3UMDA

Structure of pb intermediate of photoactive yellow protein (pyp) at ph 4.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Photoactive yellow protein
publication title pH Dependence of the Photoactive Yellow Protein Photocycle Investigated by Time-Resolved Crystallography.
pubmed doi rcsb
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3umdA00
2Z6CA 3LI9A 1P0ZA 3VE4A 1P97A 2ZBBA 3MJQA 4BBVA 3A0SA 1OJ5A 4DJ3A 5HWWA 2PHYA 3F1NB 4HH3A 4NXEA 3UB6A 3IBRA 2V0WA 1X0OA 5HZHA 3UB7A 1F9IA 5A8BA 1G28A 5AVEA 3LI8A 5EFWA 1Y28A 2A24B 1TS7A 3UB9A 4KUKA 3A0RA 2V0UA 1ODVA 5DKKA 2D02A 3GDIA 4I39A 2VEAA 4LRZE 2HV1A 1DP9A 4HJ4A 2ZOIA 3UE6A 4EXOA 2ZOHA 5HSQA 2KX6A 3ZQ5A 2I9VA 3BY8A 4HHDA 4BBTA 3LICA 4HNBA 1LSWA 4WN5A 2K7SA 4WL9A 4RQ9A 3C2WA 1D7EA 3NJAA 4R38A 3IS2A 3FC7A 4LRXC 2GJ3A 4EQ1A 1JNUA 4HH2A 3CWFA 2B02A 3H9WA 4LLOB 2V1AA 3LIDA 2M1CA 1OT9A 5AVFA 2L4RA 1D06A 1UWNX 3F1PB 2W27A 2CMNA 3GECA 1MZUA 1OJGA 2VV7A 3E4QA 1XFNA 2JHEA 3MXQA 1T18A 1XJ3A 2V1BA 2D01A 4YWZA 3MQQA 2BASA 3BWLA 4JGOA 3UMEA 3F1OB 1VB6A 5G4ZA 2PR6A 4I3IA 1XJ6A 3F1PA 2QJ7A 4HY8A 5DKLA 3OLOA 4EERA 4HP4A 1TS8A 5HD5A 5J4EA 3NOPC 1N9OA 4WLAA 1S67L 5HDCA 5IS1A 3HJIA 4GS9A 5HDDA 3D72A 4GCZA 3H82B 2OWJA 3IS2B 3F1OA 3P7NA 4I3AA 4EEPA 1XJ2A 5HWTA 1KOUA 1LL8A 5G4YA 2QWSA 4EETB 1DP8A 3NHQA 1GSXA 5I5LA 3LYXA 2L1MA 3SW1A 3VE3A 3EEHA 2QKPA 1TS0A 1WA9A 1S66L 3H82A 5DJUA 4NXBA 1V9ZA 4HQAA 2INWA 2J80A 2WKQA 4KUOA 3NOTC 3BY9A 5HDSA 1BYWA 2OWHA 3K3CA 2QHKA 5F6AA 3ULFA 2PYRA 2YKHA 4XT2A 2W0NA 3LIEA 4NXFA 2V9AA 4F3LA 2VLGA 2PD8A 4EESA 1GSWA 3KX0X 3NOUC 3C8CA 4GW9A 2PYPA 1OTDA 4GS9B 3RTYA 1XJ4A 5HD3A 1N9NA 1V9YA 1TS6A 4JGQA 1DP6A 2EA9A 4R6LA 1T1BA 2OOLA 4L9FA 2VV6A 4K08A 5KIZA 4HIAA 4MN5A 2QJ5A 1XFQA 4HJ3A 1DRMA 1OTIA 4HOIA 3UMDA 5HWVA 4R3AA 4DJ2A 4I38A 4LPZA 5IU1A 3LUQA 4NXGA 5F69A 4B9OA 1OTAA 1S4RA 4EEUA 4HP9A 3T50A 3FG8A 3ICYA 3G6OA 5TBMA 3PHYA 1S4SA 4M4XA 3RH8B 2PR5A 3A0VA 1S1ZA 1LSXA 4GHIB 3E4PA 1N9LA 5DJTA 4XT2B 1GSVA 4I5SA 4L9EA 1LT0A 4F3LB 3LIAA 1T1AA 3MQOA 3PYPA 3K3DA 4R70A 3UB8A 2WKRA 4L9GA 2R78A 2Z6DA 3H7WB 2YKFA 3MR0A 1OT6A 1T19A 4H6JB 2VV8A 4JGPA 4GHIA 3F1NA 3EWKA 5F5YA 5J3WA 1F98A 5F68A 1S1YA 3LIBA 2PD7A 4KQDA 4WF0A 2PDRA 4HI4A 4E04A 2A24A 3MFXA 4WUJA 3LIFA 3CLOA 2WKPA 1EW0A 4HJ6A 1NWZA 3H7WA 1UGUA 3HJKA 4LRYC 4I3JA 1OTEA 2JN7A 5J7EA 1T1CA 2H28A 4PKYA 3CAXA 4H6JA 2L0WA 1LSVA 5TBMB 4EW7A 1UWPX 1OTBA 2KDKA 4BBUA 3VOLA 4PKYG 3B33A 4JGRA 4MN6A 3E4OA 2P7JA
chains in the Genus database with same CATH superfamily
3LI9A 2Y2NA 2H0TA 3HLCA 5CERA 3S7OA 3ZG9B 4CPKA 3TE8A 1OJ5A 3G31A 3C4OA 2C6WB 5GLCA 5E2HA 1IYPA 3PR6A 4HH3A 4OPRA 3ZGAB 1PNEA 1PI5A 4ZJ2A 1K57C 2ZC5B 1X0OA 5JYOA 3PBQA 3IT9A 4UHUA 3S7PA 5DFXA 1WE4A 3LI8A 5HX9A 1Y28A 2W1TA 3OPHA 3HLBA 1Z6FA 2V0UA 1ODVA 3A0RA 4Q0HA 5DKKA 2PBYA 1ZC2A 3EGXC 3A3JA 2D02A 3GDIA 3KYEA 4LRZE 1KGEA 1DP9A 4WZ4A 2ZOIA 3UE6A 4JLFA 4DDYA 2ZQ8A 1ES3A 4GJ4A 1ES4A 5F1GA 1JWZA 2ZC4B 4MLLA 4GD6A 4LENA 5CHMA 2FH5A 2WKIA 3B47A 3IS2A 4B4XA 5TFQA 3M6BA 5F1FA 2XSSA 3FC7A 2GJ3A 4JBFA 1IEMA 4HH2A 1PZPA 3CWFA 3LIDA 5AQAA 1P9WA 3IBJA 1UWNX 3UY6A 4EUZA 1S6RA 1RCJA 3MQ0A 2B95A 1JVJA 2M7VA 2J3TC 2Y2MA 4S2PA 2WZZA 1XFNA 2V8FA 2JHEA 3IH8A 3QP8A 1FSWA 2RCXA 1NY0A 4S2KA 4YWZA 4R4SA 1ALQA 2BASA 3BWLA 2B18A 3Q7ZA 3LGOA 4OPQA 3VFHA 5CEBA 2VGLS 4QU3A 2XGNA 4OOLA 2XFSA 2ZM0A 1YQSA 1W8QA 2DMWA 4BQMA 4N1HA 3QP4A 3RFBA 4RYEA 4FH4A 4EERA 3ITAA 2XA7S 2HZ5A 5M1AA 4X1LA 1N9OA 5LBRA 3CHWP 3HCYA 4QY5A 2EXBA 2JBFA 4ARZB 5HDCA 4ZTKA 1L0DA 1KE3A 4DE3A 4IUKA 4DE0A 4GS9A 4Y0TA 4GCZA 4X69A 4G3WA 4LCLA 4O01A 4C75A 4I3AA 1LL5A 1K0KA 4EEPA 3BRMA 3PBNA 1XJ2A 1KOUA 1MKIA 3Q7VA 1LL8A 2WUQA 5EECA 1ZKJA 1XXMA 2X01A 3UPNA 3C7UA 2QWSA 1F5MA 4XXRA 4EUVA 3N8RA 4MMNA 3OCNA 1NZOA 2P04A 2Z2LB 4Y3IA 1G5UA 3NHQA 1ZG6A 3BFCA 1GSXA 2L1MA 2LB5A 3OOVA 2NUTC 4L0LA 5EVIA 1FSYA 3S22A 5FA7A 4KZAA 4P6BA 3VP3A 1V9ZA 2INWA 2J80A 4HEFA 3SS4A 2EX6A 5EM1A 4X53A 3KSIA 2HP6A 3K3CA 2W3FA 3BYDA 5HL6A 3ZYTA 5D3OA 1QMEA 4Q0JA 4KG2A 3ULFA 1VHMA 4WBGA 4KZBA 3LIEA 2ACGA 3GVBA 4P6ZS 3BFFA 4GZBA 2FZ0A 1IYSA 1GSWA 3K2NA 3C8CA 2P74A 4KQQA 1N9NA 1MWUA 1TS6A 4DMZA 1H8MA 1G68A 3ZVWA 4QHCA 3HREA 4EV4A 5L09A 4R6LA 1SDNA 4KZ6A 2VV6A 4OOYA 2QJ5A 3TOIA 3LFVA 4HJ3A 1Z09A 3GRJA 3UMDA 2X02A 5L10A 4LPZA 3GTCA 1ONHA 2JKRM 3KSGA 3IF5A 4C3QA 2JC7A 3B3XA 1MPLA 4EEUA 1NLYA 1PWDA 3NULA 4OPYA 3ZVTA 4U0TA 1MC0A 4PPRA 2W1RA 3G6OA 1YT4A 1PW1A 1PI4A 4CJNA 3V5MA 5FSRA 2H5SA 5E43A 3E4PA 4Y17A 1L2SA 1CEGA 3WWXA 4S2JA 4K91A 3V3RA 2W3EA 2ZD8A 4XT2B 4R1GA 5AQ7A 4OP8A 2IWDA 1LT0A 4F3LB 1T1AA 1PW8A 4LFUA 3K3DA 3T1RA 2V20A 3QNBA 1XP4A 4PAUA 5DVAA 5FDSA 2DNSA 1KE0A 2YKFA 3OC2A 5HAQA 1CQAA 2IA2A 2V1ZA 2PT7A 4X1MA 4JGPA 3SZTA 3F1NA 5BOHA 2JKTI 5F68A 3UN7A 3QHYA 4WMCD 3C5AA 2EX9A 2OSUA 4QB8A 1PFLA 2J3TD 2W3GA 4FUWA 4WUJA 