1OTIA

E46q mutant of photoactive yellow protein, p65 at 295k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1otiA00
5KIZA 4HP9A 3IS2B 4WF0A 1EW0A 1LSWA 5TBMB 2B02A 1UGUA 4HOIA 3F1NA 3VE4A 3FC7A 4EQ1A 1OTBA 5HSQA 3E4PA 3MR0A 3PYPA 3RH8B 2I9VA 3NHQA 2OWHA 3IS2A 3NOPC 5F68A 3MQQA 2KDKA 1UWNX 1OTEA 3A0SA 2L0WA 2PDRA 2QWSA 4HIAA 4NXGA 5I5LA 5DJTA 4GS9B 3T50A 4F3LB 1N9OA 2W0NA 3NOTC 3UB8A 4I38A 3D72A 4EEPA 1DP9A 1P0ZA 2VV8A 1OT9A 1G28A 4GS9A 4NXBA 5A8BA 3LUQA 4LRZE 4M4XA 3ZQ5A 5IS1A 4F3LA 4JGPA 3E4OA 1XJ6A 2Z6DA 1T19A 1T18A 3OLOA 2WKQA 3BY9A 5HD3A 2H28A 2KX6A 4HH3A 1GSWA 1OJGA 1P97A 4B9OA 4R3AA 3LI9A 3IBRA 5HDCA 4EETB 4JGQA 4I3JA 2ZOHA 4H6JB 1JNUA 1DRMA 1XJ4A 1X0OA 3EEHA 1LT0A 2V0UA 4HH2A 4EXOA 5HWTA 2YKFA 1T1BA 5IU1A 3CWFA 2EA9A 2W27A 2P7JA 4WUJA 1MZUA 1V9ZA 2A24B 4GW9A 1DP6A 3NJAA 2GJ3A 3MQOA 2OOLA 2CMNA 2OWJA 4I3AA 3UB6A 1TS7A 2PYPA 4MN6A 1KOUA 5HWWA 4GHIB 4NXEA 4DJ3A 2JHEA 1Y28A 2WKPA 1OTIA 3GECA 3NOUC 4XT2B 5J7EA 2D02A 2VV6A 4HQAA 1S1ZA 1LL8A 3VE3A 2K7SA 5TBMA 1VB6A 3FG8A 4DJ2A 2QJ5A 4HY8A 2L1MA 4GHIA 3A0VA 2V9AA 1D7EA 4PKYA 3ICYA 3MXQA 4HP4A 3C8CA 5F6AA 4XT2A 4L9EA 1TS0A 3LIDA 3LYXA 3LIAA 5G4ZA 1T1CA 1UWPX 3H7WB 4HJ3A 2ZBBA 4KUOA 3B33A 1ODVA 1XJ2A 1XFQA 1S67L 5HDDA 4HI4A 3GDIA 4HNBA 2QKPA 4WN5A 1S4RA 1T1AA 4L9GA 3BY8A 3UB7A 1LSVA 2QHKA 4NXFA 3H7WA 3UMEA 2WKRA 1F98A 2D01A 2PD8A 4R6LA 4L9FA 5DJUA 1V9YA 3UE6A 3H82B 1D06A 4I3IA 1S4SA 1TS6A 2PD7A 4YWZA 5HZHA 5J3WA 3UMDA 3BWLA 3F1OB 4WL9A 3MJQA 1N9NA 4HHDA 3KX0X 3EWKA 3A0RA 2J80A 3F1PB 3LICA 3H82A 4H6JA 2VV7A 1BYWA 2PR6A 5DKKA 1OTAA 2PYRA 2V1AA 2BASA 1DP8A 3F1NB 4KQDA 4KUKA 4LPZA 4R70A 2VLGA 2V1BA 3F1PA 2A24A 3C2WA 5HDSA 4E04A 2PR5A 5HWVA 2JN7A 4LRYC 1TS8A 1OJ5A 1XFNA 5F69A 4R38A 2ZOIA 1F9IA 3LIEA 3G6OA 1OT6A 4LLOB 5DKLA 4BBTA 4EESA 3RTYA 4BBUA 1GSXA 4I5SA 4GCZA 4K08A 4BBVA 2M1CA 2VEAA 4JGRA 5EFWA 3UB9A 4HJ6A 5F5YA 3SW1A 5HD5A 3MFXA 3CAXA 4JGOA 4EERA 1S66L 2PHYA 4EW7A 4LRXC 2V0WA 3ULFA 5AVFA 1NWZA 5AVEA 4I39A 3CLOA 3LIFA 2R78A 4HJ4A 1XJ3A 2Z6CA 4RQ9A 3E4QA 4PKYG 3K3DA 2HV1A 3LI8A 3PHYA 2QJ7A 4WLAA 4MN5A 2INWA 3K3CA 1OTDA 4EEUA 1LSXA 5G4YA 1GSVA 3HJIA 1N9LA 3H9WA 3P7NA 3LIBA 5J4EA 3HJKA 1S1YA 1WA9A 2L4RA 2YKHA 3VOLA 3F1OA
chains in the Genus database with same CATH superfamily
2JKRI 2XRNA 4HP9A 3MZFA 2E8IA 3IS2B 2EXBA 2WZXA 4WF0A 2V8FA 4HESA 4DDYA 4WZ5C 4GLQA 4O7DA 4ZJ2A 4ETZA 3N6IA 3ZHHA 1JTGA 3FWLA 4FCFA 5A93A 1J9MA 1PI4A 3IS2A 3S4XA 4N1XA 1W63M 1AXBA 2XFTA 1ZG4A 1BLCA 5GHYA 3MKFA 5AQAA 2QWSA 1L0EA 1TVFA 4NXGA 1NYYA 5I5LA 4GS9B 1ERQA 4DKIA 2XK1A 3T50A 1NRJA 2QZ6A 4OLDA 3TOIA 4ZAMA 1FOFA 4UHUA 2DCFA 4EEPA 3G2YA 4N9LA 1KE3A 4WELA 5CGWA 2VV8A 3LR5A 1HTZA 3D4FA 2PBYA 4GS9A 3RJUA 3W4OA 4PM7A 1VHMA 4LRZE 4M4XA 3S7PA 4E3KA 3ZQ5A 3GQZA 5L8MA 5FSRA 1XJ6A 1IOUA 3FPVA 2Y2IA 3QP8A 1DJAA 1I5QA 1DJBA 3ZDJA 3OLOA 4LV0A 3BY9A 2H10A 2KX6A 2C5WB 4B9OA 2ZMFA 1GHMA 5F1FA 1MC0A 4S2LA 3IBRA 5HDCA 4LV1A 5J8XA 2ZL1B 4H6JB 4PPRA 5EOOA 2XSSA 4JBFA 4QPRA 4FSFA 3CUEA 5KSCA 2Y2QA 4UQIM 4DE3A 1XJ4A 2HZ5A 2ZQDA 4DF6A 3FYZA 3EEHA 5GHXA 2V0UA 1GCEA 1LHYA 3E2KA 4Y3IA 3CWFA 4YINA 5CX7A 1CF0A 1MZUA 1G6OA 4X55A 5KSHA 3KO6A 5U47A 1DP6A 2ZL1A 2GJ3A 1ES5A 3V39A 1JTDA 2WAEA 2OWJA 3DW0A 2VA0A 4GOGA 4KG2A 3N8RA 2VX8A 5HWWA 1G68A 3HCYA 2Y2HA 1E3UD 4NXEA 5FQQA 4KZBA 4KZ8A 4JF6A 1Y28A 4E3MA 4ARZA 1OTIA 3GECA 3Q7ZA 5CECA 2XDMA 2VV6A 3ITAA 1LL8A 5TBMA 1VB6A 1KGGA 1PW1A 3IX4A 4U0XA 4X68A 1S0WA 2J3TD 3A0VA 2V9AA 1D7EA 4DRTA 3ICYA 3C8CA 4KQQA 5EPHA 1LLBA 1LI0A 3MQ0A 5EM0A 3W2ZA 1FR1A 2XGNA 3LIAA 5EM1A 1RCJA 1T1CA 3BFDA 4OP5A 1EI5A 1IYOA 3H7WB 4BL3A 4EU0A 3RXWA 4YOFA 2ZBBA 3M6HA 4KUOA 3B3XA 3B33A 1ODVA 1XJ2A 3SS3A 4OH0A 4Y13A 1S67L 5HDDA 1MKIA 1BUEA 4QHCA 2V8CA 1WYCA 3HL9A 1HLUP 4K91A 2EWWA 1KGEA 3IBJA 1T1AA 3BFFA 3UO9A 4WMCA 2PAVP 4NXFA 3H7WA 2ZM8A 5E2EA 4KZ9A 2D01A 5GHZA 2ZC3B 2X01A 3PBSA 3O86A 2JC7A 4OPRA 3UE6A 3V67A 5L10A 1D06A 1TS6A 3LEQA 4R0QA 1HD8A 2Y59A 3UE0A 4EUZA 4KZ4A 5HAPA 2HJ9C 2X71A 3QP2A 1YLYA 5JYPA 1ESIA 4KZ5A 4WYYA 3SS5A 4JPMA 1YLJA 3BLSA 4FD8A 5DKKA 3E0YA 2PYRA 3IHBA 2BASA 4OPQA 5EVEA 1DP8A 3F1NB 4GKUA 2B5RA 2J3WA 3MKEA 2PRFA 2DNSA 3MBZA 3VV4A 4LPZA 4C75A 3VSKA 4E3OA 1YMXA 1SDEA 4AFIA 5HDSA 3IT9A 4OQIA 3D3OA 1XKZA 4MMNA 5L2FA 2XF3A 3VOZA 4KQOA 3EQVA 3T1RA 4R38A 5GLDA 3U2AA 4S2MA 5IT5A 3G6OA 1OT6A 4BQMA 2BTFP 2Y2OA 4LLOB 5EUAA 3UE3A 3T4KA 3MXSA 1IEMA 3D9YA 1GSXA 4OVDA 4I5SA 2K2NA 1E25A 3CZDA 3N7WA 2M1CA 4DE1A 1IYSA 2VEAA 3ZVTA 4Y5FA 1FILA 2DRWA 4JGRA 3W4QA 2VGLS 1BZAA 4WM9A 3BEBA 1PZPA 3OPRA 1YSQA 2XQZA 3VMAA 1P9WA 2WZZA 2V0WA 3T4QA 4CLCB 4JXSA 3VP2A 2O9AA 4KZ6A 5AVEA 5E2GA 3KYEA 2W3EA 5AQBA 4EWFA 2Q9NA 4PAUA 3VFHA 1XJ3A 2BLSA 3E4QA 3VP1A 4E3IA 4WLAA 2IWDA 1IFQA 3K3CA 1OTDA 4EEUA 4CLCA 4OKPA 1PWDA 4U3TA 3ZG5A 3HLGA 2ZQ8A 1H3QA 4ID4A 1YAXA 1GA9A 3H9WA 1A0KA 3Q81A 3P7NA 5J4EA 1PWGA 1FQGA 2MJ6A 4OPYA 4JXVA 3LR4A 4Y15A 1K6SA 3LY3A 3F1OA 3MZDA 1N4OA 1VEUB 5E2HA 5KIZA 3BRMA 2WKHA 1FCMA 3DAVA 3ZNTA 1LSWA 1YLTA 5FQKA 2XA7S 4O8GA 5DVAA 1UGUA 3IH8A 4S2NC 4HOIA 3A3FA 