4KZ9A

Crystal structure of ampc beta-lactamase in complex with fragment 41 ((4r,4as,8as)-4-phenyldecahydroquinolin-4-ol)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Increasing chemical space coverage by combining empirical and computational fragment screens.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4kz9A00
1W79A 4R4SA 3SS3A 3HUNA 5AQ7A 1JTDA 2ZQCA 4PM8A 2J7VA 1GHMA 3GRJA 1KGGA 4KZ4A 1Q2QA 4QB8A 1FQGA 4N92A 4E3LA 2XH9A 2ZM0A 3ITAA 3O88A 5CHJA 4C75A 1IELA 3JYIA 1BUEA 2OSUA 4RX2A 4QY6A 1DJCA 1ZG6A 3S22A 3M2KA 3MKFA 3ZG7B 4LV0A 5TFQA 2OLVA 2P74A 1FSYA 2JCHA 2WAEA 1ES4A 1S0WA 2E8IA 3NCKA 4QHCA 3EQUA 1BLCA 3V3SA 4LV1A 4GDBA 1Y54A 3IHAA 5A90A 4QU3A 3W4OA 1MXOA 4BJPA 1KE3A 4ID4A 2XDMA 3G2YA 1NRFA 4EBNA 4XXRA 3V50A 1I2SA 1L0EA 1N9BA 3E2LA 1M40A 5CGSA 1KDSA 2H0TA 3A3DA 3HUOA 4QJGA 4YINA 1JWVA 4RVAA 5M19A 1K55A 4N9KA 2Q9MA 3QNBA 4PM5A 2WADA 5CRFA 2EFUA 3G30A 1GHIA 4OOLA 4DF6A 4K0WA 1MWTA 4PM9A 4BL3A 4WZ5A 4OQHA 1YLYA 4H8RA 4K91A 3AGEA 5E2EA 1ZG4A 1MWUA 1S6RA 4S2NC 1DY6A 1RP5A 4C6YA 5HAQA 3UDXA 2XGNA 3G32A 1KGEA 1K54C 4GN2A 4P85A 3ITBA 4RYEA 1XA1A 2HDUA 1ERMA 5E43A 3P09A 3HLEA 5EE8A 4L0LA 1K56D 3IXBA 1IYQA 3HBRA 4MBHA 3W4PA 2ZQ7A 1SCWA 1VM1A 3HLBA 1PW8A 4Y0UA 3NI9A 2I72A 3BFFA 4KG2A 2Z2MB 4A5RA 1MPLA 2Y55A 1LI9A 1TVFA 3GR2A 3HLGA 3M2JA 2ZQDA 4EWFA 1ONGA 5F82A 5CTMA 3NIAA 1KDWA 3IH8A 1ALQA 4OLDA 2J9OA 4N1XA 3IWQA 4LCLA 2HP5A 2WZXA 3Q7VA 3IF6C 3MZFA 2BG1A 2WUQA 5EVIA 1ESIA 1CI8A 1GA9A 4QD4A 5FI6A 3MXSA 5M1AA 3UE1A 4JF5A 3ZG0A 3NC8A 1MBLA 1PZPA 1LL5A 1H8ZA 2ZC7A 4KG5A 5FA7A 1K6RA 1FCMA 3ZVWA 4K0XA 1XA7A 1O7EA 1MWSA 1IYPA 1XPBA 2PU4A 1LI0A 4R3BA 3MFDA 4OOYA 3SOIA 1IKGA 1C3BA 4P0MA 1ZKJA 4DDYA 2R9XA 1TDGA 3Q1FA 2HDRA 1CI9A 5G18A 2RCXA 4JPMA 1NYYA 1IKIA 3VSKA 3GSGA 1KE0A 3G34A 1ES2A 2XQZA 3BFGA 1ZC2A 3I7JA 2J8YA 3IXHA 4FCFA 3V5MA 3UPNA 4ZAMA 1KVMA 3N7WA 5F1FA 1KGFA 1FR1A 4UAAA 2OV5A 4MEZA 1XGIA 5DF8A 3VFFA 5FATA 2OLUA 2Y2LA 2G2WA 3IXGA 2WGWA 3IXDA 4X6TA 1N4OA 1RGZA 1TDLA 2FFFB 3ZNTA 4DRTA 4DE0A 1H8YA 3BECA 4U0XA 1JVJA 2ZLYA 3GV9A 3HLFA 4KQOA 1MWRA 1L0GA 3GMWA 4XUZA 3HLCA 2XLNA 3WS5A 2WKEA 1CK3A 4GDNA 5EVLA 5FAPA 4E3JA 5KSHA 3DTMA 4M3KA 3QHYA 4X56A 4OH0A 4OQGA 1LLBA 4EBPA 4R3JA 4BLMA 3NDEA 3OZHA 4GNUA 4S2JA 3S1YA 5DF9A 3RXWA 2PU2A 2R9WA 4WELA 4Y0OA 4P87A 1K6SA 3MZDA 2V20A 3HUMA 4IVKA 1K57C 2Y2IA 3ISGA 4JXVA 4WM9A 1YMSA 5FAQA 5FQKA 4IVIA 4FH4A 4S2PA 2IWBA 3HREA 3AGDA 5M18A 5KMWA 5FSRA 3G2ZA 1VQQA 3HVFA 4Z9QA 4BD1A 3VOYA 3OCNA 4ZJ1A 3VP0A 3BLSA 3MKEA 2A49A 4R23A 2VGKA 3OCLA 3MZEA 5FQMA 3Q7ZA 2HDSA 1YMXA 5DTSA 2EFXA 3LCEA 3VP3A 5FAOA 1M6KA 3DW0A 2Y2OA 4S2LA 2ZD8A 2Y59A 3HLWA 1L0DA 1G68A 1YLWA 1WYCA 2H0YA 2HP6A 2JC7A 3Q7VB 4FD8A 3ZGAB 1BULA 5EVIB 1I5QA 2C5WB 4PM7A 1J9MA 3PBSA 3E2KA 3VP4A 1BLSA 3ZG9B 3V3RA 2Y2KA 1BLPA 1WYBA 2VGJA 3FV7A 3IWIA 5DTTA 4U0TA 3ZCZA 3WS1A 4JF4A 2HP9A 2QZ6A 4U3TA 5D3OA 3N8LA 2IWCA 4OKPA 4MBKA 4EV4A 2C6WB 5EECA 5TGFA 4KQQA 5HFOA 5KSCA 3MXRA 2ZC5B 4MLLA 5AQBA 3B3XA 2XFSA 3IHBA 2Y91A 3C7VA 3CZDA 4XUXA 5U47A 3A3EA 4Y7PA 5GHXA 1FR6A 1NJ4A 4ZJ2A 3VMAA 5CECA 2EXBA 3NY4A 4JXSA 3QNCA 1SKFA 3ZVTA 3A3IA 5I94A 3N6IA 2ZC3B 5EOEA 1EI5A 1YLJA 3SH9A 4LENA 4R0QA 2XK1A 1IYOA 4JKTA 5JYPA 5EVID 3N4IA 1QMEA 5HL1A 3HL9A 4X69A 1JWPA 2WGWB 2WKHA 5EVIC 4HESA 4S2NA 5CEBA 3BM6A 1JWZA 1K25A 2HDQA 4WEJA 1K54A 3TOIA 3BRMA 4ZDXA 3W8KA 4UA6A 5E2FA 4LCMA 2WKIA 1YT4A 4GOGA 4CJNA 1XKZA 5A93A 4BQMA 2WAFA 4QY5A 1XXMA 1FSWA 3OPPA 4ZTKA 1K56A 5CXWA 2EX9A 2V1ZA 3PBQA 5E2GA 4KZ6A 4JF6A 4KZ8A 1BTLA 4Y0TA 2XD5A 1FOFA 5FI2A 2CC1A 3N8RA 1Q2PA 3LEZA 3VOZA 4OVDA 1L0FA 5HAIA 3UE3A 1W8QA 2ZMAA 1ES3A 5JYOA 4JBFA 1TEMA 2EXAA 4E3IA 4RX3A 2JBFA 4OQ0A 1PI4A 1DJAA 2Y4AA 4OQIA 4E6WA 5EOOA 5GHYA 2V2FF 1NZUA 5GHZA 5CERA 4DE3A 5L2FA 3IF6A 4JXWA 1K4EA 3OC2A 3CG5A 5GLAA 2EX6A 3M6HA 2ZM2A 3SS5A 4E6XA 5HARA 1L2SA 2WK0A 3GQZA 3GTCA 4DXBA 3A3FA 4OPZA 4OP8A 3PTEA 2DNSA 3LY3A 5E2HA 3C5AA 3WS2A 3ZG8B 2PBYA 3PBTA 2X01A 1YLPA 3FYZA 1ONHA 1CEGA 2DRWA 3UDFA 1FCOA 3CMZA 3ZHHA 4EUZA 3WRTA 3PAEA 4F94A 2GDNA 4WMCA 2ZQ9A 4GKUA 4E3NA 2ZC4B 1BT5A 1E4DA 3Q82A 4KZ3A 3LO7A 4P6BA 2XFTA 2FFYA 4KZ7A 2ZJ9A 2A3UA 3C4OA 2ZM8A 1PIOA 2J9PA 1BSGA 1ERQA 2WGVA 1HVBA 1E3UA 3O86A 2Y2JA 5HX9A 5FDHA 5GLCA 3UPOA 3IWOA 3IQAA 4DKIA 4EQIA 1LHYA 2Q9NA 5DVAA 1U60A 3TG9A 3VSLA 4WBGA 3WWXA 2X71A 2P9VA 5CEDA 4N9LA 1PWGA 1YLTA 4OLGA 4BENA 5J8XA 5IHVA 5HW3A 1YQSA 3VFHA 4BD0A 4OPQA 2G2UA 4MBFA 4OPRA 4E3KA 5GL9A 3N8SA 3UY6A 4IBRA 1PYYA 1HZOA 5EPHA 5BOHA 1E25A 1MY8A 1BLHA 3LY4A 1PZOA 4GD6A 1XP4A 3PBNA 4S2OA 4WZ4A 1SDNA 4DXCA 3UNWA 4GB7A 1AXBA 1K55C 5GLBA 4MNRA 3O3VA 1NYMA 4N1HA 3ZDJA 2X02A 4IBXA 3EQVA 4B4XA 3V39A 1ES5A 4KZ5A 1K57A 5FQQA 1NY0A 2B5RA 4OOMA 2XF3A 4WZ5C 4HBUA 1BZAA 4DE2A 5AQ9A 1IEMA 4HEFA 5A92A 2EX8A 3D4FA 4LV2A 3P98A 3ZFZA 1XX2A 4E3OA 4KQRA 4KENB 3IH9A 4YFMA 2Y2PA 5CGWA 2Y2QA 1YM1A 3W4QA 3PAGA 1PI5A 1GA0A 5FQ9A 4X68A 1ESUA 4O7DA 3UDIA 3FKWA 3NDGA 2HPBA 4NK3A 3IT9A 2QMIA 4GZBA 1HTZA 4BL2A 1XGJA 3IF6B 3C7UA 1DJBA 2Y2NA 1W7FA 4OONA 1EWZA 1QMFA 4X55A 3BYDA 3OPRA 2WYXA 3AGFA 3PBOA 4LV3A 4C3QA 4KG6A 3OPLA 3VP1A 3DWZA 1W8YA 2Y2GA 5AQAA 1OMEA 3M6BA 3GVBA 1CEFA 2XR0A 2ZC6B 1RCJA 2BLSA 4X53A 5CTNA 5FI7A 3G35A 1FCNA 4ZBEA 3RJUA 1MKIA 3UPPA 5HAPA 4GD8A 1PW1A 4B4ZA 4OP5A 4PM6A 4EBLA 2Y2HA 3MBZA 4JLFA 1SHVA 3WS4A 2IWDA 3PBRA 4B88A 4E3MA 3ZG5A 5F1GA 4R4RA 1GCEA 3BFDA 1KE4A 1KVLA 2RL3A 1WE4A 5TR7A 4DDSA 4Q8IA 2H5SA 4KZBA 5EUAA 3FZCA 2P9VB 2Z2LB 1GHPA 3SS4A 3OPHA 5DTKA 4FSFA 1NZOA 4KZAA 3Q81A 3UE0A 1YLZA 2UWXA 4ZJ3A 1IYSA 3WS0A 4S2MA 3SH8A 3WRZA 3HLDA 2EX2A 3O87A 1RGYA 1W5DA 4NETA 4HBTA 4WEKA 3BLMA 4WMCD 1K4FA 1JTGA 4FH2A 4WYYA 5FQJA 2Y2MA 3UO9A 3S4XA 2DCFA 4JXGA 4UA7A 4UHUA 3SH7A 4D2OA 1PWCA 2WZZA 1H5XA 3DWKA 3CJMA 5CGXA 5CHMA 3A3JA 2QPNA 1I2WA 1SDEA 4S2KA 4CPKA 1HD8A 3VP2A 4DE1A 1E3UD 3FKVA 5FASA 3BFCA 1EROA 3ZNYA 1G6AA 5F83A 1NXYA 1O07A 1LL9A 2ZQ8A 3Q07A 4S2IA 4OPYA 4R1GA 4UA9A 5DF7A 2H10A 3FWLA 4IEDA 4RA7A 2WGIA 2ZQAA 3C4PA 5CHUA 5GLDA 3IF5A 3BFEA 3RXXA 2XD1A 3BEBA 5KZHA 3G4PA 3TSGA 4PPRA 4PMAA 5A91A 3UN7A 1PWDA 2XEPA 4KZ9A 3G31A 3NBLA 1K38A 5FQIA 1Z6FA 2JE5A
chains in the Genus database with same CATH superfamily
