ A;  2WKQ A;  3N4I A;  4ARZ B;  1PW1 A;  1HTZ A;  2OLV A;  3BWL A;  3OPL A;  5HL1 A;  4L9E A;  4Z1W A;  1CEG A;  2XK1 A;  4F3L B;  4BD1 A;  2VKS A;  3UE6 A;  1PWD A;  4HJ6 A;  3C4P A;  4PM8 A;  1MY8 A;  5CGW A;  1YT4 A;  3L7H A;  3LO7 A;  4JGP A;  1FCM A;  3CG5 A;  5FI7 A;  3BY9 A;  3KSH A;  5DKK A;  2J7V A;  1DP9 A;  3HJI A;  2OWJ A;  4B4X A;  3VOZ A;  2INW A;  4MBK A;  2VEA A;  1M40 A;  4MBF A;  2ZLY A;  1IEM A;  1XFN A;  3NOP C;  3EEA A;  1IYQ A;  3OPP A;  3HUM A;  1E25 A;  1S66 L;  2QWS A;  3CPT A;  4FH4 A;  3CI6 A;  3ZHH A;  3EQV A;  3A3I A;  1ZG6 A;  3ZFZ A;  2WKI A;  1J9M A;  3TRC A;  1W8Q A;  1BTL A;  2J9O A;  5HD5 A;  1NRJ A;  3LR3 A;  3PR6 A;  4IVK A;  5FAP A;  3UME A;  1GHM A;  2V1B A;  2VZW A;  4OQH A;  4G3W A;  4X68 A;  4CLC E;  2PBY A;  2JCH A;  1MWR A;  3WS4 A;  5G4Z A;  3OC2 A;  4GNU A;  3NDE A;  4Y17 A;  4DE2 A;  1NXY A;  2X01 A;  4IHQ A;  3NCK A;  1EWZ A;  4ZAM A;  4MDZ A;  1N4O A;  1ES2 A;  5FQQ A;  1GSV A;  2XFT A;  5F5Y A;  1BLS A;  2PBD P;  1SZV A;  5AQA A;  1NLZ A;  4NXE A;  1T1A A;  2K31 A;  4DXC A;  5CHM A;  1BYW A;  2J3T D;  3MZF A;  5F68 A;  3IBR A;  4MLL A;  4EET B;  3W4O A;  5TR7 A;  5HAI A;  4D60 A;  4P87 A;  1FR1 A;  1VET A;  3SS3 A;  1VQQ A;  2JC7 A;  4LPZ A;  4CJN A;  5FAS A;  1FQG A;  3U2A A;  4KZA A;  1BLH A;  3PXP A;  5FL3 A;  3UDX A;  3G30 A;  3K2N A;  3DBA A;  4FOF A;  4GJ4 A;  3ZYT A;  4RYE A;  5L07 A;  2OAQ 1;  1XA1 A;  4K0X A;  1TDL A;  1JVJ A;  3CLO A;  4B88 A;  4A5R A;  2PR5 A;  1JWP A;  1OT6 A;  4HIA A;  4OOL A;  1Z09 A;  4EEU A;  1SKO A;  1BT5 A;  4IVI A;  2XGN A;  2W1T A;  4PM5 A;  3B42 A;  2OWH A;  5HDD A;  2D02 A;  4IUH A;  4EUZ A;  1MWT A;  2G2U A;  4DE1 A;  3BFG A;  4KZB A;  4HQA A;  3G4P A;  4KQR A;  4UAA A;  4KG6 A;  4MMN A;  4LRZ E;  1LSW A;  3EEH A;  5HWV A;  4WMC D;  2Y2H A;  2OSU A;  4JF4 A;  4E6X A;  2VLG A;  4X1M A;  1IKG A;  1RGY A;  3H7W A;  2Y2G A;  1K4E A;  4S2J A;  4PAU A;  1DP8 A;  2WUQ A;  1ERM A;  3OOV A;  3V39 A;  3B47 A;  3IHA A;  1ERQ A;  2LB5 A;  1KGF A;  2BAS A;  1K6S A;  1NYM A;  4EBP A;  4C3Q A;  3GMW A;  1HZO A;  3IBJ A;  4JXS A;  3F1O A;  1MWS A;  4M3K A;  1UWP X;  4Y7P A;  1K57 A;  4X69 A;  2ZOI A;  3GTC A;  3OPR A;  4KZ6 A;  3HLE A;  3O3V A;  5CHJ A;  4K91 A;  2M7V A;  3EWK A;  3VP0 A;  3GSG A;  5I5L A;  4N92 A;  3T4Q A;  1T18 A;  4E3L A;  3VP2 A;  2L0W A;  4I3A A;  1PI5 A;  3PBT A;  5FQI A;  5A90 A;  2WKP A;  5K5B A;  4U3T A;  1ACF A;  1WYB A;  4U0T A;  1IEL A;  4G3K A;  4G3V A;  3H82 A;  3UB5 P;  1BUE A;  2HDS A;  3IS2 A;  2PAV P;  2VGK A;  3M2K A;  2P08 A;  3ICY A;  1L2S A;  3TJZ C;  3G32 