5MC7A 2W3FA 3G4PA 3C4OA 3UY6A 3VE4A 2H0TA 3FC7A 2VK3A 4MN7A 4EQ1A 2EXAA 3FZCA 3NCKA 1VEUA 3RH8B 3NHQA 3NOPC 2OLVA 3GV9A 3QP1A 4HBUA 4JXGA 2KDKA 3ZVWA 1BLPA 3TRCA 1FSYA 2Y2PA 2XR0A 4BENA 3OBFA 3SH9A 4ZBEA 1O07A 2ACGA 4QB8A 5FASA 1SDNA 4JF5A 5FEFA 4FH4A 5A91A 5DJTA 3S1YA 1W8QA 4OQGA 3C7UA 2HDQA 3EEAA 1L0GA 3QP4A 4X53A 1N9OA 2WGVA 5GLCA 3NOTC 5EE8A 2WGIA 1G5UA 3MXRA 5HL6A 3JYIA 3UPNA 2DMWA 1EWZA 5A8BA 3LUQA 3IX3A 1PW8A 3S7OA 4P6ZM 5FDSA 1W79A 1CK3A 4IHQA 4IJGA 3W4PA 4PM9A 2Y2JA 5KMWA 2LB9A 4YNRA 2G2WA 2WKQA 1H0MA 2WGWA 4CLCC 3TSGA 2H28A 1GSWA 2OAQ1 1YKDA 3ZG9B 4MBKA 4D60A 3LI9A 1ES3A 1ZG6A 3K2NA 1JNUA 3PR6A 4X1MA 3PTEA 1X0OA 2VJWA 1LT0A 4EBNA 3ZCZA 5HWTA 1T1BA 2Y55A 5EVIB 4G3WA 3IXGA 5DF8A 1NLYA 5HARA 3NJAA 4I3AA 1TS7A 2HP9A 2PYPA 1ZC2A 3BM6A 3CJMA 3N8SA 4MN6A 1KOUA 1I2SA 3HLDA 1ESUA 2JBFA 3G32A 4QWOA 4KZ7A 2ZM2A 2ZMVA 1WE4A 2WKPA 3S7QA 3OOVA 2G7UA 4XT2B 3BQ8A 5EVIA 2XFSA 4OOMA 4X6TA 3DTIA 1FSWA 4HQAA 1XA7A 4EBLA 1IELA 3IWOA 3RFBA 1N9BA 3FG8A 4Y17A 4S2IA 4DJ2A 2ZC5B 3T1QB 4UEYA 1PFLA 4WMCD 5K5BA 3GR2A 3UPOA 1CI8A 4HY8A 3M6BA 5DF9A 2EX6A 3O3VA 1K57A 4HP4A 3WS1A 4XT2A 3TW8A 1YLPA 3ZG8B 2PT7A 3UDFA 3MS6A 4NETA 4BD0A 4RA7A 3T4OA 1DJCA 3NBLA 1KDWA 4N1HA 3HREA 5FL3A 2PU4A 4QJGA 1UWPX 3NDGA 1MKMA 5CERA 2Y2GA 4EBPA 2ZM0A 4IUHA 3FPWA 5CGSA 2E8JA 1K0KA 3LCEA 5FATA 3GDIA 2WK0A 3B47A 4P87A 4FOFA 4WN5A 3HVFA 2C6WB 4L9GA 1LSVA 3OCLA 2HJEA 2W1TB 4IEDA 3UMEA 3R4KA 1K56A 4R6LA 3IXHA 3NY4A 4E6WA 3DTMA 3LEZA 1JWZA 1ES4A 4I3IA 1S4SA 5CHMA 2V1ZA 2EWVA 4YWZA 4Y0TA 1TD5A 4WZ4A 3QHYA 2OV5A 3EOIA 4WL9A 1H5XA 4GJ4A 1LI9A 4HHDA 2H5SA 4GD6A 4H6JA 1BYWA 4WEKA 1M40A 1PNEA 4DXBA 1GHPA 1ERMA 2EFXA 4GN2A 1XGJA 1Q2QA 4YFMA 3FV7A 5EVIC 3KYQA 3TJZC 5HPIA 3VP0A 3MSHA 4RX2A 5DF7A 1NLZA 3C2WA 2EX9A 5FA7A 2P9VB 4Y2FA 3SS4A 4E04A 5HWVA 2JN7A 2Y79A 3PAGA 4WBGA 1K57C 4S2PA 4Z1WA 4EQIA 5F69A 3O88A 1PIOA 3V50A 1D1JA 3Q1FA 3IF6B 1CI9A 1NJ4A 2EX2A 2XLNA 3Q7VB 4KG5A 3ZNYA 2P9VA 1W63Q 3B42A 5CRFA 2J9PA 1SZVA 3N8LA 4K08A 2KOIA 3C4PA 4GDNA 3M2JA 4G3KA 2IWCA 5EFWA 1ES2A 3UB9A 2CC1A 3QNCA 4H8RA 3SW1A 1LL9A 1C3BA 2NUPC 3MFXA 3MF0A 4ETXA 4ZJ1A 4K0XA 2ZLYA 4LV3A 4BL2A 4EERA 1S66L 5DTSA 4EW7A 5HFOA 1VM1A 2JKFA 1NWZA 2HP6A 2O0YA 4PM6A 4Q0JA 4I39A 1K6RA 1PYYA 4HJ4A 2HGVA 2XD5A 3WS2A 3PHYA 1KE4A 2W3DA 2PBDP 4OOLA 4XUXA 1YT4A 2A2LA 4MN5A 2INWA 5FQJA 2GZAA 1GSVA 1MWTA 4LCMA 3HJIA 3UDXA 5HL1A 1CQAA 3BECA 2WYXA 5FI7A 4F94A 1ACFA 1RGYA 4KZ3A 4O0PA 2ZJ9A 4P0MA 5L09A 2Z2LB 4WEJA 4ZTKA 4UA7A 3V5MA 5EV0A 4R3JA 1RGZA 3HLCA 2WAFA 3BYDA 3WRTA 2WADA 3HLEA 4GD8A 1JVJA 4II7A 5CTMA 4DDSA 2J8YA 4GNUA 5FAPA 3F1NA 4R1GA 4S2NA 3Q07A 2EFUA 1PI5A 1OTBA 5HSQA 3E4PA 3MR0A 3PYPA 2I9VA 5FI2A 4Y7PA 5F68A 3MQQA 1L0FA 1YSPA 1UWNX 1OTEA 3A0SA 1U60A 3CITA 4GB7A 4BMWA 2L0WA 4NK3A 3LO7A 2PDRA 4HIAA 4N92A 3I7JA 1FCNA 3IXBA 1K55A 5CEDA 2HDRA 2PU2A 3HLFA 4HBTA 4IBRA 1GHIA 2HDSA 1NZOA 4A5RA 2W0NA 3CPTB 4I38A 3D72A 3ZG7B 4QU3A 1P0ZA 3DBAA 4LFUA 4FUWA 3UDIA 4LV2A 1OT9A 5A90A 1CEFA 1TDGA 5FQIA 4B93A 4CPKA 1MWUA 5HX9A 4IVKA 3DWKA 5TFQA 4JGPA 3TE8A 2Z6DA 5FQMA 1XGIA 3CPTA 1VQQA 1T18A 4UA9A 5HD3A 1OJGA 1P97A 4R3AA 1ZKJA 1K4EA 1L2SA 3AGFA 1F2KA 3NDEA 5F82A 5CHUA 4EETB 4JGQA 4ZJ3A 4JXWA 1FR6A 2ZOHA 3UN7A 3QP6A 5GLBA 4M3KA 1DRMA 4MCWA 3ITBA 3VOYA 2GNXA 1L3LA 1XXMA 4BJPA 5CTNA 4HH2A 3S22A 1ZTUA 3PXPA 2YKFA 2EA9A 2W27A 4C3QA 3E98A 1V9ZA 2A24B 4GW9A 4R23A 1BULA 3MQOA 2OOLA 2CMNA 3QP5A 2JKGA 3UB6A 1IYQA 1G6AA 1E4DA 4DE0A 3NIAA 3T4TA 1W5DA 4UQIS 4N9KA 2JHEA 3CI6A 3OC2A 3HUNA 1ONHA 2RL3A 3NOUC 5J7EA 2D02A 4JLFA 3BLMA 4RYEA 1S1ZA 2K7SA 1YQSA 1BT5A 3A3JA 2OLUA 3IXDA 4B4ZA 2QJ5A 1SHVA 2LB5A 3KSHA 5GL9A 2L1MA 1K55C 3T1SA 4D2OA 1I2WA 3LR3A 2QMIA 2OAP1 4NKPA 4PKYA 3BFGA 4DMZA 2HP5A 3EGXC 5F6AA 4B4XA 5TGFA 4L9EA 2ZC7A 3DWZA 1Y54A 1VETB 3LIDA 3LYXA 3W8KA 3ZG0A 1YM1A 5A92A 2FZ0A 4C6YA 4Y0UA 3ZGAB 2ZC6B 4HJ3A 1KVMA 2M7UA 4ME4A 2VKSA 3UPPA 1XFQA 3WS4A 2QPNA 5E43A 4X56A 2JCHA 4HEFA 5FAOA 5E2FA 4EV4A 1YMSA 1YLZA 5TR7A 2QKPA 3JVVA 1S4RA 3LGOA 3S7NA 3BY8A 4E6XA 2A49A 4X1LA 3PBQA 2WKRA 3NI9A 3R7WB 1O7EA 2PD8A 3C38A 3PBNA 2ZD8A 1LL5A 1FIKA 4Q0HA 4L9FA 3GRJA 5DJUA 1V9YA 2B18A 3HUMA 5HZHA 4E3JA 4ZDXA 3HBRA 3BWLA 2ZQ9A 2G2UA 3MJQA 4CQHA 2FH5A 5M19A 4KZAA 3KX0X 3EWKA 2J80A 3QNBA 3LICA 2M7VA 1BSGA 2JKTI 2PR6A 1OTAA 1KE0A 4BWIA 1KGFA 2Y2NA 3PBRA 4IUKA 4S2OA 4KQDA 2I72A 3HLBA 4KUKA 3MZEA 4PMAA 1NRFA 3FKWA 2V1BA 1Z09A 1JWVA 1H8ZA 2O99A 2P04A 2PR5A 2WKIA 1PZOA 3IH9A 1OJ5A 2RCXA 2VGLM 4LGWA 2Q9MA 1MPLA 4OPZA 3L7HA 1BLSA 3T4JA 3NECA 5DKLA 4BBTA 2ZQAA 3RTYA 4CJNA 2XROA 4BBUA 1AWIA 4GCZA 4E3LA 4BBVA 1TDLA 2HPBA 4KENB 4IVIA 1ZHHB 3JVUA 4HJ6A 2X02A 5F5YA 1Q2PA 5DTTA 2WKEA 5HD5A 2UV0E 5G18A 4JGOA 3PBTA 1HZOA 2Y2MA 2W3GA 3RXXA 5AVFA 2WUQA 4DN0A 3LR0A 3CLOA 4JKTA 3LIFA 4Q0IA 2Z6CA 3IF5A 1S6RA 1ALQA 4CLCE 1NYMA 1K38A 3K3DA 2HV1A 3LI8A 2QJ7A 2Y4AA 3E2LA 1LSXA 2W1TA 3T4SA 2XA7M 5DFXA 4KG6A 1N9LA 1MXOA 2Y2LA 4QY6A 3NULA 5C5KA 3LY4A 3HJKA 4S2JA 1WA9A 2L4RA 2Y2KA 1MY8A 2Y8HA 4MBHA 1EROA 3EQUA 3UNWA 2YKHA 3VOLA 2EX8A 3Q82A 