3H7WB 4R4SA 3SS3A 2L1MA 1Q2QA 5HDDA 5CHJA 2ZOHA 1BUEA 4QY6A 5MC7A 3ZG7B 5TFQA 4PKYG 3NOTC 3PR6A 5G4ZA 1Y54A 3IHAA 4QU3A 3W4OA 1MXOA 4BJPA 4EBNA 4XXRA 3E2LA 1M40A 2K2NA 4NXGA 3HUOA 4QJGA 4RVAA 3QNBA 2WADA 5CRFA 4YNRA 1GHIA 4OOLA 4DF6A 5E2EA 2EA9A 1S6RA 5HAQA 4RYEA 2HDUA 3HLEA 4II7A 2A24B 3NECA 1LT0A 3IXBA 2QWSA 1LSWA 1VM1A 1SKOB 2I72A 3BFFA 2Y55A 1LI9A 4EWFA 3M2JA 2ZQDA 1ONGA 1ZHHB 2NUTC 4PKYA 2J9OA 3IWQA 2HP5A 3IF6C 1VEUB 4GHIA 2HZ5A 1DRMA 1Y4OA 2GZAA 4NXEA 1PZPA 1FCMA 5HD5A 1XA7A 4R38A 3SOIA 5HL6A 3HJKA 1IKGA 4P0MA 2ZMVA 4DDYA 1TDGA 1W63Q 4GLQA 5G4YA 5G18A 3H82B 4XT2B 4KUOA 2ZBBA 1IKIA 1KE0A 3E4PA 1ES2A 2XQZA 3BFGA 3IXHA 4R70A 3ZYTA 5F1FA 3N7WA 5FATA 2G2WA 2FFFB 1RGZA 2J80A 3S7NA 2ZLYA 5AVEA 3GV9A 4KQOA 2W1TA 1MWRA 1L0GA 1CK3A 4HH2A 2VGLM 4AFIA 4OH0A 4OQGA 1LLBA 4EBPA 4R3JA 3OZHA 3K3CA 2R9WA 4Y0OA 2QYBA 3MZDA 2V20A 1YMSA 2IWBA 1KOUA 3AGDA 5KMWA 2A49A 4R23A 2VGKA 3OCLA 3IBJA 1YMXA 2EFXA 3LCEA 4Y13A 1M6KA 4G3WA 2Y2OA 4O8GA 2Y59A 1L0DA 5KIZA 1NLZA 2HP6A 2XA7S 4FD8A 1UWNX 5EVIB 1I5QA 4PM7A 3VP4A 1A0KA 3IBRA 3IS2A 4EERA 3V3RA 2Y2KA 1BLPA 2VGJA 3FV7A 5DTTA 4U3TA 5D3OA 3N8LA 3LIFA 4OKPA 5EECA 5HFOA 2ZC5B 5AQBA 2PAVP 3IHBA 2Y91A 3C7VA 4XUXA 5U47A 2W3DA 2P04A 1NJ4A 3EEHA 5CECA 3U4LP 3LIDA 3ZVTA 3A3IA 2ZL1A 2ZC3B 2P7JA 1YLJA 1S1ZA 1GSWA 1IYOA 4JKTA 5JYPA 3LIEA 3N4IA 4X69A 1JWPA 4S2NA 2ZOIA 1JWZA 5CX7A 1K25A 2HDQA 3T1QB 4WL9A 4ZDXA 3W8KA 4UA6A 1YT4A 1TF1A 2VKSA 4BQMA 5A93A 4QY5A 1XXMA 4HJ6A 3MSHA 4KZ8A 3UE6A 5FI2A 3VOZA 3QP4A 3UB6A 4JBFA 4E3IA 4OQ0A 4E6WA 5GHYA 2V2FF 5GHZA 1F9IA 1GSVA 3OC2A 2EX6A 3SS5A 1TS8A 1XFQA 3LR4A 3GTCA 4DXBA 3PTEA 2PD8A 3B33A 3D3OA 5EM1A 5DJUA 1ONHA 2Z6DA 3ZHHA 3PAEA 5FEFA 2XROA 2M7VA 1BT5A 2XFTA 2FFYA 4KZ7A 2ZM8A 1PIOA 2J9PA 1ERQA 2KLIA 2NUPC 1W63M 1Y28A 1YSQA 1EW0A 3KSIA 2VK3A 3K3DA 3VSLA 4N9LA 1YLTA 4BENA 5IHVA 5HW3A 4OPQA 2G2UA 4IBRA 1HZOA 5EPHA 3T12B 2JKRM 2L4RA 5BOHA 1E25A 2V0UA 5L10A 1PZOA 2J3TD 5A8BA 4WZ4A 5C5KA 4DXCA 2J3TC 3UNWA 5EVEA 3O3VA 1NYMA 2X02A 3V39A 5FQQA 1K57A 1CQAA 2B5RA 4DE2A 5A92A 2PD7A 4I5SA 3P98A 4YWZA 4KENB 3IH9A 2Y2QA 3W4QA 5FQ9A 2HPBA 3KSGA 2O9BA 3IF6B 3C30A 1V9YA 4Q0HA 3OPLA 3VP1A 4IUHA 2FZ0A 3HJIA 5CTNA 1FCNA 3UPPA 4ARZB 2O9AA 3MBZA 1SHVA 5HWWA 3E98A 2W3HA 1GCEA 3BFDA 2RL3A 1D7EA 2Z2LB 2KX6A 1DP6A 3CPTB 1NZOA 4KZAA 4ZJ3A 1ODVA 3SH8A 3HLDA 3MFXA 1RGYA 4BBVA 1FIKA 3P01A 1H0MA 1D1JA 3A0SA 4WYYA 2Y2MA 4G3VA 1J3WA 4LPZA 4IUKA 3UO9A 3QP6A 4D2OA 4ARZA 5CGXA 5CHMA 3VE4A 2QPNA 4CPKA 3LUQA 4S2KA 2B02A 4DE1A 3FKVA 5FASA 2W0NA 5F83A 4K08A 1NXYA 1O07A 1NRJA 4DJ2A 5CHUA 2QJ5A 5GLDA 3UMEA 2PBDP 3G4PA 4PPRA 4PMAA 1PWDA 1Z6FA 5F69A 5AQ7A 1GHMA 3GRJA 4KZ4A 4N92A 2XH9A 2M1CA 3ITAA 3S22A 1S4SA 2XRNA 3MKFA 4YOFA 1XFNA 5TBMB 2OLVA 2PYPA 2JCHA 2E8IA 3V3SA 3F1NB 4ID4A 3G2YA 4EETB 2ACGA 1I2SA 4MMNA 2H0TA 2V8FA 2PHYA 4N9KA 4PM5A 3BWLA 4Z1WA 4PM9A 2H28A 4BL3A 1ZG4A 1MWUA 1T1CA 4JGOA 4P6ZS 4S2NC 3UDXA 2XGNA 1KGEA 4IHQA 4Y2FA 1ERMA 2ZQ7A 4LRYC 4Y0UA 3NI9A 4A5RA 4EEUA 3IH8A 4OLDA 3CI6A 4I38A 4LCLA 3U2AA 3Q7VA 1ESIA 5M1AA 4JF5A 2HV1A 3NC8A 1MBLA 1S4RA 1LL5A 4HJ4A 1K6RA 2XSSA 3ZVWA 1O7EA 1MWSA 2JN7A 1XPBA 4R3BA 1LI0A 3MFDA 4PHTA 1G6OA 3Q1FA 2HDRA 1CI9A 1CJFA 2RCXA 4JPMA 1NYYA 3G34A 3VOLA 1ZC2A 3I7JA 3EWKA 1MZUA 1KVMA 1UGUA 4JGQA 1KGFA 2OV5A 3S7PA 4NXFA 3IXGA 2WGWA 1N4OA 4DE0A 3BECA 2PT7A 3HLFA 1DP9A 4ETZA 3GMWA 3HLCA 3OBFA 5EFWA 2B18A 4X56A 3ULFA 1P9WA 4GNUA 3NOPC 4WELA 3HUMA 4Y15A 1K57C 4JXVA 1Z09A 3HREA 5M18A 2LB5A 5FSRA 3G2ZA 3R4KA 1VQQA 3E0YA 3T1SA 3MZEA 5FQMA 2VV6A 3SW1A 3Q7ZA 4CLCE 2VV7A 5FAOA 4H6JA 3DW0A 4RQ9A 4S2LA 2ZD8A 4GS9A 1G68A 3T4OA 4GHIB 3E2KA 3IWIA 2K31A 4GW9A 4U0TA 2PR6A 4JF4A 4JGRA 5HWVA 3C38A 1PFLA 4KQQA 3A0VA 2XFSA 5DKKA 3LR3A 3A3EA 3VMAA 4GCZA 4M4XA 4KQDA 3QNCA 2VLGA 5I94A 3SH9A 4LENA 2EWVA 3BQ8A 4O0PA 2V0WA 3BM6A 3T4SA 2W3EA 1NLYA 4I3JA 3BRMA 3MR0A 2W1TB 3FG8A 2D02A 1FSWA 4B93A 4ZTKA 1K56A 2KDKA 2OAP1 2W3FA 5HDSA 2EX9A 4JF6A 4EXOA 2XD5A 1L0FA 5HPFA 2ZMAA 3NJAA 2GNXA 3DTIA 3MXQA 2JBFA 2Y4AA 4OQIA 1NZUA 4DE3A 1K4EA 5GLAA 3M6HA 4E6XA 1OT6A 4OPZA 3LY3A 2FH5A 3MF0A 2DRWA 2V1AA 3UDFA 4EUZA 3WRTA 2GDNA 3IS2B 1S67L 3JVVA 3V67A 1E4DA 4P6BA 3CWFA 3C4OA 2A3UA 2HGVA 3KYZA 1VB6A 2Y2JA 5HX9A 5FDHA 3IX4A 3UPOA 3IWOA 4DKIA 3UB7A 4EQIA 2Q9NA 4NKPA 1U60A 3TG9A 4WBGA 3BY9A 2YKFA 1CF0A 1YQSA 4E3KA 5GL9A 2ZL1B 2GJ3A 1BLHA 3PBNA 4GB7A 4BBTA 1AXBA 2G7UA 4MNRA 4N1HA 1ES5A 4KZ5A 5AQ9A 4HEFA 4QPRA 2VX8A 3LICA 4KQRA 4LRZE 2Y2PA 1YM1A 2IA2A 1GA0A 4DMZA 4EU0A 4NK3A 3IT9A 1HTZA 4OONA 5L09A 4BWIA 1QMFA 4X55A 4HQAA 3TE8A 3T4KA 3DWZA 1OMEA 4MN5A 3GVBA 1CEFA 1F98A 2XR0A 4ESPA 4X53A 5FI7A 3CHWP 3G35A 2JKRI 5HAPA 3DTKA 4B4ZA 4OP5A 3T4JA 1L3LA 4EBLA 4FTXA 2LB9A 3WS4A 3H9WA 4CLCA 4B88A 4E3MA 5F1GA 4R4RA 1KVLA 1WE4A 1XJ6A 5TR7A 3FPVA 2PR5A 2XA7M 1YLZA 2UWXA 2YKHA 2JKTM 4S2MA 1LSXA 3O87A 4NETA 5J4EA 2HF6A 5HPIA 1D06A 3D72A 1K4FA 1JTGA 2ZMFA 5IU1A 3R7WA 3A0RA 1S66L 1X0OA 3EGXC 1H5XA 3DWKA 2AVXA 1I2WA 1HD8A 4I3IA 3T4TA 2Y79A 3VP2A 3BFCA 1EROA 1OTIA 1LL9A 3Q07A 4OPYA 2H10A 3FWLA 1YSPA 2WGIA 2ZQAA 4EW7A 3IF5A 4DN0A 3RXXA 5DFXA 2K7SA 3C2WA 3UN7A 1T1AA 3NBLA 3KSFA 1W79A 3HUNA 5FDSA 2ZQCA 4PM8A 2J7VA 5DJTA 1KGGA 1FQGA 4E3LA 2ZM0A 4FUWA 3KSHA 3JYIA 2OSUA 1ZG6A 3M2KA 2JKGA 1FSYA 1ES4A 2PYRA 3LI9A 1S0WA 3HCYA 3EQUA 1BLCA 1FILA 1OPXA 4GDBA 3LFVA 1NRFA 1OTEA 1L0EA 5CGSA 2QHKA 1KDSA 3A3DA 2EFUA 3G30A 1VETA 4K0WA 1MWTA 3E4QA 3KYEA 4K91A 3AGEA 1DY6A 3F1OA 1YPRA 3G32A 4MN6A 3ITBA 1XA1A 5E43A 5EE8A 1K56D 1IYQA 1SCWA 3HLBA 1PW8A 4I39A 2Z2MB 5J3WA 5F82A 3NIAA 1KDWA 1DP8A 2WZXA 2VV8A 3MZFA 4B9OA 1STZA 4QD4A 3L7HA 2J3WA 2ZC7A 5LBRA 5HSQA 2QKPA 4Y3IA 2PU4A 4OOYA 4BMWA 4EESA 4L9EA 2R9XA 2V9AA 5TJJA 5F68A 3VSKA 3V5MA 3UPNA 3JVUA 1FR1A 4MEZA 5DF8A 2OLUA 2Y2LA 4DRTA 1TDLA 3UB9A 4LLOB 3FC7A 4GDNA 5FAPA 1TD5A 3CITA 1PNEA 4BLMA 4S2JA 5DF9A 2PU2A 3UB8A 3MJQA 3MQOA 4IVKA 4UQIS 3LIAA 5FAQA 5FL3A 4IVIA 4FH4A 2GX5A 4HH3A 3HVFA 4Z9QA 4ZRRA 3VOYA 2OOLA 3VP0A 3BLSA 1OTAA 2HDSA 5EV0A 2PRFA 4WN5A 1MC0A 1N9OA 1YLWA 1WYCA 1P97A 2H0YA 2JC7A 3Q7VB 4HP4A 1J9MA 3PBSA 1BLSA 4G3KA 1WYBA 5IS1A 3JPUA 2MJ6A 2VEAA 2QZ6A 1F2KA 2IWCA 4EV4A 2C6WB 5KSCA 3MXRA 5J7EA 4MLLA 1G5UA 3B3XA 1OTBA 5L07A 3CZDA 1NWZA 1SZVA 4Y7PA 5GHXA 2EXBA 4CLCD 3NY4A 1SKFA 4CLCC 4Y17A 1H8MA 2XK1A 5HD3A 5EVID 4MDZA 3HL9A 4R3AA 2WGWB 2WKHA 5EVIC 4HESA 3TOIA 1K54A 2JHEA 4LCMA 2WKIA 1N9LA 4HJ3A 5IT5A 5CXWA 3O5YA 1XJ4A 3PBQA 4D60A 5E2GA 3MQ0A 2CC1A 3N8RA 1Q2PA 3LEZA 3CAXA 5HAIA 1W8QA 5JYOA 3LGOA 5EOOA 5CERA 5HARA 2WK0A 2DNSA 5E2HA 2E8JA 3F1PA 3ZG8B 4H6JB 2X01A 4GS9B 1IOUA 1CEGA 3CMZA 4P6ZM 4X1MA 3LR5A 4E04A 4F94A 1S1YA 4GKUA 4E3NA 3Q82A 4KZ3A 2V1BA 4F3LA 2ZJ9A 1YAXA 1BSGA 1HVBA 2EWWA 3O86A 3DBAA 4Q0JA 2X71A 2P9VA 1PWGA 5J8XA 4FOFA 4MBFA 3N8SA 3UY6A 1PYYA 1MY8A 3K2NA 3LY4A 3C8CA 4S2OA 2R78A 5GLBA 4LRXC 3T1XA 4IBXA 4B4XA 3EQVA 3ICYA 3DAVA 1NY0A 4OOMA 2XF3A 4HBUA 1BZAA 1T1BA 4NEED 4QWOA 4JGPA 3OLOA 1XX2A 3T4QA 4X68A 4O7DA 1G28A 1LL8A 3H7WA 4GZBA 1XGJA 3MMHA 1DJBA 1W7FA 1EWZA 3AGFA 4LV3A 5HWTA 3MQQA 1W8YA 3LIBA 3M6BA 3GDIA 2VGLS 4HP9A 2QJ7A 2ZC6B 1RCJA 2BLSA 3RJUA 4ZBEA 3D9YA 1MKIA 4GD8A 1PW1A 4PM6A 4L9GA 2Y2HA 2W3GA 2IWDA 1P9RA 3PHYA 3T50A 3PBRA 3ZG5A 3RFBA 2H5SA 2PDRA 3FZCA 3QP8A 1GHPA 3SS4A 3OPHA 5DTKA 3VE3A 1PRQA 3UE0A 1IYSA 3EOIA 3B42A 1OJ5A 4MCWA 3WRZA 2EX2A 3NHQA 1W5DA 1T19A 1OTDA 4WEKA 2VZWA 3BY8A 4WMCD 5FQJA 4FH2A 2A24A 4JXGA 4UA7A 4UHUA 1PWCA 2WZZA 1SKOA 3BQAA 2O0YA 1SDEA 2OWHA 4WF0A 1E3UD 3ZNYA 1G6AA 3QP5A 5I5LA 4UA9A 4IEDA 4RA7A 3TJZC 