4KZ9A

Crystal structure of ampc beta-lactamase in complex with fragment 41 ((4r,4as,8as)-4-phenyldecahydroquinolin-4-ol)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Increasing chemical space coverage by combining empirical and computational fragment screens.
pubmed doi rcsb
source organism Escherichia coli
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4kz9A00
3IWIA 4JBFA 3VFFA 4LV0A 4UAAA 4BENA 4E3NA 5GHYA 1H5XA 1MWTA 1EROA 5E2EA 3WS5A 4S2OA 3HLEA 4WBGA 1NY0A 1K4EA 4WEKA 5GLCA 1NJ4A 2ZMAA 1ESUA 2EXAA 2Y2HA 3BFFA 3OZHA 2XGNA 3RXWA 1KGFA 2OLVA 2Y4AA 4FD8A 1VM1A 3PAEA 4S2LA 2Y2OA 5CHJA 3IWQA 1I5QA 4O7DA 4S2MA 2DNSA 3G35A 5GHZA 2Y2LA 4R3JA 1K57A 3IQAA 3ZG0A 2Y59A 3UPOA 2Y2KA 2GDNA 3N7WA 4ZTKA 4EBNA 2QMIA 1FSWA 1PWCA 3IHBA 1RP5A 2XH9A 1FR1A 1K55A 4X6TA 5DTSA 2ZC4B 1BLSA 2HDRA 3VSKA 3ZHHA 3IXBA 4LENA 5FI6A 2Y2NA 3M6HA 3Q7VA 1ZC2A 5AQAA 3IH8A 3ITAA 5CXWA 3E2LA 5JYOA 3ZG5A 1LL9A 4S2NA 1ES3A 2BG1A 2HDSA 1DJCA 1KGEA 1LLBA 2P9VB 3FYZA 3MBZA 3O86A 4H8RA 4JF4A 3SS5A 4EWFA 1YLWA 2WADA 1L0GA 3CJMA 4HBTA 2HP9A 3Q7ZA 4B88A 1XPBA 5F1FA 5KSCA 3E2KA 1PZOA 5GLAA 2H0TA 5M1AA 3O87A 3OPHA 2Y55A 1JWPA 4KZ6A 1NXYA 4MBHA 2RL3A 3V3SA 2WAEA 4XXRA 2ZD8A 3UE1A 3OPRA 2ZC6B 4EV4A 2Z2MB 3HUNA 1VQQA 4JLFA 4OOYA 5FDHA 1XGJA 2XLNA 4HESA 1BLCA 1KE0A 2XEPA 3DW0A 2Q9NA 3PTEA 3WRTA 4E3LA 1SDNA 4EQIA 3UPPA 4R0QA 4OQGA 2R9XA 4DE0A 5FI2A 3G2ZA 2OV5A 4ZJ1A 1YMXA 4DXCA 3VFHA 4OVDA 4D2OA 3TG9A 4RYEA 5HW3A 5A92A 4OONA 4BLMA 2A49A 1Q2QA 2OLUA 4KQRA 3WS2A 2ZJ9A 3NDGA 4X53A 3GTCA 3VSLA 4R1GA 4JXWA 4P85A 3HLFA 1YLYA 3VOZA 3ZCZA 1SDEA 5FQMA 1W5DA 1HVBA 1TVFA 4Z9QA 4EUZA 2EFXA 2RCXA 2QZ6A 2A3UA 1LHYA 1RCJA 3MXSA 3MZDA 4JF5A 1I2WA 5G18A 4OKPA 1PI5A 4B4XA 3O3VA 1K56A 2H0YA 2WKIA 4KG6A 4MEZA 3LY4A 1MWUA 5CHMA 1K6RA 2VGJA 3NY4A 3ZG7B 4R3BA 1K56D 1Y54A 2XFSA 4EBPA 1XGIA 4C3QA 4OOMA 4IVIA 3C7VA 5E2HA 1MY8A 3B3XA 2XR0A 2Y2QA 4LV1A 4N92A 3SH9A 5FAQA 1AXBA 3GRJA 3ZGAB 3A3DA 3A3IA 1M6KA 1SHVA 2JCHA 3MZEA 3SOIA 3FZCA 4OLGA 4E3KA 3AGEA 4F94A 5DF7A 4Q8IA 3MFDA 5CRFA 2P9VA 4S2JA 3N8RA 1W8YA 2EX8A 2R9WA 3BRMA 3Q1FA 5CTNA 5AQ9A 1XKZA 1PW8A 5M18A 4CJNA 3ZVWA 1BTLA 4QB8A 2UWXA 3SH8A 1GCEA 4DXBA 3NBLA 4LCLA 4GKUA 5BOHA 1E4DA 1YLZA 4N9LA 3WWXA 5AQ7A 1MKIA 3HBRA 3NC8A 4HEFA 4OP8A 4P87A 1IYOA 1IYQA 5AQBA 1FQGA 4KQOA 3P98A 5HARA 3HUOA 2IWDA 5U47A 2J8YA 3HL9A 1BSGA 1QMFA 4OLDA 1ERMA 4MNRA 2J9PA 4N1HA 4OPQA 5EE8A 4LV3A 5GLDA 4PM9A 5GLBA 3JYIA 2V2FF 2ZQ7A 3ZVTA 5HFOA 1HZOA 3ZNYA 3C5AA 3HVFA 4PMAA 5A90A 3GSGA 2JC7A 4KZBA 3IH9A 3OPPA 3Q82A 3WS0A 1DJAA 2ZC5B 2WZZA 2Y2JA 4BJPA 1I2SA 2ZQDA 3RXXA 3ZDJA 4NK3A 4JF6A 4Y0UA 5FQIA 5E2FA 2C5WB 4ZJ2A 1NRFA 4A5RA 2JBFA 3MKFA 4IBXA 4KZ4A 4XUZA 4QD4A 3BLMA 1W7FA 1XXMA 2XQZA 4RX2A 1ZG6A 2Y91A 1NYMA 5DTTA 2J7VA 4FH4A 3BFCA 4WM9A 3SS4A 2IWCA 3ZG8B 4NETA 1CI8A 4C75A 1HTZA 1OMEA 1MPLA 1MXOA 4IVKA 3WRZA 2Y2GA 3HLWA 3G32A 1IYPA 4OPYA 1LL5A 5CTMA 4IBRA 4JKTA 3UNWA 3W4PA 3V50A 1N4OA 2WAFA 5HL1A 1QMEA 1W79A 1BZAA 3DTMA 1O07A 2ZQAA 4JXSA 3UE3A 2V1ZA 3NDEA 4L0LA 5EVIB 3GMWA 1PWDA 3OC2A 3BFDA 4Y0OA 1FCOA 4WYYA 4X55A 4E3IA 4IEDA 1N9BA 1WYBA 2WGWB 3IF6B 1M40A 3DWKA 3OCLA 4GOGA 5F83A 2I72A 3UPNA 1IEMA 2B5RA 2V20A 1CK3A 4OQIA 4BD1A 5I94A 3QNBA 2ZC3B 5CGXA 1IELA 3ZFZA 2ZQ9A 3HLBA 3S22A 3VP3A 4EBLA 1JWZA 3CG5A 4GB7A 4GNUA 3HLDA 4OQ0A 1YM1A 4S2KA 3NIAA 4UA6A 4X56A 1L0EA 3A3FA 1SCWA 2DCFA 2J9OA 2XDMA 1XA1A 1BLPA 1GHMA 3MKEA 4K91A 4PM7A 3HLCA 1BLHA 3GR2A 1GA9A 3EQVA 4BL2A 4DE2A 2C6WB 2XK1A 1CEGA 5FASA 3LCEA 3AGDA 3FKVA 4ZDXA 1WYCA 3BYDA 4N1XA 3BFEA 1K25A 3PAGA 2WKEA 4ZBEA 4WZ5C 4DKIA 4Y0TA 4GD8A 3GVBA 3AGFA 4C6YA 1ERQA 3M2KA 3UN7A 4DE1A 2WKHA 1ESIA 3DWZA 1JWVA 1MWSA 1IKIA 2CC1A 4UHUA 1RGYA 4LCMA 2PBYA 4UA7A 3Q81A 3Q07A 2ZLYA 5KSHA 5EVIC 1NYYA 3V3RA 4FSFA 4K0XA 3M6BA 3IWOA 3I7JA 2XF3A 4LV2A 3IF6C 1XX2A 2EXBA 5FI7A 4Y7PA 2HDQA 4P6BA 5E43A 3P09A 1MWRA 3HLGA 4E3MA 4OOLA 2XD1A 1E25A 1G6AA 3RJUA 5HAIA 2ZM8A 3UY6A 4DDYA 1Q2PA 3O88A 3N8SA 2XD5A 4KZ9A 3UDFA 1SKFA 3PBOA 4OH0A 5DTKA 4QU3A 5KMWA 2DRWA 1K38A 5TR7A 1PWGA 2Y2MA 2G2WA 3UE0A 5EOEA 5A91A 3WS4A 4E6XA 1KVLA 3QHYA 5GHXA 3BECA 5FSRA 1KVMA 1ONHA 3IXDA 4GD6A 3VMAA 1KE4A 3VP1A 4WMCA 1KDSA 2EX9A 5CHUA 4GN2A 4K0WA 4S2PA 1XA7A 3FV7A 2FFFB 2HP5A 1FSYA 2JE5A 4KQQA 1W8QA 1JTDA 2WYXA 1C3BA 1NZOA 5FAOA 1BUEA 4DRTA 3G34A 1PIOA 5DF9A 3IXHA 4GDBA 1J9MA 2ZM0A 4HBUA 2X02A 4GDNA 3BM6A 1PI4A 1BT5A 1K55C 4S2IA 1YT4A 1IYSA 4DE3A 4WELA 3UO9A 2EX6A 2ZQ8A 3BEBA 4R23A 5FQKA 5J8XA 4S2NC 1WE4A 3ISGA 3SH7A 3SS3A 4ZAMA 4PPRA 4WZ4A 5EPHA 1BULA 5FATA 5CECA 2PU4A 1H8YA 5HAPA 4JXGA 1ES2A 5JYPA 5M19A 3G4PA 4JXVA 1ALQA 2E8IA 5CEDA 3BFGA 2P74A 2FFYA 1YLTA 2H10A 2HPBA 1IKGA 1O7EA 3TSGA 3C4PA 1PW1A 1ZG4A 1L0FA 4RA7A 3OCNA 3IHAA 4N9KA 3GV9A 3M2JA 4BL3A 3C7UA 3NI9A 3IF5A 4OQHA 3MXRA 2EFUA 5CGSA 5E2GA 1EI5A 2HDUA 1XP4A 1Z6FA 3VP2A 3LO7A 2WZXA 3C4OA 1HD8A 4FH2A 4KZ3A 1PYYA 3G31A 1ZKJA 2VGKA 4XUXA 3W8KA 4KENB 1RGZA 3LY3A 1FCMA 1S0WA 3N6IA 4MBKA 5FA7A 3S1YA 3S4XA 3FKWA 1FOFA 1LI0A 2ZC7A 3IT9A 1JVJA 4MLLA 1YMSA 5FQQA 2WUQA 5HX9A 3HUMA 4E3JA 5TGFA 4KZ5A 5EVLA 4M3KA 3N4IA 4MBFA 4P0MA 4KG2A 4RVAA 5FAPA 1CI9A 3QNCA 2Q9MA 3CZDA 4KG5A 3NCKA 1KE3A 3A3JA 4ID4A 5DVAA 2X01A 5CERA 3VP4A 3W4QA 3ZNTA 5HAQA 1YLJA 5CGWA 5L2FA 4R4RA 4QJGA 1TEMA 4WEJA 2H5SA 1PZPA 3GQZA 2WGIA 3PBRA 4QY5A 2Y2PA 5EUAA 2WGVA 4KZ7A 3BLSA 5CEBA 1K54C 4GZBA 3MZFA 4PM8A 1JTGA 3ITBA 4E3OA 1YLPA 1GHIA 2ZM2A 4QY6A 4YINA 2HP6A 3FWLA 3A3EA 4U0TA 5F1GA 5FQJA 3N8LA 1MBLA 2XFTA 4U0XA 5GL9A 5IHVA 4PM5A 4RX3A 3VP0A 1KDWA 1ONGA 4OPZA 3Q7VB 5DF8A 4KZAA 1LI9A 3D4FA 3PBQA 4KZ8A 4X68A 4B4ZA 1G68A 5EOOA 5D3OA 2WK0A 5A93A 4YFMA 3EQUA 3HREA 3G30A 3UDXA 4DF6A 2G2UA 1EWZA 1NZUA 1L0DA 4DDSA 1DY6A 4BD0A 4U3TA 1ES5A 1K54A 1L2SA 3IXGA 2EX2A 3VOYA 4WZ5A 3WS1A 1E3UA 2Z2LB 2QPNA 4OPRA 3LEZA 4X69A 1ES4A 3V5MA 4CPKA 3PBSA 3G2YA 4BQMA 5TFQA 1E3UD 2BLSA 1S6RA 4OP5A 2OSUA 5FQ9A 4QHCA 5F82A 3W4OA 1U60A 4FCFA 5EVIA 5KZHA 1TDLA 1TDGA 4E6WA 2PU2A 3UDIA 2WGWA 4R4SA 3IF6A 5EVID 3PBNA 1GA0A 1FCNA 4JPMA 2IWBA 1K6SA 1K4FA 1YQSA 2X71A 1H8ZA 2ZQCA 3PBTA 3TOIA 4WMCD 3V39A 3ZG9B 5EECA 1CEFA 1FR6A 1GHPA 1KGGA 2Y2IA 1K57C 4UA9A 4PM6A 1DJBA 3CMZA 3OPLA 4ZJ3A
chains in the Genus database with same CATH superfamily
