3UMDA

Structure of pb intermediate of photoactive yellow protein (pyp) at ph 4.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title pH Dependence of the Photoactive Yellow Protein Photocycle Investigated by Time-Resolved Crystallography.
pubmed doi rcsb
molecule tags Protein binding
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3umdA00
2D02A 2KDKA 2W27A 1F9IA 2QKPA 4BBUA 2R78A 4XT2B 5KIZA 4LLOB 3K3CA 1LT0A 5G4YA 4R6LA 2QJ7A 3LIDA 3E4QA 1UWPX 2A24B 3F1NA 5EFWA 4HHDA 2VEAA 1GSWA 1XJ6A 2W0NA 4HOIA 1V9ZA 4F3LA 5F69A 4WL9A 3GECA 1DP6A 1N9NA 1DRMA 3MFXA 2YKFA 4L9EA 3F1PA 1OJGA 2M1CA 4MN5A 1P0ZA 4LRZE 2Z6CA 1T1BA 1VB6A 3MR0A 2VV6A 4XT2A 3LUQA 3FC7A 3VOLA 1UGUA 3SW1A 5HSQA 4HH2A 4I3AA 3CWFA 4JGOA 2A24A 4H6JB 2JHEA 3MJQA 4M4XA 4JGPA 4EEUA 1KOUA 3H82B 5AVFA 1S67L 5IS1A 1XFNA 4PKYA 3NOPC 1GSVA 1EW0A 4GS9B 5DJUA 2BASA 4MN6A 3LIEA 3LYXA 2VV7A 4NXEA 5J4EA 1OTBA 1OTDA 5DKKA 3KX0X 3BY8A 5I5LA 1T1CA 2L4RA 2JN7A 3ULFA 3A0SA 1P97A 3G6OA 3H7WB 4KUKA 3E4OA 3HJKA 1OTEA 3H9WA 1S4SA 4EXOA 5HZHA 4EESA 3GDIA 1S66L 3LI8A 5G4ZA 4GW9A 4H6JA 2PYPA 3D72A 1X0OA 2EA9A 3H82A 1V9YA 2PR5A 3UMEA 1TS7A 2D01A 2HV1A 4BBTA 5HWWA 3LICA 1LSWA 3LIAA 1BYWA 4GS9A 1N9OA 2J80A 2INWA 2ZOIA 1T19A 3HJIA 1XJ2A 4DJ2A 2PYRA 4HIAA 2V1BA 4HQAA 1LSXA 4B9OA 1LL8A 3NOUC 5J7EA 2KX6A 1D06A 2VLGA 4I3JA 4EQ1A 3H7WA 5A8BA 2H28A 1OT9A 2V1AA 4NXGA 5HWTA 4LRXC 1XJ4A 5TBMA 4RQ9A 1OJ5A 5HDCA 2V9AA 5IU1A 2QHKA 3ZQ5A 4KQDA 4NXBA 5F5YA 4PKYG 3C2WA 1T18A 2OWHA 3P7NA 4HJ4A 2K7SA 4DJ3A 3OLOA 3A0VA 3FG8A 3E4PA 1OTAA 4HNBA 5HDDA 1OTIA 3MQOA 4BBVA 1S1YA 3PHYA 4WUJA 1GSXA 5HWVA 3F1OB 2L0WA 3IS2B 3PYPA 4EEPA 2VV8A 2PDRA 3UB6A 2WKRA 4HI4A 4LRYC 5HD5A 4GCZA 1XJ3A 4WLAA 4EETB 4LPZA 1T1AA 4HP9A 4JGQA 5TBMB 3UB9A 3UE6A 1S4RA 3MXQA 1WA9A 3RTYA 4JGRA 1N9LA 1TS6A 4HJ3A 1F98A 3LI9A 1JNUA 3IBRA 3EEHA 1G28A 1MZUA 2GJ3A 2PHYA 2PD7A 3VE3A 3UB7A 4L9GA 1TS8A 4WF0A 3F1OA 5F68A 3K3DA 3IS2A 1OT6A 4HY8A 2OOLA 4HP4A 3VE4A 2V0UA 5HDSA 5DJTA 4I38A 4I39A 1ODVA 2L1MA 2PD8A 4HJ6A 3CAXA 1UWNX 4WN5A 2PR6A 3NJAA 3UB8A 2B02A 3C8CA 5AVEA 2Z6DA 5J3WA 4R70A 2V0WA 4GHIB 5HD3A 1Y28A 3UMDA 1DP8A 4I5SA 2I9VA 2WKPA 3LIBA 4NXFA 1DP9A 1NWZA 5DKLA 4EERA 2CMNA 3ICYA 4R3AA 3NHQA 2YKHA 3RH8B 4K08A 2ZOHA 3BY9A 3A0RA 3F1NB 3EWKA 3BWLA 4R38A 1LSVA 2QWSA 1XFQA 1D7EA 2OWJA 2QJ5A 1TS0A 3B33A 4HH3A 4L9FA 3CLOA 4YWZA 4I3IA 4E04A 3LIFA 4F3LB 5F6AA 4KUOA 1S1ZA 3NOTC 4EW7A 2ZBBA 4GHIA 3F1PB 2WKQA 2P7JA 3T50A 3MQQA
chains in the Genus database with same CATH superfamily
2W27A 2R78A 3DW0A 5KSHA 5KIZA 3K3CA 4RA7A 1ZG6A 1Z6FA 3IBJA 3F1NA 1BLCA 3DTEA 4E3NA 4Y7PA 4OPYA 1MWUA 5DF9A 2R9XA 3PBQA 4MLLA 3DWZA 5GLCA 3LGOA 3WRZA 5CGWA 1S6RA 2Q9NA 5CHJA 4GB7A 5F69A 5LBRA 4OQIA 3RXXA 4OQHA 1MXOA 4YNRA 1DP6A 1N9NA 4NK3A 4HBTA 2J7VA 2YKFA 2JBFA 3NDEA 4ZBEA 3A3EA 5C5KA 1PWCA 1WYCA 3RJUA 5AQ9A 1NLZA 4LRZE 4ZJ1A 3S4XA 4OQ0A 3MZDA 3GMWA 4KZBA 5A93A 4XT2A 1CQAA 3MBZA 3SW1A 3PBSA 5HSQA 4HH2A 4I3AA 4WBGA 4FCFA 3SOIA 1KGGA 2JHEA 2QPNA 4DXCA 3T4LA 1K57C 3NECA 2HPBA 3K2NA 1E3UD 1GA0A 1STZA 3NOPC 3S1YA 4WZ4A 1EW0A 2R9WA 3U4LP 4ID4A 3HL9A 2ZC7A 2VV7A 4QD4A 3A3IA 3VFHA 1NJ4A 3ZHHA 2XRNA 5DF7A 2O0YA 1OTBA 2HJEA 3WWXA 2P04A 2O99A 3G2YA 3C38A 4N9KA 2WAFA 3Q07A 1T1CA 1W5DA 1HTZA 4WELA 4ZTKA 3ULFA 1O7EA 3A0SA 1NYMA 4KUKA 3HJKA 4ARZA 5FASA 4EXOA 4WYYA 3S22A 2XD1A 5GHXA 4P0MA 1S66L 5G4ZA 3GQZA 3LFVA 3N8RA 3MZEA 2A3UA 3BEBA 4OOLA 2PR5A 3CJMA 3UMEA 1TS7A 5TR7A 2B95A 2WAEA 3CG5A 2NUTC 3LIAA 5EVIA 4GS9A 2J80A 2INWA 2ZOIA 3HJIA 1YLTA 3UB5P 2V1BA 4ZRRA 4B9OA 1FQGA 4ZDXA 1LL8A 3C7UA 5J7EA 3CITA 3MS6A 5F1FA 2IWDA 1VETB 2ZM2A 4I3JA 2EX2A 1A0KA 4DDYA 4Z9QA 3OBFA 1PW1A 5A8BA 2V1AA 3BM6A 1XJ4A 4RQ9A 1OJ5A 1W79A 1MWTA 1ZKJA 2HP9A 2HDRA 2QHKA 1VEUB 3HLWA 1MBLA 3LCEA 4NXBA 4CLCC 5F83A 4OPQA 3UN7A 5EVEA 4BMWA 3DBAA 4U3TA 2M7UA 3GR2A 1AXBA 5U47A 1PNEA 3P7NA 2XF3A 4DJ3A 3TSGA 2G2UA 2GNXA 3FG8A 4KG5A 2BG1A 4DF6A 1GCEA 3OCNA 4GD8A 1CEGA 3IH9A 4GOGA 4EV4A 1L0EA 2ZQ8A 4P6BA 5DTSA 2RCXA 1L0DA 4GJ4A 2E8IA 1W63M 3WS1A 3ZG0A 4FOFA 4HI4A 3RFBA 3GRJA 5FAPA 1GHIA 3C30A 5HFOA 3ZNYA 4LFUA 4S2NC 3UE6A 1S4RA 4CLCB 3MXQA 5E43A 1QMFA 1YAXA 1GA9A 2HJ9C 4FH2A 3JVVA 1BZAA 3BW6A 1F98A 1IYPA 4IJGA 4KZ6A 3BYDA 3WS2A 4R1GA 5CRFA 3IHAA 3S7QA 3FWLA 4OH0A 1NRFA 5L10A 3DWKA 3NIAA 4KZ7A 2PD7A 4LV2A 4E3OA 3NBLA 2CC1A 3IS2A 4QY6A 2OOLA 1PWGA 4PHTA 3C5AA 2W3EA 3MXRA 2EWVA 2ZQAA 2NUPC 4WMCD 3B3XA 4I39A 1ODVA 2L1MA 4E3LA 4EBLA 3HLCA 2Y59A 2WGIA 5HAIA 5FEGA 1EWZA 2B02A 2XLNA 5M1AA 5TFQA 1FR6A 2XFTA 4R70A 2Y2HA 4UA6A 4S2JA 5HD3A 3UNWA 4PMAA 5CHUA 1E4DA 4MBFA 1PI5A 1YLZA 3V3SA 1KDWA 1RCJA 2H5SA 1DY6A 2BTFP 1PRQA 1ZC2A 5EM0A 4NXFA 3QNBA 3PBNA 5DKLA 1M40A 1TDGA 4Q0HA 4K0WA 3LR0A 4EQIA 1Y54A 3RH8B 4K08A 1YLPA 2ZOHA 4JXSA 3F1NB 1NXYA 2Y2QA 2Y2MA 5KSCA 1C3BA 3C7VA 4R38A 4B93A 2QWSA 2DNSA 3WS4A 3MF0A 4QJGA 2FFYA 2OWJA 3HVFA 1NRJA 2JKRM 5MC7A 4K91A 5HPFA 1Z09A 4MCWA 1EI5A 3IWIA 4L9FA 1YSQA 4YWZA 4JF5A 1FSYA 1ES4A 4ESPA 4E6WA 1S1ZA 3KSHA 4II7A 5FAQA 4R3BA 4P87A 4C75A 3BFDA 1E3UA 2Y4AA 1ERMA 4UQIS 4S2MA 1L0GA 1J3WA 