A;  4OH0 A;  2P04 A;  2W0N A;  2UV0 E;  1OJ5 A;  3SH7 A;  2ZD8 A;  3P7N A;  4LCM A;  1JWV A;  3M6H A;  1K54 A;  1IOU A;  5BOH A;  2A24 B;  5D3O A;  2Z6C A;  4P6Z S;  2IA2 A;  1K0K A;  1XXM A;  2JKR M;  1D06 A;  1YQS A;  1VET B;  1VM1 A;  1CI9 A;  4JPM A;  4S2I A;  2WGW A;  4JF5 A;  1CJF A;  5DTT A;  5AQB A;  1ESI A;  3O87 A;  2BTF P;  3NY4 A;  2PR6 A;  2CC1 A;  1STZ A;  4WZ5 A;  5HSQ A;  1ODV A;  4EBN A;  5FAQ A;  3JYI A;  1TEM A;  2J80 A;  3QP5 A;  5HDC A;  2PRF A;  3QP6 A;  4HBU A;  2XQZ A;  3E4P A;  4GW9 A;  1YLJ A;  1G6O A;  1X0O A;  2QJ5 A;  1PI4 A;  3DWZ A;  2M7U A;  5GLC A;  2HV1 A;  4ZJ3 A;  4S2L A;  3HUO A;  5HWW A;  4EW7 A;  4EES A;  3FG8 A;  1QME A;  3WRZ A;  4ARZ A;  3HLG A;  3JPU A;  2GZA A;  2Y2K A;  2Y2I A;  5A93 A;  4YFM A;  3UPN A;  5L2F A;  3T1Q B;  4GD8 A;  3LYX A;  4Y2F A;  4F3L A;  1ES3 A;  2WZZ A;  1F98 A;  3CMZ A;  3IXD A;  4ZDX A;  1PW8 A;  3LCE A;  4P0M A;  3MKF A;  4N9K A;  1ZTU A;  4JXW A;  4DDS A;  2OOL A;  3CHW P;  4X6T A;  3MQO A;  3UB6 A;  3RTY A;  3H7W B;  2ZQ8 A;  3G6O A;  4MN7 A;  4PM6 A;  4KUK A;  2Z2M B;  3T4S A;  3UE1 A;  2WAF A;  2WKR A;  1WYC A;  4JBF A;  1DJA A;  3HCY A;  3H9W A;  2V9A A;  3TSG A;  3NOU C;  5EVI C;  3M6B A;  1ES5 A;  4GKU A;  4KUO A;  5CGS A;  2ZOH A;  1L0F A;  4MN6 A;  4BBV A;  4DDY A;  5F1G A;  3ZDJ A;  4UQI S;  1W8Y A;  2V20 A;  1FCO A;  4Y0U A;  2QHK A;  2Q0O A;  1ALQ A;  4U0X A;  3T1R A;  1UWN X;  4EXO A;  4ZRR A;  3T4O A;  4R3A A;  2B02 A;  5AJG A;  2P74 A;  4QHC A;  3BRM A;  1PFL A;  5DF7 A;  5EM0 A;  1N9N A;  5FA7 A;  4WL9 A;  1BZA A;  3UPO A;  4QY5 A;  3FC7 A;  5E2G A;  2ZC7 A;  4F94 A;  3C4O A;  1SKF A;  3UO9 A;  3NIA A;  4AFI A;  5E2E A;  4WBG A;  4R38 A;  4HI4 A;  2B95 A;  4UA7 A;  4MEZ A;  4S2P A;  3OCN A;  4HY8 A;  4S2N A;  4HOI A;  4GDN A;  1T19 A;  4R3B A;  2V2F F;  4E6W A;  2Z2L B;  5EV0 A;  1PWC A;  1TF1 A;  3HLC A;  1W5D A;  1H8Z A;  2XDM A;  1NYY A;  3B33 A;  1G5U A;  2JE5 A;  1V9Z A;  1G28 A;  4Q8I A;  4Y0T A;  1XA7 A;  3VMA A;  3WS5 A;  2Y79 A;  3UNW A;  3S7P A;  1K25 A;  5U47 A;  1DRM A;  1YLP A;  2WYX A;  4P6Z M;  3BFD A;  3O88 A;  2WAE A;  1P9R A;  2PU4 A;  4GHI A;  4CLC C;  4QPR A;  4P6B A;  5L09 A;  1CQA A;  3E4O A;  4OPQ A;  3E2K A;  1RGZ A;  1XJ2 A;  2PD7 A;  1PRQ A;  2NUT C;  4WN5 A;  3LEZ A;  3NDG A;  5HAP A;  3LR5 A;  2KLI A;  3ZQ5 A;  4BBT A;  3BFF A;  3BYD A;  1XFQ A;  3BLM A;  3BM6 A;  2V1Z A;  3ZG7 B;  3T12 B;  1F9I A;  1C3B A;  2NUP C;  2A2L A;  2PD8 A;  4R4R A;  4OP5 A;  3VSK A;  4O7D A;  3AGF A;  4GS9 B;  4C6Y A;  5MC7 A;  1YM1 A;  3HRE A;  4GLQ A;  4QD4 A;  5KIZ A;  3O86 