2BASA 4E3NA 1XFNA 5GHYA 1EROA 3WS5A 4WBGA 1VHMA 1K4EA 1DP6A 3OZHA 1KGFA 4XT2B 1VM1A 3NHQA 3PAEA 2Y2OA 2PAVP 1I5QA 4O7DA 3QP4A 1NWZA 4DJ3A 3IQAA 3ZG0A 1LSVA 3UPOA 2J3TD 1FSWA 5KIZA 3R4KA 1J3WA 3IXBA 5FI6A 5EM0A 3LIDA 1ZC2A 3ITAA 3E2LA 1ES3A 1ODVA 2HDSA 1DJCA 4QWOA 1L0GA 3CJMA 2MJ6A 4B88A 1OPXA 5KSCA 3E2KA 1PZOA 5GLAA 1L3LA 3S7PA 1JWPA 4KZ6A 4MBHA 2V0WA 4XXRA 2ZD8A 4EV4A 2W3EA 1VQQA 4JLFA 4L9FA 3EWKA 2Q9NA 3PTEA 3WRTA 4E3LA 4GS9B 2JN7A 3UPPA 3UB6A 4O01A 3VFHA 4D2OA 4RYEA 5A92A 4OONA 4MN5A 4ME4A 3WS2A 3GTCA 4R1GA 4JXWA 4I38A 5K5BA 1HVBA 4HJ6A 3NECA 3MXSA 3LIBA 1W63M 2H0YA 2WKIA 3LY4A 1MWUA 3PXPA 1XJ4A 3LYXA 1UWPX 3ZG7B 3H82B 2XFSA 4EBPA 4LV1A 2XR0A 5FAQA 1AXBA 3GRJA 2JCHA 2WKQA 2LB9A 2AVXA 4OLGA 2HV1A 1NRJA 1S4SA 3BRMA 4P6ZM 5I5LA 5M18A 2JKFA 2UWXA 3NBLA 4LCLA 1D06A 2GNXA 2OAP1 1IOUA 1MKIA 1IYOA 3RFBA 4KQOA 3ZYTA 3HUOA 5U47A 2J8YA 1BSGA 1OTDA 4OPQA 3JYIA 5HZHA 1HZOA 3U2AA 5L09A 4PMAA 5LBRA 5A90A 3GSGA 2JC7A 4KZBA 5DJTA 3WS0A 5IU1A 2ZC5B 4BJPA 4JF6A 5E2FA 4A5RA 4XUZA 3BLMA 4RX2A 2JKRI 2XQZA 5F5YA 1NYMA 5AJGA 3ZG8B 3HJIA 2IWCA 3SS4A 4C75A 3MS6A 4IVKA 1SKOB 5HWTA 5HD3A 1LL5A 5CTMA 3V50A 4ZRRA 1O07A 4EUVA 4X55A 4E3IA 1N9BA 1G6OA 5HWWA 1G5UA 1IEMA 4BD1A 4HP9A 2ZL1B 3LI9A 3VP3A 2PBDP 4X56A 3A3FA 2VA0A 1XA1A 4K91A 3EEHA 2Y8HA 1TS6A 2CMNA 3C8CA 5FASA 2JKGA 3CUEC 3T4KA 3AGFA 3M2KA 1RGYA 3BQAA 2ZLYA 3KSGA 4K0XA 5FI7A 4Y7PA 2HDQA 4CLCD 1MWRA 3CUEA 4Y3IA 4NXFA 2VV8A 1Q2PA 4QU3A 3F1OA 1XJ3A 3L7HA 1NLZA 5EM1A 4GD6A 2W1RA 1MC0A 3FV7A 1FSYA 2JE5A 1JTDA 2WYXA 1C3BA 5FAOA 3G34A 2ZL1A 4GDBA 2ZM0A 2X02A 3T1RA 1S1ZA 1EW0A 1YT4A 3QP6A 4F3LB 3UO9A 3E4PA 3UB5P 4EQ1A 2ZQ8A 4R23A 5J8XA 3LR4A 1H8YA 4JXGA 4II7A 1YLTA 1O7EA 1VEUA 1W63Q 3IHAA 4N9KA 3S7OA 3C7UA 3NI9A 4OQHA 2EFUA 5HPFA 1LSXA 1HD8A 4I3JA 3W8KA 2QHKA 3KYEA 3TRCA 4PKYA 4I3AA 5FA7A 3CPTB 3V67A 5FQQA 1JVJA 1YMSA 2WUQA 3HUMA 5EVLA 4M3KA 1T18A 5FAPA 4RVAA 1HLUP 3LEQA 4KG5A 2M7UA 3DTEA 1G28A 5DVAA 1JNUA 5CERA 5CGWA 4R4RA 3B42A 4R70A 2WGVA 3C38A 1GHIA 4YINA 1KOUA 3A3EA 2BTFP 1MBLA 3Q7VB 3PBQA 4B4ZA 3G30A 3MQQA 2Y79A 2QKPA 1NZUA 1T19A 4BD0A 4U3TA 2ZOHA 3WS1A 2QPNA 4X69A 4CPKA 1ES4A 2W0NA 3G2YA 5TFQA 1S6RA 5FQ9A 5F82A 1T1BA 4EU0A 2VGLM 1TDGA 4R4SA 3IF6A 1PNEA 3TOIA 1K4FA 3V39A 5EECA 1FR6A 3S7NA 3K3DA 1DJBA 5HDSA 3IWIA 4JBFA 3G6OA 4CLCE 3VFFA 4BENA 5E2EA 3P7NA 4HJ4A 4I39A 2ZMAA 1ESUA 2EXAA 3LFVA 4FD8A 2Y4AA 3IWQA 3IS2A 2DNSA 1OJGA 2DMWA 2VK3A 2GZAA 3IX3A 3G35A 5GHZA 4R3JA 5HD5A 4NXBA 2Y59A 3PYPA 4EBNA 3QP2A 2QMIA 3IHBA 2XH9A 5DTSA 3SZTA 5J7EA 3ZHHA 4LENA 2FH5A 3Q7VA 5AQAA 5CXWA 3ZG5A 4S2NA 3D9YA 4H8RA 3O86A 1LLBA 1YLWA 2HP9A 1XPBA 5M1AA 3O87A 3OPHA 4QPRA 1Z09A 2O99A 5J3WA 1NXYA 1IFQA 2WAEA 3OPRA 2ZC6B 3HUNA 4HY8A 2VLGA 1XGJA 4R3AA 1BLCA 2HZ5A 3BY9A 4HOIA 4R0QA 2W3FA 4JGOA 3G2ZA 2B95A 4OVDA 3ULFA 1Q2QA 4KQRA 4IUHA 3H9WA 3HJKA 3VOZA 1SDEA 4EUZA 2A3UA 2RCXA 3SH8A 3MZDA 3KYQA 1DP8A 1I2WA 2KX6A 1PI5A 3CWFA 1K56A 1N9OA 1K56D 1PRQA 5E2HA 3B3XA 2A24B 3A3DA 1SHVA 3SW1A 2K7SA 3SOIA 3GDIA 3AGEA 3MFDA 1GSXA 3N8RA 4UQIM 3Q1FA 5CTNA 5IT5A 4FUWA 4BBVA 1BTLA 2W3DA 5F68A 1E4DA 4GCZA 1YLZA 1FILA 4N9LA 1YKDA 3LI8A 1IYQA 1FQGA 2KLIA 4EXOA 3D3OA 5HARA 3HL9A 4OLDA 3FPWA 1ERMA 2INWA 4MNRA 2J9PA 2VKSA 5GLDA 1F5MA 4PM9A 2HJ9C 2V2FF 4Y13A 2K31A 3HVFA 2GX5A 3IH9A 3OPPA 1XJ6A 2WZZA 2Y2JA 2ZQDA 3RXXA 5FQIA 4G3WA 4Y0UA 2C5WB 4ZJ2A 2JBFA 4IBXA 4JGRA 5C5KA 2Y91A 1YPRA 4WM9A 3TJZC 1MPLA 1MXOA 3WRZA 1IYPA 3UNWA 3W4PA 1N4OA 2HJEA 1BZAA 3DTMA 2V1ZA 3NDEA 2A24A 3GMWA 4GLQA 1FCOA 4WYYA 4IEDA 1WYBA 2WGWB 1N9LA 1M40A 5F83A 2B5RA 4D60A 3JVVA 3LIAA 2VX8A 3ZFZA 2ZQ9A 3NOTC 3B33A 3HLDA 5MC7A 3KSFA 1SCWA 2V8FA 1GHMA 2IA2A 1S4RA 1GA9A 2C6WB 2XK1A 2YKHA 4Y17A 3LCEA 3FKVA 4K08A 4XT2A 1XJ2A 3BFEA 1K25A 2JKTM 4WZ5C 2P04A 1ERQA 4DE1A 2GJ3A 5J4EA 1MWSA 1IKIA 2Q0OA 3Q07A 2VV7A 1NYYA 3M6BA 3IWOA 2JHEA 4LV2A 2EXBA 3T12B 3P09A 3PR6A 4OOLA 3RJUA 5HAIA 2ZM8A 4DDYA 4KZ9A 3UDFA 5KMWA 1K38A 5TR7A 5A91A 2VGLS 3EGXC 3QHYA 1H0MA 3BECA 5FSRA 3IXDA 3NJAA 1KE4A 4WMCA 3BJNA 4GS9A 2FFFB 5HL6A 1NZOA 1BUEA 4ETXA 3B47A 2P08A 4HBUA 3BM6A 1PI4A 1K55C 1IYSA 4KUOA 4DE3A 1SZVA 1X0OA 3P01A 3BWLA 5HAPA 1ES2A 3G4PA 1GSVA 1UGUA 3BFGA 3ZQ5A 4RA7A 1MZUA 3M2JA 2XA7S 3H82A 2Z6CA 4BL3A 3IF5A 3F1NB 1BYWA 2PD8A 3MXRA 5CGSA 5E2GA 2HDUA 1Z6FA 3LO7A 1NLYA 3C4OA 4RQ9A 3BQ8A 1Y4OA 4XUXA 2EWWA 1FCMA 4EETB 1S0WA 3N6IA 3LIEA 4O0PA 4DJ2A 5TGFA 4KZ5A 3N4IA 4P0MA 3E4QA 3QP5A 3CZDA 1KE3A 4Y15A 3ZNTA 2KDKA 3IBJA 4MMNA 2H5SA 3T4QA 2NUPC 3MFXA 4JGQA 1K54C 1JTGA 4E3OA 1YLPA 3CAXA 4QY6A 4ESPA 1KDWA 1ONGA 5IS1A 2W1TB 4CLCC 1LI9A 3F1PB 4H6JB 3EQUA 3HREA 4FTXA 4R6LA 1K54A 2W3HA 2QYBA 3LEZA 1SKOA 3JVUA 3A0VA 2K2NA 3F1NA 1OTEA 3T4SA 1U60A 4GJ4A 3UDIA 3KX0X 1S1YA 3W4OA 2IWBA 1K6SA 3PBTA 3VE3A 1KGGA 2Y2IA 4UA9A 4PM6A 4WL9A 3CMZA 3OPLA 4HP4A 2OV5A 4PKYG 4LV0A 1H5XA 1MWTA 4S2OA 3HLEA 1P9WA 1NY0A 5EVEA 4WEKA 2J80A 2Y2HA 4WN5A 3RXWA 3U4LP 2OLVA 4S2LA 2VEAA 2OAQ1 4MN7A 2XROA 2GDNA 1P9RA 3KSHA 4ZTKA 3E0YA 4LFUA 1FR1A 2ZC4B 5FEFA 1H8MA 2Y2NA 3EEAA 5F69A 4H6JA 1P0ZA 1KGEA 4JF4A 3SS5A 3VV4A 3Q7ZA 2YKFA 2H0TA 4Q0HA 4BMWA 5G4ZA 2VJWA 3V3SA 5AVFA 3UE1A 4EERA 3MF0A 4OOYA 2J3WA 4HESA 3NOUC 4X25A 1KE0A 2XEPA 3DW0A 1P97A 4X1MA 2R9XA 5FI2A 4ZJ1A 2Z6DA 3T4TA 1YMXA 3K2NA 1TD5A 3HCYA 4BLMA 2A49A 2OLUA 2ZJ9A 3FPVA 3NDGA 4F3LA 3VSLA 2ZMFA 5EFWA 3ZCZA 4Z9QA 2EFXA 5L8MA 3H7WB 4OKPA 4B4XA 3S7QA 2VGJA 3R7WB 4ARZB 4R3BA 1Y54A 1XGIA 2PYPA 1F9IA 4N92A 3K3CA 3ZGAB 3A3IA 3MZEA 3FZCA 4E3KA 2PDRA 4G3VA 4P6ZS 1W8YA 2R9WA 4B9OA 3MSHA 1XKZA 1PW8A 1YAXA 5L07A 4QB8A 4DXBA 5BOHA 4GKUA 3CPTA 3MXQA 3OOVA 4P87A 4HEFA 4MDZA 4OP8A 5AQBA 3E4OA 3FG8A 4NKPA 2IWDA 1QMFA 4GHIB 4N1HA 5EE8A 2ZQ7A 5HFOA 3ZNYA 1LL8A 4IHQA 3MMHA 2O9BA 3LR5A 1I2SA 1NRFA 4KZ4A 4QD4A 3VOLA 2QJ5A 5DTTA 2J7VA 4Y5FA 1CI8A 1VB6A 2PR5A 1HTZA 1OMEA 2W3GA 4OPYA 1A0KA 1H3QA 3T50A 5HL1A 5HSQA 1W79A 1OT9A 2ZQAA 1TS0A 3UE3A 4Q0JA 5EVIB 4Y0OA 1PWDA 5DKLA 4MCWA 1S66L 3OCLA 4GOGA 2I72A 3UPNA 1CK3A 3TW8A 3CLOA 4HI4A 2ZC3B 4LRZE 1TS7A 3QP8A 3S22A 3CG5A 4GB7A 4OQ0A 3NIAA 4UA6A 4NXGA 2DCFA 2XDMA 4PM7A 2L1MA 1BLPA 3HLCA 1BLHA 3GR2A 5L10A 2XSSA 1CEGA 3AGDA 2PT7A 5DFXA 4GHIA 2H28A 3BYDA 1ZHHB 3MQOA 3D72A 5DFYA 4ZBEA 3ICYA 4C6YA 4WUJA 3UN7A 4WLAA 3LR3A 3JPUA 1JWVA 4Y2FA 2OWHA 4LCMA 2V1BA 2PBYA 4UA7A 3Q81A 5KSHA 5EVIC 3V3RA 3C2WA 1XX2A 1D7EA 5E43A 1G6AA 3UY6A 5DJUA 4IJGA 1SKFA 3PBOA 2DRWA 2W27A 1F98A 1PWGA 2G2WA 3UE0A 1DRMA 4E6XA 1KVLA 5GHXA 2PRFA 3PHYA 3VMAA 3VP1A 2EX9A 4B93A 2ZBBA 4K0WA 4L9EA 1XA7A 4JGPA 2HP5A 2UV0E 1W8QA 2J3TC 1TS8A 4LRXC 4DRTA 5DF9A 1J9MA 2D01A 4S2IA 4CQHA 1BT5A 5TJJA 4WELA 2EX6A 3BEBA 4EW7A 3NOPC 4NEED 4PHTA 3ISGA 3SH7A 3SS3A 4ZAMA 4PPRA 5EPHA 5FATA 5CECA 5JYPA 5M19A 3DBAA 4JXVA 5CEDA 2FFYA 2H10A 2HPBA 3TSGA 3C4PA 1ZG4A 3OCNA 3GV9A 2JKTI 2I9VA 3MJQA 3VP2A 2WZXA 1OTIA 4HIAA 1PYYA 5G4YA 2VGKA 3C30A 3GECA 3LY3A 4KUKA 1FOFA 3QP1A 3IT9A 4MLLA 4E3JA 4M4XA 4MBFA 1CI9A 4ID4A 2X01A 3A3JA 5HAQA 1YLJA 2P7JA 1F2KA 4QJGA 2PR6A 4Z1WA 1PZPA 3GQZA 2WGIA 2B02A 1CQAA 1OJ5A 4QY5A 2Y2PA 5FEGA 4GZBA 4PM8A 3A0RA 2ZM2A 1Y28A 5F1GA 5FQJA 3N8LA 2XFTA 4U0XA 5GL9A 5IHVA 4PM5A 1D1JA 1VETB 4RX3A 3VP0A 5HDCA 4EEPA 5DF8A 2QWSA 4KZAA 3D4FA 2WK0A 4BBTA 4YFMA 4DF6A 2G2UA 4I5SA 4I3IA 1L0DA 3UB9A 1DY6A 4WF0A 3IXGA 1L2SA 2EX2A 3VOYA 4WZ5A 1E3UA 4O8GA 3PBSA 1K0KA 1E3UD 2BLSA 4OP5A 4LRYC 4QHCA 3KYZA 2L4RA 4E6WA 2PU2A 2WGWA 4ETZA 1FCNA 3BY8A 3LR0A 1YQSA 2X71A 1H8ZA 4WMCD 1UWNX 3ZG9B 1GHPA 1K57C 4ZJ3A 5DKKA 2QJ7A 