1ZTUA 1F9IA 5E2FA 4R4SA 4XT2B 4B88A 3W8KA 4DXBA 3T4KA 2E8JA 1LT0A 4IVIA 3BECA 3MKEA 1K6RA 1UWPX 4ETXA 3UDIA 1K55A 1XX2A 4ZJ2A 1GSWA 5EVIC 3BRMA 2JC7A 1XA1A 3BLSA 3PAGA 3OOVA 4FTXA 4QHCA 3NCKA 3B47A 1DRMA 4DE0A 1TDLA 3TG9A 5CECA 5EECA 4KG6A 3MFXA 4L9EA 1OJGA 5HL6A 4BD1A 4EUZA 1OMEA 1P0ZA 2J3WA 4HBUA 3FPVA 3Q81A 1T1BA 1MKIA 3UDFA 2Y2LA 3EGDC 4RX3A 3LUQA 2Z2MB 4X1LA 5FSRA 3Q7ZA 3CWFA 1ES3A 4JPMA 2A24A 4EEUA 4JGPA 4OKPA 3V5MA 1YPRA 1S67L 4Q8IA 2ZL1A 1XFNA 4S2LA 2HDSA 3V39A 3G30A 2W3FA 3BJNA 4GS9B 4CLCE 5DJUA 4UQIM 2UWXA 1SHVA 1YLYA 5FATA 3KSIA 1VHMA 2HDQA 4NXEA 3VV4A 5J4EA 3PAEA 1OTDA 4LCMA 2P9VA 3KX0X 2A2LA 3BY8A 5I5LA 3BQ8A 2L4RA 3B42A 1W8YA 3AGFA 2W1TA 1S4SA 5HZHA 4P6ZM 3GDIA 2XGNA 2AVXA 3LI8A 1ES5A 3T1SA 4GW9A 4H6JA 1OPXA 3GVBA 1V9YA 2HF6A 3QP1A 4U0TA 1SKFA 2Q9MA 1BYWA 3IH8A 4XUZA 2XFSA 1N9OA 1T19A 1XJ2A 1RGZA 5IT5A 4JXVA 2PYRA 1TEMA 1BLSA 5AQAA 1M6KA 2XA7S 2WGWB 5FI2A 5TJJA 3NOUC 2Y79A 4EUVA 4S2OA 2HZ5A 5TGFA 2VKSA 4PM8A 4Y2FA 1FCOA 3ZG7B 2HP5A 1JWPA 1W7FA 4IUHA 1K38A 1OT9A 1H8YA 3BFEA 2RL3A 2OLVA 3CHWP 4LRXC 1NZUA 5HDCA 3BFFA 4JF4A 4GDBA 2PT7A 1FCNA 5E2EA 3C2WA 3L9KA 1YT4A 4LENA 1T18A 1KGEA 3A3JA 5AJGA 1G6AA 1W8QA 5E2GA 4QY5A 2EX8A 5FQQA 3A0VA 4NKPA 5HARA 4DE2A 1IKIA 4G3VA 3ZVTA 1HD8A 2GDNA 2VK3A 1KVMA 5CEDA 3MQOA 3HLFA 2Y91A 4KZ3A 5HL1A 3NDGA 1JWZA 1GSXA 1KE4A 3IS2B 4EEPA 1IKGA 3OPRA 2IWBA 2JKRI 4JKTA 5L07A 5HX9A 4FSFA 2QMIA 5L09A 5EOOA 2Y55A 4QPRA 4LPZA 1T1AA 3IXDA 2H0YA 2OLUA 4OLDA 3Q7VA 4JGQA 5TBMB 4QWOA 1IYSA 2PU4A 3O5YA 3UB9A 2FFFB 4X56A 2XA7M 3PTEA 3RTYA 2FZ0A 3TJZC 1TS6A 3E0YA 1YKDA 2Y2JA 3LI9A 1JNUA 4MDZA 4EBNA 3T4JA 4UHUA 2Y2IA 1PI4A 3QP5A 3V67A 1SKOA 3VOYA 3UB7A 1K55C 1IELA 2VGLM 2J3TD 4L9GA 1BTLA 1KVLA 4OPRA 3V3RA 3F1OA 3NI9A 5F68A 3HLGA 1OT6A 4UA9A 1JVJA 2JKTM 3VE4A 3LR3A 3IXBA 5HDSA 4PAUA 1G6OA 4WM9A 2VJWA 3IXGA 4HJ6A 3CI6A 4IEDA 5CHMA 3TRCA 4B4XA 2ZJ9A 3HUMA 2B18A 1MC0A 1YMSA 3O88A 3M6BA 1ACFA 4LV1A 2V0WA 1FOFA 3L7HA 3R7WA 2XK1A 2QZ6A 1Y28A 2JKFA 1NZOA 4EBPA 1N9BA 2I9VA 2H0TA 1K6SA 3LIBA 2P74A 3TW8A 3ZVWA 1NWZA 4OQGA 3MMHA 4CPKA 1W63Q 3W2ZA 1PYYA 5EM1A 1PZOA 4DMZA 4E3MA 5HW3A 2VX8A 1LSVA 1MWRA 4Y13A 4MMNA 2QJ5A 3IX3A 3LY4A 1TS0A 4HH3A 5CGSA 1KE3A 4Z1WA 1F2KA 3N4IA 4LV3A 3HBRA 3IXHA 1XPBA 5CX7A 2ACGA 5AQ7A 3IX8A 5FQ9A 3EQVA 5FI7A 3T1QB 1BSGA 3PR6A 4GHIA 3W4PA 5FL3A 2V8FA 3T50A 1BT5A 2X02A 2J9PA 3MQQA 4LCLA 3ZFZA 4DE3A 2QKPA 1BULA 4BBUA 4O7DA 4RX2A 4LLOB 4PM5A 3E98A 3E2LA 4Y3IA 4BENA 1IFQA 3LIDA 3OPHA 3E4QA 2A24B 4HHDA 3IF5A 2EXBA 5CTNA 2Y2NA 3N8SA 2ZL1B 1XA7A 3VSLA 2W0NA 5BOHA 5JYOA 2ZQDA 4BD0A 3T4SA 4KG2A 1G68A 4F3LA 4WL9A 1LL9A 3KYZA 4S2PA 2GX5A 3MKFA 1YSPA 3GECA 3C4PA 4N92A 5FA7A 4WZ5A 3F1PA 1PW8A 3SZTA 2P9VB 5F82A 4MN5A 4YINA 3MSHA 1EROA 3LEZA 2Z6CA 1JTDA 4LV0A 3MXSA 2VV6A 1FSWA 3ZNTA 3FC7A 3TE8A 1UGUA 1KDSA 3NULA 1RP5A 3IX4A 2OV5A 3T4QA 4H6JB 3IT9A 3N8LA 4FUWA 4GKUA 5CERA 4OVDA 2B5RA 3N7WA 3UO9A 2JE5A 5D3OA 3VP0A 4R23A 3S7OA 1GSVA 3C4OA 2V1ZA 4MN6A 4OOMA 3LIEA 3LYXA 3QNCA 4DRTA 4BL2A 4XXRA 3QP6A 2WUQA 1LI9A 1VETA 3KO6A 4AFIA 2WZZA 3O3VA 5CGXA 1NYYA 4BLMA 4NG2A 3CPTA 1CI9A 2JN7A 2WKIA 2PRFA 5GLBA 1GHMA 1P97A 4KZ5A 4X1MA 3E4OA 4UAAA 4FH4A 4PM7A 1ALQA 1VEUA 2V8CA 3CUEC 3HLDA 5HAPA 1ONHA 2EA9A 1YQSA 3H82A 2D01A 3QP4A 3ZG8B 2HV1A 4BBTA 3LEQA 5HWWA 1LSWA 3VP4A 4R3JA 3DTKA 1BUEA 5DF8A 3EOIA 4MBKA 4KQQA 4P6ZS 4DJ2A 4HIAA 4B4ZA 1IYOA 1LSXA 4KZ9A 3OCLA 4KENB 2V2FF 1ESUA 3WS5A 1ES2A 1MKMA 2JKTI 3KSFA 3UE1A 3H7WA 3S7NA 5AQBA 2H28A 1TF1A 3PBTA 3VOZA 4ARZB 2V9AA 4N9LA 5FEFA 5GLAA 4PM9A 1QMEA 2DMWA 2XH9A 5F5YA 4PKYG 4BQMA 3IF6C 1LL5A 1ZHHB 2BLSA 4EWFA 4ZJ3A 5FQJA 4HJ4A 3EEAA 2VGKA 1O07A 5GLDA 1SDNA 5EVIB 3E4PA 2LB9A 1OTAA 3HUOA 4HNBA 2XQZA 3KYQA 5A92A 4PPRA 1K56D 1WYBA 2UV0E 5HDDA 1PFLA 5L8MA 4BBVA 1SKOB 3PHYA 4WUJA 1FIKA 2ZC3B 1DJBA 3F1OB 2L0WA 5KMWA 4FD8A 3KYEA 2VA0A 2ZQ9A 2VV8A 2PDRA 1H0MA 4GZBA 3SS4A 2HGVA 3UB6A 1HVBA 4MNRA 3BQAA 4LRYC 2J8YA 4GCZA 2ZQCA 3UDXA 1XJ3A 2ZC5B 3W4QA 5FDHA 3UE0A 5CEBA 3KSGA 4EETB 4X69A 3DAVA 3O86A 4N1HA 1N4OA 3G34A 5E2HA 3SH7A 2PBYA 3LR4A 1N9LA 3R7WB 4HJ3A 1LLBA 3IBRA 3EEHA 4OLGA 1FCMA 2QYBA 2G2WA 1ZG4A 1G28A 2XDMA 2MJ6A 2GJ3A 3IWQA 1JWVA 2PHYA 2W3GA 2ZLYA 3VE3A 3SH9A 3WS0A 1TS8A 4WF0A 3K3DA 4HY8A 4HP4A 2K2NA 3NC8A 4JF6A 4WEJA 4I38A 4XUXA 3SS5A 2PBDP 5EVLA 5A91A 5FQIA 3CAXA 4KZ4A 3VP1A 4X25A 4WN5A 2JKGA 4ME4A 2PR6A 1XP4A 2VGLS 3C8CA 1D1JA 4HEFA 3FYZA 4WZ5C 4Y0TA 3ZYTA 3ZDJA 4R4RA 1K0KA 4GHIB 2ZMAA 2Q0OA 1XGJA 4BJPA 3VFFA 3FKVA 3HCYA 3UMDA 3UPPA 1DP8A 4I5SA 4WMCA 4Q0IA 4F94A 2O9CA 2WKPA 3RXWA 3IHBA 4E6XA 4D2OA 5FAOA 4JBFA 4EERA 3ZG5A 5CTMA 2CMNA 3ICYA 4R3AA 4Y15A 2YKHA 4JXWA 4DKIA 1I2WA 3OPPA 3A0RA 1HZOA 3EWKA 2X01A 2WZXA 1PWDA 3IQAA 4RVAA 1D7EA 2ZMVA 2OAQ1 4CQHA 3T4OA 1NY0A 3CLOA 4IHQA 3HLEA 4F3LB 1YM1A 5F6AA 5DFYA 3CUEA 3ITAA 1FR1A 1IEMA 1I2SA 4EW7A 4GN2A 2K31A 2W1RA 2ZBBA 4OP5A 3F1PB 4GDNA 5G18A 5FQMA 4Y0OA 1ERQA 4IUKA 2D02A 2KDKA 4N1XA 5G4YA 4R6LA 1XKZA 3N6IA 2QJ7A 1SCWA 4KZ8A 4IBRA 5EFWA 4CLCD 1VQQA 4KQRA 2VEAA 3NY4A 4MEZA 1XJ6A 4YOFA 4L0LA 5DFXA 3UPNA 4GLQA 