1OTIA

E46q mutant of photoactive yellow protein, p65 at 295k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otiA00
4JGQA 4MN5A 1G28A 4PKYA 5DKLA 5F69A 3HJIA 1D7EA 4HJ6A 5DJUA 3GECA 3H82A 4WF0A 5G4YA 2PD7A 4HH2A 4XT2B 3F1NB 1F9IA 2PR5A 4GCZA 2OOLA 1OTAA 4JGRA 1T19A 5J3WA 4LRZE 4I5SA 3UB9A 2YKHA 4L9GA 4F3LB 2GJ3A 4I3IA 1XJ3A 1OTBA 2B02A 4HHDA 3F1OB 5KIZA 1XFNA 2H28A 3NOTC 2D02A 1ODVA 3K3DA 3MXQA 4GW9A 4I38A 3UB6A 5HSQA 5J7EA 5EFWA 3H7WB 1LSXA 1S4RA 3ULFA 4JGPA 4I3JA 2PDRA 2V9AA 2VV8A 4R6LA 3H82B 1VB6A 3UMEA 3IS2A 4R38A 4NXEA 1XJ2A 3VE4A 2INWA 2KX6A 4HNBA 4GS9B 3OLOA 4NXGA 5HD5A 1TS7A 2HV1A 2EA9A 1NWZA 2D01A 2PD8A 5F6AA 3P7NA 3NHQA 3NOPC 1KOUA 4JGOA 2P7JA 3LYXA 1N9NA 3F1NA 3GDIA 1V9YA 3A0SA 3IBRA 4NXBA 4HP4A 1T1AA 5HD3A 1DP8A 1TS6A 2PYPA 4LRXC 4R3AA 2JHEA 4EQ1A 1LL8A 1LT0A 1OTIA 1S1YA 2A24A 2CMNA 2QHKA 3CAXA 3E4QA 1S66L 3BY8A 3K3CA 3F1PA 1XJ4A 3LIBA 2ZBBA 3UMDA 3UB8A 3EEHA 1XFQA 3UB7A 1UWNX 3BWLA 1LSVA 3D72A 2KDKA 4BBUA 3T50A 2K7SA 5AVFA 5TBMB 2OWJA 2VLGA 4XT2A 4PKYG 3ZQ5A 4I3AA 2M1CA 2Z6DA 2ZOHA 3IS2B 4HIAA 1X0OA 2J80A 2VV7A 2QJ5A 2PHYA 3PHYA 4L9EA 4WUJA 1JNUA 4H6JB 4BBTA 3G6OA 5G4ZA 5IU1A 3LUQA 4KUOA 2Z6CA 3H7WA 3E4PA 2YKFA 3A0RA 2JN7A 4LLOB 1WA9A 1EW0A 2QKPA 1D06A 1GSVA 4NXFA 5HDDA 4DJ2A 5TBMA 3FG8A 3C2WA 3MQOA 1T18A 1S67L 2V1AA 2W27A 4HP9A 1TS8A 1GSWA 5DJTA 3RTYA 4EERA 1T1BA 3LIAA 4GS9A 3CLOA 4B9OA 3H9WA 3KX0X 1S1ZA 2VEAA 1BYWA 4EESA 4HH3A 1OT9A 1V9ZA 2L1MA 2V0WA 3MFXA 2BASA 4EEUA 4LRYC 5DKKA 3LIDA 4GHIB 2L0WA 3RH8B 1DP9A 3E4OA 4HJ3A 4BBVA 5J4EA 1DP6A 5IS1A 1N9LA 3LIFA 1P97A 3BY9A 1F98A 1MZUA 5HWTA 3VE3A 4EETB 3LI8A 2V0UA 3UE6A 2VV6A 3FC7A 3MQQA 4R70A 3MJQA 4KUKA 1P0ZA 1N9OA 1UGUA 2PR6A 3MR0A 3NJAA 4HJ4A 3B33A 4HQAA 5HZHA 1OTDA 4WN5A 3ICYA 4L9FA 4K08A 4EW7A 1S4SA 1TS0A 2WKQA 4YWZA 2WKPA 3SW1A 1DRMA 2W0NA 3LIEA 4HOIA 4HY8A 3CWFA 5F5YA 4F3LA 1OJ5A 5HDSA 4EEPA 4MN6A 5HWVA 3A0VA 4DJ3A 5HDCA 4H6JA 4KQDA 1GSXA 1OTEA 3EWKA 5A8BA 3F1OA 1T1CA 2R78A 3LI9A 4WL9A 2V1BA 4WLAA 4M4XA 3C8CA 3LICA 1OT6A 1LSWA 2I9VA 3F1PB 4I39A 4RQ9A 4GHIA 1XJ6A 1Y28A 5I5LA 4E04A 1OJGA 2ZOIA 5HWWA 2PYRA 2QJ7A 5AVEA 4LPZA 2OWHA 2QWSA 4HI4A 1UWPX 3PYPA 4EXOA 2WKRA 2L4RA 3HJKA 3NOUC 3VOLA 2A24B 5F68A
chains in the Genus database with same CATH superfamily
2Y59A 2HDRA 1MKIA 2P9VA 5J3WA 2FFFB 3E2LA 4KG5A 1YLYA 4HBTA 2XDMA 1E3UA 5I94A 4I3JA 4KENB 3T4JA 2ZQ9A 1MXOA 2W1TA 1K25A 1SDEA 5L10A 1QMEA 1SCWA 3LYXA 3F1NA 4UQIM 2EWWA 3IBRA 1HTZA 4O0PA 1NLZA 1DP8A 4EBLA 1Y54A 4Y13A 1OTIA 1EROA 3E4QA 3VP2A 1XJ4A 3UPPA 3UB7A 3IWIA 5HAIA 5HPIA 1PI4A 1J3WA 1MBLA 1NZUA 2WKIA 4E3OA 3CHWP 5IU1A 3A0RA 3UE1A 3VFHA 1K38A 2V1AA 1S67L 4HP9A 3RTYA 3GRJA 3IX8A 2XGNA 4B9OA 4ZAMA 3VOZA 2Y2KA 2NUPC 3C7VA 3E4OA 2W3DA 3DTEA 4IVKA 5GLDA 4R70A 4KQQA 3Q7VA 1IKGA 1S4SA 5HAQA 4NG2A 5F5YA 2JKTI 4Z1WA 3K2NA 4LGWA 5J8XA 2C6WB 4B93A 2ZM0A 1IYOA 4GHIA 4R3JA 5I5LA 3AGDA 4BQMA 2PYRA 2JBFA 3SZTA 4IBXA 3NI9A 4JXSA 2CC1A 2ZC5B 5IT5A 4PMAA 3MZDA 5FQ9A 2K31A 3IWOA 1D7EA 1F9IA 3UB9A 4LRZE 4I5SA 3CI6A 3SS5A 4N1XA 1M40A 1FCOA 1YSPA 3IS2A 3VE4A 3IXHA 2FZ0A 4RVAA 1N9NA 4K0WA 3UDIA 3IBJA 4KZ7A 3TG9A 2GZAA 5AVFA 4Y5FA 4BD1A 1I5QA 3UE0A 4WBGA 3U4LP 3BQAA 4X53A 3HLFA 3IHAA 1IELA 5CHJA 3Q7ZA 4E6WA 1BULA 2VEAA 4QB8A 3MFXA 4Q0IA 4P85A 4OPYA 3VOYA 5CGWA 4HJ3A 2ZJ9A 4LCMA 4D2OA 1PYYA 4KUKA 4S2OA 2JCHA 1KE4A 2ZQAA 2EWVA 5HDSA 3HLCA 3NCKA 3LICA 4AFIA 1LSWA 2BG1A 2W3GA 2ZQ7A 3HUOA 3U2AA 5HWWA 3WS0A 2VGLS 3W4OA 4G3KA 3IHBA 3JVUA 3HJKA 2G2UA 3E2KA 3MQ0A 2XEPA 3F1NB 3IF6B 1ZG4A 4JGRA 5D3OA 1I2WA 1FCMA 4GJ4A 4KQRA 4BD0A 2D02A 3G31A 4RYEA 5FSRA 4JGPA 2V9AA 4R6LA 2BLSA 1VB6A 3KYQA 5JYOA 4YINA 4E3NA 3HBRA 3HLWA 1EWZA 2KX6A 1BZAA 2EA9A 3IQAA 4OVDA 2Z2MB 4II7A 4HESA 3GSGA 4ESPA 5HWVA 4E3KA 2DMWA 4OPZA 2EFUA 3SH7A 2HDQA 3BFGA 4OPQA 2ZL1B 4PAUA 5EM1A 2J8YA 2OAQ1 4H6JB 2UV0E 3Q7VB 2XF3A 5CGSA 5AQBA 3ZQ5A 5EOOA 4ARZA 4OONA 3LIAA 4X1LA 1S1ZA 3MBZA 3ITBA 1L3LA 3CUEC 3BFCA 4GHIB 1K55A 3R7WA 2E8JA 3QP8A 4Y15A 1JWPA 1W63M 3UE6A 4LV3A 3HCYA 4L0LA 2K2NA 3PBSA 5EVEA 1ZG6A 3M2KA 3EEAA 1XGIA 2JC7A 1I2SA 4EEPA 1OTEA 2OSUA 3S7QA 1FQGA 3BFDA 4KG2A 2DCFA 2XQZA 1RCJA 1ZTUA 2X02A 5FATA 1P9RA 2PBDP 4ZRRA 1T19A 2YKHA 5AQAA 1S0WA 5KIZA 3NDGA 3NOTC 5FI2A 4XUZA 1E3UD 2EX8A 1TEMA 3UMEA 4O01A 2Y2QA 1PZOA 4GS9B 4S2KA 1C3BA 2PD8A 4OP8A 4S2NC 3SH8A 3NOPC 4PHTA 3A3IA 1NZOA 3V3SA 1VETA 2RCXA 4LRXC 1S1YA 1G68A 3CAXA 2WKEA 2E8IA 3WRZA 2C5WB 4JXVA 3UMDA 4LV2A 1UWNX 3BWLA 1DJCA 4CLCA 4S2NA 3PTEA 3D9YA 4I3AA 3OCNA 3P01A 2GX5A 3PXPA 3B47A 3G32A 2XFSA 3T4KA 2YKFA 4DE2A 4DMZA 2O9AA 1BYWA 3FPVA 4BENA 1DP9A 1N9LA 4E3JA 1F2KA 5E43A 2XA7M 3PBOA 3QP5A 5EVIB 4CLCD 4OQ0A 4CLCC 4OOYA 4D60A 3A0VA 3T4OA 4FD8A 5HL1A 2IWDA 4GLQA 3C8CA 4EU0A 2ZMAA 2JE5A 3UB5P 1YKDA 2OWHA 3SS4A 4MBFA 2VJWA 1ES4A 1FSYA 3CG5A 4LCLA 5DKLA 2M7VA 4QHCA 5MC7A 5DJUA 5G4YA 1OTAA 2H28A 3ZHHA 4Q8IA 3BFFA 3VP3A 3R7WB 1CK3A 4X25A 1W7FA 3BECA 4KZ9A 4R4RA 4NETA 1JWZA 4N9KA 5AQ9A 1HLUP 1KGGA 1YPRA 4JGOA 4KZ6A 1ES2A 4HP4A 5CERA 1BT5A 4OQHA 2JHEA 4JLFA 4FH2A 5FI7A 