4KZ9A

Crystal structure of ampc beta-lactamase in complex with fragment 41 ((4r,4as,8as)-4-phenyldecahydroquinolin-4-ol)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increasing chemical space coverage by combining empirical and computational fragment screens.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4kz9A00
4CPKA 4U0TA 2EX9A 5GLCA 4E3LA 3GVBA 4OP8A 2H0YA 5JYOA 4LV0A 3NDEA 4S2IA 3G31A 3IF6B 2ZC3B 4KZ9A 1S6RA 1MPLA 3UPPA 1KE4A 4R1GA 1IKGA 1JWPA 5FA7A 2PU2A 4LCLA 3SH7A 1BZAA 1Q2QA 3BFCA 4WMCD 4K91A 1QMFA 4OQ0A 3OPRA 2QZ6A 4FCFA 4XUZA 5CHMA 5EE8A 4GKUA 1BLCA 5A90A 4N92A 4C6YA 1YLPA 4WMCA 3HUNA 4Y0TA 2WAFA 2ZJ9A 3M6HA 4L0LA 1I2WA 3VSKA 3HLFA 4DE2A 1ERMA 5GL9A 3BYDA 1I5QA 5DF9A 3UNWA 1KGEA 3PTEA 1YLTA 2E8IA 4WBGA 4IEDA 4PMAA 1ESIA 3O3VA 3A3DA 1GA0A 1NY0A 3G2YA 3G4PA 4FH4A 3GTCA 5AQBA 2Y2NA 3WS4A 4IBXA 2Y59A 3A3EA 1L2SA 3VOYA 1GCEA 4GZBA 1ONHA 3FYZA 5TR7A 3ZG8B 3ZVWA 4QY5A 5DF8A 5EVID 4OPYA 5FI7A 3BFGA 1JVJA 1SKFA 4OPZA 3WRZA 4DDYA 3CZDA 2DRWA 1N9BA 1G6AA 5CEBA 5EPHA 3W4PA 1FOFA 4K0WA 2HDSA 2RCXA 5EVIC 5EVIA 4B4ZA 3N8RA 1XGJA 2Y2JA 3ZG7B 4GD6A 4OLGA 2G2WA 2ZLYA 1DY6A 4GDNA 4RYEA 3UE3A 1Y54A 1YLJA 1S0WA 2Y2KA 5M18A 3HREA 4KQQA 1L0EA 5FQIA 3MKEA 3A3JA 1ES5A 3FZCA 1XA7A 1K4FA 3Q7ZA 2A49A 1NYMA 2ZM2A 4JLFA 3O86A 2V20A 2HP5A 5E2FA 2V1ZA 3VP4A 3VP1A 2XQZA 4ZJ1A 2P74A 2DCFA 3N7WA 4N9KA 4X53A 5GLAA 3MFDA 5F83A 1RGYA 4QJGA 4HESA 5KMWA 1SDEA 1CI8A 4JXGA 4MEZA 4D2OA 1DJBA 4XUXA 1ES4A 4O7DA 2ZQAA 5GLBA 1ZG6A 3CG5A 5CGSA 4MBFA 4RX3A 3V50A 3G34A 3VMAA 1G68A 4EUZA 2ZD8A 3N4IA 4P0MA 1DJCA 2QMIA 3E2KA 3EQVA 4JF5A 1IYOA 4Z9QA 5EECA 3MZFA 4OPQA 2Z2LB 3NIAA 3A3IA 1SCWA 4IVKA 1O7EA 1EI5A 1VQQA 4UA9A 2WUQA 1BT5A 4BLMA 1K6SA 5HL1A 1LHYA 1FSWA 2EX2A 3PBOA 1BSGA 3C4PA 1NXYA 2BLSA 2XH9A 2J9PA 3BLSA 1BLPA 5GHZA 5FI6A 3BRMA 4FH2A 1PW8A 3ITAA 1BLHA 5U47A 4OONA 1PI5A 5L2FA 4ZJ2A 2VGJA 3WS1A 1CI9A 2J9OA 4OOLA 2JCHA 3IWQA 2PU4A 5BOHA 1HVBA 1KDWA 1N4OA 4DDSA 3VP2A 3DWZA 5TFQA 3GRJA 4HEFA 5TGFA 4QB8A 2XLNA 2Y4AA 1Z6FA 1CK3A 4P87A 4Y0OA 5GLDA 1K6RA 3AGFA 3OC2A 5DTTA 4R3BA 2UWXA 3NBLA 4WELA 1XA1A 2ZC6B 3TOIA 2J7VA 2EXAA 4OH0A 3B3XA 4C3QA 5CHUA 4UHUA 2PBYA 1KVMA 1XGIA 5KZHA 3HUMA 2G2UA 4BENA 5A92A 3HLEA 5CGXA 3ZHHA 2ZQCA 4KZ5A 4A5RA 5FQ9A 2HP6A 2I72A 3UO9A 3VFFA 3BM6A 5FI2A 4IVIA 2CC1A 5M19A 4OQHA 1MY8A 1TEMA 3Q1FA 3LY4A 5FAQA 1YMSA 4MNRA 1AXBA 1C3BA 5HAIA 3UDFA 1KGGA 5M1AA 1MXOA 1YLYA 4JF6A 2Y2MA 3NC8A 3V39A 3PBNA 4PPRA 3M6BA 3VSLA 2Y2LA 2IWBA 2ZM0A 3QHYA 1EWZA 3PBRA 3P98A 4KZ4A 1FCMA 5J8XA 2R9WA 3UE1A 1KGFA 2Z2MB 4JF4A 4U0XA 1W8YA 2WKHA 3OZHA 4DRTA 1XXMA 2Y2GA 5HAQA 2P9VA 3FV7A 3NY4A 3C7VA 4RVAA 3IT9A 1TDGA 1XPBA 2Y2QA 4F94A 4GNUA 1HTZA 1OMEA 3NI9A 2H0TA 1KVLA 2HP9A 2WGWA 4S2PA 4LV2A 4X68A 3S4XA 5CEDA 2EFUA 4DKIA 1PI4A 4ZBEA 3WS2A 2Y2OA 2HDUA 1YM1A 4RA7A 2WYXA 1SHVA 1W5DA 3OCLA 2OSUA 1K4EA 5HFOA 2OV5A 1BULA 1K25A 4U3TA 1NRFA 2A3UA 4JXWA 4YINA 4Q8IA 5FSRA 5D3OA 4BJPA 1EROA 2Q9MA 3OCNA 3Q7VA 1IYSA 3HLBA 4Y0UA 3SH9A 4S2NC 4S2NA 2Y2PA 2FFYA 5HAPA 5DF7A 2WKIA 4LV3A 5F1GA 3ZG5A 1GHPA 2BG1A 3OPLA 4PM8A 4R23A 4KG2A 5A91A 1FR6A 1H8YA 4WM9A 3W4QA 2GDNA 2FFFB 3IF6C 3IF6A 4OKPA 5E43A 5FQMA 2XFSA 4S2OA 2XGNA 1I2SA 3ISGA 3EQUA 5EOOA 3BFEA 3LY3A 1K56D 5F82A 3PBTA 1H8ZA 4X69A 3OPPA 5EUAA 5E2EA 3HUOA 3UDIA 3QNCA 4BD0A 2XD5A 1JTGA 5KSHA 2OLUA 3VFHA 1IKIA 1K56A 3RJUA 3BEBA 2DNSA 1Q2PA 2EX6A 4N1HA 3PBSA 1K54C 1K54A 4PM6A 4QHCA 3PAGA 3IH8A 3N8SA 3HBRA 3WWXA 3D4FA 4BQMA 1ONGA 1PWCA 3MXSA 5E2GA 1LLBA 1L0DA 1QMEA 2XK1A 3ITBA 3Q81A 4LENA 2R9XA 2IWDA 2V2FF 4MLLA 3O87A 1BTLA 1PWDA 3NDGA 1NZOA 4H8RA 3IXHA 4KZ3A 4Y7PA 5HARA 4E3KA 2WGIA 1CEFA 3CJMA 1K55C 1K55A 1NZUA 4OQGA 3DWKA 1LI9A 2X02A 3BFFA 3Q82A 4ID4A 5CECA 5FQKA 4JKTA 3RXXA 5KSCA 2XD1A 3E2LA 3DW0A 3UDXA 1DJAA 4S2LA 3Q07A 3C7UA 3IXBA 3VP3A 4XXRA 4EQIA 4ZDXA 3MXRA 1RP5A 3V5MA 2X01A 3ZCZA 5DTSA 3ZNTA 3UPOA 1K38A 1K57C 1K57A 1WYBA 3FKVA 3ZVTA 3O88A 2EX8A 3G30A 4EBNA 3IHAA 5G18A 3BFDA 2C5WB 3JYIA 1WYCA 2ZC4B 1VM1A 1YLWA 4S2JA 4QY6A 2WKEA 3N6IA 4UA6A 5EVIB 2H5SA 3FKWA 1LL5A 3IWIA 4NETA 3HLDA 3ZDJA 4IBRA 3SS4A 3GR2A 4HBTA 2XF3A 5CXWA 1XP4A 4HBUA 5AQ9A 5DVAA 2X71A 4OOYA 5E2HA 2IWCA 3G32A 4JXVA 5EVLA 1KE3A 2Q9NA 3Q7VB 4S2KA 2ZQ9A 4ZTKA 3TG9A 1MWSA 3FWLA 4JPMA 2HDQA 2HPBA 1H5XA 3IQAA 3OPHA 3IH9A 4K0XA 2JE5A 4X55A 5FQQA 1ES2A 4E3MA 4KG5A 3LO7A 4GD8A 1RGZA 4KG6A 1LL9A 5FATA 3CMZA 3G35A 3MZDA 1WE4A 3HLGA 4E3IA 4R4RA 1PYYA 4DE0A 3G2ZA 4GB7A 4GN2A 4WZ5A 4KQRA 4WZ5C 4QD4A 4WZ4A 3VOZA 1E4DA 4E3JA 3SS5A 2ZM8A 3S1YA 4BL3A 3UE0A 4PM9A 2ZQ7A 1FCOA 4DE3A 3GSGA 1E25A 1ERQA 4NK3A 5CTMA 3GMWA 3PAEA 4UAAA 1ES3A 4S2MA 5IHVA 1CEGA 1JWVA 1PIOA 1YQSA 3M2JA 5A93A 3AGEA 1YT4A 1W7FA 2ZQ8A 1PZOA 3WRTA 3IXGA 4OVDA 4MBKA 5HW3A 5FQJA 4ZAMA 5GHYA 1FQGA 4DE1A 4LV1A 4R4SA 5CHJA 3ZG0A 1FCNA 2WGVA 3HLCA 3WS0A 3UN7A 1M6KA 2HDRA 1W79A 2B5RA 3WS5A 1MWTA 4R0QA 5AQAA 1SDNA 2Y2HA 4OQIA 4DF6A 1MWRA 4PM7A 1TDLA 4P6BA 4UA7A 4EV4A 2QPNA 1RCJA 4N9LA 4E3NA 3W4OA 1GHMA 4E6XA 3SH8A 3TSGA 3A3FA 2XFTA 4KZ6A 4P85A 2WAEA 1IEMA 4N1XA 3IF5A 2Y55A 3IWOA 2EXBA 2OLVA 2WZXA 1ZC2A 2ZMAA 1ESUA 4M3KA 2ZQDA 1YLZA 2H10A 4JXSA 1FSYA 3MKFA 3AGDA 3S22A 4ZJ3A 1MKIA 1XKZA 4E3OA 3DTMA 5DTKA 2WZZA 4KZ7A 1W8QA 1GA9A 1BLSA 4MBHA 3NCKA 4KQOA 3HLWA 1JWZA 3MZEA 1KE0A 3UPNA 1NJ4A 5GHXA 4R3JA 3HVFA 5FDHA 4EWFA 3M2KA 2ZC5B 1U60A 3HL9A 4DXCA 4KZAA 3ZNYA 3I7JA 4B88A 3GQZA 5CERA 5FASA 3LEZA 4WEKA 2Y91A 3GV9A 5CTNA 2XR0A 1LI0A 1MWUA 2VGKA 1E3UD 2JC7A 1IYPA 2J8YA 1L0GA 4FD8A 1TVFA 4OLDA 4X56A 4WEJA 3N8LA 4X6TA 4PM5A 5I94A 1BUEA 4KZ8A 2XDMA 2ZC7A 4OP5A 3V3RA 3PBQA 1HZOA 4BL2A 4E6WA 1E3UA 2P9VB 1MBLA 2Y2IA 3W8KA 1PZPA 4YFMA 1M40A 3C5AA 2JBFA 2C6WB 5CGWA 2XEPA 3V3SA 5HX9A 3MBZA 1J9MA 1PWGA 4QU3A 1ZKJA 2WGWB 5FAPA 4OPRA 1GHIA 2EFXA 3LCEA 4OOMA 1KDSA 4EBPA 3P09A 3UY6A 4B4XA 3C4OA 4DXBA 4LCMA 4GDBA 1L0FA 1ALQA 3RXWA 4BD1A 1O07A 1PW1A 5CRFA 4FSFA 5AQ7A 4C75A 3ZG9B 3BLMA 5FAOA 3ZFZA 4RX2A 3SOIA 2RL3A 3VP0A 3ZGAB 2WK0A 4KZBA 1FR1A 3IHBA 1IELA 4GOGA 1ZG4A 1YMXA 5JYPA 1JTDA 5F1FA 1IYQA 1NYYA 1HD8A 4KENB 3IXDA 4EBLA 4WYYA 3BECA 1XX2A 4CJNA 5EOEA 2WADA 4JBFA 3SS3A 3QNBA
chains in the Genus database with same CATH superfamily