1H3QA 3CLOA 4U3TA 3RJUA 3T1QB 3VP0A 5EOEA 5FQ9A 5M18A 4HJ6A 1YLTA 1NRFA 2VZWA 1OTEA 2JN7A 3IXGA 1T1CA 2H28A 4ZRRA 3WS2A 1GA9A 3NCKA 2BTFP 3JYIA 4OP5A 4EW7A 1DJCA 3IX4A 3ZCZA 1S0WA 5G18A 3BJNA 1SKFA 4RX3A 1J3WA 2HP5A 3BQAA 3DTKA 4PKYG 1G6AA 4XUZA 1IYOA 1MWRA 1Q2QA 4OQIA 4PM6A 5F82A 2P7JA 3IWQA 2GX5A 3BFEA 1P0ZA 3VE4A 2HJEA 2VX8A 1L0FA 4BBVA 4CLCA 4UQIS 2UWXA 3C38A 1K56A 2PHYA 1BULA 1O7EA 2O9BA 5FAPA 4FSFA 3IHBA 4ZDXA 3IBRA 2OLVA 3IXBA 3UB7A 4G3KA 5A8BA 4X6TA 2E8JA 1FIKA 5AVEA 2A24B 3HLEA 3UB9A 4KUKA 4NKPA 3OZHA 1SDEA 3PBTA 2ZM2A 3VV4A 4EXOA 3BY8A 3FKVA 4HHDA 4BBTA 3UDIA 3VP1A 4DDSA 5GLAA 4WL9A 4JXVA 3CZDA 1D7EA 4R38A 1YSQA 3LR3A 1M6KA 1JNUA 3P98A 4KZ8A 3KSFA 5AJGA 2V1AA 2QZ6A 4HBTA 5AVFA 1D06A 4BL2A 4KZ7A 4X55A 1AXBA 2CMNA 1GHIA 5FQMA 4DE1A 2VV7A 4EBLA 1A0KA 1CEFA 3MXQA 2V1BA 3PXPA 1IKIA 1BLHA 3HUNA 3T4OA 4N92A 2DCFA 1PRQA 4E3LA 3IX8A 2QYBA 2PR6A 1LLBA 1YLPA 4NEED 2QJ7A 2W1TB 4HY8A 3BEBA 3VOZA 3OLOA 4HP4A 1NYMA 5HD5A 4UA6A 5J4EA 3NOPC 1YLWA 5EVEA 1FR6A 3V67A 1FQGA 3HJIA 4K0XA 4O0PA 1P9RA 3HUOA 5HDDA 3W4PA 3TSGA 2ZM8A 4X56A 3TW8A 3IS2B 5FQQA 2ZL1B 2HF6A 3Q82A 3OCLA 3U4LP 2EWVA 1YKDA 1GHPA 4S2MA 1CI9A 4PMAA 4M3KA 4YNRA 1ESIA 4EETB 3M6HA 5L07A 1FCOA 1OMEA 1IFQA 2QPNA 5CTNA 2XH9A 5F83A 3EQUA 5A92A 5DJUA 4NXBA 4HQAA 4OVDA 2ZL1A 1OPXA 1ZHHB 3BY9A 5HDSA 4EQIA 5CEDA 2AVXA 3D4FA 5GHYA 2Y8HA 3UE1A 3C4PA 2GNXA 1BT5A 3AGEA 4RA7A 3NBLA 3SH9A 2YKHA 4BD1A 2W0NA 2Y4AA 4BWIA 1W79A 2QMIA 3JVUA 5DTTA 5CRFA 1E3UA 3HL9A 2VLGA 3ZFZA 1ES2A 4N1XA 2PD8A 1HLUP 4ID4A 3IXHA 5EV0A 1K55A 3NOUC 4JXWA 3RTYA 4GS9B 3RXXA 4JGQA 3MKEA 1I2SA 5CHJA 1DP6A 5DF8A 3IXDA 2ZMFA 4GLQA 4JF6A 1EWZA 1HTZA 3V3SA 2OOLA 3SS5A 3DW0A 3Q7VB 1JWPA 3CMZA 1N9BA 5E2EA 3E0YA 5AQ9A 1DRMA 1OTIA 4Y7PA 1MY8A 5HWVA 3KYZA 3G35A 2FFFB 3ZNYA 4NXGA 1K25A 4OH0A 5HL1A 3GR2A 3NI9A 1MXOA 5E2GA 5EVIB 4B4ZA 2XFTA 5TJJA 2VK3A 3R4KA 3FG8A 2FFYA 1L3LA 4PM7A 3RH8B 1PIOA 3A0VA 1S1ZA 4B88A 1LSXA 4BLMA 4BMWA 2GZAA 5FL3A 4GHIB 1MKMA 5DJTA 1G6OA 5HW3A 1I5QA 3VP2A 1TDLA 3VSLA 3JPUA 4P85A 4R3JA 3LIAA 1FILA 4Y0OA 3TJZC 4F94A 3ZNTA 4R70A 4YFMA 5TGFA 1XX2A 4KENB 3UB8A 3E2LA 5GL9A 1WYBA 4A5RA 5DTSA 2PAVP 3MR0A 4PM8A 1K54A 4OOMA 2Y2GA 5EVIC 2VV8A 3A3DA 4GHIA 1EROA 2JKFA 3UB5P 4ZAMA 3UPOA 4P0MA 3T4KA 3VFFA 5FDHA 4WEKA 3IHAA 1K54C 2KOIA 1KVMA 2Q9MA 1U60A 4HI4A 3E98A 4AFIA 5EVLA 4E04A 3M2KA 3LCEA 3LIFA 4KZ4A 3VSKA 3A3IA 1YLYA 4RX2A 2EFXA 1Q2PA 1KDWA 4U0XA 4S2OA 3TG9A 1NWZA 2ZQ9A 3HJKA 1UGUA 4LRYC 4Q0IA 4I3JA 3KO6A 2H10A 2OAQ1 2V8CA 3SH8A 2KLIA 4CLCE 4KZ5A 1JTDA 2KDKA 1Y4OA 3MFDA 1O07A 2P9VB 2CC1A 4BBUA 2B5RA 5CGWA 1XGIA 3NECA 2XA7M 4E3NA 1DJAA 5L2FA 4PHTA 5GHXA 3O86A 3B42A 5HPFA 2Z6CA 4OQHA 4B93A 1P97A 4GB7A 5FAQA 1BLSA 2R9XA 2JE5A 4E3IA 2ZLYA 3WS0A 4DJ3A 1FR1A 1H0MA 1VETA 5HAPA 1BLCA 1RGZA 2P9VA 3F1NB 4NXEA 3UB6A 2V0WA 3HLFA 1W7FA 1W8YA 3FKWA 2ZQAA 5HZHA 4E6WA 4DE2A 3SH7A 5EFWA 3EOIA 3MF0A 2NUPC 2X71A 5EM0A 2Y2KA 1ERMA 1HVBA 3EQVA 2ZMVA 4I39A 2VEAA 2O0YA 3DWZA 5CX7A 2HV1A 2ZOHA 2IWBA 4QJGA 2I9VA 3CG5A 2XEPA 3LICA 2XD1A 1FOFA 4HNBA 2A3UA 5EOOA 4PM5A 4WELA 3C2WA 2BG1A 3BLMA 1DY6A 1GHMA 5HAIA 5JYPA 2JCHA 4JXGA 4EQ1A 5CHUA 4DXBA 2B02A 3IF6B 3GSGA 5GHZA 2M1CA 3HVFA 4P6ZM 3F1PB 4GKUA 4DN0A 3GECA 5AQBA 1NJ4A 1MZUA 1PYYA 4KQRA 2JKGA 3MXRA 2Y2HA 4KG5A 1XA1A 2J3WA 3SS3A 1EI5A 2HPBA 4CLCB 2I72A 4BD0A 5KSCA 2G2WA 1XJ3A 2D01A 2ZMAA 3R7WA 1FCNA 3MQQA 4JGOA 2HGVA 4MBFA 1E4DA 3UMEA 1ERQA 3IF6A 5E2FA 1VB6A 3CPTB 1HD8A 3C7VA 1CK3A 1DJBA 3HBRA 3N6IA 4I3IA 4Z1WA 3F1PA 4MDZA 4BL3A 1E25A 5DKLA 5HFOA 3IF6C 2GDNA 1TS8A 2XQZA 3CUEA 4RVAA 4S2NA 4WLAA 4HBUA 3VMAA 4UA9A 3BFGA 3L7HA 1SHVA 5IS1A 4O8GA 3D72A 4NK3A 1YM1A 2Q9NA 3H82B 4OONA 4CLCC 1SKOA 3O88A 3CPTA 3PBOA 1YSPA 5HWTA 4X25A 2Y2IA 3LY3A 4GDNA 5G4YA 2Y2PA 3BQ8A 3LR0A 2O9AA 3N8SA 4FD8A 4G3VA 5I5LA 3LYXA 3VE3A 4Y13A 3IQAA 2BLSA 3EEHA 1TS0A 3U2AA 1S66L 3E2KA 3W2ZA 4OPZA 1IKGA 5EVID 1H8ZA 3H82A 3WRZA 1VEUB 5EPHA 2WKQA 4KUOA 1SZVA 3NOTC 1ZTUA 4C6YA 4QD4A 1BYWA 4JKTA 2PU4A 5U47A 4R23A 4WZ5A 4D2OA 4R3BA 3QP6A 2J9OA 1CF0A 1K4FA 4LV3A 2V2FF 2QHKA 4LV1A 5HPIA 3ZG0A 1W5DA 3W8KA 4Y5FA 3SOIA 3UNWA 3G2YA 3N7WA 4WZ5C 4DXCA 4IEDA 1K4EA 1RP5A 4IBXA 4S2LA 5FI6A 5A90A 1GCEA 3BLSA 3C30A 3S4XA 1RGYA 4OKPA 3IWIA 4GW9A 2PYPA 1OTDA 2WGWB 5HD3A 1VEUA 3LR4A 1JWVA 4GDBA 2ZQ7A 3T4QA 3S1YA 1TF1A 1KDSA 2ZC3B 2JKTM 1T1BA 1HZOA 2XK1A 3CITA 3RXWA 5KIZA 2EX8A 4HIAA 3QP5A 2WKEA 3PAGA 1WYCA 3EGDC 1XFQA 2ZC6B 3MZDA 4GNUA 1PWGA 4WYYA 1YLJA 3I7JA 4MBKA 5CGSA 4OLDA 5EUAA 4R3AA 4I38A 3MKFA 5IU1A 2PBDP 5F69A 1BZAA 4ZJ1A 2WGWA 4ESPA 1OTAA 1S4RA 3BECA 2K31A 1LL9A 3QP1A 3PTEA 4OQ0A 4HP9A 4E3MA 4MEZA 1K57A 5TBMA 3PHYA 1H5XA 5DF7A 2HDUA 4ZJ3A 1D1JA 1N9LA 2HDQA 2XRNA 4IBRA 3ZG5A 1LI9A 2E8IA 3G32A 1JTGA 3WRTA 5KZHA 3MZEA 4FOFA 4JXSA 3PBRA 4I5SA 2K2NA 2WADA 3N8LA 4L9EA 4LV0A 4EWFA 1KVLA 