2VGJA 2VK3A 4XT2A 5EM0A 1SDNA 3PHYA 3IH8A 3G6OA 3H7WA 1E4DA 1L0EA 1JTGA 3ZGAB 4QJGA 1T18A 2VKSA 3UNWA 3T1RA 2XD1A 3NBLA 2KOIA 4IHQA 3M6HA 4BBVA 2ZM8A 3LR3A 1WYCA 2ZD8A 3BLMA 3IXGA 1UGUA 4HQAA 4GD6A 1OTDA 3ICYA 3AGEA 1BLCA 4XXRA 1JVJA 3CWFA 1KGEA 5HDCA 4WYYA 1Z09A 4CQHA 2WADA 2Y2HA 3VMAA 5KZHA 1H3QA 4N9LA 3AGFA 4BJPA 5TJJA 2IA2A 3BRMA 1CJFA 5KSCA 1ONGA 4DRTA 1YLWA 3IF6C 3GMWA 1OTBA 1KE3A 4R3BA 1XA7A 4KZBA 1BSGA 4ZBEA 4I38A 1L0GA 3UE3A 2QMIA 1NXYA 1NLYA 5FL3A 2NUTC 5EVIA 5L2FA 1IOUA 3IWQA 2DNSA 5F83A 1GHIA 2UWXA 2KLIA 5FAQA 4EQ1A 2A24A 3UPOA 2ZBBA 4BBUA 2PBYA 3MXRA 4BWIA 2M1CA 2V1ZA 3PBNA 1IYQA 1KE0A 2VGKA 1XGJA 1L0FA 1XX2A 3LY3A 5HAPA 4QU3A 3TW8A 2ZLYA 4RX3A 3ZYTA 1E25A 2J7VA 3LGOA 4HH3A 2L1MA 1KGFA 1SKFA 1DP6A 1DJBA 4OOMA 1N4OA 4IUHA 5HL6A 4MN7A 1P0ZA 4M3KA 4HJ4A 4K08A 5DF9A 1CI8A 4U0XA 1RGYA 2WUQA 4WMCD 4FUWA 1T1CA 4X69A 5CRFA 1DJAA 3ZG7B 3C30A 1K54C 3CPTB 3F1PB 2Y2JA 3IX3A 3CZDA 5CHUA 4MBKA 5EE8A 4E3IA 2L4RA 3HL9A 3PBTA 1G28A 5F69A 3HJIA 4WF0A 4EV4A 1J9MA 3KSHA 1XP4A 2GJ3A 4UEYA 4KZ8A 2P08A 3G34A 5F1GA 5EFWA 1S4RA 1K4EA 2X71A 1NRFA 4BLMA 4OQIA 3LR0A 3G35A 1TDLA 2Y55A 3GVBA 1L2SA 3T12B 3OPRA 4LFUA 3GDIA 3CITA 5DF8A 5TFQA 4WZ4A 4BL3A 4R3AA 2CMNA 1HZOA 5E2EA 3UB8A 2LB9A 1SKOA 5K5BA 2V8CA 2ZOHA 3C38A 1RP5A 4DE1A 1VETB 3WRTA 3NDEA 3TOIA 1P9WA 4P6BA 4MDZA 2WAEA 4GOGA 3I7JA 1AWIA 1OT9A 4Y0UA 1W8YA 1TF1A 4Y0TA 3LR4A 4KZ3A 5HWTA 4OPRA 5DFYA 4WM9A 2VV6A 3MSHA 3KSIA 4EBNA 4YFMA 1N9OA 1DRMA 5AQ7A 5FDSA 2AVXA 2Y2IA 4FH4A 3EQVA 2Q0OA 3ZNYA 3Q82A 3N6IA 4OKPA 4I39A 2OLUA 4KQOA 2ZOIA 2QWSA 1CEGA 4PM6A 4JGQA 4PPRA 3C4PA 1F5MA 2VA0A 2V20A 3B42A 3C7UA 2J9OA 4ZTKA 1CI9A 1N9BA 1SZVA 4N92A 2WZXA 4GNUA 2P74A 4P6ZS 2WGWB 2ZQDA 2B95A 3O5YA 1YMXA 4ZJ1A 5L8MA 2Y2NA 3NHQA 3LFVA 3E0YA 5CX7A 4R1GA 2OAP1 2OLVA 4P0MA 1PW1A 3A0SA 3KO6A 2V8FA 1K56A 2M7UA 4B4ZA 3TE8A 1NYYA 4S2MA 3UDFA 2KDKA 5CECA 3LY4A 2VLGA 3PR6A 4HIAA 1X0OA 3GTCA 1A0KA 5FQMA 4UQIS 4Q0HA 2JKFA 2QKPA 4DN0A 1S6RA 3C2WA 3FKWA 2B18A 4Z9QA 2W27A 1YQSA 3G2YA 2Y2OA 3A3DA 3RXWA 1IKIA 2HP6A 2V0WA 4GB7A 1BTLA 5FQIA 4IJGA 4GN2A 3VP1A 3VE3A 2PU4A 3FC7A 5GLBA 1QMFA 4S2LA 2ZMVA 1PRQA 2XH9A 3QP6A 3SW1A 5BOHA 1MKMA 1GHPA 4DXBA 3LI9A 3OBFA 3T1XA 5DF7A 3R4KA 5FQJA 3S7NA 1PWGA 1YT4A 2QJ7A 1ERQA 2ZQ8A 3VOLA 4K0XA 5FA7A 2B5RA 2Q9MA 3HLGA 3HUNA 3L9KA 3GECA 5FEGA 4HH2A 5EOEA 4UA9A 5CGXA 5TGFA 4F3LB 3N8LA 3KYEA 3WS2A 1PWDA 5HX9A 3H7WB 5CTNA 3IX4A 1K54A 3MFDA 3T4LA 3OZHA 1XJ2A 2INWA 4HEFA 2XROA 1TS7A 1W79A 3UPNA 2P7JA 2Y2MA 4NXBA 4A5RA 3ZG8B 4JKTA 3SS3A 3KSGA 1XFQA 3VP4A 3UY6A 4DKIA 3CMZA 2J80A 3ZG0A 5M1AA 3SOIA 5KMWA 4DE3A 3OOVA 5G4ZA 3NC8A 3E4PA 1ESIA 1GSVA 1FILA 5TR7A 3ITAA 2P9VB 3Q07A 1ERMA 1JWVA 1XPBA 2I72A 4X1MA 3WS5A 2BASA 4OQGA 4G3WA 4X68A 2WGIA 4OLGA 2Y79A 3RH8B 5J4EA 1P97A 3DBAA 1PWCA 1HD8A 3RFBA 2HP5A 2W1TB 2PR6A 1IFQA 3MR0A 5E2FA 2Y91A 4WN5A 4L9FA 3DWZA 4N1HA 4IBRA 4ID4A 4Y3IA 1STZA 4H6JA 3EWKA 4PM5A 4RQ9A 1BLPA 2HJ9C 3DWKA 4ARZB 1UWPX 2WGWA 2PT7A 3CUEA 3HLBA 2ZMFA 4ZJ2A 1BLHA 4HJ6A 3PAGA 3MZEA 2PD7A 1GCEA 4WEKA 1KDSA 2B02A 2XRNA 3K3DA 2XLNA 4R23A 4ZDXA 1H5XA 1G6AA 5HD5A 3OPHA 2XD5A 4JF6A 3P7NA 2H5SA 2W3EA 3IH9A 2PU2A 1TS6A 2PYPA 2P04A 2J3TC 3DTKA 1ONHA 3UO9A 3T50A 2ZQCA 4QY6A 2HDUA 4GDBA 2IWCA 2QJ5A 2XSSA 4JXGA 2EX9A 1ZHHB 3PBRA 4EQIA 4E3MA 4O8GA 4NXFA 1D06A 1OPXA 1GA0A 5TBMA 3FG8A 4Q0JA 5DJTA 2GDNA 1T1BA 4FSFA 3SH9A 1WYBA 4X56A 3W8KA 4EESA 1V9ZA 1MWSA 4LRYC 4DE0A 2JKGA 2WKHA 2XFTA 4CPKA 4HBUA 1ES3A 4O7DA 5LBRA 2HPBA 3A3EA 3BYDA 2XA7S 1PFLA 3MJQA 1Q2PA 3GQZA 5HZHA 3UDXA 4EUZA 3EQUA 1BLSA 2W1RA 3V50A 3NY4A 1FSWA 4GD8A 1Y28A 4E04A 4JPMA 1O7EA 1VHMA 2O99A 5DVAA 2GNXA 4S2JA 1ACFA 2VGLM 1KVMA 1W63Q 3V67A 1CF0A 2HZ5A 3UB6A 2WGVA 4R0QA 3HUMA 3OCLA 3MKEA 2JKRM 3ZFZA 5EPHA 1PNEA 1L0DA 2EXAA 3C4OA 4NXGA 4GZBA 5IHVA 1NY0A 2O9CA 5M19A 4YOFA 3GV9A 1MPLA 5DTSA 3RJUA 5J7EA 4PM8A 2K7SA 2ZC6B 5KSHA 4WZ5C 2VV7A 4F94A 1JNUA 4BBTA 3ZVWA 4K91A 4LLOB 3KYZA 4EEUA 2WZZA 4EERA 1GSWA 1SHVA 3IF6A 1MY8A 1W8QA 1K57A 3KX0X 4UAAA 2G2WA 4NEED 4P6ZM 3NECA 4H8RA 1TVFA 3S4XA 1Q2QA 2G7UA 4FTXA 4KG6A 1KDWA 5GLCA 3PBQA 1LI9A 5FQQA 3LI8A 2Y2PA 2O9BA 1K6SA 3HVFA 1TS0A 3D3OA 2WKPA 3W4PA 2LB5A 1VEUB 1OJ5A 1TD5A 3FV7A 3QP2A 5EUAA 2R78A 2V2FF 5M18A 3ZCZA 3OPPA 4U0TA 2PAVP 4WEJA 5GHYA 4Y7PA 5F1FA 3FPWA 3MXSA 5JYPA 2H0TA 4IEDA 5FAPA 4X6TA 3EGDC 3G2ZA 3S7PA 2OOLA 3FKVA 4L9GA 3WS4A 2PRFA 4GW9A 1LSXA 2QPNA 2PDRA 2VV8A 4CLCB 4U3TA 4R38A 1ES5A 2HDSA 1V9YA 5EECA 3L7HA 1YSQA 2HJEA 1LI0A 3LIBA 3BM6A 3T1SA 3VSLA 3VP0A 3TRCA 4RA7A 3FZCA 4ME4A 4G3VA 4L9EA 1G5UA 3WS1A 2Y2GA 3QNCA 5C5KA 2W3FA 2EX2A 5HDDA 3QNBA 4DJ2A 3MQOA 1TS8A 4OH0A 1YLPA 5F82A 2IWBA 3OPLA 5AJGA 3MMHA 2WAFA 1YAXA 5E2GA 1YM1A 4EW7A 3JYIA 3P98A 2W0NA 5GHXA 3QHYA 2A2LA 2QYBA 1BUEA 4MN6A 3MF0A 4KQDA 2I9VA 1XJ6A 1DY6A 1NJ4A 4BL2A 4DDYA 5F68A 4XUXA 3ZDJA 3H82A 1YLZA 3HLEA 2PR5A 3MZFA 1MWRA 4GKUA 3W2ZA 3A3FA 3DTIA 4HHDA 1AXBA 5GL9A 3MXQA 3N4IA 1GHMA 2WK0A 4C3QA 5CTMA 3N8SA 3ZG5A 3HREA 4ETZA 5A91A 2WYXA 1G6OA 3M6BA 2HV1A 1NWZA 4IVIA 3NULA 1U60A 