4ARZB 4BLMA 3U4LP 4GDBA 1DY6A 1M6KA 3GVBA 1EW0A 5TBMB 2B02A 3P98A 2XEPA 4MEZA 2H0YA 1NZUA 3ZYTA 4R4RA 4MLLA 1GA0A 1QMFA 3G2ZA 1H8MA 5D3OA 3GTCA 2GDNA 2J7VA 1JWPA 2B95A 4OLGA 2OWHA 3FKVA 1XX2A 2Z2MB 4XUZA 2JE5A 3KSFA 3SZTA 5CGXA 4KQRA 3HLWA 5I94A 3VP3A 4CLCD 1L0DA 4JF4A 3IWQA 4OQ0A 3BW6A 4F3LB 4R3BA 3HUOA 3IF6A 3UB8A 3Q7VA 1Y4OA 4OQHA 4BD1A 1DP9A 3PAEA 5CHJA 5IHVA 5AQ7A 3OZHA 1G28A 3UB5P 3GSGA 4NXBA 4XXRA 5IS1A 3AGDA 2QYBA 4F3LA 3E4OA 3T4LA 1TEMA 4R4SA 4UA6A 3OCNA 1KDSA 5EVLA 4NG2A 3N4IA 1T19A 4K0WA 1IKGA 2R9XA 4HH3A 5HPFA 3V3RA 3WS0A 1IKIA 2P74A 2IA2A 1YPRA 5FI6A 1HVBA 3T12B 3CUEC 4I3JA 3BFCA 4OP8A 3BFEA 4DXCA 2ZMAA 2XH9A 5FDHA 3A3IA 1MWSA 1FCOA 4P6ZS 1F5MA 3SH7A 5HAQA 4EXOA 2HDUA 5IU1A 2P7JA 4WUJA 1TF1A 4DE2A 2O9CA 4UAAA 3IWIA 1PRQA 5GLAA 3C5AA 3L9KA 3DTEA 3V3SA 1SKFA 3VFFA 3AGEA 4ESPA 5CXWA 5FAQA 2OSUA 5CEBA 4GHIB 1QMEA 4ZRRA 5LBRA 4DJ3A 3KSGA 2FFYA 2ZQCA 2UWXA 2ZC4B 3VE3A 4O01A 4MDZA 1MWRA 3A3EA 2Q0OA 3G35A 4GHIA 1XA1A 4S2KA 3C7VA 1MBLA 1ONGA 3MXQA 5BOHA 3IF6C 5AQ9A 2R9WA 1NY0A 2W1RA 1TS0A 5AJGA 1IYPA 2A3UA 4RVAA 3MFDA 5G4ZA 2VGJA 4RX3A 1E3UA 1BLHA 1K4FA 3KSIA 4HI4A 1Z6FA 1P9RA 4HNBA 4MBFA 2IWBA 4EUVA 5M18A 2KLIA 3GMWA 3P01A 3UB7A 1CEGA 2QHKA 1OMEA 4P6BA 5F1GA 2V20A 4Y0OA 3OPPA 1F98A 5EECA 4IBXA 5EVID 1BTLA 3OPHA 1W8YA 4QY5A 2VGKA 3H82B 2W3HA 3C30A 2PD7A 4X25A 1K54A 2P08A 2NUTC 5J3WA 4PM8A 3DTKA 3VSLA 1J3WA 3UMDA 2VZWA 3F1OB 5TJJA 1XP4A 1H8YA 1N9NA 3JPUA 2J9OA 3SH8A 4FH2A 3A0RA 3F1PB 3H82A 3IQAA 3CMZA 2VV7A 5HW3A 1SKOB 3VP4A 3WRZA 2V1AA 3KYZA 5L07A 3WWXA 5HAIA 3T1XA 2HF6A 4R70A 2VLGA 3SOIA 1RP5A 1XPBA 3F1PA 2A24A 2ZQ7A 1NXYA 4PM5A 3MMHA 4P85A 3P09A 1SKOA 4NEED 4WZ5A 5DFYA 2XD1A 4B88A 4LRYC 5FQ9A 1TS8A 1XFNA 3PBOA 4FTXA 2ZOIA 1F9IA 1K56D 2JKTM 3LIEA 5JYOA 5F83A 3TG9A 4Q8IA 4EESA 1KVLA 1W7FA 4U0TA 4GZBA 2JKRM 3O87A 2V2FF 2BG1A 3IX8A 2GX5A 2FFFB 2AVXA 1VETA 4Z9QA 3CAXA 2J3TC 2WGWB 4E3NA 4LCLA 3EGDC 3UE1A 2PHYA 4LRXC 3LFVA 1OPXA 3CG5A 3ULFA 3NC8A 1CJFA 3G31A 3BJNA 3M2KA 3ISGA 3O5YA 3G30A 4OONA 5EOEA 2R78A 4LENA 1K54C 3BQAA 4RQ9A 4PKYG 1K25A 2O9BA 3CHWP 4QD4A 1STZA 4OOYA 4PHTA 3A3DA 3IHAA 5G4YA 3R7WA 3WS5A 3ZFZA 5KZHA 1SCWA 5M1AA 5FEGA 3LIBA 3G34A 4X69A 1PWCA 2K31A 1S1YA 4MNRA 3OPLA 2Y91A 4L0LA 1WYBA 4G3VA 1YLWA 5DTKA
chains in the Genus database with same CATH topology
5KIZA 2JKRI 2XRNA 4HP9A 3IS2B 4WF0A 1EW0A 1LSWA 5TBMB 4II7A 2B02A 4GLQA 2XA7S 4O8GA 1UGUA 3ZYTA 4HOIA 4ETZA 5MC7A 2W3FA 3F1NA 1H8MA 3VE4A 3FC7A 4MN7A 4EQ1A 1OTBA 5HSQA 3E4PA 3MR0A 3PYPA 3RH8B 2I9VA 3NHQA 2OWHA 3IS2A 3NOPC 5F68A 3MQQA 1W63M 1YSPA 2KDKA 1UWNX 3TRCA 1OTEA 3A0SA 3KSFA 3OBFA 3CITA 4BMWA 2L0WA 2PDRA 2QWSA 4HIAA 4NXGA 5I5LA 5DJTA 4GS9B 4CLCD 3EEAA 3T50A 1NRJA 3BW6A 4F3LB 1N9OA 2W0NA 3NOTC 3UB8A 4I38A 3D72A 4EEPA 1DP9A 1P0ZA 3DBAA 5HL6A 4WELA 2VV8A 3LR5A 1OT9A 1G28A 4GS9A 4B93A 2DMWA 4NXBA 5A8BA 1VHMA 3LUQA 4LRZE 4M4XA 3S7PA 3S7OA 3ZQ5A 5IS1A 2QYBA 5L8MA 4JGPA 4F3LA 3E4OA 4P6ZM 3T4LA 3TE8A 1XJ6A 2Z6DA 3FPVA 3OCNA 1IOUA 4IHQA 4IJGA 2LB9A 1T19A 1T18A 4YNRA 3OLOA 2WKQA 4CLCC 3BY9A 5HD3A 2H28A 2KX6A 4HH3A 1GSWA 1OJGA 1P97A 5HPFA 4R3AA 2ZMFA 4B9OA 2OAQ1 1YKDA 1MC0A 2IA2A 3LI9A 3IBRA 5HDCA 4EETB 4JGQA 3CUEC 4I3JA 2ZOHA 4H6JB 2XSSA 4QPRA 3K2NA 1JNUA 3PR6A 1DRMA 4FSFA 3CUEA 4MCWA 4UQIM 1XJ4A 2GNXA 1X0OA 3EEHA 2VJWA 1LT0A 4P6ZS 4BJPA 1F5MA 2V0UA 4HH2A 1ZTUA 4EXOA 3PXPA 5HWTA 2YKFA 1T1BA 4Y3IA 5IU1A 3CWFA 2EA9A 2W27A 5CX7A 2P7JA 4WUJA 1MZUA 1TF1A 4G3WA 1G6OA 3E98A 2O9CA 1V9ZA 5KSHA 2A24B 4GW9A 1NLYA 3KO6A 1DP6A 3NJAA 2GJ3A 3MQOA 2OOLA 2CMNA 2OWJA 4I3AA 3UB6A 1TS7A 2PYPA 2VA0A 4MN6A 1KOUA 4G3VA 3T4TA 2VX8A 5HWWA 3HCYA 4GHIB 4UQIS 4ZRRA 4NXEA 5LBRA 4DJ3A 2JHEA 3KSGA 1Y28A 3CI6A 2ZMVA 2WKPA 4ARZA 1OTIA 3GECA 3S7QA 3OC2A 3OOVA 3NOUC 2G7UA 4XT2B 5J7EA 3BQ8A 2D02A 2VV6A 4OOMA 4HQAA 1S1ZA 1LL8A 3VE3A 2K7SA 5TBMA 1VB6A 3RFBA 3FG8A 4O01A 4DJ2A 4UEYA 2QJ5A 2LB5A 3KSHA 5K5BA 4MDZA 4HY8A 2L1MA 2J3TD 4GHIA 3A0VA 2V9AA 1D7EA 3LR3A 2OAP1 5DF9A 4NKPA 4PKYA 4DMZA 3EGXC 3ICYA 3MXQA 4HP4A 3C8CA 5F6AA 4XT2A 3TW8A 4L9EA 2PT7A 3MQ0A 2W1RA 1TS0A 3LIDA 5AJGA 3W2ZA 3LYXA 3T4OA 3LIAA 5G4ZA 5FL3A 1T1CA 1UWPX 2FZ0A 3H7WB 1MKMA 4HJ3A 4EU0A 4YOFA 2M7UA 4ME4A 2ZBBA 4IUHA 4KUOA 2VKSA 3B33A 1ODVA 1XJ2A 1XFQA 3FPWA 3KSIA 1S67L 5HDDA 4HI4A 3GDIA 1P9RA 3B47A 4HNBA 4EUVA 2EWWA 4FOFA 2QKPA 4WN5A 3JVVA 3IBJA 1S4RA 2KLIA 3P01A 1T1AA 4L9GA 3BY8A 3S7NA 3UB7A 1LSVA 2QHKA 3PBQA 4NXFA 3H7WA 3OCLA 2HJEA 2W1TB 3UMEA 2WKRA 3R4KA 3R7WB 1F98A 2D01A 2PD8A 3C38A 3PBNA 4R6LA 3PBSA 4Q0HA 4L9FA 5DJUA 1V9YA 3UE6A 3H82B 3V67A 2W3HA 3C30A 1D06A 4I3IA 1S4SA 2B18A 1TS6A 2PD7A 2EWVA 4YWZA 2P08A 2NUTC 5HZHA 5J3WA 1TD5A 3UMDA 2HJ9C 2VZWA 3BWLA 3EOIA 3F1OB 4WL9A 3MJQA 4CQHA 5TJJA 2FH5A 4GJ4A 1N9NA 4HHDA 3KX0X 3EWKA 3A0RA 2J80A 3F1PB 3LICA 2M7VA 3H82A 4H6JA 2VV7A 1BYWA 2JKTI 2PR6A 5DKKA 1OTAA 3E0YA 2PYRA 2V1AA 2BASA 4BWIA 4WEKA 3PBRA 3KYZA 1DP8A 3F1NB 4IUKA 2J3WA 4KQDA 2HF6A 3KYQA 4KUKA 3VV4A 4LPZA 4R70A 3TJZC 2VLGA 5HPIA 2V1BA 3F1PA 2A24A 1NLZA 3C2WA 2O99A 3MMHA 4AFIA 