3E2KA 1F5MA 3M6HA 4HOIA 1V9ZA 1JTGA 3OZHA 2Y2PA 4H8RA 1CI8A 3JYIA 2KOIA 1KGFA 1CEFA 1WE4A 4Y17A 3PXPA 1K25A 2OAP1 3A3FA 2M7VA 3VP2A 4ETZA 4JXGA 4O0PA 3DTMA 1K54C 2G7UA 2M1CA 3IF6A 4G3WA 5A90A 5M18A 3CPTB 3PBRA 3GSGA 1VB6A 1AWIA 5FQKA 3MR0A 5F1GA 3BFCA 4OP8A 5M19A 5DTKA 3VOLA 1Y4OA 4S2KA 4Q0JA 3ZCZA 4JGOA 2IWCA 3MJQA 4M4XA 2J3TC 1KOUA 3H82B 3Q1FA 2W3HA 5AVFA 2XD5A 5KZHA 5FI6A 5IS1A 4D60A 1SDEA 3HLBA 4S2IA 1PIOA 4PKYA 4ZAMA 2XSSA 5EPHA 2C6WB 3HUNA 1P9WA 1H5XA 1H8MA 2BASA 2EXAA 3UPOA 2WGWA 2A49A 1BLHA 2I72A 1Q2QA 2J9OA 3ZGAB 4OONA 5DKKA 4NEED 2OSUA 1U60A 3JPUA 2WYXA 1XXMA 1CF0A 4EU0A 3BFGA 3G6OA 4DDSA 3H7WB 1DJCA 1OTEA 2Y2OA 3H9WA 3U2AA 3SH8A 1KE0A 4QU3A 5JYPA 4EESA 3PBOA 4KZAA 3D3OA 2EX9A 4YFMA 2PYPA 1K56A 3D72A 1X0OA 4GD6A 1NLYA 3CMZA 1BLPA 5EUAA 4M3KA 3OPLA 4A5RA 5GL9A 3GV9A 2ZQ7A 2HDUA 3LICA 3R4KA 4X55A 1ESIA 2Y8HA 2DCFA 3QP2A 4U0XA 2WKEA 4JLFA 3ITBA 4OPZA 4HQAA 1CK3A 4X53A 1P9RA 4PM6A 2KX6A 1D06A 4RYEA 3ZG9B 2VLGA 5HPIA 2EFUA 3VMAA 4O01A 1Q2PA 2Y2GA 4EQ1A 3I7JA 2DRWA 5EOEA 4CJNA 4DN0A 4Y5FA 4IVKA 3W4OA 5EV0A 3MFDA 4NXGA 5HWTA 2V20A 1S0WA 5TBMA 4NETA 2W1TB 2WKHA 5IU1A 5CXWA 2WGVA 1YMXA 2XR0A 4KQDA 3ZQ5A 3OC2A 5L2FA 4C3QA 3FKWA 3FZCA 2WADA 4C6YA 1K57A 1MPLA 1ONGA 2OWHA 2ZM8A 3MZFA 5IHVA 1FILA 1H8ZA 1PZPA 2K7SA 3AGDA 3G31A 5FDSA 5HAQA 2VZWA 3OLOA 3DTIA 2HP6A 3P09A 3V50A 1L3LA 3MQ0A 3G2ZA 1LHYA 4Y0UA 4X6TA 2JCHA 3Q82A 3VSKA 3EGXC 5I94A 1OTIA 1S1YA 3JVUA 4P85A 5HWVA 3PYPA 3T12B 4HESA 5EVID 2IA2A 2ZC6B 1MY8A 2FH5A 5GHYA 3T1XA 1I5QA 3D9YA 2WKRA 5HD5A 2X71A 1K4FA 3LO7A 4WLAA 1YLJA 3G4PA 1HLUP 4HP9A 2EFXA 3FV7A 1YLWA 2WK0A 4KQOA 3ISGA 4BL3A 5GHZA 3P98A 3BLMA 1WA9A 4JGRA 2Z2LB 3GTCA 1CJFA 2ZD8A 5J8XA 2O9BA 4UA7A 2XROA 2Y2KA 1E25A 4MBHA 2KLIA 1L2SA 1MZUA 3M2KA 1MWSA 3FPWA 1H3QA 1IYQA 3QP8A 1IOUA 1XGIA 3LY3A 5K5BA 4BWIA 3CZDA 3P01A 2P08A 3O87A 1K54A 2V0UA 3A3DA 1LI0A 4WEKA 5DJTA 4E3KA 2PD8A 3TOIA 4LGWA 4IBXA 4UEYA 2EX6A 1DJAA 1UWNX 2O9AA 1TD5A 3NJAA 3UB8A 1RGYA 4QB8A 1G5UA 3G35A 3HREA 5AVEA 2Z6DA 3SS3A 5J3WA 4CLCA 3Q7VB 3D4FA 1K4EA 4E3IA 3WRTA 2ZM0A 4K0XA 3LR5A 2ZC4B 2ZMFA 2PU2A 4GNUA 3S7PA 1GHPA 4DE1A 3AGEA 1SZVA 1DP9A 3T4TA 4MN7A 2PAVP 3NHQA 1L0FA 5EE8A 3EQUA 2GZAA 3BY9A 2W3DA 2EWWA 4R0QA 3BWLA 2C5WB 4O8GA 1XFQA 3VP3A 2VGJA 3B33A 3M2JA 5DVAA 2H10A 4I3IA 4E04A 1J9MA 3LIFA 3UE3A 3G32A 4G3KA 2LB5A 3UY6A 4KUOA 3T1RA 4OOYA 3NOTC 3QHYA 1VM1A 4E3JA 4S2NA 3IWOA 2XEPA 2WKQA 4X68A 2P7JA 5DTTA 3IF6B 1TVFA
chains in the Genus database with same CATH topology
1ZTUA 2D02A 2KDKA 2W27A 1F9IA 2QKPA 4BBUA 2R78A 5KSHA 4XT2B 5KIZA 4LLOB 3K3CA 3T4KA 3E98A 1LT0A 4Y3IA 5G4YA 4R6LA 1IFQA 2QJ7A 3LIDA 3E4QA 1UWPX 4ETXA 2A24B 3IBJA 3F1NA 5EFWA 4CLCD 4HHDA 2VEAA 5DF9A 1GSWA 1XJ6A 3PBQA 4YOFA 4L0LA 5DFXA 2W0NA 4GLQA 1F5MA 4HOIA 1V9ZA 3T4SA 4F3LA 3OOVA 2KOIA 5F69A 5LBRA 4WL9A 3KYZA 4YNRA 3PXPA 2GX5A 1YSPA 1DP6A 1N9NA 1DRMA 2OAP1 3B47A 3GECA 2M7VA 4ETZA 3MFXA 2YKFA 4L9EA 3F1PA 1OJGA 4O0PA 5HL6A 2G7UA 2M1CA 4MN5A 1P0ZA 2J3WA 4G3WA 5C5KA 3FPVA 1NLZA 2Z6CA 3PBRA 4LRZE 1T1BA 1VB6A 3MR0A 3EGDC 2VV6A 4XT2A 3LUQA 3FC7A 3TE8A 3VOLA 1UGUA 3SW1A 3PBSA 5HSQA 4HH2A 4I3AA 4Q0JA 3CWFA 4JGOA 2A24A 3T4QA 4H6JB 2JHEA 3MJQA 4M4XA 4JGPA 4EEUA 2J3TC 1KOUA 3H82B 2W3HA 5AVFA 3T4LA 1S67L 5IS1A 3K2NA 1STZA 1XFNA 4PKYA 3S7OA 3NOPC 1GSVA 1EW0A 2XSSA 2W3FA 3BJNA 1P9WA 4GS9B 4CLCE 5DJUA 4UQIM 1H8MA 2BASA 4MN6A 4OOMA 3LIEA 3LYXA 2VV7A 3KSIA 1VHMA 4NXEA 3VV4A 5J4EA 2XRNA 2O0YA 3KO6A 1OTBA 2HJEA 4AFIA 1OTDA 2O99A 2P04A 3C38A 5DKKA 3KX0X 2A2LA 3BY8A 4NEED 5I5LA 1T1CA 3BQ8A 2L4RA 3B42A 2JN7A 4WELA 3ULFA 3A0SA 4EU0A 1P97A 3G6OA 3H7WB 4KUKA 3E4OA 3HJKA 4ARZA 2W1TA 1OTEA 3H9WA 1S4SA 3U2AA 4EXOA 5HZHA 4P6ZM 4EESA 3GDIA 3PBOA 1S66L 3CUEC 3D3OA 3LI8A 5G4ZA 4GW9A 4H6JA 1OPXA 2PYPA 3LFVA 3D72A 1X0OA 2EA9A 3H82A 1V9YA 4OOLA 1NLYA 2PR5A 3UMEA 1TS7A 2D01A 2HF6A 2HV1A 4BBTA 5HWWA 3LICA 3R4KA 2NUTC 1LSWA 3LIAA 1BYWA 2Y8HA 4GS9A 1N9OA 2J80A 2INWA 2ZOIA 1T19A 3HJIA 3EOIA 1XJ2A 4P6ZS 4DJ2A 5IT5A 2PYRA 4HIAA 2V1BA 4HQAA 4ZRRA 1LSXA 4B9OA 2XA7S 3OCLA 5TJJA 1LL8A 3NOUC 2Y79A 1P9RA 4EUVA 5J7EA 2KX6A 1D06A 3CITA 2VLGA 2VKSA 1MKMA 2JKTI 5HPIA 4Y2FA 3KSFA 4O01A 4I3JA 4EQ1A 3H7WA 4DN0A 3S7NA 3OBFA 4IUHA 5A8BA 2H28A 1TF1A 1OT9A 2V1AA 4Y5FA 3PBTA 4NXGA 5HWTA 4LRXC 1XJ4A 5TBMA 4RQ9A 1OJ5A 5HDCA 4ARZB 2W1TB 2V9AA 5IU1A 2QHKA 3ZQ5A 4KQDA 4NXBA 3OC2A 2DMWA 4CLCC 2PT7A 5F5YA 4PKYG 3C2WA 1ZHHB 4BMWA 1T18A 3DBAA 2M7UA 2OWHA 5AJGA 3P7NA 4HJ4A 2K7SA 4DJ3A 3EEAA 2VZWA 3OLOA 2GNXA 3A0VA 3FG8A 4NKPA 3E4PA 2LB9A 1OTAA 3MQ0A 3OCNA 4HNBA 4G3VA 3KYQA 5HDDA 3EGXC 5L8MA 1OTIA 3MQOA 4BBVA 1S1YA 3PHYA 3JVUA 4WUJA 1GSXA 5HWVA 3F1OB 2L0WA 3IS2B 3PYPA 4EEPA 2VA0A 2IA2A 2VV8A 2JKRI 2PDRA 2FH5A 4GJ4A 1W63M 2HGVA 3UB6A 4FOFA 4FSFA 2WKRA 4HI4A 3BQAA 4LRYC 5HD5A 4QPRA 4GCZA 3RFBA 1XJ3A 4WLAA 3C30A 3KSGA 4EETB 4LPZA 1T1AA 4HP9A 4JGQA 5TBMB 3O5YA 3UB9A 4KQOA 3UE6A 1S4RA 2XA7M 4CLCB 3MXQA 3LR4A 1YAXA 1WA9A 3RTYA 2HJ9C 2FZ0A 3TJZC 4JGRA 1N9LA 1TS6A 3E0YA 3R7WB 3JVVA 4HJ3A 1YKDA 3BW6A 1F98A 3LI9A 1JNUA 4IJGA 3IBRA 2O9BA 4MDZA 