4ETXA 5GLCA 1F9IA 4HY8A 2H0YA 3NDEA 3IF6B 2ZC3B 3UPPA 1KE4A 1JWPA 2PU2A 3SH7A 1Z09A 3OPRA 4GKUA 1BLCA 3MJQA 3BW6A 3HLFA 2D02A 3BYDA 3UNWA 1KGEA 2B02A 4EU0A 3PTEA 2E8IA 2JKRI 4M4XA 3KSGA 3O3VA 4K08A 4HOIA 3H7WA 3MXQA 4LPZA 1UWNX 3VOYA 1GCEA 4GZBA 1ONHA 5J4EA 3BFGA 3E0YA 3W4PA 4K0WA 3PHYA 3A0RA 3CITA 1WA9A 4CQHA 4RYEA 1Y54A 1L0EA 4IUHA 3EWKA 1LT0A 2L1MA 5HWTA 1K4FA 2A49A 3C8CA 2ZOIA 4JLFA 2V20A 2V1ZA 2VV6A 3VP4A 4L9EA 4N9KA 4QJGA 1PRQA 1ES4A 2W27A 5A8BA 1ZG6A 5CGSA 4MBFA 4XT2A 4RX3A 4EUZA 5J3WA 2PAVP 2GX5A 2V1BA 2VA0A 4DJ2A 3RFBA 1BT5A 2PBDP 3CPTA 2BLSA 2XH9A 2J9PA 3BLSA 1BLPA 5FI6A 3ITAA 3T1XA 5L2FA 1P97A 2OWJA 3WS1A 1CI9A 5BOHA 5EM0A 4HEFA 5EV0A 2Y4AA 4EQ1A 3F1OA 4R3BA 5IU1A 3TOIA 2LB5A 4HP4A 3B3XA 5CHUA 4UHUA 3TRCA 4O01A 5A92A 2QHKA 5CGXA 3ZHHA 2HP6A 5FI2A 4IVIA 1NWZA 3LGOA 2WKRA 4OQHA 1D06A 3U2AA 5FAQA 1AXBA 3F1NA 3VOLA 1YLYA 3PBNA 3QHYA 4UQIM 3UE1A 2Z2MB 4JF4A 2WKHA 5TBMB 1XXMA 2Y2GA 1IOUA 4YOFA 2NUTC 3C7VA 3IT9A 2Y2QA 1N9NA 1HTZA 4GHIB 1PI4A 5HL6A 2EWVA 1SHVA 4LFUA 2L4RA 1VHMA 5HFOA 2OV5A 3V67A 1NRFA 3SZTA 4MDZA 4Q8IA 5FSRA 3OOVA 2Q9MA 3DTIA 3OCNA 4LRZE 1GSVA 4EUVA 3HLBA 4Y0UA 4CLCE 3UMDA 5LBRA 5MC7A 2FFYA 5HAPA 4LV3A 1GHPA 2VV7A 1FR6A 1H8YA 4WM9A 2GDNA 3NOTC 5E43A 4OKPA 1DP6A 1I2SA 3EQUA 1H8ZA 4GS9A 3HUOA 2XD5A 1JTGA 4PKYG 2OLUA 4ME4A 3RJUA 4NKPA 2EX6A 1K54C 1K54A 2MJ6A 3IH8A 3N8SA 3DBAA 4LLOB 3MXSA 5E2GA 2Y8HA 4IUKA 2R9XA 2V2FF 2V1AA 5HARA 1NZOA 3IXHA 2P7JA 1HLUP 2JKTI 3CJMA 1K55C 1K55A 4IJGA 2PDRA 3RXXA 3E4PA 5AVFA 3H7WB 3Q07A 3IXBA 4HJ6A 4NXFA 3MXRA 1RP5A 3V5MA 3ZNTA 1K57C 1K57A 4KQDA 2EX8A 3G30A 1G5UA 5G18A 4EBNA 3BFDA 3JYIA 4HNBA 4S2JA 1LL5A 4X25A 3SS4A 4GCZA 4BWIA 5DVAA 4JXVA 4I3AA 2Q9NA 4S2KA 3LI8A 2A2LA 2ZQ9A 1OTBA 1MWSA 4ZTKA 3IQAA 2JE5A 1OJ5A 1ES2A 5FQQA 4GD8A 1LL9A 5FATA 3CMZA 3G35A 3HLGA 3T4TA 4E3JA 4GN2A 4LRXC 3CWFA 1T1BA 4PM9A 4L9FA 1FCOA 4XT2B 1ERQA 4UAAA 3LI9A 3T1QB 1CEGA 1PIOA 3CLOA 4I5SA 4I3IA 4B93A 1YQSA 5A93A 2ZQ8A 1PZOA 3CPTB 5FQJA 2V9AA 4ZAMA 5GHYA 1XJ6A 4LV1A 3G6OA 3WS0A 2W0NA 3UN7A 1M6KA 3T4OA 5FEGA 1MWTA 1LSWA 4OQIA 1RCJA 3ICYA 3W4OA 1TF1A 4E6XA 5KIZA 3TSGA 4KZ6A 3LIAA 3F1OB 3LR3A 3IF5A 2Y55A 3KYZA 2OLVA 3BJNA 4M3KA 3K3DA 2H10A 1FSYA 3MKFA 3S22A 4LGWA 1XKZA 4BBVA 2O99A 5DTKA 2WZZA 2YKHA 4MBHA 1KE0A 3UPNA 4EWFA 4BMWA 2W3EA 1XJ4A 4DXCA 4KZAA 3ZNYA 1A0KA 3F1NB 3GQZA 2BASA 1LL8A 3LIBA 4WEKA 2Y91A 3VE3A 1MWUA 1ZHHB 1E3UD 2HJEA 4FD8A 4X56A 1E3UA 4D60A 1PZPA 2AVXA 1M40A 3C5AA 4YWZA 4QU3A 1ZKJA 2PHYA 4EBPA 1KDSA 1P9WA 3P09A 3UY6A 3S7QA 5CRFA 1YKDA 3ZG9B 2W3DA 4RX2A 4EEPA 3VP0A 3ZGAB 2VGLM 4MCWA 1IELA 1HD8A 3IXDA 4CJNA 2WADA 3BY8A 3KSFA 4CPKA 3T4JA 1S6RA 1MPLA 4WL9A 1QMFA 2ACGA 1ZTUA 4OQ0A 3PYPA 4GS9B 5EE8A 5A90A 3HUNA 4Y0TA 1TS7A 2WAFA 2ZJ9A 4L0LA 3VSKA 1ERMA 2OWHA 3O5YA 5C5KA 4HHDA 5HDDA 3QP2A 1T18A 2FZ0A 5I5LA 4I38A 4FH4A 1NY0A 5AQBA 3WS4A 3GTCA 2Y59A 5TR7A 4DMZA 4QY5A 5EVID 4OPZA 3ZYTA 4DDYA 3CZDA 1FIKA 1N9BA 5CEBA 5EVIC 5EVIA 2RCXA 3QP6A 4JGOA 3ZG7B 2L0WA 2ZLYA 4GDNA 3RTYA 4KQQA 5FQIA 3A3JA 3Q7ZA 3UB8A 1NYMA 2EWWA 2KOIA 2HP5A 3VP1A 2DCFA 4EETB 3N7WA 1RGYA 5KMWA 1CI8A 2W3GA 4G3KA 4O7DA 5TBMA 4HQAA 3CG5A 2ZD8A 4P6ZS 4Z9QA 3KSHA 2Z2LB 2M7VA 3PR6A 2W1TA 1VQQA 4GHIA 2WUQA 3T4SA 4BLMA 5HL1A 1LHYA 1FSWA 2EX2A 2E8JA 1BSGA 1NXYA 3KX0X 2XA7M 3CHWP 2VK3A 4FH2A 1PW8A 1OT6A 5K5BA 3S7NA 2J9OA 3NJAA 1OT9A 1HVBA 1N4OA 2PYRA 2HV1A 4QB8A 1FILA 1CK3A 4P87A 4FUWA 1K6RA 2K31A 4BBUA 1DP8A 2ZC6B 2J7VA 5EVEA 1CJFA 2PBYA 1XGIA 1OTIA 4WLAA 5DJUA 5KZHA 4BENA 3LIEA 4A5RA 3UO9A 3VFFA 4Q0HA 4X1MA 4GLQA 1TEMA 3Q1FA 4H6JA 4MNRA 3B33A 1OTAA 1MXOA 1NRJA 4PPRA 3M6BA 2Y2LA 1N9LA 3SW1A 1EWZA 1FCMA 5J8XA 1KGFA 4U0XA 1VEUA 3FV7A 4ARZA 2K7SA 3NI9A 2HP9A 2WGWA 4S2PA 3KYEA 4X68A 5CEDA 2EFUA 4DKIA 1S66L 3WS2A 1G6OA 2HDUA 1H8MA 1T19A 2WYXA 1K4EA 1BULA 1K25A 2GZAA 2W3FA 4WF0A 1H0MA 3L9KA 4YINA 2J3TC 3SH9A 2Y2PA 2WKIA 3ZG5A 2QJ7A 4R23A 4BBTA 4KG2A 5A91A 3MQQA 2QYBA 2FFFB 5FQMA 2XFSA 3ISGA 2VX8A 3LY3A 1ACFA 4BD0A 3UDIA 3VFHA 4X1LA 1Q2PA 4QHCA 3D4FA 1ONGA 1PWCA 3TW8A 1LLBA 2JHEA 2O9CA 1QMEA 2Y79A 3IS2A 3ITBA 4CLCC 4CLCA 5DFYA 4H8RA 4KZ3A 1CEFA 4Q0IA 1NZUA 3DWKA 2X02A 3DW0A 4S2LA 3VP3A 4EQIA 3T1SA 4R38A 5DTSA 4JGPA 1K38A 1WYBA 3FKVA 1D7EA 2HF6A 3O88A 4L9GA 3JPUA 2HGVA 2ZC4B 5EVIB 3IWIA 3HLDA 3ZDJA 2XF3A 5CXWA 2ZBBA 4YNRA 2V8CA 3T50A 2IWCA 5L8MA 3Q7VB 3TG9A 2HPBA 3VV4A 1H5XA 3OPHA 4PAUA 4E3MA 4Y17A 3LR0A 3LUQA 4DE0A 4GB7A 4KQRA 3VOZA 5EFWA 2ZM8A 3UE0A 4NG2A 2PR5A 2W3HA 5CTMA 3DTKA 1ES3A 1MZUA 2W1TB 4HI4A 3AGEA 3IX8A 1YT4A 1W7FA 2WKPA 3D72A 3RH8B 4HH2A 3MMHA 5F68A 4DE1A 3FC7A 4EXOA 3ZG0A 3HLCA 2HDRA 1W79A 2B5RA 3WS5A 5HPFA 5AQAA 1SDNA 4MMNA 4PM7A 1TDLA 4EV4A 3BY9A 1AWIA 3LIFA 3SH8A 5L07A 2XFTA 4P85A 3GDIA 2EXBA 2WZXA 2ZMAA 3IX4A 1ESUA 2OOLA 2ZQDA 4JXSA 4ZJ3A 3LIDA 3DTMA 4Y15A 4KZ7A 1BLSA 2DMWA 3BWLA 3H9WA 3HLWA 1NJ4A 4R3JA 3M2KA 4H6JB 2ZC5B 1TS0A 5IT5A 4B88A 1OPXA 4EERA 3GV9A 1LI0A 2VGKA 1IYPA 2J8YA 1XJ2A 3BQAA 2ZC7A 4HIAA 4KZ8A 3V3RA 1VEUB 3PBQA 2A24A 4ARZB 3W8KA 4Y13A 5FL3A 4YFMA 2C6WB 2XEPA 3V3SA 5HX9A 2XROA 3MBZA 2PR6A 3HCYA 2WGWB 3W2ZA 1YAXA 3D9YA 2EFXA 4O8GA 4OPRA 2B95A 1ALQA 3RXWA 3LYXA 4BD1A 2Z6CA 4C75A 5FAOA 5JYPA 5F1FA 4KENB 2G7UA 4WYYA 4JBFA 3QNBA 3CAXA 1MC0A 1NLZA 2EX9A 4U0TA 3EGXC 1NLYA 4KZ9A 1IKGA 4LCLA 1BZAA 3BFCA 4K91A 4XUZA 5CHMA 3QP8A 4R70A 4N92A 1YLPA 5DKKA 3M6HA 4O0PA 1YPRA 4DE2A 5GL9A 3IS2B 1YLTA 4IEDA 2Z6DA 4CLCB 1ESIA 3A3DA 3G4PA 1L3LA 2Y2NA 4IBXA 4NXBA 3FYZA 4WUJA 3ZG8B 3ZVWA 4OPYA 5FI7A 3FG8A 2DRWA 5EPHA 3N8RA 2Y2JA 4GD6A 4OLGA 2G2WA 1DY6A 3UE3A 1YLJA 3HREA 3MKEA 3FZCA 1S1ZA 1XA7A 2HJ9C 4Y2FA 3KSIA 2ZM2A 2ZMVA 1G28A 3O86A 5E2FA 3NOPC 2P74A 3MFDA 5F83A 3P7NA 4JXGA 4MEZA 3U4LP 4D2OA 4XUXA 3LFVA 3T4QA 2KLIA 3V50A 3G34A 4P0MA 1DJCA 3EQVA 1IYOA 3NIAA 4IVKA 1EI5A 2WKQA 3UMEA 1K6SA 1XFNA 3C4PA 3BRMA 3C38A 1OTDA 1BLHA 5U47A 2PRFA 2VGJA 5AJGA 1KDWA 4DDSA 3VP2A 3DWZA 3MQOA 2NUPC 3QP1A 5L10A 3AGFA 3OC2A 3B42A 2UWXA 2JKRM 2PT7A 2EXAA 4OH0A 3HUMA 3HLEA 2ZQCA 3BM6A 2CC1A 2V0UA 4ETZA 1YMSA 1C3BA 4JGQA 1KGGA 3C2WA 3FPVA 3VSLA 5FEFA 1LSXA 3PBRA 3P98A 2R9WA 1W8YA 4II7A 3OZHA 4DRTA 2D01A 3LICA 1V9YA 3UB9A 4F94A 1XPBA 1OMEA 2A24B 1KVLA 3S4XA 4ZBEA 2Y2OA 3B47A 1YM1A 2K2NA 4RA7A 3OCLA 3CI6A 2A3UA 5HSQA 4PHTA 5D3OA 3VE4A 1EROA 3Q7VA 1IYSA 3H82A 4R3AA 2Q0OA 2KDKA 4S2NC 4S2NA 4RQ9A 5DF7A 4I3JA 2BG1A 3S7OA 3UB6A 3KO6A 3W4QA 4KUKA 2XGNA 3EOIA 5EOOA 3BFEA 1K56D 3QP5A 5F82A 3PBTA 5EUAA 5E2EA 3QNCA 5L09A 1K56A 2DNSA 2QKPA 4N1HA 4PM6A 3PAGA 3HBRA 3OBFA 2XK1A 3Q81A 2IWDA 3K3CA 1BTLA 4Y7PA 3NDGA 2JKGA 1LI9A 3BFFA 4ID4A 5CECA 5FQKA 2XD1A 3E2LA 1DJAA 3C7UA 4XXRA 4F3LA 4ZDXA 2X01A 1PNEA 3UPOA 2VEAA 5HWVA 3IHAA 3T4LA 1VM1A 1YLWA 3N6IA 3FKWA 4IBRA 1CQAA 3GR2A 1XP4A 4HBUA 5AQ9A 5E2HA 4OOYA 1YSPA 3G32A 1KE3A 3A0VA 3K2NA 4FOFA 2LB9A 3DTEA 4JPMA 3EEHA 1JNUA 4B9OA 3IH9A 4K0XA 1BYWA 2V8FA 2J80A 4KG5A 2P04A 1RGZA 5AVEA 4ZRRA 3MZDA 4R4RA 1PYYA 1XJ3A 4WZ5C 4P6ZM 4WZ5A 4QD4A 4WZ4A 1E4DA 2CMNA 5HDSA 2UV0E 4KUOA 4DE3A 5HDCA 3GSGA 1E25A 4NK3A 3PAEA 4S2MA 4WN5A 2JKFA 5IS1A 3LR5A 3T12B 3WRTA 3IXGA 2QWSA 4MBKA 5HW3A 2EA9A 1FQGA 3UE6A 2J3TD 4R4SA 5CHJA 2WGVA 4ESPA 2ZOHA 4R0QA 1MWRA 2P08A 2O0YA 4P6BA 4N9LA 4E3NA 2O9AA 1J3WA 3A3FA 2WAEA 3IWOA 3ZQ5A 2JKTM 2VLGA 1MKIA 2HZ5A 2M1CA 1W8QA 1GA9A 3NCKA 4KQOA 1JWZA 3MZEA 4CLCD 5GHXA 4NXGA 3HVFA 2ZMFA 3HL9A 4GJ4A 2PD8A 5FASA 3LEZA 2XR0A 1L0GA 2JC7A 3N8LA 4PM5A 5I94A 5EM1A 4UQIS 4OP5A 2XDMA 4E6WA 1HZOA 1MBLA 3F1PA 2JBFA 5FAPA 3IBJA 4OOMA 1GHIA 3LCEA 3C4OA 4FTXA 4LCMA 