4UHUA 3JVVA 2BTFP 3T4QA 1LL8A 3K3CA 4ZJ3A 3JPUA 4X55A 5FASA 5EVID 1FR1A 3S1YA 5TBMB 2OWJA 2J9PA 3BEBA 4PKYG 4WUJA 5CEBA 1K6RA 2OV5A 3CLOA 3BLSA 1LLBA 3LIDA 2L0WA 3O3VA 4NK3A 2W3HA 3T4SA 3Q81A 3DTMA 4JF5A 4S2PA 2FFYA 2ZC7A 5CXWA 3NJAA 3G30A 1LL9A 3S7OA 4YWZA 2WKQA 1FIKA 3LIEA 1ZC2A 1NRJA 1GSXA 3MS6A 2QZ6A 4MNRA 3VFFA 1PI5A 4EXOA 3NOUC 4CLCE 3S22A 1VQQA 4PKYA 4DXCA 3MKFA 3TSGA 3EGXC 3LEZA 5A90A 5CHMA 3V3RA 1H8YA 2Y4AA 2JKRI 4DDSA 4RX2A 4LV0A 4GDNA 4HNBA 1CEFA 5EV0A 4QY5A 1KOUA 3D4FA 4MEZA 2Y8HA 4JF4A 4FCFA 5HD3A 5CEDA 3RXXA 2VZWA 3FWLA 1S66L 4MLLA 4WELA 3F1PA 3LO7A 1D1JA 4KZ5A 1LSVA 3D72A 3BQ8A 1CQAA 1IYPA 5DTTA 4B4XA 1XXMA 2Y2LA 1MWTA 4IUKA 1KVLA 1ZKJA 2EXBA 3LUQA 5FEFA 3IT9A 1K0KA 1WA9A 1EW0A 1M6KA 4CJNA 5FDHA 4EUVA 3EOIA 5DFXA 4PM9A 5U47A 5DKKA 5IS1A 1MZUA 4YNRA 1NYMA 3G4PA 4C75A 3MQQA 1K4FA 3LCEA 4MBHA 4Y2FA 5A93A 4EBPA 3O86A 4HY8A 4QPRA 2O0YA 3DW0A 1ALQA 1PZPA 1LHYA 1PW8A 2JKTM 4M4XA 1LL5A 4LPZA 5HPFA 3UN7A 3VSKA 1H0MA 3TJZC 3IF5A 1MWUA 4XT2B 1EI5A 3QP4A 4MCWA 3T4TA 3NIAA 5L09A 4I3IA 2R9WA 5HFOA 3F1OB 3B3XA 2A49A 1VM1A 5A92A 2DRWA 3E98A 4S2IA 4NXEA 5L07A 3V39A 3O87A 5F6AA 3W4QA 4Y0OA 5FI6A 3ZG9B 3BW6A 1W5DA 2HF6A 3FYZA 3LEQA 1JTDA 3IXDA 1H8MA 1LT0A 4QWOA 4Y17A 3BY8A 3EEHA 1K55C 3CPTA 1VEUA 4E3LA 5FQKA 1K56D 2R9XA 4FOFA 4R4SA 4KUOA 2Z6CA 3GR2A 2JN7A 2HP9A 1YMSA 3ZNTA 1TDGA 2ZM2A 2EFXA 1XKZA 3H9WA 1FR6A 3C5AA 3P09A 1IEMA 2J3WA 5GLAA 2RL3A 3HLDA 1YLTA 5HARA 3CJMA 5EVLA 3LIFA 1F98A 3DAVA 4OLDA 4JXWA 3B33A 4P87A 4HOIA 5A8BA 4C6YA 3T1QB 1PIOA 4WL9A 4WLAA 1OT6A 4DF6A 1SKOB 5AVEA 1ESUA 3KSFA 4HI4A 4B88A 2WKRA 2A24B 4KZ4A 5EVIC 4NKPA 4MN5A 2Q9NA 4UA6A 4EWFA 4UA7A 3ISGA 4GCZA 2A3UA 1Z6FA 1K57C 1XJ3A 1XFNA 1O07A 3WWXA 1ODVA 5HSQA 5HW3A 3ULFA 2H10A 3N7WA 3H82B 3ZVTA 1WE4A 1OMEA 3OLOA 4ETXA 4WZ5A 2D01A 4MMNA 5GHZA 1FCNA 1T1AA 5G18A 2FH5A 4OOLA 5E2HA 2XR0A 3QP1A 2H0YA 2QHKA 4WMCA 3BFEA 3VV4A 3M2JA 5DTKA 2Z6DA 3BJNA 3IS2B 4BMWA 4LENA 2PHYA 5FAOA 1Y4OA 1GA9A 2EX6A 3Q1FA 1FOFA 1RGZA 1H8ZA 2J3TD 1MC0A 2ZC4B 2XK1A 2ZL1A 1HVBA 4GS9A 3V5MA 4JBFA 4OP5A 2Z2LB 3N8RA 4QD4A 3BY9A 1IYSA 2ZC3B 4EETB 2V0UA 1YLJA 3LR5A 1XA1A 2VX8A 4PM7A 2HGVA 3PAEA 4KZAA 2X01A 4F3LA 2MJ6A 4DJ3A 3F1OA 2V1BA 3IXBA 1OJGA 4E6XA 3OC2A 3A3JA 3PYPA 3O88A 2ACGA 4LV1A
chains in the Genus database with same CATH topology
2M7VA 5DKLA 5MC7A 5DJUA 3GECA 3H82A 5G4YA 4HH2A 5J3WA 2PR5A 1OTAA 4F3LB 3W2ZA 4HHDA 2H28A 3MXQA 3H7WB 3R7WB 4I3JA 3T4JA 3T4LA 4ETZA 1XJ2A 2W1TA 2INWA 1G6OA 2XROA 1TS7A 2HV1A 1NWZA 4JGOA 2P7JA 3LYXA 3F1NA 4UQIM 2EWWA 3IBRA 3JVVA 4NXBA 4HP4A 4O0PA 1NLZA 1DP8A 3T4QA 2JHEA 1LL8A 1OTIA 3E4QA 3K3CA 1XJ4A 3KSGA 3UB7A 1XFQA 5HPIA 5TBMB 2OWJA 4XT2A 4PKYG 2J80A 3PHYA 4WUJA 3G6OA 3OOVA 5G4ZA 5IU1A 3H7WA 3E4PA 3A0RA 1GSVA 1T18A 1S67L 2V1AA 4HP9A 3RTYA 3CLOA 4B9OA 2VKSA 2BASA 2KOIA 3LIDA 4G3WA 4IHQA 2NUPC 2L0WA 2Y79A 3E4OA 3RH8B 2W3DA 4BBVA 5J4EA 3LR3A 1P97A 3DBAA 2W3HA 3T4SA 4R70A 3RFBA 2W1TB 2PR6A 1UGUA 1IFQA 3MR0A 3NJAA 4HQAA 1OTDA 3S7OA 4WN5A 3ICYA 4L9FA 1S4SA 2WKQA 4YWZA 4Y3IA 3LIEA 5F5YA 2JKTI 3CWFA 4Z1WA 1STZA 3K2NA 5HDCA 4H6JA 1NRJA 1GSXA 3EWKA 4CQHA 4B93A 1H3QA 4RQ9A 4BJPA 4GHIA 2HJ9C 5I5LA 2PYRA 4ARZB 1UWPX 5TJJA 2IA2A 2PT7A 3CUEA 3NOUC 4EXOA 4CLCE 5IT5A 2ZMFA 4PKYA 2K31A 1D7EA 4HJ6A 2PD7A 1F9IA 3UB9A 4LRZE 4I5SA 3EGXC 4WEKA 1OTBA 2B02A 2XRNA 3K3DA 4I38A 2JKRI 3CI6A 3UE3A 1NLYA 5FL3A 1YSPA 3IS2A 2NUTC 3VE4A 4HNBA 2FZ0A 5HD5A 3P7NA 1IOUA 1KOUA 1N9NA 2Y8HA 2W3EA 5HD3A 2KLIA 2PYPA 1TS6A 2P04A 2J3TC 4EQ1A 3IBJA 2A24A 2VZWA 1S66L 4WELA 3F1PA 2ZBBA 4BBUA 2GZAA 1LSVA 3D72A 3BQ8A 3T50A 5AVFA 4Y5FA 4BWIA 2M1CA 2QJ5A 2XSSA 3PBNA 3BQAA 4IUKA 1ZHHB 3PBRA 3LUQA 4O8GA 1WA9A 1EW0A 4NXFA 1D06A 1OPXA 3TW8A 5TBMA 3FG8A 4Q0JA 5DJTA 3ZYTA 4EUVA 3EOIA 1T1BA 5DFXA 4FSFA 2VEAA 4EESA 4HH3A 1V9ZA 3MFXA 2L1MA 4Q0IA 4LRYC 5DKKA 4HJ3A 1DP6A 5IS1A 4OOMA 1MZUA 4IUHA 5LBRA 5HL6A 4YNRA 4MN7A 2XA7S 3MQQA 3MJQA 4KUKA 1P0ZA 4HJ4A 5HZHA 4K08A 4Y2FA 5DF9A 2EWVA 3EQUA 4HY8A 4QPRA 2O0YA 5HDSA 2W1RA 2JKTM 1T1CA 3C30A 4M4XA 3LICA 4AFIA 1LSWA 3F1PB 1Y28A 4E04A 2W3GA 3U2AA 5HWWA 4LPZA 5HPFA 2VGLS 4G3KA 3JVUA 2L4RA 3HJKA 3PBTA 1VHMA 2O99A 1G28A 5F69A 2GNXA 3HJIA 3MQ0A 3TJZC 2VGLM 4WF0A 4XT2B 3F1NB 4JGRA 3KSHA 4MCWA 3T4TA 2GJ3A 4UEYA 4I3IA 4GJ4A 1W63Q 3F1OB 3V67A 2D02A 2P08A 3UB6A 5EFWA 1S4RA 4JGPA 3OCLA 2JKRM 2V9AA 4R6LA 3E98A 1VB6A 3KYQA 3LR0A 4NXEA 2KX6A 4NXGA 5F6AA 2EA9A 2O9CA 3BW6A 4II7A 3GDIA 2HF6A 3CITA 4YOFA 4R3AA 1H8MA 1LT0A 5HWVA 2CMNA 5J7EA 3BY8A 2DMWA 3UB8A 3EEHA 2LB9A 2K7SA 5KSHA 5K5BA 2ZOHA 2VV7A 4PAUA 3C38A 2OAQ1 1JNUA 4H6JB 4BBTA 4FOFA 4KUOA 2Z6CA 2JN7A 1P9WA 4LLOB 3KYZA 4EEUA 3ZQ5A 4MDZA 4EERA 1GSWA 4ARZA 3LIAA 3H9WA 3KX0X 1S1ZA 4NEED 1OT9A 4P6ZM 3CUEC 2J3WA 4GHIB 1TF1A 2G7UA 3R7WA 3LR4A 3PBQA 3LIFA 1F98A 5HWTA 5DFYA 1W63M 3LI8A 3UE6A 2VV6A 3HCYA 3KSIA 4L0LA 2K2NA 3PBSA 2O9BA 1N9OA 3B33A 1TS0A 3D3OA 2WKPA 3EEAA 1DRMA 2LB5A 4HOIA 1OJ5A 1TD5A 4EEPA 3EQVA 5A8BA 1OTEA 2R78A 4WL9A 4WLAA 4I39A 1OT6A 4KQOA 2ZOIA 5AVEA 3KSFA 2QWSA 4HI4A 3S7QA 