5EFWA

Crystal structure of lov2-zdk1 - the complex of oat lov2 and the affibody protein zdark1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
141
structure length
141
Chain Sequence
TTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords NPH1-1
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
total genus 42
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2015-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5efwA00
2JN7A 2PDRA 3UB6A 4BBUA 3LIBA 3LIFA 5HDDA 2PR6A 1OJGA 4LPZA 1N9OA 5DJUA 1S4SA 2QJ5A 1S66L 4BBVA 3C2WA 1T1AA 3B33A 5A8BA 1DRMA 2H28A 1OTDA 1WA9A 3CLOA 2L0WA 4HP9A 4MN5A 2D01A 4GS9A 4L9GA 5IU1A 4HH2A 2V1AA 3F1PA 3NOPC 4HOIA 4R38A 4GCZA 2JHEA 3PYPA 1OTIA 3BWLA 4I3JA 3LIDA 3C8CA 3ZQ5A 5J3WA 5TBMA 3CAXA 3LI9A 4JGRA 1DP9A 5DJTA 4EERA 3F1NA 4HJ6A 2A24B 4DJ2A 4WF0A 1TS0A 2PYRA 3D72A 1JNUA 4WUJA 3E4PA 2OOLA 1MZUA 4HY8A 4B9OA 1OTEA 1T1BA 4WL9A 3H9WA 3MQQA 1T19A 4KUKA 4KUOA 1D7EA 4LRXC 1OTBA 3P7NA 3H82A 2V0UA 3LIEA 3A0VA 5F69A 2PD8A 3KX0X 1OTAA 2INWA 1LSXA 2V9AA 1G28A 3UB9A 2WKRA 2WKPA 4HP4A 2R78A 5DKLA 4HI4A 3UMDA 3MXQA 2QKPA 4I3AA 3LI8A 2QHKA 2HV1A 2VLGA 4R6LA 1UWNX 4NXBA 2D02A 3A0SA 4R70A 1P97A 3F1OB 4XT2B 2I9VA 3IS2A 2QJ7A 1VB6A 5F5YA 4LRYC 2L1MA 2V0WA 4BBTA 4NXFA 5IS1A 3NHQA 1F9IA 4HJ3A 2GJ3A 5HDSA 1S1ZA 4JGOA 5F6AA 4F3LA 4EETB 1GSVA 1Y28A 1V9YA 5KIZA 2VV8A 3MQOA 2J80A 3H7WA 3PHYA 3G6OA 3LYXA 3T50A 2WKQA 3VE4A 4EW7A 3LUQA 1EW0A 2K7SA 5HD5A 5J7EA 4KQDA 4NXGA 4I3IA 1GSXA 2VV6A 4NXEA 2PR5A 2PHYA 3VOLA 2KDKA 4HQAA 4JGQA 1OT9A 1F98A 3BY9A 3OLOA 3UB7A 3MJQA 2Z6CA 4WLAA 1LT0A 3SW1A 5G4ZA 3MFXA 1V9ZA 3LIAA 1OT6A 3FG8A 1N9NA 5TBMB 1D06A 3UB8A 4I39A 2EA9A 3E4OA 3K3CA 4EQ1A 4K08A 5AVFA 4GW9A 3RH8B 2Z6DA 4EEPA 1BYWA 3ULFA 5G4YA 2BASA 2V1BA 1TS8A 4L9FA 4PKYG 2M1CA 1X0OA 4GHIB 5HWWA 1DP6A 2PD7A 4EESA 5J4EA 4I5SA 2W0NA 1XJ3A 1DP8A 2VEAA 4H6JB 3NOTC 1LSWA 4RQ9A 4I38A 2P7JA 3NOUC 2B02A 5HZHA 3BY8A 1KOUA 2ZOIA 4YWZA 2W27A 1XJ2A 1UWPX 2OWHA 3UMEA 1TS7A 1NWZA 3IS2B 2A24A 2YKFA 3LICA 3HJIA 5HDCA 2ZBBA 2L4RA 4MN6A 5HWTA 1XJ4A 2ZOHA 3CWFA 1LL8A 5F68A 2PYPA 5AVEA 4LRZE 3EWKA 3IBRA 1ODVA 4F3LB 4HH3A 4DJ3A 4GS9B 1XJ6A 1XFQA 3GDIA 3F1PB 4E04A 1N9LA 4EEUA 5HSQA 3FC7A 3ICYA 1P0ZA 3H7WB 2KX6A 2VV7A 5DKKA 5I5LA 3MR0A 1GSWA 1S4RA 5EFWA 1XFNA 3GECA 4HJ4A 3F1NB 1LSVA 4GHIA 3UE6A 1S1YA 2CMNA 3HJKA 3NJAA 4R3AA 2QWSA 2YKHA 3F1OA 4XT2A 3RTYA 1TS6A 1UGUA 4LLOB 1T18A 4PKYA 1S67L 4HIAA 3VE3A 4HHDA 4H6JA 3A0RA 4EXOA 5HD3A 3K3DA 3E4QA 4JGPA 3EEHA 4WN5A 4L9EA 4HNBA 1OJ5A 3H82B 5HWVA 4M4XA 2OWJA 1T1CA
chains in the Genus database with same CATH superfamily
2DMWA 3Q07A 4IEDA 3LIBA 5HDDA 1OJGA 5EM0A 4OLGA 3A3JA 5FL3A 2K31A 3QHYA 1L0EA 4Z1WA 3T1QB 2OLUA 3V50A 1T1AA 4YFMA 3IWIA 1YT4A 2WKEA 2H10A 2H28A 1WA9A 3CLOA 4MN5A 5CGXA 2Y2KA 4L9GA 5IU1A 4HOIA 3OC2A 1NRFA 1ACFA 1HVBA 3MZDA 1NZOA 4EUZA 2PU2A 2P9VB 3P09A 3C4OA 3C8CA 1VEUB 3IXGA 2R9XA 1TD5A 2J9PA 3GQZA 3T4LA 4ID4A 1DP9A 1MPLA 1NYYA 3EGDC 5EVLA 3RXXA 2RCXA 4ZTKA 4FH4A 5KMWA 4S2MA 4OOMA 4MCWA 2VGJA 2ZQ8A 1TS0A 1PI5A 5AQ9A 4CPKA 3PBNA 3E4PA 1OTEA 4OPQA 3QNBA 3MKEA 1DY6A 2FFFB 3H9WA 3MQQA 3QP6A 2PBYA 1S6RA 3T4QA 1KGGA 4KUOA 1ZTUA 2O0YA 4DDSA 5K5BA 2VK3A 4LENA 3QP2A 4GDBA 2V0UA 3KX0X 3CI6A 1GHIA 1ONHA 3IH8A 4WELA 2IWCA 2JC7A 2XD5A 4Q0IA 1L0GA 1H3QA 2GZAA 4X55A 5AQBA 1RGZA 3S22A 3IX3A 3I7JA 4P87A 3N6IA 4WMCA 1PWGA 3MXQA 4R4SA 3OCLA 4X25A 3HLGA 2G2UA 3UN7A 2VLGA 4GJ4A 4R6LA 1UWNX 4ZJ3A 2C5WB 4Q8IA 1ZHHB 2XA7S 2BLSA 1KE3A 5TFQA 4R70A 3ZDJA 3DTKA 4K0XA 3HCYA 2FZ0A 2QJ7A 2Y2IA 2ZC7A 2ACGA 3WS5A 4CLCC 5FASA 3NHQA 4BD1A 3BFCA 4O8GA 2G2WA 4X53A 3RJUA 2J9OA 5EUAA 3W4PA 1S1ZA 3PBOA 2ZD8A 4LCMA 5F6AA 1KGEA 1VEUA 1MKMA 2V1ZA 3BLSA 2ZQDA 4IUHA 3NDEA 5CECA 5CGSA 3LGOA 5FQKA 5M1AA 2J3TD 3MQOA 2ZQAA 4R23A 3PHYA 1BTLA 2OAQ1 4DXCA 5HL1A 3LUQA 4UEYA 5FQJA 1ZG4A 3N4IA 1KE0A 2DCFA 3G32A 4KQDA 3ZHHA 4AFIA 1K57C 4WM9A 1SHVA 3ZCZA 5DF9A 3IXBA 4M3KA 3UPNA 2V2FF 2PR5A 2PHYA 1PWDA 1TEMA 2O9BA 3VOLA 5L09A 2W3EA 1PIOA 3WRTA 4HQAA 4JGQA 3BY9A 1E4DA 1DJBA 4FUWA 1K38A 1G6OA 4FD8A 2Y2JA 3UDFA 3SS3A 3C30A 3LCEA 3FG8A 4BL2A 1N9NA 4S2PA 5HX9A 4WZ4A 1N4OA 3FYZA 1M40A 1CJFA 2ZJ9A 3GRJA 5A93A 4Y17A 4UA6A 4GDNA 4KZAA 5AVFA 3OOVA 4G3VA 4O01A 1BYWA 4II7A 3ULFA 3NECA 5G4YA 4OQHA 3DWKA 1TS8A 3HUOA 4IJGA 4L9FA 3E2LA 4EV4A 3Q82A 2DNSA 4QJGA 3MS6A 4DF6A 4P6ZM 4E3KA 2I72A 4OQIA 3N7WA 1L3LA 1SDNA 3RXWA 1PWCA 1WYCA 3QP5A 4BJPA 4X1LA 1XA1A 1LLBA 2QYBA 1XJ3A 1L2SA 3IWQA 2HP5A 1F2KA 2VEAA 3BJNA 3R7WB 1K25A 4LGWA 2B18A 3IX4A 5FATA 1GA0A 1RCJA 1LSWA 1VHMA 3MZFA 2Z2LB 1ES2A 4JXSA 3WS4A 2Y8HA 2B02A 4ETZA 5HZHA 2XLNA 3BY8A 1KOUA 2P08A 4MLLA 3PAEA 3HLFA 3CUEC 2ZOIA 3N8LA 1STZA 2VX8A 1N9BA 2Y55A 5GHXA 4UQIM 2VKSA 4B93A 4IUKA 1K56A 3NIAA 4G3KA 3KSHA 4KQOA 1QMFA 1E3UD 3GSGA 3LICA 4QY6A 5DTTA 1NLZA 4R0QA 3HVFA 2ZOHA 3CWFA 3S7OA 3CPTB 5CRFA 5F68A 5AVEA 5I94A 4JXVA 1HZOA 1I2SA 4CLCB 5C5KA 3IBRA 3ITBA 3NY4A 1MY8A 3JVVA 1BZAA 1ES3A 1P0ZA 3H7WB 1YAXA 4KG2A 3W8KA 4GD8A 3SZTA 2KX6A 3T1RA 1W7FA 5I5LA 3W4QA 4MDZA 3QP8A 1CEGA 3LFVA 3IQAA 5EFWA 1K0KA 4WZ5A 