4MN6A 5F5YA 1L0FA 3FPWA 3MSHA 2H28A 1N9OA 3D3OA 3SOIA 2RL3A 2PD7A 4KZBA 2W1RA 1FR1A 2B18A 4GOGA 3KYQA 3LR4A 3H82B 1IYQA 4EBLA 3NOUC 3BECA 3SS3A 5F69A 4E3LA 3GVBA 3NHQA 4OP8A 5JYOA 4LV0A 4S2IA 3G31A 4R1GA 2IA2A 1OJGA 5FA7A 4GW9A 1Q2QA 4WMCD 2QZ6A 4FCFA 4C6YA 4WMCA 5G4ZA 1I2WA 1VETA 1I5QA 5DF9A 4G3WA 4IHQA 3NULA 4WBGA 4PMAA 5HD3A 1GA0A 3G2YA 5HZHA 3A3EA 1L2SA 2OAQ1 5DF8A 2ZL1A 1JVJA 1SKFA 4HJ3A 3WRZA 4F3LB 2OAP1 1G6AA 1FOFA 2HDSA 1X0OA 4B4ZA 1XGJA 4E04A 1S1YA 3L7HA 2GNXA 1S0WA 2Y2KA 5M18A 5J7EA 1XFQA 3DAVA 1ES5A 5DJTA 2XQZA 3IX3A 4ZJ1A 3C30A 4X53A 5GLAA 5TJJA 4HESA 1SDEA 2GJ3A 1DJBA 3E4OA 2QJ5A 2ZQAA 5GLBA 3VMAA 2VKSA 1G68A 3MR0A 3N4IA 2QMIA 3E2KA 4JF5A 4MN5A 5EECA 3MZFA 4OPQA 4R6LA 3A3IA 1SCWA 1O7EA 4UA9A 4Q0JA 3PBOA 5GHZA 1GSXA 4Y5FA 4OONA 1PI5A 4Z1WA 1SKOA 3UB5P 3S7PA 4ZJ2A 4EEUA 2R78A 4OOLA 3T4KA 2JCHA 3IWQA 2PU4A 1LSVA 5TFQA 3GRJA 5TGFA 3TJZC 2XLNA 1V9ZA 1Z6FA 5DFXA 2M7UA 4Y0OA 5GLDA 5DTTA 3NBLA 2PYPA 4WELA 1XA1A 3P01A 2O9BA 4MN7A 1S4RA 4C3QA 1CF0A 3TE8A 1KVMA 5FDSA 1F2KA 2G2UA 1TD5A 4KZ5A 5FQ9A 2I72A 3MF0A 4AFIA 4NEED 3R7WA 5M19A 1MY8A 3LY4A 1K0KA 5HAIA 3UDFA 5M1AA 4JF6A 2Y2MA 3NC8A 3V39A 2IWBA 2ZM0A 4KZ4A 3E4QA 3JVVA 5HAQA 2P9VA 3NY4A 4RVAA 1TDGA 1IFQA 4GNUA 1UWPX 2H0TA 3UB7A 4JGRA 4LV2A 3F1PB 5HD5A 3BQ8A 4HP9A 1YSQA 1W5DA 2OSUA 4U3TA 1GSWA 1OTEA 4JXWA 3MFXA 3A0SA 4BJPA 2XSSA 1S67L 3MS6A 3LEQA 3PXPA 2VV8A 1ODVA 5F1GA 5HWWA 3OPLA 4PM8A 2VGLS 1W63Q 1DP9A 5CX7A 3IF6C 3IF6A 4S2OA 2J3WA 4X69A 1STZA 3OPPA 3HJIA 3QP4A 5KSHA 5HPIA 1IKIA 3BEBA 2KX6A 2BTFP 4QWOA 3PBSA 3WWXA 4BQMA 1L0DA 3IBRA 4LENA 1VETB 4MLLA 3O87A 4Y3IA 1PWDA 4E3KA 1EW0A 1P0ZA 2WGIA 4HH3A 4OQGA 3Q82A 1P9RA 4JKTA 5KSCA 3UDXA 1F98A 3ZCZA 1VB6A 3ZVTA 2ZL1B 2JN7A 3EGDC 2C5WB 5G4YA 1WYCA 2V0WA 4QY6A 2WKEA 2YKFA 4UA6A 2H5SA 4NETA 3NECA 4HBTA 1TS6A 2X71A 5EVLA 3FWLA 2HDQA 1H3QA 4X55A 3LO7A 4KG6A 1F5MA 1WE4A 4E3IA 4QPRA 3T1RA 3G2ZA 1PFLA 4DJ3A 3SS5A 3S1YA 4BL3A 4EW7A 4NXEA 2ZQ7A 3EEAA 3GMWA 1Y4OA 5IHVA 1JWVA 4EESA 4G3VA 3M2JA 2VZWA 4DN0A 4OVDA 2FH5A 2XA7S 1KOUA 1FCNA 1SKOB 4I39A 1SZVA 1DRMA 2Y2HA 4DF6A 4UA7A 2QPNA 2VJWA 2INWA 1GHMA 4N1XA 1IEMA 1TS8A 1ZC2A 1YLZA 3AGDA 4E3OA 4UEYA 3HJKA 3R7WB 5FDHA 3CUEC 3CUEA 1S4SA 1U60A 3I7JA 3R4KA 3OLOA 5CERA 5CTNA 3JVUA 1TVFA 4OLDA 4WEJA 4X6TA 1MKMA 1T1CA 1BUEA 4BL2A 2P9VB 2Y2IA 2I9VA 5F6AA 5CGWA 1J9MA 1PWGA 5DKLA 4DXBA 4B4XA 1T1AA 2XRNA 4GDBA 1O07A 3E98A 1PW1A 4FSFA 5AQ7A 3BLMA 3ZFZA 1W63M 4HJ4A 4PKYA 1D1JA 2WK0A 1Y28A 3IHBA 3ULFA 1ZG4A 1UGUA 1YMXA 3GECA 1JTDA 1NYYA 4LRYC 3MQ0A 1XX2A 5EOEA
chains in the Genus database with same CATH topology
4CPKA 4U0TA 2EX9A 5GLCA 4E3LA 3GVBA 4OP8A 2H0YA 5JYOA 4LV0A 3NDEA 4S2IA 3G31A 3IF6B 2ZC3B 4KZ9A 1S6RA 1MPLA 3UPPA 1KE4A 4R1GA 1IKGA 1JWPA 5FA7A 2PU2A 4LCLA 3SH7A 1BZAA 1Q2QA 3BFCA 4WMCD 4K91A 1QMFA 4OQ0A 3OPRA 2QZ6A 4FCFA 4XUZA 5CHMA 5EE8A 4GKUA 1BLCA 5A90A 4N92A 4C6YA 1YLPA 4WMCA 3HUNA 4Y0TA 2WAFA 2ZJ9A 3M6HA 4L0LA 1I2WA 3VSKA 3HLFA 4DE2A 1ERMA 5GL9A 3BYDA 1I5QA 5DF9A 3UNWA 1KGEA 3PTEA 1YLTA 2E8IA 4WBGA 4IEDA 4PMAA 1ESIA 3O3VA 3A3DA 1GA0A 1NY0A 3G2YA 3G4PA 4FH4A 3GTCA 5AQBA 2Y2NA 3WS4A 4IBXA 2Y59A 3A3EA 1L2SA 3VOYA 1GCEA 4GZBA 1ONHA 3FYZA 5TR7A 3ZG8B 3ZVWA 4QY5A 5DF8A 5EVID 4OPYA 5FI7A 3BFGA 1JVJA 1SKFA 4OPZA 3WRZA 4DDYA 3CZDA 2DRWA 1N9BA 1G6AA 5CEBA 5EPHA 3W4PA 1FOFA 4K0WA 2HDSA 2RCXA 5EVIC 5EVIA 4B4ZA 3N8RA 1XGJA 2Y2JA 3ZG7B 4GD6A 4OLGA 2G2WA 2ZLYA 1DY6A 4GDNA 4RYEA 3UE3A 1Y54A 1YLJA 1S0WA 2Y2KA 5M18A 3HREA 4KQQA 1L0EA 5FQIA 3MKEA 3A3JA 1ES5A 3FZCA 1XA7A 1K4FA 3Q7ZA 2A49A 1NYMA 2ZM2A 4JLFA 3O86A 2V20A 2HP5A 5E2FA 2V1ZA 3VP4A 3VP1A 2XQZA 4ZJ1A 2P74A 2DCFA 3N7WA 4N9KA 4X53A 5GLAA 3MFDA 5F83A 1RGYA 4QJGA 4HESA 5KMWA 1SDEA 1CI8A 4JXGA 4MEZA 4D2OA 1DJBA 4XUXA 1ES4A 4O7DA 2ZQAA 5GLBA 1ZG6A 3CG5A 5CGSA 4MBFA 4RX3A 3V50A 3G34A 3VMAA 1G68A 4EUZA 2ZD8A 3N4IA 4P0MA 1DJCA 2QMIA 3E2KA 3EQVA 4JF5A 1IYOA 4Z9QA 5EECA 3MZFA 4OPQA 2Z2LB 3NIAA 3A3IA 1SCWA 4IVKA 1O7EA 1EI5A 1VQQA 4UA9A 2WUQA 1BT5A 4BLMA 1K6SA 5HL1A 1LHYA 1FSWA 2EX2A 3PBOA 1BSGA 3C4PA 1NXYA 2BLSA 2XH9A 2J9PA 3BLSA 1BLPA 5GHZA 5FI6A 3BRMA 4FH2A 1PW8A 3ITAA 1BLHA 5U47A 4OONA 1PI5A 5L2FA 4ZJ2A 2VGJA 3WS1A 1CI9A 2J9OA 4OOLA 2JCHA 3IWQA 2PU4A 5BOHA 1HVBA 1KDWA 1N4OA 4DDSA 3VP2A 3DWZA 5TFQA 3GRJA 4HEFA 5TGFA 4QB8A 2XLNA 2Y4AA 1Z6FA 1CK3A 4P87A 4Y0OA 5GLDA 1K6RA 3AGFA 3OC2A 5DTTA 4R3BA 2UWXA 3NBLA 4WELA 1XA1A 2ZC6B 3TOIA 2J7VA 2EXAA 4OH0A 3B3XA 4C3QA 5CHUA 4UHUA 2PBYA 1KVMA 1XGIA 5KZHA 3HUMA 2G2UA 4BENA 5A92A 3HLEA 5CGXA 3ZHHA 2ZQCA 4KZ5A 4A5RA 5FQ9A 2HP6A 2I72A 3UO9A 3VFFA 3BM6A 5FI2A 4IVIA 2CC1A 5M19A 4OQHA 1MY8A 1TEMA 3Q1FA 3LY4A 5FAQA 1YMSA 4MNRA 1AXBA 1C3BA 5HAIA 3UDFA 1KGGA 5M1AA 1MXOA 1YLYA 4JF6A 2Y2MA 3NC8A 3V39A 3PBNA 4PPRA 3M6BA 3VSLA 2Y2LA 2IWBA 2ZM0A 3QHYA 1EWZA 3PBRA 3P98A 4KZ4A 1FCMA 5J8XA 2R9WA 3UE1A 1KGFA 2Z2MB 4JF4A 4U0XA 1W8YA 2WKHA 3OZHA 4DRTA 1XXMA 2Y2GA 5HAQA 2P9VA 3FV7A 3NY4A 3C7VA 4RVAA 3IT9A 1TDGA 1XPBA 2Y2QA 4F94A 4GNUA 1HTZA 1OMEA 3NI9A 2H0TA 1KVLA 2HP9A 2WGWA 4S2PA 4LV2A 4X68A 3S4XA 5CEDA 2EFUA 4DKIA 1PI4A 4ZBEA 3WS2A 2Y2OA 2HDUA 1YM1A 4RA7A 2WYXA 1SHVA 1W5DA 3OCLA 2OSUA 1K4EA 5HFOA 2OV5A 1BULA 1K25A 4U3TA 1NRFA 2A3UA 4JXWA 4YINA 4Q8IA 5FSRA 5D3OA 4BJPA 1EROA 2Q9MA 3OCNA 3Q7VA 1IYSA 3HLBA 4Y0UA 3SH9A 4S2NC 4S2NA 2Y2PA 2FFYA 5HAPA 5DF7A 2WKIA 4LV3A 5F1GA 3ZG5A 1GHPA 2BG1A 3OPLA 4PM8A 4R23A 4KG2A 5A91A 1FR6A 1H8YA 4WM9A 3W4QA 2GDNA 2FFFB 3IF6C 3IF6A 4OKPA 5E43A 5FQMA 2XFSA 4S2OA 2XGNA 1I2SA 3ISGA 3EQUA 5EOOA 3BFEA 3LY3A 1K56D 5F82A 3PBTA 1H8ZA 4X69A 3OPPA 5EUAA 5E2EA 3HUOA 3UDIA 3QNCA 4BD0A 2XD5A 1JTGA 5KSHA 2OLUA 3VFHA 1IKIA 1K56A 3RJUA 3BEBA 2DNSA 1Q2PA 2EX6A 4N1HA 3PBSA 1K54C 1K54A 4PM6A 4QHCA 3PAGA 3IH8A 3N8SA 3HBRA 3WWXA 3D4FA 4BQMA 1ONGA 1PWCA 3MXSA 5E2GA 1LLBA 1L0DA 1QMEA 2XK1A 3ITBA 3Q81A 4LENA 2R9XA 2IWDA 2V2FF 4MLLA 3O87A 1BTLA 1PWDA 3NDGA 1NZOA 4H8RA 3IXHA 4KZ3A 4Y7PA 5HARA 4E3KA 2WGIA 1CEFA 3CJMA 1K55C 1K55A 1NZUA 4OQGA 3DWKA 1LI9A 2X02A 3BFFA 3Q82A 4ID4A 5CECA 5FQKA 4JKTA 3RXXA 5KSCA 2XD1A 3E2LA 3DW0A 3UDXA 1DJAA 4S2LA 3Q07A 3C7UA 3IXBA 3VP3A 4XXRA 4EQIA 4ZDXA 3MXRA 1RP5A 3V5MA 2X01A 3ZCZA 5DTSA 3ZNTA 3UPOA 1K38A 1K57C 1K57A 1WYBA 3FKVA 3ZVTA 3O88A 2EX8A 3G30A 4EBNA 3IHAA 5G18A 3BFDA 2C5WB 3JYIA 1WYCA 2ZC4B 1VM1A 1YLWA 4S2JA 4QY6A 2WKEA 3N6IA 4UA6A 5EVIB 2H5SA 3FKWA 1LL5A 3IWIA 4NETA 3HLDA 3ZDJA 4IBRA 3SS4A 3GR2A 4HBTA 2XF3A 5CXWA 1XP4A 4HBUA 5AQ9A 5DVAA 2X71A 4OOYA 5E2HA 2IWCA 3G32A 4JXVA 5EVLA 1KE3A 2Q9NA 3Q7VB 4S2KA 2ZQ9A 4ZTKA 3TG9A 1MWSA 3FWLA 4JPMA 2HDQA 2HPBA 1H5XA 3IQAA 3OPHA 3IH9A 4K0XA 2JE5A 4X55A 5FQQA 1ES2A 4E3MA 4KG5A 3LO7A 4GD8A 1RGZA 4KG6A 1LL9A 5FATA 3CMZA 3G35A 3MZDA 1WE4A 3HLGA 4E3IA 4R4RA 1PYYA 4DE0A 3G2ZA 4GB7A 4GN2A 4WZ5A 4KQRA 4WZ5C 4QD4A 4WZ4A 3VOZA 1E4DA 4E3JA 3SS5A 2ZM8A 3S1YA 4BL3A 3UE0A 4PM9A 2ZQ7A 1FCOA 