2OV5A 1MBLA 3PBSA 3M2JA 3Q1FA 4L9GA 3O87A 4OQGA 2R78A 2WGVA 3UE0A 4HESA 1I2WA 1OT6A 4H6JB 5KMWA 2J9PA 3NC8A 2XF3A 2WYXA 1IYQA 3EWKA 4H8RA 5F5YA 5J3WA 3FV7A 4FCFA 5EE8A 1S1YA 1QMFA 2PD7A 4WMCA 3T4TA 4WF0A 1TVFA 3UDXA 2PDRA 3HLDA 3QNCA 1Y54A 3MFXA 4R0QA 3A3FA 5M19A 3KSHA 2WKPA 4MBHA 1EW0A 2JKRI 4R4RA 5DTKA 4K0WA 5GLDA 2ZQCA 3P09A 2EWWA 3CAXA 4H6JA 3O5YA 2A49A 1K55C 5C5KA 3G2ZA 4XUXA 3BM6A 2G2UA 1UWPX 1BSGA 3L9KA 1W63M 3LO7A 2W3HA 3VP4A 1ACFA 2Y55A 4JGRA 1NYYA 4MN6A 2M7UA 1S4SA 1ZG4A 5IT5A 5FI7A 4GD8A 4MNRA 2ZBBA 3W4QA 2A2LA 3MJQA 4JF5A 3A0SA 1PZOA 4CLCD 1NZUA 5FI2A 1K56D 4UAAA 4MN7A 5HWWA 5L8MA 4LGWA 1MWSA 3T12B 1XPBA 3T4JA 1NRJA 1N4OA 1XKZA 5J8XA 4YINA 1K6RA 1F9IA 1G28A 3IH9A 3OBFA 4DRTA 4JPMA 4Y15A 1TS7A 3S7NA 2VKSA 3UDFA 5HARA 1KE4A 4HJ4A 2XROA 5HSQA 2VGKA 2KX6A 3ZQ5A 4ARZA 4OLGA 5FATA 3O3VA 1LSWA 4WN5A 4UA7A 2K7SA 4IHQA 3BW6A 4RQ9A 1XA7A 1L0GA 3NJAA 2Y2OA 3D3OA 3NY4A 3EEAA 4LRXC 3LEZA 3JVVA 4EBPA 2XLNA 3CI6A 3D9YA 4IVIA 1J9MA 3G34A 1ES5A 1BLPA 3H9WA 4LLOB 1NXYA 2EXAA 1OT9A 2L4RA 3NDEA 2G7UA 3MXSA 2W27A 1BTLA 2WKHA 3MS6A 3QP2A 3ITBA 2MJ6A 2ZC7A 1OJGA 3KYQA 4Y2FA 4Z9QA 3E4QA 2VGLM 1K6SA 4KQOA 1PWCA 3Q81A 4GN2A 1T18A 3GQZA 2Q0OA 1VETB 2WZXA 3HLGA 3FWLA 2WGIA 2Y91A 2Y59A 3DWKA 4FH2A 2O9CA 1AWIA 3F1OB 3N4IA 4QWOA 4IVKA 5G4ZA 2ZJ9A 2XDMA 1XJ6A 2Y79A 3AGFA 3ZHHA 3V50A 3W4OA 2HJ9C 1IELA 4BENA 3MSHA 4X68A 5I94A 3FPWA 1BUEA 5CXWA 3WS4A 1S67L 1GA0A 2W3DA 1YAXA 4CQHA 3A3EA 4N9KA 3FPVA 1TD5A 3G30A 1FCMA 5IHVA 4FTXA 2OWJA 3ZDJA 2H0YA 5DFYA 3DBAA 3F1OA 2WAFA 3P7NA 5FQKA 3MBZA 2J8YA 1CI8A 1TEMA 2Y2LA 4KG6A 1K38A 2UV0E 2OLUA 3CJMA 1DP8A 3OPLA 4DF6A 3T4SA 2Z2MB 3SW1A 4N9LA 3FZCA 1YMXA 2QKPA 1WA9A 4Y0UA 3R7WB 4DKIA 3IX3A 3WS1A 1SCWA 3DAVA 5FEGA 1TDGA 4ZBEA 1IOUA 2ZQDA 1M40A 2HDRA 4YOFA 2PRFA 2LB9A 3T1SA 3VOYA 1C3BA 1YPRA 2OWHA 2IWCA 5TR7A 3FYZA 2EX2A 2RL3A 4QY6A 1KGGA 5F6AA 2PYRA 4XT2A 5A93A 2Y2JA 5CGXA 2VGJA 4ETZA 5FQJA 4BJPA 3UPPA 1E3UD 3NIAA 4NXFA 2V9AA 4F3LA 1XGJA 3LEQA 2PU2A 3S7QA 2WK0A 3ZG7B 4EESA 3KX0X 4KZ3A 1KGFA 4JF4A 1XJ4A 1V9YA 4UEYA 2XD5A 1VQQA 5FAOA 1L0EA 3NDGA 2R9WA 3P01A 3AGDA 1H8YA 1YLZA 2EA9A 1SKOB 3ZG8B 5CTMA 3T4LA 4NETA 1MWTA 4E3OA 4L9FA 4K08A 3Q07A 5CECA 4MN5A 1VM1A 4QPRA 3GV9A 1YMSA 2J7VA 1STZA 4HOIA 5FQIA 4DJ2A 2C5WB 2Y2QA 3LUQA 4EU0A 4MCWA 4B9OA 3V39A 1CJFA 3BFDA 3CUEC 4S2NC 4ME4A 3T50A 4II7A 3IWOA 4WEJA 3ICYA 4S2IA 4M4XA 2PR5A 2VJWA 4KZ9A 4GOGA 4WM9A 3UO9A 5KSHA 1GSVA 3WS5A 4D60A 1F2KA 3MQOA 3PYPA 4ETXA 2WKRA 4LCMA 3GMWA 3T1XA 2Z6DA 3H7WB 3DTMA 3G4PA 1T19A 2OAP1 3MZFA 1LHYA 4E3JA 1F98A 3MMHA 1ONGA 3LIBA 3ISGA 1W63Q 4KQDA 2WAEA 3DTEA 3LR5A 4IUHA 3PAEA 2A24A 2VA0A 2HP9A 3HLWA 4E3KA 5A91A 1ESUA 5FEFA 4O7DA 5FASA 1LI0A 4E6XA 3H7WA 1NLZA 4P87A 2P08A 5GLBA 5MC7A 4LV2A 5J7EA 3OPPA 2EFUA 2HDSA 4PKYA 4PM9A 5K5BA 2L0WA 1LSVA 5TBMB 2XR0A 3TRCA 2DRWA 1OTBA 3OPRA 4NG2A 3DTIA 4IJGA 4Q8IA 5DF9A 3VOLA 2O99A 3B33A 3UE3A 4EBNA 3HUMA 4UQIM 3LY4A 3E4OA
chains in the Genus database with same CATH topology
3B42A 5HPFA 2GX5A 2Z6CA 3LI9A 5IT5A 1P0ZA 4B93A 3VE4A 1P97A 2HJEA 2ZBBA 2VX8A 2A2LA 3MJQA 3S7OA 4BBVA 4CLCA 3A0SA 4UQIS 4CLCD 3TE8A 3C38A 1OJ5A 4DJ3A 4MN7A 5HWWA 2PHYA 5L8MA 3F1NB 3PR6A 2O9BA 4HH3A 4NXEA 4FSFA 3T4JA 3UB6A 3IBRA 1NRJA 2V0WA 1X0OA 3PBQA 5HZHA 3UB7A 1F9IA 4G3KA 5A8BA 1G28A 3S7PA 5DFXA 3OBFA 3LI8A 5EFWA 5AVEA 3EOIA 1Y28A 3MF0A 2A24B 1TS7A 2W1TA 3UB9A 2NUPC 4KUKA 3A0RA 2V0UA 1ODVA 4NKPA 3S7NA 2VKSA 4Q0HA 5DKKA 3EGXC 3EQVA 2ZMVA 2D02A 3GDIA 4I39A 2VEAA 4LRZE 2O0YA 3PBTA 5CX7A 2HV1A 1DP9A 4HJ4A 2ZOIA 3UE6A 2XROA 3VV4A 4EXOA 2ZOHA 5HSQA 2KX6A 2I9VA 3BY8A 4GJ4A 4HHDA 3ZQ5A 4ARZA 4BBTA 3LICA 4HNBA 1LSWA 4WN5A 2K7SA 4WL9A 4IHQA 3BW6A 4RQ9A 4WELA 3C2WA 2FH5A 1D7EA 3NJAA 3B47A 4R38A 3IS2A 3D3OA 1YSQA 3LR3A 3FC7A 2XSSA 3EEAA 2GJ3A 4LRXC 4EQ1A 3JVVA 3CI6A 1JNUA 4HH2A 3CWFA 2B02A 3KSFA 3H9WA 5AJGA 4LLOB 2V1AA 3LIDA 2M1CA 1OT9A 5AVFA 2L4RA 4P6ZM 1P9WA 1D06A 3IBJA 1UWNX 3F1PB 2G7UA 4DN0A 2W27A 2CMNA 3GECA 3MQ0A 1MZUA 2M7VA 2J3TC 2MJ6A 1OJGA 3KYQA 2J3WA 4Y2FA 2VV7A 3E4QA 1XFNA 2VGLM 4KQOA 2JHEA 4CLCB 3MXQA 1T18A 1XJ3A 2V1BA 2D01A 3PXPA 4YWZA 3R7WA 3MQQA 2BASA 3BWLA 2B18A 4JGOA 2HGVA 3UMEA 3T4OA 2O9CA 2VGLS 3F1OB 1VB6A 4OOLA 2QYBA 5G4ZA 2DMWA 2PR6A 4I3IA 4Z1WA 1XJ6A 2Y79A 3F1PA 4MDZA 4NEED 2QJ7A 3RFBA 2W1TB 2HJ9C 4HY8A 5DKLA 3OLOA 4EERA 4HP4A 3FPWA 1TS8A 5HD5A 2XA7S 5J4EA 3CUEA 3NOPC 1N9OA 4WLAA 5LBRA 3HCYA 3V67A 1S67L 4ARZB 2W3DA 5HDCA 1YAXA 4CQHA 5IS1A 3HJIA 4O0PA 4IUKA 4GS9A 1P9RA 3FPVA 1TD5A 4O8GA 5HDDA 3D72A 4GCZA 4G3WA 3H82B 2OWJA 3TW8A 3IS2B 4O01A 5DFYA 3DBAA 4CLCC 3F1OA 3P7NA 4I3AA 2HF6A 3PBOA 3OCLA 2EWVA 4EEPA 1YKDA 1YSPA 3PBNA 1XJ2A 5HWTA 1KOUA 1LL8A 5G4YA 4YNRA 3BQ8A 3LR0A 2QWSA 2O9AA 1F5MA 4EETB 4EUVA 1DP8A 4MMNA 3OCNA 2P04A 4Y3IA 4G3VA 3T4SA 3NHQA 1GSXA 5I5LA 3LYXA 2L1MA 3SW1A 