2WKRA 4WEJA 2A24B 3FPWA 4NKPA 4JGQA 4MN5A 1ZTUA 1P9RA 4ZRRA 3EGDC 1F5MA 2VA0A 3B42A 4GCZA 3S7PA 2OOLA 1T19A 2YKHA 4L9GA 1XJ3A 5KIZA 1XFNA 3NOTC 1ODVA 4GW9A 5HSQA 3ULFA 1LSXA 2PDRA 2VV8A 4P6ZS 4CLCB 3H82B 3UMEA 4O01A 4R38A 3O5YA 4GS9B 3OLOA 4ETXA 2D01A 2PD8A 5L8MA 3NHQA 3LFVA 3NOPC 3E0YA 5CX7A 4PHTA 2OAP1 4MMNA 1V9YA 3A0SA 1T1AA 3KO6A 2FH5A 4OOLA 1YSQA 4LRXC 2HJEA 2M7UA 1S1YA 2QHKA 3CAXA 3TE8A 3LIBA 3UMDA 3VV4A 1UWNX 3BWLA 2KDKA 4CLCA 2VLGA 3TRCA 3PR6A 4I3AA 3OCNA 2Z6DA 3BJNA 3IS2B 4HIAA 4ME4A 1X0OA 3P01A 4G3VA 4BMWA 2PHYA 2GX5A 4L9EA 3PXPA 3B47A 4UQIS 4Q0HA 5C5KA 2W3FA 2YKFA 3T4KA 2QKPA 5HDDA 4DN0A 2J3TD 4DJ2A 3C2WA 3MQOA 2B18A 1MC0A 2W27A 1TS8A 4DMZA 2O9AA 4GS9A 1BYWA 3FPVA 2V0WA 5AJGA 3MMHA 1DP9A 1N9LA 4IJGA 3BY9A 1YAXA 3VE3A 4EETB 2V0UA 3LR5A 3FC7A 2VX8A 2HGVA 2XA7M 3PBOA 2ZMVA 4EW7A 3SW1A 1MKMA 4CLCD 2W0NA 4CLCC 2A2LA 4F3LA 2QYBA 2MJ6A 4MN6A 3A0VA 4DJ3A 3MF0A 4KQDA 3T4OA 3F1OA 3LI9A 3OBFA 2V1BA 4GLQA 3C8CA 3R4KA 2I9VA 4EU0A 1XJ6A 1OJGA 3S7NA 2QJ7A 1YKDA 2OWHA 3OC2A 3PYPA 2VJWA 3VOLA 5F68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGQ A;  4MN5 A;  1G28 A;  4PKY A;  5DKL A;  5F69 A;  3HJI A;  1D7E A;  4HJ6 A;  5DJU A;  3GEC A;  3H82 A;  4WF0 A;  5G4Y A;  2PD7 A;  4HH2 A;  4XT2 B;  3F1N B;  1F9I A;  2PR5 A;  4GCZ A;  2OOL A;  1OTA A;  4JGR A;  1T19 A;  5J3W A;  4LRZ E;  4I5S A;  3UB9 A;  2YKH A;  4L9G A;  4F3L B;  2GJ3 A;  4I3I A;  1XJ3 A;  1OTB A;  2B02 A;  4HHD A;  3F1O B;  5KIZ A;  1XFN A;  2H28 A;  3NOT C;  2D02 A;  1ODV A;  3K3D A;  3MXQ A;  4GW9 A;  4I38 A;  3UB6 A;  5HSQ A;  5J7E A;  5EFW A;  3H7W B;  1LSX A;  1S4R A;  3ULF A;  4JGP A;  4I3J A;  2PDR A;  2V9A A;  2VV8 A;  4R6L A;  3H82 B;  1VB6 A;  3UME A;  3IS2 A;  4R38 A;  4NXE A;  1XJ2 A;  3VE4 A;  2INW A;  2KX6 A;  4HNB A;  4GS9 B;  3OLO A;  4NXG A;  5HD5 A;  1TS7 A;  2HV1 A;  2EA9 A;  1NWZ A;  2D01 A;  2PD8 A;  5F6A A;  3P7N A;  3NHQ A;  3NOP C;  1KOU A;  4JGO A;  2P7J A;  3LYX A;  1N9N A;  3F1N A;  3GDI A;  1V9Y A;  3A0S A;  3IBR A;  4NXB A;  4HP4 A;  1T1A A;  5HD3 A;  1DP8 A;  1TS6 A;  2PYP A;  4LRX C;  4R3A A;  2JHE A;  4EQ1 A;  1LL8 A;  1LT0 A;  1OTI A;  1S1Y A;  2A24 A;  2CMN A;  2QHK A;  3CAX A;  3E4Q A;  1S66 L;  3BY8 A;  3K3C A;  3F1P A;  1XJ4 A;  3LIB A;  2ZBB A;  3UMD A;  3UB8 A;  3EEH A;  1XFQ A;  3UB7 A;  1UWN X;  3BWL A;  1LSV A;  3D72 A;  2KDK A;  4BBU A;  3T50 A;  2K7S A;  5AVF A;  5TBM B;  2OWJ A;  2VLG A;  4XT2 A;  4PKY G;  3ZQ5 A;  4I3A A;  2M1C A;  2Z6D A;  2ZOH A;  3IS2 B;  4HIA A;  1X0O A;  2J80 A;  2VV7 A;  2QJ5 A;  2PHY A;  3PHY A;  4L9E A;  4WUJ A;  1JNU A;  4H6J B;  4BBT A;  3G6O A;  5G4Z A;  5IU1 A;  3LUQ A;  4KUO A;  2Z6C A;  3H7W A;  3E4P A;  2YKF A;  3A0R A;  2JN7 A;  4LLO B;  1WA9 A;  1EW0 A;  2QKP A;  1D06 A;  1GSV A;  4NXF A;  5HDD A;  4DJ2 A;  5TBM A;  3FG8 A;  3C2W A;  3MQO A;  1T18 A;  1S67 L;  2V1A A;  2W27 A;  4HP9 A;  1TS8 A;  1GSW A;  5DJT A;  3RTY A;  4EER A;  1T1B A;  3LIA A;  4GS9 A;  3CLO A;  4B9O A;  3H9W A;  3KX0 X;  1S1Z A;  2VEA A;  1BYW A;  4EES A;  4HH3 A;  1OT9 A;  1V9Z A;  2L1M A;  2V0W A;  3MFX A;  2BAS A;  4EEU A;  4LRY C;  5DKK A;  3LID A;  4GHI B;  2L0W A;  3RH8 B;  1DP9 A;  3E4O A;  4HJ3 A;  4BBV A;  5J4E A;  1DP6 A;  5IS1 A;  1N9L A;  3LIF A;  1P97 A;  3BY9 A;  1F98 A;  1MZU A;  5HWT A;  3VE3 A;  4EET B;  3LI8 A;  2V0U A;  3UE6 A;  2VV6 A;  3FC7 A;  3MQQ A;  4R70 A;  3MJQ A;  4KUK A;  1P0Z A;  1N9O A;  1UGU A;  2PR6 A;  3MR0 A;  3NJA A;  4HJ4 A;  3B33 A;  4HQA A;  5HZH A;  1OTD A;  4WN5 A;  3ICY A;  4L9F A;  4K08 A;  4EW7 A;  1S4S A;  1TS0 A;  2WKQ A;  4YWZ A;  2WKP A;  3SW1 A;  1DRM A;  2W0N A;  3LIE A;  4HOI A;  4HY8 A;  3CWF A;  5F5Y A;  4F3L A;  1OJ5 A;  5HDS A;  4EEP A;  4MN6 A;  5HWV A;  3A0V A;  4DJ3 A;  5HDC A;  4H6J A;  4KQD A;  1GSX A;  1OTE A;  3EWK A;  5A8B A;  3F1O A;  1T1C A;  2R78 A;  3LI9 A;  4WL9 A;  2V1B A;  4WLA A;  4M4X A;  3C8C A;  3LIC A;  1OT6 A;  1LSW A;  2I9V A;  3F1P B;  4I39 A;  4RQ9 A;  4GHI A;  1XJ6 A;  1Y28 A;  5I5L A;  4E04 A;  1OJG A;  2ZOI A;  5HWW A;  2PYR A;  2QJ7 A;  5AVE A;  4LPZ A;  2OWH A;  2QWS A;  4HI4 A;  1UWP X;  3PYP A;  4EXO A;  2WKR A;  2L4R A;  3HJK A;  3NOU C;  3VOL A;  2A24 B;  5F68 A; 
#chains in the Genus database with same CATH topology