4DE3A 3GSGA 1E25A 1ERQA 4NK3A 5CTMA 3GMWA 3PAEA 4UAAA 1ES3A 4S2MA 5IHVA 1CEGA 1JWVA 1PIOA 1YQSA 3M2JA 5A93A 3AGEA 1YT4A 1W7FA 2ZQ8A 1PZOA 3WRTA 3IXGA 4OVDA 4MBKA 5HW3A 5FQJA 4ZAMA 5GHYA 1FQGA 4DE1A 4LV1A 4R4SA 5CHJA 3ZG0A 1FCNA 2WGVA 3HLCA 3WS0A 3UN7A 1M6KA 2HDRA 1W79A 2B5RA 3WS5A 1MWTA 4R0QA 5AQAA 1SDNA 2Y2HA 4OQIA 4DF6A 1MWRA 4PM7A 1TDLA 4P6BA 4UA7A 4EV4A 2QPNA 1RCJA 4N9LA 4E3NA 3W4OA 1GHMA 4E6XA 3SH8A 3TSGA 3A3FA 2XFTA 4KZ6A 4P85A 2WAEA 1IEMA 4N1XA 3IF5A 2Y55A 3IWOA 2EXBA 2OLVA 2WZXA 1ZC2A 2ZMAA 1ESUA 4M3KA 2ZQDA 1YLZA 2H10A 4JXSA 1FSYA 3MKFA 3AGDA 3S22A 4ZJ3A 1MKIA 1XKZA 4E3OA 3DTMA 5DTKA 2WZZA 4KZ7A 1W8QA 1GA9A 1BLSA 4MBHA 3NCKA 4KQOA 3HLWA 1JWZA 3MZEA 1KE0A 3UPNA 1NJ4A 5GHXA 4R3JA 3HVFA 5FDHA 4EWFA 3M2KA 2ZC5B 1U60A 3HL9A 4DXCA 4KZAA 3ZNYA 3I7JA 4B88A 3GQZA 5CERA 5FASA 3LEZA 4WEKA 2Y91A 3GV9A 5CTNA 2XR0A 1LI0A 1MWUA 2VGKA 1E3UD 2JC7A 1IYPA 2J8YA 1L0GA 4FD8A 1TVFA 4OLDA 4X56A 4WEJA 3N8LA 4X6TA 4PM5A 5I94A 1BUEA 4KZ8A 2XDMA 2ZC7A 4OP5A 3V3RA 3PBQA 1HZOA 4BL2A 4E6WA 1E3UA 2P9VB 1MBLA 2Y2IA 3W8KA 1PZPA 4YFMA 1M40A 3C5AA 2JBFA 2C6WB 5CGWA 2XEPA 3V3SA 5HX9A 3MBZA 1J9MA 1PWGA 4QU3A 1ZKJA 2WGWB 5FAPA 4OPRA 1GHIA 2EFXA 3LCEA 4OOMA 1KDSA 4EBPA 3P09A 3UY6A 4B4XA 3C4OA 4DXBA 4LCMA 4GDBA 1L0FA 1ALQA 3RXWA 4BD1A 1O07A 1PW1A 5CRFA 4FSFA 5AQ7A 4C75A 3ZG9B 3BLMA 5FAOA 3ZFZA 4RX2A 3SOIA 2RL3A 3VP0A 3ZGAB 2WK0A 4KZBA 1FR1A 3IHBA 1IELA 4GOGA 1ZG4A 1YMXA 5JYPA 1JTDA 5F1FA 1IYQA 1NYYA 1HD8A 4KENB 3IXDA 4EBLA 4WYYA 3BECA 1XX2A 4CJNA 5EOEA 2WADA 4JBFA 3SS3A 3QNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CPK A;  4U0T A;  2EX9 A;  5GLC A;  4E3L A;  3GVB A;  4OP8 A;  2H0Y A;  5JYO A;  4LV0 A;  3NDE A;  4S2I A;  3G31 A;  3IF6 B;  2ZC3 B;  4KZ9 A;  1S6R A;  1MPL A;  3UPP A;  1KE4 A;  4R1G A;  1IKG A;  1JWP A;  5FA7 A;  2PU2 A;  4LCL A;  3SH7 A;  1BZA A;  1Q2Q A;  3BFC A;  4WMC D;  4K91 A;  1QMF A;  4OQ0 A;  3OPR A;  2QZ6 A;  4FCF A;  4XUZ A;  5CHM A;  5EE8 A;  4GKU A;  1BLC A;  5A90 A;  4N92 A;  4C6Y A;  1YLP A;  4WMC A;  3HUN A;  4Y0T A;  2WAF A;  2ZJ9 A;  3M6H A;  4L0L A;  1I2W A;  3VSK A;  3HLF A;  4DE2 A;  1ERM A;  5GL9 A;  3BYD A;  1I5Q A;  5DF9 A;  3UNW A;  1KGE A;  3PTE A;  1YLT A;  2E8I A;  4WBG A;  4IED A;  4PMA A;  1ESI A;  3O3V A;  3A3D A;  1GA0 A;  1NY0 A;  3G2Y A;  3G4P A;  4FH4 A;  3GTC A;  5AQB A;  2Y2N A;  3WS4 A;  4IBX A;  2Y59 A;  3A3E A;  1L2S A;  3VOY A;  1GCE A;  4GZB A;  1ONH A;  3FYZ A;  5TR7 A;  3ZG8 B;  3ZVW A;  4QY5 A;  5DF8 A;  5EVI D;  4OPY A;  5FI7 A;  3BFG A;  1JVJ A;  1SKF A;  4OPZ A;  3WRZ A;  4DDY A;  3CZD A;  2DRW A;  1N9B A;  1G6A A;  5CEB A;  5EPH A;  3W4P A;  1FOF A;  4K0W A;  2HDS A;  2RCX A;  5EVI C;  5EVI A;  4B4Z A;  3N8R A;  1XGJ A;  2Y2J A;  3ZG7 B;  4GD6 A;  4OLG A;  2G2W A;  2ZLY A;  1DY6 A;  4GDN A;  4RYE A;  3UE3 A;  1Y54 A;  1YLJ A;  1S0W A;  2Y2K A;  5M18 A;  3HRE A;  4KQQ A;  1L0E A;  5FQI A;  3MKE A;  3A3J A;  1ES5 A;  3FZC A;  1XA7 A;  1K4F A;  3Q7Z A;  2A49 A;  1NYM A;  2ZM2 A;  4JLF A;  3O86 A;  2V20 A;  2HP5 A;  5E2F A;  2V1Z A;  3VP4 A;  3VP1 A;  2XQZ A;  4ZJ1 A;  2P74 A;  2DCF A;  3N7W A;  4N9K A;  4X53 A;  5GLA A;  3MFD A;  5F83 A;  1RGY A;  4QJG A;  4HES A;  5KMW A;  1SDE A;  1CI8 A;  4JXG A;  4MEZ A;  4D2O A;  1DJB A;  4XUX A;  1ES4 A;  4O7D A;  2ZQA A;  5GLB A;  1ZG6 A;  3CG5 A;  5CGS A;  4MBF A;  4RX3 A;  3V50 A;  3G34 A;  3VMA A;  1G68 A;  4EUZ A;  2ZD8 A;  3N4I A;  4P0M A;  1DJC A;  2QMI A;  3E2K A;  3EQV A;  4JF5 A;  1IYO A;  4Z9Q A;  5EEC A;  3MZF A;  4OPQ A;  2Z2L B;  3NIA A;  3A3I A;  1SCW A;  4IVK A;  1O7E A;  1EI5 A;  1VQQ A;  4UA9 A;  2WUQ A;  1BT5 A;  4BLM A;  1K6S A;  5HL1 A;  1LHY A;  1FSW A;  2EX2 A;  3PBO A;  1BSG A;  3C4P A;  1NXY A;  2BLS A;  2XH9 A;  2J9P A;  3BLS A;  1BLP A;  5GHZ A;  5FI6 A;  3BRM A;  4FH2 A;  1PW8 A;  3ITA A;  1BLH A;  5U47 A;  4OON A;  1PI5 A;  5L2F A;  4ZJ2 A;  2VGJ A;  3WS1 A;  1CI9 A;  2J9O A;  4OOL A;  2JCH A;  3IWQ A;  2PU4 A;  5BOH A;  1HVB A;  1KDW A;  1N4O A;  4DDS A;  3VP2 A;  3DWZ A;  5TFQ A;  3GRJ A;  4HEF A;  5TGF A;  4QB8 A;  2XLN A;  2Y4A A;  1Z6F A;  1CK3 A;  4P87 A;  4Y0O A;  5GLD A;  1K6R A;  3AGF A;  3OC2 A;  5DTT A;  4R3B A;  2UWX A;  3NBL A;  4WEL A;  1XA1 A;  2ZC6 B;  3TOI A;  2J7V A;  2EXA A;  4OH0 A;  3B3X A;  4C3Q A;  5CHU A;  4UHU A;  2PBY A;  1KVM A;  1XGI A;  5KZH A;  3HUM A;  2G2U A;  4BEN A;  5A92 A;  3HLE A;  5CGX A;  3ZHH A;  2ZQC A;  4KZ5 A;  4A5R A;  5FQ9 A;  2HP6 A;  2I72 A;  3UO9 A;  3VFF A;  3BM6 A;  5FI2 A;  4IVI A;  2CC1 A;  5M19 A;  4OQH A;  1MY8 A;  1TEM A;  3Q1F A;  3LY4 A;  5FAQ A;  1YMS A;  4MNR A;  1AXB A;  1C3B A;  5HAI A;  3UDF A;  1KGG A;  5M1A A;  1MXO A;  1YLY A;  4JF6 A;  2Y2M A;  3NC8 A;  3V39 A;  3PBN A;  4PPR A;  3M6B A;  3VSL A;  2Y2L A;  2IWB A;  2ZM0 A;  3QHY A;  1EWZ A;  3PBR A;  3P98 A;  4KZ4 A;  1FCM A;  5J8X A;  2R9W A;  3UE1 A;  1KGF A;  2Z2M B;  4JF4 A;  4U0X A;  1W8Y A;  2WKH A;  3OZH A;  4DRT A;  1XXM A;  2Y2G A;  5HAQ A;  2P9V A;  3FV7 A;  3NY4 A;  3C7V A;  4RVA A;  3IT9 A;  1TDG A;  1XPB A;  2Y2Q A;  4F94 A;  4GNU A;  1HTZ A;  1OME A;  3NI9 A;  2H0T A;  1KVL A;  2HP9 A;  2WGW A;  4S2P A;  4LV2 A;  4X68 A;  3S4X A;  5CED A;  2EFU A;  4DKI A;  1PI4 A;  4ZBE A;  3WS2 A;  2Y2O A;  2HDU A;  1YM1 A;  4RA7 A;  2WYX A;  1SHV A;  1W5D A;  3OCL A;  2OSU A;  1K4E A;  5HFO A;  2OV5 A;  1BUL A;  1K25 A;  4U3T A;  1NRF A;  2A3U A;  4JXW A;  4YIN A;  4Q8I A;  5FSR A;  5D3O A;  4BJP A;  1ERO A;  2Q9M A;  3OCN A;  3Q7V A;  1IYS A;  3HLB A;  4Y0U A;  3SH9 A;  4S2N C;  4S2N A;  2Y2P A;  2FFY A;  5HAP A;  5DF7 A;  2WKI A;  4LV3 A;  5F1G A;  3ZG5 A;  1GHP A;  2BG1 A;  3OPL A;  4PM8 A;  4R23 A;  4KG2 A;  5A91 A;  1FR6 A;  1H8Y A;  4WM9 A;  3W4Q A;  2GDN A;  2FFF B;  3IF6 C;  3IF6 A;  4OKP A;  5E43 A;  5FQM A;  2XFS A;  4S2O A;  2XGN A;  1I2S A;  3ISG A;  3EQU A;  5EOO A;  3BFE A;  3LY3 A;  1K56 D;  5F82 A;  3PBT A;  1H8Z A;  4X69 A;  3OPP A;  5EUA A;  5E2E A;  3HUO A;  3UDI A;  3QNC A;  4BD0 A;  2XD5 A;  1JTG A;  5KSH A;  2OLU A;  3VFH A;  1IKI A;  1K56 A;  3RJU A;  3BEB A;  2DNS A;  1Q2P A;  2EX6 A;  4N1H A;  3PBS A;  1K54 C;  1K54 A;  4PM6 A;  4QHC A;  3PAG A;  3IH8 A;  3N8S A;  3HBR A;  3WWX A;  3D4F A;  4BQM A;  1ONG A;  1PWC A;  3MXS A;  5E2G A;  1LLB A;  1L0D A;  1QME A;  2XK1 A;  3ITB A;  3Q81 A;  4LEN A;  2R9X A;  2IWD A;  2V2F F;  4MLL A;  3O87 A;  1BTL A;  1PWD A;  3NDG A;  1NZO A;  4H8R A;  3IXH A;  4KZ3 A;  4Y7P A;  5HAR A;  4E3K A;  2WGI A;  1CEF A;  3CJM A;  1K55 C;  1K55 A;  1NZU A;  4OQG A;  3DWK A;  1LI9 A;  2X02 A;  3BFF A;  3Q82 A;  4ID4 A;  5CEC A;  5FQK A;  4JKT A;  3RXX A;  5KSC A;  2XD1 A;  3E2L A;  3DW0 A;  3UDX A;  1DJA A;  4S2L A;  3Q07 A;  3C7U A;  3IXB A;  3VP3 A;  4XXR A;  4EQI A;  