A;  2QZ6 A;  3IXH A;  1KE0 A;  2PYP A;  1YLT A;  1DJB A;  3UB9 A;  1NLY A;  2B5R A;  2FH5 A;  2HDU A;  4LEN A;  4H6J B;  4Y5F A;  4IBX A;  2ZQ7 A;  3S4X A;  2ZQ9 A;  1IFQ A;  4BBU A;  3QP4 A;  4R23 A;  3W4P A;  2Q9N A;  3HLB A;  3HLF A;  3E0Y A;  1GHP A;  1KDS A;  2QYB A;  3IH8 A;  4YOF A;  2EX6 A;  4UQI M;  1SHV A;  3C5A A;  4HNB A;  5CER A;  4KEN B;  1PZP A;  1DJC A;  4JLF A;  3ZVW A;  1MBL A;  4EQI A;  4ETZ A;  3VV4 A;  1I5Q A;  5CGX A;  3CUE C;  2DCF A;  2J3T C;  3C30 A;  4EER A;  4OPY A;  2A24 A;  2JKF A;  2ZC3 B;  5DJU A;  3DW0 A;  3D4F A;  2Y2N A;  1O07 A;  4HH3 A;  5FQJ A;  3WRT A;  1D1J A;  4OPR A;  1N9L A;  3SS4 A;  2V0U A;  4JXV A;  3PBN A;  5GLD A;  4KZ5 A;  4HBT A;  2ZL1 B;  5DTK A;  3LR4 A;  3MFX A;  1KE4 A;  5J7E A;  4OQ0 A;  2M1C A;  3DAV A;  4GZB A;  1HD8 A;  4KQQ A;  2ZM2 A;  5CHU A;  1NZO A;  3WWX A;  4IUK A;  3HVF A;  1W63 M;  2VV7 A;  3WS2 A;  1PYY A;  5HPF A;  3LIC A;  5EOE A;  2FFY A;  4NXB A;  4GHI B;  4KZ4 A;  1KE3 A;  1A0K A;  2HDR A;  4B4Z A;  2HF6 A;  1RP5 A;  3A0V A;  1LI9 A;  3P98 A;  1K56 A;  1S67 L;  3LGO A;  2GDN A;  3KX0 X;  1Q2P A;  1AWI A;  2HGV A;  2ZMF A;  3GQZ A;  4H8R A;  4UEY A;  5L10 A;  2ZBB A;  5EVL A;  2ZMA A;  5M19 A;  2W1R A;  2X02 A;  1OME A;  5TBM B;  2KDK A;  2WGI A;  3IF6 C;  4IED A;  4XUX A;  4D2O A;  5A91 A;  4L0L A;  4S2K A;  1OTD A;  3UY6 A;  2GX5 A;  4HHD A;  4OLG A;  4BJP A;  3MXS A;  3A3D A;  2O9C A;  1ZG4 A;  3A3E A;  3GDI A;  2Y4A A;  2ZC5 B;  3PTE A;  1FOF A;  3DTE A;  2JBF A;  4HP9 A;  4NET A;  5IHV A;  4GDB A;  5FQ9 A;  1JTG A;  2IWC A;  1ONH A;  3KSF A;  4B93 A;  4E3K A;  4FH2 A;  5EVI A;  3UE3 A;  2W3G A;  2ZM0 A;  1YLW A;  5CTN A;  4KZ7 A;  3S7O A;  3IX3 A;  5FEG A;  4QY6 A;  1GA0 A;  5HZH A;  1S1Z A;  2XSS A;  1ZHH B;  3WS1 A;  5TGF A;  4KZ3 A;  3A3J A;  1GSX A;  3FKW A;  2V1A A;  2LB9 A;  4E3N A;  3ZVT A;  2Z6D A;  2HP5 A;  5FAO A;  3T4J A;  4LV3 A;  3VP3 A;  3LIF A;  1E3U A;  1L3L A;  2EFX A;  3LIA A;  3OBF A;  3MFD A;  3MKE A;  5DTS A;  1YPR A;  1D7E A;  4BEN A;  4K08 A;  4YNR A;  5EE8 A;  2H28 A;  4RX2 A;  3NEC A;  3HJK A;  2VV8 A;  1KGE A;  5GHX A;  3MZD A;  1K55 C;  5EFW A;  3D3O A;  5EOO A;  3BLS A;  3S22 A;  5GHZ A;  1P0Z A;  2VJW A;  3U4L P;  3JVV A;  1S4S A;  2XLN A;  2E8J A;  2GJ3 A;  4I3I A;  4C75 A;  5CEB A;  4ME4 A;  3BQ8 A;  2PDR A;  3AGE A;  3LR0 A;  4HJ3 A;  5HD3 A;  1HLU P;  3IQA A;  2W3E A;  3UN7 A;  3GR2 A;  3LID A;  3G2Y A;  3C7U A;  3Q7V A;  1EW0 A;  1L0D A;  4MNR A;  1YLZ A;  1P97 A;  5GLB A;  4PHT A;  2IWD A;  1PZO A;  4MCW A;  1IYP A;  3N8S A;  3HLW A;  3SZT A;  3ZG8 B;  5A92 A;  