2P04A 4Y2FA 5HDSA 4E04A 4NEED 2PR5A 5HWVA 5DFYA 2JN7A 2Y79A 3D3OA 4LRYC 4MMNA 1TS8A 4KQOA 3EQVA 4Z1WA 1OJ5A 2VGLM 1XFNA 5F69A 3PBOA 4R38A 2ZOIA 1F9IA 2JKTM 3LIEA 3U2AA 3T4JA 5IT5A 3G6OA 1OT6A 4LLOB 5DKLA 4BBTA 3UE3A 4EESA 3T4KA 1W63Q 3RTYA 2XROA 4BBUA 1GSXA 3B42A 2JKRM 4I5SA 4GCZA 2K2NA 4K08A 2KOIA 4BBVA 2M1CA 2GX5A 2VEAA 4Y5FA 4G3KA 4JGRA 5EFWA 1ZHHB 2VGLS 3JVUA 3UB9A 4HJ6A 5F5YA 3SW1A 2NUPC 5HD5A 3MFXA 3MF0A 1YSQA 4ETXA 3CAXA 2J3TC 4JGOA 1P9WA 3PBTA 4EERA 3EGDC 1S66L 2PHYA 2W3GA 4EW7A 4LRXC 2V0WA 3LFVA 3T4QA 1OPXA 4CLCB 3ULFA 5AVFA 4DN0A 3BJNA 1NWZA 2O9AA 5AVEA 3O5YA 3LR0A 2O0YA 4Q0JA 4I39A 3CLOA 2W3EA 3LIFA 2R78A 4HJ4A 4PAUA 1XJ3A 3BQAA 4Q0IA 2Z6CA 4CLCE 2HGVA 4RQ9A 3E4QA 4PKYG 2O9BA 3K3DA 2HV1A 3LI8A 3PHYA 2QJ7A 2W3DA 4OOLA 4WLAA 1STZA 2A2LA 1IFQA 2INWA 4MN5A 3K3CA 1OTDA 2GZAA 4EEUA 1LSXA 2W1TA 4PHTA 3T4SA 4CLCA 5G4YA 3R7WA 2XA7M 1GSVA 5DFXA 1H3QA 3HJIA 1N9LA 1YAXA 3H9WA 3P7NA 3LIBA 5J4EA 5C5KA 4O0PA 3HJKA 2K31A 1S1YA 2MJ6A 1WA9A 2L4RA 3LR4A 2Y8HA 3EQUA 2YKHA 3VOLA 4WEJA 4L0LA 4ARZB 3F1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIZ A;  4HP9 A;  3IS2 B;  4WF0 A;  1EW0 A;  1LSW A;  5TBM B;  2B02 A;  1UGU A;  4HOI A;  3F1N A;  3VE4 A;  3FC7 A;  4EQ1 A;  1OTB A;  5HSQ A;  3E4P A;  3MR0 A;  3PYP A;  3RH8 B;  2I9V A;  3NHQ A;  2OWH A;  3IS2 A;  3NOP C;  5F68 A;  3MQQ A;  2KDK A;  1UWN X;  1OTE A;  3A0S A;  2L0W A;  2PDR A;  2QWS A;  4HIA A;  4NXG A;  5I5L A;  5DJT A;  4GS9 B;  3T50 A;  4F3L B;  1N9O A;  2W0N A;  3NOT C;  3UB8 A;  4I38 A;  3D72 A;  4EEP A;  1DP9 A;  1P0Z A;  2VV8 A;  1OT9 A;  1G28 A;  4GS9 A;  4NXB A;  5A8B A;  3LUQ A;  4LRZ E;  4M4X A;  3ZQ5 A;  5IS1 A;  4F3L A;  4JGP A;  3E4O A;  1XJ6 A;  2Z6D A;  1T19 A;  1T18 A;  3OLO A;  2WKQ A;  3BY9 A;  5HD3 A;  2H28 A;  2KX6 A;  4HH3 A;  1GSW A;  1OJG A;  1P97 A;  4B9O A;  4R3A A;  3LI9 A;  3IBR A;  5HDC A;  4EET B;  4JGQ A;  4I3J A;  2ZOH A;  4H6J B;  1JNU A;  1DRM A;  1XJ4 A;  1X0O A;  3EEH A;  1LT0 A;  2V0U A;  4HH2 A;  4EXO A;  5HWT A;  2YKF A;  1T1B A;  5IU1 A;  3CWF A;  2EA9 A;  2W27 A;  2P7J A;  4WUJ A;  1MZU A;  1V9Z A;  2A24 B;  4GW9 A;  1DP6 A;  3NJA A;  2GJ3 A;  3MQO A;  2OOL A;  2CMN A;  2OWJ A;  4I3A A;  3UB6 A;  1TS7 A;  2PYP A;  4MN6 A;  1KOU A;  5HWW A;  4GHI B;  4NXE A;  4DJ3 A;  2JHE A;  1Y28 A;  2WKP A;  1OTI A;  3GEC A;  3NOU C;  4XT2 B;  5J7E A;  2D02 A;  2VV6 A;  4HQA A;  1S1Z A;  1LL8 A;  3VE3 A;  2K7S A;  5TBM A;  1VB6 A;  3FG8 A;  4DJ2 A;  2QJ5 A;  4HY8 A;  2L1M A;  4GHI A;  3A0V A;  2V9A A;  1D7E A;  4PKY A;  3ICY A;  3MXQ A;  4HP4 A;  3C8C A;  5F6A A;  4XT2 A;  4L9E A;  1TS0 A;  3LID A;  3LYX A;  3LIA A;  5G4Z A;  1T1C A;  1UWP X;  3H7W B;  4HJ3 A;  2ZBB A;  4KUO A;  3B33 A;  1ODV A;  1XJ2 A;  1XFQ A;  1S67 L;  5HDD A;  4HI4 A;  3GDI A;  4HNB A;  2QKP A;  4WN5 A;  1S4R A;  1T1A A;  4L9G A;  3BY8 A;  3UB7 A;  1LSV A;  2QHK A;  4NXF A;  3H7W A;  3UME A;  2WKR A;  1F98 A;  2D01 A;  2PD8 A;  4R6L A;  4L9F A;  5DJU A;  1V9Y A;  3UE6 A;  3H82 B;  1D06 A;  4I3I A;  1S4S A;  1TS6 A;  2PD7 A;  4YWZ A;  5HZH A;  5J3W A;  3UMD A;  3BWL A;  3F1O B;  4WL9 A;  3MJQ A;  1N9N A;  4HHD A;  3KX0 X;  3EWK A;  3A0R A;  2J80 A;  3F1P B;  3LIC A;  3H82 A;  4H6J A;  2VV7 A;  1BYW A;  2PR6 A;  5DKK A;  1OTA A;  2PYR A;  2V1A A;  2BAS A;  1DP8 A;  3F1N B;  4KQD A;  4KUK A;  4LPZ A;  4R70 A;  2VLG A;  2V1B A;  3F1P A;  2A24 A;  3C2W A;  5HDS A;  4E04 A;  2PR5 A;  5HWV A;  2JN7 A;  4LRY C;  1TS8 A;  1OJ5 A;  1XFN A;  5F69 A;  4R38 A;  2ZOI A;  1F9I A;  3LIE A;  3G6O A;  1OT6 A;  4LLO B;  5DKL A;  4BBT A;  4EES A;  3RTY A;  4BBU A;  1GSX A;  4I5S A;  4GCZ A;  4K08 A;  4BBV A;  2M1C A;  2VEA A;  4JGR A;  5EFW A;  3UB9 A;  4HJ6 A;  5F5Y A;  3SW1 A;  5HD5 A;  3MFX A;  3CAX A;  4JGO A;  4EER A;  1S66 L;  2PHY A;  4EW7 A;  4LRX C;  2V0W A;  3ULF A;  5AVF A;  1NWZ A;  5AVE A;  4I39 A;  3CLO A;  3LIF A;  2R78 A;  4HJ4 A;  1XJ3 A;  2Z6C A;  4RQ9 A;  3E4Q A;  4PKY G;  3K3D A;  2HV1 A;  3LI8 A;  3PHY A;  2QJ7 A;  4WLA A;  4MN5 A;  2INW A;  3K3C A;  1OTD A;  4EEU A;  1LSX A;  5G4Y A;  1GSV A;  3HJI A;  1N9L A;  3H9W A;  3P7N A;  3LIB A;  5J4E A;  3HJK A;  1S1Y A;  1WA9 A;  2L4R A;  2YKH A;  3VOL A;  3F1O A; 
#chains in the Genus database with same CATH topology