4ZDX A;  3MXR A;  1RP5 A;  3V5M A;  2X01 A;  3ZCZ A;  5DTS A;  3ZNT A;  3UPO A;  1K38 A;  1K57 C;  1K57 A;  1WYB A;  3FKV A;  3ZVT A;  3O88 A;  2EX8 A;  3G30 A;  4EBN A;  3IHA A;  5G18 A;  3BFD A;  2C5W B;  3JYI A;  1WYC A;  2ZC4 B;  1VM1 A;  1YLW A;  4S2J A;  4QY6 A;  2WKE A;  3N6I A;  4UA6 A;  5EVI B;  2H5S A;  3FKW A;  1LL5 A;  3IWI A;  4NET A;  3HLD A;  3ZDJ A;  4IBR A;  3SS4 A;  3GR2 A;  4HBT A;  2XF3 A;  5CXW A;  1XP4 A;  4HBU A;  5AQ9 A;  5DVA A;  2X71 A;  4OOY A;  5E2H A;  2IWC A;  3G32 A;  4JXV A;  5EVL A;  1KE3 A;  2Q9N A;  3Q7V B;  4S2K A;  2ZQ9 A;  4ZTK A;  3TG9 A;  1MWS A;  3FWL A;  4JPM A;  2HDQ A;  2HPB A;  1H5X A;  3IQA A;  3OPH A;  3IH9 A;  4K0X A;  2JE5 A;  4X55 A;  5FQQ A;  1ES2 A;  4E3M A;  4KG5 A;  3LO7 A;  4GD8 A;  1RGZ A;  4KG6 A;  1LL9 A;  5FAT A;  3CMZ A;  3G35 A;  3MZD A;  1WE4 A;  3HLG A;  4E3I A;  4R4R A;  1PYY A;  4DE0 A;  3G2Z A;  4GB7 A;  4GN2 A;  4WZ5 A;  4KQR A;  4WZ5 C;  4QD4 A;  4WZ4 A;  3VOZ A;  1E4D A;  4E3J A;  3SS5 A;  2ZM8 A;  3S1Y A;  4BL3 A;  3UE0 A;  4PM9 A;  2ZQ7 A;  1FCO A;  4DE3 A;  3GSG A;  1E25 A;  1ERQ A;  4NK3 A;  5CTM A;  3GMW A;  3PAE A;  4UAA A;  1ES3 A;  4S2M A;  5IHV A;  1CEG A;  1JWV A;  1PIO A;  1YQS A;  3M2J A;  5A93 A;  3AGE A;  1YT4 A;  1W7F A;  2ZQ8 A;  1PZO A;  3WRT A;  3IXG A;  4OVD A;  4MBK A;  5HW3 A;  5FQJ A;  4ZAM A;  5GHY A;  1FQG A;  4DE1 A;  4LV1 A;  4R4S A;  5CHJ A;  3ZG0 A;  1FCN A;  2WGV A;  3HLC A;  3WS0 A;  3UN7 A;  1M6K A;  2HDR A;  1W79 A;  2B5R A;  3WS5 A;  1MWT A;  4R0Q A;  5AQA A;  1SDN A;  2Y2H A;  4OQI A;  4DF6 A;  1MWR A;  4PM7 A;  1TDL A;  4P6B A;  4UA7 A;  4EV4 A;  2QPN A;  1RCJ A;  4N9L A;  4E3N A;  3W4O A;  1GHM A;  4E6X A;  3SH8 A;  3TSG A;  3A3F A;  2XFT A;  4KZ6 A;  4P85 A;  2WAE A;  1IEM A;  4N1X A;  3IF5 A;  2Y55 A;  3IWO A;  2EXB A;  2OLV A;  2WZX A;  1ZC2 A;  2ZMA A;  1ESU A;  4M3K A;  2ZQD A;  1YLZ A;  2H10 A;  4JXS A;  1FSY A;  3MKF A;  3AGD A;  3S22 A;  4ZJ3 A;  1MKI A;  1XKZ A;  4E3O A;  3DTM A;  5DTK A;  2WZZ A;  4KZ7 A;  1W8Q A;  1GA9 A;  1BLS A;  4MBH A;  3NCK A;  4KQO A;  3HLW A;  1JWZ A;  3MZE A;  1KE0 A;  3UPN A;  1NJ4 A;  5GHX A;  4R3J A;  3HVF A;  5FDH A;  4EWF A;  3M2K A;  2ZC5 B;  1U60 A;  3HL9 A;  4DXC A;  4KZA A;  3ZNY A;  3I7J A;  4B88 A;  3GQZ A;  5CER A;  5FAS A;  3LEZ A;  4WEK A;  2Y91 A;  3GV9 A;  5CTN A;  2XR0 A;  1LI0 A;  1MWU A;  2VGK A;  1E3U D;  2JC7 A;  1IYP A;  2J8Y A;  1L0G A;  4FD8 A;  1TVF A;  4OLD A;  4X56 A;  4WEJ A;  3N8L A;  4X6T A;  4PM5 A;  5I94 A;  1BUE A;  4KZ8 A;  2XDM A;  2ZC7 A;  4OP5 A;  3V3R A;  3PBQ A;  1HZO A;  4BL2 A;  4E6W A;  1E3U A;  2P9V B;  1MBL A;  2Y2I A;  3W8K A;  1PZP A;  4YFM A;  1M40 A;  3C5A A;  2JBF A;  2C6W B;  5CGW A;  2XEP A;  3V3S A;  5HX9 A;  3MBZ A;  1J9M A;  1PWG A;  4QU3 A;  1ZKJ A;  2WGW B;  5FAP A;  4OPR A;  1GHI A;  2EFX A;  3LCE A;  4OOM A;  1KDS A;  4EBP A;  3P09 A;  3UY6 A;  4B4X A;  3C4O A;  4DXB A;  4LCM A;  4GDB A;  1L0F A;  1ALQ A;  3RXW A;  4BD1 A;  1O07 A;  1PW1 A;  5CRF A;  4FSF A;  5AQ7 A;  4C75 A;  3ZG9 B;  3BLM A;  5FAO A;  3ZFZ A;  4RX2 A;  3SOI A;  2RL3 A;  3VP0 A;  3ZGA B;  2WK0 A;  4KZB A;  1FR1 A;  3IHB A;  1IEL A;  4GOG A;  1ZG4 A;  1YMX A;  5JYP A;  1JTD A;  5F1F A;  1IYQ A;  1NYY A;  1HD8 A;  4KEN B;  3IXD A;  4EBL A;  4WYY A;  3BEC A;  1XX2 A;  4CJN A;  5EOE A;  2WAD A;  4JBF A;  3SS3 A;  3QNB A; 
#chains in the Genus database with same CATH topology
 4ETX A;  5GLC A;  1F9I A;  4HY8 A;  2H0Y A;  3NDE A;  3IF6 B;  2ZC3 B;  3UPP A;  1KE4 A;  1JWP A;  2PU2 A;  3SH7 A;  1Z09 A;  3OPR A;  4GKU A;  1BLC A;  3MJQ A;  3BW6 A;  3HLF A;  2D02 A;  3BYD A;  3UNW A;  1KGE A;  2B02 A;  4EU0 A;  3PTE A;  2E8I A;  2JKR I;  4M4X A;  3KSG A;  3O3V A;  4K08 A;  4HOI A;  3H7W A;  3MXQ A;  4LPZ A;  1UWN X;  3VOY A;  1GCE A;  4GZB A;  1ONH A;  5J4E A;  3BFG A;  3E0Y A;  3W4P A;  4K0W A;  3PHY A;  3A0R A;  3CIT A;  1WA9 A;  4CQH A;  4RYE A;  1Y54 A;  1L0E A;  4IUH A;  3EWK A;  1LT0 A;  2L1M A;  5HWT A;  1K4F A;  2A49 A;  3C8C A;  2ZOI A;  4JLF A;  2V20 A;  2V1Z A;  2VV6 A;  3VP4 A;  4L9E A;  4N9K A;  4QJG A;  1PRQ A;  1ES4 A;  2W27 A;  5A8B A;  1ZG6 A;  5CGS A;  4MBF A;  4XT2 A;  4RX3 A;  4EUZ A;  5J3W A;  2PAV P;  2GX5 A;  2V1B A;  2VA0 A;  4DJ2 A;  3RFB A;  1BT5 A;  2PBD P;  3CPT A;  2BLS A;  2XH9 A;  2J9P A;  3BLS A;  1BLP A;  5FI6 A;  3ITA A;  3T1X A;  5L2F A;  1P97 A;  2OWJ A;  3WS1 A;  1CI9 A;  5BOH A;  5EM0 A;  4HEF A;  5EV0 A;  2Y4A A;  4EQ1 A;  3F1O A;  4R3B A;  5IU1 A;  3TOI A;  2LB5 A;  4HP4 A;  3B3X A;  5CHU A;  4UHU A;  3TRC A;  4O01 A;  5A92 A;  2QHK A;  5CGX A;  3ZHH A;  2HP6 A;  5FI2 A;  4IVI A;  1NWZ A;  3LGO A;  2WKR A;  4OQH A;  1D06 A;  3U2A A;  5FAQ A;  1AXB A;  3F1N A;  3VOL A;  1YLY A;  3PBN A;  3QHY A;  4UQI M;  3UE1 A;  2Z2M B;  4JF4 A;  2WKH A;  5TBM B;  1XXM A;  2Y2G A;  1IOU A;  4YOF A;  2NUT C;  3C7V A;  3IT9 A;  2Y2Q A;  1N9N A;  1HTZ A;  4GHI B;  1PI4 A;  5HL6 A;  2EWV A;  1SHV A;  4LFU A;  2L4R A;  1VHM A;  5HFO A;  2OV5 A;  3V67 A;  1NRF A;  3SZT A;  4MDZ A;  4Q8I A;  5FSR A;  3OOV A;  2Q9M A;  3DTI A;  3OCN A;  4LRZ E;  1GSV A;  4EUV A;  3HLB A;  4Y0U A;  4CLC E;  3UMD A;  5LBR A;  5MC7 A;  2FFY A;  5HAP A;  4LV3 A;  1GHP A;  2VV7 A;  1FR6 A;  1H8Y A;  4WM9 A;  2GDN A;  3NOT C;  5E43 A;  4OKP A;  1DP6 A;  1I2S A;  3EQU A;  1H8Z A;  4GS9 A;  3HUO A;  2XD5 A;  1JTG A;  4PKY G;  2OLU A;  4ME4 A;  3RJU A;  4NKP A;  2EX6 A;  1K54 C;  1K54 A;  2MJ6 A;  3IH8 A;  3N8S A;  3DBA A;  4LLO B;  3MXS A;  5E2G A;  2Y8H A;  4IUK A;  2R9X A;  2V2F F;  2V1A A;  5HAR A;  1NZO A;  3IXH A;  2P7J A;  1HLU P;  2JKT I;  3CJM A;  1K55 C;  1K55 A;  4IJG A;  2PDR A;  3RXX A;  3E4P A;  5AVF A;  3H7W B;  3Q07 A;  3IXB A;  4HJ6 A;  4NXF A;  3MXR A;  1RP5 A;  3V5M A;  3ZNT A;  1K57 C;  1K57 A;  4KQD A;  2EX8 A;  3G30 A;  1G5U A;  5G18 A;  4EBN A;  3BFD A;  3JYI A;  4HNB A;  4S2J A;  1LL5 A;  4X25 A;  3SS4 A;  4GCZ A;  4BWI A;  5DVA A;  4JXV A;  4I3A A;  2Q9N A;  4S2K A;  3LI8 A;  2A2L A;  2ZQ9 A;  1OTB A;  1MWS A;  4ZTK A;  3IQA A;  2JE5 A;  1OJ5 A;  1ES2 A;  5FQQ A;  4GD8 A;  1LL9 A;  5FAT A;  3CMZ A;  3G35 A;  3HLG A;  3T4T A;  4E3J A;  4GN2 A;  4LRX C;  3CWF A;  1T1B A;  4PM9 A;  4L9F A;  1FCO A;  4XT2 B;  1ERQ A;  4UAA A;  3LI9 A;  3T1Q B;  1CEG A;  1PIO A;  3CLO A;  4I5S A;  4I3I A;  4B93 A;  1YQS A;  5A93 A;  2ZQ8 A;  1PZO A;  3CPT B;  5FQJ A;  2V9A A;  4ZAM A;  5GHY A;  1XJ6 A;  4LV1 A;  3G6O A;  3WS0 A;  2W0N A;  3UN7 A;  1M6K A;  3T4O A;  5FEG A;  1MWT A;  1LSW A;  4OQI A;  1RCJ A;  3ICY A;  3W4O A;  1TF1 A;  4E6X A;  5KIZ A;  3TSG A;  4KZ6 A;  3LIA A;  3F1O B;  3LR3 A;  3IF5 A;  2Y55 A;  3KYZ A;  2OLV A;  3BJN A;  4M3K A;  3K3D A;  2H10 A;  1FSY A;  3MKF A;  3S22 A;  