4BENA 2EXAA 2JCHA 4KQRA 3OBFA 4HJ4A 3NCKA 3NDGA 4QB8A 4Y15A 5DFYA 1AXBA 3NC8A 3E2KA 3HJKA 3NJAA 2JKGA 1T18A 2QZ6A 1YMSA 2QPNA 2GDNA 5FAPA 1SKOA 3PXPA 4HHDA 1YLJA 3A0RA 3R7WA 5AQ7A 5HD3A 3T4TA 4L9EA 1CK3A 3SOIA 1SKFA 4YINA 5FAOA 1OJ5A 5DF8A 1ZKJA 3H82B 5JYOA 2WADA 3ITAA 1C3BA 5DVAA 1YLPA 3ZG5A 4DDYA 4ZBEA 3G31A 2BTFP 4LCLA 3WS0A 2JN7A 2PDRA 2XFSA 4BBUA 1YSPA 2OLVA 2WGIA 1DJAA 2V20A 1N9OA 4LPZA 5DJUA 4ARZB 3G4PA 4S2KA 4RYEA 5E2GA 4IBXA 1O7EA 5A8BA 5J8XA 4CLCD 1IEMA 4QY5A 4E3MA 3VFHA 3D4FA 4CJNA 3FWLA 3O87A 1OTDA 2L0WA 4QU3A 2EX9A 3MF0A 4HH2A 1EROA 3B42A 3NOPC 4R38A 4GCZA 4ZDXA 1XA7A 3FPVA 5EPHA 4FOFA 4Y3IA 4EUVA 3LIDA 4S2LA 3HLWA 2O9CA 3CAXA 3LI9A 3G30A 4C75A 3S7PA 4MBFA 4S2NA 1VETB 2Y2PA 4N9KA 1Y54A 5FEGA 4HJ6A 3WWXA 4DJ2A 2EFUA 3OPHA 4UAAA 2PYRA 3D72A 3Q7ZA 3Q1FA 4WUJA 4X68A 5GLAA 4Y0UA 4HY8A 5FA7A 4NG2A 3OPPA 3M6HA 1T1BA 1JTDA 1YM1A 1PW1A 1K55A 3VP3A 2XGNA 2ZM0A 5M18A 4GKUA 4JF4A 3H82A 4U3TA 5F69A 1OTAA 2A3UA 1LSXA 1I5QA 3UPOA 3VV4A 1KDWA 2WKRA 2WKPA 1FOFA 3OPLA 1GCEA 4ARZA 4MBHA 3P01A 1QMEA 2HDQA 4UHUA 4ESPA 3BECA 3UY6A 2XF3A 2D02A 2PAVP 3A0SA 1MWRA 3KSFA 4G3WA 2I9VA 4KZ8A 1JWVA 3HLBA 4D2OA 3ZG8B 2FFYA 1BLSA 1U60A 5IT5A 1H5XA 1F9IA 2Q9MA 5CERA 4OPZA 3NI9A 2GJ3A 2XSSA 3D9YA 3T4OA 5HDSA 1WYBA 3C38A 4E6WA 1H0MA 5KZHA 4F3LA 4EETB 4ZJ2A 2WKHA 2WZZA 4LV0A 1I2WA 3UPPA 1XKZA 2VJWA 2J80A 3HBRA 1JTGA 3O5YA 3G6OA 2WKQA 1VM1A 1ESIA 5HD5A 5FAQA 5EVIC 3BFGA 1W63M 4NXGA 4ZRRA 4I3IA 3MZEA 1NYMA 4OQ0A 4NXEA 3T1XA 2Y2HA 4Y0OA 1K54C 2O99A 4R3JA 4Y13A 3LR4A 3LO7A 4QWOA 1GHPA 3A3FA 3UB7A 2ZL1A 3T4KA 4ETXA 1LT0A 3CG5A 5TGFA 1OT6A 5GL9A 5DF7A 4H8RA 2WAFA 5TBMB 3W4OA 4RA7A 3UB8A 1CEFA 4I39A 1YLYA 2AVXA 4S2OA 2EA9A 1NZUA 4OOLA 1AWIA 4JLFA 4KENB 1MWUA 2GX5A 3IF6C 3TSGA 4K08A 2X71A 1SDEA 3RH8B 5EE8A 1FIKA 2BASA 5IHVA 4IVKA 4CLCE 1L0DA 5E43A 4A5RA 2WGWB 3IF5A 4XXRA 3N8SA 1YLZA 3HUNA 1X0OA 3BW6A 3C7VA 4R4RA 3EOIA 3UE1A 4O7DA 4Y5FA 2PD7A 4EESA 1LI9A 2HDSA 4C6YA 3IT9A 1K6SA 1DP8A 4LV3A 5FDHA 1XXMA 3NOTC 4DRTA 1HTZA 3KSIA 2PU4A 3ZNTA 5CXWA 4I38A 3W2ZA 3LR3A 4IHQA 2OV5A 2P9VA 3PAGA 1YKDA 4JPMA 2HJEA 3ZGAB 4E3JA 2HPBA 2OWHA 5CX7A 3O3VA 3KYZA 3IS2B 4PAUA 5FQQA 1LHYA 2Y59A 4JKTA 4MNRA 5CEBA 3HJIA 5DTSA 2ZBBA 2IWBA 1YLWA 1J9MA 4MN6A 1XJ4A 4P85A 1ES4A 2PYPA 3C7UA 3VOZA 4LRZE 3EWKA 3UDIA 4PHTA 1MWSA 4DJ3A 5E2HA 5TJJA 1XFQA 3F1PB 3BRMA 1HLUP 4E04A 2GNXA 4EEUA 1K4EA 4DKIA 3EQVA 3JYIA 4OLDA 3V67A 4DMZA 2VGLS 3GTCA 3ISGA 3IHBA 2HZ5A 4OPYA 3DTIA 5MC7A 3QP1A 3CZDA 4N1XA 1YMXA 3GECA 5HAPA 5EVIB 3UE6A 2Y2NA 2CMNA 4HBTA 4YOFA 1D1JA 3CHWP 5EECA 3ZG7B 3RTYA 3VSLA 3VE3A 4O0PA 2JKRM 5HAIA 5E2EA 3K3DA 3K2NA 2E8JA 2NUTC 5HPIA 2J8YA 4UA7A 4JBFA 4LFUA 1L0FA 4KG6A 5JYPA 5AJGA 3LIFA 3UO9A 3BFDA 1RP5A 1S4SA 3ZNYA 3VP2A 1H8MA 3C2WA 4OONA 3B33A 1XGIA 1DRMA 2VGKA 1IOUA 3VOYA 1FSYA 3CJMA 2D01A 1RGYA 5CHMA 2V1AA 3F1PA 1Z09A 5F83A 1E3UA 1WE4A 1OTIA 3KYEA 1H8ZA 3EQUA 2OSUA 3OCNA 3T12B 3DWZA 5HFOA 5CTMA 3V3SA 5GLCA 5J3WA 1MKIA 2K2NA 3GVBA 3GR2A 2Y2LA 3V3RA 1W5DA 5DJTA 3S7QA 5EVID 4P6BA 1FR6A 5GHZA 2WK0A 3L7HA 2A24B 4B88A 5AQAA 2HP6A 3SS5A 4LV2A 4WF0A 3IWOA 2X01A 3GMWA 1MZUA 4B9OA 5CGWA 2DRWA 3FKVA 4P6ZS 4BQMA 2OAP1 1LI0A 3VP1A 1FILA 1BLCA 2WKIA 1D7EA 3JVUA 2VZWA 4Q0HA 4LRXC 1OTBA 5FQMA 4QPRA 3P7NA 2B5RA 3LIEA 2WGVA 3FZCA 1TDLA 2PD8A 2HDUA 1J3WA 2V9AA 3NBLA 1G28A 2W1TB 4QD4A 3ZVTA 4HP4A 3PBRA 3G35A 5FQIA 3UE0A 3VP4A 4X1MA 2QHKA 2A2LA 3LEQA 2HV1A 5EVEA 4WYYA 2LB9A 4UQIS 4NXBA 4KZ3A 1IELA 4N9LA 1P97A 3F1OB 4ZJ1A 4XT2B 2WAEA 3DBAA 2H0TA 1VQQA 3BFFA 4KQQA 1VB6A 4LRYC 2L1MA 1CI9A 3D3OA 5IS1A 4IBRA 1BSGA 4R1GA 5G18A 3CPTA 2Q9NA 2HP9A 4HJ3A 3C5AA 4CLCA 1BULA 2EWWA 3KO6A 3RFBA 1GSVA 5HAQA 1IYPA 1PW8A 3A3DA 5L07A 2PRFA 2VV8A 4X69A 4WEJA 3H7WA 3SH9A 4KZBA 1ERQA 4E3NA 3LYXA 3VE4A 2ZC6B 1EW0A 4XUZA 2K7SA 5J7EA 2ZQ7A 3MXSA 4NEED 1GSXA 2KLIA 3LR5A 2VV6A 1LL9A 1W8QA 3VFFA 4FTXA 3Q7VB 2KDKA 5FI6A 1K57A 4GOGA 3OLOA 5KSHA 2RL3A 1W8YA 1HD8A 1OMEA 4OPRA 4F94A 4WBGA 3Q81A 5G4ZA 3O86A 3MFXA 5A91A 2V8CA 1ALQA 1NRJA 2Q0OA 2W1TA 2QMIA 4BD0A 3HUMA 1CF0A 3KSGA 4FSFA 4PM5A 4BWIA 3E4OA 3EEAA 2IWDA 4FCFA 2LB5A 3K3CA 1W79A 4PM9A 5CHUA 3MXRA 3MFDA 3HREA 5U47A 2W3DA 4EEPA 1O07A 4K91A 1JWZA 1S0WA 2V1BA 4LV1A 5EOOA 3TOIA 3IH9A 4N92A 3M2KA 5FEFA 3ZG0A 4E3IA 3DTEA 4HBUA 2ZQ9A 4GHIB 2ZMFA 4NKPA 3IXHA 4DE3A 1KVMA 5J4EA 2XEPA 2W0NA 1IFQA 4B4ZA 4OVDA 4H6JB 4GD6A 3BM6A 4N1HA 3ZG9B 4BLMA 2HGVA 2P74A 5HW3A 2P7JA 3WRZA 2V8FA 1KE4A 4JF6A 2W27A 1UWPX 1VETA 3A3IA 1NLYA 3CUEA 3UMEA 4EBLA 4MEZA 2XA7M 1FCNA 1NWZA 3Q7VA 3T1SA 4PM6A 2A49A 4FH2A 2NUPC 3MMHA 2L4RA 2H5SA 2PBDP 1YSQA 5HWTA 4MMNA 1LL8A 5D3OA 5GHYA 2H0YA 1FCOA 5FSRA 2XDMA 2ZC5B 1ODVA 4GS9B 4DN0A 4RX2A 3GDIA 2R9WA 3HL9A 4OKPA 1N9LA 2HF6A 2P04A 3BEBA 5HSQA 1EI5A 1ZG6A 3HLDA 5KSCA 4DE2A 4WZ5C 3UE3A 2W3FA 2VV7A 3BLMA 3UB5P 3BQAA 3AGFA 3PTEA 5L2FA 2JKRI 2ZM2A 4DE0A 1XFNA 3NULA 4BL3A 2MJ6A 1SZVA 1BLPA 1G5UA 3VP0A 3F1NB 4S2JA 4GHIA 3DTMA 2BG1A 4R3AA 1E25A 3IHAA 4K0WA 3CMZA 1TS6A 4LLOB 4PKYA 1S67L 4H6JA 2VGLM 4EXOA 4KZ9A 4WMCD 3JPUA 4WN5A 4HNBA 1JWPA 2ZMAA 5LBRA 5HWVA 