4UAAA 3DTIA 4YWZA 5GLCA 1NJ4A 3BFFA 2XGNA 5CHJA 3CHWP 4S2MA 2Y2LA 1K57A 4X1LA 2Y2KA 4HH3A 4BBUA 3N7WA 1PWCA 2V9AA 1RP5A 4X6TA 1K55A 1BLSA 2HDRA 3VSKA 3A0SA 2D02A 1VETA 1V9YA 3M6HA 4CLCB 1T1AA 3IH8A 5JYOA 4DMZA 1LL9A 1OTBA 2BG1A 2P9VB 3FYZA 3MBZA 4EWFA 3LICA 2WADA 4HBTA 1V9ZA 3F1OB 5F1FA 2Y55A 2RL3A 3T4JA 2Z2MB 2G7UA 3VE4A 1ZTUA 5FDHA 3NULA 2XLNA 1SDNA 4EQIA 4OQGA 4DE0A 4DXCA 4Q0IA 3TG9A 5HW3A 2EA9A 2M1CA 2JKRM 2HGVA 5FDSA 3KSIA 4X53A 4EEUA 4P85A 3HLFA 1YLYA 2ZMVA 5FQMA 1W5DA 1TVFA 1LHYA 2QZ6A 1RCJA 1TF1A 4JF5A 3MR0A 5G18A 5A8BA 3OLOA 1T1CA 3O3VA 4KG6A 4MEZA 1ACFA 5CHMA 1K6RA 1VEUB 3NY4A 1DP9A 4C3QA 4OOMA 2V8CA 3C7VA 4IVIA 1MY8A 2Y2QA 3SH9A 1XFQA 4CLCA 3RTYA 1M6KA 3RH8B 4F94A 5DF7A 4UQIS 4Q8IA 2O0YA 5CRFA 2P9VA 4S2JA 3T4OA 2EX8A 5AQ9A 3T1QB 4CJNA 3ZVWA 3UMEA 4DN0A 1GCEA 1STZA 3WWXA 5AQ7A 3DAVA 3HBRA 3NC8A 2VV6A 3P98A 4NXEA 3KO6A 2WKPA 3L9KA 2VZWA 4E04A 4LV3A 5GLBA 3ZVTA 3C5AA 3Q82A 1DJAA 5FL3A 1CF0A 3ZDJA 4NK3A 4LLOB 5F6AA 2W1TA 3LGOA 3MKFA 3F1PA 1W7FA 1XXMA 3CI6A 1ZG6A 3T1SA 5CX7A 4FH4A 3BFCA 5TBMB 4NETA 2V0UA 2Y2GA 3HLWA 3G32A 1WA9A 4IBRA 4JKTA 2A2LA 2WAFA 1QMEA 3UB7A 4JXSA 4L0LA 3OC2A 3BFDA 3IF6B 3DWKA 4UEYA 4NG2A 4L9GA 4YOFA 1N9NA 2V20A 4OQIA 5I94A 3QNBA 3E98A 5CGXA 1IELA 4HHDA 3HLBA 4EBLA 1JWZA 1YSQA 4GNUA 4S2KA 1YM1A 2KOIA 1L0EA 2J9OA 3MKEA 3IX8A 4DE2A 1OT6A 3EQVA 4BL2A 4YNRA 3OBFA 4ZDXA 3IS2B 1WYCA 4N1XA 2WKRA 3PAGA 2WKEA 4DKIA 4Y0TA 4GD8A 3GVBA 2WKHA 4G3KA 1ESIA 3DWZA 3UB8A 2CC1A 2XRNA 4UHUA 3TE8A 4FSFA 3I7JA 2XF3A 4HH2A 3IF6C 4P6BA 4E3MA 3HLGA 2XD1A 1E25A 1AWIA 5TBMA 1MKMA 3O88A 3N8SA 2XD5A 4OH0A 5DTKA 2Y2MA 4HNBA 5EOEA 3EGDC 3WS4A 2PHYA 2OOLA 1KVMA 1ONHA 3IX4A 1KDSA 5CHUA 4GN2A 2ACGA 4S2PA 1OTAA 2LB5A 4KQQA 4KQDA 3UMDA 4AFIA 5EV0A 1PIOA 3LUQA 3IXHA 4GDNA 2HF6A 4MN6A 3LIFA 2O9CA 1LSWA 3EOIA 5FQKA 3T4LA 4S2NC 1WE4A 4WZ4A 1BULA 1FIKA 2PU4A 2O9AA 1ALQA 2E8IA 2P74A 3H7WA 1IKGA 5AVEA 1PW1A 3R7WA 1L0FA 1LT0A 4ARZA 2XA7M 1EI5A 3CITA 1XP4A 4FOFA 5HPIA 2ZOIA 2L0WA 4FH2A 4KZ3A 3G31A 1ZKJA 4KENB 1RGZA 4LPZA 3S4XA 3BW6A 4MBKA 3S1YA 3FKWA 1LI0A 2ZC7A 1YSPA 5HX9A 4IUKA 4BWIA 5HWVA 3T1XA 4PAUA 4KG2A 3QNCA 2Q9MA 3MQ0A 3NCKA 3W4QA 3VP4A 5L2FA 2E8JA 3DTKA 1TEMA 4WEJA 1CJFA 3PBRA 1GSWA 5EUAA 2PYRA 4KZ7A 1PFLA 3BLSA 5CEBA 3FC7A 3MZFA 3ITBA 2HP6A 3FWLA 3IBRA 4U0TA 4OPZA 2V1AA 4LGWA 4X68A 4KZ8A 2NUTC 1G68A 5EOOA 5D3OA 5A93A 2M7VA 2FZ0A 3UDXA 1EWZA 2B18A 1S67L 4DDSA 1ES5A 4EESA 2Z2LB 3O5YA 4HQAA 4OPRA 3V5MA 4BQMA 5HDDA 4GW9A 2OSUA 3UE6A 4FCFA 5EVIA 5KZHA 1TDLA 2EWVA 5EVID 3PBNA 4R38A 4JPMA 1GA0A 2R78A 2PD7A 2ZQCA 3W2ZA 1CEFA 4HJ3A 2OWJA
chains in the Genus database with same CATH topology
3IWIA 4JBFA 3VFFA 4LV0A 4UAAA 4BENA 4E3NA 5GHYA 1H5XA 1MWTA 1EROA 5E2EA 3WS5A 4S2OA 3HLEA 4WBGA 1NY0A 1K4EA 4WEKA 5GLCA 1NJ4A 2ZMAA 1ESUA 2EXAA 2Y2HA 3BFFA 3OZHA 2XGNA 3RXWA 1KGFA 2OLVA 2Y4AA 4FD8A 1VM1A 3PAEA 4S2LA 2Y2OA 5CHJA 3IWQA 1I5QA 4O7DA 4S2MA 2DNSA 3G35A 5GHZA 2Y2LA 4R3JA 1K57A 3IQAA 3ZG0A 2Y59A 3UPOA 2Y2KA 2GDNA 3N7WA 4ZTKA 4EBNA 2QMIA 1FSWA 1PWCA 3IHBA 1RP5A 2XH9A 1FR1A 1K55A 4X6TA 5DTSA 2ZC4B 1BLSA 2HDRA 3VSKA 3ZHHA 3IXBA 4LENA 5FI6A 2Y2NA 3M6HA 3Q7VA 1ZC2A 5AQAA 3IH8A 3ITAA 5CXWA 3E2LA 5JYOA 3ZG5A 1LL9A 4S2NA 1ES3A 2BG1A 2HDSA 1DJCA 1KGEA 1LLBA 2P9VB 3FYZA 3MBZA 3O86A 4H8RA 4JF4A 3SS5A 4EWFA 1YLWA 2WADA 1L0GA 3CJMA 4HBTA 2HP9A 3Q7ZA 4B88A 1XPBA 5F1FA 5KSCA 3E2KA 1PZOA 5GLAA 2H0TA 5M1AA 3O87A 3OPHA 2Y55A 1JWPA 4KZ6A 1NXYA 4MBHA 2RL3A 3V3SA 2WAEA 4XXRA 2ZD8A 3UE1A 3OPRA 2ZC6B 4EV4A 2Z2MB 3HUNA 1VQQA 4JLFA 4OOYA 5FDHA 1XGJA 2XLNA 4HESA 1BLCA 1KE0A 2XEPA 3DW0A 2Q9NA 3PTEA 3WRTA 4E3LA 1SDNA 4EQIA 3UPPA 4R0QA 4OQGA 2R9XA 4DE0A 5FI2A 3G2ZA 2OV5A 4ZJ1A 1YMXA 4DXCA 3VFHA 4OVDA 4D2OA 3TG9A 4RYEA 5HW3A 5A92A 4OONA 4BLMA 2A49A 1Q2QA 2OLUA 4KQRA 3WS2A 2ZJ9A 3NDGA 4X53A 3GTCA 3VSLA 4R1GA 4JXWA 4P85A 3HLFA 1YLYA 3VOZA 3ZCZA 1SDEA 5FQMA 1W5DA 1HVBA 1TVFA 4Z9QA 4EUZA 2EFXA 2RCXA 2QZ6A 2A3UA 1LHYA 1RCJA 3MXSA 3MZDA 4JF5A 1I2WA 5G18A 4OKPA 1PI5A 4B4XA 3O3VA 1K56A 2H0YA 2WKIA 4KG6A 4MEZA 3LY4A 1MWUA 5CHMA 1K6RA 2VGJA 3NY4A 3ZG7B 4R3BA 1K56D 1Y54A 2XFSA 4EBPA 1XGIA 4C3QA 4OOMA 4IVIA 3C7VA 5E2HA 1MY8A 3B3XA 2XR0A 2Y2QA 4LV1A 4N92A 3SH9A 5FAQA 1AXBA 3GRJA 3ZGAB 3A3DA 3A3IA 1M6KA 1SHVA 2JCHA 3MZEA 3SOIA 3FZCA 4OLGA 4E3KA 3AGEA 4F94A 5DF7A 4Q8IA 3MFDA 5CRFA 2P9VA 4S2JA 3N8RA 1W8YA 2EX8A 2R9WA 3BRMA 3Q1FA 5CTNA 5AQ9A 1XKZA 1PW8A 5M18A 4CJNA 3ZVWA 1BTLA 4QB8A 2UWXA 3SH8A 1GCEA 4DXBA 3NBLA 4LCLA 4GKUA 5BOHA 1E4DA 1YLZA 4N9LA 3WWXA 5AQ7A 1MKIA 3HBRA 3NC8A 4HEFA 4OP8A 4P87A 1IYOA 1IYQA 5AQBA 1FQGA 4KQOA 3P98A 5HARA 3HUOA 2IWDA 5U47A 2J8YA 3HL9A 1BSGA 1QMFA 4OLDA 1ERMA 4MNRA 2J9PA 4N1HA 4OPQA 5EE8A 4LV3A 5GLDA 4PM9A 5GLBA 3JYIA 2V2FF 2ZQ7A 3ZVTA 5HFOA 1HZOA 3ZNYA 3C5AA 3HVFA 4PMAA 5A90A 3GSGA 2JC7A 4KZBA 3IH9A 3OPPA 3Q82A 3WS0A 1DJAA 2ZC5B 2WZZA 2Y2JA 4BJPA 1I2SA 2ZQDA 3RXXA 3ZDJA 4NK3A 4JF6A 4Y0UA 5FQIA 5E2FA 2C5WB 4ZJ2A 1NRFA 4A5RA 2JBFA 3MKFA 4IBXA 4KZ4A 4XUZA 4QD4A 3BLMA 1W7FA 1XXMA 2XQZA 4RX2A 1ZG6A 2Y91A 1NYMA 5DTTA 2J7VA 4FH4A 3BFCA 4WM9A 3SS4A 2IWCA 3ZG8B 4NETA 1CI8A 4C75A 1HTZA 1OMEA 1MPLA 1MXOA 4IVKA 3WRZA 2Y2GA 3HLWA 3G32A 1IYPA 4OPYA 1LL5A 5CTMA 4IBRA 4JKTA 3UNWA 3W4PA 3V50A 1N4OA 2WAFA 5HL1A 1QMEA 1W79A 1BZAA 3DTMA 1O07A 2ZQAA 4JXSA 3UE3A 2V1ZA 3NDEA 4L0LA 5EVIB 3GMWA 1PWDA 3OC2A 3BFDA 4Y0OA 1FCOA 4WYYA 4X55A 4E3IA 4IEDA 1N9BA 1WYBA 2WGWB 3IF6B 1M40A 3DWKA 3OCLA 4GOGA 5F83A 2I72A 3UPNA 1IEMA 2B5RA 2V20A 1CK3A 4OQIA 4BD1A 5I94A 3QNBA 2ZC3B 5CGXA 1IELA 3ZFZA 2ZQ9A 3HLBA 3S22A 3VP3A 4EBLA 1JWZA 3CG5A 4GB7A 4GNUA 3HLDA 4OQ0A 1YM1A 4S2KA 3NIAA 4UA6A 4X56A 1L0EA 3A3FA 1SCWA 2DCFA 2J9OA 2XDMA 1XA1A 1BLPA 1GHMA 3MKEA 4K91A 4PM7A 3HLCA 1BLHA 3GR2A 1GA9A 3EQVA 4BL2A 4DE2A 2C6WB 2XK1A 1CEGA 5FASA 3LCEA 3AGDA 3FKVA 4ZDXA 1WYCA 3BYDA 4N1XA 3BFEA 1K25A 3PAGA 2WKEA 4ZBEA 4WZ5C 4DKIA 4Y0TA 4GD8A 3GVBA 3AGFA 4C6YA 1ERQA 3M2KA 3UN7A 4DE1A 2WKHA 1ESIA 3DWZA 1JWVA 1MWSA 1IKIA 2CC1A 4UHUA 1RGYA 4LCMA 2PBYA 4UA7A 3Q81A 3Q07A 2ZLYA 5KSHA 5EVIC 1NYYA 3V3RA 4FSFA 4K0XA 3M6BA 3IWOA 3I7JA 2XF3A 4LV2A 3IF6C 1XX2A 2EXBA 5FI7A 4Y7PA 2HDQA 4P6BA 5E43A 3P09A 1MWRA 3HLGA 4E3MA 4OOLA 2XD1A 1E25A 1G6AA 3RJUA 5HAIA 2ZM8A 3UY6A 4DDYA 1Q2PA 3O88A 3N8SA 2XD5A 4KZ9A 3UDFA 1SKFA 3PBOA 4OH0A 5DTKA 4QU3A 5KMWA 2DRWA 1K38A 5TR7A 1PWGA 2Y2MA 2G2WA 3UE0A 5EOEA 5A91A 3WS4A 4E6XA 1KVLA 3QHYA 5GHXA 3BECA 5FSRA 1KVMA 1ONHA 3IXDA 4GD6A 3VMAA 1KE4A 3VP1A 4WMCA 1KDSA 2EX9A 5CHUA 4GN2A 4K0WA 4S2PA 1XA7A 3FV7A 2FFFB 2HP5A 1FSYA 2JE5A 4KQQA 1W8QA 1JTDA 2WYXA 1C3BA 1NZOA 5FAOA 1BUEA 4DRTA 3G34A 1PIOA 5DF9A 3IXHA 4GDBA 1J9MA 2ZM0A 4HBUA 2X02A 4GDNA 3BM6A 1PI4A 1BT5A 1K55C 4S2IA 1YT4A 1IYSA 4DE3A 4WELA 3UO9A 2EX6A 2ZQ8A 3BEBA 4R23A 5FQKA 5J8XA 4S2NC 1WE4A 3ISGA 3SH7A 3SS3A 4ZAMA 4PPRA 4WZ4A 5EPHA 1BULA 5FATA 5CECA 2PU4A 1H8YA 5HAPA 4JXGA 1ES2A 