3EEHA 2XROA 2QYBA 3T4JA 3S7QA 2KLIA 1G28A 1MZUA 2MJ6A 2GJ3A 2PHYA 3FPWA 3V67A 2PD7A 2W3GA 1H3QA 3VE3A 3UB7A 1IOUA 2VGLM 2J3TD 4L9GA 1TS8A 4WF0A 3F1OA 3K3DA 5F68A 3IS2A 5K5BA 1OT6A 4HY8A 2OOLA 4BWIA 4HP4A 2K2NA 4PHTA 2JKTM 3P01A 2P08A 3VE4A 2W3EA 3LR3A 2EWVA 2NUPC 2V0UA 4WEJA 4WEKA 5HDSA 5DJTA 4I38A 4I39A 1ODVA 2L1MA 4PAUA 1G6OA 2PD8A 2VJWA 4HJ6A 3CI6A 4UEYA 3CAXA 1UWNX 2O9AA 4ME4A 4WN5A 3TRCA 2PR6A 1TD5A 3NJAA 3UB8A 2B02A 2VGLS 2B18A 3C8CA 5AVEA 1MC0A 2Z6DA 5J3WA 3ZYTA 4CLCA 4R70A 2V0WA 3R7WA 4GHIB 5HD3A 1Y28A 3LR5A 4BJPA 2ZMFA 3HCYA 3UMDA 1DP8A 4I5SA 4Q0IA 2O9CA 3S7PA 2I9VA 2WKPA 3LIBA 3TW8A 4NXFA 1DP9A 1NWZA 3PBNA 5DKLA 3T4TA 4EERA 4MN7A 2CMNA 3ICYA 4R3AA 3MMHA 4Q0HA 3LR0A 3NHQA 2YKHA 3RH8B 3EQUA 2ZOHA 4K08A 2GZAA 3BY9A 2W3DA 3A0RA 3F1NB 1W63Q 2EWWA 3W2ZA 3EWKA 3BWLA 4DMZA 4O8GA 4R38A 2VX8A 4B93A 1LSVA 2QWSA 1XFQA 1D7EA 2ZMVA 2OAQ1 3MF0A 4CQHA 2OWJA 2QJ5A 1NRJA 2JKRM 4MMNA 3T4OA 5MC7A 1TS0A 3B33A 5HPFA 4MCWA 4HH3A 4L9FA 3CLOA 1YSQA 4IHQA 4YWZA 4Z1WA 4I3IA 4E04A 3LIFA 4F3LB 3UE3A 4G3KA 2LB5A 5CX7A 5F6AA 5DFYA 4KUOA 3CUEA 3EQVA 1S1ZA 3KSHA 3NOTC 4II7A 4EW7A 3PR6A 2K31A 2W1RA 2ZBBA 4GHIA 3F1PB 2WKQA 5FL3A 2P7JA 3T50A 4UQIS 4IUKA 3MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D02 A;  2KDK A;  2W27 A;  1F9I A;  2QKP A;  4BBU A;  2R78 A;  4XT2 B;  5KIZ A;  4LLO B;  3K3C A;  1LT0 A;  5G4Y A;  4R6L A;  2QJ7 A;  3LID A;  3E4Q A;  1UWP X;  2A24 B;  3F1N A;  5EFW A;  4HHD A;  2VEA A;  1GSW A;  1XJ6 A;  2W0N A;  4HOI A;  1V9Z A;  4F3L A;  5F69 A;  4WL9 A;  3GEC A;  1DP6 A;  1N9N A;  1DRM A;  3MFX A;  2YKF A;  4L9E A;  3F1P A;  1OJG A;  2M1C A;  4MN5 A;  1P0Z A;  4LRZ E;  2Z6C A;  1T1B A;  1VB6 A;  3MR0 A;  2VV6 A;  4XT2 A;  3LUQ A;  3FC7 A;  3VOL A;  1UGU A;  3SW1 A;  5HSQ A;  4HH2 A;  4I3A A;  3CWF A;  4JGO A;  2A24 A;  4H6J B;  2JHE A;  3MJQ A;  4M4X A;  4JGP A;  4EEU A;  1KOU A;  3H82 B;  5AVF A;  1S67 L;  5IS1 A;  1XFN A;  4PKY A;  3NOP C;  1GSV A;  1EW0 A;  4GS9 B;  5DJU A;  2BAS A;  4MN6 A;  3LIE A;  3LYX A;  2VV7 A;  4NXE A;  5J4E A;  1OTB A;  1OTD A;  5DKK A;  3KX0 X;  3BY8 A;  5I5L A;  1T1C A;  2L4R A;  2JN7 A;  3ULF A;  3A0S A;  1P97 A;  3G6O A;  3H7W B;  4KUK A;  3E4O A;  3HJK A;  1OTE A;  3H9W A;  1S4S A;  4EXO A;  5HZH A;  4EES A;  3GDI A;  1S66 L;  3LI8 A;  5G4Z A;  4GW9 A;  4H6J A;  2PYP A;  3D72 A;  1X0O A;  2EA9 A;  3H82 A;  1V9Y A;  2PR5 A;  3UME A;  1TS7 A;  2D01 A;  2HV1 A;  4BBT A;  5HWW A;  3LIC A;  1LSW A;  3LIA A;  1BYW A;  4GS9 A;  1N9O A;  2J80 A;  2INW A;  2ZOI A;  1T19 A;  3HJI A;  1XJ2 A;  4DJ2 A;  2PYR A;  4HIA A;  2V1B A;  4HQA A;  1LSX A;  4B9O A;  1LL8 A;  3NOU C;  5J7E A;  2KX6 A;  1D06 A;  2VLG A;  4I3J A;  4EQ1 A;  3H7W A;  5A8B A;  2H28 A;  1OT9 A;  2V1A A;  4NXG A;  5HWT A;  4LRX C;  1XJ4 A;  5TBM A;  4RQ9 A;  1OJ5 A;  5HDC A;  2V9A A;  5IU1 A;  2QHK A;  3ZQ5 A;  4KQD A;  4NXB A;  5F5Y A;  4PKY G;  3C2W A;  1T18 A;  2OWH A;  3P7N A;  4HJ4 A;  2K7S A;  4DJ3 A;  3OLO A;  3A0V A;  3FG8 A;  3E4P A;  1OTA A;  4HNB A;  5HDD A;  1OTI A;  3MQO A;  4BBV A;  1S1Y A;  3PHY A;  4WUJ A;  1GSX A;  5HWV A;  3F1O B;  2L0W A;  3IS2 B;  3PYP A;  4EEP A;  2VV8 A;  2PDR A;  3UB6 A;  2WKR A;  4HI4 A;  4LRY C;  5HD5 A;  4GCZ A;  1XJ3 A;  4WLA A;  4EET B;  4LPZ A;  1T1A A;  4HP9 A;  4JGQ A;  5TBM B;  3UB9 A;  3UE6 A;  1S4R A;  3MXQ A;  1WA9 A;  3RTY A;  4JGR A;  1N9L A;  1TS6 A;  4HJ3 A;  1F98 A;  3LI9 A;  1JNU A;  3IBR A;  3EEH A;  1G28 A;  1MZU A;  2GJ3 A;  2PHY A;  2PD7 A;  3VE3 A;  3UB7 A;  4L9G A;  1TS8 A;  4WF0 A;  3F1O A;  5F68 A;  3K3D A;  3IS2 A;  1OT6 A;  4HY8 A;  2OOL A;  4HP4 A;  3VE4 A;  2V0U A;  5HDS A;  5DJT A;  4I38 A;  4I39 A;  1ODV A;  2L1M A;  2PD8 A;  4HJ6 A;  3CAX A;  1UWN X;  4WN5 A;  2PR6 A;  3NJA A;  3UB8 A;  2B02 A;  3C8C A;  5AVE A;  2Z6D A;  5J3W A;  4R70 A;  2V0W A;  4GHI B;  5HD3 A;  1Y28 A;  3UMD A;  1DP8 A;  4I5S A;  2I9V A;  2WKP A;  3LIB A;  4NXF A;  1DP9 A;  1NWZ A;  5DKL A;  4EER A;  2CMN A;  3ICY A;  4R3A A;  3NHQ A;  2YKH A;  3RH8 B;  4K08 A;  2ZOH A;  3BY9 A;  3A0R A;  3F1N B;  3EWK A;  3BWL A;  4R38 A;  1LSV A;  2QWS A;  1XFQ A;  1D7E A;  2OWJ A;  2QJ5 A;  1TS0 A;  3B33 A;  4HH3 A;  4L9F A;  3CLO A;  4YWZ A;  4I3I A;  4E04 A;  3LIF A;  4F3L B;  5F6A A;  4KUO A;  1S1Z A;  3NOT C;  4EW7 A;  2ZBB A;  4GHI A;  3F1P B;  2WKQ A;  2P7J A;  3T50 A;  3MQQ A; 
#chains in the Genus database with same CATH topology