5HDS A;  5J4E A;  2W27 A;  5DF9 A;  2C5W B;  5EPH A;  2ZM8 A;  2L4R A;  3T1X A;  3VOY A;  2EWV A;  5LBR A;  2ZC4 B;  1OTB A;  2EXB A;  3LIE A;  3AGD A;  1NJ4 A;  1K38 A;  3MS6 A;  3FV7 A;  5AQ9 A;  3PAG A;  1MXO A;  3K3C A;  5KSH A;  3N7W A;  3BFC A;  1S0W A;  3E4Q A;  5HW3 A;  1K4F A;  3BEC A;  5JYP A;  1XJ4 A;  1PWG A;  2I72 A;  5KSC A;  3W4Q A;  4IJG A;  2QKP A;  3FYZ A;  1KGG A;  4LV1 A;  4MN5 A;  5FAT A;  4HH2 A;  2RCX A;  5HAQ A;  4BWI A;  1CK3 A;  3MBZ A;  5EUA A;  4KZ8 A;  2BG1 A;  2YKF A;  1F2K A;  3O5Y A;  4GS9 A;  3RFB A;  4OQG A;  1LSV A;  1YMS A;  5FI6 A;  2Y55 A;  1JNU A;  2JKR I;  4YWZ A;  4ESP A;  3OCL A;  5KZH A;  1YSP A;  3B3X A;  3ZCZ A;  5DF8 A;  3SH8 A;  2Y2Q A;  2R9X A;  3FPV A;  4H6J A;  4LCL A;  1K57 C;  4WEJ A;  3C2W A;  4KZ9 A;  4X55 A;  5EVI B;  3FKV A;  5HX9 A;  2XRN A;  2G7U A;  1XX2 A;  4IBR A;  4OKP A;  1YLY A;  2H0T A;  5FQM A;  1MWU A;  1KVM A;  3NC8 A;  1DP6 A;  3ISG A;  3N8L A;  3UDI A;  5AVF A;  1I2S A;  1WE4 A;  3IH9 A;  3W8K A;  3GEC A;  3MQQ A;  2EX2 A;  2QPN A;  1TS0 A;  4NEE D;  1F5M A;  3UB7 A;  4GN2 A;  2J8Y A;  4NG2 A;  5CX7 A;  2WZX A;  1E3U D;  1P9W A;  3PBO A;  5DKL A;  2HPB A;  1KDW A;  5F1F A;  1W7F A;  3WS0 A;  5J3W A;  4E3I A;  3QNB A;  1BSG A;  2C6W B;  3G2Z A;  3G35 A;  3LIB A;  3Q82 A;  5I94 A;  3S1Y A;  3LEQ A;  1KOU A;  3F1P B;  1K54 C;  4GCZ A;  4E04 A;  4EV4 A;  3ITB A;  3IX8 A;  3MJQ A;  5HWT A;  2ZL1 A;  1N9O A;  1OJG A;  5AQ7 A;  3C38 A;  5F83 A;  3MXR A;  1LL5 A;  2XD1 A;  1BUL A;  3NBL A;  3I7J A;  4EU0 A;  4X53 A;  3Q7V B;  5GLA A;  3C8C A;  2ZMV A;  1WA9 A;  1H3Q A;  2O9A A;  1FR6 A;  5KMW A;  2JHE A;  3UDF A;  2XEP A;  3PYP A;  3R7W A;  4L9F A;  3ZG9 B;  1JWZ A;  3CJM A;  1AXB A;  1XP4 A;  4LV0 A;  5G18 A;  4Y13 A;  1YAX A;  4HEF A;  2A49 A;  2VA0 A;  3S7N A;  3ZNY A;  3LY4 A;  1T1C A;  3KYQ A;  2VGL S;  4DJ3 A;  3IF5 A;  3T1S A;  3ULF A;  4XT2 B;  4Y15 A;  1YKD A;  1YSQ A;  2DNS A;  5CRF A;  4CLC B;  3GVB A;  3ZGA B;  1CI8 A;  2H5S A;  4P85 A;  4CQH A;  4QWO A;  3PBS A;  5CXW A;  1FCN A;  1XPB A;  2J9P A;  4EWF A;  5TBM A;  2B18 A;  1MZU A;  2H0Y A;  4LLO B;  4FTX A;  4JXG A;  5L8M A;  5M18 A;  3TW8 A;  4RVA A;  5EM1 A;  4WMC A;  4JGO A;  2X71 A;  5IU1 A;  1M6K A;  1V9Y A;  3E98 A;  1ONG A;  3IF6 A;  4N1H A;  4K0W A;  5C5K A;  4M4X A;  2QMI A;  3V5M A;  4O01 A;  3T4L A;  1UGU A;  1XKZ A;  2OLU A;  3V67 A;  4DE0 A;  1NY0 A;  2EFU A;  1DY6 A;  2JKT M;  2V8F A;  3UMD A;  3EGX C;  3VE3 A;  3TOI A;  4I3J A;  4I5S A;  1XGI A;  3P01 A;  2VX8 A;  5EEC A;  1I2W A;  1NWZ A;  2I9V A;  3GRJ A;  4L9G A;  2ZQA A;  