 2JKR I;  2XRN A;  4HP9 A;  3MZF A;  2E8I A;  3IS2 B;  2EXB A;  2WZX A;  4WF0 A;  2V8F A;  4HES A;  4DDY A;  4WZ5 C;  4GLQ A;  4O7D A;  4ZJ2 A;  4ETZ A;  3N6I A;  3ZHH A;  1JTG A;  3FWL A;  4FCF A;  5A93 A;  1J9M A;  1PI4 A;  3IS2 A;  3S4X A;  4N1X A;  1W63 M;  1AXB A;  2XFT A;  1ZG4 A;  1BLC A;  5GHY A;  3MKF A;  5AQA A;  2QWS A;  1L0E A;  1TVF A;  4NXG A;  1NYY A;  5I5L A;  4GS9 B;  1ERQ A;  4DKI A;  2XK1 A;  3T50 A;  1NRJ A;  2QZ6 A;  4OLD A;  3TOI A;  4ZAM A;  1FOF A;  4UHU A;  2DCF A;  4EEP A;  3G2Y A;  4N9L A;  1KE3 A;  4WEL A;  5CGW A;  2VV8 A;  3LR5 A;  1HTZ A;  3D4F A;  2PBY A;  4GS9 A;  3RJU A;  3W4O A;  4PM7 A;  1VHM A;  4LRZ E;  4M4X A;  3S7P A;  4E3K A;  3ZQ5 A;  3GQZ A;  5L8M A;  5FSR A;  1XJ6 A;  1IOU A;  3FPV A;  2Y2I A;  3QP8 A;  1DJA A;  1I5Q A;  1DJB A;  3ZDJ A;  3OLO A;  4LV0 A;  3BY9 A;  2H10 A;  2KX6 A;  2C5W B;  4B9O A;  2ZMF A;  1GHM A;  5F1F A;  1MC0 A;  4S2L A;  3IBR A;  5HDC A;  4LV1 A;  5J8X A;  2ZL1 B;  4H6J B;  4PPR A;  5EOO A;  2XSS A;  4JBF A;  4QPR A;  4FSF A;  3CUE A;  5KSC A;  2Y2Q A;  4UQI M;  4DE3 A;  1XJ4 A;  2HZ5 A;  2ZQD A;  4DF6 A;  3FYZ A;  3EEH A;  5GHX A;  2V0U A;  1GCE A;  1LHY A;  3E2K A;  4Y3I A;  3CWF A;  4YIN A;  5CX7 A;  1CF0 A;  1MZU A;  1G6O A;  4X55 A;  5KSH A;  3KO6 A;  5U47 A;  1DP6 A;  2ZL1 A;  2GJ3 A;  1ES5 A;  3V39 A;  1JTD A;  2WAE A;  2OWJ A;  3DW0 A;  2VA0 A;  4GOG A;  4KG2 A;  3N8R A;  2VX8 A;  5HWW A;  1G68 A;  3HCY A;  2Y2H A;  1E3U D;  4NXE A;  5FQQ A;  4KZB A;  4KZ8 A;  4JF6 A;  1Y28 A;  4E3M A;  4ARZ A;  1OTI A;  3GEC A;  3Q7Z A;  5CEC A;  2XDM A;  2VV6 A;  3ITA A;  1LL8 A;  5TBM A;  1VB6 A;  1KGG A;  1PW1 A;  3IX4 A;  4U0X A;  4X68 A;  1S0W A;  2J3T D;  3A0V A;  2V9A A;  1D7E A;  4DRT A;  3ICY A;  3C8C A;  4KQQ A;  5EPH A;  1LLB A;  1LI0 A;  3MQ0 A;  5EM0 A;  3W2Z A;  1FR1 A;  2XGN A;  3LIA A;  5EM1 A;  1RCJ A;  1T1C A;  3BFD A;  4OP5 A;  1EI5 A;  1IYO A;  3H7W B;  4BL3 A;  4EU0 A;  3RXW A;  4YOF A;  2ZBB A;  3M6H A;  4KUO A;  3B3X A;  3B33 A;  1ODV A;  1XJ2 A;  3SS3 A;  4OH0 A;  4Y13 A;  1S67 L;  5HDD A;  1MKI A;  1BUE A;  4QHC A;  2V8C A;  1WYC A;  3HL9 A;  1HLU P;  4K91 A;  2EWW A;  1KGE A;  3IBJ A;  1T1A A;  3BFF A;  3UO9 A;  4WMC A;  2PAV P;  4NXF A;  3H7W A;  2ZM8 A;  5E2E A;  4KZ9 A;  2D01 A;  5GHZ A;  2ZC3 B;  2X01 A;  3PBS A;  3O86 A;  2JC7 A;  4OPR A;  3UE6 A;  3V67 A;  5L10 A;  1D06 A;  1TS6 A;  3LEQ A;  4R0Q A;  1HD8 A;  2Y59 A;  3UE0 A;  4EUZ A;  4KZ4 A;  5HAP A;  2HJ9 C;  2X71 A;  3QP2 A;  1YLY A;  5JYP A;  1ESI A;  4KZ5 A;  4WYY A;  3SS5 A;  4JPM A;  1YLJ A;  3BLS A;  4FD8 A;  5DKK A;  3E0Y A;  2PYR A;  3IHB A;  2BAS A;  4OPQ A;  5EVE A;  1DP8 A;  3F1N B;  4GKU A;  2B5R A;  2J3W A;  3MKE A;  2PRF A;  2DNS A;  3MBZ A;  3VV4 A;  4LPZ A;  4C75 A;  3VSK A;  4E3O A;  1YMX A;  1SDE A;  4AFI A;  5HDS A;  3IT9 A;  4OQI A;  3D3O A;  1XKZ A;  4MMN A;  5L2F A;  2XF3 A;  3VOZ A;  4KQO A;  3EQV A;  3T1R A;  4R38 A;  5GLD A;  3U2A A;  4S2M A;  5IT5 A;  3G6O A;  1OT6 A;  4BQM A;  2BTF P;  2Y2O A;  4LLO B;  5EUA A;  3UE3 A;  3T4K A;  3MXS A;  1IEM A;  3D9Y A;  1GSX A;  4OVD A;  4I5S A;  2K2N A;  1E25 A;  3CZD A;  3N7W A;  2M1C A;  4DE1 A;  1IYS A;  2VEA A;  3ZVT A;  4Y5F A;  1FIL A;  2DRW A;  4JGR A;  3W4Q A;  2VGL S;  1BZA A;  4WM9 A;  3BEB A;  1PZP A;  3OPR A;  1YSQ A;  2XQZ A;  3VMA A;  1P9W A;  2WZZ A;  2V0W A;  3T4Q A;  4CLC B;  4JXS A;  3VP2 A;  2O9A A;  4KZ6 A;  5AVE A;  5E2G A;  3KYE A;  2W3E A;  5AQB A;  4EWF A;  2Q9N A;  4PAU A;  3VFH A;  1XJ3 A;  2BLS A;  3E4Q A;  3VP1 A;  4E3I A;  4WLA A;  2IWD A;  1IFQ A;  3K3C A;  1OTD A;  4EEU A;  4CLC A;  4OKP A;  1PWD A;  4U3T A;  3ZG5 A;  3HLG A;  2ZQ8 A;  1H3Q A;  4ID4 A;  1YAX A;  1GA9 A;  3H9W A;  1A0K A;  3Q81 A;  3P7N A;  5J4E A;  1PWG A;  1FQG A;  2MJ6 A;  4OPY A;  4JXV A;  3LR4 A;  4Y15 A;  1K6S A;  3LY3 A;  3F1O A;  3MZD A;  1N4O A;  1VEU B;  5E2H A;  5KIZ A;  3BRM A;  2WKH A;  1FCM A;  3DAV A;  3ZNT A;  1LSW A;  1YLT A;  5FQK A;  2XA7 S;  4O8G A;  5DVA A;  1UGU A;  3IH8 A;  4S2N C;  4HOI A;  3A3F A;  5MC7 A;  2W3F A;  3G4P A;  3C4O A;  3UY6 A;  3VE4 A;  2H0T A;  3FC7 A;  2VK3 A;  4MN7 A;  4EQ1 A;  2EXA A;  3FZC A;  3NCK A;  1VEU A;  3RH8 B;  3NHQ A;  3NOP C;  2OLV A;  3GV9 A;  3QP1 A;  4HBU A;  4JXG A;  2KDK A;  3ZVW A;  1BLP A;  3TRC A;  1FSY A;  2Y2P A;  2XR0 A;  4BEN A;  3OBF A;  3SH9 A;  4ZBE A;  1O07 A;  2ACG A;  4QB8 A;  5FAS A;  1SDN A;  4JF5 A;  5FEF A;  4FH4 A;  5A91 A;  5DJT A;  3S1Y A;  1W8Q A;  4OQG A;  3C7U A;  2HDQ A;  3EEA A;  1L0G A;  3QP4 A;  4X53 A;  1N9O A;  2WGV A;  5GLC A;  3NOT C;  5EE8 A;  2WGI A;  1G5U A;  3MXR A;  5HL6 A;  3JYI A;  3UPN A;  2DMW A;  1EWZ A;  5A8B A;  3LUQ A;  3IX3 A;  1PW8 A;  3S7O A;  4P6Z M;  5FDS A;  1W79 A;  1CK3 A;  4IHQ A;  4IJG A;  3W4P A;  4PM9 A;  2Y2J A;  5KMW A;  2LB9 A;  4YNR A;  2G2W A;  2WKQ A;  1H0M A;  2WGW A;  4CLC C;  3TSG A;  2H28 A;  1GSW A;  2OAQ 1;  1YKD A;  3ZG9 B;  4MBK A;  4D60 A;  3LI9 A;  1ES3 A;  1ZG6 A;  3K2N A;  1JNU A;  3PR6 A;  4X1M A;  3PTE A;  1X0O A;  2VJW A;  1LT0 A;  4EBN A;  3ZCZ A;  5HWT A;  1T1B A;  2Y55 A;  5EVI B;  4G3W A;  3IXG A;  5DF8 A;  1NLY A;  5HAR A;  3NJA A;  4I3A A;  1TS7 A;  2HP9 A;  2PYP A;  1ZC2 A;  3BM6 A;  3CJM A;  3N8S A;  4MN6 A;  1KOU A;  1I2S A;  3HLD A;  1ESU A;  2JBF A;  3G32 A;  4QWO A;  4KZ7 A;  2ZM2 A;  2ZMV A;  1WE4 A;  2WKP A;  3S7Q A;  3OOV A;  2G7U A;  4XT2 B;  3BQ8 A;  5EVI A;  2XFS A;  4OOM A;  4X6T A;  3DTI A;  1FSW A;  4HQA A;  1XA7 A;  4EBL A;  1IEL A;  3IWO A;  3RFB A;  1N9B A;  3FG8 A;  4Y17 A;  4S2I A;  4DJ2 A;  2ZC5 B;  3T1Q B;  4UEY A;  1PFL A;  4WMC D;  5K5B A;  3GR2 A;  3UPO A;  