2XRNA 2X02A 3BFEA 4OP8A 2Y2GA 3LY4A 1T1CA 3TRCA 1BLHA 4Q0JA 3UB6A 5CTNA 3P98A 5EOEA 5L8MA 2PR6A 3AGDA 1K6RA 2XQZA 3DW0A 2E8IA 2QJ5A 3HLCA 1S66L 3U2AA 4BBVA 1ERMA 2B95A 4JXWA 3SS4A 1PI4A 4D60A 3A3EA 4HP9A 4OOYA 4HEFA 4GS9A 2JBFA 5E2FA 2JHEA 3PYPA 4E3OA 5A92A 3BWLA 4C3QA 4KZ6A 4I3JA 3VSKA 4S2NC 1K4FA 5DFXA 2C6WB 3ZQ5A 3OZHA 5TBMA 4PMAA 3SH7A 5EM1A 2XFTA 4JGRA 1KVLA 1XPBA 4YNRA 4EERA 3QP4A 4L0LA 5A90A 3F1NA 4PPRA 4CQHA 1LL5A 3WS1A 2W3GA 3GV9A 1YLTA 1P9RA 1JNUA 2UWXA 1K55C 3MSHA 4EBNA 2OOLA 2WGWA 4RVAA 3LY3A 2VA0A 1Q2PA 3N8RA 3EGXC 4WL9A 2ZM8A 3PR6A 1T19A 2ZC4B 4KUKA 2UV0E 3S7NA 3U4LP 5M19A 1YPRA 4Z9QA 2JE5A 3WS2A 4GZBA 3A0VA 2INWA 5F82A 3LR0A 3T4SA 4KZ5A 3UB9A 1SCWA 4XUXA 4DE1A 5GLDA 1ESUA 2WZXA 2R78A 5DKLA 4HI4A 3UMDA 3AGEA 2JKTI 5BOHA 1FR1A 2QKPA 4I3AA 3LI8A 1CI8A 2WUQA 3E98A 3C4PA 5CEDA 2XK1A 3IF6B 5FDSA 2JKFA 2W1RA 3ZVWA 3IS2A 4EWFA 5CHJA 1SKOB 5F5YA 3O88A 2J3WA 3LEZA 2V0WA 4BBTA 4NXFA 3R4KA 1IKIA 3TE8A 2Y2MA 4JGOA 2XROA 3V39A 3OPRA 1MC0A 3PBQA 2EX8A 4PM7A 3CITA 1Y28A 1K56D 4KG5A 1IYQA 3S1YA 1G6AA 1V9YA 1PZPA 5KIZA 2WYXA 2Y4AA 4HESA 1KDSA 1FQGA 1EWZA 4OH0A 3B3XA 4KZ4A 3T50A 3E0YA 4EW7A 4GB7A 5FI2A 3T4JA 4EBPA 4KZ7A 2PT7A 1W63Q 1CQAA 2ZC3B 5EVIA 3KYQA 2XH9A 1OT9A 3SH8A 1F98A 3ZYTA 4Y2FA 4UA9A 1A0KA 1PFLA 1GA9A 5HL6A 1OPXA 4PM8A 3G34A 3MJQA 4GN2A 2Z6CA 4X6TA 4ZAMA 1K54A 4WLAA 3TW8A 3SW1A 3PBSA 5GLBA 2W3HA 3VMAA 3V5MA 4OQGA 2EFXA 1TVFA 1V9ZA 2HDRA 3LIAA 4WEKA 1FSWA 2Y79A 4S2IA 1D06A 4EQIA 1H8YA 1PNEA 5EV0A 4EQ1A 2ZQCA 4JXGA 3FKWA 2HJ9C 3MKFA 1JVJA 3L9KA 4GW9A 2Z6DA 4GLQA 3S4XA 3IF6A 1PZOA 1MWTA 3G2ZA 3M2JA 4PKYG 1PRQA 2Z2MB 1TF1A 3QNCA 2M1CA 4EU0A 4R3BA 5HWWA 2O9AA 1BUEA 1MBLA 1DP6A 1DJCA 1IYSA 5DTKA 4P0MA 4I5SA 2EX6A 5L10A 4MBKA 1PYYA 3BQ8A 3TG9A 5HARA 4NETA 1G68A 3M6BA 1IYOA 2J7VA 4RQ9A 4NK3A 3NOUC 1TDGA 3HLEA 3FV7A 2JKTM 4U0TA 1XP4A 4RX3A 3MQ0A 5TR7A 3ZFZA 2FH5A 4JF5A 3B47A 2M7UA 3IBJA 4YWZA 1F5MA 1XJ2A 2J3TC 4Y7PA 2CC1A 4U0XA 4E6XA 1TS7A 3UNWA 3BYDA 5FI7A 2A24A 2IA2A 5F1GA 2YKFA 3G2YA 2Y91A 5HDCA 1NXYA 5FQ9A 1ZC2A 1GHMA 2KOIA 1KGFA 1XX2A 4DXBA 1P9WA 1Q2QA 4GNUA 4HH3A 4F3LB 1XJ6A 2ZMVA 3IX8A 2G7UA 2EX2A 3FC7A 3FPWA 3ICYA 3DAVA 5DKKA 5F1FA 3MR0A 1GSWA 1S4RA 1ONGA 4B4XA 4BMWA 1BT5A 3IXDA 3PBTA 2EWVA 1LSVA 1S1YA 4IVIA 4E3LA 3MBZA 1YQSA 2EXBA 2Y2OA 2ZL1B 4ME4A 2QWSA 2YKHA 3F1OA 1MXOA 4XT2A 3UDXA 1UGUA 1FCMA 4OP5A 4HIAA 1M6KA 2XD1A 4QHCA 3E4QA 4X56A 1NY0A 1Y4OA 4JGPA 1XGJA 3EEHA 1ES5A 2Y2QA 2XR0A 3TJZC 4Y0TA 1NJ4A 1IKGA 2ZLYA 4MN7A 2M7VA 4M4XA 2OWJA 5HPFA 1Z6FA
chains in the Genus database with same CATH topology
2DMWA 4Q0JA 2JN7A 2PDRA 3UB6A 4BBUA 1YSPA 5AJGA 3LIBA 3LIFA 5HDDA 5L8MA 2PR6A 1OJGA 4LPZA 1N9OA 5DJUA 4ARZB 1S4SA 5FL3A 2K31A 2QJ5A 1S66L 3U2AA 1H8MA 4Z1WA 4BBVA 3C2WA 1T1AA 3B33A 5A8BA 1DRMA 4CLCD 1IOUA 2H28A 1OTDA 1WA9A 3CLOA 2L0WA 4HP9A 4MN5A 3MF0A 2D01A 4GS9A 4L9GA 5IU1A 4HH2A 2V1AA 3F1PA 3B42A 3NOPC 4HOIA 4R38A 4GCZA 2JHEA 3PYPA 1OTIA 3OC2A 3BWLA 3FPVA 4FOFA 4I3JA 4Y3IA 4EUVA 3EQUA 3OCNA 3LIDA 3C8CA 5DFXA 3ZQ5A 5J3WA 2O9CA 5TBMA 3CAXA 1TD5A 3T4LA 3LI9A 2K2NA 3S7PA 4JGRA 1DP9A 5DJTA 3S7QA 3EGDC 4YNRA 4EERA 4L0LA 3F1NA 4CQHA 4HJ6A 2A24B 4DJ2A 4OOMA 4MCWA 4WF0A 2W3GA 1TS0A 2PYRA 3D72A 1P9RA 1JNUA 4WUJA 3PBNA 3E4PA 2OOLA 1MZUA 4HY8A 4B9OA 1OTEA 2VA0A 1T1BA 4P6ZS 3EGXC 4WL9A 3H9WA 3PR6A 3MQQA 1T19A 2OAP1 4KUKA 3S7NA 3T4QA 4KUOA 1ZTUA 2O0YA 5K5BA 1D7EA 3JVUA 2VZWA 4Q0HA 4LRXC 1OTBA 4QPRA 3P7NA 3H82A 2V0UA 3LIEA 3A0VA 5F69A 2PD8A 3KX0X 1OTAA 2INWA 3CI6A 1LSXA 2V9AA 3LR0A 1G28A 4WELA 4Q0IA 3VV4A 3T4SA 2W1TB 3UB9A 2WKRA 2WKPA 1H3QA 2GZAA 4HP4A 2R78A 5DKLA 3PBRA 4HI4A 4ARZA 3UMDA 3P01A 3MXQA 2JKTI 3OCLA 2QKPA 4I3AA 3LI8A 2QHKA 3E98A 2A2LA 2HV1A 2VLGA 4GJ4A 2LB9A 4R6LA 4UQIS 1UWNX 4NXBA 2D02A 1ZHHB 2XA7S 3A0SA 3KSFA 4G3WA 1P97A 4R70A 3F1OB 2W1RA 4XT2B 2I9VA 3HCYA 3IS2A 3DBAA 2FZ0A 2QJ7A 1VB6A 5F5YA 4CLCC 4LRYC 2L1MA 2J3WA 2V0WA 3D3OA 4NXFA 4BBTA 5IT5A 3NHQA 3R4KA 5IS1A 1F9IA 4HJ3A 2GJ3A 4O8GA 2XSSA 3TE8A 3T4OA 5HDSA 4CLCA 1S1ZA 4JGOA 2XROA 2EWWA 3C38A 3PBOA 3KO6A 5F6AA 3RFBA 4F3LA 4EETB 1MC0A 1GSVA 1MKMA 3PBQA 3CITA 1Y28A 4IUHA 1V9YA 5KIZA 2VV8A 2J3TD 2VJWA 4WEJA 3MQOA 2J80A 3H7WA 3PHYA 2OAQ1 3O5YA 3G6OA 3LYXA 3T50A 2WKQA 3E0YA 3VE4A 3LUQA 4EW7A 4UEYA 1EW0A 2K7SA 5HD5A 5J7EA 4KQDA 1W63M 4NXGA 4ZRRA 4I3IA 3T4JA 4AFIA 5DF9A 4NEED 1GSXA 2KLIA 3LR5A 2PT7A 2VV6A 4NXEA 2PR5A 2PHYA 1W63Q 3VOLA 2O9BA 2KDKA 2W3EA 3KYQA 2O99A 4HQAA 4JGQA 1OT9A 3LR4A 1F98A 3BY9A 3ZYTA 4Y2FA 3OLOA 1G6OA 5KSHA 3UB7A 3T4KA 5HL6A 1OPXA 3MJQA 4ETXA 3C30A 2Z6CA 4WLAA 3TW8A 1LT0A 3SW1A 3PBSA 5G4ZA 2W3HA 3MFXA 1V9ZA 3LIAA 4WEKA 1OT6A 1NRJA 2W1TA 3FG8A 1N9NA 2Y79A 5TBMB 3KSGA 4FSFA 1D06A 3UB8A 4I39A 4BWIA 2EA9A 3E4OA 4OOLA 3EEAA 2GX5A 2LB5A 3K3CA 4EQ1A 4K08A 2HJ9C 5AVFA 3OOVA 4G3VA 4O01A 2W3DA 4GW9A 3RH8B 2Z6DA 4GLQA 4EEPA 1BYWA 4II7A 3ULFA 5G4YA 2BASA 2V1BA 4CLCE 1TS8A 4IJGA 4L9FA 4PKYG 1TF1A 2M1CA 1X0OA 3BW6A 4EU0A 4GHIB 5HWWA 3EOIA 2O9AA 4P6ZM 2ZMFA 1DP6A 4Y5FA 2PD7A 4EESA 4NKPA 5J4EA 4I5SA 4BJPA 2W0NA 1IFQA 3BQ8A 2QYBA 1XJ3A 1DP8A 2VEAA 4H6JB 3NOTC 