2E8I A;  5DVA A;  3RXX A;  4EBL A;  4HP4 A;  4EUV A;  4II7 A;  1VHM A;  1GCE A;  3HBR A;  3EQU A;  1L0E A;  1TS6 A;  4WF0 A;  2ZC6 B;  4R6L A;  3T4K A;  5HPI A;  4PM9 A;  1MKI A;  3IWO A;  5HAR A;  1S1Y A;  2HZ5 A;  1GHI A;  3F1N B;  4JGQ A;  3MQ0 A;  2HJ9 C;  1TD5 A;  4KG5 A;  3LFV A;  4S2N C;  2VGJ A;  2AVX A;  1U60 A;  5FSR A;  3RJU A;  1XGJ A;  2WAD A;  3MR0 A;  3N8R A;  4OPZ A;  5HFO A;  3EGD C;  2ZJ9 A;  1HVB A;  1K55 A;  3DTK A;  4QJG A;  3FWL A;  1Y54 A;  4RX3 A;  3NJA A;  4XUZ A;  5TFQ A;  1Q2Q A;  1GA9 A;  2P9V B;  1H8M A;  3KYE A;  3LI8 A;  3CIT A;  1Y28 A;  4DKI A;  4KQD A;  1GSW A;  2JKT I;  4Y0O A;  1MPL A;  4HJ4 A;  4KQO A;  3V50 A;  3PAE A;  3T50 A;  3R7W B;  3TG9 A;  4LV2 A;  1ZKJ A;  4Q0J A;  3SH9 A;  1TVF A;  1FIL A;  4X56 A;  2HJE A;  2JN7 A;  3VSL A;  2QJ7 A;  2IWB A;  3A0S A;  1PNE A;  3HUN A;  2XRO A;  3KO6 A;  1TS7 A;  5DFX A;  2Y2O A;  3HLD A;  1VEU B;  3EOI A;  4E3J A;  3Q1F A;  5A8B A;  4FUW A;  3P09 A;  4DN0 A;  3BJN A;  5E2F A;  2OAP 1;  2V8C A;  3LI9 A;  3VOL A;  3M2J A;  4N1X A;  3LY3 A;  2Y2J A;  2W3D A;  5AVE A;  2VGL M;  1FIK A;  2R78 A;  4QB8 A;  3JVU A;  1XJ6 A;  3L9K A;  2G2W A;  1CF0 A;  3T4T A;  5CEC A;  2O99 A;  1NRF A;  1Z6F A;  3NOT C;  1G68 A;  3MMH A;  4Y3I A;  5IT5 A;  1J3W A;  3IF6 B;  4I39 A;  4EQ1 A;  3MF0 A;  4Q0H A;  2YKH A;  2ACG A;  4WLA A;  4UA6 A;  1IYS A;  5TJJ A;  3Q81 A;  5F82 A;  4ZJ2 A;  3PHY A;  4R70 A;  4FD8 A;  1SDE A;  2EWW A;  2MJ6 A;  5M1A A;  2BLS A;  2A3U A;  3BFE A;  4DRT A;  4R3J A;  2KX6 A;  1ZC2 A;  3DWK A;  4LRY C;  2K7S A;  2P7J A;  2XR0 A;  4BLM A;  3IHB A;  3FPW A;  4R1G A;  2XA7 S;  1OTI A;  1IYO A;  1YMX A;  3V3R A;  4DE3 A;  2D01 A;  3IXB A;  3RXW A;  3CPT B;  2OV5 A;  4OLD A;  3ITA A;  4OVD A;  1CEF A;  1LL9 A;  2EA9 A;  4I38 A;  5DFY A;  1JTD A;  1T1B A; 
#chains in the Genus database with same CATH homology
 2Y2Q A;  3LEZ A;  5E2H A;  3NDG A;  3SS3 A;  4KG2 A;  2R9X A;  1VQQ A;  1BLC A;  5HAP A;  2JC7 A;  4CJN A;  5FAS A;  1FQG A;  1N9B A;  4KZA A;  4LCL A;  1BLH A;  3BFF A;  1ES4 A;  1K57 C;  3BYD A;  4KZ9 A;  4WEJ A;  4X55 A;  3UDX A;  3BLM A;  3G30 A;  1H8Y A;  4OQI A;  5EVI B;  2WKE A;  4XXR A;  3BM6 A;  2V1Z A;  4DF6 A;  4DXB A;  4RYE A;  3FKV A;  3ZG7 B;  5HX9 A;  1XA1 A;  1XX2 A;  4IBR A;  4OKP A;  4K0X A;  1TDL A;  1JVJ A;  1YLY A;  2H0T A;  1C3B A;  4B88 A;  4A5R A;  5FQM A;  1JWP A;  4BL2 A;  1MWU A;  1KVM A;  2XH9 A;  3NC8 A;  4OOL A;  3ISG A;  1S6R A;  3N8L A;  4R4R A;  3UDI A;  4OP5 A;  4OP8 A;  1I2S A;  1WE4 A;  3IH9 A;  4O7D A;  1BT5 A;  3AGF A;  3VSK A;  4IVI A;  2XGN A;  