 2W27 A;  2R78 A;  3DW0 A;  5KSH A;  5KIZ A;  3K3C A;  4RA7 A;  1ZG6 A;  1Z6F A;  3IBJ A;  3F1N A;  1BLC A;  3DTE A;  4E3N A;  4Y7P A;  4OPY A;  1MWU A;  5DF9 A;  2R9X A;  3PBQ A;  4MLL A;  3DWZ A;  5GLC A;  3LGO A;  3WRZ A;  5CGW A;  1S6R A;  2Q9N A;  5CHJ A;  4GB7 A;  5F69 A;  5LBR A;  4OQI A;  3RXX A;  4OQH A;  1MXO A;  4YNR A;  1DP6 A;  1N9N A;  4NK3 A;  4HBT A;  2J7V A;  2YKF A;  2JBF A;  3NDE A;  4ZBE A;  3A3E A;  5C5K A;  1PWC A;  1WYC A;  3RJU A;  5AQ9 A;  1NLZ A;  4LRZ E;  4ZJ1 A;  3S4X A;  4OQ0 A;  3MZD A;  3GMW A;  4KZB A;  5A93 A;  4XT2 A;  1CQA A;  3MBZ A;  3SW1 A;  3PBS A;  5HSQ A;  4HH2 A;  4I3A A;  4WBG A;  4FCF A;  3SOI A;  1KGG A;  2JHE A;  2QPN A;  4DXC A;  3T4L A;  1K57 C;  3NEC A;  2HPB A;  3K2N A;  1E3U D;  1GA0 A;  1STZ A;  3NOP C;  3S1Y A;  4WZ4 A;  1EW0 A;  2R9W A;  3U4L P;  4ID4 A;  3HL9 A;  2ZC7 A;  2VV7 A;  4QD4 A;  3A3I A;  3VFH A;  1NJ4 A;  3ZHH A;  2XRN A;  5DF7 A;  2O0Y A;  1OTB A;  2HJE A;  3WWX A;  2P04 A;  2O99 A;  3G2Y A;  3C38 A;  4N9K A;  2WAF A;  3Q07 A;  1T1C A;  1W5D A;  1HTZ A;  4WEL A;  4ZTK A;  3ULF A;  1O7E A;  3A0S A;  1NYM A;  4KUK A;  3HJK A;  4ARZ A;  5FAS A;  4EXO A;  4WYY A;  3S22 A;  2XD1 A;  5GHX A;  4P0M A;  1S66 L;  5G4Z A;  3GQZ A;  3LFV A;  3N8R A;  3MZE A;  2A3U A;  3BEB A;  4OOL A;  2PR5 A;  3CJM A;  3UME A;  1TS7 A;  5TR7 A;  2B95 A;  2WAE A;  3CG5 A;  2NUT C;  3LIA A;  5EVI A;  4GS9 A;  2J80 A;  2INW A;  2ZOI A;  3HJI A;  1YLT A;  3UB5 P;  2V1B A;  4ZRR A;  4B9O A;  1FQG A;  4ZDX A;  1LL8 A;  3C7U A;  5J7E A;  3CIT A;  3MS6 A;  5F1F A;  2IWD A;  1VET B;  2ZM2 A;  4I3J A;  2EX2 A;  1A0K A;  4DDY A;  4Z9Q A;  3OBF A;  1PW1 A;  5A8B A;  2V1A A;  3BM6 A;  1XJ4 A;  4RQ9 A;  1OJ5 A;  1W79 A;  1MWT A;  1ZKJ A;  2HP9 A;  2HDR A;  2QHK A;  1VEU B;  3HLW A;  1MBL A;  3LCE A;  4NXB A;  4CLC C;  5F83 A;  4OPQ A;  3UN7 A;  5EVE A;  4BMW A;  3DBA A;  4U3T A;  2M7U A;  3GR2 A;  1AXB A;  5U47 A;  1PNE A;  3P7N A;  2XF3 A;  4DJ3 A;  3TSG A;  2G2U A;  2GNX A;  3FG8 A;  4KG5 A;  2BG1 A;  4DF6 A;  1GCE A;  3OCN A;  4GD8 A;  1CEG A;  3IH9 A;  4GOG A;  4EV4 A;  1L0E A;  2ZQ8 A;  4P6B A;  5DTS A;  2RCX A;  1L0D A;  4GJ4 A;  2E8I A;  1W63 M;  3WS1 A;  3ZG0 A;  4FOF A;  4HI4 A;  3RFB A;  3GRJ A;  5FAP A;  1GHI A;  3C30 A;  5HFO A;  3ZNY A;  4LFU A;  4S2N C;  3UE6 A;  1S4R A;  4CLC B;  3MXQ A;  5E43 A;  1QMF A;  1YAX A;  1GA9 A;  2HJ9 C;  4FH2 A;  3JVV A;  1BZA A;  3BW6 A;  1F98 A;  1IYP A;  4IJG A;  4KZ6 A;  3BYD A;  3WS2 A;  4R1G A;  5CRF A;  3IHA A;  3S7Q A;  3FWL A;  4OH0 A;  1NRF A;  5L10 A;  3DWK A;  3NIA A;  4KZ7 A;  2PD7 A;  4LV2 A;  4E3O A;  3NBL A;  2CC1 A;  3IS2 A;  4QY6 A;  2OOL A;  1PWG A;  4PHT A;  3C5A A;  2W3E A;  3MXR A;  2EWV A;  2ZQA A;  2NUP C;  4WMC D;  3B3X A;  4I39 A;  1ODV A;  2L1M A;  4E3L A;  4EBL A;  3HLC A;  2Y59 A;  2WGI A;  5HAI A;  5FEG A;  1EWZ A;  2B02 A;  2XLN A;  5M1A A;  5TFQ A;  1FR6 A;  2XFT A;  4R70 A;  2Y2H A;  4UA6 A;  4S2J A;  5HD3 A;  3UNW A;  4PMA A;  5CHU A;  1E4D A;  4MBF A;  1PI5 A;  1YLZ A;  3V3S A;  1KDW A;  1RCJ A;  2H5S A;  1DY6 A;  2BTF P;  1PRQ A;  1ZC2 A;  5EM0 A;  4NXF A;  3QNB A;  3PBN A;  5DKL A;  1M40 A;  1TDG A;  4Q0H A;  4K0W A;  3LR0 A;  4EQI A;  1Y54 A;  3RH8 B;  4K08 A;  1YLP A;  2ZOH A;  4JXS A;  3F1N B;  1NXY A;  2Y2Q A;  2Y2M A;  5KSC A;  1C3B A;  3C7V A;  4R38 A;  4B93 A;  2QWS A;  2DNS A;  3WS4 A;  3MF0 A;  4QJG A;  2FFY A;  2OWJ A;  3HVF A;  1NRJ A;  2JKR M;  5MC7 A;  4K91 A;  5HPF A;  1Z09 A;  4MCW A;  1EI5 A;  3IWI A;  4L9F A;  1YSQ A;  4YWZ A;  4JF5 A;  1FSY A;  1ES4 A;  4ESP A;  4E6W A;  1S1Z A;  3KSH A;  4II7 A;  5FAQ A;  4R3B A;  4P87 A;  4C75 A;  3BFD A;  1E3U A;  2Y4A A;  1ERM A;  4UQI S;  4S2M A;  1L0G A;  1J3W A;  1ZTU A;  1F9I A;  5E2F A;  4R4S A;  4XT2 B;  4B88 A;  3W8K A;  4DXB A;  3T4K A;  2E8J A;  1LT0 A;  4IVI A;  3BEC A;  3MKE A;  1K6R A;  1UWP X;  4ETX A;  3UDI A;  1K55 A;  1XX2 A;  4ZJ2 A;  1GSW A;  5EVI C;  3BRM A;  2JC7 A;  1XA1 A;  3BLS A;  3PAG A;  3OOV A;  4FTX A;  4QHC A;  3NCK A;  3B47 A;  1DRM A;  4DE0 A;  1TDL A;  3TG9 A;  5CEC A;  5EEC A;  4KG6 A;  3MFX A;  4L9E A;  1OJG A;  5HL6 A;  4BD1 A;  4EUZ A;  1OME A;  1P0Z A;  2J3W A;  4HBU A;  3FPV A;  3Q81 A;  1T1B A;  1MKI A;  3UDF A;  2Y2L A;  3EGD C;  4RX3 A;  3LUQ A;  2Z2M B;  4X1L A;  5FSR A;  3Q7Z A;  3CWF A;  1ES3 A;  4JPM A;  2A24 A;  4EEU A;  4JGP A;  4OKP A;  3V5M A;  1YPR A;  1S67 L;  4Q8I A;  2ZL1 A;  1XFN A;  4S2L A;  2HDS A;  3V39 A;  3G30 A;  2W3F A;  3BJN A;  4GS9 B;  4CLC E;  5DJU A;  4UQI M;  2UWX A;  1SHV A;  1YLY A;  5FAT A;  3KSI A;  1VHM A;  2HDQ A;  4NXE A;  3VV4 A;  5J4E A;  3PAE A;  1OTD A;  4LCM A;  2P9V A;  3KX0 X;  2A2L A;  3BY8 A;  5I5L A;  3BQ8 A;  2L4R A;  3B42 A;  1W8Y A;  3AGF A;  2W1T A;  1S4S A;  5HZH A;  4P6Z M;  3GDI A;  2XGN A;  2AVX A;  3LI8 A;  1ES5 A;  3T1S A;  4GW9 A;  4H6J A;  1OPX A;  3GVB A;  1V9Y A;  2HF6 A;  3QP1 A;  4U0T A;  1SKF A;  2Q9M A;  1BYW A;  3IH8 A;  4XUZ A;  2XFS A;  1N9O A;  1T19 A;  1XJ2 A;  1RGZ A;  5IT5 A;  4JXV A;  2PYR A;  1TEM A;  1BLS A;  5AQA A;  1M6K A;  2XA7 S;  2WGW B;  5FI2 A;  5TJJ A;  3NOU C;  2Y79 A;  4EUV A;  4S2O A;  2HZ5 A;  5TGF A;  2VKS A;  4PM8 A;  4Y2F A;  1FCO A;  3ZG7 B;  2HP5 A;  1JWP A;  1W7F A;  4IUH A;  1K38 A;  1OT9 A;  1H8Y A;  3BFE A;  2RL3 A;  2OLV A;  3CHW P;  4LRX C;  1NZU A;  5HDC A;  3BFF A;  4JF4 A;  4GDB A;  2PT7 A;  1FCN A;  5E2E A;  3C2W A;  3L9K A;  1YT4 A;  4LEN A;  1T18 A;  1KGE A;  3A3J A;  5AJG A;  1G6A A;  1W8Q A;  5E2G A;  4QY5 A;  2EX8 A;  5FQQ A;  3A0V A;  4NKP