3VE3A 1IFQA 2LB5A 3EEHA 3OOVA 2QKPA 1TS0A 2NUTC 4L0LA 1WA9A 3U2AA 1S66L 3W2ZA 3EQUA 3H82A 3R7WB 5DJUA 4NXBA 1V9ZA 4HQAA 2INWA 2J80A 1IOUA 2WKQA 4KUOA 3NOTC 4YOFA 1ZTUA 1OPXA 2LB9A 1ZHHB 3BY9A 5HDSA 1BYWA 3KSIA 2OWHA 3K3CA 2Y8HA 2W3FA 5HL6A 3ZYTA 2GNXA 2QHKA 4Q0JA 5F6AA 3ULFA 2PYRA 2YKHA 4XT2A 5HPIA 1VHMA 2W0NA 4Y5FA 4BWIA 4ETZA 3LIEA 3JVUA 4BJPA 4NXFA 2V9AA 4F3LA 4P6ZS 2VLGA 2PD8A 3C30A 2FZ0A 3S7QA 4EESA 1GSWA 3KX0X 3NOUC 3K2NA 3C8CA 4GW9A 2PYPA 1OTDA 4GS9B 3RTYA 1XJ4A 5HD3A 3LR4A 1N9NA 1V9YA 4UEYA 1TS6A 4JGQA 4DMZA 3P01A 1DP6A 2EA9A 1H8MA 3T4QA 2ZMFA 4GLQA 3T4LA 1TF1A 2JKTM 4R6LA 1T1BA 2OOLA 3CITA 4L9FA 2VV6A 4K08A 5KIZA 4HIAA 4MN5A 2QJ5A 4QPRA 3EGDC 1XFQA 3E0YA 3LFVA 1DRMA 4HJ3A 1OTIA 1STZA 4HOIA 3UMDA 5HWVA 3KYZA 4R3AA 4DJ2A 4I38A 4LPZA 5IU1A 3LUQA 4NXGA 2JKRM 4MCWA 5F69A 3KSGA 4B9OA 4EU0A 1OTAA 1S4RA 3CUEC 2K31A 4ME4A 5TJJA 4EEUA 1NLYA 4HP9A 3T50A 4II7A 3R4KA 3FG8A 4WEJA 3ICYA 1MC0A 2W1RA 3G6OA 5TBMA 3PHYA 1S4SA 4M4XA 3RH8B 2PR5A 3A0VA 1S1ZA 2VJWA 1LSXA 4BMWA 2GZAA 5FL3A 4GHIB 3E4PA 1N9LA 1MKMA 5DJTA 2XRNA 1G6OA 2W3EA 5KSHA 4XT2B 4FOFA 1GSVA 3PBRA 4I5SA 2K2NA 4L9EA 1LT0A 4F3LB 3LIAA 1T1AA 3TJZC 3MQOA 3PYPA 3K3DA 3PBSA 4R70A 3UB8A 4ETXA 2WKRA 4L9GA 4PAUA 2R78A 2Z6DA 3H7WB 2YKFA 3OC2A 3MR0A 2IA2A 1OT6A 4OOMA 1T19A 2PT7A 4H6JB 2VV8A 4JGPA 4GHIA 3F1NA 2OAP1 3EWKA 5F5YA 5J3WA 2JKTI 1F98A 3MMHA 3T4KA 5F68A 1S1YA 3LIBA 2PD7A 1W63Q 3T4TA 4WEKA 4KQDA 4WF0A 2KOIA 3LR5A 2PDRA 4HI4A 4IUHA 3E98A 4AFIA 4E04A 2A24A 2VA0A 2J3TD 2W3GA 3MFXA 4WUJA 3LIFA 1H3QA 3CLOA 3KSHA 2WKPA 1EW0A 4HJ6A 1NWZA 2JKRI 3HJKA 1UGUA 3H7WA 4LRYC 1NLZA 4Q0IA 2VZWA 4I3JA 3KO6A 1OTEA 2P08A 2JN7A 5MC7A 2OAQ1 5J7EA 1T1CA 2H28A 4PKYA 2EWWA 3CAXA 4H6JA 3O5YA 4ZRRA 5K5BA 2KLIA 2L0WA 1LSVA 5TBMB 5C5KA 4CLCE 4EW7A 3TRCA 1UWPX 1OTBA 2KDKA 1W63M 2W3HA 4IJGA 3BJNA 4BBUA 5DF9A 3VOLA 2O99A 3BQAA 4PKYG 3B33A 2XA7M 3UE3A 4JGRA 4PHTA 4UQIM 4MN6A 2M7UA 3E4OA 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6C A;  3LI9 A;  1P0Z A;  3VE4 A;  1P97 A;  2ZBB A;  3MJQ A;  4BBV A;  3A0S A;  1OJ5 A;  4DJ3 A;  5HWW A;  2PHY A;  3F1N B;  4HH3 A;  4NXE A;  3UB6 A;  3IBR A;  2V0W A;  1X0O A;  5HZH A;  3UB7 A;  1F9I A;  5A8B A;  1G28 A;  5AVE A;  3LI8 A;  5EFW A;  1Y28 A;  2A24 B;  1TS7 A;  3UB9 A;  4KUK A;  3A0R A;  2V0U A;  1ODV A;  5DKK A;  2D02 A;  3GDI A;  4I39 A;  2VEA A;  4LRZ E;  2HV1 A;  1DP9 A;  4HJ4 A;  2ZOI A;  3UE6 A;  4EXO A;  2ZOH A;  5HSQ A;  2KX6 A;  3ZQ5 A;  2I9V A;  3BY8 A;  4HHD A;  4BBT A;  3LIC A;  4HNB A;  1LSW A;  4WN5 A;  2K7S A;  4WL9 A;  4RQ9 A;  3C2W A;  1D7E A;  3NJA A;  4R38 A;  3IS2 A;  3FC7 A;  4LRX C;  2GJ3 A;  4EQ1 A;  1JNU A;  4HH2 A;  3CWF A;  2B02 A;  3H9W A;  4LLO B;  2V1A A;  3LID A;  2M1C A;  1OT9 A;  5AVF A;  2L4R A;  1D06 A;  1UWN X;  3F1P B;  2W27 A;  2CMN A;  3GEC A;  1MZU A;  1OJG A;  2VV7 A;  3E4Q A;  1XFN A;  2JHE A;  3MXQ A;  1T18 A;  1XJ3 A;  2V1B A;  2D01 A;  4YWZ A;  3MQQ A;  2BAS A;  3BWL A;  4JGO A;  3UME A;  3F1O B;  1VB6 A;  5G4Z A;  2PR6 A;  4I3I A;  1XJ6 A;  3F1P A;  2QJ7 A;  4HY8 A;  5DKL A;  3OLO A;  4EER A;  4HP4 A;  1TS8 A;  5HD5 A;  5J4E A;  3NOP C;  1N9O A;  4WLA A;  1S67 L;  5HDC A;  5IS1 A;  3HJI A;  4GS9 A;  5HDD A;  3D72 A;  4GCZ A;  3H82 B;  2OWJ A;  3IS2 B;  3F1O A;  3P7N A;  4I3A A;  4EEP A;  1XJ2 A;  5HWT A;  1KOU A;  1LL8 A;  5G4Y A;  2QWS A;  4EET B;  1DP8 A;  3NHQ A;  1GSX A;  5I5L A;  3LYX A;  2L1M A;  3SW1 A;  3VE3 A;  3EEH A;  2QKP A;  1TS0 A;  1WA9 A;  1S66 L;  3H82 A;  5DJU A;  4NXB A;  1V9Z A;  4HQA A;  2INW A;  2J80 A;  2WKQ A;  4KUO A;  3NOT C;  3BY9 A;  5HDS A;  1BYW A;  2OWH A;  3K3C A;  2QHK A;  5F6A A;  3ULF A;  2PYR A;  2YKH A;  4XT2 A;  2W0N A;  3LIE A;  4NXF A;  2V9A A;  4F3L A;  2VLG A;  2PD8 A;  4EES A;  1GSW A;  3KX0 X;  3NOU C;  3C8C A;  4GW9 A;  2PYP A;  1OTD A;  4GS9 B;  3RTY A;  1XJ4 A;  5HD3 A;  1N9N A;  1V9Y A;  1TS6 A;  4JGQ A;  1DP6 A;  2EA9 A;  4R6L A;  1T1B A;  2OOL A;  4L9F A;  2VV6 A;  4K08 A;  5KIZ A;  4HIA A;  4MN5 A;  2QJ5 A;  1XFQ A;  4HJ3 A;  1DRM A;  1OTI A;  4HOI A;  3UMD A;  5HWV A;  4R3A A;  4DJ2 A;  4I38 A;  4LPZ A;  5IU1 A;  3LUQ A;  4NXG A;  5F69 A;  4B9O A;  1OTA A;  1S4R A;  4EEU A;  4HP9 A;  3T50 A;  3FG8 A;  3ICY A;  3G6O A;  5TBM A;  3PHY A;  1S4S A;  4M4X A;  3RH8 B;  2PR5 A;  3A0V A;  1S1Z A;  1LSX A;  4GHI B;  3E4P A;  1N9L A;  5DJT A;  4XT2 B;  1GSV A;  4I5S A;  4L9E A;  1LT0 A;  4F3L B;  3LIA A;  1T1A A;  3MQO A;  3PYP A;  3K3D A;  4R70 A;  3UB8 A;  2WKR A;  4L9G A;  2R78 A;  2Z6D A;  3H7W B;  2YKF A;  3MR0 A;  1OT6 A;  1T19 A;  4H6J B;  2VV8 A;  4JGP A;  4GHI A;  3F1N A;  3EWK A;  5F5Y A;  5J3W A;  1F98 A;  5F68 A;  1S1Y A;  3LIB A;  2PD7 A;  4KQD A;  4WF0 A;  2PDR A;  4HI4 A;  4E04 A;  2A24 A;  3MFX A;  4WUJ A;  3LIF A;  3CLO A;  2WKP A;  1EW0 A;  4HJ6 A;  1NWZ A;  3H7W A;  1UGU A;  3HJK A;  4LRY C;  4I3J A;  1OTE A;  2JN7 A;  5J7E A;  1T1C A;  2H28 A;  4PKY A;  3CAX A;  4H6J A;  2L0W A;  1LSV A;  5TBM B;  4EW7 A;  1UWP X;  1OTB A;  2KDK A;  4BBU A;  3VOL A;  4PKY G;  3B33 A;  4JGR A;  4MN6 A;  3E4O A;  2P7J A; 