3W8K A;  4C6Y A;  3HL9 A;  4GOG A;  1LLB A;  1YM1 A;  1BLP A;  2EX2 A;  3VP1 A;  2QPN A;  2WK0 A;  3HRE A;  4PM5 A;  4QD4 A;  1FSY A;  4UHU A;  3O86 A;  4GN2 A;  2J8Y A;  4EUZ A;  1MWT A;  1E3U D;  2G2U A;  2QZ6 A;  2WZX A;  3IXH A;  1KE0 A;  3PBR A;  4DE1 A;  4E3M A;  3PBO A;  2HPB A;  3BFG A;  4KZB A;  1KDW A;  1YLT A;  3G4P A;  4KQR A;  1DJB A;  4UAA A;  2B5R A;  4KG6 A;  2HDU A;  4LEN A;  5F1F A;  4WZ4 A;  1W7F A;  3WS0 A;  3DTM A;  4WMC D;  2Y2H A;  2OSU A;  4E3O A;  4JF4 A;  4E3I A;  4E6X A;  1PIO A;  4Z9Q A;  3Q07 A;  2HP9 A;  4IBX A;  1IKG A;  2ZQ7 A;  3S4X A;  2ZQ9 A;  3QNB A;  1RGY A;  1BSG A;  2C6W B;  3G2Z A;  3G35 A;  3Q82 A;  5I94 A;  2Y2G A;  3S1Y A;  1K4E A;  4S2J A;  4NK3 A;  4JKT A;  3IWQ A;  1K54 C;  2WUQ A;  4R23 A;  1ERM A;  3UE0 A;  4EV4 A;  3ITB A;  3V39 A;  3W4P A;  2Q9N A;  3C7V A;  3HLB A;  3HLF A;  2H10 A;  1K56 D;  3IHA A;  1ERQ A;  5GL9 A;  2Y59 A;  4PPR A;  1KGF A;  1GHP A;  1K6S A;  5AQ7 A;  1KDS A;  1NYM A;  5F83 A;  3MXR A;  4EBP A;  1EI5 A;  5FI2 A;  4C3Q A;  1E4D A;  3GMW A;  1LL5 A;  2XD1 A;  1BUL A;  1HZO A;  3NBL A;  3I7J A;  4X53 A;  3A3F A;  3UPP A;  1QMF A;  4JXS A;  3Q7V B;  3IH8 A;  1MWS A;  2EX6 A;  5GLA A;  1FSW A;  4M3K A;  1FR6 A;  2HP6 A;  5KMW A;  1SHV A;  3C5A A;  1KVL A;  3UDF A;  2Y91 A;  2XEP A;  3QHY A;  4OOY A;  4Y7P A;  4ID4 A;  4KEN B;  1K57 A;  4X69 A;  5CER A;  3ZG9 B;  1PZP A;  1JWZ A;  3CJM A;  1AXB A;  1DJC A;  1XP4 A;  4JLF A;  4GB7 A;  3GTC A;  4LV0 A;  5E43 A;  1MBL A;  3OPR A;  3ZVW A;  5G18 A;  4KZ6 A;  3HLE A;  3O3V A;  5CHJ A;  4K91 A;  4EQI A;  1I5Q A;  5CGX A;  3VP0 A;  3GSG A;  4HEF A;  4QU3 A;  2DCF A;  2Y2L A;  1ESU A;  2A49 A;  4N92 A;  3Q7Z A;  1TDG A;  2Q9M A;  4OPY A;  4E3L A;  3SOI A;  4FSF A;  3ZNY A;  3LY4 A;  2XD5 A;  2ZC3 B;  4OON A;  3VP2 A;  3IF5 A;  3DW0 A;  3D4F A;  1PI5 A;  2ZQC A;  2Y2N A;  3PBT A;  1O07 A;  5FQI A;  5FQJ A;  3WRT A;  4OPR A;  5A90 A;  3SS4 A;  2DNS A;  4U3T A;  4ZJ1 A;  5CRF A;  3GVB A;  4MBH A;  4JXV A;  3PBN A;  5GLD A;  1WYB A;  4RA7 A;  3IWI A;  2XFS A;  4KZ5 A;  4U0T A;  1CI8 A;  1IEL A;  2H5S A;  4HBT A;  2XF3 A;  4PM7 A;  4P85 A;  5DTK A;  1KE4 A;  3ZG0 A;  3PBS A;  5CXW A;  1BUE A;  1FCN A;  1XPB A;  5EVI D;  2HDS A;  4OQ0 A;  2J9P A;  1W79 A;  4EWF A;  2UWX A;  4GZB A;  5JYO A;  1HD8 A;  4KQQ A;  2VGK A;  3M2K A;  2ZM2 A;  5CHU A;  1L2S A;  1SDN A;  2WKH A;  1NZO A;  3CZD A;  2H0Y A;  4JXG A;  2HDQ A;  3WWX A;  5M18 A;  3G32 A;  4OH0 A;  3HVF A;  4GD6 A;  4RVA A;  3WS2 A;  3SH7 A;  1PYY A;  5FQK A;  4WMC A;  2ZD8 A;  5EOE A;  4OOM A;  4R4S A;  5CED A;  