4LGW A;  1XKZ A;  4BBV A;  2O99 A;  5DTK A;  2WZZ A;  2YKH A;  4MBH A;  1KE0 A;  3UPN A;  4EWF A;  4BMW A;  2W3E A;  1XJ4 A;  4DXC A;  4KZA A;  3ZNY A;  1A0K A;  3F1N B;  3GQZ A;  2BAS A;  1LL8 A;  3LIB A;  4WEK A;  2Y91 A;  3VE3 A;  1MWU A;  1ZHH B;  1E3U D;  2HJE A;  4FD8 A;  4X56 A;  1E3U A;  4D60 A;  1PZP A;  2AVX A;  1M40 A;  3C5A A;  4YWZ A;  4QU3 A;  1ZKJ A;  2PHY A;  4EBP A;  1KDS A;  1P9W A;  3P09 A;  3UY6 A;  3S7Q A;  5CRF A;  1YKD A;  3ZG9 B;  2W3D A;  4RX2 A;  4EEP A;  3VP0 A;  3ZGA B;  2VGL M;  4MCW A;  1IEL A;  1HD8 A;  3IXD A;  4CJN A;  2WAD A;  3BY8 A;  3KSF A;  4CPK A;  3T4J A;  1S6R A;  1MPL A;  4WL9 A;  1QMF A;  2ACG A;  1ZTU A;  4OQ0 A;  3PYP A;  4GS9 B;  5EE8 A;  5A90 A;  3HUN A;  4Y0T A;  1TS7 A;  2WAF A;  2ZJ9 A;  4L0L A;  3VSK A;  1ERM A;  2OWH A;  3O5Y A;  5C5K A;  4HHD A;  5HDD A;  3QP2 A;  1T18 A;  2FZ0 A;  5I5L A;  4I38 A;  4FH4 A;  1NY0 A;  5AQB A;  3WS4 A;  3GTC A;  2Y59 A;  5TR7 A;  4DMZ A;  4QY5 A;  5EVI D;  4OPZ A;  3ZYT A;  4DDY A;  3CZD A;  1FIK A;  1N9B A;  5CEB A;  5EVI C;  5EVI A;  2RCX A;  3QP6 A;  4JGO A;  3ZG7 B;  2L0W A;  2ZLY A;  4GDN A;  3RTY A;  4KQQ A;  5FQI A;  3A3J A;  3Q7Z A;  3UB8 A;  1NYM A;  2EWW A;  2KOI A;  2HP5 A;  3VP1 A;  2DCF A;  4EET B;  3N7W A;  1RGY A;  5KMW A;  1CI8 A;  2W3G A;  4G3K A;  4O7D A;  5TBM A;  4HQA A;  3CG5 A;  2ZD8 A;  4P6Z S;  4Z9Q A;  3KSH A;  2Z2L B;  2M7V A;  3PR6 A;  2W1T A;  1VQQ A;  4GHI A;  2WUQ A;  3T4S A;  4BLM A;  5HL1 A;  1LHY A;  1FSW A;  2EX2 A;  2E8J A;  1BSG A;  1NXY A;  3KX0 X;  2XA7 M;  3CHW P;  2VK3 A;  4FH2 A;  1PW8 A;  1OT6 A;  5K5B A;  3S7N A;  2J9O A;  3NJA A;  1OT9 A;  1HVB A;  1N4O A;  2PYR A;  2HV1 A;  4QB8 A;  1FIL A;  1CK3 A;  4P87 A;  4FUW A;  1K6R A;  2K31 A;  4BBU A;  1DP8 A;  2ZC6 B;  2J7V A;  5EVE A;  1CJF A;  2PBY A;  1XGI A;  1OTI A;  4WLA A;  5DJU A;  5KZH A;  4BEN A;  3LIE A;  4A5R A;  3UO9 A;  3VFF A;  4Q0H A;  4X1M A;  4GLQ A;  1TEM A;  3Q1F A;  4H6J A;  4MNR A;  3B33 A;  1OTA A;  1MXO A;  1NRJ A;  4PPR A;  3M6B A;  2Y2L A;  1N9L A;  3SW1 A;  1EWZ A;  1FCM A;  5J8X A;  1KGF A;  4U0X A;  1VEU A;  3FV7 A;  4ARZ A;  2K7S A;  3NI9 A;  2HP9 A;  2WGW A;  4S2P A;  3KYE A;  4X68 A;  5CED A;  2EFU A;  4DKI A;  1S66 L;  3WS2 A;  1G6O A;  2HDU A;  1H8M A;  1T19 A;  2WYX A;  1K4E A;  1BUL A;  1K25 A;  2GZA A;  2W3F A;  4WF0 A;  1H0M A;  3L9K A;  4YIN A;  2J3T C;  3SH9 A;  2Y2P A;  2WKI A;  3ZG5 A;  2QJ7 A;  4R23 A;  4BBT A;  4KG2 A;  5A91 A;  3MQQ A;  2QYB A;  2FFF B;  5FQM A;  2XFS A;  3ISG A;  2VX8 A;  3LY3 A;  1ACF A;  4BD0 A;  3UDI A;  3VFH A;  4X1L A;  1Q2P A;  4QHC A;  3D4F A;  1ONG A;  1PWC A;  3TW8 A;  1LLB A;  2JHE A;  2O9C A;  1QME A;  2Y79 A;  3IS2 A;  3ITB A;  4CLC C;  4CLC A;  5DFY A;  4H8R A;  4KZ3 A;  1CEF A;  4Q0I A;  1NZU A;  3DWK A;  2X02 A;  3DW0 A;  4S2L A;  3VP3 A;  4EQI A;  3T1S A;  4R38 A;  5DTS A;  4JGP A;  1K38 A;  1WYB A;  3FKV A;  1D7E A;  2HF6 A;  3O88 A;  4L9G A;  3JPU A;  2HGV A;  2ZC4 B;  5EVI B;  3IWI A;  3HLD A;  3ZDJ A;  2XF3 A;  5CXW A;  2ZBB A;  4YNR A;  2V8C A;  3T50 A;  2IWC A;  5L8M A;  3Q7V B;  3TG9 A;  2HPB A;  3VV4 A;  1H5X A;  3OPH A;  4PAU A;  4E3M A;  4Y17 A;  3LR0 A;  3LUQ A;  4DE0 A;  4GB7 A;  4KQR A;  3VOZ A;  5EFW A;  2ZM8 A;  3UE0 A;  4NG2 A;  2PR5 A;  2W3H A;  5CTM A;  3DTK A;  1ES3 A;  1MZU A;  2W1T B;  4HI4 A;  3AGE A;  3IX8 A;  1YT4 A;  1W7F A;  2WKP A;  3D72 A;  3RH8 B;  4HH2 A;  3MMH A;  5F68 A;  4DE1 A;  3FC7 A;  4EXO A;  3ZG0 A;  3HLC A;  2HDR A;  1W79 A;  2B5R A;  3WS5 A;  5HPF A;  5AQA A;  1SDN A;  4MMN A;  4PM7 A;  1TDL A;  4EV4 A;  3BY9 A;  1AWI A;  3LIF A;  3SH8 A;  5L07 A;  2XFT A;  4P85 A;  3GDI A;  2EXB A;  2WZX A;  2ZMA A;  3IX4 A;  1ESU A;  2OOL A;  2ZQD A;  4JXS A;  4ZJ3 A;  3LID A;  3DTM A;  4Y15 A;  4KZ7 A;  1BLS A;  2DMW A;  3BWL A;  3H9W A;  3HLW A;  1NJ4 A;  4R3J A;  3M2K A;  4H6J B;  2ZC5 B;  1TS0 A;  5IT5 A;  4B88 A;  1OPX A;  4EER A;  3GV9 A;  1LI0 A;  2VGK A;  1IYP A;  2J8Y A;  1XJ2 A;  3BQA A;  2ZC7 A;  4HIA A;  4KZ8 A;  3V3R A;  1VEU B;  3PBQ A;  2A24 A;  4ARZ B;  3W8K A;  4Y13 A;  5FL3 A;  4YFM A;  2C6W B;  2XEP A;  3V3S A;  5HX9 A;  2XRO A;  3MBZ A;  2PR6 A;  3HCY A;  2WGW B;  3W2Z A;  1YAX A;  3D9Y A;  2EFX A;  4O8G A;  4OPR A;  2B95 A;  1ALQ A;  3RXW A;  3LYX A;  4BD1 A;  2Z6C A;  4C75 A;  5FAO A;  5JYP A;  5F1F A;  4KEN B;  2G7U A;  4WYY A;  4JBF A;  3QNB A;  3CAX A;  1MC0 A;  1NLZ A;  2EX9 A;  4U0T A;  3EGX C;  1NLY A;  4KZ9 A;  1IKG A;  4LCL A;  1BZA A;  3BFC A;  4K91 A;  4XUZ A;  5CHM A;  3QP8 A;  4R70 A;  4N92 A;  1YLP A;  5DKK A;  3M6H A;  4O0P A;  1YPR A;  4DE2 A;  5GL9 A;  3IS2 B;  1YLT A;  4IED A;  2Z6D A;  4CLC B;  1ESI A;  3A3D A;  3G4P A;  1L3L A;  2Y2N A;  4IBX A;  4NXB A;  3FYZ A;  4WUJ A;  3ZG8 B;  3ZVW A;  4OPY A;  5FI7 A;  3FG8 A;  2DRW A;  5EPH A;  3N8R A;  2Y2J A;  4GD6 A;  4OLG A;  2G2W A;  1DY6 A;  3UE3 A;  1YLJ A;  3HRE A;  3MKE A;  3FZC A;  1S1Z A;  1XA7 A;  2HJ9 C;  4Y2F A;  3KSI A;  2ZM2 A;  2ZMV A;  1G28 A;  3O86 A;  5E2F A;  3NOP C;  2P74 A;  3MFD A;  5F83 A;  3P7N A;  4JXG A;  4MEZ A;  3U4L P;  4D2O A;  4XUX A;  3LFV A;  3T4Q A;  2KLI A;  3V50 A;  3G34 A;  4P0M A;  1DJC A;  3EQV A;  1IYO A;  3NIA A;  4IVK A;  1EI5 A;  2WKQ A;  3UME A;  1K6S A;  1XFN A;  3C4P A;  3BRM A;  3C38 A;  1OTD A;  1BLH A;  5U47 A;  2PRF A;  2VGJ A;  5AJG A;  1KDW A;  4DDS A;  3VP2 A;  3DWZ A;  3MQO A;  2NUP C;  3QP1 A;  5L10 A;  3AGF A;  3OC2 A;  3B42 A;  2UWX A;  2JKR M;  2PT7 A;  2EXA A;  4OH0 A;  3HUM A;  3HLE A;  2ZQC A;  3BM6 A;  2CC1 A;  2V0U A;  4ETZ A;  1YMS A;  1C3B A;  4JGQ A;  1KGG A;  3C2W A;  3FPV A;  3VSL A;  5FEF A;  1LSX A;  3PBR A;  3P98 A;  2R9W A;  1W8Y A;  4II7 A;  3OZH A;  4DRT A;  2D01 A;  3LIC A;  1V9Y A;  3UB9 A;  4F94 A;  1XPB A;  1OME A;  2A24 B;  1KVL A;  3S4X A;  4ZBE A;  2Y2O A;  3B47 A;  1YM1 A;  2K2N A;  4RA7 A;  3OCL A;  3CI6 A;  2A3U A;  5HSQ A;  4PHT A;  5D3O A;  3VE4 A;  1ERO A;  3Q7V A;  1IYS A;  3H82 A;  4R3A A;  2Q0O A;  2KDK A;  4S2N C;  4S2N A;  4RQ9 A;  5DF7 A;  4I3J A;  2BG1 A;  3S7O A;  3UB6 A;  3KO6 A;  3W4Q A;  4KUK A;  2XGN A;  3EOI A;  5EOO A;  3BFE A;  1K56 D;  3QP5 A;  5F82 A;  3PBT A;  5EUA A;  5E2E A;  3QNC A;  5L09 A;  1K56 A;  2DNS A;  2QKP A;  4N1H A;  4PM6 A;  3PAG A;  3HBR A;  3OBF A;  2XK1 A;  3Q81 A;  2IWD A;  3K3C A;  1BTL A;  4Y7P A;  3NDG A;  2JKG A;  1LI9 A;  3BFF A;  4ID4 A;  5CEC A;  5FQK A;  2XD1 A;  3E2L A;  1DJA A;  3C7U A;  4XXR A;  4F3L A;  4ZDX A;  2X01 A;  1PNE A;  3UPO A;  2VEA A;  5HWV A;  3IHA A;  3T4L A;  1VM1 A;  1YLW A;  3N6I A;  3FKW A;  4IBR A;  1CQA A;  3GR2 A;  1XP4 A;  4HBU A;  5AQ9 A;  5E2H A;  4OOY A;  1YSP A;  3G32 A;  1KE3 A;  3A0V A;  3K2N A;  4FOF A;  2LB9 A;  3DTE A;  