3BJNA 3R7WB 2B18A 3KSIA 1LSWA 4RQ9A 2HGVA 1VHMA 4I38A 2P7JA 3NOUC 2JKTM 3W2ZA 3LR3A 2Y8HA 4IHQA 2B02A 4ETZA 5HZHA 3BY8A 3MQ0A 1KOUA 2P08A 2FH5A 3B47A 3CUEC 3IBJA 2M7UA 1YKDA 2ZOIA 2HJEA 4YWZA 1STZA 2VX8A 1F5MA 2W27A 1XJ2A 2J3TC 1UWPX 4UQIM 2VKSA 2OWHA 5CX7A 1NLYA 3CUEA 3UMEA 4B93A 4IUKA 2XA7M 3KYZA 1TS7A 1NWZA 4G3KA 3KSHA 3IS2B 4KQOA 4PAUA 2A24A 2IA2A 2YKFA 3LICA 2NUPC 3HJIA 5HDCA 3MMHA 2ZBBA 2L4RA 1NLZA 1YSQA 4MN6A 5HWTA 1XJ4A 2ZOHA 3CWFA 1LL8A 4MMNA 3S7OA 5F68A 2PYPA 5AVEA 4LRZE 3EWKA 4CLCB 2KOIA 4PHTA 5C5KA 3IBRA 1ODVA 1P9WA 4HH3A 4F3LB 4DJ3A 4GS9B 1XJ6A 5TJJA 4DN0A 1XFQA 3GDIA 3F1PB 2ZMVA 1N9LA 2GNXA 4E04A 4EEUA 2G7UA 2HF6A 2P04A 3EQVA 3JVVA 5HSQA 3FC7A 3FPWA 3ICYA 1P0ZA 3H7WB 3V67A 1YAXA 4DMZA 2VGLS 2KX6A 2W3FA 3UE3A 2VV7A 5DKKA 3BQAA 5I5LA 4MDZA 3MR0A 1GSWA 1S4RA 3LFVA 2JKRI 5MC7A 5EFWA 1XFNA 4BMWA 2MJ6A 3GECA 3OBFA 4HJ4A 3F1NB 3PBTA 2EWVA 1LSVA 4GHIA 3UE6A 1S1YA 2CMNA 4YOFA 5DFYA 3HJKA 3NJAA 4R3AA 4ME4A 2QWSA 2YKHA 3F1OA 4XT2A 3RTYA 1TS6A 1UGUA 4LLOB 1T18A 4PKYA 1S67L 4HIAA 3PXPA 3VE3A 4HHDA 4H6JA 4O0PA 2VGLM 3A0RA 3R7WA 2JKRM 4EXOA 5HD3A 3T4TA 3K3DA 3E4QA 4JGPA 3EEHA 3K2NA 4WN5A 4L9EA 2NUTC 4HNBA 5HPIA 1OJ5A 3H82B 5LBRA 5HWVA 3TJZC 2XRNA 4MN7A 2M7VA 4M4XA 2OWJA 1T1CA 5HPFA 3TRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN7 A;  2PDR A;  3UB6 A;  4BBU A;  3LIB A;  3LIF A;  5HDD A;  2PR6 A;  1OJG A;  4LPZ A;  1N9O A;  5DJU A;  1S4S A;  2QJ5 A;  1S66 L;  4BBV A;  3C2W A;  1T1A A;  3B33 A;  5A8B A;  1DRM A;  2H28 A;  1OTD A;  1WA9 A;  3CLO A;  2L0W A;  4HP9 A;  4MN5 A;  2D01 A;  4GS9 A;  4L9G A;  5IU1 A;  4HH2 A;  2V1A A;  3F1P A;  3NOP C;  4HOI A;  4R38 A;  4GCZ A;  2JHE A;  3PYP A;  1OTI A;  3BWL A;  4I3J A;  3LID A;  3C8C A;  3ZQ5 A;  5J3W A;  5TBM A;  3CAX A;  3LI9 A;  4JGR A;  1DP9 A;  5DJT A;  4EER A;  3F1N A;  4HJ6 A;  2A24 B;  4DJ2 A;  4WF0 A;  1TS0 A;  2PYR A;  3D72 A;  1JNU A;  4WUJ A;  3E4P A;  2OOL A;  1MZU A;  4HY8 A;  4B9O A;  1OTE A;  1T1B A;  4WL9 A;  3H9W A;  3MQQ A;  1T19 A;  4KUK A;  4KUO A;  1D7E A;  4LRX C;  1OTB A;  3P7N A;  3H82 A;  2V0U A;  3LIE A;  3A0V A;  5F69 A;  2PD8 A;  3KX0 X;  1OTA A;  2INW A;  1LSX A;  2V9A A;  1G28 A;  3UB9 A;  2WKR A;  2WKP A;  4HP4 A;  2R78 A;  5DKL A;  4HI4 A;  3UMD A;  3MXQ A;  2QKP A;  4I3A A;  3LI8 A;  2QHK A;  2HV1 A;  2VLG A;  4R6L A;  1UWN X;  4NXB A;  2D02 A;  3A0S A;  4R70 A;  1P97 A;  3F1O B;  4XT2 B;  2I9V A;  3IS2 A;  2QJ7 A;  1VB6 A;  5F5Y A;  4LRY C;  2L1M A;  2V0W A;  4BBT A;  4NXF A;  5IS1 A;  3NHQ A;  1F9I A;  4HJ3 A;  2GJ3 A;  5HDS A;  1S1Z A;  4JGO A;  5F6A A;  4F3L A;  4EET B;  1GSV A;  1Y28 A;  1V9Y A;  5KIZ A;  2VV8 A;  3MQO A;  2J80 A;  3H7W A;  3PHY A;  3G6O A;  3LYX A;  3T50 A;  2WKQ A;  3VE4 A;  4EW7 A;  3LUQ A;  1EW0 A;  2K7S A;  5HD5 A;  5J7E A;  4KQD A;  4NXG A;  4I3I A;  1GSX A;  2VV6 A;  4NXE A;  2PR5 A;  2PHY A;  3VOL A;  2KDK A;  4HQA A;  4JGQ A;  1OT9 A;  1F98 A;  3BY9 A;  3OLO A;  3UB7 A;  3MJQ A;  2Z6C A;  4WLA A;  1LT0 A;  3SW1 A;  5G4Z A;  3MFX A;  1V9Z A;  3LIA A;  1OT6 A;  3FG8 A;  1N9N A;  5TBM B;  1D06 A;  3UB8 A;  4I39 A;  2EA9 A;  3E4O A;  3K3C A;  4EQ1 A;  4K08 A;  5AVF A;  4GW9 A;  3RH8 B;  2Z6D A;  4EEP A;  1BYW A;  3ULF A;  5G4Y A;  2BAS A;  2V1B A;  1TS8 A;  4L9F A;  4PKY G;  2M1C A;  1X0O A;  4GHI B;  5HWW A;  1DP6 A;  2PD7 A;  4EES A;  5J4E A;  4I5S A;  2W0N A;  1XJ3 A;  1DP8 A;  2VEA A;  4H6J B;  3NOT C;  1LSW A;  4RQ9 A;  4I38 A;  2P7J A;  3NOU C;  2B02 A;  5HZH A;  3BY8 A;  1KOU A;  2ZOI A;  4YWZ A;  2W27 A;  1XJ2 A;  1UWP X;  2OWH A;  3UME A;  1TS7 A;  1NWZ A;  3IS2 B;  2A24 A;  2YKF A;  3LIC A;  3HJI A;  5HDC A;  2ZBB A;  2L4R A;  4MN6 A;  5HWT A;  1XJ4 A;  2ZOH A;  3CWF A;  1LL8 A;  5F68 A;  2PYP A;  5AVE A;  4LRZ E;  3EWK A;  3IBR A;  1ODV A;  4F3L B;  4HH3 A;  4DJ3 A;  4GS9 B;  1XJ6 A;  1XFQ A;  3GDI A;  3F1P B;  4E04 A;  1N9L A;  4EEU A;  5HSQ A;  3FC7 A;  3ICY A;  1P0Z A;  3H7W B;  2KX6 A;  2VV7 A;  5DKK A;  5I5L A;  3MR0 A;  1GSW A;  1S4R A;  5EFW A;  1XFN A;  3GEC A;  4HJ4 A;  3F1N B;  1LSV A;  4GHI A;  3UE6 A;  1S1Y A;  2CMN A;  3HJK A;  3NJA A;  4R3A A;  2QWS A;  2YKH A;  3F1O A;  4XT2 A;  3RTY A;  1TS6 A;  1UGU A;  4LLO B;  1T18 A;  4PKY A;  1S67 L;  4HIA A;  3VE3 A;  4HHD A;  4H6J A;  3A0R A;  4EXO A;  5HD3 A;  3K3D A;  3E4Q A;  4JGP A;  3EEH A;  4WN5 A;  4L9E A;  4HNB A;  1OJ5 A;  3H82 B;  5HWV A;  4M4X A;  2OWJ A;  1T1C A; 
#chains in the Genus database with same CATH topology