#chains in the Genus database with same CATH topology
 3LI9 A;  2Y2N A;  2H0T A;  3HLC A;  5CER A;  3S7O A;  3ZG9 B;  4CPK A;  3TE8 A;  1OJ5 A;  3G31 A;  3C4O A;  2C6W B;  5GLC A;  5E2H A;  1IYP A;  3PR6 A;  4HH3 A;  4OPR A;  3ZGA B;  1PNE A;  1PI5 A;  4ZJ2 A;  1K57 C;  2ZC5 B;  1X0O A;  5JYO A;  3PBQ A;  3IT9 A;  4UHU A;  3S7P A;  5DFX A;  1WE4 A;  3LI8 A;  5HX9 A;  1Y28 A;  2W1T A;  3OPH A;  3HLB A;  1Z6F A;  2V0U A;  1ODV A;  3A0R A;  4Q0H A;  5DKK A;  2PBY A;  1ZC2 A;  3EGX C;  3A3J A;  2D02 A;  3GDI A;  3KYE A;  4LRZ E;  1KGE A;  1DP9 A;  4WZ4 A;  2ZOI A;  3UE6 A;  4JLF A;  4DDY A;  2ZQ8 A;  1ES3 A;  4GJ4 A;  1ES4 A;  5F1G A;  1JWZ A;  2ZC4 B;  4MLL A;  4GD6 A;  4LEN A;  5CHM A;  2FH5 A;  2WKI A;  3B47 A;  3IS2 A;  4B4X A;  5TFQ A;  3M6B A;  5F1F A;  2XSS A;  3FC7 A;  2GJ3 A;  4JBF A;  1IEM A;  4HH2 A;  1PZP A;  3CWF A;  3LID A;  5AQA A;  1P9W A;  3IBJ A;  1UWN X;  3UY6 A;  4EUZ A;  1S6R A;  1RCJ A;  3MQ0 A;  2B95 A;  1JVJ A;  2M7V A;  2J3T C;  2Y2M A;  4S2P A;  2WZZ A;  1XFN A;  2V8F A;  2JHE A;  3IH8 A;  3QP8 A;  1FSW A;  2RCX A;  1NY0 A;  4S2K A;  4YWZ A;  4R4S A;  1ALQ A;  2BAS A;  3BWL A;  2B18 A;  3Q7Z A;  3LGO A;  4OPQ A;  3VFH A;  5CEB A;  2VGL S;  4QU3 A;  2XGN A;  4OOL A;  2XFS A;  2ZM0 A;  1YQS A;  1W8Q A;  2DMW A;  4BQM A;  4N1H A;  3QP4 A;  3RFB A;  4RYE A;  4FH4 A;  4EER A;  3ITA A;  2XA7 S;  2HZ5 A;  5M1A A;  4X1L A;  1N9O A;  5LBR A;  3CHW P;  3HCY A;  4QY5 A;  2EXB A;  2JBF A;  4ARZ B;  5HDC A;  4ZTK A;  1L0D A;  1KE3 A;  4DE3 A;  4IUK A;  4DE0 A;  4GS9 A;  4Y0T A;  4GCZ A;  4X69 A;  4G3W A;  4LCL A;  4O01 A;  4C75 A;  4I3A A;  1LL5 A;  1K0K A;  4EEP A;  3BRM A;  3PBN A;  1XJ2 A;  1KOU A;  1MKI A;  3Q7V A;  1LL8 A;  2WUQ A;  5EEC A;  1ZKJ A;  1XXM A;  2X01 A;  3UPN A;  3C7U A;  2QWS A;  1F5M A;  4XXR A;  4EUV A;  3N8R A;  4MMN A;  3OCN A;  1NZO A;  2P04 A;  2Z2L B;  4Y3I A;  1G5U A;  3NHQ A;  1ZG6 A;  3BFC A;  1GSX A;  2L1M A;  2LB5 A;  3OOV A;  2NUT C;  4L0L A;  5EVI A;  1FSY A;  3S22 A;  5FA7 A;  4KZA A;  4P6B A;  3VP3 A;  1V9Z A;  2INW A;  2J80 A;  4HEF A;  3SS4 A;  2EX6 A;  5EM1 A;  4X53 A;  3KSI A;  2HP6 A;  3K3C A;  2W3F A;  3BYD A;  5HL6 A;  3ZYT A;  5D3O A;  1QME A;  4Q0J A;  4KG2 A;  3ULF A;  1VHM A;  4WBG A;  4KZB A;  3LIE A;  2ACG A;  3GVB A;  4P6Z S;  3BFF A;  4GZB A;  2FZ0 A;  1IYS A;  1GSW A;  3K2N A;  3C8C A;  2P74 A;  4KQQ A;  1N9N A;  1MWU A;  1TS6 A;  4DMZ A;  1H8M A;  1G68 A;  3ZVW A;  4QHC A;  3HRE A;  4EV4 A;  5L09 A;  4R6L A;  1SDN A;  4KZ6 A;  2VV6 A;  4OOY A;  2QJ5 A;  3TOI A;  3LFV A;  4HJ3 A;  1Z09 A;  3GRJ A;  3UMD A;  2X02 A;  5L10 A;  4LPZ A;  3GTC A;  1ONH A;  2JKR M;  3KSG A;  3IF5 A;  4C3Q A;  2JC7 A;  3B3X A;  1MPL A;  4EEU A;  1NLY A;  1PWD A;  3NUL A;  4OPY A;  3ZVT A;  4U0T A;  1MC0 A;  4PPR A;  2W1R A;  3G6O A;  1YT4 A;  1PW1 A;  1PI4 A;  4CJN A;  3V5M A;  5FSR A;  2H5S A;  5E43 A;  3E4P A;  4Y17 A;  1L2S A;  1CEG A;  3WWX A;  4S2J A;  4K91 A;  3V3R A;  2W3E A;  2ZD8 A;  4XT2 B;  4R1G A;  5AQ7 A;  4OP8 A;  2IWD A;  1LT0 A;  4F3L B;  1T1A A;  1PW8 A;  4LFU A;  3K3D A;  3T1R A;  2V20 A;  3QNB A;  1XP4 A;  4PAU A;  5DVA A;  5FDS A;  2DNS A;  1KE0 A;  2YKF A;  3OC2 A;  5HAQ A;  1CQA A;  2IA2 A;  2V1Z A;  2PT7 A;  4X1M A;  4JGP A;  3SZT A;  3F1N A;  5BOH A;  2JKT I;  5F68 A;  3UN7 A;  3QHY A;  4WMC D;  3C5A A;  2EX9 A;  2OSU A;  4QB8 A;  1PFL A;  2J3T D;  2W3G A;  4FUW A;  4WUJ A;  1H3Q A;  3CLO A;  4U3T A;  3RJU A;  3T1Q B;  3VP0 A;  5EOE A;  5FQ9 A;  5M18 A;  4HJ6 A;  1YLT A;  1NRF A;  2VZW A;  1OTE A;  2JN7 A;  3IXG A;  1T1C A;  2H28 A;  4ZRR A;  3WS2 A;  1GA9 A;  3NCK A;  2BTF P;  3JYI A;  4OP5 A;  4EW7 A;  1DJC A;  3IX4 A;  3ZCZ A;  1S0W A;  5G18 A;  3BJN A;  1SKF A;  4RX3 A;  1J3W A;  2HP5 A;  3BQA A;  3DTK A;  4PKY G;  1G6A A;  4XUZ A;  1IYO A;  1MWR A;  1Q2Q A;  4OQI A;  4PM6 A;  5F82 A;  2P7J A;  3IWQ A;  2GX5 A;  3BFE A;  1P0Z A;  3VE4 A;  2HJE A;  2VX8 A;  1L0F A;  4BBV A;  4CLC A;  4UQI S;  2UWX A;  3C38 A;  1K56 A;  2PHY A;  1BUL A;  1O7E A;  2O9B A;  5FAP A;  4FSF A;  3IHB A;  4ZDX A;  3IBR A;  2OLV A;  3IXB A;  3UB7 A;  4G3K A;  5A8B A;  4X6T A;  2E8J A;  1FIK A;  5AVE A;  2A24 B;  3HLE A;  3UB9 A;  4KUK A;  4NKP A;  3OZH A;  1SDE A;  3PBT A;  2ZM2 A;  3VV4 A;  4EXO A;  3BY8 A;  3FKV A;  4HHD A;  4BBT A;  3UDI A;  3VP1 A;  4DDS A;  5GLA A;  4WL9 A;  4JXV A;  3CZD A;  1D7E A;  4R38 A;  1YSQ A;  3LR3 A;  1M6K A;  