4JPM A;  3EEH A;  1JNU A;  4B9O A;  3IH9 A;  4K0X A;  1BYW A;  2V8F A;  2J80 A;  4KG5 A;  2P04 A;  1RGZ A;  5AVE A;  4ZRR A;  3MZD A;  4R4R A;  1PYY A;  1XJ3 A;  4WZ5 C;  4P6Z M;  4WZ5 A;  4QD4 A;  4WZ4 A;  1E4D A;  2CMN A;  5HDS A;  2UV0 E;  4KUO A;  4DE3 A;  5HDC A;  3GSG A;  1E25 A;  4NK3 A;  3PAE A;  4S2M A;  4WN5 A;  2JKF A;  5IS1 A;  3LR5 A;  3T12 B;  3WRT A;  3IXG A;  2QWS A;  4MBK A;  5HW3 A;  2EA9 A;  1FQG A;  3UE6 A;  2J3T D;  4R4S A;  5CHJ A;  2WGV A;  4ESP A;  2ZOH A;  4R0Q A;  1MWR A;  2P08 A;  2O0Y A;  4P6B A;  4N9L A;  4E3N A;  2O9A A;  1J3W A;  3A3F A;  2WAE A;  3IWO A;  3ZQ5 A;  2JKT M;  2VLG A;  1MKI A;  2HZ5 A;  2M1C A;  1W8Q A;  1GA9 A;  3NCK A;  4KQO A;  1JWZ A;  3MZE A;  4CLC D;  5GHX A;  4NXG A;  3HVF A;  2ZMF A;  3HL9 A;  4GJ4 A;  2PD8 A;  5FAS A;  3LEZ A;  2XR0 A;  1L0G A;  2JC7 A;  3N8L A;  4PM5 A;  5I94 A;  5EM1 A;  4UQI S;  4OP5 A;  2XDM A;  4E6W A;  1HZO A;  1MBL A;  3F1P A;  2JBF A;  5FAP A;  3IBJ A;  4OOM A;  1GHI A;  3LCE A;  3C4O A;  4FTX A;  4LCM A;  4MN6 A;  5F5Y A;  1L0F A;  3FPW A;  3MSH A;  2H28 A;  1N9O A;  3D3O A;  3SOI A;  2RL3 A;  2PD7 A;  4KZB A;  2W1R A;  1FR1 A;  2B18 A;  4GOG A;  3KYQ A;  3LR4 A;  3H82 B;  1IYQ A;  4EBL A;  3NOU C;  3BEC A;  3SS3 A;  5F69 A;  4E3L A;  3GVB A;  3NHQ A;  4OP8 A;  5JYO A;  4LV0 A;  4S2I A;  3G31 A;  4R1G A;  2IA2 A;  1OJG A;  5FA7 A;  4GW9 A;  1Q2Q A;  4WMC D;  2QZ6 A;  4FCF A;  4C6Y A;  4WMC A;  5G4Z A;  1I2W A;  1VET A;  1I5Q A;  5DF9 A;  4G3W A;  4IHQ A;  3NUL A;  4WBG A;  4PMA A;  5HD3 A;  1GA0 A;  3G2Y A;  5HZH A;  3A3E A;  1L2S A;  2OAQ 1;  5DF8 A;  2ZL1 A;  1JVJ A;  1SKF A;  4HJ3 A;  3WRZ A;  4F3L B;  2OAP 1;  1G6A A;  1FOF A;  2HDS A;  1X0O A;  4B4Z A;  1XGJ A;  4E04 A;  1S1Y A;  3L7H A;  2GNX A;  1S0W A;  2Y2K A;  5M18 A;  5J7E A;  1XFQ A;  3DAV A;  1ES5 A;  5DJT A;  2XQZ A;  3IX3 A;  4ZJ1 A;  3C30 A;  4X53 A;  5GLA A;  5TJJ A;  4HES A;  1SDE A;  2GJ3 A;  1DJB A;  3E4O A;  2QJ5 A;  2ZQA A;  5GLB A;  3VMA A;  2VKS A;  1G68 A;  3MR0 A;  3N4I A;  2QMI A;  3E2K A;  4JF5 A;  4MN5 A;  5EEC A;  3MZF A;  4OPQ A;  4R6L A;  3A3I A;  1SCW A;  1O7E A;  4UA9 A;  4Q0J A;  3PBO A;  5GHZ A;  1GSX A;  4Y5F A;  4OON A;  1PI5 A;  4Z1W A;  1SKO A;  3UB5 P;  3S7P A;  4ZJ2 A;  4EEU A;  2R78 A;  4OOL A;  3T4K A;  2JCH A;  3IWQ A;  2PU4 A;  1LSV A;  5TFQ A;  3GRJ A;  5TGF A;  3TJZ C;  2XLN A;  1V9Z A;  1Z6F A;  5DFX A;  2M7U A;  4Y0O A;  5GLD A;  5DTT A;  3NBL A;  2PYP A;  4WEL A;  1XA1 A;  3P01 A;  2O9B A;  4MN7 A;  1S4R A;  4C3Q A;  1CF0 A;  3TE8 A;  1KVM A;  5FDS A;  1F2K A;  2G2U A;  1TD5 A;  4KZ5 A;  5FQ9 A;  2I72 A;  3MF0 A;  4AFI A;  4NEE D;  3R7W A;  5M19 A;  1MY8 A;  3LY4 A;  1K0K A;  5HAI A;  3UDF A;  5M1A A;  4JF6 A;  2Y2M A;  3NC8 A;  3V39 A;  2IWB A;  2ZM0 A;  4KZ4 A;  3E4Q A;  3JVV A;  5HAQ A;  2P9V A;  3NY4 A;  4RVA A;  1TDG A;  1IFQ A;  4GNU A;  1UWP X;  2H0T A;  3UB7 A;  4JGR A;  4LV2 A;  3F1P B;  5HD5 A;  3BQ8 A;  4HP9 A;  1YSQ A;  1W5D A;  2OSU A;  4U3T A;  1GSW A;  1OTE A;  4JXW A;  3MFX A;  3A0S A;  4BJP A;  2XSS A;  1S67 L;  3MS6 A;  3LEQ A;  3PXP A;  2VV8 A;  1ODV A;  5F1G A;  5HWW A;  3OPL A;  4PM8 A;  2VGL S;  1W63 Q;  1DP9 A;  5CX7 A;  3IF6 C;  3IF6 A;  4S2O A;  2J3W A;  4X69 A;  1STZ A;  3OPP A;  3HJI A;  3QP4 A;  5KSH A;  5HPI A;  1IKI A;  3BEB A;  2KX6 A;  2BTF P;  4QWO A;  3PBS A;  3WWX A;  4BQM A;  1L0D A;  3IBR A;  4LEN A;  1VET B;  4MLL A;  3O87 A;  4Y3I A;  1PWD A;  4E3K A;  1EW0 A;  1P0Z A;  2WGI A;  4HH3 A;  4OQG A;  3Q82 A;  1P9R A;  4JKT A;  5KSC A;  3UDX A;  1F98 A;  3ZCZ A;  1VB6 A;  3ZVT A;  2ZL1 B;  2JN7 A;  3EGD C;  2C5W B;  5G4Y A;  1WYC A;  2V0W A;  4QY6 A;  2WKE A;  2YKF A;  4UA6 A;  2H5S A;  4NET A;  3NEC A;  4HBT A;  1TS6 A;  2X71 A;  5EVL A;  3FWL A;  2HDQ A;  1H3Q A;  4X55 A;  3LO7 A;  4KG6 A;  1F5M A;  1WE4 A;  4E3I A;  4QPR A;  3T1R A;  3G2Z A;  1PFL A;  4DJ3 A;  3SS5 A;  3S1Y A;  4BL3 A;  4EW7 A;  4NXE A;  2ZQ7 A;  3EEA A;  3GMW A;  1Y4O A;  5IHV A;  1JWV A;  4EES A;  4G3V A;  3M2J A;  2VZW A;  4DN0 A;  4OVD A;  2FH5 A;  2XA7 S;  1KOU A;  1FCN A;  1SKO B;  4I39 A;  1SZV A;  1DRM A;  2Y2H A;  4DF6 A;  4UA7 A;  2QPN A;  2VJW A;  2INW A;  1GHM A;  4N1X A;  1IEM A;  1TS8 A;  1ZC2 A;  1YLZ A;  3AGD A;  4E3O A;  4UEY A;  3HJK A;  3R7W B;  5FDH A;  3CUE C;  3CUE A;  1S4S A;  1U60 A;  3I7J A;  3R4K A;  3OLO A;  5CER A;  5CTN A;  3JVU A;  1TVF A;  4OLD A;  4WEJ A;  4X6T A;  1MKM A;  1T1C A;  1BUE A;  4BL2 A;  2P9V B;  2Y2I A;  2I9V A;  5F6A A;  5CGW A;  1J9M A;  1PWG A;  5DKL A;  4DXB A;  4B4X A;  1T1A A;  2XRN A;  4GDB A;  1O07 A;  3E98 A;  1PW1 A;  4FSF A;  5AQ7 A;  3BLM A;  3ZFZ A;  1W63 M;  4HJ4 A;  4PKY A;  1D1J A;  2WK0 A;  1Y28 A;  3IHB A;  3ULF A;  1ZG4 A;  1UGU A;  1YMX A;  3GEC A;  1JTD A;  1NYY A;  4LRY C;  3MQ0 A;  1XX2 A;  5EOE A; 
#chains in the Genus database with same CATH homology
 4CPK A;  4U0T A;  2EX9 A;  5GLC A;  4E3L A;  3GVB A;  4OP8 A;  2H0Y A;  5JYO A;  4LV0 A;  3NDE A;  4S2I A;  3G31 A;  3IF6 B;  2ZC3 B;  4KZ9 A;  1S6R A;  1MPL A;  3UPP A;  1KE4 A;  4R1G A;  1IKG A;  1JWP A;  5FA7 A;  2PU2 A;  4LCL A;  3SH7 A;  1BZA A;  1Q2Q A;  3BFC A;  4WMC D;  4K91 A;  1QMF A;  4OQ0 A;  3OPR A;  2QZ6 A;  4FCF A;  4XUZ A;  5CHM A;  5EE8 A;  4GKU A;  1BLC A;  5A90 A;  4N92 A;  4C6Y A;  1YLP A;  4WMC A;  3HUN A;  4Y0T A;  2WAF A;  2ZJ9 A;  3M6H A;  4L0L A;  1I2W A;  3VSK A;  3HLF A;  4DE2 A;  1ERM A;  5GL9 A;  3BYD A;  1I5Q A;  5DF9 A;  3UNW A;  1KGE A;  3PTE A;  1YLT A;  2E8I A;  4WBG A;  4IED A;  4PMA A;  1ESI A;  3O3V A;  3A3D A;  1GA0 A;  1NY0 A;  3G2Y A;  3G4P A;  4FH4 A;  3GTC A;  5AQB A;  2Y2N A;  3WS4 A;  4IBX A;  2Y59 A;  3A3E A;  1L2S A;  3VOY A;  1GCE A;  4GZB A;  1ONH A;  3FYZ A;  5TR7 A;  3ZG8 B;  3ZVW A;  4QY5 A;  5DF8 A;  5EVI D;  4OPY A;  5FI7 A;  3BFG A;  1JVJ A;  1SKF A;  4OPZ A;  3WRZ A;  4DDY A;  3CZD A;  2DRW A;  1N9B A;  1G6A A;  5CEB A;  5EPH A;  3W4P A;  1FOF A;  4K0W A;  2HDS A;  2RCX A;  5EVI C;  5EVI A;  4B4Z A;  3N8R A;  1XGJ A;  2Y2J A;  3ZG7 B;  4GD6 A;  4OLG A;  2G2W A;  2ZLY A;  1DY6 A;  4GDN A;  4RYE A;  3UE3 A;  1Y54 A;  1YLJ A;  1S0W A;  2Y2K A;  5M18 A;  3HRE A;  4KQQ A;  1L0E A;  5FQI A;  3MKE A;  3A3J A;  1ES5 A;  3FZC A;  1XA7 A;  1K4F A;  3Q7Z A;  2A49 A;  1NYM A;  2ZM2 A;  4JLF A;  3O86 A;  2V20 A;  2HP5 A;  5E2F A;  2V1Z A;  3VP4 A;  3VP1 A;  2XQZ A;  4ZJ1 A;  2P74 A;  2DCF A;  3N7W A;  4N9K A;  4X53 A;  5GLA A;  3MFD A;  5F83 A;  1RGY A;  4QJG A;  4HES A;  5KMW A;  1SDE A;  1CI8 A;  4JXG A;  4MEZ A;  4D2O A;  1DJB A;  4XUX A;  1ES4 A;  4O7D A;  2ZQA A;  5GLB A;  1ZG6 A;  3CG5 A;  5CGS A;  4MBF A;  4RX3 A;  3V50 A;  3G34 A;  3VMA A;  1G68 A;  4EUZ A;  2ZD8 A;  3N4I A;  4P0M A;  1DJC