5JYPA 5M19A 3G4PA 4JXVA 1ALQA 2E8IA 5CEDA 3BFGA 2P74A 2FFYA 1YLTA 2H10A 2HPBA 1IKGA 1O7EA 3TSGA 3C4PA 1PW1A 1ZG4A 1L0FA 4RA7A 3OCNA 3IHAA 4N9KA 3GV9A 3M2JA 4BL3A 3C7UA 3NI9A 3IF5A 4OQHA 3MXRA 2EFUA 5CGSA 5E2GA 1EI5A 2HDUA 1XP4A 1Z6FA 3VP2A 3LO7A 2WZXA 3C4OA 1HD8A 4FH2A 4KZ3A 1PYYA 3G31A 1ZKJA 2VGKA 4XUXA 3W8KA 4KENB 1RGZA 3LY3A 1FCMA 1S0WA 3N6IA 4MBKA 5FA7A 3S1YA 3S4XA 3FKWA 1FOFA 1LI0A 2ZC7A 3IT9A 1JVJA 4MLLA 1YMSA 5FQQA 2WUQA 5HX9A 3HUMA 4E3JA 5TGFA 4KZ5A 5EVLA 4M3KA 3N4IA 4MBFA 4P0MA 4KG2A 4RVAA 5FAPA 1CI9A 3QNCA 2Q9MA 3CZDA 4KG5A 3NCKA 1KE3A 3A3JA 4ID4A 5DVAA 2X01A 5CERA 3VP4A 3W4QA 3ZNTA 5HAQA 1YLJA 5CGWA 5L2FA 4R4RA 4QJGA 1TEMA 4WEJA 2H5SA 1PZPA 3GQZA 2WGIA 3PBRA 4QY5A 2Y2PA 5EUAA 2WGVA 4KZ7A 3BLSA 5CEBA 1K54C 4GZBA 3MZFA 4PM8A 1JTGA 3ITBA 4E3OA 1YLPA 1GHIA 2ZM2A 4QY6A 4YINA 2HP6A 3FWLA 3A3EA 4U0TA 5F1GA 5FQJA 3N8LA 1MBLA 2XFTA 4U0XA 5GL9A 5IHVA 4PM5A 4RX3A 3VP0A 1KDWA 1ONGA 4OPZA 3Q7VB 5DF8A 4KZAA 1LI9A 3D4FA 3PBQA 4KZ8A 4X68A 4B4ZA 1G68A 5EOOA 5D3OA 2WK0A 5A93A 4YFMA 3EQUA 3HREA 3G30A 3UDXA 4DF6A 2G2UA 1EWZA 1NZUA 1L0DA 4DDSA 1DY6A 4BD0A 4U3TA 1ES5A 1K54A 1L2SA 3IXGA 2EX2A 3VOYA 4WZ5A 3WS1A 1E3UA 2Z2LB 2QPNA 4OPRA 3LEZA 4X69A 1ES4A 3V5MA 4CPKA 3PBSA 3G2YA 4BQMA 5TFQA 1E3UD 2BLSA 1S6RA 4OP5A 2OSUA 5FQ9A 4QHCA 5F82A 3W4OA 1U60A 4FCFA 5EVIA 5KZHA 1TDLA 1TDGA 4E6WA 2PU2A 3UDIA 2WGWA 4R4SA 3IF6A 5EVID 3PBNA 1GA0A 1FCNA 4JPMA 2IWBA 1K6SA 1K4FA 1YQSA 2X71A 1H8ZA 2ZQCA 3PBTA 3TOIA 4WMCD 3V39A 3ZG9B 5EECA 1CEFA 1FR6A 1GHPA 1KGGA 2Y2IA 1K57C 4UA9A 4PM6A 1DJBA 3CMZA 3OPLA 4ZJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWI A;  4JBF A;  3VFF A;  4LV0 A;  4UAA A;  4BEN A;  4E3N A;  5GHY A;  1H5X A;  1MWT A;  1ERO A;  5E2E A;  3WS5 A;  4S2O A;  3HLE A;  4WBG A;  1NY0 A;  1K4E A;  4WEK A;  5GLC A;  1NJ4 A;  2ZMA A;  1ESU A;  2EXA A;  2Y2H A;  3BFF A;  3OZH A;  2XGN A;  3RXW A;  1KGF A;  2OLV A;  2Y4A A;  4FD8 A;  1VM1 A;  3PAE A;  4S2L A;  2Y2O A;  5CHJ A;  3IWQ A;  1I5Q A;  4O7D A;  4S2M A;  2DNS A;  3G35 A;  5GHZ A;  2Y2L A;  4R3J A;  1K57 A;  3IQA A;  3ZG0 A;  2Y59 A;  3UPO A;  2Y2K A;  2GDN A;  3N7W A;  4ZTK A;  4EBN A;  2QMI A;  1FSW A;  1PWC A;  3IHB A;  1RP5 A;  2XH9 A;  1FR1 A;  1K55 A;  4X6T A;  5DTS A;  2ZC4 B;  1BLS A;  2HDR A;  3VSK A;  3ZHH A;  3IXB A;  4LEN A;  5FI6 A;  2Y2N A;  3M6H A;  3Q7V A;  1ZC2 A;  5AQA A;  3IH8 A;  3ITA A;  5CXW A;  3E2L A;  5JYO A;  3ZG5 A;  1LL9 A;  4S2N A;  1ES3 A;  2BG1 A;  2HDS A;  1DJC A;  1KGE A;  1LLB A;  2P9V B;  3FYZ A;  3MBZ A;  3O86 A;  4H8R A;  4JF4 A;  3SS5 A;  4EWF A;  1YLW A;  2WAD A;  1L0G A;  3CJM A;  4HBT A;  2HP9 A;  3Q7Z A;  4B88 A;  1XPB A;  5F1F A;  5KSC A;  3E2K A;  1PZO A;  5GLA A;  2H0T A;  5M1A A;  3O87 A;  3OPH A;  2Y55 A;  1JWP A;  4KZ6 A;  1NXY A;  4MBH A;  2RL3 A;  3V3S A;  2WAE A;  4XXR A;  2ZD8 A;  3UE1 A;  3OPR A;  2ZC6 B;  4EV4 A;  2Z2M B;  3HUN A;  1VQQ A;  4JLF A;  4OOY A;  5FDH A;  1XGJ A;  2XLN A;  4HES A;  1BLC A;  1KE0 A;  2XEP A;  3DW0 A;  2Q9N A;  3PTE A;  3WRT A;  4E3L A;  1SDN A;  4EQI A;  3UPP A;  4R0Q A;  4OQG A;  2R9X A;  4DE0 A;  5FI2 A;  3G2Z A;  2OV5 A;  4ZJ1 A;  1YMX A;  4DXC A;  3VFH A;  4OVD A;  4D2O A;  3TG9 A;  4RYE A;  5HW3 A;  5A92 A;  4OON A;  4BLM A;  2A49 A;  1Q2Q A;  2OLU A;  4KQR A;  3WS2 A;  2ZJ9 A;  3NDG A;  4X53 A;  3GTC A;  3VSL A;  4R1G A;  4JXW A;  4P85 A;  3HLF A;  1YLY A;  3VOZ A;  3ZCZ A;  1SDE A;  5FQM A;  1W5D A;  1HVB A;  1TVF A;  4Z9Q A;  4EUZ A;  2EFX A;  2RCX A;  2QZ6 A;  2A3U A;  1LHY A;  1RCJ A;  3MXS A;  3MZD A;  4JF5 A;  1I2W A;  5G18 A;  4OKP A;  1PI5 A;  4B4X A;  3O3V A;  1K56 A;  2H0Y A;  2WKI A;  4KG6 A;  4MEZ A;  3LY4 A;  1MWU A;  5CHM A;  1K6R A;  2VGJ A;  3NY4 A;  3ZG7 B;  4R3B A;  1K56 D;  1Y54 A;  2XFS A;  4EBP A;  1XGI A;  4C3Q A;  4OOM A;  4IVI A;  3C7V A;  5E2H A;  1MY8 A;  3B3X A;  2XR0 A;  2Y2Q A;  4LV1 A;  4N92 A;  3SH9 A;  5FAQ A;  1AXB A;  3GRJ A;  3ZGA B;  3A3D A;  3A3I A;  1M6K A;  1SHV A;  2JCH A;  3MZE A;  3SOI A;  3FZC A;  4OLG A;  4E3K A;  3AGE A;  4F94 A;  5DF7 A;  4Q8I A;  3MFD A;  5CRF A;  2P9V A;  4S2J A;  3N8R A;  1W8Y A;  2EX8 A;  2R9W A;  3BRM A;  3Q1F A;  5CTN A;  5AQ9 A;  1XKZ A;  1PW8 A;  5M18 A;  4CJN A;  3ZVW A;  1BTL A;  4QB8 A;  2UWX A;  3SH8 A;  1GCE A;  4DXB A;  3NBL A;  4LCL A;  4GKU A;  5BOH A;  1E4D A;  1YLZ A;  4N9L A;  3WWX A;  5AQ7 A;  1MKI A;  3HBR A;  3NC8 A;  4HEF A;  4OP8 A;  4P87 A;  1IYO A;  1IYQ A;  5AQB A;  1FQG A;  4KQO A;  3P98 A;  5HAR A;  3HUO A;  2IWD A;  5U47 A;  2J8Y A;  3HL9 A;  1BSG A;  1QMF A;  4OLD A;  1ERM A;  4MNR A;  2J9P A;  4N1H A;  4OPQ A;  5EE8 A;  4LV3 A;  5GLD A;  4PM9 A;  5GLB A;  3JYI A;  2V2F F;  2ZQ7 A;  3ZVT A;  5HFO A;  1HZO A;  3ZNY A;  3C5A A;  3HVF A;  4PMA A;  5A90 A;  3GSG A;  2JC7 A;  4KZB A;  3IH9 A;  3OPP A;  3Q82 A;  3WS0 A;  1DJA A;  2ZC5 B;  2WZZ A;  2Y2J A;  4BJP A;  1I2S A;  2ZQD A;  3RXX A;  3ZDJ A;  4NK3 A;  4JF6 A;  4Y0U A;  5FQI A;  5E2F A;  2C5W B;  4ZJ2 A;  1NRF A;  4A5R A;  2JBF A;  3MKF A;  4IBX A;  4KZ4 A;  4XUZ A;  4QD4 A;  3BLM A;  1W7F A;  1XXM A;  2XQZ A;  4RX2 A;  1ZG6 A;  2Y91 A;  1NYM A;  5DTT A;  2J7V A;  4FH4 A;  3BFC A;  4WM9 A;  3SS4 A;  2IWC A;  3ZG8 B;  4NET A;  1CI8 A;  4C75 A;  1HTZ A;  1OME A;  1MPL A;  1MXO A;  4IVK A;  3WRZ A;  2Y2G A;  3HLW A;  3G32 A;  1IYP A;  4OPY A;  1LL5 A;  5CTM A;  4IBR A;  4JKT A;  3UNW A;  3W4P A;  3V50 A;  1N4O A;  2WAF A;  5HL1 A;  1QME A;  1W79 A;  1BZA A;  3DTM A;  1O07 A;  2ZQA A;  4JXS A;  3UE3 A;  2V1Z A;  3NDE A;  4L0L A;  5EVI B;  3GMW A;  1PWD A;  3OC2 A;  3BFD A;  4Y0O A;  1FCO A;  4WYY A;  4X55 A;  4E3I A;  4IED A;  1N9B A;  1WYB A;  2WGW B;  3IF6 B;  1M40 A;  3DWK A;  3OCL A;  4GOG A;  5F83 A;  2I72 A;  3UPN A;  1IEM A;  2B5R A;  2V20 A;  1CK3 A;  4OQI A;  4BD1 A;  5I94 A;  3QNB A;  2ZC3 B;  5CGX A;  1IEL A;  3ZFZ A;  2ZQ9 A;  3HLB A;  3S22 A;  3VP3 A;  4EBL A;  1JWZ A;  3CG5 A;  4GB7 A;  4GNU A;  3HLD A;  4OQ0 A;  1YM1 A;  4S2K A;  3NIA A;  4UA6 A;  4X56 A;  1L0E A;  3A3F A;  1SCW A;  2DCF A;  2J9O A;  2XDM A;  1XA1 A;  1BLP A;  1GHM A;  3MKE A;  4K91 A;  4PM7 A;  3HLC A;  1BLH A;  3GR2 A;  1GA9 A;  3EQV A;  4BL2 A;  4DE2 A;  2C6W B;  2XK1 A;  1CEG A;  5FAS A;  3LCE A;  3AGD A;  3FKV A;  4ZDX A;  1WYC A;  3BYD A;  4N1X A;  3BFE A;  1K25 A;  3PAG A;  2WKE A;  4ZBE A;  4WZ5 C;  4DKI A;  4Y0T A;  4GD8 A;  3GVB A;  3AGF A;  4C6Y A;  1ERQ A;  3M2K A;  3UN7 A;  4DE1 A;  2WKH A;  1ESI A;  3DWZ A;  1JWV A;  1MWS A;  1IKI A;  2CC1 A;  4UHU A;  1RGY A;  4LCM A;  2PBY A;  4UA7 A;  3Q81 A;  3Q07 A;  2ZLY A;  5KSH A;  5EVI C;  1NYY A;  3V3R A;  4FSF A;  4K0X A;  3M6B A;  3IWO A;  3I7J A;  2XF3 A;  4LV2 A;  3IF6 C;  1XX2 A;  2EXB A;  5FI7 A;  4Y7P A;  2HDQ A;  4P6B A;  5E43 A;  3P09 