1JNU A;  3P98 A;  4KZ8 A;  3KSF A;  5AJG A;  2V1A A;  2QZ6 A;  4HBT A;  5AVF A;  1D06 A;  4BL2 A;  4KZ7 A;  4X55 A;  1AXB A;  2CMN A;  1GHI A;  5FQM A;  4DE1 A;  2VV7 A;  4EBL A;  1A0K A;  1CEF A;  3MXQ A;  2V1B A;  3PXP A;  1IKI A;  1BLH A;  3HUN A;  3T4O A;  4N92 A;  2DCF A;  1PRQ A;  4E3L A;  3IX8 A;  2QYB A;  2PR6 A;  1LLB A;  1YLP A;  4NEE D;  2QJ7 A;  2W1T B;  4HY8 A;  3BEB A;  3VOZ A;  3OLO A;  4HP4 A;  1NYM A;  5HD5 A;  4UA6 A;  5J4E A;  3NOP C;  1YLW A;  5EVE A;  1FR6 A;  3V67 A;  1FQG A;  3HJI A;  4K0X A;  4O0P A;  1P9R A;  3HUO A;  5HDD A;  3W4P A;  3TSG A;  2ZM8 A;  4X56 A;  3TW8 A;  3IS2 B;  5FQQ A;  2ZL1 B;  2HF6 A;  3Q82 A;  3OCL A;  3U4L P;  2EWV A;  1YKD A;  1GHP A;  4S2M A;  1CI9 A;  4PMA A;  4M3K A;  4YNR A;  1ESI A;  4EET B;  3M6H A;  5L07 A;  1FCO A;  1OME A;  1IFQ A;  2QPN A;  5CTN A;  2XH9 A;  5F83 A;  3EQU A;  5A92 A;  5DJU A;  4NXB A;  4HQA A;  4OVD A;  2ZL1 A;  1OPX A;  1ZHH B;  3BY9 A;  5HDS A;  4EQI A;  5CED A;  2AVX A;  3D4F A;  5GHY A;  2Y8H A;  3UE1 A;  3C4P A;  2GNX A;  1BT5 A;  3AGE A;  4RA7 A;  3NBL A;  3SH9 A;  2YKH A;  4BD1 A;  2W0N A;  2Y4A A;  4BWI A;  1W79 A;  2QMI A;  3JVU A;  5DTT A;  5CRF A;  1E3U A;  3HL9 A;  2VLG A;  3ZFZ A;  1ES2 A;  4N1X A;  2PD8 A;  1HLU P;  4ID4 A;  3IXH A;  5EV0 A;  1K55 A;  3NOU C;  4JXW A;  3RTY A;  4GS9 B;  3RXX A;  4JGQ A;  3MKE A;  1I2S A;  5CHJ A;  1DP6 A;  5DF8 A;  3IXD A;  2ZMF A;  4GLQ A;  4JF6 A;  1EWZ A;  1HTZ A;  3V3S A;  2OOL A;  3SS5 A;  3DW0 A;  3Q7V B;  1JWP A;  3CMZ A;  1N9B A;  5E2E A;  3E0Y A;  5AQ9 A;  1DRM A;  1OTI A;  4Y7P A;  1MY8 A;  5HWV A;  3KYZ A;  3G35 A;  2FFF B;  3ZNY A;  4NXG A;  1K25 A;  4OH0 A;  5HL1 A;  3GR2 A;  3NI9 A;  1MXO A;  5E2G A;  5EVI B;  4B4Z A;  2XFT A;  5TJJ A;  2VK3 A;  3R4K A;  3FG8 A;  2FFY A;  1L3L A;  4PM7 A;  3RH8 B;  1PIO A;  3A0V A;  1S1Z A;  4B88 A;  1LSX A;  4BLM A;  4BMW A;  2GZA A;  5FL3 A;  4GHI B;  1MKM A;  5DJT A;  1G6O A;  5HW3 A;  1I5Q A;  3VP2 A;  1TDL A;  3VSL A;  3JPU A;  4P85 A;  4R3J A;  3LIA A;  1FIL A;  4Y0O A;  3TJZ C;  4F94 A;  3ZNT A;  4R70 A;  4YFM A;  5TGF A;  1XX2 A;  4KEN B;  3UB8 A;  3E2L A;  5GL9 A;  1WYB A;  4A5R A;  5DTS A;  2PAV P;  3MR0 A;  4PM8 A;  1K54 A;  4OOM A;  2Y2G A;  5EVI C;  2VV8 A;  3A3D A;  4GHI A;  1ERO A;  2JKF A;  3UB5 P;  4ZAM A;  3UPO A;  4P0M A;  3T4K A;  3VFF A;  5FDH A;  4WEK A;  3IHA A;  1K54 C;  2KOI A;  1KVM A;  2Q9M A;  1U60 A;  4HI4 A;  3E98 A;  4AFI A;  5EVL A;  4E04 A;  3M2K A;  3LCE A;  3LIF A;  4KZ4 A;  3VSK A;  3A3I A;  1YLY A;  4RX2 A;  2EFX A;  1Q2P A;  1KDW A;  4U0X A;  4S2O A;  3TG9 A;  1NWZ A;  2ZQ9 A;  3HJK A;  1UGU A;  4LRY C;  4Q0I A;  4I3J A;  3KO6 A;  2H10 A;  2OAQ 1;  2V8C A;  3SH8 A;  2KLI A;  4CLC E;  4KZ5 A;  1JTD A;  2KDK A;  1Y4O A;  3MFD A;  1O07 A;  2P9V B;  2CC1 A;  4BBU A;  2B5R A;  5CGW A;  1XGI A;  3NEC A;  2XA7 M;  4E3N A;  1DJA A;  5L2F A;  4PHT A;  5GHX A;  3O86 A;  3B42 A;  5HPF A;  2Z6C A;  4OQH A;  4B93 A;  1P97 A;  4GB7 A;  5FAQ A;  1BLS A;  2R9X A;  2JE5 A;  4E3I A;  2ZLY A;  3WS0 A;  4DJ3 A;  1FR1 A;  1H0M A;  1VET A;  5HAP A;  1BLC A;  1RGZ A;  2P9V A;  3F1N B;  4NXE A;  3UB6 A;  2V0W A;  3HLF A;  1W7F A;  1W8Y A;  3FKW A;  2ZQA A;  5HZH A;  4E6W A;  4DE2 A;  3SH7 A;  5EFW A;  3EOI A;  3MF0 A;  2NUP C;  2X71 A;  5EM0 A;  2Y2K A;  1ERM A;  1HVB A;  3EQV A;  2ZMV A;  4I39 A;  2VEA A;  2O0Y A;  3DWZ A;  5CX7 A;  2HV1 A;  2ZOH A;  2IWB A;  4QJG A;  2I9V A;  3CG5 A;  2XEP A;  3LIC A;  2XD1 A;  1FOF A;  4HNB A;  2A3U A;  5EOO A;  4PM5 A;  4WEL A;  3C2W A;  2BG1 A;  3BLM A;  1DY6 A;  1GHM A;  5HAI A;  5JYP A;  2JCH A;  4JXG A;  4EQ1 A;  5CHU A;  4DXB A;  2B02 A;  3IF6 B;  3GSG A;  5GHZ A;  2M1C A;  3HVF A;  4P6Z M;  3F1P B;  4GKU A;  4DN0 A;  3GEC A;  5AQB A;  1NJ4 A;  1MZU A;  1PYY A;  4KQR A;  2JKG A;  3MXR A;  2Y2H A;  4KG5 A;  1XA1 A;  2J3W A;  3SS3 A;  1EI5 A;  2HPB A;  4CLC B;  2I72 A;  4BD0 A;  5KSC A;  2G2W A;  1XJ3 A;  2D01 A;  2ZMA A;  3R7W A;  1FCN A;  3MQQ A;  4JGO A;  2HGV A;  4MBF A;  1E4D A;  3UME A;  1ERQ A;  3IF6 A;  5E2F A;  1VB6 A;  3CPT B;  1HD8 A;  3C7V A;  1CK3 A;  1DJB A;  3HBR A;  3N6I A;  4I3I A;  4Z1W A;  3F1P A;  4MDZ A;  4BL3 A;  1E25 A;  5DKL A;  5HFO A;  3IF6 C;  2GDN A;  1TS8 A;  2XQZ A;  3CUE A;  4RVA A;  4S2N A;  4WLA A;  4HBU A;  3VMA A;  4UA9 A;  3BFG A;  3L7H A;  1SHV A;  5IS1 A;  4O8G A;  3D72 A;  4NK3 A;  1YM1 A;  2Q9N A;  3H82 B;  4OON A;  4CLC C;  1SKO A;  3O88 A;  3CPT A;  3PBO A;  1YSP A;  5HWT A;  4X25 A;  2Y2I A;  3LY3 A;  4GDN A;  5G4Y A;  2Y2P A;  3BQ8 A;  3LR0 A;  2O9A A;  3N8S A;  4FD8 A;  4G3V A;  5I5L A;  3LYX A;  3VE3 A;  4Y13 A;  3IQA A;  2BLS A;  3EEH A;  1TS0 A;  3U2A A;  1S66 L;  3E2K A;  3W2Z A;  4OPZ A;  1IKG A;  5EVI