A;  2QMI A;  3E2K A;  3EQV A;  4JF5 A;  1IYO A;  4Z9Q A;  5EEC A;  3MZF A;  4OPQ A;  2Z2L B;  3NIA A;  3A3I A;  1SCW A;  4IVK A;  1O7E A;  1EI5 A;  1VQQ A;  4UA9 A;  2WUQ A;  1BT5 A;  4BLM A;  1K6S A;  5HL1 A;  1LHY A;  1FSW A;  2EX2 A;  3PBO A;  1BSG A;  3C4P A;  1NXY A;  2BLS A;  2XH9 A;  2J9P A;  3BLS A;  1BLP A;  5GHZ A;  5FI6 A;  3BRM A;  4FH2 A;  1PW8 A;  3ITA A;  1BLH A;  5U47 A;  4OON A;  1PI5 A;  5L2F A;  4ZJ2 A;  2VGJ A;  3WS1 A;  1CI9 A;  2J9O A;  4OOL A;  2JCH A;  3IWQ A;  2PU4 A;  5BOH A;  1HVB A;  1KDW A;  1N4O A;  4DDS A;  3VP2 A;  3DWZ A;  5TFQ A;  3GRJ A;  4HEF A;  5TGF A;  4QB8 A;  2XLN A;  2Y4A A;  1Z6F A;  1CK3 A;  4P87 A;  4Y0O A;  5GLD A;  1K6R A;  3AGF A;  3OC2 A;  5DTT A;  4R3B A;  2UWX A;  3NBL A;  4WEL A;  1XA1 A;  2ZC6 B;  3TOI A;  2J7V A;  2EXA A;  4OH0 A;  3B3X A;  4C3Q A;  5CHU A;  4UHU A;  2PBY A;  1KVM A;  1XGI A;  5KZH A;  3HUM A;  2G2U A;  4BEN A;  5A92 A;  3HLE A;  5CGX A;  3ZHH A;  2ZQC A;  4KZ5 A;  4A5R A;  5FQ9 A;  2HP6 A;  2I72 A;  3UO9 A;  3VFF A;  3BM6 A;  5FI2 A;  4IVI A;  2CC1 A;  5M19 A;  4OQH A;  1MY8 A;  1TEM A;  3Q1F A;  3LY4 A;  5FAQ A;  1YMS A;  4MNR A;  1AXB A;  1C3B A;  5HAI A;  3UDF A;  1KGG A;  5M1A A;  1MXO A;  1YLY A;  4JF6 A;  2Y2M A;  3NC8 A;  3V39 A;  3PBN A;  4PPR A;  3M6B A;  3VSL A;  2Y2L A;  2IWB A;  2ZM0 A;  3QHY A;  1EWZ A;  3PBR A;  3P98 A;  4KZ4 A;  1FCM A;  5J8X A;  2R9W A;  3UE1 A;  1KGF A;  2Z2M B;  4JF4 A;  4U0X A;  1W8Y A;  2WKH A;  3OZH A;  4DRT A;  1XXM A;  2Y2G A;  5HAQ A;  2P9V A;  3FV7 A;  3NY4 A;  3C7V A;  4RVA A;  3IT9 A;  1TDG A;  1XPB A;  2Y2Q A;  4F94 A;  4GNU A;  1HTZ A;  1OME A;  3NI9 A;  2H0T A;  1KVL A;  2HP9 A;  2WGW A;  4S2P A;  4LV2 A;  4X68 A;  3S4X A;  5CED A;  2EFU A;  4DKI A;  1PI4 A;  4ZBE A;  3WS2 A;  2Y2O A;  2HDU A;  1YM1 A;  4RA7 A;  2WYX A;  1SHV A;  1W5D A;  3OCL A;  2OSU A;  1K4E A;  5HFO A;  2OV5 A;  1BUL A;  1K25 A;  4U3T A;  1NRF A;  2A3U A;  4JXW A;  4YIN A;  4Q8I A;  5FSR A;  5D3O A;  4BJP A;  1ERO A;  2Q9M A;  3OCN A;  3Q7V A;  1IYS A;  3HLB A;  4Y0U A;  3SH9 A;  4S2N C;  4S2N A;  2Y2P A;  2FFY A;  5HAP A;  5DF7 A;  2WKI A;  4LV3 A;  5F1G A;  3ZG5 A;  1GHP A;  2BG1 A;  3OPL A;  4PM8 A;  4R23 A;  4KG2 A;  5A91 A;  1FR6 A;  1H8Y A;  4WM9 A;  3W4Q A;  2GDN A;  2FFF B;  3IF6 C;  3IF6 A;  4OKP A;  5E43 A;  5FQM A;  2XFS A;  4S2O A;  2XGN A;  1I2S A;  3ISG A;  3EQU A;  5EOO A;  3BFE A;  3LY3 A;  1K56 D;  5F82 A;  3PBT A;  1H8Z A;  4X69 A;  3OPP A;  5EUA A;  5E2E A;  3HUO A;  3UDI A;  3QNC A;  4BD0 A;  2XD5 A;  1JTG A;  5KSH A;  2OLU A;  3VFH A;  1IKI A;  1K56 A;  3RJU A;  3BEB A;  2DNS A;  1Q2P A;  2EX6 A;  4N1H A;  3PBS A;  1K54 C;  1K54 A;  4PM6 A;  4QHC A;  3PAG A;  3IH8 A;  3N8S A;  3HBR A;  3WWX A;  3D4F A;  4BQM A;  1ONG A;  1PWC A;  3MXS A;  5E2G A;  1LLB A;  1L0D A;  1QME A;  2XK1 A;  3ITB A;  3Q81 A;  4LEN A;  2R9X A;  2IWD A;  2V2F F;  4MLL A;  3O87 A;  1BTL A;  1PWD A;  3NDG A;  1NZO A;  4H8R A;  3IXH A;  4KZ3 A;  4Y7P A;  5HAR A;  4E3K A;  2WGI A;  1CEF A;  3CJM A;  1K55 C;  1K55 A;  1NZU A;  4OQG A;  3DWK A;  1LI9 A;  2X02 A;  3BFF A;  3Q82 A;  4ID4 A;  5CEC A;  5FQK A;  4JKT A;  3RXX A;  5KSC A;  2XD1 A;  3E2L A;  3DW0 A;  3UDX A;  1DJA A;  4S2L A;  3Q07 A;  3C7U A;  3IXB A;  3VP3 A;  4XXR A;  4EQI A;  4ZDX A;  3MXR A;  1RP5 A;  3V5M A;  2X01 A;  3ZCZ A;  5DTS A;  3ZNT A;  3UPO A;  1K38 A;  1K57 C;  1K57 A;  1WYB A;  3FKV A;  3ZVT A;  3O88 A;  2EX8 A;  3G30 A;  4EBN A;  3IHA A;  5G18 A;  3BFD A;  2C5W B;  3JYI A;  1WYC A;  2ZC4 B;  1VM1 A;  1YLW A;  4S2J A;  4QY6 A;  2WKE A;  3N6I A;  4UA6 A;  5EVI B;  2H5S A;  3FKW A;  1LL5 A;  3IWI A;  4NET A;  3HLD A;  3ZDJ A;  4IBR A;  3SS4 A;  3GR2 A;  4HBT A;  2XF3 A;  5CXW A;  1XP4 A;  4HBU A;  5AQ9 A;  5DVA A;  2X71 A;  4OOY A;  5E2H A;  2IWC A;  3G32 A;  4JXV A;  5EVL A;  1KE3 A;  2Q9N A;  3Q7V B;  4S2K A;  2ZQ9 A;  4ZTK A;  3TG9 A;  1MWS A;  3FWL A;  4JPM A;  2HDQ A;  2HPB A;  1H5X A;  3IQA A;  3OPH A;  3IH9 A;  4K0X A;  2JE5 A;  4X55 A;  5FQQ A;  1ES2 A;  4E3M A;  4KG5 A;  3LO7 A;  4GD8 A;  1RGZ A;  4KG6 A;  1LL9 A;  5FAT A;  3CMZ A;  3G35 A;  3MZD A;  1WE4 A;  3HLG A;  4E3I A;  4R4R A;  1PYY A;  4DE0 A;  3G2Z A;  4GB7 A;  4GN2 A;  4WZ5 A;  4KQR A;  4WZ5 C;  4QD4 A;  4WZ4 A;  3VOZ A;  1E4D A;  4E3J A;  3SS5 A;  2ZM8 A;  3S1Y A;  4BL3 A;  3UE0 A;  4PM9 A;  2ZQ7 A;  1FCO A;  4DE3 A;  3GSG A;  1E25 A;  1ERQ A;  4NK3 A;  5CTM A;  3GMW A;  3PAE A;  4UAA A;  1ES3 A;  4S2M A;  5IHV A;  1CEG A;  1JWV A;  1PIO A;  1YQS A;  3M2J A;  5A93 A;  3AGE A;  1YT4 A;  1W7F A;  2ZQ8 A;  1PZO A;  3WRT A;  3IXG A;  4OVD A;  4MBK A;  5HW3 A;  5FQJ A;  4ZAM A;  5GHY A;  1FQG A;  4DE1 A;  4LV1 A;  4R4S A;  5CHJ A;  3ZG0 A;  1FCN A;  2WGV A;  3HLC A;  3WS0 A;  3UN7 A;  1M6K A;  2HDR A;  1W79 A;  2B5R A;  3WS5 A;  1MWT A;  4R0Q A;  5AQA A;  1SDN A;  2Y2H A;  4OQI A;  4DF6 A;  1MWR A;  4PM7 A;  1TDL A;  4P6B A;  4UA7 A;  4EV4 A;  2QPN A;  1RCJ A;  4N9L A;  4E3N A;  3W4O A;  1GHM A;  4E6X A;  3SH8 A;  3TSG A;  3A3F A;  2XFT A;  4KZ6 A;  4P85 A;  2WAE A;  1IEM A;  4N1X A;  3IF5 A;  2Y55 A;  3IWO A;  2EXB A;  2OLV A;  2WZX A;  1ZC2 A;  2ZMA A;  1ESU A;  4M3K A;  2ZQD A;  1YLZ A;  2H10 A;  4JXS A;  1FSY A;  3MKF A;  3AGD A;  3S22 A;  4ZJ3 A;  1MKI A;  1XKZ A;  4E3O A;  3DTM A;  5DTK A;  2WZZ A;  4KZ7 A;  1W8Q A;  1GA9 A;  1BLS A;  4MBH A;  3NCK A;  4KQO A;  3HLW A;  1JWZ A;  3MZE A;  1KE0 A;  3UPN A;  1NJ4 A;  5GHX A;  4R3J A;  3HVF A;  5FDH A;  4EWF A;  3M2K A;  2ZC5 B;  1U60 A;  3HL9 A;  4DXC A;  4KZA A;  3ZNY A;  3I7J A;  4B88 A;  3GQZ A;  5CER A;  5FAS A;  3LEZ A;  4WEK A;  2Y91 A;  3GV9 A;  5CTN A;  2XR0 A;  1LI0 A;  1MWU A;  2VGK A;  1E3U D;  2JC7 A;  1IYP A;  2J8Y A;  1L0G A;  4FD8 A;  1TVF A;  4OLD A;  4X56 A;  4WEJ A;  3N8L A;  4X6T A;  4PM5 A;  5I94 A;  1BUE A;  4KZ8 A;  2XDM A;  2ZC7 A;  4OP5 A;  3V3R A;  3PBQ A;  1HZO A;  4BL2 A;  4E6W A;  1E3U A;  2P9V B;  1MBL A;  2Y2I A;  3W8K A;  1PZP A;  4YFM A;  1M40 A;  3C5A A;  2JBF A;  2C6W B;  5CGW A;  2XEP A;  3V3S A;  5HX9 A;  3MBZ A;  1J9M A;  1PWG A;  4QU3 A;  1ZKJ A;  2WGW B;  5FAP A;  4OPR A;  1GHI A;  2EFX A;  3LCE A;  4OOM A;  1KDS A;  4EBP A;  3P09 A;  3UY6 A;  4B4X A;  3C4O A;  4DXB A;  4LCM A;  4GDB A;  1L0F A;  1ALQ A;  3RXW A;  4BD1 A;  1O07 A;  1PW1 A;  5CRF A;  4FSF A;  5AQ7 A;  4C75 A;  3ZG9 B;  3BLM A;  5FAO A;  3ZFZ A;  4RX2 A;  3SOI A;  2RL3 A;  3VP0 A;  3ZGA B;  2WK0 A;  4KZB A;  1FR1 A;  3IHB A;  1IEL A;  4GOG A;  1ZG4 A;  1YMX A;  5JYP A;  1JTD A;  5F1F A;  1IYQ A;  1NYY A;  1HD8 A;  4KEN B;  3IXD A;  4EBL A;  4WYY A;  3BEC A;  1XX2 A;  4CJN A;  5EOE A;  2WAD A;  4JBF A;  3SS3 A;  3QNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...