 2DMW A;  3Q07 A;  4IED A;  3LIB A;  5HDD A;  1OJG A;  5EM0 A;  4OLG A;  3A3J A;  5FL3 A;  2K31 A;  3QHY A;  1L0E A;  4Z1W A;  3T1Q B;  2OLU A;  3V50 A;  1T1A A;  4YFM A;  3IWI A;  1YT4 A;  2WKE A;  2H10 A;  2H28 A;  1WA9 A;  3CLO A;  4MN5 A;  5CGX A;  2Y2K A;  4L9G A;  5IU1 A;  4HOI A;  3OC2 A;  1NRF A;  1ACF A;  1HVB A;  3MZD A;  1NZO A;  4EUZ A;  2PU2 A;  2P9V B;  3P09 A;  3C4O A;  3C8C A;  1VEU B;  3IXG A;  2R9X A;  1TD5 A;  2J9P A;  3GQZ A;  3T4L A;  4ID4 A;  1DP9 A;  1MPL A;  1NYY A;  3EGD C;  5EVL A;  3RXX A;  2RCX A;  4ZTK A;  4FH4 A;  5KMW A;  4S2M A;  4OOM A;  4MCW A;  2VGJ A;  2ZQ8 A;  1TS0 A;  1PI5 A;  5AQ9 A;  4CPK A;  3PBN A;  3E4P A;  1OTE A;  4OPQ A;  3QNB A;  3MKE A;  1DY6 A;  2FFF B;  3H9W A;  3MQQ A;  3QP6 A;  2PBY A;  1S6R A;  3T4Q A;  1KGG A;  4KUO A;  1ZTU A;  2O0Y A;  4DDS A;  5K5B A;  2VK3 A;  4LEN A;  3QP2 A;  4GDB A;  2V0U A;  3KX0 X;  3CI6 A;  1GHI A;  1ONH A;  3IH8 A;  4WEL A;  2IWC A;  2JC7 A;  2XD5 A;  4Q0I A;  1L0G A;  1H3Q A;  2GZA A;  4X55 A;  5AQB A;  1RGZ A;  3S22 A;  3IX3 A;  3I7J A;  4P87 A;  3N6I A;  4WMC A;  1PWG A;  3MXQ A;  4R4S A;  3OCL A;  4X25 A;  3HLG A;  2G2U A;  3UN7 A;  2VLG A;  4GJ4 A;  4R6L A;  1UWN X;  4ZJ3 A;  2C5W B;  4Q8I A;  1ZHH B;  2XA7 S;  2BLS A;  1KE3 A;  5TFQ A;  4R70 A;  3ZDJ A;  3DTK A;  4K0X A;  3HCY A;  2FZ0 A;  2QJ7 A;  2Y2I A;  2ZC7 A;  2ACG A;  3WS5 A;  4CLC C;  5FAS A;  3NHQ A;  4BD1 A;  3BFC A;  4O8G A;  2G2W A;  4X53 A;  3RJU A;  2J9O A;  5EUA A;  3W4P A;  1S1Z A;  3PBO A;  2ZD8 A;  4LCM A;  5F6A A;  1KGE A;  1VEU A;  1MKM A;  2V1Z A;  3BLS A;  2ZQD A;  4IUH A;  3NDE A;  5CEC A;  5CGS A;  3LGO A;  5FQK A;  5M1A A;  2J3T D;  3MQO A;  2ZQA A;  4R23 A;  3PHY A;  1BTL A;  2OAQ 1;  4DXC A;  5HL1 A;  3LUQ A;  4UEY A;  5FQJ A;  1ZG4 A;  3N4I A;  1KE0 A;  2DCF A;  3G32 A;  4KQD A;  3ZHH A;  4AFI A;  1K57 C;  4WM9 A;  1SHV A;  3ZCZ A;  5DF9 A;  3IXB A;  4M3K A;  3UPN A;  2V2F F;  2PR5 A;  2PHY A;  1PWD A;  1TEM A;  2O9B A;  3VOL A;  5L09 A;  2W3E A;  1PIO A;  3WRT A;  4HQA A;  4JGQ A;  3BY9 A;  1E4D A;  1DJB A;  4FUW A;  1K38 A;  1G6O A;  4FD8 A;  2Y2J A;  3UDF A;  3SS3 A;  3C30 A;  3LCE A;  3FG8 A;  4BL2 A;  1N9N A;  4S2P A;  5HX9 A;  4WZ4 A;  1N4O A;  3FYZ A;  1M40 A;  1CJF A;  2ZJ9 A;  3GRJ A;  5A93 A;  4Y17 A;  4UA6 A;  4GDN A;  4KZA A;  5AVF A;  3OOV A;  4G3V A;  4O01 A;  1BYW A;  4II7 A;  3ULF A;  3NEC A;  5G4Y A;  4OQH A;  3DWK A;  1TS8 A;  3HUO A;  4IJG A;  4L9F A;  3E2L A;  4EV4 A;  3Q82 A;  2DNS A;  4QJG A;  3MS6 A;  4DF6 A;  4P6Z M;  4E3K A;  2I72 A;  4OQI A;  3N7W A;  1L3L A;  1SDN A;  3RXW A;  1PWC A;  1WYC A;  3QP5 A;  4BJP A;  4X1L A;  1XA1 A;  1LLB A;  2QYB A;  1XJ3 A;  1L2S A;  3IWQ A;  2HP5 A;  1F2K A;  2VEA A;  3BJN A;  3R7W B;  1K25 A;  4LGW A;  2B18 A;  3IX4 A;  5FAT A;  1GA0 A;  1RCJ A;  1LSW A;  1VHM A;  3MZF A;  2Z2L B;  1ES2 A;  4JXS A;  3WS4 A;  2Y8H A;  2B02 A;  4ETZ A;  5HZH A;  2XLN A;  3BY8 A;  1KOU A;  2P08 A;  4MLL A;  3PAE A;  3HLF A;  3CUE C;  2ZOI A;  3N8L A;  1STZ A;  2VX8 A;  1N9B A;  2Y55 A;  5GHX A;  4UQI M;  2VKS A;  4B93 A;  4IUK A;  1K56 A;  3NIA A;  4G3K A;  3KSH A;  4KQO A;  1QMF A;  1E3U D;  3GSG A;  3LIC A;  4QY6 A;  5DTT A;  1NLZ A;  4R0Q A;  3HVF A;  2ZOH A;  3CWF A;  3S7O A;  3CPT B;  5CRF A;  5F68 A;  5AVE A;  5I94 A;  4JXV A;  1HZO A;  1I2S A;  4CLC B;  5C5K A;  3IBR A;  3ITB A;  3NY4 A;  1MY8 A;  3JVV A;  1BZA A;  1ES3 A;  1P0Z A;  3H7W B;  1YAX A;  4KG2 A;  3W8K A;  4GD8 A;  3SZT A;  2KX6 A;  3T1R A;  1W7F A;  5I5L A;  3W4Q A;  4MDZ A;  3QP8 A;  1CEG A;  3LFV A;  3IQA A;  5EFW A;  1K0K A;  4WZ5 A;  4BEN A;  2EXA A;  2JCH A;  4KQR A;  3OBF A;  4HJ4 A;  3NCK A;  3NDG A;  4QB8 A;  4Y15 A;  5DFY A;  1AXB A;  3NC8 A;  3E2K A;  3HJK A;  3NJA A;  2JKG A;  1T18 A;  2QZ6 A;  1YMS A;  2QPN A;  2GDN A;  5FAP A;  1SKO A;  3PXP A;  4HHD A;  1YLJ A;  3A0R A;  3R7W A;  5AQ7 A;  5HD3 A;  3T4T A;  4L9E A;  1CK3 A;  3SOI A;  1SKF A;  4YIN A;  5FAO A;  1OJ5 A;  5DF8 A;  1ZKJ A;  3H82 B;  5JYO A;  2WAD A;  3ITA A;  1C3B A;  5DVA A;  1YLP A;  3ZG5 A;  4DDY A;  4ZBE A;  3G31 A;  2BTF P;  4LCL A;  3WS0 A;  2JN7 A;  2PDR A;  2XFS A;  4BBU A;  1YSP A;  2OLV A;  2WGI A;  1DJA A;  2V20 A;  1N9O A;  4LPZ A;  5DJU A;  4ARZ B;  3G4P A;  4S2K A;  4RYE A;  5E2G A;  4IBX A;  1O7E A;  5A8B A;  5J8X A;  4CLC D;  1IEM A;  4QY5 A;  4E3M A;  3VFH A;  3D4F A;  4CJN A;  3FWL A;  3O87 A;  1OTD A;  2L0W A;  4QU3 A;  2EX9 A;  3MF0 A;  4HH2 A;  1ERO A;  3B42 A;  3NOP C;  4R38 A;  4GCZ A;  4ZDX A;  1XA7 A;  3FPV A;  5EPH A;  4FOF A;  4Y3I A;  4EUV A;  3LID A;  4S2L A;  3HLW A;  2O9C A;  3CAX A;  3LI9 A;  3G30 A;  4C75 A;  3S7P A;  4MBF A;  4S2N A;  1VET B;  2Y2P A;  4N9K A;  1Y54 A;  5FEG A;  4HJ6 A;  3WWX A;  4DJ2 A;  2EFU A;  3OPH A;  4UAA A;  2PYR A;  3D72 A;  3Q7Z A;  3Q1F A;  4WUJ A;  4X68 A;  5GLA A;  4Y0U A;  4HY8 A;  5FA7 A;  4NG2 A;  3OPP A;  3M6H A;  1T1B A;  1JTD A;  1YM1 A;  1PW1 A;  1K55 A;  3VP3 A;  2XGN A;  2ZM0 A;  5M18 A;  4GKU A;  4JF4 A;  3H82 A;  4U3T A;  5F69 A;  1OTA A;  2A3U A;  1LSX A;  1I5Q A;  3UPO A;  3VV4 A;  1KDW A;  2WKR A;  2WKP A;  1FOF A;  3OPL A;  1GCE A;  4ARZ A;  4MBH A;  3P01 A;  1QME A;  2HDQ A;  4UHU A;  4ESP A;  3BEC A;  3UY6 A;  2XF3 A;  2D02 A;  2PAV P;  3A0S A;  1MWR A;  3KSF A;  4G3W A;  2I9V A;  4KZ8 A;  1JWV A;  3HLB A;  4D2O A;  3ZG8 B;  2FFY A;  1BLS A;  1U60 A;  5IT5 A;  1H5X A;  1F9I A;  2Q9M A;  5CER A;  4OPZ A;  3NI9 A;  2GJ3 A;  2XSS A;  3D9Y A;  3T4O A;  5HDS A;  1WYB A;  3C38 A;  4E6W A;  