2FFY A;  2X71 A;  1M6K A;  4LCM A;  1JWV A;  3IT9 A;  3IF6 A;  3M6H A;  1ONG A;  4ZDX A;  4N1H A;  4KZ4 A;  1K54 A;  4K0W A;  1KE3 A;  4YIN A;  5BOH A;  5D3O A;  2QMI A;  1H5X A;  3V5M A;  4HES A;  2HDR A;  1LI0 A;  4B4Z A;  1RP5 A;  1XXM A;  3BEB A;  1LI9 A;  3P98 A;  4JF6 A;  1K56 A;  1YQS A;  2GDN A;  3GV9 A;  1XKZ A;  2OLU A;  2R9W A;  1Q2P A;  3OPH A;  5J8X A;  4DE0 A;  1LHY A;  1VM1 A;  1CI9 A;  4JPM A;  1NY0 A;  2EX8 A;  4S2I A;  2EFU A;  2WGW A;  3QNC A;  4JF5 A;  5DTT A;  1DY6 A;  2Y2P A;  5AQB A;  4BQM A;  3GQZ A;  1ESI A;  4H8R A;  4N9L A;  3NI9 A;  3O87 A;  5EVL A;  2ZMA A;  3NY4 A;  3G31 A;  5M19 A;  2CC1 A;  3TOI A;  2X02 A;  4R0Q A;  4WM9 A;  2Y2M A;  4WZ5 A;  1OME A;  4ZTK A;  2WGI A;  4EBN A;  1XGI A;  3IF6 C;  5FAQ A;  3JYI A;  4IED A;  4XUX A;  1TEM A;  1I2W A;  5EEC A;  5A91 A;  4D2O A;  4L0L A;  4S2K A;  2EX9 A;  3GRJ A;  4HBU A;  2XQZ A;  3UY6 A;  2ZQA A;  2E8I A;  4S2O A;  5DVA A;  4OLG A;  3G34 A;  4BJP A;  3MXS A;  1YLJ A;  2RL3 A;  3A3D A;  1ZG4 A;  1PI4 A;  3A3E A;  3DWZ A;  5GLC A;  3RXX A;  3SS5 A;  2Y4A A;  2ZC5 B;  3PTE A;  4S2M A;  4ZJ3 A;  3VP4 A;  4S2L A;  4EBL A;  1FOF A;  4WEL A;  3HUO A;  2PU2 A;  4BL3 A;  1K6R A;  2P9V A;  2JBF A;  1QME A;  2DRW A;  3WRZ A;  3HLG A;  2ZQD A;  1IKI A;  4NET A;  1GCE A;  2Y2K A;  3ZNT A;  5IHV A;  4ZBE A;  3HBR A;  4GDB A;  1NZU A;  2Y2I A;  5FQ9 A;  5A93 A;  4YFM A;  3EQU A;  1L0E A;  3ZG5 A;  3IXG A;  3UPN A;  5L2F A;  1JTG A;  4WZ5 C;  2IWC A;  2FFF B;  1ONH A;  2ZC6 B;  4BD0 A;  3PBQ A;  4GD8 A;  4E3K A;  3FZC A;  3OZH A;  1SCW A;  4FH2 A;  2WGW B;  4WYY A;  1ES3 A;  2WZZ A;  1MKI A;  3CMZ A;  3IXD A;  3IWO A;  2ZM0 A;  1PW8 A;  4PM9 A;  3LCE A;  5CTM A;  5HAR A;  1YLW A;  3E2L A;  4P0M A;  5CTN A;  1L0G A;  1GHI A;  3MKF A;  4PMA A;  4KZ7 A;  4N9K A;  2EXA A;  3V3S A;  4JXW A;  4DDS A;  4WEK A;  4X6T A;  5GHY A;  4UA9 A;  1O7E A;  4QY6 A;  1GA0 A;  4KG5 A;  4S2N C;  2VGJ A;  2ZQ8 A;  1U60 A;  5FSR A;  3MZE A;  3RJU A;  1XGJ A;  2WAD A;  3N8R A;  4OPZ A;  5TGF A;  3WS1 A;  4KZ3 A;  4PM6 A;  5HFO A;  3A3J A;  3FKW A;  2WGV A;  2ZJ9 A;  1HVB A;  2Z2M B;  1K55 A;  4E3N A;  3UE1 A;  3ZVT A;  2WAF A;  2HP5 A;  4QJG A;  1WYC A;  3FWL A;  1Y54 A;  3N6I A;  5FAO A;  4CPK A;  1ERO A;  4JBF A;  4RX3 A;  1DJA A;  4FCF A;  3VFH A;  5FDH A;  3VFF A;  1G6A A;  4XUZ A;  1RCJ A;  4LV3 A;  3VP3 A;  1E3U A;  2EFX A;  5TFQ A;  3TSG A;  1Q2Q A;  5EVI C;  1GA9 A;  2P9V B;  3MFD A;  3MKE A;  3N4I A;  3M6B A;  1ES5 A;  4DKI A;  1PW1 A;  4GKU A;  1HTZ A;  4Y0O A;  5DTS A;  1MPL A;  5CGS A;  4KQO A;  2OLV A;  3V50 A;  3PAE