3C4PA 3BFEA 2XD1A 5KZHA 1VEUA 4X1LA 5A91A 4KZ9A 1K38A 5FQIA 2WKQA 3TW8A 1JTDA 3LEQA 5DKLA 3QP1A 3DTEA 4QB8A 3O88A 1OT9A 1IELA 4C75A 4RX2A 1DJCA 3GECA 4UEYA 4LV0A 2JKTI 1IFQA 3QP2A 2P74A 3H82A 4XT2A 5AVFA 2WAEA 3LR0A 5EM0A 3NCKA 3IX3A 4QHCA 4LV1A 3EEAA 5A90A 3CLOA 1KE3A 4CLCB 2XDMA 3V50A 2JKFA 1N9BA 5F5YA 3IX8A 4HOIA 4YINA 1JWVA 5M19A 1K55A 2Q9MA 4Y5FA 4WZ5A 4LFUA 1YLYA 4H8RA 4OQHA 4LGWA 2OWJA 2OAQ1 2INWA 1RP5A 4C6YA 4EUVA 1K54C 4GN2A 4P85A 3R7WB 3P09A 1K0KA 4L0LA 3HBRA 4MBHA 3W4PA 4R6LA 1TS6A 4KG2A 1MPLA 1TVFA 3GR2A 3HLGA 4NG2A 5CTMA 3UMDA 4O01A 1ALQA 4BBUA 3W2ZA 4N1XA 4DJ3A 2BG1A 2WUQA 5EVIA 1CI8A 1GA9A 5FI6A 3UE1A 3MXSA 3G6OA 3ZG0A 4KG5A 5FA7A 1H8ZA 3L9KA 4K0XA 1T18A 3T4LA 1IYPA 1GSXA 1C3BA 3S7QA 1ZKJA 3E4OA 5DFYA 3GSGA 2J8YA 4FCFA 4ZAMA 4NXBA 4UAAA 1XGIA 3VFFA 4ME4A 3IXDA 4X6TA 4MN7A 3ZNTA 1H8YA 3CUEC 4U0XA 1JVJA 3FPWA 4XUZA 2XLNA 3WS5A 2WKEA 5EVLA 5KSHA 4E3JA 3DTMA 1VETB 4M3KA 3QHYA 4Q0IA 3MS6A 3NDEA 3S1YA 3RXWA 3F1OB 4P87A 1K6SA 2Y2IA 3ISGA 4WM9A 3UB5P 5FQKA 4S2PA 4BD1A 2I9VA 3OCNA 4ZJ1A 3MKEA 3B47A 5DTSA 3VP3A 1MKMA 3HLWA 4WUJA 1ZTUA 3ZGAB 1BULA 1F5MA 2C5WB 3ZG9B 4CQHA 4IJGA 2VA0A 4PAUA 3ZCZA 3WS1A 2HP9A 2V8CA 4MBKA 5AJGA 2VJWA 3LI8A 5TGFA 5K5BA 2A2LA 1TS7A 1FR6A 4ZJ2A 4JXSA 2WKPA 4I3AA 3N6IA 5EOEA 1EI5A 3RTYA 4R0QA 3OOVA 1OJGA 1QMEA 5HL1A 5CEBA 3T1RA 1HLUP 4WEJA 4HY8A 5F6AA 5E2FA 4CJNA 4GOGA 1XKZA 2WAFA 3OPPA 2BTFP 2V1ZA 4KZ6A 1LSVA 1BTLA 4Y0TA 1FOFA 4HI4A 2W1RA 4OVDA 3UE3A 1ES3A 1TEMA 2EXAA 4RX3A 1PI4A 1DJAA 4WLAA 3VV4A 1H3QA 5L2FA 1XJ2A 3IF6A 4JXWA 3CG5A 2WKRA 2ZM2A 1UWPX 1L2SA 2CMNA 3GQZA 2W27A 3A3FA 4OP8A 3C5AA 3WS2A 2PBYA 3PBTA 1YLPA 3FYZA 2UV0E 1BYWA 1FCOA 2Z6CA 4WMCA 2M7UA 2ZQ9A 2ZC4B 3RH8B 3LO7A 3P7NA 1VHMA 2WGVA 1E3UA 5GLCA 3IQAA 1XJ3A 1LHYA 5DVAA 3WWXA 5CEDA 4X25A 1WA9A 2D01A 4OLGA 3CPTA 3VFHA 4BD0A 4OPRA 2HJEA 2DMWA 5HDCA 4GD6A 1XP4A 3TRCA 1SDNA 1K55C 1ACFA 3ZDJA 1YKDA 2P08A 4WZ5C 3KO6A 1IEMA 2EX8A 2Q0OA 3D4FA 1N9NA 3KYQA 4LV2A 3ZFZA 4E3OA 3NULA 1JNUA 4YFMA 5CGWA 3PAGA 1PI5A 4GJ4A 2KOIA 4EEPA 1ESUA 4L9FA 3UDIA 3SZTA 3BJNA 3FKWA 3NDGA 2O99A 2L0WA 2QMIA 4HHDA 4BL2A 3C7UA 2Y2NA 3BYDA 3OPRA 2WYXA 3PBOA 4C3QA 4KG6A 2Y2GA 5AQAA 3F1PB 5TBMA 5FEGA 3F1NA 4UQIM 3KX0X 4F3LB 3BW6A 1P0ZA 4JLFA 2B95A 4HNBA 1V9ZA 1KE4A 1AWIA 4HIAA 3NOUC 4DDSA 4Q8IA 4KZBA 5EUAA 2P9VB 2O9CA 2BASA 4FSFA 3Q81A 5L8MA 3WS0A 3EGDC 4HBTA 4EQ1A 3BLMA 3LYXA 4KUKA 4ETXA 3S4XA 2DCFA 3S7OA 3SH7A 2Y8HA 3PYPA 3CJMA 3A3JA 1TS0A 3ZQ5A 2ZQ8A 4S2IA 4R1GA 5DF7A 5HZHA 3PXPA 3BEBA 3TSGA 2XEPA 3G31A 2HJ9C 3CUEA 2JE5A
chains in the Genus database with same CATH topology
1W79A 4R4SA 3SS3A 3HUNA 5AQ7A 1JTDA 2ZQCA 4PM8A 2J7VA 1GHMA 3GRJA 1KGGA 4KZ4A 1Q2QA 4QB8A 1FQGA 4N92A 4E3LA 2XH9A 2ZM0A 3ITAA 3O88A 5CHJA 4C75A 1IELA 3JYIA 1BUEA 2OSUA 4RX2A 4QY6A 1DJCA 1ZG6A 3S22A 3M2KA 3MKFA 3ZG7B 4LV0A 5TFQA 2OLVA 2P74A 1FSYA 2JCHA 2WAEA 1ES4A 1S0WA 2E8IA 3NCKA 4QHCA 3EQUA 1BLCA 3V3SA 4LV1A 4GDBA 1Y54A 3IHAA 5A90A 4QU3A 3W4OA 1MXOA 4BJPA 1KE3A 4ID4A 2XDMA 3G2YA 1NRFA 4EBNA 4XXRA 3V50A 1I2SA 1L0EA 1N9BA 3E2LA 1M40A 5CGSA 1KDSA 2H0TA 3A3DA 3HUOA 4QJGA 4YINA 1JWVA 4RVAA 5M19A 1K55A 4N9KA 2Q9MA 3QNBA 4PM5A 2WADA 5CRFA 2EFUA 3G30A 1GHIA 4OOLA 4DF6A 4K0WA 1MWTA 4PM9A 4BL3A 4WZ5A 4OQHA 1YLYA 4H8RA 4K91A 3AGEA 5E2EA 1ZG4A 1MWUA 1S6RA 4S2NC 1DY6A 1RP5A 4C6YA 5HAQA 3UDXA 2XGNA 3G32A 1KGEA 1K54C 4GN2A 4P85A 3ITBA 4RYEA 1XA1A 2HDUA 1ERMA 5E43A 3P09A 3HLEA 5EE8A 4L0LA 1K56D 3IXBA 1IYQA 3HBRA 4MBHA 3W4PA 2ZQ7A 1SCWA 1VM1A 3HLBA 1PW8A 4Y0UA 3NI9A 2I72A 3BFFA 4KG2A 2Z2MB 4A5RA 1MPLA 2Y55A 1LI9A 1TVFA 3GR2A 3HLGA 3M2JA 2ZQDA 4EWFA 1ONGA 5F82A 5CTMA 3NIAA 1KDWA 3IH8A 1ALQA 4OLDA 2J9OA 4N1XA 3IWQA 4LCLA 2HP5A 2WZXA 3Q7VA 3IF6C 3MZFA 2BG1A 2WUQA 5EVIA 1ESIA 1CI8A 1GA9A 4QD4A 5FI6A 3MXSA 5M1AA 3UE1A 4JF5A 3ZG0A 3NC8A 1MBLA 1PZPA 1LL5A 1H8ZA 2ZC7A 4KG5A 5FA7A 1K6RA 1FCMA 3ZVWA 4K0XA 1XA7A 1O7EA 1MWSA 1IYPA 1XPBA 2PU4A 1LI0A 4R3BA 3MFDA 4OOYA 3SOIA 1IKGA 1C3BA 4P0MA 1ZKJA 4DDYA 2R9XA 1TDGA 3Q1FA 2HDRA 1CI9A 5G18A 2RCXA 4JPMA 1NYYA 1IKIA 3VSKA 3GSGA 1KE0A 3G34A 1ES2A 2XQZA 3BFGA 1ZC2A 3I7JA 2J8YA 3IXHA 4FCFA 3V5MA 3UPNA 4ZAMA 1KVMA 3N7WA 5F1FA 1KGFA 1FR1A 4UAAA 2OV5A 4MEZA 1XGIA 5DF8A 3VFFA 5FATA 2OLUA 2Y2LA 2G2WA 3IXGA 2WGWA 3IXDA 4X6TA 1N4OA 1RGZA 1TDLA 2FFFB 3ZNTA 4DRTA 4DE0A 1H8YA 3BECA 4U0XA 1JVJA 2ZLYA 3GV9A 3HLFA 4KQOA 1MWRA 1L0GA 3GMWA 4XUZA 3HLCA 2XLNA 3WS5A 2WKEA 1CK3A 4GDNA 5EVLA 5FAPA 4E3JA 5KSHA 3DTMA 4M3KA 3QHYA 4X56A 4OH0A 4OQGA 1LLBA 4EBPA 4R3JA 4BLMA 3NDEA 3OZHA 4GNUA 4S2JA 3S1YA 5DF9A 3RXWA 2PU2A 2R9WA 4WELA 4Y0OA 4P87A 1K6SA 3MZDA 2V20A 3HUMA 4IVKA 1K57C 2Y2IA 3ISGA 4JXVA 4WM9A 1YMSA 5FAQA 5FQKA 4IVIA 4FH4A 4S2PA 2IWBA 3HREA 3AGDA 5M18A 5KMWA 5FSRA 3G2ZA 1VQQA 3HVFA 4Z9QA 4BD1A 3VOYA 3OCNA 4ZJ1A 3VP0A 3BLSA 3MKEA 2A49A 4R23A 2VGKA 3OCLA 3MZEA 5FQMA 3Q7ZA 2HDSA 1YMXA 5DTSA 2EFXA 3LCEA 3VP3A 5FAOA 1M6KA 3DW0A 2Y2OA 4S2LA 2ZD8A 2Y59A 3HLWA 1L0DA 1G68A 1YLWA 1WYCA 2H0YA 2HP6A 2JC7A 3Q7VB 4FD8A 3ZGAB 1BULA 5EVIB 1I5QA 2C5WB 4PM7A 1J9MA 3PBSA 3E2KA 3VP4A 1BLSA 3ZG9B 3V3RA 2Y2KA 1BLPA 1WYBA 2VGJA 3FV7A 3IWIA 5DTTA 4U0TA 3ZCZA 3WS1A 4JF4A 2HP9A 2QZ6A 4U3TA 5D3OA 3N8LA 2IWCA 4OKPA 4MBKA 4EV4A 2C6WB 5EECA 5TGFA 4KQQA 5HFOA 5KSCA 3MXRA 2ZC5B 4MLLA 5AQBA 3B3XA 2XFSA 3IHBA 2Y91A 3C7VA 3CZDA 4XUXA 5U47A 3A3EA 4Y7PA 5GHXA 1FR6A 1NJ4A 4ZJ2A 3VMAA 5CECA 2EXBA 3NY4A 4JXSA 3QNCA 1SKFA 3ZVTA 3A3IA 5I94A 3N6IA 2ZC3B 5EOEA 1EI5A 1YLJA 3SH9A 4LENA 4R0QA 2XK1A 1IYOA 4JKTA 5JYPA 5EVID 3N4IA 1QMEA 5HL1A 3HL9A 4X69A 1JWPA 2WGWB 2WKHA 5EVIC 4HESA 4S2NA 5CEBA 3BM6A 1JWZA 1K25A 2HDQA 4WEJA 1K54A 3TOIA 3BRMA 4ZDXA 3W8KA 4UA6A 5E2FA 4LCMA 2WKIA 1YT4A 4GOGA 4CJNA 1XKZA 5A93A 4BQMA 2WAFA 4QY5A 1XXMA 1FSWA 3OPPA 4ZTKA 1K56A 5CXWA 2EX9A 2V1ZA 3PBQA 5E2GA 4KZ6A 4JF6A 4KZ8A 1BTLA 4Y0TA 2XD5A 1FOFA 5FI2A 2CC1A 3N8RA 1Q2PA 3LEZA 3VOZA 4OVDA 1L0FA 5HAIA 3UE3A 1W8QA 2ZMAA 1ES3A 5JYOA 4JBFA 1TEMA 2EXAA 4E3IA 4RX3A 2JBFA 4OQ0A 1PI4A 1DJAA 2Y4AA 4OQIA 4E6WA 5EOOA 5GHYA 2V2FF 1NZUA 5GHZA 5CERA 4DE3A 5L2FA 3IF6A 4JXWA 1K4EA 3OC2A 3CG5A 5GLAA 2EX6A 3M6HA 2ZM2A 3SS5A 4E6XA 5HARA 1L2SA 2WK0A 3GQZA 3GTCA 4DXBA 3A3FA 4OPZA 4OP8A 3PTEA 2DNSA 3LY3A 5E2HA 3C5AA 3WS2A 3ZG8B 2PBYA 3PBTA 2X01A 1YLPA 3FYZA 1ONHA 1CEGA 2DRWA 3UDFA 1FCOA 3CMZA 3ZHHA 4EUZA 3WRTA 3PAEA 4F94A 2GDNA 4WMCA 2ZQ9A 4GKUA 4E3NA 2ZC4B 1BT5A 1E4DA 3Q82A 4KZ3A 3LO7A 4P6BA 2XFTA 2FFYA 4KZ7A 2ZJ9A 2A3UA 3C4OA 2ZM8A 1PIOA 2J9PA 1BSGA 1ERQA 2WGVA 1HVBA 1E3UA 3O86A 2Y2JA 5HX9A 5FDHA 5GLCA 3UPOA 3IWOA 3IQAA 4DKIA 4EQIA 1LHYA 2Q9NA 5DVAA 1U60A 3TG9A 3VSLA 4WBGA 3WWXA 2X71A 2P9VA 5CEDA 4N9LA 1PWGA 1YLTA 4OLGA 4BENA 5J8XA 5IHVA 5HW3A 1YQSA 3VFHA 4BD0A 4OPQA 2G2UA 4MBFA 4OPRA 4E3KA 5GL9A 3N8SA 3UY6A 4IBRA 1PYYA 1HZOA 5EPHA 5BOHA 1E25A 1MY8A 1BLHA 3LY4A 1PZOA 4GD6A 1XP4A 3PBNA 4S2OA 4WZ4A 1SDNA 