1H0M A;  5KZH A;  4F3L A;  4EET B;  4ZJ2 A;  2WKH A;  2WZZ A;  4LV0 A;  1I2W A;  3UPP A;  1XKZ A;  2VJW A;  2J80 A;  3HBR A;  1JTG A;  3O5Y A;  3G6O A;  2WKQ A;  1VM1 A;  1ESI A;  5HD5 A;  5FAQ A;  5EVI C;  3BFG A;  1W63 M;  4NXG A;  4ZRR A;  4I3I A;  3MZE A;  1NYM A;  4OQ0 A;  4NXE A;  3T1X A;  2Y2H A;  4Y0O A;  1K54 C;  2O99 A;  4R3J A;  4Y13 A;  3LR4 A;  3LO7 A;  4QWO A;  1GHP A;  3A3F A;  3UB7 A;  2ZL1 A;  3T4K A;  4ETX A;  1LT0 A;  3CG5 A;  5TGF A;  1OT6 A;  5GL9 A;  5DF7 A;  4H8R A;  2WAF A;  5TBM B;  3W4O A;  4RA7 A;  3UB8 A;  1CEF A;  4I39 A;  1YLY A;  2AVX A;  4S2O A;  2EA9 A;  1NZU A;  4OOL A;  1AWI A;  4JLF A;  4KEN B;  1MWU A;  2GX5 A;  3IF6 C;  3TSG A;  4K08 A;  2X71 A;  1SDE A;  3RH8 B;  5EE8 A;  1FIK A;  2BAS A;  5IHV A;  4IVK A;  4CLC E;  1L0D A;  5E43 A;  4A5R A;  2WGW B;  3IF5 A;  4XXR A;  3N8S A;  1YLZ A;  3HUN A;  1X0O A;  3BW6 A;  3C7V A;  4R4R A;  3EOI A;  3UE1 A;  4O7D A;  4Y5F A;  2PD7 A;  4EES A;  1LI9 A;  2HDS A;  4C6Y A;  3IT9 A;  1K6S A;  1DP8 A;  4LV3 A;  5FDH A;  1XXM A;  3NOT C;  4DRT A;  1HTZ A;  3KSI A;  2PU4 A;  3ZNT A;  5CXW A;  4I38 A;  3W2Z A;  3LR3 A;  4IHQ A;  2OV5 A;  2P9V A;  3PAG A;  1YKD A;  4JPM A;  2HJE A;  3ZGA B;  4E3J A;  2HPB A;  2OWH A;  5CX7 A;  3O3V A;  3KYZ A;  3IS2 B;  4PAU A;  5FQQ A;  1LHY A;  2Y59 A;  4JKT A;  4MNR A;  5CEB A;  3HJI A;  5DTS A;  2ZBB A;  2IWB A;  1YLW A;  1J9M A;  4MN6 A;  1XJ4 A;  4P85 A;  1ES4 A;  2PYP A;  3C7U A;  3VOZ A;  4LRZ E;  3EWK A;  3UDI A;  4PHT A;  1MWS A;  4DJ3 A;  5E2H A;  5TJJ A;  1XFQ A;  3F1P B;  3BRM A;  1HLU P;  4E04 A;  2GNX A;  4EEU A;  1K4E A;  4DKI A;  3EQV A;  3JYI A;  4OLD A;  3V67 A;  4DMZ A;  2VGL S;  3GTC A;  3ISG A;  3IHB A;  2HZ5 A;  4OPY A;  3DTI A;  5MC7 A;  3QP1 A;  3CZD A;  4N1X A;  1YMX A;  3GEC A;  5HAP A;  5EVI B;  3UE6 A;  2Y2N A;  2CMN A;  4HBT A;  4YOF A;  1D1J A;  3CHW P;  5EEC A;  3ZG7 B;  3RTY A;  3VSL A;  3VE3 A;  4O0P A;  2JKR M;  5HAI A;  5E2E A;  3K3D A;  3K2N A;  2E8J A;  2NUT C;  5HPI A;  2J8Y A;  4UA7 A;  4JBF A;  4LFU A;  1L0F A;  4KG6 A;  5JYP A;  5AJG A;  3LIF A;  3UO9 A;  3BFD A;  1RP5 A;  1S4S A;  3ZNY A;  3VP2 A;  1H8M A;  3C2W A;  4OON A;  3B33 A;  1XGI A;  1DRM A;  2VGK A;  1IOU A;  3VOY A;  1FSY A;  3CJM A;  2D01 A;  1RGY A;  5CHM A;  2V1A A;  3F1P A;  1Z09 A;  5F83 A;  1E3U A;  1WE4 A;  1OTI A;  3KYE A;  1H8Z A;  3EQU A;  2OSU A;  3OCN A;  3T12 B;  3DWZ A;  5HFO A;  5CTM A;  3V3S A;  5GLC A;  5J3W A;  1MKI A;  2K2N A;  3GVB A;  3GR2 A;  2Y2L A;  3V3R A;  1W5D A;  5DJT A;  3S7Q A;  5EVI D;  4P6B A;  1FR6 A;  5GHZ A;  2WK0 A;  3L7H A;  2A24 B;  4B88 A;  5AQA A;  2HP6 A;  3SS5 A;  4LV2 A;  4WF0 A;  3IWO A;  2X01 A;  3GMW A;  1MZU A;  4B9O A;  5CGW A;  2DRW A;  3FKV A;  4P6Z S;  4BQM A;  2OAP 1;  1LI0 A;  3VP1 A;  1FIL A;  1BLC A;  2WKI A;  1D7E A;  3JVU A;  2VZW A;  4Q0H A;  4LRX C;  1OTB A;  5FQM A;  4QPR A;  3P7N A;  2B5R A;  3LIE A;  2WGV A;  3FZC A;  1TDL A;  2PD8 A;  2HDU A;  1J3W A;  2V9A A;  3NBL A;  1G28 A;  2W1T B;  4QD4 A;  3ZVT A;  4HP4 A;  3PBR A;  3G35 A;  5FQI A;  3UE0 A;  3VP4 A;  4X1M A;  2QHK A;  2A2L A;  3LEQ A;  2HV1 A;  5EVE A;  4WYY A;  2LB9 A;  4UQI S;  4NXB A;  4KZ3 A;  1IEL A;  4N9L A;  1P97 A;  3F1O B;  4ZJ1 A;  4XT2 B;  2WAE A;  3DBA A;  2H0T A;  1VQQ A;  3BFF A;  4KQQ A;  1VB6 A;  4LRY C;  2L1M A;  1CI9 A;  3D3O A;  5IS1 A;  4IBR A;  1BSG A;  4R1G A;  5G18 A;  3CPT A;  2Q9N A;  2HP9 A;  4HJ3 A;  3C5A A;  4CLC A;  1BUL A;  2EWW A;  3KO6 A;  3RFB A;  1GSV A;  5HAQ A;  1IYP A;  1PW8 A;  3A3D A;  5L07 A;  2PRF A;  2VV8 A;  4X69 A;  4WEJ A;  3H7W A;  3SH9 A;  4KZB A;  1ERQ A;  4E3N A;  3LYX A;  3VE4 A;  2ZC6 B;  1EW0 A;  4XUZ A;  2K7S A;  5J7E A;  2ZQ7 A;  3MXS A;  4NEE D;  1GSX A;  2KLI A;  3LR5 A;  2VV6 A;  1LL9 A;  1W8Q A;  3VFF A;  4FTX A;  3Q7V B;  2KDK A;  5FI6 A;  1K57 A;  4GOG A;  3OLO A;  5KSH A;  2RL3 A;  1W8Y A;  1HD8 A;  1OME A;  4OPR A;  4F94 A;  4WBG A;  3Q81 A;  5G4Z A;  3O86 A;  3MFX A;  5A91 A;  2V8C A;  1ALQ A;  1NRJ A;  2Q0O A;  2W1T A;  2QMI A;  4BD0 A;  3HUM A;  1CF0 A;  3KSG A;  4FSF A;  4PM5 A;  4BWI A;  3E4O A;  3EEA A;  2IWD A;  4FCF A;  2LB5 A;  3K3C A;  1W79 A;  4PM9 A;  5CHU A;  3MXR A;  3MFD A;  3HRE A;  5U47 A;  2W3D A;  4EEP A;  1O07 A;  4K91 A;  1JWZ A;  1S0W A;  2V1B A;  4LV1 A;  5EOO A;  3TOI A;  3IH9 A;  4N92 A;  3M2K A;  5FEF A;  3ZG0 A;  4E3I A;  3DTE A;  4HBU A;  2ZQ9 A;  4GHI B;  2ZMF A;  4NKP A;  3IXH A;  4DE3 A;  1KVM A;  5J4E A;  2XEP A;  2W0N A;  1IFQ A;  4B4Z A;  4OVD A;  4H6J B;  4GD6 A;  3BM6 A;  4N1H A;  3ZG9 B;  4BLM A;  2HGV A;  2P74 A;  5HW3 A;  2P7J A;  3WRZ A;  2V8F A;  1KE4 A;  4JF6 A;  2W27 A;  1UWP X;  1VET A;  3A3I A;  1NLY A;  3CUE A;  3UME A;  4EBL A;  4MEZ A;  2XA7 M;  1FCN A;  1NWZ A;  3Q7V A;  3T1S A;  4PM6 A;  2A49 A;  4FH2 A;  2NUP C;  3MMH A;  2L4R A;  2H5S A;  2PBD P;  1YSQ A;  5HWT A;  4MMN A;  1LL8 A;  5D3O A;  5GHY A;  2H0Y A;  1FCO A;  5FSR A;  2XDM A;  2ZC5 B;  1ODV A;  4GS9 B;  4DN0 A;  