A;  3OPL A;  3TG9 A;  4BEN A;  4LV2 A;  1L0F A;  5EE8 A;  1ZKJ A;  5HL1 A;  4RX2 A;  4DDY A;  5F1G A;  3SH9 A;  1CEG A;  1TVF A;  2XK1 A;  4X56 A;  4BD1 A;  3ZDJ A;  1PWD A;  1W8Y A;  2V20 A;  1FCO A;  1KGE A;  5GHX A;  3MZD A;  3VSL A;  2IWB A;  1K55 C;  4Y0U A;  5EOO A;  3HUN A;  3BLS A;  3S22 A;  5GHZ A;  3C4P A;  1ALQ A;  2Y2O A;  4PM8 A;  1MY8 A;  5CGW A;  3HLD A;  2XLN A;  1YT4 A;  4U0X A;  3LO7 A;  4C75 A;  5CEB A;  1FCM A;  3CG5 A;  5FI7 A;  4E3J A;  3AGE A;  3Q1F A;  2J7V A;  3ZGA B;  3IQA A;  3P09 A;  2P74 A;  4QHC A;  3GR2 A;  3UN7 A;  3G2Y A;  4B4X A;  3C7U A;  3VOZ A;  4MBK A;  3BRM A;  1M40 A;  3Q7V A;  4MBF A;  2ZLY A;  5DF7 A;  1IEM A;  5FA7 A;  1L0D A;  1BZA A;  5E2F A;  4MNR A;  1YLZ A;  3UPO A;  5EVI A;  4QY5 A;  5GLB A;  3M2J A;  4N1X A;  3LY3 A;  3UE3 A;  2IWD A;  2Y2J A;  5E2G A;  1PZO A;  1IYQ A;  3OPP A;  2ZC7 A;  4F94 A;  1IYP A;  3N8S A;  3HUM A;  1E25 A;  3C4O A;  3HLW A;  1SKF A;  4QB8 A;  3UO9 A;  3NIA A;  3ZG8 B;  5A92 A;  5E2E A;  4WBG A;  4FH4 A;  5DF9 A;  2G2W A;  2C5W B;  5EPH A;  3ZHH A;  2ZM8 A;  5CEC A;  1NRF A;  1Z6F A;  3A3I A;  3EQV A;  4MEZ A;  4UA7 A;  1ZG6 A;  4S2P A;  3OCN A;  1G68 A;  3VOY A;  3ZFZ A;  4S2N A;  2WKI A;  1J9M A;  3IF6 B;  4GDN A;  1W8Q A;  1BTL A;  2ZC4 B;  2EXB A;  2J9O A;  4R3B A;  2V2F F;  3AGD A;  2Z2L B;  4E6W A;  4IVK A;  1NJ4 A;  4UA6 A;  5FAP A;  1PWC A;  1IYS A;  1K38 A;  1GHM A;  3Q81 A;  3FV7 A;  3HLC A;  5F82 A;  5AQ9 A;  1W5D A;  1H8Z A;  2XDM A;  1NYY A;  3PAG A;  1MXO A;  4OQH A;  4ZJ2 A;  4X68 A;  2PBY A;  2JE5 A;  5KSH A;  2JCH A;  1MWR A;  3WS4 A;  4FD8 A;  3OC2 A;  1SDE A;  3N7W A;  5M1A A;  3BFC A;  1S0W A;  2BLS A;  4GNU A;  4Q8I A;  4Y0T A;  1XA7 A;  2A3U A;  3BFE A;  4DRT A;  3VMA A;  3NDE A;  3WS5 A;  1K4F A;  3BEC A;  4DE2 A;  5HW3 A;  5JYP A;  4R3J A;  1NXY A;  1PWG A;  2I72 A;  2X01 A;  1ZC2 A;  3DWK A;  3UNW A;  5KSC A;  3NCK A;  3W4Q A;  1EWZ A;  4ZAM A;  1N4O A;  1K25 A;  2XR0 A;  1ES2 A;  4BLM A;  3FYZ A;  3IHB A;  5FQQ A;  1KGG A;  2XFT A;  4LV1 A;  5FAT A;  5U47 A;  4R1G A;  2RCX A;  5HAQ A;  1BLS A;  1YLP A;  2WYX A;  1CK3 A;  1IYO A;  1YMX A;  5AQA A;  3V3R A;  4DE3 A;  3MBZ A;  5EUA A;  4KZ8 A;  2BG1 A;  3BFD A;  3O88 A;  4DXC A;  5CHM A;  2WAE A;  3IXB A;  3RXW A;  3MZF A;  2PU4 A;  4OQG A;  4OLD A;  2OV5 A;  3ITA A;  4OVD A;  1YMS A;  4P6B A;  2Y55 A;  4MLL A;  5FI6 A;  3W4O A;  1CEF A;  5TR7 A;  5HAI A;  1LL9 A;  4OPQ A;  3E2K A;  4P87 A;  1RGZ A;  3OCL A;  3B3X A;  3ZCZ A;  1JTD A;  5KZH A;  1FR1 A;  5DF8 A;  3SH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...