A;  1MWR A;  3HLG A;  4E3M A;  4OOL A;  2XD1 A;  1E25 A;  1G6A A;  3RJU A;  5HAI A;  2ZM8 A;  3UY6 A;  4DDY A;  1Q2P A;  3O88 A;  3N8S A;  2XD5 A;  4KZ9 A;  3UDF A;  1SKF A;  3PBO A;  4OH0 A;  5DTK A;  4QU3 A;  5KMW A;  2DRW A;  1K38 A;  5TR7 A;  1PWG A;  2Y2M A;  2G2W A;  3UE0 A;  5EOE A;  5A91 A;  3WS4 A;  4E6X A;  1KVL A;  3QHY A;  5GHX A;  3BEC A;  5FSR A;  1KVM A;  1ONH A;  3IXD A;  4GD6 A;  3VMA A;  1KE4 A;  3VP1 A;  4WMC A;  1KDS A;  2EX9 A;  5CHU A;  4GN2 A;  4K0W A;  4S2P A;  1XA7 A;  3FV7 A;  2FFF B;  2HP5 A;  1FSY A;  2JE5 A;  4KQQ A;  1W8Q A;  1JTD A;  2WYX A;  1C3B A;  1NZO A;  5FAO A;  1BUE A;  4DRT A;  3G34 A;  1PIO A;  5DF9 A;  3IXH A;  4GDB A;  1J9M A;  2ZM0 A;  4HBU A;  2X02 A;  4GDN A;  3BM6 A;  1PI4 A;  1BT5 A;  1K55 C;  4S2I A;  1YT4 A;  1IYS A;  4DE3 A;  4WEL A;  3UO9 A;  2EX6 A;  2ZQ8 A;  3BEB A;  4R23 A;  5FQK A;  5J8X A;  4S2N C;  1WE4 A;  3ISG A;  3SH7 A;  3SS3 A;  4ZAM A;  4PPR A;  4WZ4 A;  5EPH A;  1BUL A;  5FAT A;  5CEC A;  2PU4 A;  1H8Y A;  5HAP A;  4JXG A;  1ES2 A;  5JYP A;  5M19 A;  3G4P A;  4JXV A;  1ALQ A;  2E8I A;  5CED A;  3BFG A;  2P74 A;  2FFY A;  1YLT A;  2H10 A;  2HPB A;  1IKG A;  1O7E A;  3TSG A;  3C4P A;  1PW1 A;  1ZG4 A;  1L0F A;  4RA7 A;  3OCN A;  3IHA A;  4N9K A;  3GV9 A;  3M2J A;  4BL3 A;  3C7U A;  3NI9 A;  3IF5 A;  4OQH A;  3MXR A;  2EFU A;  5CGS A;  5E2G A;  1EI5 A;  2HDU A;  1XP4 A;  1Z6F A;  3VP2 A;  3LO7 A;  2WZX A;  3C4O A;  1HD8 A;  4FH2 A;  4KZ3 A;  1PYY A;  3G31 A;  1ZKJ A;  2VGK A;  4XUX A;  3W8K A;  4KEN B;  1RGZ A;  3LY3 A;  1FCM A;  1S0W A;  3N6I A;  4MBK A;  5FA7 A;  3S1Y A;  3S4X A;  3FKW A;  1FOF A;  1LI0 A;  2ZC7 A;  3IT9 A;  1JVJ A;  4MLL A;  1YMS A;  5FQQ A;  2WUQ A;  5HX9 A;  3HUM A;  4E3J A;  5TGF A;  4KZ5 A;  5EVL A;  4M3K A;  3N4I A;  4MBF A;  4P0M A;  4KG2 A;  4RVA A;  5FAP A;  1CI9 A;  3QNC A;  2Q9M A;  3CZD A;  4KG5 A;  3NCK A;  1KE3 A;  3A3J A;  4ID4 A;  5DVA A;  2X01 A;  5CER A;  3VP4 A;  3W4Q A;  3ZNT A;  5HAQ A;  1YLJ A;  5CGW A;  5L2F A;  4R4R A;  4QJG A;  1TEM A;  4WEJ A;  2H5S A;  1PZP A;  3GQZ A;  2WGI A;  3PBR A;  4QY5 A;  2Y2P A;  5EUA A;  2WGV A;  4KZ7 A;  3BLS A;  5CEB A;  1K54 C;  4GZB A;  3MZF A;  4PM8 A;  1JTG A;  3ITB A;  4E3O A;  1YLP A;  1GHI A;  2ZM2 A;  4QY6 A;  4YIN A;  2HP6 A;  3FWL A;  3A3E A;  4U0T A;  5F1G A;  5FQJ A;  3N8L A;  1MBL A;  2XFT A;  4U0X A;  5GL9 A;  5IHV A;  4PM5 A;  4RX3 A;  3VP0 A;  1KDW A;  1ONG A;  4OPZ A;  3Q7V B;  5DF8 A;  4KZA A;  1LI9 A;  3D4F A;  3PBQ A;  4KZ8 A;  4X68 A;  4B4Z A;  1G68 A;  5EOO A;  5D3O A;  2WK0 A;  5A93 A;  4YFM A;  3EQU A;  3HRE A;  3G30 A;  3UDX A;  4DF6 A;  2G2U A;  1EWZ A;  1NZU A;  1L0D A;  4DDS A;  1DY6 A;  4BD0 A;  4U3T A;  1ES5 A;  1K54 A;  1L2S A;  3IXG A;  2EX2 A;  3VOY A;  4WZ5 A;  3WS1 A;  1E3U A;  2Z2L B;  2QPN A;  4OPR A;  3LEZ A;  4X69 A;  1ES4 A;  3V5M A;  4CPK A;  3PBS A;  3G2Y A;  4BQM A;  5TFQ A;  1E3U D;  2BLS A;  1S6R A;  4OP5 A;  2OSU A;  5FQ9 A;  4QHC A;  5F82 A;  3W4O A;  1U60 A;  4FCF A;  5EVI A;  5KZH A;  1TDL A;  1TDG A;  4E6W A;  2PU2 A;  3UDI A;  2WGW A;  4R4S A;  3IF6 A;  5EVI D;  3PBN A;  1GA0 A;  1FCN A;  4JPM A;  2IWB A;  1K6S A;  1K4F A;  1YQS A;  2X71 A;  1H8Z A;  2ZQC A;  3PBT A;  3TOI A;  4WMC D;  3V39 A;  3ZG9 B;  5EEC A;  1CEF A;  1FR6 A;  1GHP A;  1KGG A;  2Y2I A;  1K57 C;  4UA9 A;  4PM6 A;  1DJB A;  3CMZ A;  3OPL A;  4ZJ3 A; 
#chains in the Genus database with same CATH topology
 2BAS A;  4E3N A;  1XFN A;  5GHY A;  1ERO A;  3WS5 A;  4WBG A;  1VHM A;  1K4E A;  1DP6 A;  3OZH A;  1KGF A;  4XT2 B;  1VM1 A;  3NHQ A;  3PAE A;  2Y2O A;  2PAV P;  1I5Q A;  4O7D A;  3QP4 A;  1NWZ A;  4DJ3 A;  3IQA A;  3ZG0 A;  1LSV A;  3UPO A;  2J3T D;  1FSW A;  5KIZ A;  3R4K A;  1J3W A;  3IXB A;  5FI6 A;  5EM0 A;  3LID A;  1ZC2 A;  3ITA A;  3E2L A;  1ES3 A;  1ODV A;  2HDS A;  1DJC A;  4QWO A;  1L0G A;  3CJM A;  2MJ6 A;  4B88 A;  1OPX A;  5KSC A;  3E2K A;  1PZO A;  5GLA A;  1L3L A;  3S7P A;  1JWP A;  4KZ6 A;  4MBH A;  2V0W A;  4XXR A;  2ZD8 A;  4EV4 A;  2W3E A;  1VQQ A;  4JLF A;  4L9F A;  3EWK A;  2Q9N A;  3PTE A;  3WRT A;  4E3L A;  4GS9 B;  2JN7 A;  3UPP A;  3UB6 A;  4O01 A;  3VFH A;  4D2O A;  4RYE A;  5A92 A;  4OON A;  4MN5 A;  4ME4 A;  3WS2 A;  3GTC A;  4R1G A;  4JXW A;  4I38 A;  5K5B A;  1HVB A;  4HJ6 A;  3NEC A;  3MXS A;  3LIB A;  1W63 M;  2H0Y A;  2WKI A;  3LY4 A;  1MWU A;  3PXP A;  1XJ4 A;  3LYX A;  1UWP X;  3ZG7 B;  3H82 B;  2XFS A;  4EBP A;  4LV1 A;  2XR0 A;  5FAQ A;  1AXB A;  3GRJ A;  2JCH A;  2WKQ A;  2LB9 A;  2AVX A;  4OLG A;  2HV1 A;  1NRJ A;  1S4S A;  3BRM A;  4P6Z M;  5I5L A;  5M18 A;  2JKF A;  2UWX A;  3NBL A;  4LCL A;  1D06 A;  2GNX A;  2OAP 1;  1IOU A;  1MKI A;  1IYO A;  3RFB A;  4KQO A;  3ZYT A;  3HUO A;  5U47 A;  2J8Y A;  1BSG A;  1OTD A;  4OPQ A;  3JYI A;  5HZH A;  1HZO A;  3U2A A;  5L09 A;  4PMA A;  5LBR A;  5A90 A;  3GSG A;  2JC7 A;  4KZB A;  5DJT A;  3WS0 A;  5IU1 A;  2ZC5 B;  4BJP A;  4JF6 A;  5E2F A;  4A5R A;  4XUZ A;  3BLM A;  4RX2 A;  2JKR I;  2XQZ A;  5F5Y A;  1NYM A;  5AJG A;  3ZG8 B;  3HJI A;  2IWC A;  3SS4 A;  4C75 A;  3MS6 A;  4IVK A;  1SKO B;  5HWT A;  5HD3 A;  1LL5 A;  5CTM A;  3V50 A;  4ZRR A;  1O07 A;  4EUV A;  4X55 A;  4E3I A;  1N9B A;  1G6O A;  5HWW A;  1G5U A;  1IEM A;  4BD1 A;  4HP9 A;  2ZL1 B;  3LI9 A;  3VP3 A;  2PBD P;  4X56 A;  3A3F A;  2VA0 A;  1XA1 A;  4K91 A;  3EEH A;  2Y8H A;  1TS6 A;  2CMN A;  3C8C A;  5FAS A;  2JKG A;  3CUE C;  3T4K A;  3AGF A;  3M2K A;  1RGY A;  3BQA A;  2ZLY A;  3KSG A;  4K0X A;  5FI7 A;  4Y7P A;  2HDQ A;  4CLC D;  1MWR A;  3CUE A;  4Y3I A;  4NXF A;  2VV8 A;  1Q2P A;  4QU3 A;  3F1O A;  1XJ3 A;  3L7H A;  1NLZ A;  5EM1 A;  4GD6 A;  2W1R A;  1MC0 A;  3FV7 A;  1FSY A;  2JE5 A;  1JTD A;  2WYX A;  1C3B A;  5FAO A;  3G34 A;  2ZL1 A;  4GDB A;  2ZM0 A;  2X02 A;  3T1R A;  1S1Z A;  1EW0 A;  1YT4 A;  3QP6 A;  4F3L B;  3UO9 A;  3E4P A;  3UB5 P;  4EQ1 A;  2ZQ8 A;  4R23 A;  5J8X A;  3LR4 A;  1H8Y A;  4JXG A;  4II7 A;  1YLT A;  1O7E A;  1VEU A;  1W63 Q;  3IHA A;  4N9K A;  3S7O A;  3C7U A;  3NI9 A;  4OQH A;  2EFU A;  5HPF A;  1LSX A;  1HD8 A;  4I3J A;  3W8K A;  2QHK A;  3KYE A;  3TRC A;  4PKY A;  4I3A A;  5FA7 A;  3CPT B;  3V67 A;  5FQQ A;  1JVJ A;  1YMS A;  2WUQ A;  3HUM A;  5EVL A;  4M3K A;  1T18 A;  5FAP A;  4RVA A;  1HLU P;  3LEQ A;  4KG5 A;  2M7U A;  3DTE A;  1G28 A;  5DVA A;  1JNU A;  5CER A;  5CGW A;  4R4R A;  3B42 A;  4R70 A;  2WGV A;  3C38 A;  1GHI A;  4YIN A;  1KOU A;  3A3E A;  2BTF P;  1MBL A;  3Q7V B;  3PBQ A;  4B4Z A;  3G30 A;  3MQQ A;  2Y79 A;  2QKP A;  1NZU A;  1T19 A;  4BD0 A;  4U3T A;  2ZOH A;  3WS1 A;  2QPN A;  4X69 A;  4CPK A;  1ES4 A;  2W0N A;  3G2Y A;  5TFQ A;  1S6R A;  5FQ9 A;  5F82 A;  1T1B A;  4EU0 A;  2VGL M;  1TDG A;  