 2Y59 A;  2HDR A;  1MKI A;  2P9V A;  5J3W A;  2FFF B;  3E2L A;  4KG5 A;  1YLY A;  4HBT A;  2XDM A;  1E3U A;  5I94 A;  4I3J A;  4KEN B;  3T4J A;  2ZQ9 A;  1MXO A;  2W1T A;  1K25 A;  1SDE A;  5L10 A;  1QME A;  1SCW A;  3LYX A;  3F1N A;  4UQI M;  2EWW A;  3IBR A;  1HTZ A;  4O0P A;  1NLZ A;  1DP8 A;  4EBL A;  1Y54 A;  4Y13 A;  1OTI A;  1ERO A;  3E4Q A;  3VP2 A;  1XJ4 A;  3UPP A;  3UB7 A;  3IWI A;  5HAI A;  5HPI A;  1PI4 A;  1J3W A;  1MBL A;  1NZU A;  2WKI A;  4E3O A;  3CHW P;  5IU1 A;  3A0R A;  3UE1 A;  3VFH A;  1K38 A;  2V1A A;  1S67 L;  4HP9 A;  3RTY A;  3GRJ A;  3IX8 A;  2XGN A;  4B9O A;  4ZAM A;  3VOZ A;  2Y2K A;  2NUP C;  3C7V A;  3E4O A;  2W3D A;  3DTE A;  4IVK A;  5GLD A;  4R70 A;  4KQQ A;  3Q7V A;  1IKG A;  1S4S A;  5HAQ A;  4NG2 A;  5F5Y A;  2JKT I;  4Z1W A;  3K2N A;  4LGW A;  5J8X A;  2C6W B;  4B93 A;  2ZM0 A;  1IYO A;  4GHI A;  4R3J A;  5I5L A;  3AGD A;  4BQM A;  2PYR A;  2JBF A;  3SZT A;  4IBX A;  3NI9 A;  4JXS A;  2CC1 A;  2ZC5 B;  5IT5 A;  4PMA A;  3MZD A;  5FQ9 A;  2K31 A;  3IWO A;  1D7E A;  1F9I A;  3UB9 A;  4LRZ E;  4I5S A;  3CI6 A;  3SS5 A;  4N1X A;  1M40 A;  1FCO A;  1YSP A;  3IS2 A;  3VE4 A;  3IXH A;  2FZ0 A;  4RVA A;  1N9N A;  4K0W A;  3UDI A;  3IBJ A;  4KZ7 A;  3TG9 A;  2GZA A;  5AVF A;  4Y5F A;  4BD1 A;  1I5Q A;  3UE0 A;  4WBG A;  3U4L P;  3BQA A;  4X53 A;  3HLF A;  3IHA A;  1IEL A;  5CHJ A;  3Q7Z A;  4E6W A;  1BUL A;  2VEA A;  4QB8 A;  3MFX A;  4Q0I A;  4P85 A;  4OPY A;  3VOY A;  5CGW A;  4HJ3 A;  2ZJ9 A;  4LCM A;  4D2O A;  1PYY A;  4KUK A;  4S2O A;  2JCH A;  1KE4 A;  2ZQA A;  2EWV A;  5HDS A;  3HLC A;  3NCK A;  3LIC A;  4AFI A;  1LSW A;  2BG1 A;  2W3G A;  2ZQ7 A;  3HUO A;  3U2A A;  5HWW A;  3WS0 A;  2VGL S;  3W4O A;  4G3K A;  3IHB A;  3JVU A;  3HJK A;  2G2U A;  3E2K A;  3MQ0 A;  2XEP A;  3F1N B;  3IF6 B;  1ZG4 A;  4JGR A;  5D3O A;  1I2W A;  1FCM A;  4GJ4 A;  4KQR A;  4BD0 A;  2D02 A;  3G31 A;  4RYE A;  5FSR A;  4JGP A;  2V9A A;  4R6L A;  2BLS A;  1VB6 A;  3KYQ A;  5JYO A;  4YIN A;  4E3N A;  3HBR A;  3HLW A;  1EWZ A;  2KX6 A;  1BZA A;  2EA9 A;  3IQA A;  4OVD A;  2Z2M B;  4II7 A;  4HES A;  3GSG A;  4ESP A;  5HWV A;  4E3K A;  2DMW A;  4OPZ A;  2EFU A;  3SH7 A;  2HDQ A;  3BFG A;  4OPQ A;  2ZL1 B;  4PAU A;  5EM1 A;  2J8Y A;  2OAQ 1;  4H6J B;  2UV0 E;  3Q7V B;  2XF3 A;  5CGS A;  5AQB A;  3ZQ5 A;  5EOO A;  4ARZ A;  4OON A;  3LIA A;  4X1L A;  1S1Z A;  3MBZ A;  3ITB A;  1L3L A;  3CUE C;  3BFC A;  4GHI B;  1K55 A;  3R7W A;  2E8J A;  3QP8 A;  4Y15 A;  1JWP A;  1W63 M;  3UE6 A;  4LV3 A;  3HCY A;  4L0L A;  2K2N A;  3PBS A;  5EVE A;  1ZG6 A;  3M2K A;  3EEA A;  1XGI A;  2JC7 A;  1I2S A;  4EEP A;  1OTE A;  2OSU A;  3S7Q A;  1FQG A;  3BFD A;  4KG2 A;  2DCF A;  2XQZ A;  1RCJ A;  1ZTU A;  2X02 A;  5FAT A;  1P9R A;  2PBD P;  4ZRR A;  1T19 A;  2YKH A;  5AQA A;  1S0W A;  5KIZ A;  3NDG A;  3NOT C;  5FI2 A;  4XUZ A;  1E3U D;  2EX8 A;  1TEM A;  3UME A;  4O01 A;  2Y2Q A;  1PZO A;  4GS9 B;  4S2K A;  1C3B A;  2PD8 A;  4OP8 A;  4S2N C;  3SH8 A;  3NOP C;  4PHT A;  3A3I A;  1NZO A;  3V3S A;  1VET A;  2RCX A;  4LRX C;  1S1Y A;  1G68 A;  3CAX A;  2WKE A;  2E8I A;  3WRZ A;  2C5W B;  4JXV A;  3UMD A;  4LV2 A;  1UWN X;  3BWL A;  1DJC A;  4CLC A;  4S2N A;  3PTE A;  3D9Y A;  4I3A A;  3OCN A;  3P01 A;  2GX5 A;  3PXP A;  3B47 A;  3G32 A;  2XFS A;  3T4K A;  2YKF A;  4DE2 A;  4DMZ A;  2O9A A;  1BYW A;  3FPV A;  4BEN A;  1DP9 A;  1N9L A;  4E3J A;  1F2K A;  5E43 A;  2XA7 M;  3PBO A;  3QP5 A;  5EVI B;  4CLC D;  4OQ0 A;  4CLC C;  4OOY A;  4D60 A;  3A0V A;  3T4O A;  4FD8 A;  5HL1 A;  2IWD A;  4GLQ A;  3C8C A;  4EU0 A;  2ZMA A;  2JE5 A;  3UB5 P;  1YKD A;  2OWH A;  3SS4 A;  4MBF A;  2VJW A;  1ES4 A;  1FSY A;  3CG5 A;  4LCL A;  5DKL A;  2M7V A;  4QHC A;  5MC7 A;  5DJU A;  5G4Y A;  1OTA A;  2H28 A;  3ZHH A;  4Q8I A;  3BFF A;  3VP3 A;  3R7W B;  1CK3 A;  4X25 A;  1W7F A;  3BEC A;  4KZ9 A;  4R4R A;  4NET A;  1JWZ A;  4N9K A;  5AQ9 A;  1HLU P;  1KGG A;  1YPR A;  4JGO A;  4KZ6 A;  1ES2 A;  4HP4 A;  5CER A;  1BT5 A;  4OQH A;  2JHE A;  4JLF A;  4FH2 A;  5FI7 A;  2VGJ A;  2VK3 A;  4XT2 A;  5EM0 A;  1SDN A;  3PHY A;  3IH8 A;  3G6O A;  3H7W A;  1E4D A;  1L0E A;  1JTG A;  3ZGA B;  4QJG A;  1T18 A;  2VKS A;  3UNW A;  3T1R A;  2XD1 A;  3NBL A;  2KOI A;  4IHQ A;  3M6H A;  4BBV A;  2ZM8 A;  3LR3 A;  1WYC A;  2ZD8 A;  3BLM A;  3IXG A;  1UGU A;  4HQA A;  4GD6 A;  1OTD A;  3ICY A;  3AGE A;  1BLC A;  4XXR A;  1JVJ A;  3CWF A;  1KGE A;  5HDC A;  4WYY A;  1Z09 A;  4CQH A;  2WAD A;  2Y2H A;  3VMA A;  5KZH A;  1H3Q A;  4N9L A;  3AGF A;  4BJP A;  5TJJ A;  2IA2 A;  3BRM A;  1CJF A;  5KSC A;  1ONG A;  4DRT A;  1YLW A;  3IF6 C;  3GMW A;  1OTB A;  1KE3 A;  4R3B A;  1XA7 A;  4KZB A;  1BSG A;  4ZBE A;  4I38 A;  1L0G A;  3UE3 A;  2QMI A;  1NXY A;  1NLY A;  5FL3 A;  2NUT C;  5EVI A;  5L2F A;  1IOU A;  3IWQ A;  2DNS A;  5F83 A;  1GHI A;  2UWX A;  2KLI A;  5FAQ A;  4EQ1 A;  2A24 A;  3UPO A;  2ZBB A;  4BBU A;  2PBY A;  3MXR A;  4BWI A;  2M1C A;  2V1Z A;  3PBN A;  1IYQ A;  1KE0 A;  2VGK A;  1XGJ A;  1L0F A;  1XX2 A;  3LY3 A;  5HAP A;  4QU3 A;  3TW8 A;  2ZLY A;  4RX3 A;  3ZYT A;  1E25 A;  2J7V A;  3LGO A;  4HH3 A;  2L1M A;  1KGF A;  1SKF A;  1DP6 A;  1DJB A;  4OOM A;  1N4O A;  4IUH A;  5HL6 A;  4MN7 A;  1P0Z A;  4M3K A;  4HJ4 A;  4K08 A;  5DF9 A;  1CI8 A;  4U0X A;  1RGY A;  2WUQ A;  4WMC D;  4FUW A;  1T1C A;  4X69 A;  5CRF A;  1DJA A;  3ZG7 B;  3C30 A;  1K54 C;  3CPT B;  3F1P B;  2Y2J A;  3IX3 A;  3CZD A;  5CHU A;  4MBK A;  5EE8 A;  4E3I A;  2L4R A;  3HL9 A;  3PBT A;  1G28 A;  5F69 A;  3HJI A;  4WF0 A;  4EV4 A;  1J9M A;  3KSH A;  1XP4 A;  2GJ3 A;  4UEY A;  4KZ8 A;  2P08 A;  3G34 A;  5F1G A;  5EFW