4DXCA 3UNWA 4GB7A 1AXBA 1K55C 5GLBA 4MNRA 3O3VA 1NYMA 4N1HA 3ZDJA 2X02A 4IBXA 3EQVA 4B4XA 3V39A 1ES5A 4KZ5A 1K57A 5FQQA 1NY0A 2B5RA 4OOMA 2XF3A 4WZ5C 4HBUA 1BZAA 4DE2A 5AQ9A 1IEMA 4HEFA 5A92A 2EX8A 3D4FA 4LV2A 3P98A 3ZFZA 1XX2A 4E3OA 4KQRA 4KENB 3IH9A 4YFMA 2Y2PA 5CGWA 2Y2QA 1YM1A 3W4QA 3PAGA 1PI5A 1GA0A 5FQ9A 4X68A 1ESUA 4O7DA 3UDIA 3FKWA 3NDGA 2HPBA 4NK3A 3IT9A 2QMIA 4GZBA 1HTZA 4BL2A 1XGJA 3IF6B 3C7UA 1DJBA 2Y2NA 1W7FA 4OONA 1EWZA 1QMFA 4X55A 3BYDA 3OPRA 2WYXA 3AGFA 3PBOA 4LV3A 4C3QA 4KG6A 3OPLA 3VP1A 3DWZA 1W8YA 2Y2GA 5AQAA 1OMEA 3M6BA 3GVBA 1CEFA 2XR0A 2ZC6B 1RCJA 2BLSA 4X53A 5CTNA 5FI7A 3G35A 1FCNA 4ZBEA 3RJUA 1MKIA 3UPPA 5HAPA 4GD8A 1PW1A 4B4ZA 4OP5A 4PM6A 4EBLA 2Y2HA 3MBZA 4JLFA 1SHVA 3WS4A 2IWDA 3PBRA 4B88A 4E3MA 3ZG5A 5F1GA 4R4RA 1GCEA 3BFDA 1KE4A 1KVLA 2RL3A 1WE4A 5TR7A 4DDSA 4Q8IA 2H5SA 4KZBA 5EUAA 3FZCA 2P9VB 2Z2LB 1GHPA 3SS4A 3OPHA 5DTKA 4FSFA 1NZOA 4KZAA 3Q81A 3UE0A 1YLZA 2UWXA 4ZJ3A 1IYSA 3WS0A 4S2MA 3SH8A 3WRZA 3HLDA 2EX2A 3O87A 1RGYA 1W5DA 4NETA 4HBTA 4WEKA 3BLMA 4WMCD 1K4FA 1JTGA 4FH2A 4WYYA 5FQJA 2Y2MA 3UO9A 3S4XA 2DCFA 4JXGA 4UA7A 4UHUA 3SH7A 4D2OA 1PWCA 2WZZA 1H5XA 3DWKA 3CJMA 5CGXA 5CHMA 3A3JA 2QPNA 1I2WA 1SDEA 4S2KA 4CPKA 1HD8A 3VP2A 4DE1A 1E3UD 3FKVA 5FASA 3BFCA 1EROA 3ZNYA 1G6AA 5F83A 1NXYA 1O07A 1LL9A 2ZQ8A 3Q07A 4S2IA 4OPYA 4R1GA 4UA9A 5DF7A 2H10A 3FWLA 4IEDA 4RA7A 2WGIA 2ZQAA 3C4PA 5CHUA 5GLDA 3IF5A 3BFEA 3RXXA 2XD1A 3BEBA 5KZHA 3G4PA 3TSGA 4PPRA 4PMAA 5A91A 3UN7A 1PWDA 2XEPA 4KZ9A 3G31A 3NBLA 1K38A 5FQIA 1Z6FA 2JE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W79 A;  4R4S A;  3SS3 A;  3HUN A;  5AQ7 A;  1JTD A;  2ZQC A;  4PM8 A;  2J7V A;  1GHM A;  3GRJ A;  1KGG A;  4KZ4 A;  1Q2Q A;  4QB8 A;  1FQG A;  4N92 A;  4E3L A;  2XH9 A;  2ZM0 A;  3ITA A;  3O88 A;  5CHJ A;  4C75 A;  1IEL A;  3JYI A;  1BUE A;  2OSU A;  4RX2 A;  4QY6 A;  1DJC A;  1ZG6 A;  3S22 A;  3M2K A;  3MKF A;  3ZG7 B;  4LV0 A;  5TFQ A;  2OLV A;  2P74 A;  1FSY A;  2JCH A;  2WAE A;  1ES4 A;  1S0W A;  2E8I A;  3NCK A;  4QHC A;  3EQU A;  1BLC A;  3V3S A;  4LV1 A;  4GDB A;  1Y54 A;  3IHA A;  5A90 A;  4QU3 A;  3W4O A;  1MXO A;  4BJP A;  1KE3 A;  4ID4 A;  2XDM A;  3G2Y A;  1NRF A;  4EBN A;  4XXR A;  3V50 A;  1I2S A;  1L0E A;  1N9B A;  3E2L A;  1M40 A;  5CGS A;  1KDS A;  2H0T A;  3A3D A;  3HUO A;  4QJG A;  4YIN A;  1JWV A;  4RVA A;  5M19 A;  1K55 A;  4N9K A;  2Q9M A;  3QNB A;  4PM5 A;  2WAD A;  5CRF A;  2EFU A;  3G30 A;  1GHI A;  4OOL A;  4DF6 A;  4K0W A;  1MWT A;  4PM9 A;  4BL3 A;  4WZ5 A;  4OQH A;  1YLY A;  4H8R A;  4K91 A;  3AGE A;  5E2E A;  1ZG4 A;  1MWU A;  1S6R A;  4S2N C;  1DY6 A;  1RP5 A;  4C6Y A;  5HAQ A;  3UDX A;  2XGN A;  3G32 A;  1KGE A;  1K54 C;  4GN2 A;  4P85 A;  3ITB A;  4RYE A;  1XA1 A;  2HDU A;  1ERM A;  5E43 A;  3P09 A;  3HLE A;  5EE8 A;  4L0L A;  1K56 D;  3IXB A;  1IYQ A;  3HBR A;  4MBH A;  3W4P A;  2ZQ7 A;  1SCW A;  1VM1 A;  3HLB A;  1PW8 A;  4Y0U A;  3NI9 A;  2I72 A;  3BFF A;  4KG2 A;  2Z2M B;  4A5R A;  1MPL A;  2Y55 A;  1LI9 A;  1TVF A;  3GR2 A;  3HLG A;  3M2J A;  2ZQD A;  4EWF A;  1ONG A;  5F82 A;  5CTM A;  3NIA A;  1KDW A;  3IH8 A;  1ALQ A;  4OLD A;  2J9O A;  4N1X A;  3IWQ A;  4LCL A;  2HP5 A;  2WZX A;  3Q7V A;  3IF6 C;  3MZF A;  2BG1 A;  2WUQ A;  5EVI A;  1ESI A;  1CI8 A;  1GA9 A;  4QD4 A;  5FI6 A;  3MXS A;  5M1A A;  3UE1 A;  4JF5 A;  3ZG0 A;  3NC8 A;  1MBL A;  1PZP A;  1LL5 A;  1H8Z A;  2ZC7 A;  4KG5 A;  5FA7 A;  1K6R A;  1FCM A;  3ZVW A;  4K0X A;  1XA7 A;  1O7E A;  1MWS A;  1IYP A;  1XPB A;  2PU4 A;  1LI0 A;  4R3B A;  3MFD A;  4OOY A;  3SOI A;  1IKG A;  1C3B A;  4P0M A;  1ZKJ A;  4DDY A;  2R9X A;  1TDG A;  3Q1F A;  2HDR A;  1CI9 A;  5G18 A;  2RCX A;  4JPM A;  1NYY A;  1IKI A;  3VSK A;  3GSG A;  1KE0 A;  3G34 A;  1ES2 A;  2XQZ A;  3BFG A;  1ZC2 A;  3I7J A;  2J8Y A;  3IXH A;  4FCF A;  3V5M A;  3UPN A;  4ZAM A;  1KVM A;  3N7W A;  5F1F A;  1KGF A;  1FR1 A;  4UAA A;  2OV5 A;  4MEZ A;  1XGI A;  5DF8 A;  3VFF A;  5FAT A;  2OLU A;  2Y2L A;  2G2W A;  3IXG A;  2WGW A;  3IXD A;  4X6T A;  1N4O A;  1RGZ A;  1TDL A;  2FFF B;  3ZNT A;  4DRT A;  4DE0 A;  1H8Y A;  3BEC A;  4U0X A;  1JVJ A;  2ZLY A;  3GV9 A;  3HLF A;  4KQO A;  1MWR A;  1L0G A;  3GMW A;  4XUZ A;  3HLC A;  2XLN A;  3WS5 A;  2WKE A;  1CK3 A;  4GDN A;  5EVL A;  5FAP A;  4E3J A;  5KSH A;  3DTM A;  4M3K A;  3QHY A;  4X56 A;  4OH0 A;  4OQG A;  1LLB A;  4EBP A;  4R3J A;  4BLM A;  3NDE A;  3OZH A;  4GNU A;  4S2J A;  3S1Y A;  5DF9 A;  3RXW A;  2PU2 A;  2R9W A;  4WEL A;  4Y0O A;  4P87 A;  1K6S A;  3MZD A;  2V20 A;  3HUM A;  4IVK A;  1K57 C;  2Y2I A;  3ISG A;  4JXV A;  4WM9 A;  1YMS A;  5FAQ A;  5FQK A;  4IVI A;  4FH4 A;  4S2P A;  2IWB A;  3HRE A;  3AGD A;  5M18 A;  5KMW A;  5FSR A;  3G2Z A;  1VQQ A;  3HVF A;  4Z9Q A;  4BD1 A;  3VOY A;  3OCN A;  4ZJ1 A;  3VP0 A;  3BLS A;  3MKE A;  2A49 A;  4R23 A;  2VGK A;  3OCL A;  3MZE A;  5FQM A;  3Q7Z A;  2HDS A;  1YMX A;  5DTS A;  2EFX A;  3LCE A;  3VP3 A;  5FAO A;  1M6K A;  3DW0 A;  2Y2O A;  4S2L A;  2ZD8 A;  2Y59 A;  3HLW A;  1L0D A;  1G68 A;  1YLW A;  1WYC A;  2H0Y A;  2HP6 A;  2JC7 A;  3Q7V B;  4FD8 A;  3ZGA B;  1BUL A;  5EVI B;  1I5Q A;  2C5W B;  4PM7 A;  1J9M A;  3PBS A;  3E2K A;  3VP4 A;  1BLS A;  3ZG9 B;  3V3R A;  2Y2K A;  1BLP A;  1WYB A;  2VGJ A;  3FV7 A;  3IWI A;  5DTT A;  4U0T A;  3ZCZ A;  3WS1 A;  4JF4 A;  2HP9 A;  2QZ6 A;  4U3T A;  5D3O A;  3N8L A;  2IWC A;  4OKP A;  4MBK A;  4EV4 A;  2C6W B;  5EEC A;  5TGF A;  4KQQ A;  5HFO A;  5KSC A;  3MXR A;  2ZC5 B;  4MLL A;  5AQB A;  3B3X A;  2XFS A;  3IHB A;  2Y91 A;  3C7V A;  3CZD A;  4XUX A;  5U47 A;  3A3E A;  4Y7P A;  5GHX A;  1FR6 A;  1NJ4 A;  4ZJ2 A;  3VMA A;  5CEC A;  2EXB A;  3NY4 A;  4JXS A;  3QNC A;  1SKF A;  3ZVT A;  3A3I A;  5I94 A;  3N6I A;  2ZC3 B;  5EOE A;  1EI5 A;  1YLJ A;  3SH9 A;  4LEN A;  4R0Q A;  2XK1 A;  1IYO A;  4JKT A;  5JYP A;  5EVI D;  3N4I A;  1QME A;  5HL1 A;  3HL9 A;  4X69 A;  1JWP A;  2WGW B;  2WKH A;  5EVI C;  4HES A;  4S2N A;  5CEB A;  3BM6 A;  1JWZ A;  1K25 A;  2HDQ A;  4WEJ A;  1K54 A;  3TOI A;  3BRM A;  4ZDX A;  3W8K A;  4UA6 A;  5E2F A;  4LCM A;  2WKI A;  1YT4 A;  4GOG A;  4CJN A;  1XKZ A;  5A93 A;  4BQM A;  2WAF A;  4QY5 A;  1XXM A;  1FSW A;  3OPP A;  4ZTK A;  1K56 A;  5CXW A;  2EX9 A;  2V1Z A;  3PBQ A;  5E2G A;  4KZ6 A;  4JF6 A;  4KZ8 A;  1BTL A;  4Y0T A;  2XD5 A;  1FOF A;  5FI2 A;  2CC1 A;  3N8R A;  1Q2P A;  3LEZ A;  3VOZ A;  4OVD A;  1L0F A;  5HAI A;  3UE3 A;  1W8Q A;  2ZMA A;  1ES3 A;  5JYO A;  4JBF A;  1TEM A;  2EXA A;  4E3I A;  4RX3 A;  2JBF A;  4OQ0 A;  1PI4 A;  1DJA A;  2Y4A A;  4OQI A;  4E6W A;  5EOO A;  5GHY A;  2V2F F;  1NZU A;  5GHZ A;  5CER A;  4DE3 A;  5L2F A;  3IF6 A;  4JXW A;  1K4E A;  3OC2 A;  3CG5 A;  5GLA A;  2EX6 A;  3M6H A;  2ZM2 A;  3SS5 A;  