4RX2 A;  3GDI A;  2R9W A;  3HL9 A;  4OKP A;  1N9L A;  2HF6 A;  2P04 A;  3BEB A;  5HSQ A;  1EI5 A;  1ZG6 A;  3HLD A;  5KSC A;  4DE2 A;  4WZ5 C;  3UE3 A;  2W3F A;  2VV7 A;  3BLM A;  3UB5 P;  3BQA A;  3AGF A;  3PTE A;  5L2F A;  2JKR I;  2ZM2 A;  4DE0 A;  1XFN A;  3NUL A;  4BL3 A;  2MJ6 A;  1SZV A;  1BLP A;  1G5U A;  3VP0 A;  3F1N B;  4S2J A;  4GHI A;  3DTM A;  2BG1 A;  4R3A A;  1E25 A;  3IHA A;  4K0W A;  3CMZ A;  1TS6 A;  4LLO B;  4PKY A;  1S67 L;  4H6J A;  2VGL M;  4EXO A;  4KZ9 A;  4WMC D;  3JPU A;  4WN5 A;  4HNB A;  1JWP A;  2ZMA A;  5LBR A;  5HWV A;  2XRN A;  2X02 A;  3BFE A;  4OP8 A;  2Y2G A;  3LY4 A;  1T1C A;  3TRC A;  1BLH A;  4Q0J A;  3UB6 A;  5CTN A;  3P98 A;  5EOE A;  5L8M A;  2PR6 A;  3AGD A;  1K6R A;  2XQZ A;  3DW0 A;  2E8I A;  2QJ5 A;  3HLC A;  1S66 L;  3U2A A;  4BBV A;  1ERM A;  2B95 A;  4JXW A;  3SS4 A;  1PI4 A;  4D60 A;  3A3E A;  4HP9 A;  4OOY A;  4HEF A;  4GS9 A;  2JBF A;  5E2F A;  2JHE A;  3PYP A;  4E3O A;  5A92 A;  3BWL A;  4C3Q A;  4KZ6 A;  4I3J A;  3VSK A;  4S2N C;  1K4F A;  5DFX A;  2C6W B;  3ZQ5 A;  3OZH A;  5TBM A;  4PMA A;  3SH7 A;  5EM1 A;  2XFT A;  4JGR A;  1KVL A;  1XPB A;  4YNR A;  4EER A;  3QP4 A;  4L0L A;  5A90 A;  3F1N A;  4PPR A;  4CQH A;  1LL5 A;  3WS1 A;  2W3G A;  3GV9 A;  1YLT A;  1P9R A;  1JNU A;  2UWX A;  1K55 C;  3MSH A;  4EBN A;  2OOL A;  2WGW A;  4RVA A;  3LY3 A;  2VA0 A;  1Q2P A;  3N8R A;  3EGX C;  4WL9 A;  2ZM8 A;  3PR6 A;  1T19 A;  2ZC4 B;  4KUK A;  2UV0 E;  3S7N A;  3U4L P;  5M19 A;  1YPR A;  4Z9Q A;  2JE5 A;  3WS2 A;  4GZB A;  3A0V A;  2INW A;  5F82 A;  3LR0 A;  3T4S A;  4KZ5 A;  3UB9 A;  1SCW A;  4XUX A;  4DE1 A;  5GLD A;  1ESU A;  2WZX A;  2R78 A;  5DKL A;  4HI4 A;  3UMD A;  3AGE A;  2JKT I;  5BOH A;  1FR1 A;  2QKP A;  4I3A A;  3LI8 A;  1CI8 A;  2WUQ A;  3E98 A;  3C4P A;  5CED A;  2XK1 A;  3IF6 B;  5FDS A;  2JKF A;  2W1R A;  3ZVW A;  3IS2 A;  4EWF A;  5CHJ A;  1SKO B;  5F5Y A;  3O88 A;  2J3W A;  3LEZ A;  2V0W A;  4BBT A;  4NXF A;  3R4K A;  1IKI A;  3TE8 A;  2Y2M A;  4JGO A;  2XRO A;  3V39 A;  3OPR A;  1MC0 A;  3PBQ A;  2EX8 A;  4PM7 A;  3CIT A;  1Y28 A;  1K56 D;  4KG5 A;  1IYQ A;  3S1Y A;  1G6A A;  1V9Y A;  1PZP A;  5KIZ A;  2WYX A;  2Y4A A;  4HES A;  1KDS A;  1FQG A;  1EWZ A;  4OH0 A;  3B3X A;  4KZ4 A;  3T50 A;  3E0Y A;  4EW7 A;  4GB7 A;  5FI2 A;  3T4J A;  4EBP A;  4KZ7 A;  2PT7 A;  1W63 Q;  1CQA A;  2ZC3 B;  5EVI A;  3KYQ A;  2XH9 A;  1OT9 A;  3SH8 A;  1F98 A;  3ZYT A;  4Y2F A;  4UA9 A;  1A0K A;  1PFL A;  1GA9 A;  5HL6 A;  1OPX A;  4PM8 A;  3G34 A;  3MJQ A;  4GN2 A;  2Z6C A;  4X6T A;  4ZAM A;  1K54 A;  4WLA A;  3TW8 A;  3SW1 A;  3PBS A;  5GLB A;  2W3H A;  3VMA A;  3V5M A;  4OQG A;  2EFX A;  1TVF A;  1V9Z A;  2HDR A;  3LIA A;  4WEK A;  1FSW A;  2Y79 A;  4S2I A;  1D06 A;  4EQI A;  1H8Y A;  1PNE A;  5EV0 A;  4EQ1 A;  2ZQC A;  4JXG A;  3FKW A;  2HJ9 C;  3MKF A;  1JVJ A;  3L9K A;  4GW9 A;  2Z6D A;  4GLQ A;  3S4X A;  3IF6 A;  1PZO A;  1MWT A;  3G2Z A;  3M2J A;  4PKY G;  1PRQ A;  2Z2M B;  1TF1 A;  3QNC A;  2M1C A;  4EU0 A;  4R3B A;  5HWW A;  2O9A A;  1BUE A;  1MBL A;  1DP6 A;  1DJC A;  1IYS A;  5DTK A;  4P0M A;  4I5S A;  2EX6 A;  5L10 A;  4MBK A;  1PYY A;  3BQ8 A;  3TG9 A;  5HAR A;  4NET A;  1G68 A;  3M6B A;  1IYO A;  2J7V A;  4RQ9 A;  4NK3 A;  3NOU C;  1TDG A;  3HLE A;  3FV7 A;  2JKT M;  4U0T A;  1XP4 A;  4RX3 A;  3MQ0 A;  5TR7 A;  3ZFZ A;  2FH5 A;  4JF5 A;  3B47 A;  2M7U A;  3IBJ A;  4YWZ A;  1F5M A;  1XJ2 A;  2J3T C;  4Y7P A;  2CC1 A;  4U0X A;  4E6X A;  1TS7 A;  3UNW A;  3BYD A;  5FI7 A;  2A24 A;  2IA2 A;  5F1G A;  2YKF A;  3G2Y A;  2Y91 A;  5HDC A;  1NXY A;  5FQ9 A;  1ZC2 A;  1GHM A;  2KOI A;  1KGF A;  1XX2 A;  4DXB A;  1P9W A;  1Q2Q A;  4GNU A;  4HH3 A;  4F3L B;  1XJ6 A;  2ZMV A;  3IX8 A;  2G7U A;  2EX2 A;  3FC7 A;  3FPW A;  3ICY A;  3DAV A;  5DKK A;  5F1F A;  3MR0 A;  1GSW A;  1S4R A;  1ONG A;  4B4X A;  4BMW A;  1BT5 A;  3IXD A;  3PBT A;  2EWV A;  1LSV A;  1S1Y A;  4IVI A;  4E3L A;  3MBZ A;  1YQS A;  2EXB A;  2Y2O A;  2ZL1 B;  4ME4 A;  2QWS A;  2YKH A;  3F1O A;  1MXO A;  4XT2 A;  3UDX A;  1UGU A;  1FCM A;  4OP5 A;  4HIA A;  1M6K A;  2XD1 A;  4QHC A;  3E4Q A;  4X56 A;  1NY0 A;  1Y4O A;  4JGP A;  1XGJ A;  3EEH A;  1ES5 A;  2Y2Q A;  2XR0 A;  3TJZ C;  4Y0T A;  1NJ4 A;  1IKG A;  2ZLY A;  4MN7 A;  2M7V A;  4M4X A;  2OWJ A;  5HPF A;  1Z6F A; 
#chains in the Genus database with same CATH homology