1CI8 A;  4HY8 A;  3M6B A;  5DF9 A;  2EX6 A;  3O3V A;  1K57 A;  4HP4 A;  3WS1 A;  4XT2 A;  3TW8 A;  1YLP A;  3ZG8 B;  2PT7 A;  3UDF A;  3MS6 A;  4NET A;  4BD0 A;  4RA7 A;  3T4O A;  1DJC A;  3NBL A;  1KDW A;  4N1H A;  3HRE A;  5FL3 A;  2PU4 A;  4QJG A;  1UWP X;  3NDG A;  1MKM A;  5CER A;  2Y2G A;  4EBP A;  2ZM0 A;  4IUH A;  3FPW A;  5CGS A;  2E8J A;  1K0K A;  3LCE A;  5FAT A;  3GDI A;  2WK0 A;  3B47 A;  4P87 A;  4FOF A;  4WN5 A;  3HVF A;  2C6W B;  4L9G A;  1LSV A;  3OCL A;  2HJE A;  2W1T B;  4IED A;  3UME A;  3R4K A;  1K56 A;  4R6L A;  3IXH A;  3NY4 A;  4E6W A;  3DTM A;  3LEZ A;  1JWZ A;  1ES4 A;  4I3I A;  1S4S A;  5CHM A;  2V1Z A;  2EWV A;  4YWZ A;  4Y0T A;  1TD5 A;  4WZ4 A;  3QHY A;  2OV5 A;  3EOI A;  4WL9 A;  1H5X A;  4GJ4 A;  1LI9 A;  4HHD A;  2H5S A;  4GD6 A;  4H6J A;  1BYW A;  4WEK A;  1M40 A;  1PNE A;  4DXB A;  1GHP A;  1ERM A;  2EFX A;  4GN2 A;  1XGJ A;  1Q2Q A;  4YFM A;  3FV7 A;  5EVI C;  3KYQ A;  3TJZ C;  5HPI A;  3VP0 A;  3MSH A;  4RX2 A;  5DF7 A;  1NLZ A;  3C2W A;  2EX9 A;  5FA7 A;  2P9V B;  4Y2F A;  3SS4 A;  4E04 A;  5HWV A;  2JN7 A;  2Y79 A;  3PAG A;  4WBG A;  1K57 C;  4S2P A;  4Z1W A;  4EQI A;  5F69 A;  3O88 A;  1PIO A;  3V50 A;  1D1J A;  3Q1F A;  3IF6 B;  1CI9 A;  1NJ4 A;  2EX2 A;  2XLN A;  3Q7V B;  4KG5 A;  3ZNY A;  2P9V A;  1W63 Q;  3B42 A;  5CRF A;  2J9P A;  1SZV A;  3N8L A;  4K08 A;  2KOI A;  3C4P A;  4GDN A;  3M2J A;  4G3K A;  2IWC A;  5EFW A;  1ES2 A;  3UB9 A;  2CC1 A;  3QNC A;  4H8R A;  3SW1 A;  1LL9 A;  1C3B A;  2NUP C;  3MFX A;  3MF0 A;  4ETX A;  4ZJ1 A;  4K0X A;  2ZLY A;  4LV3 A;  4BL2 A;  4EER A;  1S66 L;  5DTS A;  4EW7 A;  5HFO A;  1VM1 A;  2JKF A;  1NWZ A;  2HP6 A;  2O0Y A;  4PM6 A;  4Q0J A;  4I39 A;  1K6R A;  1PYY A;  4HJ4 A;  2HGV A;  2XD5 A;  3WS2 A;  3PHY A;  1KE4 A;  2W3D A;  2PBD P;  4OOL A;  4XUX A;  1YT4 A;  2A2L A;  4MN5 A;  2INW A;  5FQJ A;  2GZA A;  1GSV A;  1MWT A;  4LCM A;  3HJI A;  3UDX A;  5HL1 A;  1CQA A;  3BEC A;  2WYX A;  5FI7 A;  4F94 A;  1ACF A;  1RGY A;  4KZ3 A;  4O0P A;  2ZJ9 A;  4P0M A;  5L09 A;  2Z2L B;  4WEJ A;  4ZTK A;  4UA7 A;  3V5M A;  5EV0 A;  4R3J A;  1RGZ A;  3HLC A;  2WAF A;  3BYD A;  3WRT A;  2WAD A;  3HLE A;  4GD8 A;  1JVJ A;  4II7 A;  5CTM A;  4DDS A;  2J8Y A;  4GNU A;  5FAP A;  3F1N A;  4R1G A;  4S2N A;  3Q07 A;  2EFU A;  1PI5 A;  1OTB A;  5HSQ A;  3E4P A;  3MR0 A;  3PYP A;  2I9V A;  5FI2 A;  4Y7P A;  5F68 A;  3MQQ A;  1L0F A;  1YSP A;  1UWN X;  1OTE A;  3A0S A;  1U60 A;  3CIT A;  4GB7 A;  4BMW A;  2L0W A;  4NK3 A;  3LO7 A;  2PDR A;  4HIA A;  4N92 A;  3I7J A;  1FCN A;  3IXB A;  1K55 A;  5CED A;  2HDR A;  2PU2 A;  3HLF A;  4HBT A;  4IBR A;  1GHI A;  2HDS A;  1NZO A;  4A5R A;  2W0N A;  3CPT B;  4I38 A;  3D72 A;  3ZG7 B;  4QU3 A;  1P0Z A;  3DBA A;  4LFU A;  4FUW A;  3UDI A;  4LV2 A;  1OT9 A;  5A90 A;  1CEF A;  1TDG A;  5FQI A;  4B93 A;  4CPK A;  1MWU A;  5HX9 A;  4IVK A;  3DWK A;  5TFQ A;  4JGP A;  3TE8 A;  2Z6D A;  5FQM A;  1XGI A;  3CPT A;  1VQQ A;  1T18 A;  4UA9 A;  5HD3 A;  1OJG A;  1P97 A;  4R3A A;  1ZKJ A;  1K4E A;  1L2S A;  3AGF A;  1F2K A;  3NDE A;  5F82 A;  5CHU A;  4EET B;  4JGQ A;  4ZJ3 A;  4JXW A;  1FR6 A;  2ZOH A;  3UN7 A;  3QP6 A;  5GLB A;  4M3K A;  1DRM A;  4MCW A;  3ITB A;  3VOY A;  2GNX A;  1L3L A;  1XXM A;  4BJP A;  5CTN A;  4HH2 A;  3S22 A;  1ZTU A;  3PXP A;  2YKF A;  2EA9 A;  2W27 A;  4C3Q A;  3E98 A;  1V9Z A;  2A24 B;  4GW9 A;  4R23 A;  1BUL A;  3MQO A;  2OOL A;  2CMN A;  3QP5 A;  2JKG A;  3UB6 A;  1IYQ A;  1G6A A;  1E4D A;  4DE0 A;  3NIA A;  3T4T A;  1W5D A;  4UQI S;  4N9K A;  2JHE A;  3CI6 A;  3OC2 A;  3HUN A;  1ONH A;  2RL3 A;  3NOU C;  5J7E A;  2D02 A;  4JLF A;  3BLM A;  4RYE A;  1S1Z A;  2K7S A;  1YQS A;  1BT5 A;  3A3J A;  2OLU A;  3IXD A;  4B4Z A;  2QJ5 A;  1SHV A;  2LB5 A;  3KSH A;  5GL9 A;  2L1M A;  1K55 C;  3T1S A;  4D2O A;  1I2W A;  3LR3 A;  2QMI A;  2OAP 1;  4NKP A;  4PKY A;  3BFG A;  4DMZ A;  2HP5 A;  3EGX C;  5F6A A;  4B4X A;  5TGF A;  4L9E A;  2ZC7 A;  3DWZ A;  1Y54 A;  1VET B;  3LID A;  3LYX A;  3W8K A;  3ZG0 A;  1YM1 A;  5A92 A;  2FZ0 A;  4C6Y A;  4Y0U A;  3ZGA B;  2ZC6 B;  4HJ3 A;  1KVM A;  2M7U A;  4ME4 A;  2VKS A;  3UPP A;  1XFQ A;  3WS4 A;  2QPN A;  5E43 A;  4X56 A;  2JCH A;  4HEF A;  5FAO A;  5E2F A;  4EV4 A;  1YMS A;  1YLZ A;  5TR7 A;  2QKP A;  3JVV A;  1S4R A;  3LGO A;  3S7N A;  3BY8 A;  4E6X A;  2A49 A;  4X1L A;  3PBQ A;  2WKR A;  3NI9 A;  3R7W B;  1O7E A;  2PD8 A;  3C38 A;  3PBN A;  2ZD8 A;  1LL5 A;  1FIK A;  4Q0H A;  4L9F A;  3GRJ A;  5DJU A;  1V9Y A;  2B18 A;  3HUM A;  5HZH A;  4E3J A;  4ZDX A;  3HBR A;  3BWL A;  2ZQ9 A;  2G2U A;  3MJQ A;  4CQH A;  2FH5 A;  5M19 A;  4KZA A;  3KX0 X;  3EWK A;  2J80 A;  3QNB A;  3LIC A;  2M7V A;  1BSG A;  2JKT I;  2PR6 A;  1OTA A;  1KE0 A;  4BWI A;  1KGF A;  2Y2N A;  3PBR A;  4IUK A;  4S2O A;  4KQD A;  2I72 A;  3HLB A;  4KUK A;  3MZE A;  4PMA A;  1NRF A;  3FKW A;  2V1B A;  1Z09 A;  1JWV A;  1H8Z A;  2O99 A;  2P04 A;  2PR5 A;  2WKI A;  