A;  5HAR A;  4DE2 A;  1IKI A;  4G3V A;  3ZVT A;  1HD8 A;  2GDN A;  2VK3 A;  1KVM A;  5CED A;  3MQO A;  3HLF A;  2Y91 A;  4KZ3 A;  5HL1 A;  3NDG A;  1JWZ A;  1GSX A;  1KE4 A;  3IS2 B;  4EEP A;  1IKG A;  3OPR A;  2IWB A;  2JKR I;  4JKT A;  5L07 A;  5HX9 A;  4FSF A;  2QMI A;  5L09 A;  5EOO A;  2Y55 A;  4QPR A;  4LPZ A;  1T1A A;  3IXD A;  2H0Y A;  2OLU A;  4OLD A;  3Q7V A;  4JGQ A;  5TBM B;  4QWO A;  1IYS A;  2PU4 A;  3O5Y A;  3UB9 A;  2FFF B;  4X56 A;  2XA7 M;  3PTE A;  3RTY A;  2FZ0 A;  3TJZ C;  1TS6 A;  3E0Y A;  1YKD A;  2Y2J A;  3LI9 A;  1JNU A;  4MDZ A;  4EBN A;  3T4J A;  4UHU A;  2Y2I A;  1PI4 A;  3QP5 A;  3V67 A;  1SKO A;  3VOY A;  3UB7 A;  1K55 C;  1IEL A;  2VGL M;  2J3T D;  4L9G A;  1BTL A;  1KVL A;  4OPR A;  3V3R A;  3F1O A;  3NI9 A;  5F68 A;  3HLG A;  1OT6 A;  4UA9 A;  1JVJ A;  2JKT M;  3VE4 A;  3LR3 A;  3IXB A;  5HDS A;  4PAU A;  1G6O A;  4WM9 A;  2VJW A;  3IXG A;  4HJ6 A;  3CI6 A;  4IED A;  5CHM A;  3TRC A;  4B4X A;  2ZJ9 A;  3HUM A;  2B18 A;  1MC0 A;  1YMS A;  3O88 A;  3M6B A;  1ACF A;  4LV1 A;  2V0W A;  1FOF A;  3L7H A;  3R7W A;  2XK1 A;  2QZ6 A;  1Y28 A;  2JKF A;  1NZO A;  4EBP A;  1N9B A;  2I9V A;  2H0T A;  1K6S A;  3LIB A;  2P74 A;  3TW8 A;  3ZVW A;  1NWZ A;  4OQG A;  3MMH A;  4CPK A;  1W63 Q;  3W2Z A;  1PYY A;  5EM1 A;  1PZO A;  4DMZ A;  4E3M A;  5HW3 A;  2VX8 A;  1LSV A;  1MWR A;  4Y13 A;  4MMN A;  2QJ5 A;  3IX3 A;  3LY4 A;  1TS0 A;  4HH3 A;  5CGS A;  1KE3 A;  4Z1W A;  1F2K A;  3N4I A;  4LV3 A;  3HBR A;  3IXH A;  1XPB A;  5CX7 A;  2ACG A;  5AQ7 A;  3IX8 A;  5FQ9 A;  3EQV A;  5FI7 A;  3T1Q B;  1BSG A;  3PR6 A;  4GHI A;  3W4P A;  5FL3 A;  2V8F A;  3T50 A;  1BT5 A;  2X02 A;  2J9P A;  3MQQ A;  4LCL A;  3ZFZ A;  4DE3 A;  2QKP A;  1BUL A;  4BBU A;  4O7D A;  4RX2 A;  4LLO B;  4PM5 A;  3E98 A;  3E2L A;  4Y3I A;  4BEN A;  1IFQ A;  3LID A;  3OPH A;  3E4Q A;  2A24 B;  4HHD A;  3IF5 A;  2EXB A;  5CTN A;  2Y2N A;  3N8S A;  2ZL1 B;  1XA7 A;  3VSL A;  2W0N A;  5BOH A;  5JYO A;  2ZQD A;  4BD0 A;  3T4S A;  4KG2 A;  1G68 A;  4F3L A;  4WL9 A;  1LL9 A;  3KYZ A;  4S2P A;  2GX5 A;  3MKF A;  1YSP A;  3GEC A;  3C4P A;  4N92 A;  5FA7 A;  4WZ5 A;  3F1P A;  1PW8 A;  3SZT A;  2P9V B;  5F82 A;  4MN5 A;  4YIN A;  3MSH A;  1ERO A;  3LEZ A;  2Z6C A;  1JTD A;  4LV0 A;  3MXS A;  2VV6 A;  1FSW A;  3ZNT A;  3FC7 A;  3TE8 A;  1UGU A;  1KDS A;  3NUL A;  1RP5 A;  3IX4 A;  2OV5 A;  3T4Q A;  4H6J B;  3IT9 A;  3N8L A;  4FUW A;  4GKU A;  5CER A;  4OVD A;  2B5R A;  3N7W A;  3UO9 A;  2JE5 A;  5D3O A;  3VP0 A;  4R23 A;  3S7O A;  1GSV A;  3C4O A;  2V1Z A;  4MN6 A;  4OOM A;  3LIE A;  3LYX A;  3QNC A;  4DRT A;  4BL2 A;  4XXR A;  3QP6 A;  2WUQ A;  1LI9 A;  1VET A;  3KO6 A;  4AFI A;  2WZZ A;  3O3V A;  5CGX A;  1NYY A;  4BLM A;  4NG2 A;  3CPT A;  1CI9 A;  2JN7 A;  2WKI A;  2PRF A;  5GLB A;  1GHM A;  1P97 A;  4KZ5 A;  4X1M A;  3E4O A;  4UAA A;  4FH4 A;  4PM7 A;  1ALQ A;  1VEU A;  2V8C A;  3CUE C;  3HLD A;  5HAP A;  1ONH A;  2EA9 A;  1YQS A;  3H82 A;  2D01 A;  3QP4 A;  3ZG8 B;  2HV1 A;  4BBT A;  3LEQ A;  5HWW A;  1LSW A;  3VP4 A;  4R3J A;  3DTK A;  1BUE A;  5DF8 A;  3EOI A;  4MBK A;  4KQQ A;  4P6Z S;  4DJ2 A;  4HIA A;  4B4Z A;  1IYO A;  1LSX A;  4KZ9 A;  3OCL A;  4KEN B;  2V2F F;  1ESU A;  3WS5 A;  1ES2 A;  1MKM A;  2JKT I;  3KSF A;  3UE1 A;  3H7W A;  3S7N A;  5AQB A;  2H28 A;  1TF1 A;  3PBT A;  3VOZ A;  4ARZ B;  2V9A A;  4N9L A;  5FEF A;  5GLA A;  4PM9 A;  1QME A;  2DMW A;  2XH9 A;  5F5Y A;  4PKY G;  4BQM A;  3IF6 C;  1LL5 A;  1ZHH B;  2BLS A;  4EWF A;  4ZJ3 A;  5FQJ A;  4HJ4 A;  3EEA A;  2VGK A;  1O07 A;  5GLD A;  1SDN A;  5EVI B;  3E4P A;  2LB9 A;  1OTA A;  3HUO A;  4HNB A;  2XQZ A;  3KYQ A;  5A92 A;  4PPR A;  1K56 D;  1WYB A;  2UV0 E;  5HDD A;  1PFL A;  5L8M A;  4BBV A;  1SKO B;  3PHY A;  4WUJ A;  1FIK A;  2ZC3 B;  1DJB A;  3F1O B;  2L0W A;  5KMW A;  4FD8 A;  3KYE A;  2VA0 A;  2ZQ9 A;  2VV8 A;  2PDR A;  1H0M A;  4GZB A;  3SS4 A;  2HGV A;  3UB6 A;  1HVB A;  4MNR A;  3BQA A;  4LRY C;  2J8Y A;  4GCZ A;  2ZQC A;  3UDX A;  1XJ3 A;  2ZC5 B;  3W4Q A;  5FDH A;  3UE0 A;  5CEB A;  3KSG A;  4EET B;  4X69 A;  3DAV A;  3O86 A;  4N1H A;  1N4O A;  3G34 A;  5E2H A;  3SH7 A;  2PBY A;  3LR4 A;  1N9L A;  3R7W B;  4HJ3 A;  1LLB A;  3IBR A;  3EEH A;  4OLG A;  1FCM A;  2QYB A;  2G2W A;  1ZG4 A;  1G28 A;  2XDM A;  2MJ6 A;  2GJ3 A;  3IWQ A;  1JWV A;  2PHY A;  2W3G A;  2ZLY A;  3VE3 A;  3SH9 A;  3WS0 A;  1TS8 A;  4WF0 A;  3K3D A;  4HY8 A;  4HP4 A;  2K2N A;  3NC8 A;  4JF6 A;  4WEJ A;  4I38 A;  4XUX A;  3SS5 A;  2PBD P;  5EVL A;  5A91 A;  5FQI A;  3CAX A;  4KZ4 A;  3VP1 A;  4X25 A;  4WN5 A;  2JKG A;  4ME4 A;  2PR6 A;  1XP4 A;  2VGL S;  3C8C A;  1D1J A;  4HEF A;  3FYZ A;  4WZ5 C;  4Y0T A;  3ZYT A;  3ZDJ A;  4R4R A;  1K0K A;  4GHI B;  2ZMA A;  2Q0O A;  1XGJ A;  4BJP A;  3VFF A;  3FKV A;  3HCY A;  3UMD A;  3UPP A;  1DP8 A;  4I5S A;  4WMC A;  4Q0I A;  4F94 A;  2O9C A;  2WKP A;  3RXW A;  3IHB A;  4E6X A;  4D2O A;  5FAO A;  4JBF A;  4EER A;  3ZG5 A;  5CTM A;  2CMN