D;  1H8Z A;  3H82 A;  3WRZ A;  1VEU B;  5EPH A;  2WKQ A;  4KUO A;  1SZV A;  3NOT C;  1ZTU A;  4C6Y A;  4QD4 A;  1BYW A;  4JKT A;  2PU4 A;  5U47 A;  4R23 A;  4WZ5 A;  4D2O A;  4R3B A;  3QP6 A;  2J9O A;  1CF0 A;  1K4F A;  4LV3 A;  2V2F F;  2QHK A;  4LV1 A;  5HPI A;  3ZG0 A;  1W5D A;  3W8K A;  4Y5F A;  3SOI A;  3UNW A;  3G2Y A;  3N7W A;  4WZ5 C;  4DXC A;  4IED A;  1K4E A;  1RP5 A;  4IBX A;  4S2L A;  5FI6 A;  5A90 A;  1GCE A;  3BLS A;  3C30 A;  3S4X A;  1RGY A;  4OKP A;  3IWI A;  4GW9 A;  2PYP A;  1OTD A;  2WGW B;  5HD3 A;  1VEU A;  3LR4 A;  1JWV A;  4GDB A;  2ZQ7 A;  3T4Q A;  3S1Y A;  1TF1 A;  1KDS A;  2ZC3 B;  2JKT M;  1T1B A;  1HZO A;  2XK1 A;  3CIT A;  3RXW A;  5KIZ A;  2EX8 A;  4HIA A;  3QP5 A;  2WKE A;  3PAG A;  1WYC A;  3EGD C;  1XFQ A;  2ZC6 B;  3MZD A;  4GNU A;  1PWG A;  4WYY A;  1YLJ A;  3I7J A;  4MBK A;  5CGS A;  4OLD A;  5EUA A;  4R3A A;  4I38 A;  3MKF A;  5IU1 A;  2PBD P;  5F69 A;  1BZA A;  4ZJ1 A;  2WGW A;  4ESP A;  1OTA A;  1S4R A;  3BEC A;  2K31 A;  1LL9 A;  3QP1 A;  3PTE A;  4OQ0 A;  4HP9 A;  4E3M A;  4MEZ A;  1K57 A;  5TBM A;  3PHY A;  1H5X A;  5DF7 A;  2HDU A;  4ZJ3 A;  1D1J A;  1N9L A;  2HDQ A;  2XRN A;  4IBR A;  3ZG5 A;  1LI9 A;  2E8I A;  3G32 A;  1JTG A;  3WRT A;  5KZH A;  3MZE A;  4FOF A;  4JXS A;  3PBR A;  4I5S A;  2K2N A;  2WAD A;  3N8L A;  4L9E A;  4LV0 A;  4EWF A;  1KVL A;  2OV5 A;  1MBL A;  3PBS A;  3M2J A;  3Q1F A;  4L9G A;  3O87 A;  4OQG A;  2R78 A;  2WGV A;  3UE0 A;  4HES A;  1I2W A;  1OT6 A;  4H6J B;  5KMW A;  2J9P A;  3NC8 A;  2XF3 A;  2WYX A;  1IYQ A;  3EWK A;  4H8R A;  5F5Y A;  5J3W A;  3FV7 A;  4FCF A;  5EE8 A;  1S1Y A;  1QMF A;  2PD7 A;  4WMC A;  3T4T A;  4WF0 A;  1TVF A;  3UDX A;  2PDR A;  3HLD A;  3QNC A;  1Y54 A;  3MFX A;  4R0Q A;  3A3F A;  5M19 A;  3KSH A;  2WKP A;  4MBH A;  1EW0 A;  2JKR I;  4R4R A;  5DTK A;  4K0W A;  5GLD A;  2ZQC A;  3P09 A;  2EWW A;  3CAX A;  4H6J A;  3O5Y A;  2A49 A;  1K55 C;  5C5K A;  3G2Z A;  4XUX A;  3BM6 A;  2G2U A;  1UWP X;  1BSG A;  3L9K A;  1W63 M;  3LO7 A;  2W3H A;  3VP4 A;  1ACF A;  2Y55 A;  4JGR A;  1NYY A;  4MN6 A;  2M7U A;  1S4S A;  1ZG4 A;  5IT5 A;  5FI7 A;  4GD8 A;  4MNR A;  2ZBB A;  3W4Q A;  2A2L A;  3MJQ A;  4JF5 A;  3A0S A;  1PZO A;  4CLC D;  1NZU A;  5FI2 A;  1K56 D;  4UAA A;  4MN7 A;  5HWW A;  5L8M A;  4LGW A;  1MWS A;  3T12 B;  1XPB A;  3T4J A;  1NRJ A;  1N4O A;  1XKZ A;  5J8X A;  4YIN A;  1K6R A;  1F9I A;  1G28 A;  3IH9 A;  3OBF A;  4DRT A;  4JPM A;  4Y15 A;  1TS7 A;  3S7N A;  2VKS A;  3UDF A;  5HAR A;  1KE4 A;  4HJ4 A;  2XRO A;  5HSQ A;  2VGK A;  2KX6 A;  3ZQ5 A;  4ARZ A;  4OLG A;  5FAT A;  3O3V A;  1LSW A;  4WN5 A;  4UA7 A;  2K7S A;  4IHQ A;  3BW6 A;  4RQ9 A;  1XA7 A;  1L0G A;  3NJA A;  2Y2O A;  3D3O A;  3NY4 A;  3EEA A;  4LRX C;  3LEZ A;  3JVV A;  4EBP A;  2XLN A;  3CI6 A;  3D9Y A;  4IVI A;  1J9M A;  3G34 A;  1ES5 A;  1BLP A;  3H9W A;  4LLO B;  1NXY A;  2EXA A;  1OT9 A;  2L4R A;  3NDE A;  2G7U A;  3MXS A;  2W27 A;  1BTL A;  2WKH A;  3MS6 A;  3QP2 A;  3ITB A;  2MJ6 A;  2ZC7 A;  1OJG A;  3KYQ A;  4Y2F A;  4Z9Q A;  3E4Q A;  2VGL M;  1K6S A;  4KQO A;  1PWC A;  3Q81 A;  4GN2 A;  1T18 A;  3GQZ A;  2Q0O A;  1VET B;  2WZX A;  3HLG A;  3FWL A;  2WGI A;  2Y91 A;  2Y59 A;  3DWK A;  4FH2 A;  2O9C A;  1AWI A;  3F1O B;  3N4I A;  4QWO A;  4IVK A;  5G4Z A;  2ZJ9 A;  2XDM A;  1XJ6 A;  2Y79 A;  3AGF A;  3ZHH A;  3V50 A;  3W4O A;  2HJ9 C;  1IEL A;  4BEN A;  3MSH A;  4X68 A;  5I94 A;  3FPW A;  1BUE A;  5CXW A;  3WS4 A;  1S67 L;  1GA0 A;  2W3D A;  1YAX A;  4CQH A;  3A3E A;  4N9K A;  3FPV A;  1TD5 A;  3G30 A;  1FCM A;  5IHV A;  4FTX A;  2OWJ A;  3ZDJ A;  2H0Y A;  5DFY A;  3DBA A;  3F1O A;  2WAF A;  3P7N A;  5FQK A;  3MBZ A;  2J8Y A;  1CI8 A;  1TEM A;  2Y2L A;  4KG6 A;  1K38 A;  2UV0 E;  2OLU A;  3CJM A;  1DP8 A;  3OPL A;  4DF6 A;  3T4S A;  2Z2M B;  3SW1 A;  4N9L A;  3FZC A;  1YMX A;  2QKP A;  1WA9 A;  4Y0U A;  3R7W B;  4DKI A;  3IX3 A;  3WS1 A;  1SCW A;  3DAV A;  5FEG A;  1TDG A;  4ZBE A;  1IOU A;  2ZQD A;  1M40 A;  2HDR A;  4YOF A;  2PRF A;  2LB9 A;  3T1S A;  3VOY A;  1C3B A;  1YPR A;  2OWH A;  2IWC A;  5TR7 A;  3FYZ A;  2EX2 A;  2RL3 A;  4QY6 A;  1KGG A;  5F6A A;  2PYR A;  4XT2 A;  5A93 A;  2Y2J A;  5CGX A;  2VGJ A;  4ETZ A;  5FQJ A;  4BJP A;  3UPP A;  1E3U D;  3NIA A;  4NXF A;  2V9A A;  4F3L A;  1XGJ A;  3LEQ A;  2PU2 A;  3S7Q A;  2WK0 A;  3ZG7 B;  4EES A;  3KX0 X;  4KZ3 A;  1KGF A;  4JF4 A;  1XJ4 A;  1V9Y A;  4UEY A;  2XD5 A;  1VQQ A;  5FAO A;  1L0E A;  3NDG A;  2R9W A;  3P01 A;  3AGD A;  1H8Y A;  1YLZ A;  2EA9 A;  1SKO B;  3ZG8 B;  5CTM A;  3T4L A;  4NET A;  1MWT A;  4E3O A;  4L9F A;  4K08 A;  3Q07 A;  5CEC A;  4MN5 A;  1VM1 A;  4QPR A;  3GV9 A;  1YMS A;  2J7V A;  1STZ A;  4HOI A;  5FQI A;  4DJ2 A;  2C5W B;  2Y2Q