4R4S A;  3IF6 A;  1PNE A;  3TOI A;  1K4F A;  3V39 A;  5EEC A;  1FR6 A;  3S7N A;  3K3D A;  1DJB A;  5HDS A;  3IWI A;  4JBF A;  3G6O A;  4CLC E;  3VFF A;  4BEN A;  5E2E A;  3P7N A;  4HJ4 A;  4I39 A;  2ZMA A;  1ESU A;  2EXA A;  3LFV A;  4FD8 A;  2Y4A A;  3IWQ A;  3IS2 A;  2DNS A;  1OJG A;  2DMW A;  2VK3 A;  2GZA A;  3IX3 A;  3G35 A;  5GHZ A;  4R3J A;  5HD5 A;  4NXB A;  2Y59 A;  3PYP A;  4EBN A;  3QP2 A;  2QMI A;  3IHB A;  2XH9 A;  5DTS A;  3SZT A;  5J7E A;  3ZHH A;  4LEN A;  2FH5 A;  3Q7V A;  5AQA A;  5CXW A;  3ZG5 A;  4S2N A;  3D9Y A;  4H8R A;  3O86 A;  1LLB A;  1YLW A;  2HP9 A;  1XPB A;  5M1A A;  3O87 A;  3OPH A;  4QPR A;  1Z09 A;  2O99 A;  5J3W A;  1NXY A;  1IFQ A;  2WAE A;  3OPR A;  2ZC6 B;  3HUN A;  4HY8 A;  2VLG A;  1XGJ A;  4R3A A;  1BLC A;  2HZ5 A;  3BY9 A;  4HOI A;  4R0Q A;  2W3F A;  4JGO A;  3G2Z A;  2B95 A;  4OVD A;  3ULF A;  1Q2Q A;  4KQR A;  4IUH A;  3H9W A;  3HJK A;  3VOZ A;  1SDE A;  4EUZ A;  2A3U A;  2RCX A;  3SH8 A;  3MZD A;  3KYQ A;  1DP8 A;  1I2W A;  2KX6 A;  1PI5 A;  3CWF A;  1K56 A;  1N9O A;  1K56 D;  1PRQ A;  5E2H A;  3B3X A;  2A24 B;  3A3D A;  1SHV A;  3SW1 A;  2K7S A;  3SOI A;  3GDI A;  3AGE A;  3MFD A;  1GSX A;  3N8R A;  4UQI M;  3Q1F A;  5CTN A;  5IT5 A;  4FUW A;  4BBV A;  1BTL A;  2W3D A;  5F68 A;  1E4D A;  4GCZ A;  1YLZ A;  1FIL A;  4N9L A;  1YKD A;  3LI8 A;  1IYQ A;  1FQG A;  2KLI A;  4EXO A;  3D3O A;  5HAR A;  3HL9 A;  4OLD A;  3FPW A;  1ERM A;  2INW A;  4MNR A;  2J9P A;  2VKS A;  5GLD A;  1F5M A;  4PM9 A;  2HJ9 C;  2V2F F;  4Y13 A;  2K31 A;  3HVF A;  2GX5 A;  3IH9 A;  3OPP A;  1XJ6 A;  2WZZ A;  2Y2J A;  2ZQD A;  3RXX A;  5FQI A;  4G3W A;  4Y0U A;  2C5W B;  4ZJ2 A;  2JBF A;  4IBX A;  4JGR A;  5C5K A;  2Y91 A;  1YPR A;  4WM9 A;  3TJZ C;  1MPL A;  1MXO A;  3WRZ A;  1IYP A;  3UNW A;  3W4P A;  1N4O A;  2HJE A;  1BZA A;  3DTM A;  2V1Z A;  3NDE A;  2A24 A;  3GMW A;  4GLQ A;  1FCO A;  4WYY A;  4IED A;  1WYB A;  2WGW B;  1N9L A;  1M40 A;  5F83 A;  2B5R A;  4D60 A;  3JVV A;  3LIA A;  2VX8 A;  3ZFZ A;  2ZQ9 A;  3NOT C;  3B33 A;  3HLD A;  5MC7 A;  3KSF A;  1SCW A;  2V8F A;  1GHM A;  2IA2 A;  1S4R A;  1GA9 A;  2C6W B;  2XK1 A;  2YKH A;  4Y17 A;  3LCE A;  3FKV A;  4K08 A;  4XT2 A;  1XJ2 A;  3BFE A;  1K25 A;  2JKT M;  4WZ5 C;  2P04 A;  1ERQ A;  4DE1 A;  2GJ3 A;  5J4E A;  1MWS A;  1IKI A;  2Q0O A;  3Q07 A;  2VV7 A;  1NYY A;  3M6B A;  3IWO A;  2JHE A;  4LV2 A;  2EXB A;  3T12 B;  3P09 A;  3PR6 A;  4OOL A;  3RJU A;  5HAI A;  2ZM8 A;  4DDY A;  4KZ9 A;  3UDF A;  5KMW A;  1K38 A;  5TR7 A;  5A91 A;  2VGL S;  3EGX C;  3QHY A;  1H0M A;  3BEC A;  5FSR A;  3IXD A;  3NJA A;  1KE4 A;  4WMC A;  3BJN A;  4GS9 A;  2FFF B;  5HL6 A;  1NZO A;  1BUE A;  4ETX A;  3B47 A;  2P08 A;  4HBU A;  3BM6 A;  1PI4 A;  1K55 C;  1IYS A;  4KUO A;  4DE3 A;  1SZV A;  1X0O A;  3P01 A;  3BWL A;  5HAP A;  1ES2 A;  3G4P A;  1GSV A;  1UGU A;  3BFG A;  3ZQ5 A;  4RA7 A;  1MZU A;  3M2J A;  2XA7 S;  3H82 A;  2Z6C A;  4BL3 A;  3IF5 A;  3F1N B;  1BYW A;  2PD8 A;  3MXR A;  5CGS A;  5E2G A;  2HDU A;  1Z6F A;  3LO7 A;  1NLY A;  3C4O A;  4RQ9 A;  3BQ8 A;  1Y4O A;  4XUX A;  2EWW A;  1FCM A;  4EET B;  1S0W A;  3N6I A;  3LIE A;  4O0P A;  4DJ2 A;  5TGF A;  4KZ5 A;  3N4I A;  4P0M A;  3E4Q A;  3QP5 A;  3CZD A;  1KE3 A;  4Y15 A;  3ZNT A;  2KDK A;  3IBJ A;  4MMN A;  2H5S A;  3T4Q A;  2NUP C;  3MFX A;  4JGQ A;  1K54 C;  1JTG A;  4E3O A;  1YLP A;  3CAX A;  4QY6 A;  4ESP A;  1KDW A;  1ONG A;  5IS1 A;  2W1T B;  4CLC C;  1LI9 A;  3F1P B;  4H6J B;  3EQU A;  3HRE A;  4FTX A;  4R6L A;  1K54 A;  2W3H A;  2QYB A;  3LEZ A;  1SKO A;  3JVU A;  3A0V A;  2K2N A;  3F1N A;  1OTE A;  3T4S A;  1U60 A;  4GJ4 A;  3UDI A;  3KX0 X;  1S1Y A;  3W4O A;  2IWB A;  1K6S A;  3PBT A;  3VE3 A;  1KGG A;  2Y2I A;  4UA9 A;  4PM6 A;  4WL9 A;  3CMZ A;  3OPL A;  4HP4 A;  2OV5 A;  4PKY G;  4LV0 A;  1H5X A;  1MWT A;  4S2O A;  3HLE A;  1P9W A;  1NY0 A;  5EVE A;  4WEK A;  2J80 A;  2Y2H A;  4WN5 A;  3RXW A;  3U4L P;  2OLV A;  4S2L A;  2VEA A;  2OAQ 1;  4MN7 A;  2XRO A;  2GDN A;  1P9R A;  3KSH A;  4ZTK A;  3E0Y A;  4LFU A;  1FR1 A;  2ZC4 B;  5FEF A;  1H8M A;  2Y2N A;  3EEA A;  5F69 A;  4H6J A;  1P0Z A;  1KGE A;  4JF4 A;  3SS5 A;  3VV4 A;  3Q7Z A;  2YKF A;  2H0T A;  4Q0H A;  4BMW A;  5G4Z A;  2VJW A;  3V3S A;  5AVF A;  3UE1 A;  4EER A;  3MF0 A;  4OOY A;  2J3W A;  4HES A;  3NOU C;  4X25 A;  1KE0 A;  2XEP A;  3DW0 A;  1P97 A;  4X1M A;  2R9X A;  5FI2 A;  4ZJ1 A;  2Z6D A;  3T4T A;  1YMX A;  3K2N A;  1TD5 A;  3HCY A;  4BLM A;  2A49 A;  2OLU A;  2ZJ9 A;  3FPV A;  3NDG A;  4F3L A;  3VSL A;  2ZMF A;  5EFW A;  3ZCZ A;  4Z9Q A;  2EFX A;  5L8M A;  3H7W B;  4OKP A;  4B4X A;  3S7Q A;  2VGJ A;  3R7W B;  4ARZ B;  4R3B A;  1Y54 A;  1XGI A;  2PYP A;  1F9I A;  4N92 A;  3K3C A;  3ZGA B;  3A3I A;  3MZE A;  3FZC A;  4E3K A;  2PDR A;  4G3V A;  4P6Z S;  1W8Y A;  2R9W A;  4B9O A;  3MSH A;  1XKZ A;  1PW8 A;  1YAX A;  5L07 A;  4QB8 A;  4DXB A;  5BOH A;  4GKU A;  3CPT A;  3MXQ A;  3OOV A;  4P87 A;  4HEF A;  4MDZ A;  4OP8 A;  5AQB A;  3E4O A;  3FG8 A;  4NKP A;  2IWD A;  1QMF A;  4GHI B;  4N1H A;  5EE8 A;  2ZQ7 A;  5HFO A;  3ZNY A;  1LL8 A;  4IHQ A;  3MMH A;  2O9B A;  3LR5 A;  1I2S A;  1NRF A;  4KZ4 A;  4QD4 A;  3VOL A;  2QJ5 A;  5DTT A;  2J7V A;  4Y5F A;  1CI8 A;  1VB6 A;  2PR5 A;  1HTZ A;  1OME A;  2W3G A;  4OPY A;  1A0K A;  1H3Q A;  3T50 A;  5HL1 A;  5HSQ A;  1W79 A;  1OT9 A;  2ZQA A;  1TS0 A;  3UE3 A;  4Q0J A;  5EVI B;  4Y0O A;  1PWD A;  5DKL A;  4MCW A;  1S66 L;  3OCL A;  4GOG A;  2I72 A;  3UPN A;  1CK3 A;  3TW8 A;  3CLO A;  4HI4 A;  2ZC3 B;  4LRZ E;  1TS7 A;  3QP8 A;  3S22 A;  3CG5 A;  4GB7 A;  4OQ0 A;  3NIA A;  4UA6 A;  4NXG A;  2DCF A;  2XDM A;  4PM7 A;  2L1M A;  1BLP A;  3HLC A;  1BLH A;  3GR2 A;  5L10 A;  2XSS A;  1CEG A;  3AGD A;  2PT7 A;  5DFX A;  4GHI A;  2H28 A;  3BYD A;  1ZHH B;  3MQO A;  3D72 A;  5DFY A;  4ZBE A;  3ICY A;  4C6Y A;  4WUJ A;  3UN7 A;  4WLA A;  3LR3 A;  3JPU A;  1JWV A;  4Y2F A;  2OWH A;  4LCM A;  2V1B A;  2PBY A;  4UA7 A;  3Q81 A;  5KSH A;  5EVI C;  3V3R A;  3C2W A;  1XX2 A;  1D7E A;  5E43 A;  1G6A A;  3UY6 A;  5DJU A;  4IJG A;  1SKF A;  3PBO A;  2DRW A;  2W27 A;  1F98 A;  1PWG A;  2G2W A;  3UE0 A;  1DRM A;  4E6X A;  1KVL A;  5GHX A;  2PRF A;  3PHY A;  3VMA A;  3VP1 A;  2EX9 A;  4B93 A;  2ZBB A;  4K0W A;  4L9E A;  1XA7 A;  4JGP A;  2HP5 A;  2UV0 E;  1W8Q A;  2J3T C;  1TS8 A;  4LRX C;  4DRT A;  5DF9 A;  1J9M A;  2D01 A;  4S2I A;  4CQH A;  1BT5 A;  5TJJ A;  4WEL A;  2EX6 A;  3BEB A;  4EW7 A;  3NOP C;  4NEE D;  4PHT A;  3ISG A;  3SH7 A;  3SS3 A;  4ZAM A;  4PPR A;  5EPH A;  5FAT A;  5CEC A;  5JYP A;  5M19 A;  3DBA A;  4JXV A;  5CED A;  2FFY A;  2H10 A;  2HPB A;  3TSG A;  3C4P A;  1ZG4 A;  3OCN A;  3GV9 A;  2JKT I;  2I9V A;  3MJQ A;  3VP2 