4E6X A;  5HAR A;  1L2S A;  2WK0 A;  3GQZ A;  3GTC A;  4DXB A;  3A3F A;  4OPZ A;  4OP8 A;  3PTE A;  2DNS A;  3LY3 A;  5E2H A;  3C5A A;  3WS2 A;  3ZG8 B;  2PBY A;  3PBT A;  2X01 A;  1YLP A;  3FYZ A;  1ONH A;  1CEG A;  2DRW A;  3UDF A;  1FCO A;  3CMZ A;  3ZHH A;  4EUZ A;  3WRT A;  3PAE A;  4F94 A;  2GDN A;  4WMC A;  2ZQ9 A;  4GKU A;  4E3N A;  2ZC4 B;  1BT5 A;  1E4D A;  3Q82 A;  4KZ3 A;  3LO7 A;  4P6B A;  2XFT A;  2FFY A;  4KZ7 A;  2ZJ9 A;  2A3U A;  3C4O A;  2ZM8 A;  1PIO A;  2J9P A;  1BSG A;  1ERQ A;  2WGV A;  1HVB A;  1E3U A;  3O86 A;  2Y2J A;  5HX9 A;  5FDH A;  5GLC A;  3UPO A;  3IWO A;  3IQA A;  4DKI A;  4EQI A;  1LHY A;  2Q9N A;  5DVA A;  1U60 A;  3TG9 A;  3VSL A;  4WBG A;  3WWX A;  2X71 A;  2P9V A;  5CED A;  4N9L A;  1PWG A;  1YLT A;  4OLG A;  4BEN A;  5J8X A;  5IHV A;  5HW3 A;  1YQS A;  3VFH A;  4BD0 A;  4OPQ A;  2G2U A;  4MBF A;  4OPR A;  4E3K A;  5GL9 A;  3N8S A;  3UY6 A;  4IBR A;  1PYY A;  1HZO A;  5EPH A;  5BOH A;  1E25 A;  1MY8 A;  1BLH A;  3LY4 A;  1PZO A;  4GD6 A;  1XP4 A;  3PBN A;  4S2O A;  4WZ4 A;  1SDN A;  4DXC A;  3UNW A;  4GB7 A;  1AXB A;  1K55 C;  5GLB A;  4MNR A;  3O3V A;  1NYM A;  4N1H A;  3ZDJ A;  2X02 A;  4IBX A;  3EQV A;  4B4X A;  3V39 A;  1ES5 A;  4KZ5 A;  1K57 A;  5FQQ A;  1NY0 A;  2B5R A;  4OOM A;  2XF3 A;  4WZ5 C;  4HBU A;  1BZA A;  4DE2 A;  5AQ9 A;  1IEM A;  4HEF A;  5A92 A;  2EX8 A;  3D4F A;  4LV2 A;  3P98 A;  3ZFZ A;  1XX2 A;  4E3O A;  4KQR A;  4KEN B;  3IH9 A;  4YFM A;  2Y2P A;  5CGW A;  2Y2Q A;  1YM1 A;  3W4Q A;  3PAG A;  1PI5 A;  1GA0 A;  5FQ9 A;  4X68 A;  1ESU A;  4O7D A;  3UDI A;  3FKW A;  3NDG A;  2HPB A;  4NK3 A;  3IT9 A;  2QMI A;  4GZB A;  1HTZ A;  4BL2 A;  1XGJ A;  3IF6 B;  3C7U A;  1DJB A;  2Y2N A;  1W7F A;  4OON A;  1EWZ A;  1QMF A;  4X55 A;  3BYD A;  3OPR A;  2WYX A;  3AGF A;  3PBO A;  4LV3 A;  4C3Q A;  4KG6 A;  3OPL A;  3VP1 A;  3DWZ A;  1W8Y A;  2Y2G A;  5AQA A;  1OME A;  3M6B A;  3GVB A;  1CEF A;  2XR0 A;  2ZC6 B;  1RCJ A;  2BLS A;  4X53 A;  5CTN A;  5FI7 A;  3G35 A;  1FCN A;  4ZBE A;  3RJU A;  1MKI A;  3UPP A;  5HAP A;  4GD8 A;  1PW1 A;  4B4Z A;  4OP5 A;  4PM6 A;  4EBL A;  2Y2H A;  3MBZ A;  4JLF A;  1SHV A;  3WS4 A;  2IWD A;  3PBR A;  4B88 A;  4E3M A;  3ZG5 A;  5F1G A;  4R4R A;  1GCE A;  3BFD A;  1KE4 A;  1KVL A;  2RL3 A;  1WE4 A;  5TR7 A;  4DDS A;  4Q8I A;  2H5S A;  4KZB A;  5EUA A;  3FZC A;  2P9V B;  2Z2L B;  1GHP A;  3SS4 A;  3OPH A;  5DTK A;  4FSF A;  1NZO A;  4KZA A;  3Q81 A;  3UE0 A;  1YLZ A;  2UWX A;  4ZJ3 A;  1IYS A;  3WS0 A;  4S2M A;  3SH8 A;  3WRZ A;  3HLD A;  2EX2 A;  3O87 A;  1RGY A;  1W5D A;  4NET A;  4HBT A;  4WEK A;  3BLM A;  4WMC D;  1K4F A;  1JTG A;  4FH2 A;  4WYY A;  5FQJ A;  2Y2M A;  3UO9 A;  3S4X A;  2DCF A;  4JXG A;  4UA7 A;  4UHU A;  3SH7 A;  4D2O A;  1PWC A;  2WZZ A;  1H5X A;  3DWK A;  3CJM A;  5CGX A;  5CHM A;  3A3J A;  2QPN A;  1I2W A;  1SDE A;  4S2K A;  4CPK A;  1HD8 A;  3VP2 A;  4DE1 A;  1E3U D;  3FKV A;  5FAS A;  3BFC A;  1ERO A;  3ZNY A;  1G6A A;  5F83 A;  1NXY A;  1O07 A;  1LL9 A;  2ZQ8 A;  3Q07 A;  4S2I A;  4OPY A;  4R1G A;  4UA9 A;  5DF7 A;  2H10 A;  3FWL A;  4IED A;  4RA7 A;  2WGI A;  2ZQA A;  3C4P A;  5CHU A;  5GLD A;  3IF5 A;  3BFE A;  3RXX A;  2XD1 A;  3BEB A;  5KZH A;  3G4P A;  3TSG A;  4PPR A;  4PMA A;  5A91 A;  3UN7 A;  1PWD A;  2XEP A;  4KZ9 A;  3G31 A;  3NBL A;  1K38 A;  5FQI A;  1Z6F A;  2JE5 A; 
#chains in the Genus database with same CATH topology
 3H7W B;  4R4S A;  3SS3 A;  2L1M A;  1Q2Q A;  5HDD A;  5CHJ A;  2ZOH A;  1BUE A;  4QY6 A;  5MC7 A;  3ZG7 B;  5TFQ A;  4PKY G;  3NOT C;  3PR6 A;  5G4Z A;  1Y54 A;  3IHA A;  4QU3 A;  3W4O A;  1MXO A;  4BJP A;  4EBN A;  4XXR A;  3E2L A;  1M40 A;  2K2N A;  4NXG A;  3HUO A;  4QJG A;  4RVA A;  3QNB A;  2WAD A;  5CRF A;  4YNR A;  1GHI A;  4OOL A;  4DF6 A;  5E2E A;  2EA9 A;  1S6R A;  5HAQ A;  4RYE A;  2HDU A;  3HLE A;  4II7 A;  2A24 B;  3NEC A;  1LT0 A;  3IXB A;  2QWS A;  1LSW A;  1VM1 A;  1SKO B;  2I72 A;  3BFF A;  2Y55 A;  1LI9 A;  4EWF A;  3M2J A;  2ZQD A;  1ONG A;  1ZHH B;  2NUT C;  4PKY A;  2J9O A;  3IWQ A;  2HP5 A;  3IF6 C;  1VEU B;  4GHI A;  2HZ5 A;  1DRM A;  1Y4O A;  2GZA A;  4NXE A;  1PZP A;  1FCM A;  5HD5 A;  1XA7 A;  4R38 A;  3SOI A;  5HL6 A;  3HJK A;  1IKG A;  4P0M A;  2ZMV A;  4DDY A;  1TDG A;  1W63 Q;  4GLQ A;  5G4Y A;  5G18 A;  3H82 B;  4XT2 B;  4KUO A;  2ZBB A;  1IKI A;  1KE0 A;  3E4P A;  1ES2 A;  2XQZ A;  3BFG A;  3IXH A;  4R70 A;  3ZYT A;  5F1F A;  3N7W A;  5FAT A;  2G2W A;  2FFF B;  1RGZ A;  2J80 A;  3S7N A;  2ZLY A;  5AVE A;  3GV9 A;  4KQO A;  2W1T A;  1MWR A;  1L0G A;  1CK3 A;  4HH2 A;  2VGL M;  4AFI A;  4OH0 A;  4OQG A;  1LLB A;  4EBP A;  4R3J A;  3OZH A;  3K3C A;  2R9W A;  4Y0O A;  2QYB A;  3MZD A;  2V20 A;  1YMS A;  2IWB A;  1KOU A;  3AGD A;  5KMW A;  2A49 A;  4R23 A;  2VGK A;  3OCL A;  3IBJ A;  1YMX A;  2EFX A;  3LCE A;  4Y13 A;  1M6K A;  4G3W A;  2Y2O A;  4O8G A;  2Y59 A;  1L0D A;  5KIZ A;  1NLZ A;  2HP6 A;  2XA7 S;  4FD8 A;  1UWN X;  5EVI B;  1I5Q A;  4PM7 A;  3VP4 A;  1A0K A;  3IBR A;  3IS2 A;  4EER A;  3V3R A;  2Y2K A;  1BLP A;  2VGJ A;  3FV7 A;  5DTT A;  4U3T A;  5D3O A;  3N8L A;  3LIF A;  4OKP A;  5EEC A;  5HFO A;  2ZC5 B;  5AQB A;  2PAV P;  3IHB A;  2Y91 A;  3C7V A;  4XUX A;  5U47 A;  2W3D A;  2P04 A;  1NJ4 A;  3EEH A;  5CEC A;  3U4L P;  3LID A;  3ZVT A;  3A3I A;  2ZL1 A;  2ZC3 B;  2P7J A;  1YLJ A;  1S1Z A;  1GSW A;  1IYO A;  4JKT A;  5JYP A;  3LIE A;  3N4I A;  4X69 A;  1JWP A;  4S2N A;  2ZOI A;  1JWZ A;  5CX7 A;  1K25 A;  2HDQ A;  3T1Q B;  4WL9 A;  4ZDX A;  3W8K A;  4UA6 A;  1YT4 A;  1TF1 A;  2VKS A;  4BQM A;  5A93 A;  4QY5 A;  1XXM A;  4HJ6 A;  3MSH A;  4KZ8 A;  3UE6 A;  5FI2 A;  3VOZ A;  3QP4 A;  3UB6 A;  4JBF A;  4E3I A;  4OQ0 A;  4E6W A;  5GHY A;  2V2F F;  5GHZ A;  1F9I A;  1GSV A;  3OC2 A;  2EX6 A;  3SS5 A;  1TS8 A;  1XFQ A;  3LR4 A;  3GTC A;  4DXB A;  3PTE A;  2PD8 A;  3B33 A;  3D3O A;  5EM1 A;  5DJU A;  1ONH A;  2Z6D A;  3ZHH A;  3PAE A;  5FEF A;  2XRO A;  2M7V A;  1BT5 A;  2XFT A;  2FFY A;  4KZ7 A;  2ZM8 A;  1PIO A;  2J9P A;  1ERQ A;  2KLI A;  2NUP C;  1W63 M;  1Y28 A;  1YSQ A;  1EW0 A;  3KSI A;  2VK3 A;  3K3D A;  3VSL A;  4N9L A;  1YLT A;  4BEN A;  5IHV A;  5HW3 A;  4OPQ A;  2G2U A;  4IBR A;  1HZO A;  5EPH A;  3T12 B;  2JKR M;  2L4R A;  5BOH A;  1E25 A;  2V0U A;  5L10 A;  1PZO A;  2J3T D;  5A8B A;  4WZ4 A;  5C5K A;  4DXC A;  2J3T C;  3UNW A;  5EVE A;  3O3V A;  1NYM A;  2X02 A;  3V39 A;  5FQQ A;  1K57 A;  1CQA A;  2B5R A;  4DE2 A;  5A92 A;  2PD7 A;  4I5S A;  3P98 A;  4YWZ A;  4KEN B;  3IH9 A;  2Y2Q A;  3W4Q A;  5FQ9 A;  2HPB A;  3KSG A;  2O9B A;  3IF6 B;  3C30 A;  1V9Y A;  4Q0H A;  3OPL A;  3VP1 A;  4IUH A;  2FZ0 A;  3HJI A;  5CTN A;  1FCN A;  3UPP A;  4ARZ B;  2O9A A;  3MBZ A;  