A;  1S4R A;  1K4E A;  2X71 A;  1NRF A;  4BLM A;  4OQI A;  3LR0 A;  3G35 A;  1TDL A;  2Y55 A;  3GVB A;  1L2S A;  3T12 B;  3OPR A;  4LFU A;  3GDI A;  3CIT A;  5DF8 A;  5TFQ A;  4WZ4 A;  4BL3 A;  4R3A A;  2CMN A;  1HZO A;  5E2E A;  3UB8 A;  2LB9 A;  1SKO A;  5K5B A;  2V8C A;  2ZOH A;  3C38 A;  1RP5 A;  4DE1 A;  1VET B;  3WRT A;  3NDE A;  3TOI A;  1P9W A;  4P6B A;  4MDZ A;  2WAE A;  4GOG A;  3I7J A;  1AWI A;  1OT9 A;  4Y0U A;  1W8Y A;  1TF1 A;  4Y0T A;  3LR4 A;  4KZ3 A;  5HWT A;  4OPR A;  5DFY A;  4WM9 A;  2VV6 A;  3MSH A;  3KSI A;  4EBN A;  4YFM A;  1N9O A;  1DRM A;  5AQ7 A;  5FDS A;  2AVX A;  2Y2I A;  4FH4 A;  3EQV A;  2Q0O A;  3ZNY A;  3Q82 A;  3N6I A;  4OKP A;  4I39 A;  2OLU A;  4KQO A;  2ZOI A;  2QWS A;  1CEG A;  4PM6 A;  4JGQ A;  4PPR A;  3C4P A;  1F5M A;  2VA0 A;  2V20 A;  3B42 A;  3C7U A;  2J9O A;  4ZTK A;  1CI9 A;  1N9B A;  1SZV A;  4N92 A;  2WZX A;  4GNU A;  2P74 A;  4P6Z S;  2WGW B;  2ZQD A;  2B95 A;  3O5Y A;  1YMX A;  4ZJ1 A;  5L8M A;  2Y2N A;  3NHQ A;  3LFV A;  3E0Y A;  5CX7 A;  4R1G A;  2OAP 1;  2OLV A;  4P0M A;  1PW1 A;  3A0S A;  3KO6 A;  2V8F A;  1K56 A;  2M7U A;  4B4Z A;  3TE8 A;  1NYY A;  4S2M A;  3UDF A;  2KDK A;  5CEC A;  3LY4 A;  2VLG A;  3PR6 A;  4HIA A;  1X0O A;  3GTC A;  1A0K A;  5FQM A;  4UQI S;  4Q0H A;  2JKF A;  2QKP A;  4DN0 A;  1S6R A;  3C2W A;  3FKW A;  2B18 A;  4Z9Q A;  2W27 A;  1YQS A;  3G2Y A;  2Y2O A;  3A3D A;  3RXW A;  1IKI A;  2HP6 A;  2V0W A;  4GB7 A;  1BTL A;  5FQI A;  4IJG A;  4GN2 A;  3VP1 A;  3VE3 A;  2PU4 A;  3FC7 A;  5GLB A;  1QMF A;  4S2L A;  2ZMV A;  1PRQ A;  2XH9 A;  3QP6 A;  3SW1 A;  5BOH A;  1MKM A;  1GHP A;  4DXB A;  3LI9 A;  3OBF A;  3T1X A;  5DF7 A;  3R4K A;  5FQJ A;  3S7N A;  1PWG A;  1YT4 A;  2QJ7 A;  1ERQ A;  2ZQ8 A;  3VOL A;  4K0X A;  5FA7 A;  2B5R A;  2Q9M A;  3HLG A;  3HUN A;  3L9K A;  3GEC A;  5FEG A;  4HH2 A;  5EOE A;  4UA9 A;  5CGX A;  5TGF A;  4F3L B;  3N8L A;  3KYE A;  3WS2 A;  1PWD A;  5HX9 A;  3H7W B;  5CTN A;  3IX4 A;  1K54 A;  3MFD A;  3T4L A;  3OZH A;  1XJ2 A;  2INW A;  4HEF A;  2XRO A;  1TS7 A;  1W79 A;  3UPN A;  2P7J A;  2Y2M A;  4NXB A;  4A5R A;  3ZG8 B;  4JKT A;  3SS3 A;  3KSG A;  1XFQ A;  3VP4 A;  3UY6 A;  4DKI A;  3CMZ A;  2J80 A;  3ZG0 A;  5M1A A;  3SOI A;  5KMW A;  4DE3 A;  3OOV A;  5G4Z A;  3NC8 A;  3E4P A;  1ESI A;  1GSV A;  1FIL A;  5TR7 A;  3ITA A;  2P9V B;  3Q07 A;  1ERM A;  1JWV A;  1XPB A;  2I72 A;  4X1M A;  3WS5 A;  2BAS A;  4OQG A;  4G3W A;  4X68 A;  2WGI A;  4OLG A;  2Y79 A;  3RH8 B;  5J4E A;  1P97 A;  3DBA A;  1PWC A;  1HD8 A;  3RFB A;  2HP5 A;  2W1T B;  2PR6 A;  1IFQ A;  3MR0 A;  5E2F A;  2Y91 A;  4WN5 A;  4L9F A;  3DWZ A;  4N1H A;  4IBR A;  4ID4 A;  4Y3I A;  1STZ A;  4H6J A;  3EWK A;  4PM5 A;  4RQ9 A;  1BLP A;  2HJ9 C;  3DWK A;  4ARZ B;  1UWP X;  2WGW A;  2PT7 A;  3CUE A;  3HLB A;  2ZMF A;  4ZJ2 A;  1BLH A;  4HJ6 A;  3PAG A;  3MZE A;  2PD7 A;  1GCE A;  4WEK A;  1KDS A;  2B02 A;  2XRN A;  3K3D A;  2XLN A;  4R23 A;  4ZDX A;  1H5X A;  1G6A A;  5HD5 A;  3OPH A;  2XD5 A;  4JF6 A;  3P7N A;  2H5S A;  2W3E A;  3IH9 A;  2PU2 A;  1TS6 A;  2PYP A;  2P04 A;  2J3T C;  3DTK A;  1ONH A;  3UO9 A;  3T50 A;  2ZQC A;  4QY6 A;  2HDU A;  4GDB A;  2IWC A;  2QJ5 A;  2XSS A;  4JXG A;  2EX9 A;  1ZHH B;  3PBR A;  4EQI A;  4E3M A;  4O8G A;  4NXF A;  1D06 A;  1OPX A;  1GA0 A;  5TBM A;  3FG8 A;  4Q0J A;  5DJT A;  2GDN A;  1T1B A;  4FSF A;  3SH9 A;  1WYB A;  4X56 A;  3W8K A;  4EES A;  1V9Z A;  1MWS A;  4LRY C;  4DE0 A;  2JKG A;  2WKH A;  2XFT A;  4CPK A;  4HBU A;  1ES3 A;  4O7D A;  5LBR A;  2HPB A;  3A3E A;  3BYD A;  2XA7 S;  1PFL A;  3MJQ A;  1Q2P A;  3GQZ A;  5HZH A;  3UDX A;  4EUZ A;  3EQU A;  1BLS A;  2W1R A;  3V50 A;  3NY4 A;  1FSW A;  4GD8 A;  1Y28 A;  4E04 A;  4JPM A;  1O7E A;  1VHM A;  2O99 A;  5DVA A;  2GNX A;  4S2J A;  1ACF A;  2VGL M;  1KVM A;  1W63 Q;  3V67 A;  1CF0 A;  2HZ5 A;  3UB6 A;  2WGV A;  4R0Q A;  3HUM A;  3OCL A;  3MKE A;  2JKR M;  3ZFZ A;  5EPH A;  1PNE A;  1L0D A;  2EXA A;  3C4O A;  4NXG A;  4GZB A;  5IHV A;  1NY0 A;  2O9C A;  5M19 A;  4YOF A;  3GV9 A;  1MPL A;  5DTS A;  3RJU A;  5J7E A;  4PM8 A;  2K7S A;  2ZC6 B;  5KSH A;  4WZ5 C;  2VV7 A;  4F94 A;  1JNU A;  4BBT A;  3ZVW A;  4K91 A;  4LLO B;  3KYZ A;  4EEU A;  2WZZ A;  4EER A;  1GSW A;  1SHV A;  3IF6 A;  1MY8 A;  1W8Q A;  1K57 A;  3KX0 X;  4UAA A;  2G2W A;  4NEE D;  4P6Z M;  3NEC A;  4H8R A;  1TVF A;  3S4X A;  1Q2Q A;  2G7U A;  4FTX A;  4KG6 A;  1KDW A;  5GLC A;  3PBQ A;  1LI9 A;  5FQQ A;  3LI8 A;  2Y2P A;  2O9B A;  1K6S A;  3HVF A;  1TS0 A;  3D3O A;  2WKP A;  3W4P A;  2LB5 A;  1VEU B;  1OJ5 A;  1TD5 A;  3FV7 A;  3QP2 A;  5EUA A;  2R78 A;  2V2F F;  5M18 A;  3ZCZ A;  3OPP A;  4U0T A;  2PAV P;  4WEJ A;  5GHY A;  4Y7P A;  5F1F A;  3FPW A;  3MXS A;  5JYP A;  2H0T A;  4IED A;  5FAP A;  4X6T A;  3EGD C;  3G2Z A;  3S7P A;  2OOL A;  3FKV A;  4L9G A;  3WS4 A;  2PRF A;  4GW9 A;  1LSX A;  2QPN A;  2PDR A;  2VV8 A;  4CLC B;  4U3T A;  4R38 A;  1ES5 A;  