A;  2WZX A;  1OTI A;  4HIA A;  1PYY A;  5G4Y A;  2VGK A;  3C30 A;  3GEC A;  3LY3 A;  4KUK A;  1FOF A;  3QP1 A;  3IT9 A;  4MLL A;  4E3J A;  4M4X A;  4MBF A;  1CI9 A;  4ID4 A;  2X01 A;  3A3J A;  5HAQ A;  1YLJ A;  2P7J A;  1F2K A;  4QJG A;  2PR6 A;  4Z1W A;  1PZP A;  3GQZ A;  2WGI A;  2B02 A;  1CQA A;  1OJ5 A;  4QY5 A;  2Y2P A;  5FEG A;  4GZB A;  4PM8 A;  3A0R A;  2ZM2 A;  1Y28 A;  5F1G A;  5FQJ A;  3N8L A;  2XFT A;  4U0X A;  5GL9 A;  5IHV A;  4PM5 A;  1D1J A;  1VET B;  4RX3 A;  3VP0 A;  5HDC A;  4EEP A;  5DF8 A;  2QWS A;  4KZA A;  3D4F A;  2WK0 A;  4BBT A;  4YFM A;  4DF6 A;  2G2U A;  4I5S A;  4I3I A;  1L0D A;  3UB9 A;  1DY6 A;  4WF0 A;  3IXG A;  1L2S A;  2EX2 A;  3VOY A;  4WZ5 A;  1E3U A;  4O8G A;  3PBS A;  1K0K A;  1E3U D;  2BLS A;  4OP5 A;  4LRY C;  4QHC A;  3KYZ A;  2L4R A;  4E6W A;  2PU2 A;  2WGW A;  4ETZ A;  1FCN A;  3BY8 A;  3LR0 A;  1YQS A;  2X71 A;  1H8Z A;  4WMC D;  1UWN X;  3ZG9 B;  1GHP A;  1K57 C;  4ZJ3 A;  5DKK A;  2QJ7 A;  4UAA A;  3DTI A;  4YWZ A;  5GLC A;  1NJ4 A;  3BFF A;  2XGN A;  5CHJ A;  3CHW P;  4S2M A;  2Y2L A;  1K57 A;  4X1L A;  2Y2K A;  4HH3 A;  4BBU A;  3N7W A;  1PWC A;  2V9A A;  1RP5 A;  4X6T A;  1K55 A;  1BLS A;  2HDR A;  3VSK A;  3A0S A;  2D02 A;  1VET A;  1V9Y A;  3M6H A;  4CLC B;  1T1A A;  3IH8 A;  5JYO A;  4DMZ A;  1LL9 A;  1OTB A;  2BG1 A;  2P9V B;  3FYZ A;  3MBZ A;  4EWF A;  3LIC A;  2WAD A;  4HBT A;  1V9Z A;  3F1O B;  5F1F A;  2Y55 A;  2RL3 A;  3T4J A;  2Z2M B;  2G7U A;  3VE4 A;  1ZTU A;  5FDH A;  3NUL A;  2XLN A;  1SDN A;  4EQI A;  4OQG A;  4DE0 A;  4DXC A;  4Q0I A;  3TG9 A;  5HW3 A;  2EA9 A;  2M1C A;  2JKR M;  2HGV A;  5FDS A;  3KSI A;  4X53 A;  4EEU A;  4P85 A;  3HLF A;  1YLY A;  2ZMV A;  5FQM A;  1W5D A;  1TVF A;  1LHY A;  2QZ6 A;  1RCJ A;  1TF1 A;  4JF5 A;  3MR0 A;  5G18 A;  5A8B A;  3OLO A;  1T1C A;  3O3V A;  4KG6 A;  4MEZ A;  1ACF A;  5CHM A;  1K6R A;  1VEU B;  3NY4 A;  1DP9 A;  4C3Q A;  4OOM A;  2V8C A;  3C7V A;  4IVI A;  1MY8 A;  2Y2Q A;  3SH9 A;  1XFQ A;  4CLC A;  3RTY A;  1M6K A;  3RH8 B;  4F94 A;  5DF7 A;  4UQI S;  4Q8I A;  2O0Y A;  5CRF A;  2P9V A;  4S2J A;  3T4O A;  2EX8 A;  5AQ9 A;  3T1Q B;  4CJN A;  3ZVW A;  3UME A;  4DN0 A;  1GCE A;  1STZ A;  3WWX A;  5AQ7 A;  3DAV A;  3HBR A;  3NC8 A;  2VV6 A;  3P98 A;  4NXE A;  3KO6 A;  2WKP A;  3L9K A;  2VZW A;  4E04 A;  4LV3 A;  5GLB A;  3ZVT A;  3C5A A;  3Q82 A;  1DJA A;  5FL3 A;  1CF0 A;  3ZDJ A;  4NK3 A;  4LLO B;  5F6A A;  2W1T A;  3LGO A;  3MKF A;  3F1P A;  1W7F A;  1XXM A;  3CI6 A;  1ZG6 A;  3T1S A;  5CX7 A;  4FH4 A;  3BFC A;  5TBM B;  4NET A;  2V0U A;  2Y2G A;  3HLW A;  3G32 A;  1WA9 A;  4IBR A;  4JKT A;  2A2L A;  2WAF A;  1QME A;  3UB7 A;  4JXS A;  4L0L A;  3OC2 A;  3BFD A;  3IF6 B;  3DWK A;  4UEY A;  4NG2 A;  4L9G A;  4YOF A;  1N9N A;  2V20 A;  4OQI A;  5I94 A;  3QNB A;  3E98 A;  5CGX A;  1IEL A;  4HHD A;  3HLB A;  4EBL A;  1JWZ A;  1YSQ A;  4GNU A;  4S2K A;  1YM1 A;  2KOI A;  1L0E A;  2J9O A;  3MKE A;  3IX8 A;  4DE2 A;  1OT6 A;  3EQV A;  4BL2 A;  4YNR A;  3OBF A;  4ZDX A;  3IS2 B;  1WYC A;  4N1X A;  2WKR A;  3PAG A;  2WKE A;  4DKI A;  4Y0T A;  4GD8 A;  3GVB A;  2WKH A;  4G3K A;  1ESI A;  3DWZ A;  3UB8 A;  2CC1 A;  2XRN A;  4UHU A;  3TE8 A;  4FSF A;  3I7J A;  2XF3 A;  4HH2 A;  3IF6 C;  4P6B A;  4E3M A;  3HLG A;  2XD1 A;  1E25 A;  1AWI A;  5TBM A;  1MKM A;  3O88 A;  3N8S A;  2XD5 A;  4OH0 A;  5DTK A;  2Y2M A;  4HNB A;  5EOE A;  3EGD C;  3WS4 A;  2PHY A;  2OOL A;  1KVM A;  1ONH A;  3IX4 A;  1KDS A;  5CHU A;  4GN2 A;  2ACG A;  4S2P A;  1OTA A;  2LB5 A;  4KQQ A;  4KQD A;  3UMD A;  4AFI A;  5EV0 A;  1PIO A;  3LUQ A;  3IXH A;  4GDN A;  2HF6 A;  4MN6 A;  3LIF A;  2O9C A;  1LSW A;  3EOI A;  5FQK A;  3T4L A;  4S2N C;  1WE4 A;  4WZ4 A;  1BUL A;  1FIK A;  2PU4 A;  2O9A A;  1ALQ A;  2E8I A;  2P74 A;  3H7W A;  1IKG A;  5AVE A;  1PW1 A;  3R7W A;  1L0F A;  1LT0 A;  4ARZ A;  2XA7 M;  1EI5 A;  3CIT A;  1XP4 A;  4FOF A;  5HPI A;  2ZOI A;  2L0W A;  4FH2 A;  4KZ3 A;  3G31 A;  1ZKJ A;  4KEN B;  1RGZ A;  4LPZ A;  3S4X A;  3BW6 A;  4MBK A;  3S1Y A;  3FKW A;  1LI0 A;  2ZC7 A;  1YSP A;  5HX9 A;  4IUK A;  4BWI A;  5HWV A;  3T1X A;  4PAU A;  4KG2 A;  3QNC A;  2Q9M A;  3MQ0 A;  3NCK A;  3W4Q A;  3VP4 A;  5L2F A;  2E8J A;  3DTK A;  1TEM A;  4WEJ A;  1CJF A;  3PBR A;  1GSW A;  5EUA A;  2PYR A;  4KZ7 A;  1PFL A;  3BLS A;  5CEB A;  3FC7 A;  3MZF A;  3ITB A;  2HP6 A;  3FWL A;  3IBR A;  4U0T A;  4OPZ A;  2V1A A;  4LGW A;  4X68 A;  4KZ8 A;  2NUT C;  1G68 A;  5EOO A;  5D3O A;  5A93 A;  2M7V A;  2FZ0 A;  3UDX A;  1EWZ A;  2B18 A;  1S67 L;  4DDS A;  1ES5 A;  4EES A;  2Z2L B;  3O5Y A;  4HQA A;  4OPR A;  3V5M A;  4BQM A;  5HDD A;  4GW9 A;  2OSU A;  3UE6 A;  4FCF A;  5EVI A;  5KZH A;  1TDL A;  2EWV A;  5EVI D;  3PBN A;  4R38 A;  4JPM A;  1GA0 A;  2R78 A;  2PD7 A;  2ZQC A;  3W2Z A;  1CEF A;  4HJ3 A;  2OWJ A; 
#chains in the Genus database with same CATH homology
 3IWI A;  4JBF A;  3VFF A;  4LV0 A;  4UAA A;  4BEN A;  4E3N A;  5GHY A;  1H5X A;  1MWT A;  1ERO A;  5E2E A;  3WS5 A;  4S2O A;  3HLE A;  4WBG A;  1NY0 A;  1K4E A;  4WEK A;  5GLC A;  1NJ4 A;  2ZMA A;  1ESU A;  2EXA A;  2Y2H A;  3BFF A;  3OZH A;  2XGN A;  3RXW A;  1KGF A;  2OLV A;  2Y4A A;  4FD8 A;  1VM1 A;  3PAE A;  4S2L A;  2Y2O A;  5CHJ A;  3IWQ A;  1I5Q A;  4O7D A;  4S2M A;  2DNS A;  3G35 A;  5GHZ A;  2Y2L A;  4R3J A;  1K57 A;  3IQA A;  3ZG0 A;  2Y59 A;  3UPO A;  2Y2K A;  2GDN A;  3N7W A;  4ZTK A;  4EBN A;  2QMI A;  1FSW A;  1PWC A;  3IHB A;  1RP5 A;  2XH9 A;  1FR1 A;  1K55 A;  4X6T A;  5DTS A;  2ZC4 B;  1BLS A;  2HDR A;  3VSK A;  3ZHH A;  3IXB A;  4LEN A;  5FI6 A;  2Y2N A;  3M6H A;  3Q7V A;  1ZC2 A;  5AQA A;  3IH8 A;  3ITA A;  5CXW A;  3E2L A;  5JYO A;  3ZG5 A;  1LL9 A;  4S2N A;  1ES3 A;  2BG1 A;  2HDS A;  1DJC A;  1KGE A;  1LLB A;  2P9V B;  3FYZ A;  3MBZ A;  3O86 A;  4H8R A;  4JF4 A;  3SS5 A;  4EWF A;  1YLW A;  2WAD A;  1L0G A;  3CJM A;  4HBT A;  2HP9 A;  3Q7Z A;  4B88 A;  1XPB A;  5F1F A;  5KSC A;  3E2K A;  1PZO A;  5GLA A;  2H0T A;  5M1A A;  3O87 A;  3OPH A;  2Y55 A;  1JWP A;  4KZ6 A;  1NXY A;  4MBH A;  2RL3 A;  3V3S A;  2WAE A;  4XXR A;  2ZD8 A;  3UE1 A;  3OPR A;  2ZC6 B;  4EV4 A;  2Z2M B;  3HUN A;  1VQQ A;  4JLF A;  4OOY A;  5FDH A;  1XGJ A;  2XLN A;  4HES A;  1BLC A;  1KE0 A;  2XEP A;  3DW0 A;  2Q9N A;  3PTE A;  3WRT A;  4E3L A;  1SDN A;  4EQI A;  3UPP A;  4R0Q A;  4OQG A;  2R9X A;  4DE0 A;  5FI2 A;  3G2Z A;  2OV5 A;  4ZJ1 A;  1YMX A;  4DXC A;  3VFH A;  4OVD A;  4D2O A;  3TG9 A;  4RYE A;  5HW3 A;  5A92 A;  4OON A;  4BLM A;  2A49 A;  1Q2Q A;  2OLU A;  4KQR A;  3WS2 A;  2ZJ9 A;  3NDG A;  4X53 A;  3GTC A;  3VSL A;  4R1G A;  4JXW A;  4P85 A;  3HLF A;  1YLY A;  3VOZ A;  3ZCZ A;  1SDE A;  5FQM A;  1W5D A;  1HVB A;  1TVF A;  4Z9Q A;  