1SHV A;  5HWW A;  3E98 A;  2W3H A;  1GCE A;  3BFD A;  2RL3 A;  1D7E A;  2Z2L B;  2KX6 A;  1DP6 A;  3CPT B;  1NZO A;  4KZA A;  4ZJ3 A;  1ODV A;  3SH8 A;  3HLD A;  3MFX A;  1RGY A;  4BBV A;  1FIK A;  3P01 A;  1H0M A;  1D1J A;  3A0S A;  4WYY A;  2Y2M A;  4G3V A;  1J3W A;  4LPZ A;  4IUK A;  3UO9 A;  3QP6 A;  4D2O A;  4ARZ A;  5CGX A;  5CHM A;  3VE4 A;  2QPN A;  4CPK A;  3LUQ A;  4S2K A;  2B02 A;  4DE1 A;  3FKV A;  5FAS A;  2W0N A;  5F83 A;  4K08 A;  1NXY A;  1O07 A;  1NRJ A;  4DJ2 A;  5CHU A;  2QJ5 A;  5GLD A;  3UME A;  2PBD P;  3G4P A;  4PPR A;  4PMA A;  1PWD A;  1Z6F A;  5F69 A;  5AQ7 A;  1GHM A;  3GRJ A;  4KZ4 A;  4N92 A;  2XH9 A;  2M1C A;  3ITA A;  3S22 A;  1S4S A;  2XRN A;  3MKF A;  4YOF A;  1XFN A;  5TBM B;  2OLV A;  2PYP A;  2JCH A;  2E8I A;  3V3S A;  3F1N B;  4ID4 A;  3G2Y A;  4EET B;  2ACG A;  1I2S A;  4MMN A;  2H0T A;  2V8F A;  2PHY A;  4N9K A;  4PM5 A;  3BWL A;  4Z1W A;  4PM9 A;  2H28 A;  4BL3 A;  1ZG4 A;  1MWU A;  1T1C A;  4JGO A;  4P6Z S;  4S2N C;  3UDX A;  2XGN A;  1KGE A;  4IHQ A;  4Y2F A;  1ERM A;  2ZQ7 A;  4LRY C;  4Y0U A;  3NI9 A;  4A5R A;  4EEU A;  3IH8 A;  4OLD A;  3CI6 A;  4I38 A;  4LCL A;  3U2A A;  3Q7V A;  1ESI A;  5M1A A;  4JF5 A;  2HV1 A;  3NC8 A;  1MBL A;  1S4R A;  1LL5 A;  4HJ4 A;  1K6R A;  2XSS A;  3ZVW A;  1O7E A;  1MWS A;  2JN7 A;  1XPB A;  4R3B A;  1LI0 A;  3MFD A;  4PHT A;  1G6O A;  3Q1F A;  2HDR A;  1CI9 A;  1CJF A;  2RCX A;  4JPM A;  1NYY A;  3G34 A;  3VOL A;  1ZC2 A;  3I7J A;  3EWK A;  1MZU A;  1KVM A;  1UGU A;  4JGQ A;  1KGF A;  2OV5 A;  3S7P A;  4NXF A;  3IXG A;  2WGW A;  1N4O A;  4DE0 A;  3BEC A;  2PT7 A;  3HLF A;  1DP9 A;  4ETZ A;  3GMW A;  3HLC A;  3OBF A;  5EFW A;  2B18 A;  4X56 A;  3ULF A;  1P9W A;  4GNU A;  3NOP C;  4WEL A;  3HUM A;  4Y15 A;  1K57 C;  4JXV A;  1Z09 A;  3HRE A;  5M18 A;  2LB5 A;  5FSR A;  3G2Z A;  3R4K A;  1VQQ A;  3E0Y A;  3T1S A;  3MZE A;  5FQM A;  2VV6 A;  3SW1 A;  3Q7Z A;  4CLC E;  2VV7 A;  5FAO A;  4H6J A;  3DW0 A;  4RQ9 A;  4S2L A;  2ZD8 A;  4GS9 A;  1G68 A;  3T4O A;  4GHI B;  3E2K A;  3IWI A;  2K31 A;  4GW9 A;  4U0T A;  2PR6 A;  4JF4 A;  4JGR A;  5HWV A;  3C38 A;  1PFL A;  4KQQ A;  3A0V A;  2XFS A;  5DKK A;  3LR3 A;  3A3E A;  3VMA A;  4GCZ A;  4M4X A;  4KQD A;  3QNC A;  2VLG A;  5I94 A;  3SH9 A;  4LEN A;  2EWV A;  3BQ8 A;  4O0P A;  2V0W A;  3BM6 A;  3T4S A;  2W3E A;  1NLY A;  4I3J A;  3BRM A;  3MR0 A;  2W1T B;  3FG8 A;  2D02 A;  1FSW A;  4B93 A;  4ZTK A;  1K56 A;  2KDK A;  2OAP 1;  2W3F A;  5HDS A;  2EX9 A;  4JF6 A;  4EXO A;  2XD5 A;  1L0F A;  5HPF A;  2ZMA A;  3NJA A;  2GNX A;  3DTI A;  3MXQ A;  2JBF A;  2Y4A A;  4OQI A;  1NZU A;  4DE3 A;  1K4E A;  5GLA A;  3M6H A;  4E6X A;  1OT6 A;  4OPZ A;  3LY3 A;  2FH5 A;  3MF0 A;  2DRW A;  2V1A A;  3UDF A;  4EUZ A;  3WRT A;  2GDN A;  3IS2 B;  1S67 L;  3JVV A;  3V67 A;  1E4D A;  4P6B A;  3CWF A;  3C4O A;  2A3U A;  2HGV A;  3KYZ A;  1VB6 A;  2Y2J A;  5HX9 A;  5FDH A;  3IX4 A;  3UPO A;  3IWO A;  4DKI A;  3UB7 A;  4EQI A;  2Q9N A;  4NKP A;  1U60 A;  3TG9 A;  4WBG A;  3BY9 A;  2YKF A;  1CF0 A;  1YQS A;  4E3K A;  5GL9 A;  2ZL1 B;  2GJ3 A;  1BLH A;  3PBN A;  4GB7 A;  4BBT A;  1AXB A;  2G7U A;  4MNR A;  4N1H A;  1ES5 A;  4KZ5 A;  5AQ9 A;  4HEF A;  4QPR A;  2VX8 A;  3LIC A;  4KQR A;  4LRZ E;  2Y2P A;  1YM1 A;  2IA2 A;  1GA0 A;  4DMZ A;  4EU0 A;  4NK3 A;  3IT9 A;  1HTZ A;  4OON A;  5L09 A;  4BWI A;  1QMF A;  4X55 A;  4HQA A;  3TE8 A;  3T4K A;  3DWZ A;  1OME A;  4MN5 A;  3GVB A;  1CEF A;  1F98 A;  2XR0 A;  4ESP A;  4X53 A;  5FI7 A;  3CHW P;  3G35 A;  2JKR I;  5HAP A;  3DTK A;  4B4Z A;  4OP5 A;  3T4J A;  1L3L A;  4EBL A;  4FTX A;  2LB9 A;  3WS4 A;  3H9W A;  4CLC A;  4B88 A;  4E3M A;  5F1G A;  4R4R A;  1KVL A;  1WE4 A;  1XJ6 A;  5TR7 A;  3FPV A;  2PR5 A;  2XA7 M;  1YLZ A;  2UWX A;  2YKH A;  2JKT M;  4S2M A;  1LSX A;  3O87 A;  4NET A;  5J4E A;  2HF6 A;  5HPI A;  1D06 A;  3D72 A;  1K4F A;  1JTG A;  2ZMF A;  5IU1 A;  3R7W A;  3A0R A;  1S66 L;  1X0O A;  3EGX C;  1H5X A;  3DWK A;  2AVX A;  1I2W A;  1HD8 A;  4I3I A;  3T4T A;  2Y79 A;  3VP2 A;  3BFC A;  1ERO A;  1OTI A;  1LL9 A;  3Q07 A;  4OPY A;  2H10 A;  3FWL A;  1YSP A;  2WGI A;  2ZQA A;  4EW7 A;  3IF5 A;  4DN0 A;  3RXX A;  5DFX A;  2K7S A;  3C2W A;  3UN7 A;  1T1A A;  3NBL A;  3KSF A;  1W79 A;  3HUN A;  5FDS A;  2ZQC A;  4PM8 A;  2J7V A;  5DJT A;  1KGG A;  1FQG A;  4E3L A;  2ZM0 A;  4FUW A;  3KSH A;  3JYI A;  2OSU A;  1ZG6 A;  3M2K A;  2JKG A;  1FSY A;  1ES4 A;  2PYR A;  3LI9 A;  1S0W A;  3HCY A;  3EQU A;  1BLC A;  1FIL A;  1OPX A;  4GDB A;  3LFV A;  1NRF A;  1OTE A;  1L0E A;  5CGS A;  2QHK A;  1KDS A;  3A3D A;  2EFU A;  3G30 A;  1VET A;  4K0W A;  1MWT A;  3E4Q A;  3KYE A;  4K91 A;  3AGE A;  1DY6 A;  3F1O A;  1YPR A;  3G32 A;  4MN6 A;  3ITB A;  1XA1 A;  5E43 A;  5EE8 A;  1K56 D;  1IYQ A;  1SCW A;  3HLB A;  1PW8 A;  4I39 A;  2Z2M B;  5J3W A;  5F82 A;  3NIA A;  1KDW A;  1DP8 A;  2WZX A;  2VV8 A;  3MZF A;  4B9O A;  1STZ A;  4QD4 A;  3L7H A;  2J3W A;  2ZC7 A;  5LBR A;  5HSQ A;  2QKP A;  4Y3I A;  2PU4 A;  4OOY A;  4BMW A;  4EES A;  4L9E A;  2R9X A;  2V9A A;  5TJJ A;  5F68 A;  3VSK A;  3V5M A;  3UPN A;  3JVU A;  1FR1 A;  4MEZ A;  5DF8 A;  2OLU A;  2Y2L A;  4DRT A;  1TDL A;  3UB9 A;  4LLO B;  3FC7 A;  4GDN A;  5FAP A;  1TD5 A;  3CIT A;  1PNE A;  4BLM A;  4S2J A;  5DF9 A;  2PU2 A;  3UB8 A;  3MJQ A;  3MQO A;  4IVK A;  4UQI S;  3LIA A;  5FAQ A;  5FL3 A;  4IVI A;  4FH4 A;  2GX5 A;  4HH3 A;  3HVF A;  4Z9Q A;  4ZRR A;  3VOY A;  2OOL A;  3VP0 A;  3BLS A;  1OTA A;  2HDS A;  5EV0 A;  2PRF A;  4WN5 A;  1MC0 A;  1N9O A;  1YLW A;  1WYC A;  1P97 A;  2H0Y A;  2JC7 A;  3Q7V B;  4HP4 A;  1J9M A;  3PBS A;  1BLS A;  4G3K A;  1WYB A;  5IS1 A;  3JPU A;  2MJ6 A;  2VEA A;  2QZ6 A;  1F2K A;  2IWC A;  4EV4 A;  2C6W B;  5KSC A;  3MXR A;  5J7E A;  4MLL A;  1G5U A;  3B3X A;  1OTB A;  5L07 A;  3CZD A;  1NWZ A;  1SZV A;  4Y7P A;  5GHX A;  2EXB A;  4CLC D;  3NY4 A;  1SKF A;  4CLC C;  4Y17 A;  1H8M A;  2XK1 A;  5HD3 A;  5EVI D;  4MDZ A;  3HL9 A;  4R3A A;  2WGW B;  2WKH A;  5EVI C;  4HES A;  3TOI A;  1K54 A;  2JHE A;  4LCM A;  2WKI A;  1N9L A;  4HJ3 A;  5IT5 A;  5CXW A;  3O5Y A;  1XJ4 A;  3PBQ A;  4D60 A;  5E2G A;  3MQ0 A;  2CC1 A;  3N8R A;  1Q2P A;  3LEZ A;  3CAX A;  5HAI A;  1W8Q A;  5JYO A;  3LGO A;  5EOO A;  5CER A;  5HAR A;  2WK0 A;  2DNS A;  5E2H A;  2E8J A;  3F1P A;  3ZG8 B;  4H6J B;  2X01 A;  4GS9 B;  1IOU A;  1CEG A;  3CMZ A;  4P6Z M;  4X1M A;  3LR5 A;  4E04 A;  4F94 A;  1S1Y A;  4GKU A;  4E3N A;  3Q82 A;  4KZ3 A;  2V1B A;  4F3L A;  2ZJ9 A;  1YAX A;  1BSG A;  1HVB A;  2EWW A;  3O86 A;  3DBA A;  4Q0J A;  2X71 A;  2P9V A;  1PWG A;  5J8X A;  4FOF A;  4MBF A;  3N8S A;  3UY6 A;  1PYY A;  1MY8 A;  3K2N A;  3LY4 A;  3C8C A;  4S2O A;  2R78 A;  