1PZO A;  3IH9 A;  1OJ5 A;  2RCX A;  2VGL M;  4LGW A;  2Q9M A;  1MPL A;  4OPZ A;  3L7H A;  1BLS A;  3T4J A;  3NEC A;  5DKL A;  4BBT A;  2ZQA A;  3RTY A;  4CJN A;  2XRO A;  4BBU A;  1AWI A;  4GCZ A;  4E3L A;  4BBV A;  1TDL A;  2HPB A;  4KEN B;  4IVI A;  1ZHH B;  3JVU A;  4HJ6 A;  2X02 A;  5F5Y A;  1Q2P A;  5DTT A;  2WKE A;  5HD5 A;  2UV0 E;  5G18 A;  4JGO A;  3PBT A;  1HZO A;  2Y2M A;  2W3G A;  3RXX A;  5AVF A;  2WUQ A;  4DN0 A;  3LR0 A;  3CLO A;  4JKT A;  3LIF A;  4Q0I A;  2Z6C A;  3IF5 A;  1S6R A;  1ALQ A;  4CLC E;  1NYM A;  1K38 A;  3K3D A;  2HV1 A;  3LI8 A;  2QJ7 A;  2Y4A A;  3E2L A;  1LSX A;  2W1T A;  3T4S A;  2XA7 M;  5DFX A;  4KG6 A;  1N9L A;  1MXO A;  2Y2L A;  4QY6 A;  3NUL A;  5C5K A;  3LY4 A;  3HJK A;  4S2J A;  1WA9 A;  2L4R A;  2Y2K A;  1MY8 A;  2Y8H A;  4MBH A;  1ERO A;  3EQU A;  3UNW A;  2YKH A;  3VOL A;  2EX8 A;  3Q82 A;  4ARZ B;  4BLM A;  3U4L P;  4GDB A;  1DY6 A;  1M6K A;  3GVB A;  1EW0 A;  5TBM B;  2B02 A;  3P98 A;  2XEP A;  4MEZ A;  2H0Y A;  1NZU A;  3ZYT A;  4R4R A;  4MLL A;  1GA0 A;  1QMF A;  3G2Z A;  1H8M A;  5D3O A;  3GTC A;  2GDN A;  2J7V A;  1JWP A;  2B95 A;  4OLG A;  2OWH A;  3FKV A;  1XX2 A;  2Z2M B;  4XUZ A;  2JE5 A;  3KSF A;  3SZT A;  5CGX A;  4KQR A;  3HLW A;  5I94 A;  3VP3 A;  4CLC D;  1L0D A;  4JF4 A;  3IWQ A;  4OQ0 A;  3BW6 A;  4F3L B;  4R3B A;  3HUO A;  3IF6 A;  3UB8 A;  3Q7V A;  1Y4O A;  4OQH A;  4BD1 A;  1DP9 A;  3PAE A;  5CHJ A;  5IHV A;  5AQ7 A;  3OZH A;  1G28 A;  3UB5 P;  3GSG A;  4NXB A;  4XXR A;  5IS1 A;  3AGD A;  2QYB A;  4F3L A;  3E4O A;  3T4L A;  1TEM A;  4R4S A;  4UA6 A;  3OCN A;  1KDS A;  5EVL A;  4NG2 A;  3N4I A;  1T19 A;  4K0W A;  1IKG A;  2R9X A;  4HH3 A;  5HPF A;  3V3R A;  3WS0 A;  1IKI A;  2P74 A;  2IA2 A;  1YPR A;  5FI6 A;  1HVB A;  3T12 B;  3CUE C;  4I3J A;  3BFC A;  4OP8 A;  3BFE A;  4DXC A;  2ZMA A;  2XH9 A;  5FDH A;  3A3I A;  1MWS A;  1FCO A;  4P6Z S;  1F5M A;  3SH7 A;  5HAQ A;  4EXO A;  2HDU A;  5IU1 A;  2P7J A;  4WUJ A;  1TF1 A;  4DE2 A;  2O9C A;  4UAA A;  3IWI A;  1PRQ A;  5GLA A;  3C5A A;  3L9K A;  3DTE A;  3V3S A;  1SKF A;  3VFF A;  3AGE A;  4ESP A;  5CXW A;  5FAQ A;  2OSU A;  5CEB A;  4GHI B;  1QME A;  4ZRR A;  5LBR A;  4DJ3 A;  3KSG A;  2FFY A;  2ZQC A;  2UWX A;  2ZC4 B;  3VE3 A;  4O01 A;  4MDZ A;  1MWR A;  3A3E A;  2Q0O A;  3G35 A;  4GHI A;  1XA1 A;  4S2K A;  3C7V A;  1MBL A;  1ONG A;  3MXQ A;  5BOH A;  3IF6 C;  5AQ9 A;  2R9W A;  1NY0 A;  2W1R A;  1TS0 A;  5AJG A;  1IYP A;  2A3U A;  4RVA A;  3MFD A;  5G4Z A;  2VGJ A;  4RX3 A;  1E3U A;  1BLH A;  1K4F A;  3KSI A;  4HI4 A;  1Z6F A;  1P9R A;  4HNB A;  4MBF A;  2IWB A;  4EUV A;  5M18 A;  2KLI A;  3GMW A;  3P01 A;  3UB7 A;  1CEG A;  2QHK A;  1OME A;  4P6B A;  5F1G A;  2V20 A;  4Y0O A;  3OPP A;  1F98 A;  5EEC A;  4IBX A;  5EVI D;  1BTL A;  3OPH A;  1W8Y A;  4QY5 A;  2VGK A;  3H82 B;  2W3H A;  3C30 A;  2PD7 A;  4X25 A;  1K54 A;  2P08 A;  2NUT C;  5J3W A;  4PM8 A;  3DTK A;  3VSL A;  1J3W A;  3UMD A;  2VZW A;  3F1O B;  5TJJ A;  1XP4 A;  1H8Y A;  1N9N A;  3JPU A;  2J9O A;  3SH8 A;  4FH2 A;  3A0R A;  3F1P B;  3H82 A;  3IQA A;  3CMZ A;  2VV7 A;  5HW3 A;  1SKO B;  3VP4 A;  3WRZ A;  2V1A A;  3KYZ A;  5L07 A;  3WWX A;  5HAI A;  3T1X A;  2HF6 A;  4R70 A;  2VLG A;  3SOI A;  1RP5 A;  1XPB A;  3F1P A;  2A24 A;  2ZQ7 A;  1NXY A;  4PM5 A;  3MMH A;  4P85 A;  3P09 A;  1SKO A;  4NEE D;  4WZ5 A;  5DFY A;  2XD1 A;  4B88 A;  4LRY C;  5FQ9 A;  1TS8 A;  1XFN A;  3PBO A;  4FTX A;  2ZOI A;  1F9I A;  1K56 D;  2JKT M;  3LIE A;  5JYO A;  5F83 A;  3TG9 A;  4Q8I A;  4EES A;  1KVL A;  1W7F A;  4U0T A;  4GZB A;  2JKR M;  3O87 A;  2V2F F;  2BG1 A;  3IX8 A;  2GX5 A;  2FFF B;  2AVX A;  1VET A;  4Z9Q A;  3CAX A;  2J3T C;  2WGW B;  4E3N A;  4LCL A;  3EGD C;  3UE1 A;  2PHY A;  4LRX C;  3LFV A;  1OPX A;  3CG5 A;  3ULF A;  3NC8 A;  1CJF A;  3G31 A;  3BJN A;  3M2K A;  3ISG A;  3O5Y A;  3G30 A;  4OON A;  5EOE A;  2R78 A;  4LEN A;  1K54 C;  3BQA A;  4RQ9 A;  4PKY G;  1K25 A;  2O9B A;  3CHW P;  4QD4 A;  1STZ A;  4OOY A;  4PHT A;  3A3D A;  3IHA A;  5G4Y A;  3R7W A;  3WS5 A;  3ZFZ A;  5KZH A;  1SCW A;  5M1A A;  5FEG A;  3LIB A;  3G34 A;  4X69 A;  1PWC A;  2K31 A;  1S1Y A;  4MNR A;  3OPL A;  2Y91 A;  4L0L A;  1WYB A;  4G3V A;  1YLW A;  5DTK A; 
#chains in the Genus database with same CATH homology