 2DMW A;  4Q0J A;  2JN7 A;  2PDR A;  3UB6 A;  4BBU A;  1YSP A;  5AJG A;  3LIB A;  3LIF A;  5HDD A;  5L8M A;  2PR6 A;  1OJG A;  4LPZ A;  1N9O A;  5DJU A;  4ARZ B;  1S4S A;  5FL3 A;  2K31 A;  2QJ5 A;  1S66 L;  3U2A A;  1H8M A;  4Z1W A;  4BBV A;  3C2W A;  1T1A A;  3B33 A;  5A8B A;  1DRM A;  4CLC D;  1IOU A;  2H28 A;  1OTD A;  1WA9 A;  3CLO A;  2L0W A;  4HP9 A;  4MN5 A;  3MF0 A;  2D01 A;  4GS9 A;  4L9G A;  5IU1 A;  4HH2 A;  2V1A A;  3F1P A;  3B42 A;  3NOP C;  4HOI A;  4R38 A;  4GCZ A;  2JHE A;  3PYP A;  1OTI A;  3OC2 A;  3BWL A;  3FPV A;  4FOF A;  4I3J A;  4Y3I A;  4EUV A;  3EQU A;  3OCN A;  3LID A;  3C8C A;  5DFX A;  3ZQ5 A;  5J3W A;  2O9C A;  5TBM A;  3CAX A;  1TD5 A;  3T4L A;  3LI9 A;  2K2N A;  3S7P A;  4JGR A;  1DP9 A;  5DJT A;  3S7Q A;  3EGD C;  4YNR A;  4EER A;  4L0L A;  3F1N A;  4CQH A;  4HJ6 A;  2A24 B;  4DJ2 A;  4OOM A;  4MCW A;  4WF0 A;  2W3G A;  1TS0 A;  2PYR A;  3D72 A;  1P9R A;  1JNU A;  4WUJ A;  3PBN A;  3E4P A;  2OOL A;  1MZU A;  4HY8 A;  4B9O A;  1OTE A;  2VA0 A;  1T1B A;  4P6Z S;  3EGX C;  4WL9 A;  3H9W A;  3PR6 A;  3MQQ A;  1T19 A;  2OAP 1;  4KUK A;  3S7N A;  3T4Q A;  4KUO A;  1ZTU A;  2O0Y A;  5K5B A;  1D7E A;  3JVU A;  2VZW A;  4Q0H A;  4LRX C;  1OTB A;  4QPR A;  3P7N A;  3H82 A;  2V0U A;  3LIE A;  3A0V A;  5F69 A;  2PD8 A;  3KX0 X;  1OTA A;  2INW A;  3CI6 A;  1LSX A;  2V9A A;  3LR0 A;  1G28 A;  4WEL A;  4Q0I A;  3VV4 A;  3T4S A;  2W1T B;  3UB9 A;  2WKR A;  2WKP A;  1H3Q A;  2GZA A;  4HP4 A;  2R78 A;  5DKL A;  3PBR A;  4HI4 A;  4ARZ A;  3UMD A;  3P01 A;  3MXQ A;  2JKT I;  3OCL A;  2QKP A;  4I3A A;  3LI8 A;  2QHK A;  3E98 A;  2A2L A;  2HV1 A;  2VLG A;  4GJ4 A;  2LB9 A;  4R6L A;  4UQI S;  1UWN X;  4NXB A;  2D02 A;  1ZHH B;  2XA7 S;  3A0S A;  3KSF A;  4G3W A;  1P97 A;  4R70 A;  3F1O B;  2W1R A;  4XT2 B;  2I9V A;  3HCY A;  3IS2 A;  3DBA A;  2FZ0 A;  2QJ7 A;  1VB6 A;  5F5Y A;  4CLC C;  4LRY C;  2L1M A;  2J3W A;  2V0W A;  3D3O A;  4NXF A;  4BBT A;  5IT5 A;  3NHQ A;  3R4K A;  5IS1 A;  1F9I A;  4HJ3 A;  2GJ3 A;  4O8G A;  2XSS A;  3TE8 A;  3T4O A;  5HDS A;  4CLC A;  1S1Z A;  4JGO A;  2XRO A;  2EWW A;  3C38 A;  3PBO A;  3KO6 A;  5F6A A;  3RFB A;  4F3L A;  4EET B;  1MC0 A;  1GSV A;  1MKM A;  3PBQ A;  3CIT A;  1Y28 A;  4IUH A;  1V9Y A;  5KIZ A;  2VV8 A;  2J3T D;  2VJW A;  4WEJ A;  3MQO A;  2J80 A;  3H7W A;  3PHY A;  2OAQ 1;  3O5Y A;  3G6O A;  3LYX A;  3T50 A;  2WKQ A;  3E0Y A;  3VE4 A;  3LUQ A;  4EW7 A;  4UEY A;  1EW0 A;  2K7S A;  5HD5 A;  5J7E A;  4KQD A;  1W63 M;  4NXG A;  4ZRR A;  4I3I A;  3T4J A;  4AFI A;  5DF9 A;  4NEE D;  1GSX A;  2KLI A;  3LR5 A;  2PT7 A;  2VV6 A;  4NXE A;  2PR5 A;  2PHY A;  1W63 Q;  3VOL A;  2O9B A;  2KDK A;  2W3E A;  3KYQ A;  2O99 A;  4HQA A;  4JGQ A;  1OT9 A;  3LR4 A;  1F98 A;  3BY9 A;  3ZYT A;  4Y2F A;  3OLO A;  1G6O A;  5KSH A;  3UB7 A;  3T4K A;  5HL6 A;  1OPX A;  3MJQ A;  4ETX A;  3C30 A;  2Z6C A;  4WLA A;  3TW8 A;  1LT0 A;  3SW1 A;  3PBS A;  5G4Z A;  2W3H A;  3MFX A;  1V9Z A;  3LIA A;  4WEK A;  1OT6 A;  1NRJ A;  2W1T A;  3FG8 A;  1N9N A;  2Y79 A;  5TBM B;  3KSG A;  4FSF A;  1D06 A;  3UB8 A;  4I39 A;  4BWI A;  2EA9 A;  3E4O A;  4OOL A;  3EEA A;  2GX5 A;  2LB5 A;  3K3C A;  4EQ1 A;  4K08 A;  2HJ9 C;  5AVF A;  3OOV A;  4G3V A;  4O01 A;  2W3D A;  4GW9 A;  3RH8 B;  2Z6D A;  4GLQ A;  4EEP A;  1BYW A;  4II7 A;  3ULF A;  5G4Y A;  2BAS A;  2V1B A;  4CLC E;  1TS8 A;  4IJG A;  4L9F A;  4PKY G;  1TF1 A;  2M1C A;  1X0O A;  3BW6 A;  4EU0 A;  4GHI B;  5HWW A;  3EOI A;  2O9A A;  4P6Z M;  2ZMF A;  1DP6 A;  4Y5F A;  2PD7 A;  4EES A;  4NKP A;  5J4E A;  4I5S A;  4BJP A;  2W0N A;  1IFQ A;  3BQ8 A;  2QYB A;  1XJ3 A;  1DP8 A;  2VEA A;  4H6J B;  3NOT C;  3BJN A;  3R7W B;  2B18 A;  3KSI A;  1LSW A;  4RQ9 A;  2HGV A;  1VHM A;  4I38 A;  2P7J A;  3NOU C;  2JKT M;  3W2Z A;  3LR3 A;  2Y8H A;  4IHQ A;  2B02 A;  4ETZ A;  5HZH A;  3BY8 A;  3MQ0 A;  1KOU A;  2P08 A;  2FH5 A;  3B47 A;  3CUE C;  3IBJ A;  2M7U A;  1YKD A;  2ZOI A;  2HJE A;  4YWZ A;  1STZ A;  2VX8 A;  1F5M A;  2W27 A;  1XJ2 A;  2J3T C;  1UWP X;  4UQI M;  2VKS A;  2OWH A;  5CX7 A;  1NLY A;  3CUE A;  3UME A;  4B93 A;  4IUK A;  2XA7 M;  3KYZ A;  1TS7 A;  1NWZ A;  4G3K A;  3KSH A;  3IS2 B;  4KQO A;  4PAU A;  2A24 A;  2IA2 A;  2YKF A;  3LIC A;  2NUP C;  3HJI A;  5HDC A;  3MMH A;  2ZBB A;  2L4R A;  1NLZ A;  1YSQ A;  4MN6 A;  5HWT A;  1XJ4 A;  2ZOH A;  3CWF A;  1LL8 A;  4MMN A;  3S7O A;  5F68 A;  2PYP A;  5AVE A;  4LRZ E;  3EWK A;  4CLC B;  2KOI A;  4PHT A;  5C5K A;  3IBR A;  1ODV A;  1P9W A;  4HH3 A;  4F3L B;  4DJ3 A;  4GS9 B;  1XJ6 A;  5TJJ A;  4DN0 A;  1XFQ A;  3GDI A;  3F1P B;  2ZMV A;  1N9L A;  2GNX A;  4E04 A;  4EEU A;  2G7U A;  2HF6 A;  2P04 A;  3EQV A;  3JVV A;  5HSQ A;  3FC7 A;  3FPW A;  3ICY A;  1P0Z A;  3H7W B;  3V67 A;  1YAX A;  4DMZ A;  2VGL S;  2KX6 A;  2W3F A;  3UE3 A;  2VV7 A;  5DKK A;  3BQA A;  5I5L A;  4MDZ A;  3MR0 A;  1GSW A;  1S4R A;  3LFV A;  2JKR I;  5MC7 A;  5EFW A;  1XFN A;  4BMW A;  2MJ6 A;  3GEC A;  3OBF A;  4HJ4 A;  3F1N B;  3PBT A;  2EWV A;  1LSV A;  4GHI A;  3UE6 A;  1S1Y A;  2CMN A;  4YOF A;  5DFY A;  3HJK A;  3NJA A;  4R3A A;  4ME4 A;  2QWS A;  2YKH A;  3F1O A;  4XT2 A;  3RTY A;  1TS6 A;  1UGU A;  4LLO B;  1T18 A;  4PKY A;  1S67 L;  4HIA A;  3PXP A;  3VE3 A;  4HHD A;  4H6J A;  4O0P A;  2VGL M;  3A0R A;  3R7W A;  2JKR M;  4EXO A;  5HD3 A;  3T4T A;  3K3D A;  3E4Q A;  4JGP A;  3EEH A;  3K2N A;  4WN5 A;  4L9E A;  2NUT C;  4HNB A;  5HPI A;  1OJ5 A;  3H82 B;  5LBR A;  5HWV A;  3TJZ C;  2XRN A;  4MN7 A;  2M7V A;  4M4X A;  2OWJ A;  1T1C A;  5HPF A;  3TRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...