A;  3ICY A;  4R3A A;  4Y15 A;  2YKH A;  4JXW A;  4DKI A;  1I2W A;  3OPP A;  3A0R A;  1HZO A;  3EWK A;  2X01 A;  2WZX A;  1PWD A;  3IQA A;  4RVA A;  1D7E A;  2ZMV A;  2OAQ 1;  4CQH A;  3T4O A;  1NY0 A;  3CLO A;  4IHQ A;  3HLE A;  4F3L B;  1YM1 A;  5F6A A;  5DFY A;  3CUE A;  3ITA A;  1FR1 A;  1IEM A;  1I2S A;  4EW7 A;  4GN2 A;  2K31 A;  2W1R A;  2ZBB A;  4OP5 A;  3F1P B;  4GDN A;  5G18 A;  5FQM A;  4Y0O A;  1ERQ A;  4IUK A;  2D02 A;  2KDK A;  4N1X A;  5G4Y A;  4R6L A;  1XKZ A;  3N6I A;  2QJ7 A;  1SCW A;  4KZ8 A;  4IBR A;  5EFW A;  4CLC D;  1VQQ A;  4KQR A;  2VEA A;  3NY4 A;  4MEZ A;  1XJ6 A;  4YOF A;  4L0L A;  5DFX A;  3UPN A;  4GLQ A;  3E2K A;  1F5M A;  3M6H A;  4HOI A;  1V9Z A;  1JTG A;  3OZH A;  2Y2P A;  4H8R A;  1CI8 A;  3JYI A;  2KOI A;  1KGF A;  1CEF A;  1WE4 A;  4Y17 A;  3PXP A;  1K25 A;  2OAP 1;  3A3F A;  2M7V A;  3VP2 A;  4ETZ A;  4JXG A;  4O0P A;  3DTM A;  1K54 C;  2G7U A;  2M1C A;  3IF6 A;  4G3W A;  5A90 A;  5M18 A;  3CPT B;  3PBR A;  3GSG A;  1VB6 A;  1AWI A;  5FQK A;  3MR0 A;  5F1G A;  3BFC A;  4OP8 A;  5M19 A;  5DTK A;  3VOL A;  1Y4O A;  4S2K A;  4Q0J A;  3ZCZ A;  4JGO A;  2IWC A;  3MJQ A;  4M4X A;  2J3T C;  1KOU A;  3H82 B;  3Q1F A;  2W3H A;  5AVF A;  2XD5 A;  5KZH A;  5FI6 A;  5IS1 A;  4D60 A;  1SDE A;  3HLB A;  4S2I A;  1PIO A;  4PKY A;  4ZAM A;  2XSS A;  5EPH A;  2C6W B;  3HUN A;  1P9W A;  1H5X A;  1H8M A;  2BAS A;  2EXA A;  3UPO A;  2WGW A;  2A49 A;  1BLH A;  2I72 A;  1Q2Q A;  2J9O A;  3ZGA B;  4OON A;  5DKK A;  4NEE D;  2OSU A;  1U60 A;  3JPU A;  2WYX A;  1XXM A;  1CF0 A;  4EU0 A;  3BFG A;  3G6O A;  4DDS A;  3H7W B;  1DJC A;  1OTE A;  2Y2O A;  3H9W A;  3U2A A;  3SH8 A;  1KE0 A;  4QU3 A;  5JYP A;  4EES A;  3PBO A;  4KZA A;  3D3O A;  2EX9 A;  4YFM A;  2PYP A;  1K56 A;  3D72 A;  1X0O A;  4GD6 A;  1NLY A;  3CMZ A;  1BLP A;  5EUA A;  4M3K A;  3OPL A;  4A5R A;  5GL9 A;  3GV9 A;  2ZQ7 A;  2HDU A;  3LIC A;  3R4K A;  4X55 A;  1ESI A;  2Y8H A;  2DCF A;  3QP2 A;  4U0X A;  2WKE A;  4JLF A;  3ITB A;  4OPZ A;  4HQA A;  1CK3 A;  4X53 A;  1P9R A;  4PM6 A;  2KX6 A;  1D06 A;  4RYE A;  3ZG9 B;  2VLG A;  5HPI A;  2EFU A;  3VMA A;  4O01 A;  1Q2P A;  2Y2G A;  4EQ1 A;  3I7J A;  2DRW A;  5EOE A;  4CJN A;  4DN0 A;  4Y5F A;  4IVK A;  3W4O A;  5EV0 A;  3MFD A;  4NXG A;  5HWT A;  2V20 A;  1S0W A;  5TBM A;  4NET A;  2W1T B;  2WKH A;  5IU1 A;  5CXW A;  2WGV A;  1YMX A;  2XR0 A;  4KQD A;  3ZQ5 A;  3OC2 A;  5L2F A;  4C3Q A;  3FKW A;  3FZC A;  2WAD A;  4C6Y A;  1K57 A;  1MPL A;  1ONG A;  2OWH A;  2ZM8 A;  3MZF A;  5IHV A;  1FIL A;  1H8Z A;  1PZP A;  2K7S A;  3AGD A;  3G31 A;  5FDS A;  5HAQ A;  2VZW A;  3OLO A;  3DTI A;  2HP6 A;  3P09 A;  3V50 A;  1L3L A;  3MQ0 A;  3G2Z A;  1LHY A;  4Y0U A;  4X6T A;  2JCH A;  3Q82 A;  3VSK A;  3EGX C;  5I94 A;  1OTI A;  1S1Y A;  3JVU A;  4P85 A;  5HWV A;  3PYP A;  3T12 B;  4HES A;  5EVI D;  2IA2 A;  2ZC6 B;  1MY8 A;  2FH5 A;  5GHY A;  3T1X A;  1I5Q A;  3D9Y A;  2WKR A;  5HD5 A;  2X71 A;  1K4F A;  3LO7 A;  4WLA A;  1YLJ A;  3G4P A;  1HLU P;  4HP9 A;  2EFX A;  3FV7 A;  1YLW A;  2WK0 A;  4KQO A;  3ISG A;  4BL3 A;  5GHZ A;  3P98 A;  3BLM A;  1WA9 A;  4JGR A;  2Z2L B;  3GTC A;  1CJF A;  2ZD8 A;  5J8X A;  2O9B A;  4UA7 A;  2XRO A;  2Y2K A;  1E25 A;  4MBH A;  2KLI A;  1L2S A;  1MZU A;  3M2K A;  1MWS A;  3FPW A;  1H3Q A;  1IYQ A;  3QP8 A;  1IOU A;  1XGI A;  3LY3 A;  5K5B A;  4BWI A;  3CZD A;  3P01 A;  2P08 A;  3O87 A;  1K54 A;  2V0U A;  3A3D A;  1LI0 A;  4WEK A;  5DJT A;  4E3K A;  2PD8 A;  3TOI A;  4LGW A;  4IBX A;  4UEY A;  2EX6 A;  1DJA A;  1UWN X;  2O9A A;  1TD5 A;  3NJA A;  3UB8 A;  1RGY A;  4QB8 A;  1G5U A;  3G35 A;  3HRE A;  5AVE A;  2Z6D A;  3SS3 A;  5J3W A;  4CLC A;  3Q7V B;  3D4F A;  1K4E A;  4E3I A;  3WRT A;  2ZM0 A;  4K0X A;  3LR5 A;  2ZC4 B;  2ZMF A;  2PU2 A;  4GNU A;  3S7P A;  1GHP A;  4DE1 A;  3AGE A;  1SZV A;  1DP9 A;  3T4T A;  4MN7 A;  2PAV P;  3NHQ A;  1L0F A;  5EE8 A;  3EQU A;  2GZA A;  3BY9 A;  2W3D A;  2EWW A;  4R0Q A;  3BWL A;  2C5W B;  4O8G A;  1XFQ A;  3VP3 A;  2VGJ A;  3B33 A;  3M2J A;  5DVA A;  2H10 A;  4I3I A;  4E04 A;  1J9M A;  3LIF A;  3UE3 A;  3G32 A;  4G3K A;  2LB5 A;  3UY6 A;  4KUO A;  3T1R A;  4OOY A;  3NOT C;  3QHY A;  1VM1 A;  4E3J A;  4S2N A;  3IWO A;  2XEP A;  2WKQ A;  4X68 A;  2P7J A;  5DTT A;  3IF6 B;  1TVF A; 
#chains in the Genus database with same CATH homology