2HDS A;  1V9Y A;  5EEC A;  3L7H A;  1YSQ A;  2HJE A;  1LI0 A;  3LIB A;  3BM6 A;  3T1S A;  3VSL A;  3VP0 A;  3TRC A;  4RA7 A;  3FZC A;  4ME4 A;  4G3V A;  4L9E A;  1G5U A;  3WS1 A;  2Y2G A;  3QNC A;  5C5K A;  2W3F A;  2EX2 A;  5HDD A;  3QNB A;  4DJ2 A;  3MQO A;  1TS8 A;  4OH0 A;  1YLP A;  5F82 A;  2IWB A;  3OPL A;  5AJG A;  3MMH A;  2WAF A;  1YAX A;  5E2G A;  1YM1 A;  4EW7 A;  3JYI A;  3P98 A;  2W0N A;  5GHX A;  3QHY A;  2A2L A;  2QYB A;  1BUE A;  4MN6 A;  3MF0 A;  4KQD A;  2I9V A;  1XJ6 A;  1DY6 A;  1NJ4 A;  4BL2 A;  4DDY A;  5F68 A;  4XUX A;  3ZDJ A;  3H82 A;  1YLZ A;  3HLE A;  2PR5 A;  3MZF A;  1MWR A;  4GKU A;  3W2Z A;  3A3F A;  3DTI A;  4HHD A;  1AXB A;  5GL9 A;  3MXQ A;  3N4I A;  1GHM A;  2WK0 A;  4C3Q A;  5CTM A;  3N8S A;  3ZG5 A;  3HRE A;  4ETZ A;  5A91 A;  2WYX A;  1G6O A;  3M6B A;  2HV1 A;  1NWZ A;  4IVI A;  3NUL A;  1U60 A;  4UHU A;  3JVV A;  2BTF P;  3T4Q A;  1LL8 A;  3K3C A;  4ZJ3 A;  3JPU A;  4X55 A;  5FAS A;  5EVI D;  1FR1 A;  3S1Y A;  5TBM B;  2OWJ A;  2J9P A;  3BEB A;  4PKY G;  4WUJ A;  5CEB A;  1K6R A;  2OV5 A;  3CLO A;  3BLS A;  1LLB A;  3LID A;  2L0W A;  3O3V A;  4NK3 A;  2W3H A;  3T4S A;  3Q81 A;  3DTM A;  4JF5 A;  4S2P A;  2FFY A;  2ZC7 A;  5CXW A;  3NJA A;  3G30 A;  1LL9 A;  3S7O A;  4YWZ A;  2WKQ A;  1FIK A;  3LIE A;  1ZC2 A;  1NRJ A;  1GSX A;  3MS6 A;  2QZ6 A;  4MNR A;  3VFF A;  1PI5 A;  4EXO A;  3NOU C;  4CLC E;  3S22 A;  1VQQ A;  4PKY A;  4DXC A;  3MKF A;  3TSG A;  3EGX C;  3LEZ A;  5A90 A;  5CHM A;  3V3R A;  1H8Y A;  2Y4A A;  2JKR I;  4DDS A;  4RX2 A;  4LV0 A;  4GDN A;  4HNB A;  1CEF A;  5EV0 A;  4QY5 A;  1KOU A;  3D4F A;  4MEZ A;  2Y8H A;  4JF4 A;  4FCF A;  5HD3 A;  5CED A;  3RXX A;  2VZW A;  3FWL A;  1S66 L;  4MLL A;  4WEL A;  3F1P A;  3LO7 A;  1D1J A;  4KZ5 A;  1LSV A;  3D72 A;  3BQ8 A;  1CQA A;  1IYP A;  5DTT A;  4B4X A;  1XXM A;  2Y2L A;  1MWT A;  4IUK A;  1KVL A;  1ZKJ A;  2EXB A;  3LUQ A;  5FEF A;  3IT9 A;  1K0K A;  1WA9 A;  1EW0 A;  1M6K A;  4CJN A;  5FDH A;  4EUV A;  3EOI A;  5DFX A;  4PM9 A;  5U47 A;  5DKK A;  5IS1 A;  1MZU A;  4YNR A;  1NYM A;  3G4P A;  4C75 A;  3MQQ A;  1K4F A;  3LCE A;  4MBH A;  4Y2F A;  5A93 A;  4EBP A;  3O86 A;  4HY8 A;  4QPR A;  2O0Y A;  3DW0 A;  1ALQ A;  1PZP A;  1LHY A;  1PW8 A;  2JKT M;  4M4X A;  1LL5 A;  4LPZ A;  5HPF A;  3UN7 A;  3VSK A;  1H0M A;  3TJZ C;  3IF5 A;  1MWU A;  4XT2 B;  1EI5 A;  3QP4 A;  4MCW A;  3T4T A;  3NIA A;  5L09 A;  4I3I A;  2R9W A;  5HFO A;  3F1O B;  3B3X A;  2A49 A;  1VM1 A;  5A92 A;  2DRW A;  3E98 A;  4S2I A;  4NXE A;  5L07 A;  3V39 A;  3O87 A;  5F6A A;  3W4Q A;  4Y0O A;  5FI6 A;  3ZG9 B;  3BW6 A;  1W5D A;  2HF6 A;  3FYZ A;  3LEQ A;  1JTD A;  3IXD A;  1H8M A;  1LT0 A;  4QWO A;  4Y17 A;  3BY8 A;  3EEH A;  1K55 C;  3CPT A;  1VEU A;  4E3L A;  5FQK A;  1K56 D;  2R9X A;  4FOF A;  4R4S A;  4KUO A;  2Z6C A;  3GR2 A;  2JN7 A;  2HP9 A;  1YMS A;  3ZNT A;  1TDG A;  2ZM2 A;  2EFX A;  1XKZ A;  3H9W A;  1FR6 A;  3C5A A;  3P09 A;  1IEM A;  2J3W A;  5GLA A;  2RL3 A;  3HLD A;  1YLT A;  5HAR A;  3CJM A;  5EVL A;  3LIF A;  1F98 A;  3DAV A;  4OLD A;  4JXW A;  3B33 A;  4P87 A;  4HOI A;  5A8B A;  4C6Y A;  3T1Q B;  1PIO A;  4WL9 A;  4WLA A;  1OT6 A;  4DF6 A;  1SKO B;  5AVE A;  1ESU A;  3KSF A;  4HI4 A;  4B88 A;  2WKR A;  2A24 B;  4KZ4 A;  5EVI C;  4NKP A;  4MN5 A;  2Q9N A;  4UA6 A;  4EWF A;  4UA7 A;  3ISG A;  4GCZ A;  2A3U A;  1Z6F A;  1K57 C;  1XJ3 A;  1XFN A;  1O07 A;  3WWX A;  1ODV A;  5HSQ A;  5HW3 A;  3ULF A;  2H10 A;  3N7W A;  3H82 B;  3ZVT A;  1WE4 A;  1OME A;  3OLO A;  4ETX A;  4WZ5 A;  2D01 A;  4MMN A;  5GHZ A;  1FCN A;  1T1A A;  5G18 A;  2FH5 A;  4OOL A;  5E2H A;  2XR0 A;  3QP1 A;  2H0Y A;  2QHK A;  4WMC A;  3BFE A;  3VV4 A;  3M2J A;  5DTK A;  2Z6D A;  3BJN A;  3IS2 B;  4BMW A;  4LEN A;  2PHY A;  5FAO A;  1Y4O A;  1GA9 A;  2EX6 A;  3Q1F A;  1FOF A;  1RGZ A;  1H8Z A;  2J3T D;  1MC0 A;  2ZC4 B;  2XK1 A;  2ZL1 A;  1HVB A;  4GS9 A;  3V5M A;  4JBF A;  4OP5 A;  2Z2L B;  3N8R A;  4QD4 A;  3BY9 A;  1IYS A;  2ZC3 B;  4EET B;  2V0U A;  1YLJ A;  3LR5 A;  1XA1 A;  2VX8 A;  4PM7 A;  2HGV A;  3PAE A;  4KZA A;  2X01 A;  4F3L A;  2MJ6 A;  4DJ3 A;  3F1O A;  2V1B A;  3IXB A;  1OJG A;  4E6X A;  3OC2 A;  3A3J A;  3PYP A;  3O88 A;  2ACG A;  4LV1 A; 
#chains in the Genus database with same CATH homology