 5KIZ A;  2JKR I;  2XRN A;  4HP9 A;  3IS2 B;  4WF0 A;  1EW0 A;  1LSW A;  5TBM B;  4II7 A;  2B02 A;  4GLQ A;  2XA7 S;  4O8G A;  1UGU A;  3ZYT A;  4HOI A;  4ETZ A;  5MC7 A;  2W3F A;  3F1N A;  1H8M A;  3VE4 A;  3FC7 A;  4MN7 A;  4EQ1 A;  1OTB A;  5HSQ A;  3E4P A;  3MR0 A;  3PYP A;  3RH8 B;  2I9V A;  3NHQ A;  2OWH A;  3IS2 A;  3NOP C;  5F68 A;  3MQQ A;  1W63 M;  1YSP A;  2KDK A;  1UWN X;  3TRC A;  1OTE A;  3A0S A;  3KSF A;  3OBF A;  3CIT A;  4BMW A;  2L0W A;  2PDR A;  2QWS A;  4HIA A;  4NXG A;  5I5L A;  5DJT A;  4GS9 B;  4CLC D;  3EEA A;  3T50 A;  1NRJ A;  3BW6 A;  4F3L B;  1N9O A;  2W0N A;  3NOT C;  3UB8 A;  4I38 A;  3D72 A;  4EEP A;  1DP9 A;  1P0Z A;  3DBA A;  5HL6 A;  4WEL A;  2VV8 A;  3LR5 A;  1OT9 A;  1G28 A;  4GS9 A;  4B93 A;  2DMW A;  4NXB A;  5A8B A;  1VHM A;  3LUQ A;  4LRZ E;  4M4X A;  3S7P A;  3S7O A;  3ZQ5 A;  5IS1 A;  2QYB A;  5L8M A;  4JGP A;  4F3L A;  3E4O A;  4P6Z M;  3T4L A;  3TE8 A;  1XJ6 A;  2Z6D A;  3FPV A;  3OCN A;  1IOU A;  4IHQ A;  4IJG A;  2LB9 A;  1T19 A;  1T18 A;  4YNR A;  3OLO A;  2WKQ A;  4CLC C;  3BY9 A;  5HD3 A;  2H28 A;  2KX6 A;  4HH3 A;  1GSW A;  1OJG A;  1P97 A;  5HPF A;  4R3A A;  2ZMF A;  4B9O A;  2OAQ 1;  1YKD A;  1MC0 A;  2IA2 A;  3LI9 A;  3IBR A;  5HDC A;  4EET B;  4JGQ A;  3CUE C;  4I3J A;  2ZOH A;  4H6J B;  2XSS A;  4QPR A;  3K2N A;  1JNU A;  3PR6 A;  1DRM A;  4FSF A;  3CUE A;  4MCW A;  4UQI M;  1XJ4 A;  2GNX A;  1X0O A;  3EEH A;  2VJW A;  1LT0 A;  4P6Z S;  4BJP A;  1F5M A;  2V0U A;  4HH2 A;  1ZTU A;  4EXO A;  3PXP A;  5HWT A;  2YKF A;  1T1B A;  4Y3I A;  5IU1 A;  3CWF A;  2EA9 A;  2W27 A;  5CX7 A;  2P7J A;  4WUJ A;  1MZU A;  1TF1 A;  4G3W A;  1G6O A;  3E98 A;  2O9C A;  1V9Z A;  5KSH A;  2A24 B;  4GW9 A;  1NLY A;  3KO6 A;  1DP6 A;  3NJA A;  2GJ3 A;  3MQO A;  2OOL A;  2CMN A;  2OWJ A;  4I3A A;  3UB6 A;  1TS7 A;  2PYP A;  2VA0 A;  4MN6 A;  1KOU A;  4G3V A;  3T4T A;  2VX8 A;  5HWW A;  3HCY A;  4GHI B;  4UQI S;  4ZRR A;  4NXE A;  5LBR A;  4DJ3 A;  2JHE A;  3KSG A;  1Y28 A;  3CI6 A;  2ZMV A;  2WKP A;  4ARZ A;  1OTI A;  3GEC A;  3S7Q A;  3OC2 A;  3OOV A;  3NOU C;  2G7U A;  4XT2 B;  5J7E A;  3BQ8 A;  2D02 A;  2VV6 A;  4OOM A;  4HQA A;  1S1Z A;  1LL8 A;  3VE3 A;  2K7S A;  5TBM A;  1VB6 A;  3RFB A;  3FG8 A;  4O01 A;  4DJ2 A;  4UEY A;  2QJ5 A;  2LB5 A;  3KSH A;  5K5B A;  4MDZ A;  4HY8 A;  2L1M A;  2J3T D;  4GHI A;  3A0V A;  2V9A A;  1D7E A;  3LR3 A;  2OAP 1;  5DF9 A;  4NKP A;  4PKY A;  4DMZ A;  3EGX C;  3ICY A;  3MXQ A;  4HP4 A;  3C8C A;  5F6A A;  4XT2 A;  3TW8 A;  4L9E A;  2PT7 A;  3MQ0 A;  2W1R A;  1TS0 A;  3LID A;  5AJG A;  3W2Z A;  3LYX A;  3T4O A;  3LIA A;  5G4Z A;  5FL3 A;  1T1C A;  1UWP X;  2FZ0 A;  3H7W B;  1MKM A;  4HJ3 A;  4EU0 A;  4YOF A;  2M7U A;  4ME4 A;  2ZBB A;  4IUH A;  4KUO A;  2VKS A;  3B33 A;  1ODV A;  1XJ2 A;  1XFQ A;  3FPW A;  3KSI A;  1S67 L;  5HDD A;  4HI4 A;  3GDI A;  1P9R A;  3B47 A;  4HNB A;  4EUV A;  2EWW A;  4FOF A;  2QKP A;  4WN5 A;  3JVV A;  3IBJ A;  1S4R A;  2KLI A;  3P01 A;  1T1A A;  4L9G A;  3BY8 A;  3S7N A;  3UB7 A;  1LSV A;  2QHK A;  3PBQ A;  4NXF A;  3H7W A;  3OCL A;  2HJE A;  2W1T B;  3UME A;  2WKR A;  3R4K A;  3R7W B;  1F98 A;  2D01 A;  2PD8 A;  3C38 A;  3PBN A;  4R6L A;  3PBS A;  4Q0H A;  4L9F A;  5DJU A;  1V9Y A;  3UE6 A;  3H82 B;  3V67 A;  2W3H A;  3C30 A;  1D06 A;  4I3I A;  1S4S A;  2B18 A;  1TS6 A;  2PD7 A;  2EWV A;  4YWZ A;  2P08 A;  2NUT C;  5HZH A;  5J3W A;  1TD5 A;  3UMD A;  2HJ9 C;  2VZW A;  3BWL A;  3EOI A;  3F1O B;  4WL9 A;  3MJQ A;  4CQH A;  5TJJ A;  2FH5 A;  4GJ4 A;  1N9N A;  4HHD A;  3KX0 X;  3EWK A;  3A0R A;  2J80 A;  3F1P B;  3LIC A;  2M7V A;  3H82 A;  4H6J A;  2VV7 A;  1BYW A;  2JKT I;  2PR6 A;  5DKK A;  1OTA A;  3E0Y A;  2PYR A;  2V1A A;  2BAS A;  4BWI A;  4WEK A;  3PBR A;  3KYZ A;  1DP8 A;  3F1N B;  4IUK A;  2J3W A;  4KQD A;  2HF6 A;  3KYQ A;  4KUK A;  3VV4 A;  4LPZ A;  4R70 A;  3TJZ C;  2VLG A;  5HPI A;  2V1B A;  3F1P A;  2A24 A;  1NLZ A;  3C2W A;  2O99 A;  3MMH A;  4AFI A;  2P04 A;  4Y2F A;  5HDS A;  4E04 A;  4NEE D;  2PR5 A;  5HWV A;  5DFY A;  2JN7 A;  2Y79 A;  3D3O A;  4LRY C;  4MMN A;  1TS8 A;  4KQO A;  3EQV A;  4Z1W A;  1OJ5 A;  2VGL M;  1XFN A;  5F69 A;  3PBO A;  4R38 A;  2ZOI A;  1F9I A;  2JKT M;  3LIE A;  3U2A A;  3T4J A;  5IT5 A;  3G6O A;  1OT6 A;  4LLO B;  5DKL A;  4BBT A;  3UE3 A;  4EES A;  3T4K A;  1W63 Q;  3RTY A;  2XRO A;  4BBU A;  1GSX A;  3B42 A;  2JKR M;  4I5S A;  4GCZ A;  2K2N A;  4K08 A;  2KOI A;  4BBV A;  2M1C A;  2GX5 A;  2VEA A;  4Y5F A;  4G3K A;  4JGR A;  5EFW A;  1ZHH B;  2VGL S;  3JVU A;  3UB9 A;  4HJ6 A;  5F5Y A;  3SW1 A;  2NUP C;  5HD5 A;  3MFX A;  3MF0 A;  1YSQ A;  4ETX A;  3CAX A;  2J3T C;  4JGO A;  1P9W A;  3PBT A;  4EER A;  3EGD C;  1S66 L;  2PHY A;  2W3G A;  4EW7 A;  4LRX C;  2V0W A;  3LFV A;  3T4Q A;  1OPX A;  4CLC B;  3ULF A;  5AVF A;  4DN0 A;  3BJN A;  1NWZ A;  2O9A A;  5AVE A;  3O5Y A;  3LR0 A;  2O0Y A;  4Q0J A;  4I39 A;  3CLO A;  2W3E A;  3LIF A;  2R78 A;  4HJ4 A;  4PAU A;  1XJ3 A;  3BQA A;  4Q0I A;  2Z6C A;  4CLC E;  2HGV A;  4RQ9 A;  3E4Q A;  4PKY G;  2O9B A;  3K3D A;  2HV1 A;  3LI8 A;  3PHY A;  2QJ7 A;  2W3D A;  4OOL A;  4WLA A;  1STZ A;  2A2L A;  1IFQ A;  2INW A;  4MN5 A;  3K3C A;  1OTD A;  2GZA A;  4EEU A;  1LSX A;  2W1T A;  4PHT A;  3T4S A;  4CLC A;  5G4Y A;  3R7W A;  2XA7 M;  1GSV A;  5DFX A;  1H3Q A;  3HJI A;  1N9L A;  1YAX A;  3H9W A;  3P7N A;  3LIB A;  5J4E A;  5C5K A;  4O0P A;  3HJK A;  2K31 A;  1S1Y A;  2MJ6 A;  1WA9 A;  2L4R A;  3LR4 A;  2Y8H A;  3EQU A;  2YKH A;  3VOL A;  4WEJ A;  4L0L A;  4ARZ B;  3F1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...