5GLB A;  4LRX C;  3T1X A;  4IBX A;  4B4X A;  3EQV A;  3ICY A;  3DAV A;  1NY0 A;  4OOM A;  2XF3 A;  4HBU A;  1BZA A;  1T1B A;  4NEE D;  4QWO A;  4JGP A;  3OLO A;  1XX2 A;  3T4Q A;  4X68 A;  4O7D A;  1G28 A;  1LL8 A;  3H7W A;  4GZB A;  1XGJ A;  3MMH A;  1DJB A;  1W7F A;  1EWZ A;  3AGF A;  4LV3 A;  5HWT A;  3MQQ A;  1W8Y A;  3LIB A;  3M6B A;  3GDI A;  2VGL S;  4HP9 A;  2QJ7 A;  2ZC6 B;  1RCJ A;  2BLS A;  3RJU A;  4ZBE A;  3D9Y A;  1MKI A;  4GD8 A;  1PW1 A;  4PM6 A;  4L9G A;  2Y2H A;  2W3G A;  2IWD A;  1P9R A;  3PHY A;  3T50 A;  3PBR A;  3ZG5 A;  3RFB A;  2H5S A;  2PDR A;  3FZC A;  3QP8 A;  1GHP A;  3SS4 A;  3OPH A;  5DTK A;  3VE3 A;  1PRQ A;  3UE0 A;  1IYS A;  3EOI A;  3B42 A;  1OJ5 A;  4MCW A;  3WRZ A;  2EX2 A;  3NHQ A;  1W5D A;  1T19 A;  1OTD A;  4WEK A;  2VZW A;  3BY8 A;  4WMC D;  5FQJ A;  4FH2 A;  2A24 A;  4JXG A;  4UA7 A;  4UHU A;  1PWC A;  2WZZ A;  1SKO A;  3BQA A;  2O0Y A;  1SDE A;  2OWH A;  4WF0 A;  1E3U D;  3ZNY A;  1G6A A;  3QP5 A;  5I5L A;  4UA9 A;  4IED A;  4RA7 A;  3TJZ C;  3C4P A;  3BFE A;  2XD1 A;  5KZH A;  1VEU A;  4X1L A;  5A91 A;  4KZ9 A;  1K38 A;  5FQI A;  2WKQ A;  3TW8 A;  1JTD A;  3LEQ A;  5DKL A;  3QP1 A;  3DTE A;  4QB8 A;  3O88 A;  1OT9 A;  1IEL A;  4C75 A;  4RX2 A;  1DJC A;  3GEC A;  4UEY A;  4LV0 A;  2JKT I;  1IFQ A;  3QP2 A;  2P74 A;  3H82 A;  4XT2 A;  5AVF A;  2WAE A;  3LR0 A;  5EM0 A;  3NCK A;  3IX3 A;  4QHC A;  4LV1 A;  3EEA A;  5A90 A;  3CLO A;  1KE3 A;  4CLC B;  2XDM A;  3V50 A;  2JKF A;  1N9B A;  5F5Y A;  3IX8 A;  4HOI A;  4YIN A;  1JWV A;  5M19 A;  1K55 A;  2Q9M A;  4Y5F A;  4WZ5 A;  4LFU A;  1YLY A;  4H8R A;  4OQH A;  4LGW A;  2OWJ A;  2OAQ 1;  2INW A;  1RP5 A;  4C6Y A;  4EUV A;  1K54 C;  4GN2 A;  4P85 A;  3R7W B;  3P09 A;  1K0K A;  4L0L A;  3HBR A;  4MBH A;  3W4P A;  4R6L A;  1TS6 A;  4KG2 A;  1MPL A;  1TVF A;  3GR2 A;  3HLG A;  4NG2 A;  5CTM A;  3UMD A;  4O01 A;  1ALQ A;  4BBU A;  3W2Z A;  4N1X A;  4DJ3 A;  2BG1 A;  2WUQ A;  5EVI A;  1CI8 A;  1GA9 A;  5FI6 A;  3UE1 A;  3MXS A;  3G6O A;  3ZG0 A;  4KG5 A;  5FA7 A;  1H8Z A;  3L9K A;  4K0X A;  1T18 A;  3T4L A;  1IYP A;  1GSX A;  1C3B A;  3S7Q A;  1ZKJ A;  3E4O A;  5DFY A;  3GSG A;  2J8Y A;  4FCF A;  4ZAM A;  4NXB A;  4UAA A;  1XGI A;  3VFF A;  4ME4 A;  3IXD A;  4X6T A;  4MN7 A;  3ZNT A;  1H8Y A;  3CUE C;  4U0X A;  1JVJ A;  3FPW A;  4XUZ A;  2XLN A;  3WS5 A;  2WKE A;  5EVL A;  5KSH A;  4E3J A;  3DTM A;  1VET B;  4M3K A;  3QHY A;  4Q0I A;  3MS6 A;  3NDE A;  3S1Y A;  3RXW A;  3F1O B;  4P87 A;  1K6S A;  2Y2I A;  3ISG A;  4WM9 A;  3UB5 P;  5FQK A;  4S2P A;  4BD1 A;  2I9V A;  3OCN A;  4ZJ1 A;  3MKE A;  3B47 A;  5DTS A;  3VP3 A;  1MKM A;  3HLW A;  4WUJ A;  1ZTU A;  3ZGA B;  1BUL A;  1F5M A;  2C5W B;  3ZG9 B;  4CQH A;  4IJG A;  2VA0 A;  4PAU A;  3ZCZ A;  3WS1 A;  2HP9 A;  2V8C A;  4MBK A;  5AJG A;  2VJW A;  3LI8 A;  5TGF A;  5K5B A;  2A2L A;  1TS7 A;  1FR6 A;  4ZJ2 A;  4JXS A;  2WKP A;  4I3A A;  3N6I A;  5EOE A;  1EI5 A;  3RTY A;  4R0Q A;  3OOV A;  1OJG A;  1QME A;  5HL1 A;  5CEB A;  3T1R A;  1HLU P;  4WEJ A;  4HY8 A;  5F6A A;  5E2F A;  4CJN A;  4GOG A;  1XKZ A;  2WAF A;  3OPP A;  2BTF P;  2V1Z A;  4KZ6 A;  1LSV A;  1BTL A;  4Y0T A;  1FOF A;  4HI4 A;  2W1R A;  4OVD A;  3UE3 A;  1ES3 A;  1TEM A;  2EXA A;  4RX3 A;  1PI4 A;  1DJA A;  4WLA A;  3VV4 A;  1H3Q A;  5L2F A;  1XJ2 A;  3IF6 A;  4JXW A;  3CG5 A;  2WKR A;  2ZM2 A;  1UWP X;  1L2S A;  2CMN A;  3GQZ A;  2W27 A;  3A3F A;  4OP8 A;  3C5A A;  3WS2 A;  2PBY A;  3PBT A;  1YLP A;  3FYZ A;  2UV0 E;  1BYW A;  1FCO A;  2Z6C A;  4WMC A;  2M7U A;  2ZQ9 A;  2ZC4 B;  3RH8 B;  3LO7 A;  3P7N A;  1VHM A;  2WGV A;  1E3U A;  5GLC A;  3IQA A;  1XJ3 A;  1LHY A;  5DVA A;  3WWX A;  5CED A;  4X25 A;  1WA9 A;  2D01 A;  4OLG A;  3CPT A;  3VFH A;  4BD0 A;  4OPR A;  2HJE A;  2DMW A;  5HDC A;  4GD6 A;  1XP4 A;  3TRC A;  1SDN A;  1K55 C;  1ACF A;  3ZDJ A;  1YKD A;  2P08 A;  4WZ5 C;  3KO6 A;  1IEM A;  2EX8 A;  2Q0O A;  3D4F A;  1N9N A;  3KYQ A;  4LV2 A;  3ZFZ A;  4E3O A;  3NUL A;  1JNU A;  4YFM A;  5CGW A;  3PAG A;  1PI5 A;  4GJ4 A;  2KOI A;  4EEP A;  1ESU A;  4L9F A;  3UDI A;  3SZT A;  3BJN A;  3FKW A;  3NDG A;  2O99 A;  2L0W A;  2QMI A;  4HHD A;  4BL2 A;  3C7U A;  2Y2N A;  3BYD A;  3OPR A;  2WYX A;  3PBO A;  4C3Q A;  4KG6 A;  2Y2G A;  5AQA A;  3F1P B;  5TBM A;  5FEG A;  3F1N A;  4UQI M;  3KX0 X;  4F3L B;  3BW6 A;  1P0Z A;  4JLF A;  2B95 A;  4HNB A;  1V9Z A;  1KE4 A;  1AWI A;  4HIA A;  3NOU C;  4DDS A;  4Q8I A;  4KZB A;  5EUA A;  2P9V B;  2O9C A;  2BAS A;  4FSF A;  3Q81 A;  5L8M A;  3WS0 A;  3EGD C;  4HBT A;  4EQ1 A;  3BLM A;  3LYX A;  4KUK A;  4ETX A;  3S4X A;  2DCF A;  3S7O A;  3SH7 A;  2Y8H A;  3PYP A;  3CJM A;  3A3J A;  1TS0 A;  3ZQ5 A;  2ZQ8 A;  4S2I A;  4R1G A;  5DF7 A;  5HZH A;  3PXP A;  3BEB A;  3TSG A;  2XEP A;  3G31 A;  2HJ9 C;  3CUE A;  2JE5 A; 
#chains in the Genus database with same CATH homology
 1W79 A;  4R4S A;  3SS3 A;  3HUN A;  5AQ7 A;  1JTD A;  2ZQC A;  4PM8 A;  2J7V A;  1GHM A;  3GRJ A;  1KGG A;  4KZ4 A;  1Q2Q A;  4QB8 A;  1FQG A;  4N92 A;  4E3L A;  2XH9 A;  2ZM0 A;  3ITA A;  3O88 A;  5CHJ A;  4C75 A;  1IEL A;  3JYI A;  1BUE A;  2OSU A;  4RX2 A;  4QY6 A;  1DJC A;  1ZG6 A;  3S22 A;  3M2K A;  3MKF A;  3ZG7 B;  4LV0 A;  5TFQ A;  2OLV A;  2P74 A;  1FSY A;  2JCH A;  2WAE A;  1ES4 A;  1S0W A;  2E8I A;  3NCK A;  4QHC A;  3EQU A;  1BLC A;  3V3S A;  4LV1 A;  4GDB A;  1Y54 A;  3IHA A;  5A90 A;  4QU3 A;  3W4O A;  1MXO A;  4BJP A;  1KE3 A;  4ID4 A;  2XDM A;  3G2Y A;  1NRF A;  4EBN A;  4XXR A;  3V50 A;  1I2S A;  1L0E A;  1N9B A;  3E2L A;  1M40 A;  5CGS A;  1KDS A;  2H0T A;  3A3D A;  3HUO A;  4QJG A;  4YIN A;  1JWV A;  4RVA A;  5M19 A;  1K55 A;  4N9K A;  2Q9M A;  3QNB A;  4PM5 A;  2WAD A;  5CRF A;  2EFU A;  3G30 A;  1GHI A;  4OOL A;  4DF6 A;  4K0W A;  1MWT A;  4PM9 A;  4BL3 A;  4WZ5 A;  4OQH A;  1YLY A;  4H8R A;  4K91 A;  3AGE A;  5E2E A;  1ZG4 A;  1MWU A;  1S6R A;  4S2N C;  1DY6 A;  1RP5 A;  4C6Y A;  5HAQ A;  3UDX A;  2XGN A;  3G32 A;  1KGE A;  1K54 C;  4GN2 A;  4P85 A;  3ITB A;  4RYE A;  1XA1 A;  2HDU A;  1ERM A;  5E43 A;  3P09 A;  3HLE A;  5EE8 A;  4L0L A;  1K56 D;  3IXB A;  1IYQ A;  3HBR A;  4MBH A;  3W4P A;  2ZQ7 A;  1SCW A;  1VM1 A;  3HLB A;  1PW8 A;  4Y0U A;  3NI9 A;  2I72 A;  3BFF A;  4KG2 A;  2Z2M B;  4A5R A;  1MPL A;  2Y55 A;  1LI9 A;  1TVF A;  3GR2 A;  3HLG A;  3M2J A;  2ZQD A;  4EWF A;  1ONG A;  5F82 A;  5CTM A;  3NIA A;  1KDW A;  3IH8 A;  1ALQ A;  4OLD A;  2J9O A;  4N1X A;  3IWQ A;  4LCL A;  2HP5 A;  2WZX A;  3Q7V A;  3IF6 C;  3MZF A;  2BG1 A;  2WUQ A;  5EVI A;  1ESI A;  1CI8 A;  1GA9 A;  4QD4 A;  5FI6 A;  3MXS A;  5M1A A;  3UE1 A;  4JF5 A;  3ZG0 A;  3NC8 A;  1MBL A;  1PZP A;  1LL5 A;  1H8Z A;  2ZC7 A;  4KG5 A;  5FA7 A;  1K6R