 2M7V A;  5DKL A;  5MC7 A;  5DJU A;  3GEC A;  3H82 A;  5G4Y A;  4HH2 A;  5J3W A;  2PR5 A;  1OTA A;  4F3L B;  3W2Z A;  4HHD A;  2H28 A;  3MXQ A;  3H7W B;  3R7W B;  4I3J A;  3T4J A;  3T4L A;  4ETZ A;  1XJ2 A;  2W1T A;  2INW A;  1G6O A;  2XRO A;  1TS7 A;  2HV1 A;  1NWZ A;  4JGO A;  2P7J A;  3LYX A;  3F1N A;  4UQI M;  2EWW A;  3IBR A;  3JVV A;  4NXB A;  4HP4 A;  4O0P A;  1NLZ A;  1DP8 A;  3T4Q A;  2JHE A;  1LL8 A;  1OTI A;  3E4Q A;  3K3C A;  1XJ4 A;  3KSG A;  3UB7 A;  1XFQ A;  5HPI A;  5TBM B;  2OWJ A;  4XT2 A;  4PKY G;  2J80 A;  3PHY A;  4WUJ A;  3G6O A;  3OOV A;  5G4Z A;  5IU1 A;  3H7W A;  3E4P A;  3A0R A;  1GSV A;  1T18 A;  1S67 L;  2V1A A;  4HP9 A;  3RTY A;  3CLO A;  4B9O A;  2VKS A;  2BAS A;  2KOI A;  3LID A;  4G3W A;  4IHQ A;  2NUP C;  2L0W A;  2Y79 A;  3E4O A;  3RH8 B;  2W3D A;  4BBV A;  5J4E A;  3LR3 A;  1P97 A;  3DBA A;  2W3H A;  3T4S A;  4R70 A;  3RFB A;  2W1T B;  2PR6 A;  1UGU A;  1IFQ A;  3MR0 A;  3NJA A;  4HQA A;  1OTD A;  3S7O A;  4WN5 A;  3ICY A;  4L9F A;  1S4S A;  2WKQ A;  4YWZ A;  4Y3I A;  3LIE A;  5F5Y A;  2JKT I;  3CWF A;  4Z1W A;  1STZ A;  3K2N A;  5HDC A;  4H6J A;  1NRJ A;  1GSX A;  3EWK A;  4CQH A;  4B93 A;  1H3Q A;  4RQ9 A;  4BJP A;  4GHI A;  2HJ9 C;  5I5L A;  2PYR A;  4ARZ B;  1UWP X;  5TJJ A;  2IA2 A;  2PT7 A;  3CUE A;  3NOU C;  4EXO A;  4CLC E;  5IT5 A;  2ZMF A;  4PKY A;  2K31 A;  1D7E A;  4HJ6 A;  2PD7 A;  1F9I A;  3UB9 A;  4LRZ E;  4I5S A;  3EGX C;  4WEK A;  1OTB A;  2B02 A;  2XRN A;  3K3D A;  4I38 A;  2JKR I;  3CI6 A;  3UE3 A;  1NLY A;  5FL3 A;  1YSP A;  3IS2 A;  2NUT C;  3VE4 A;  4HNB A;  2FZ0 A;  5HD5 A;  3P7N A;  1IOU A;  1KOU A;  1N9N A;  2Y8H A;  2W3E A;  5HD3 A;  2KLI A;  2PYP A;  1TS6 A;  2P04 A;  2J3T C;  4EQ1 A;  3IBJ A;  2A24 A;  2VZW A;  1S66 L;  4WEL A;  3F1P A;  2ZBB A;  4BBU A;  2GZA A;  1LSV A;  3D72 A;  3BQ8 A;  3T50 A;  5AVF A;  4Y5F A;  4BWI A;  2M1C A;  2QJ5 A;  2XSS A;  3PBN A;  3BQA A;  4IUK A;  1ZHH B;  3PBR A;  3LUQ A;  4O8G A;  1WA9 A;  1EW0 A;  4NXF A;  1D06 A;  1OPX A;  3TW8 A;  5TBM A;  3FG8 A;  4Q0J A;  5DJT A;  3ZYT A;  4EUV A;  3EOI A;  1T1B A;  5DFX A;  4FSF A;  2VEA A;  4EES A;  4HH3 A;  1V9Z A;  3MFX A;  2L1M A;  4Q0I A;  4LRY C;  5DKK A;  4HJ3 A;  1DP6 A;  5IS1 A;  4OOM A;  1MZU A;  4IUH A;  5LBR A;  5HL6 A;  4YNR A;  4MN7 A;  2XA7 S;  3MQQ A;  3MJQ A;  4KUK A;  1P0Z A;  4HJ4 A;  5HZH A;  4K08 A;  4Y2F A;  5DF9 A;  2EWV A;  3EQU A;  4HY8 A;  4QPR A;  2O0Y A;  5HDS A;  2W1R A;  2JKT M;  1T1C A;  3C30 A;  4M4X A;  3LIC A;  4AFI A;  1LSW A;  3F1P B;  1Y28 A;  4E04 A;  2W3G A;  3U2A A;  5HWW A;  4LPZ A;  5HPF A;  2VGL S;  4G3K A;  3JVU A;  2L4R A;  3HJK A;  3PBT A;  1VHM A;  2O99 A;  1G28 A;  5F69 A;  2GNX A;  3HJI A;  3MQ0 A;  3TJZ C;  2VGL M;  4WF0 A;  4XT2 B;  3F1N B;  4JGR A;  3KSH A;  4MCW A;  3T4T A;  2GJ3 A;  4UEY A;  4I3I A;  4GJ4 A;  1W63 Q;  3F1O B;  3V67 A;  2D02 A;  2P08 A;  3UB6 A;  5EFW A;  1S4R A;  4JGP A;  3OCL A;  2JKR M;  2V9A A;  4R6L A;  3E98 A;  1VB6 A;  3KYQ A;  3LR0 A;  4NXE A;  2KX6 A;  4NXG A;  5F6A A;  2EA9 A;  2O9C A;  3BW6 A;  4II7 A;  3GDI A;  2HF6 A;  3CIT A;  4YOF A;  4R3A A;  1H8M A;  1LT0 A;  5HWV A;  2CMN A;  5J7E A;  3BY8 A;  2DMW A;  3UB8 A;  3EEH A;  2LB9 A;  2K7S A;  5KSH A;  5K5B A;  2ZOH A;  2VV7 A;  4PAU A;  3C38 A;  2OAQ 1;  1JNU A;  4H6J B;  4BBT A;  4FOF A;  4KUO A;  2Z6C A;  2JN7 A;  1P9W A;  4LLO B;  3KYZ A;  4EEU A;  3ZQ5 A;  4MDZ A;  4EER A;  1GSW A;  4ARZ A;  3LIA A;  3H9W A;  3KX0 X;  1S1Z A;  4NEE D;  1OT9 A;  4P6Z M;  3CUE C;  2J3W A;  4GHI B;  1TF1 A;  2G7U A;  3R7W A;  3LR4 A;  3PBQ A;  3LIF A;  1F98 A;  5HWT A;  5DFY A;  1W63 M;  3LI8 A;  3UE6 A;  2VV6 A;  3HCY A;  3KSI A;  4L0L A;  2K2N A;  3PBS A;  2O9B A;  1N9O A;  3B33 A;  1TS0 A;  3D3O A;  2WKP A;  3EEA A;  1DRM A;  2LB5 A;  4HOI A;  1OJ5 A;  1TD5 A;  4EEP A;  3EQV A;  5A8B A;  1OTE A;  2R78 A;  4WL9 A;  4WLA A;  4I39 A;  1OT6 A;  4KQO A;  2ZOI A;  5AVE A;  3KSF A;  2QWS A;  4HI4 A;  3S7Q A;  2WKR A;  4WEJ A;  2A24 B;  3FPW A;  4NKP A;  4JGQ A;  4MN5 A;  1ZTU A;  1P9R A;  4ZRR A;  3EGD C;  1F5M A;  2VA0 A;  3B42 A;  4GCZ A;  3S7P A;  2OOL A;  1T19 A;  2YKH A;  4L9G A;  1XJ3 A;  5KIZ A;  1XFN A;  3NOT C;  1ODV A;  4GW9 A;  5HSQ A;  3ULF A;  1LSX A;  2PDR A;  2VV8 A;  4P6Z S;  4CLC B;  3H82 B;  3UME A;  4O01 A;  4R38 A;  3O5Y A;  4GS9 B;  3OLO A;  4ETX A;  2D01 A;  2PD8 A;  5L8M A;  3NHQ A;  3LFV A;  3NOP C;  3E0Y A;  5CX7 A;  4PHT A;  2OAP 1;  4MMN A;  1V9Y A;  3A0S A;  1T1A A;  3KO6 A;  2FH5 A;  4OOL A;  1YSQ A;  4LRX C;  2HJE A;  2M7U A;  1S1Y A;  2QHK A;  3CAX A;  3TE8 A;  3LIB A;  3UMD A;  3VV4 A;  1UWN X;  3BWL A;  2KDK A;  4CLC A;  2VLG A;  3TRC A;  3PR6 A;  4I3A A;  3OCN A;  2Z6D A;  3BJN A;  3IS2 B;  4HIA A;  4ME4 A;  1X0O A;  3P01 A;  4G3V A;  4BMW A;  2PHY A;  2GX5 A;  4L9E A;  3PXP A;  3B47 A;  4UQI S;  4Q0H A;  5C5K A;  2W3F A;  2YKF A;  3T4K A;  2QKP A;  5HDD A;  4DN0 A;  2J3T D;  4DJ2 A;  3C2W A;  3MQO A;  2B18 A;  1MC0 A;  2W27 A;  1TS8 A;  4DMZ A;  2O9A A;  4GS9 A;  1BYW A;  3FPV A;  2V0W A;  5AJG A;  3MMH A;  1DP9 A;  1N9L A;  4IJG A;  3BY9 A;  1YAX A;  3VE3 A;  4EET B;  2V0U A;  3LR5 A;  3FC7 A;  2VX8 A;  2HGV A;  2XA7 M;  3PBO A;  2ZMV A;  4EW7 A;  3SW1 A;  1MKM A;  4CLC D;  2W0N A;  4CLC C;  2A2L A;  4F3L A;  2QYB A;  2MJ6 A;  4MN6 A;  3A0V A;  4DJ3 A;  3MF0 A;  4KQD A;  3T4O A;  3F1O A;  3LI9 A;  3OBF A;  2V1B A;  4GLQ A;  3C8C A;  3R4K A;  2I9V A;  4EU0 A;  1XJ6 A;  1OJG A;  3S7N A;  2QJ7 A;  1YKD A;  2OWH A;  3OC2 A;  3PYP A;  2VJW A;  3VOL A;  5F68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...