 1ZTU A;  2D02 A;  2KDK A;  2W27 A;  1F9I A;  2QKP A;  4BBU A;  2R78 A;  5KSH A;  4XT2 B;  5KIZ A;  4LLO B;  3K3C A;  3T4K A;  3E98 A;  1LT0 A;  4Y3I A;  5G4Y A;  4R6L A;  1IFQ A;  2QJ7 A;  3LID A;  3E4Q A;  1UWP X;  4ETX A;  2A24 B;  3IBJ A;  3F1N A;  5EFW A;  4CLC D;  4HHD A;  2VEA A;  5DF9 A;  1GSW A;  1XJ6 A;  3PBQ A;  4YOF A;  4L0L A;  5DFX A;  2W0N A;  4GLQ A;  1F5M A;  4HOI A;  1V9Z A;  3T4S A;  4F3L A;  3OOV A;  2KOI A;  5F69 A;  5LBR A;  4WL9 A;  3KYZ A;  4YNR A;  3PXP A;  2GX5 A;  1YSP A;  1DP6 A;  1N9N A;  1DRM A;  2OAP 1;  3B47 A;  3GEC A;  2M7V A;  4ETZ A;  3MFX A;  2YKF A;  4L9E A;  3F1P A;  1OJG A;  4O0P A;  5HL6 A;  2G7U A;  2M1C A;  4MN5 A;  1P0Z A;  2J3W A;  4G3W A;  5C5K A;  3FPV A;  1NLZ A;  2Z6C A;  3PBR A;  4LRZ E;  1T1B A;  1VB6 A;  3MR0 A;  3EGD C;  2VV6 A;  4XT2 A;  3LUQ A;  3FC7 A;  3TE8 A;  3VOL A;  1UGU A;  3SW1 A;  3PBS A;  5HSQ A;  4HH2 A;  4I3A A;  4Q0J A;  3CWF A;  4JGO A;  2A24 A;  3T4Q A;  4H6J B;  2JHE A;  3MJQ A;  4M4X A;  4JGP A;  4EEU A;  2J3T C;  1KOU A;  3H82 B;  2W3H A;  5AVF A;  3T4L A;  1S67 L;  5IS1 A;  3K2N A;  1STZ A;  1XFN A;  4PKY A;  3S7O A;  3NOP C;  1GSV A;  1EW0 A;  2XSS A;  2W3F A;  3BJN A;  1P9W A;  4GS9 B;  4CLC E;  5DJU A;  4UQI M;  1H8M A;  2BAS A;  4MN6 A;  4OOM A;  3LIE A;  3LYX A;  2VV7 A;  3KSI A;  1VHM A;  4NXE A;  3VV4 A;  5J4E A;  2XRN A;  2O0Y A;  3KO6 A;  1OTB A;  2HJE A;  4AFI A;  1OTD A;  2O99 A;  2P04 A;  3C38 A;  5DKK A;  3KX0 X;  2A2L A;  3BY8 A;  4NEE D;  5I5L A;  1T1C A;  3BQ8 A;  2L4R A;  3B42 A;  2JN7 A;  4WEL A;  3ULF A;  3A0S A;  4EU0 A;  1P97 A;  3G6O A;  3H7W B;  4KUK A;  3E4O A;  3HJK A;  4ARZ A;  2W1T A;  1OTE A;  3H9W A;  1S4S A;  3U2A A;  4EXO A;  5HZH A;  4P6Z M;  4EES A;  3GDI A;  3PBO A;  1S66 L;  3CUE C;  3D3O A;  3LI8 A;  5G4Z A;  4GW9 A;  4H6J A;  1OPX A;  2PYP A;  3LFV A;  3D72 A;  1X0O A;  2EA9 A;  3H82 A;  1V9Y A;  4OOL A;  1NLY A;  2PR5 A;  3UME A;  1TS7 A;  2D01 A;  2HF6 A;  2HV1 A;  4BBT A;  5HWW A;  3LIC A;  3R4K A;  2NUT C;  1LSW A;  3LIA A;  1BYW A;  2Y8H A;  4GS9 A;  1N9O A;  2J80 A;  2INW A;  2ZOI A;  1T19 A;  3HJI A;  3EOI A;  1XJ2 A;  4P6Z S;  4DJ2 A;  5IT5 A;  2PYR A;  4HIA A;  2V1B A;  4HQA A;  4ZRR A;  1LSX A;  4B9O A;  2XA7 S;  3OCL A;  5TJJ A;  1LL8 A;  3NOU C;  2Y79 A;  1P9R A;  4EUV A;  5J7E A;  2KX6 A;  1D06 A;  3CIT A;  2VLG A;  2VKS A;  1MKM A;  2JKT I;  5HPI A;  4Y2F A;  3KSF A;  4O01 A;  4I3J A;  4EQ1 A;  3H7W A;  4DN0 A;  3S7N A;  3OBF A;  4IUH A;  5A8B A;  2H28 A;  1TF1 A;  1OT9 A;  2V1A A;  4Y5F A;  3PBT A;  4NXG A;  5HWT A;  4LRX C;  1XJ4 A;  5TBM A;  4RQ9 A;  1OJ5 A;  5HDC A;  4ARZ B;  2W1T B;  2V9A A;  5IU1 A;  2QHK A;  3ZQ5 A;  4KQD A;  4NXB A;  3OC2 A;  2DMW A;  4CLC C;  2PT7 A;  5F5Y A;  4PKY G;  3C2W A;  1ZHH B;  4BMW A;  1T18 A;  3DBA A;  2M7U A;  2OWH A;  5AJG A;  3P7N A;  4HJ4 A;  2K7S A;  4DJ3 A;  3EEA A;  2VZW A;  3OLO A;  2GNX A;  3A0V A;  3FG8 A;  4NKP A;  3E4P A;  2LB9 A;  1OTA A;  3MQ0 A;  3OCN A;  4HNB A;  4G3V A;  3KYQ A;  5HDD A;  3EGX C;  5L8M A;  1OTI A;  3MQO A;  4BBV A;  1S1Y A;  3PHY A;  3JVU A;  4WUJ A;  1GSX A;  5HWV A;  3F1O B;  2L0W A;  3IS2 B;  3PYP A;  4EEP A;  2VA0 A;  2IA2 A;  2VV8 A;  2JKR I;  2PDR A;  2FH5 A;  4GJ4 A;  1W63 M;  2HGV A;  3UB6 A;  4FOF A;  4FSF A;  2WKR A;  4HI4 A;  3BQA A;  4LRY C;  5HD5 A;  4QPR A;  4GCZ A;  3RFB A;  1XJ3 A;  4WLA A;  3C30 A;  3KSG A;  4EET B;  4LPZ A;  1T1A A;  4HP9 A;  4JGQ A;  5TBM B;  3O5Y A;  3UB9 A;  4KQO A;  3UE6 A;  1S4R A;  2XA7 M;  4CLC B;  3MXQ A;  3LR4 A;  1YAX A;  1WA9 A;  3RTY A;  2HJ9 C;  2FZ0 A;  3TJZ C;  4JGR A;  1N9L A;  1TS6 A;  3E0Y A;  3R7W B;  3JVV A;  4HJ3 A;  1YKD A;  3BW6 A;  1F98 A;  3LI9 A;  1JNU A;  4IJG A;  3IBR A;  2O9B A;  4MDZ A;  3EEH A;  2XRO A;  2QYB A;  3T4J A;  3S7Q A;  2KLI A;  1G28 A;  1MZU A;  2MJ6 A;  2GJ3 A;  2PHY A;  3FPW A;  3V67 A;  2PD7 A;  2W3G A;  1H3Q A;  3VE3 A;  3UB7 A;  1IOU A;  2VGL M;  2J3T D;  4L9G A;  1TS8 A;  4WF0 A;  3F1O A;  3K3D A;  5F68 A;  3IS2 A;  5K5B A;  1OT6 A;  4HY8 A;  2OOL A;  4BWI A;  4HP4 A;  2K2N A;  4PHT A;  2JKT M;  3P01 A;  2P08 A;  3VE4 A;  2W3E A;  3LR3 A;  2EWV A;  2NUP C;  2V0U A;  4WEJ A;  4WEK A;  5HDS A;  5DJT A;  4I38 A;  4I39 A;  1ODV A;  2L1M A;  4PAU A;  1G6O A;  2PD8 A;  2VJW A;  4HJ6 A;  3CI6 A;  4UEY A;  3CAX A;  1UWN X;  2O9A A;  4ME4 A;  4WN5 A;  3TRC A;  2PR6 A;  1TD5 A;  3NJA A;  3UB8 A;  2B02 A;  2VGL S;  2B18 A;  3C8C A;  5AVE A;  1MC0 A;  2Z6D A;  5J3W A;  3ZYT A;  4CLC A;  4R70 A;  2V0W A;  3R7W A;  4GHI B;  5HD3 A;  1Y28 A;  3LR5 A;  4BJP A;  2ZMF A;  3HCY A;  3UMD A;  1DP8 A;  4I5S A;  4Q0I A;  2O9C A;  3S7P A;  2I9V A;  2WKP A;  3LIB A;  3TW8 A;  4NXF A;  1DP9 A;  1NWZ A;  3PBN A;  5DKL A;  3T4T A;  4EER A;  4MN7 A;  2CMN A;  3ICY A;  4R3A A;  3MMH A;  4Q0H A;  3LR0 A;  3NHQ A;  2YKH A;  3RH8 B;  3EQU A;  2ZOH A;  4K08 A;  2GZA A;  3BY9 A;  2W3D A;  3A0R A;  3F1N B;  1W63 Q;  2EWW A;  3W2Z A;  3EWK A;  3BWL A;  4DMZ A;  4O8G A;  4R38 A;  2VX8 A;  4B93 A;  1LSV A;  2QWS A;  1XFQ A;  1D7E A;  2ZMV A;  2OAQ 1;  3MF0 A;  4CQH A;  2OWJ A;  2QJ5 A;  1NRJ A;  2JKR M;  4MMN A;  3T4O A;  5MC7 A;  1TS0 A;  3B33 A;  5HPF A;  4MCW A;  4HH3 A;  4L9F A;  3CLO A;  1YSQ A;  4IHQ A;  4YWZ A;  4Z1W A;  4I3I A;  4E04 A;  3LIF A;  4F3L B;  3UE3 A;  4G3K A;  2LB5 A;  5CX7 A;  5F6A A;  5DFY A;  4KUO A;  3CUE A;  3EQV A;  1S1Z A;  3KSH A;  3NOT C;  4II7 A;  4EW7 A;  3PR6 A;  2K31 A;  2W1R A;  2ZBB A;  4GHI A;  3F1P B;  2WKQ A;  5FL3 A;  2P7J A;  3T50 A;  4UQI S;  4IUK A;  3MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...