4EUZ A;  2EFX A;  2RCX A;  2QZ6 A;  2A3U A;  1LHY A;  1RCJ A;  3MXS A;  3MZD A;  4JF5 A;  1I2W A;  5G18 A;  4OKP A;  1PI5 A;  4B4X A;  3O3V A;  1K56 A;  2H0Y A;  2WKI A;  4KG6 A;  4MEZ A;  3LY4 A;  1MWU A;  5CHM A;  1K6R A;  2VGJ A;  3NY4 A;  3ZG7 B;  4R3B A;  1K56 D;  1Y54 A;  2XFS A;  4EBP A;  1XGI A;  4C3Q A;  4OOM A;  4IVI A;  3C7V A;  5E2H A;  1MY8 A;  3B3X A;  2XR0 A;  2Y2Q A;  4LV1 A;  4N92 A;  3SH9 A;  5FAQ A;  1AXB A;  3GRJ A;  3ZGA B;  3A3D A;  3A3I A;  1M6K A;  1SHV A;  2JCH A;  3MZE A;  3SOI A;  3FZC A;  4OLG A;  4E3K A;  3AGE A;  4F94 A;  5DF7 A;  4Q8I A;  3MFD A;  5CRF A;  2P9V A;  4S2J A;  3N8R A;  1W8Y A;  2EX8 A;  2R9W A;  3BRM A;  3Q1F A;  5CTN A;  5AQ9 A;  1XKZ A;  1PW8 A;  5M18 A;  4CJN A;  3ZVW A;  1BTL A;  4QB8 A;  2UWX A;  3SH8 A;  1GCE A;  4DXB A;  3NBL A;  4LCL A;  4GKU A;  5BOH A;  1E4D A;  1YLZ A;  4N9L A;  3WWX A;  5AQ7 A;  1MKI A;  3HBR A;  3NC8 A;  4HEF A;  4OP8 A;  4P87 A;  1IYO A;  1IYQ A;  5AQB A;  1FQG A;  4KQO A;  3P98 A;  5HAR A;  3HUO A;  2IWD A;  5U47 A;  2J8Y A;  3HL9 A;  1BSG A;  1QMF A;  4OLD A;  1ERM A;  4MNR A;  2J9P A;  4N1H A;  4OPQ A;  5EE8 A;  4LV3 A;  5GLD A;  4PM9 A;  5GLB A;  3JYI A;  2V2F F;  2ZQ7 A;  3ZVT A;  5HFO A;  1HZO A;  3ZNY A;  3C5A A;  3HVF A;  4PMA A;  5A90 A;  3GSG A;  2JC7 A;  4KZB A;  3IH9 A;  3OPP A;  3Q82 A;  3WS0 A;  1DJA A;  2ZC5 B;  2WZZ A;  2Y2J A;  4BJP A;  1I2S A;  2ZQD A;  3RXX A;  3ZDJ A;  4NK3 A;  4JF6 A;  4Y0U A;  5FQI A;  5E2F A;  2C5W B;  4ZJ2 A;  1NRF A;  4A5R A;  2JBF A;  3MKF A;  4IBX A;  4KZ4 A;  4XUZ A;  4QD4 A;  3BLM A;  1W7F A;  1XXM A;  2XQZ A;  4RX2 A;  1ZG6 A;  2Y91 A;  1NYM A;  5DTT A;  2J7V A;  4FH4 A;  3BFC A;  4WM9 A;  3SS4 A;  2IWC A;  3ZG8 B;  4NET A;  1CI8 A;  4C75 A;  1HTZ A;  1OME A;  1MPL A;  1MXO A;  4IVK A;  3WRZ A;  2Y2G A;  3HLW A;  3G32 A;  1IYP A;  4OPY A;  1LL5 A;  5CTM A;  4IBR A;  4JKT A;  3UNW A;  3W4P A;  3V50 A;  1N4O A;  2WAF A;  5HL1 A;  1QME A;  1W79 A;  1BZA A;  3DTM A;  1O07 A;  2ZQA A;  4JXS A;  3UE3 A;  2V1Z A;  3NDE A;  4L0L A;  5EVI B;  3GMW A;  1PWD A;  3OC2 A;  3BFD A;  4Y0O A;  1FCO A;  4WYY A;  4X55 A;  4E3I A;  4IED A;  1N9B A;  1WYB A;  2WGW B;  3IF6 B;  1M40 A;  3DWK A;  3OCL A;  4GOG A;  5F83 A;  2I72 A;  3UPN A;  1IEM A;  2B5R A;  2V20 A;  1CK3 A;  4OQI A;  4BD1 A;  5I94 A;  3QNB A;  2ZC3 B;  5CGX A;  1IEL A;  3ZFZ A;  2ZQ9 A;  3HLB A;  3S22 A;  3VP3 A;  4EBL A;  1JWZ A;  3CG5 A;  4GB7 A;  4GNU A;  3HLD A;  4OQ0 A;  1YM1 A;  4S2K A;  3NIA A;  4UA6 A;  4X56 A;  1L0E A;  3A3F A;  1SCW A;  2DCF A;  2J9O A;  2XDM A;  1XA1 A;  1BLP A;  1GHM A;  3MKE A;  4K91 A;  4PM7 A;  3HLC A;  1BLH A;  3GR2 A;  1GA9 A;  3EQV A;  4BL2 A;  4DE2 A;  2C6W B;  2XK1 A;  1CEG A;  5FAS A;  3LCE A;  3AGD A;  3FKV A;  4ZDX A;  1WYC A;  3BYD A;  4N1X A;  3BFE A;  1K25 A;  3PAG A;  2WKE A;  4ZBE A;  4WZ5 C;  4DKI A;  4Y0T A;  4GD8 A;  3GVB A;  3AGF A;  4C6Y A;  1ERQ A;  3M2K A;  3UN7 A;  4DE1 A;  2WKH A;  1ESI A;  3DWZ A;  1JWV A;  1MWS A;  1IKI A;  2CC1 A;  4UHU A;  1RGY A;  4LCM A;  2PBY A;  4UA7 A;  3Q81 A;  3Q07 A;  2ZLY A;  5KSH A;  5EVI C;  1NYY A;  3V3R A;  4FSF A;  4K0X A;  3M6B A;  3IWO A;  3I7J A;  2XF3 A;  4LV2 A;  3IF6 C;  1XX2 A;  2EXB A;  5FI7 A;  4Y7P A;  2HDQ A;  4P6B A;  5E43 A;  3P09 A;  1MWR A;  3HLG A;  4E3M A;  4OOL A;  2XD1 A;  1E25 A;  1G6A A;  3RJU A;  5HAI A;  2ZM8 A;  3UY6 A;  4DDY A;  1Q2P A;  3O88 A;  3N8S A;  2XD5 A;  4KZ9 A;  3UDF A;  1SKF A;  3PBO A;  4OH0 A;  5DTK A;  4QU3 A;  5KMW A;  2DRW A;  1K38 A;  5TR7 A;  1PWG A;  2Y2M A;  2G2W A;  3UE0 A;  5EOE A;  5A91 A;  3WS4 A;  4E6X A;  1KVL A;  3QHY A;  5GHX A;  3BEC A;  5FSR A;  1KVM A;  1ONH A;  3IXD A;  4GD6 A;  3VMA A;  1KE4 A;  3VP1 A;  4WMC A;  1KDS A;  2EX9 A;  5CHU A;  4GN2 A;  4K0W A;  4S2P A;  1XA7 A;  3FV7 A;  2FFF B;  2HP5 A;  1FSY A;  2JE5 A;  4KQQ A;  1W8Q A;  1JTD A;  2WYX A;  1C3B A;  1NZO A;  5FAO A;  1BUE A;  4DRT A;  3G34 A;  1PIO A;  5DF9 A;  3IXH A;  4GDB A;  1J9M A;  2ZM0 A;  4HBU A;  2X02 A;  4GDN A;  3BM6 A;  1PI4 A;  1BT5 A;  1K55 C;  4S2I A;  1YT4 A;  1IYS A;  4DE3 A;  4WEL A;  3UO9 A;  2EX6 A;  2ZQ8 A;  3BEB A;  4R23 A;  5FQK A;  5J8X A;  4S2N C;  1WE4 A;  3ISG A;  3SH7 A;  3SS3 A;  4ZAM A;  4PPR A;  4WZ4 A;  5EPH A;  1BUL A;  5FAT A;  5CEC A;  2PU4 A;  1H8Y A;  5HAP A;  4JXG A;  1ES2 A;  5JYP A;  5M19 A;  3G4P A;  4JXV A;  1ALQ A;  2E8I A;  5CED A;  3BFG A;  2P74 A;  2FFY A;  1YLT A;  2H10 A;  2HPB A;  1IKG A;  1O7E A;  3TSG A;  3C4P A;  1PW1 A;  1ZG4 A;  1L0F A;  4RA7 A;  3OCN A;  3IHA A;  4N9K A;  3GV9 A;  3M2J A;  4BL3 A;  3C7U A;  3NI9 A;  3IF5 A;  4OQH A;  3MXR A;  2EFU A;  5CGS A;  5E2G A;  1EI5 A;  2HDU A;  1XP4 A;  1Z6F A;  3VP2 A;  3LO7 A;  2WZX A;  3C4O A;  1HD8 A;  4FH2 A;  4KZ3 A;  1PYY A;  3G31 A;  1ZKJ A;  2VGK A;  4XUX A;  3W8K A;  4KEN B;  1RGZ A;  3LY3 A;  1FCM A;  1S0W A;  3N6I A;  4MBK A;  5FA7 A;  3S1Y A;  3S4X A;  3FKW A;  1FOF A;  1LI0 A;  2ZC7 A;  3IT9 A;  1JVJ A;  4MLL A;  1YMS A;  5FQQ A;  2WUQ A;  5HX9 A;  3HUM A;  4E3J A;  5TGF A;  4KZ5 A;  5EVL A;  4M3K A;  3N4I A;  4MBF A;  4P0M A;  4KG2 A;  4RVA A;  5FAP A;  1CI9 A;  3QNC A;  2Q9M A;  3CZD A;  4KG5 A;  3NCK A;  1KE3 A;  3A3J A;  4ID4 A;  5DVA A;  2X01 A;  5CER A;  3VP4 A;  3W4Q A;  3ZNT A;  5HAQ A;  1YLJ A;  5CGW A;  5L2F A;  4R4R A;  4QJG A;  1TEM A;  4WEJ A;  2H5S A;  1PZP A;  3GQZ A;  2WGI A;  3PBR A;  4QY5 A;  2Y2P A;  5EUA A;  2WGV A;  4KZ7 A;  3BLS A;  5CEB A;  1K54 C;  4GZB A;  3MZF A;  4PM8 A;  1JTG A;  3ITB A;  4E3O A;  1YLP A;  1GHI A;  2ZM2 A;  4QY6 A;  4YIN A;  2HP6 A;  3FWL A;  3A3E A;  4U0T A;  5F1G A;  5FQJ A;  3N8L A;  1MBL A;  2XFT A;  4U0X A;  5GL9 A;  5IHV A;  4PM5 A;  4RX3 A;  3VP0 A;  1KDW A;  1ONG A;  4OPZ A;  3Q7V B;  5DF8 A;  4KZA A;  1LI9 A;  3D4F A;  3PBQ A;  4KZ8 A;  4X68 A;  4B4Z A;  1G68 A;  5EOO A;  5D3O A;  2WK0 A;  5A93 A;  4YFM A;  3EQU A;  3HRE A;  3G30 A;  3UDX A;  4DF6 A;  2G2U A;  1EWZ A;  1NZU A;  1L0D A;  4DDS A;  1DY6 A;  4BD0 A;  4U3T A;  1ES5 A;  1K54 A;  1L2S A;  3IXG A;  2EX2 A;  3VOY A;  4WZ5 A;  3WS1 A;  1E3U A;  2Z2L B;  2QPN A;  4OPR A;  3LEZ A;  4X69 A;  1ES4 A;  3V5M A;  4CPK A;  3PBS A;  3G2Y A;  4BQM A;  5TFQ A;  1E3U D;  2BLS A;  1S6R A;  4OP5 A;  2OSU A;  5FQ9 A;  4QHC A;  5F82 A;  3W4O A;  1U60 A;  4FCF A;  5EVI A;  5KZH A;  1TDL A;  1TDG A;  4E6W A;  2PU2 A;  3UDI A;  2WGW A;  4R4S A;  3IF6 A;  5EVI D;  3PBN A;  1GA0 A;  1FCN A;  4JPM A;  2IWB A;  1K6S A;  1K4F A;  1YQS A;  2X71 A;  1H8Z A;  2ZQC A;  3PBT A;  3TOI A;  4WMC D;  3V39 A;  3ZG9 B;  5EEC A;  1CEF A;  1FR6 A;  1GHP A;  1KGG A;  2Y2I A;  1K57 C;  4UA9 A;  4PM6 A;  1DJB A;  3CMZ A;  3OPL A;  4ZJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...