A;  1FCM A;  3ZVW A;  4K0X A;  1XA7 A;  1O7E A;  1MWS A;  1IYP A;  1XPB A;  2PU4 A;  1LI0 A;  4R3B A;  3MFD A;  4OOY A;  3SOI A;  1IKG A;  1C3B A;  4P0M A;  1ZKJ A;  4DDY A;  2R9X A;  1TDG A;  3Q1F A;  2HDR A;  1CI9 A;  5G18 A;  2RCX A;  4JPM A;  1NYY A;  1IKI A;  3VSK A;  3GSG A;  1KE0 A;  3G34 A;  1ES2 A;  2XQZ A;  3BFG A;  1ZC2 A;  3I7J A;  2J8Y A;  3IXH A;  4FCF A;  3V5M A;  3UPN A;  4ZAM A;  1KVM A;  3N7W A;  5F1F A;  1KGF A;  1FR1 A;  4UAA A;  2OV5 A;  4MEZ A;  1XGI A;  5DF8 A;  3VFF A;  5FAT A;  2OLU A;  2Y2L A;  2G2W A;  3IXG A;  2WGW A;  3IXD A;  4X6T A;  1N4O A;  1RGZ A;  1TDL A;  2FFF B;  3ZNT A;  4DRT A;  4DE0 A;  1H8Y A;  3BEC A;  4U0X A;  1JVJ A;  2ZLY A;  3GV9 A;  3HLF A;  4KQO A;  1MWR A;  1L0G A;  3GMW A;  4XUZ A;  3HLC A;  2XLN A;  3WS5 A;  2WKE A;  1CK3 A;  4GDN A;  5EVL A;  5FAP A;  4E3J A;  5KSH A;  3DTM A;  4M3K A;  3QHY A;  4X56 A;  4OH0 A;  4OQG A;  1LLB A;  4EBP A;  4R3J A;  4BLM A;  3NDE A;  3OZH A;  4GNU A;  4S2J A;  3S1Y A;  5DF9 A;  3RXW A;  2PU2 A;  2R9W A;  4WEL A;  4Y0O A;  4P87 A;  1K6S A;  3MZD A;  2V20 A;  3HUM A;  4IVK A;  1K57 C;  2Y2I A;  3ISG A;  4JXV A;  4WM9 A;  1YMS A;  5FAQ A;  5FQK A;  4IVI A;  4FH4 A;  4S2P A;  2IWB A;  3HRE A;  3AGD A;  5M18 A;  5KMW A;  5FSR A;  3G2Z A;  1VQQ A;  3HVF A;  4Z9Q A;  4BD1 A;  3VOY A;  3OCN A;  4ZJ1 A;  3VP0 A;  3BLS A;  3MKE A;  2A49 A;  4R23 A;  2VGK A;  3OCL A;  3MZE A;  5FQM A;  3Q7Z A;  2HDS A;  1YMX A;  5DTS A;  2EFX A;  3LCE A;  3VP3 A;  5FAO A;  1M6K A;  3DW0 A;  2Y2O A;  4S2L A;  2ZD8 A;  2Y59 A;  3HLW A;  1L0D A;  1G68 A;  1YLW A;  1WYC A;  2H0Y A;  2HP6 A;  2JC7 A;  3Q7V B;  4FD8 A;  3ZGA B;  1BUL A;  5EVI B;  1I5Q A;  2C5W B;  4PM7 A;  1J9M A;  3PBS A;  3E2K A;  3VP4 A;  1BLS A;  3ZG9 B;  3V3R A;  2Y2K A;  1BLP A;  1WYB A;  2VGJ A;  3FV7 A;  3IWI A;  5DTT A;  4U0T A;  3ZCZ A;  3WS1 A;  4JF4 A;  2HP9 A;  2QZ6 A;  4U3T A;  5D3O A;  3N8L A;  2IWC A;  4OKP A;  4MBK A;  4EV4 A;  2C6W B;  5EEC A;  5TGF A;  4KQQ A;  5HFO A;  5KSC A;  3MXR A;  2ZC5 B;  4MLL A;  5AQB A;  3B3X A;  2XFS A;  3IHB A;  2Y91 A;  3C7V A;  3CZD A;  4XUX A;  5U47 A;  3A3E A;  4Y7P A;  5GHX A;  1FR6 A;  1NJ4 A;  4ZJ2 A;  3VMA A;  5CEC A;  2EXB A;  3NY4 A;  4JXS A;  3QNC A;  1SKF A;  3ZVT A;  3A3I A;  5I94 A;  3N6I A;  2ZC3 B;  5EOE A;  1EI5 A;  1YLJ A;  3SH9 A;  4LEN A;  4R0Q A;  2XK1 A;  1IYO A;  4JKT A;  5JYP A;  5EVI D;  3N4I A;  1QME A;  5HL1 A;  3HL9 A;  4X69 A;  1JWP A;  2WGW B;  2WKH A;  5EVI C;  4HES A;  4S2N A;  5CEB A;  3BM6 A;  1JWZ A;  1K25 A;  2HDQ A;  4WEJ A;  1K54 A;  3TOI A;  3BRM A;  4ZDX A;  3W8K A;  4UA6 A;  5E2F A;  4LCM A;  2WKI A;  1YT4 A;  4GOG A;  4CJN A;  1XKZ A;  5A93 A;  4BQM A;  2WAF A;  4QY5 A;  1XXM A;  1FSW A;  3OPP A;  4ZTK A;  1K56 A;  5CXW A;  2EX9 A;  2V1Z A;  3PBQ A;  5E2G A;  4KZ6 A;  4JF6 A;  4KZ8 A;  1BTL A;  4Y0T A;  2XD5 A;  1FOF A;  5FI2 A;  2CC1 A;  3N8R A;  1Q2P A;  3LEZ A;  3VOZ A;  4OVD A;  1L0F A;  5HAI A;  3UE3 A;  1W8Q A;  2ZMA A;  1ES3 A;  5JYO A;  4JBF A;  1TEM A;  2EXA A;  4E3I A;  4RX3 A;  2JBF A;  4OQ0 A;  1PI4 A;  1DJA A;  2Y4A A;  4OQI A;  4E6W A;  5EOO A;  5GHY A;  2V2F F;  1NZU A;  5GHZ A;  5CER A;  4DE3 A;  5L2F A;  3IF6 A;  4JXW A;  1K4E A;  3OC2 A;  3CG5 A;  5GLA A;  2EX6 A;  3M6H A;  2ZM2 A;  3SS5 A;  4E6X A;  5HAR A;  1L2S A;  2WK0 A;  3GQZ A;  3GTC A;  4DXB A;  3A3F A;  4OPZ A;  4OP8 A;  3PTE A;  2DNS A;  3LY3 A;  5E2H A;  3C5A A;  3WS2 A;  3ZG8 B;  2PBY A;  3PBT A;  2X01 A;  1YLP A;  3FYZ A;  1ONH A;  1CEG A;  2DRW A;  3UDF A;  1FCO A;  3CMZ A;  3ZHH A;  4EUZ A;  3WRT A;  3PAE A;  4F94 A;  2GDN A;  4WMC A;  2ZQ9 A;  4GKU A;  4E3N A;  2ZC4 B;  1BT5 A;  1E4D A;  3Q82 A;  4KZ3 A;  3LO7 A;  4P6B A;  2XFT A;  2FFY A;  4KZ7 A;  2ZJ9 A;  2A3U A;  3C4O A;  2ZM8 A;  1PIO A;  2J9P A;  1BSG A;  1ERQ A;  2WGV A;  1HVB A;  1E3U A;  3O86 A;  2Y2J A;  5HX9 A;  5FDH A;  5GLC A;  3UPO A;  3IWO A;  3IQA A;  4DKI A;  4EQI A;  1LHY A;  2Q9N A;  5DVA A;  1U60 A;  3TG9 A;  3VSL A;  4WBG A;  3WWX A;  2X71 A;  2P9V A;  5CED A;  4N9L A;  1PWG A;  1YLT A;  4OLG A;  4BEN A;  5J8X A;  5IHV A;  5HW3 A;  1YQS A;  3VFH A;  4BD0 A;  4OPQ A;  2G2U A;  4MBF A;  4OPR A;  4E3K A;  5GL9 A;  3N8S A;  3UY6 A;  4IBR A;  1PYY A;  1HZO A;  5EPH A;  5BOH A;  1E25 A;  1MY8 A;  1BLH A;  3LY4 A;  1PZO A;  4GD6 A;  1XP4 A;  3PBN A;  4S2O A;  4WZ4 A;  1SDN A;  4DXC A;  3UNW A;  4GB7 A;  1AXB A;  1K55 C;  5GLB A;  4MNR A;  3O3V A;  1NYM A;  4N1H A;  3ZDJ A;  2X02 A;  4IBX A;  3EQV A;  4B4X A;  3V39 A;  1ES5 A;  4KZ5 A;  1K57 A;  5FQQ A;  1NY0 A;  2B5R A;  4OOM A;  2XF3 A;  4WZ5 C;  4HBU A;  1BZA A;  4DE2 A;  5AQ9 A;  1IEM A;  4HEF A;  5A92 A;  2EX8 A;  3D4F A;  4LV2 A;  3P98 A;  3ZFZ A;  1XX2 A;  4E3O A;  4KQR A;  4KEN B;  3IH9 A;  4YFM A;  2Y2P A;  5CGW A;  2Y2Q A;  1YM1 A;  3W4Q A;  3PAG A;  1PI5 A;  1GA0 A;  5FQ9 A;  4X68 A;  1ESU A;  4O7D A;  3UDI A;  3FKW A;  3NDG A;  2HPB A;  4NK3 A;  3IT9 A;  2QMI A;  4GZB A;  1HTZ A;  4BL2 A;  1XGJ A;  3IF6 B;  3C7U A;  1DJB A;  2Y2N A;  1W7F A;  4OON A;  1EWZ A;  1QMF A;  4X55 A;  3BYD A;  3OPR A;  2WYX A;  3AGF A;  3PBO A;  4LV3 A;  4C3Q A;  4KG6 A;  3OPL A;  3VP1 A;  3DWZ A;  1W8Y A;  2Y2G A;  5AQA A;  1OME A;  3M6B A;  3GVB A;  1CEF A;  2XR0 A;  2ZC6 B;  1RCJ A;  2BLS A;  4X53 A;  5CTN A;  5FI7 A;  3G35 A;  1FCN A;  4ZBE A;  3RJU A;  1MKI A;  3UPP A;  5HAP A;  4GD8 A;  1PW1 A;  4B4Z A;  4OP5 A;  4PM6 A;  4EBL A;  2Y2H A;  3MBZ A;  4JLF A;  1SHV A;  3WS4 A;  2IWD A;  3PBR A;  4B88 A;  4E3M A;  3ZG5 A;  5F1G A;  4R4R A;  1GCE A;  3BFD A;  1KE4 A;  1KVL A;  2RL3 A;  1WE4 A;  5TR7 A;  4DDS A;  4Q8I A;  2H5S A;  4KZB A;  5EUA A;  3FZC A;  2P9V B;  2Z2L B;  1GHP A;  3SS4 A;  3OPH A;  5DTK A;  4FSF A;  1NZO A;  4KZA A;  3Q81 A;  3UE0 A;  1YLZ A;  2UWX A;  4ZJ3 A;  1IYS A;  3WS0 A;  4S2M A;  3SH8 A;  3WRZ A;  3HLD A;  2EX2 A;  3O87 A;  1RGY A;  1W5D A;  4NET A;  4HBT A;  4WEK A;  3BLM A;  4WMC D;  1K4F A;  1JTG A;  4FH2 A;  4WYY A;  5FQJ A;  2Y2M A;  3UO9 A;  3S4X A;  2DCF A;  4JXG A;  4UA7 A;  4UHU A;  3SH7 A;  4D2O A;  1PWC A;  2WZZ A;  1H5X A;  3DWK A;  3CJM A;  5CGX A;  5CHM A;  3A3J A;  2QPN A;  1I2W A;  1SDE A;  4S2K A;  4CPK A;  1HD8 A;  3VP2 A;  4DE1 A;  1E3U D;  3FKV A;  5FAS A;  3BFC A;  1ERO A;  3ZNY A;  1G6A A;  5F83 A;  1NXY A;  1O07 A;  1LL9 A;  2ZQ8 A;  3Q07 A;  4S2I A;  4OPY A;  4R1G A;  4UA9 A;  5DF7 A;  2H10 A;  3FWL A;  4IED A;  4RA7 A;  2WGI A;  2ZQA A;  3C4P A;  5CHU A;  5GLD A;  3IF5 A;  3BFE A;  3RXX A;  2XD1 A;  3BEB A;  5KZH A;  3G4P A;  3TSG A;  4PPR A;  4PMA A;  5A91 A;  3UN7 A;  1PWD A;  2XEP A;  4KZ9 A;  3G31 A;  3NBL A;  1K38 A;  5FQI A;  1Z6F A;  2JE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...