A;  3LUQ A;  4EU0 A;  4MCW A;  4B9O A;  3V39 A;  1CJF A;  3BFD A;  3CUE C;  4S2N C;  4ME4 A;  3T50 A;  4II7 A;  3IWO A;  4WEJ A;  3ICY A;  4S2I A;  4M4X A;  2PR5 A;  2VJW A;  4KZ9 A;  4GOG A;  4WM9 A;  3UO9 A;  5KSH A;  1GSV A;  3WS5 A;  4D60 A;  1F2K A;  3MQO A;  3PYP A;  4ETX A;  2WKR A;  4LCM A;  3GMW A;  3T1X A;  2Z6D A;  3H7W B;  3DTM A;  3G4P A;  1T19 A;  2OAP 1;  3MZF A;  1LHY A;  4E3J A;  1F98 A;  3MMH A;  1ONG A;  3LIB A;  3ISG A;  1W63 Q;  4KQD A;  2WAE A;  3DTE A;  3LR5 A;  4IUH A;  3PAE A;  2A24 A;  2VA0 A;  2HP9 A;  3HLW A;  4E3K A;  5A91 A;  1ESU A;  5FEF A;  4O7D A;  5FAS A;  1LI0 A;  4E6X A;  3H7W A;  1NLZ A;  4P87 A;  2P08 A;  5GLB A;  5MC7 A;  4LV2 A;  5J7E A;  3OPP A;  2EFU A;  2HDS A;  4PKY A;  4PM9 A;  5K5B A;  2L0W A;  1LSV A;  5TBM B;  2XR0 A;  3TRC A;  2DRW A;  1OTB A;  3OPR A;  4NG2 A;  3DTI A;  4IJG A;  4Q8I A;  5DF9 A;  3VOL A;  2O99 A;  3B33 A;  3UE3 A;  4EBN A;  3HUM A;  4UQI M;  3LY4 A;  3E4O A; 
#chains in the Genus database with same CATH homology
 3B42 A;  5HPF A;  2GX5 A;  2Z6C A;  3LI9 A;  5IT5 A;  1P0Z A;  4B93 A;  3VE4 A;  1P97 A;  2HJE A;  2ZBB A;  2VX8 A;  2A2L A;  3MJQ A;  3S7O A;  4BBV A;  4CLC A;  3A0S A;  4UQI S;  4CLC D;  3TE8 A;  3C38 A;  1OJ5 A;  4DJ3 A;  4MN7 A;  5HWW A;  2PHY A;  5L8M A;  3F1N B;  3PR6 A;  2O9B A;  4HH3 A;  4NXE A;  4FSF A;  3T4J A;  3UB6 A;  3IBR A;  1NRJ A;  2V0W A;  1X0O A;  3PBQ A;  5HZH A;  3UB7 A;  1F9I A;  4G3K A;  5A8B A;  1G28 A;  3S7P A;  5DFX A;  3OBF A;  3LI8 A;  5EFW A;  5AVE A;  3EOI A;  1Y28 A;  3MF0 A;  2A24 B;  1TS7 A;  2W1T A;  3UB9 A;  2NUP C;  4KUK A;  3A0R A;  2V0U A;  1ODV A;  4NKP A;  3S7N A;  2VKS A;  4Q0H A;  5DKK A;  3EGX C;  3EQV A;  2ZMV A;  2D02 A;  3GDI A;  4I39 A;  2VEA A;  4LRZ E;  2O0Y A;  3PBT A;  5CX7 A;  2HV1 A;  1DP9 A;  4HJ4 A;  2ZOI A;  3UE6 A;  2XRO A;  3VV4 A;  4EXO A;  2ZOH A;  5HSQ A;  2KX6 A;  2I9V A;  3BY8 A;  4GJ4 A;  4HHD A;  3ZQ5 A;  4ARZ A;  4BBT A;  3LIC A;  4HNB A;  1LSW A;  4WN5 A;  2K7S A;  4WL9 A;  4IHQ A;  3BW6 A;  4RQ9 A;  4WEL A;  3C2W A;  2FH5 A;  1D7E A;  3NJA A;  3B47 A;  4R38 A;  3IS2 A;  3D3O A;  1YSQ A;  3LR3 A;  3FC7 A;  2XSS A;  3EEA A;  2GJ3 A;  4LRX C;  4EQ1 A;  3JVV A;  3CI6 A;  1JNU A;  4HH2 A;  3CWF A;  2B02 A;  3KSF A;  3H9W A;  5AJG A;  4LLO B;  2V1A A;  3LID A;  2M1C A;  1OT9 A;  5AVF A;  2L4R A;  4P6Z M;  1P9W A;  1D06 A;  3IBJ A;  1UWN X;  3F1P B;  2G7U A;  4DN0 A;  2W27 A;  2CMN A;  3GEC A;  3MQ0 A;  1MZU A;  2M7V A;  2J3T C;  2MJ6 A;  1OJG A;  3KYQ A;  2J3W A;  4Y2F A;  2VV7 A;  3E4Q A;  1XFN A;  2VGL M;  4KQO A;  2JHE A;  4CLC B;  3MXQ A;  1T18 A;  1XJ3 A;  2V1B A;  2D01 A;  3PXP A;  4YWZ A;  3R7W A;  3MQQ A;  2BAS A;  3BWL A;  2B18 A;  4JGO A;  2HGV A;  3UME A;  3T4O A;  2O9C A;  2VGL S;  3F1O B;  1VB6 A;  4OOL A;  2QYB A;  5G4Z A;  2DMW A;  2PR6 A;  4I3I A;  4Z1W A;  1XJ6 A;  2Y79 A;  3F1P A;  4MDZ A;  4NEE D;  2QJ7 A;  3RFB A;  2W1T B;  2HJ9 C;  4HY8 A;  5DKL A;  3OLO A;  4EER A;  4HP4 A;  3FPW A;  1TS8 A;  5HD5 A;  2XA7 S;  5J4E A;  3CUE A;  3NOP C;  1N9O A;  4WLA A;  5LBR A;  3HCY A;  3V67 A;  1S67 L;  4ARZ B;  2W3D A;  5HDC A;  1YAX A;  4CQH A;  5IS1 A;  3HJI A;  4O0P A;  4IUK A;  4GS9 A;  1P9R A;  3FPV A;  1TD5 A;  4O8G A;  5HDD A;  3D72 A;  4GCZ A;  4G3W A;  3H82 B;  2OWJ A;  3TW8 A;  3IS2 B;  4O01 A;  5DFY A;  3DBA A;  4CLC C;  3F1O A;  3P7N A;  4I3A A;  2HF6 A;  3PBO A;  3OCL A;  2EWV A;  4EEP A;  1YKD A;  1YSP A;  3PBN A;  1XJ2 A;  5HWT A;  1KOU A;  1LL8 A;  5G4Y A;  4YNR A;  3BQ8 A;  3LR0 A;  2QWS A;  2O9A A;  1F5M A;  4EET B;  4EUV A;  1DP8 A;  4MMN A;  3OCN A;  2P04 A;  4Y3I A;  4G3V A;  3T4S A;  3NHQ A;  1GSX A;  5I5L A;  3LYX A;  2L1M A;  3SW1 A;  3VE3 A;  1IFQ A;  2LB5 A;  3EEH A;  3OOV A;  2QKP A;  1TS0 A;  2NUT C;  4L0L A;  1WA9 A;  3U2A A;  1S66 L;  3W2Z A;  3EQU A;  3H82 A;  3R7W B;  5DJU A;  4NXB A;  1V9Z A;  4HQA A;  2INW A;  2J80 A;  1IOU A;  2WKQ A;  4KUO A;  3NOT C;  4YOF A;  1ZTU A;  1OPX A;  2LB9 A;  1ZHH B;  3BY9 A;  5HDS A;  1BYW A;  3KSI A;  2OWH A;  3K3C A;  2Y8H A;  2W3F A;  5HL6 A;  3ZYT A;  2GNX A;  2QHK A;  4Q0J A;  5F6A A;  3ULF A;  2PYR A;  2YKH A;  4XT2 A;  5HPI A;  1VHM A;  2W0N A;  4Y5F A;  4BWI A;  4ETZ A;  3LIE A;  3JVU A;  4BJP A;  4NXF A;  2V9A A;  4F3L A;  4P6Z S;  2VLG A;  2PD8 A;  3C30 A;  2FZ0 A;  3S7Q A;  4EES A;  1GSW A;  3KX0 X;  3NOU C;  3K2N A;  3C8C A;  4GW9 A;  2PYP A;  1OTD A;  4GS9 B;  3RTY A;  1XJ4 A;  5HD3 A;  3LR4 A;  1N9N A;  1V9Y A;  4UEY A;  1TS6 A;  4JGQ A;  4DMZ A;  3P01 A;  1DP6 A;  2EA9 A;  1H8M A;  3T4Q A;  2ZMF A;  4GLQ A;  3T4L A;  1TF1 A;  2JKT M;  4R6L A;  1T1B A;  2OOL A;  3CIT A;  4L9F A;  2VV6 A;  4K08 A;  5KIZ A;  4HIA A;  4MN5 A;  2QJ5 A;  4QPR A;  3EGD C;  1XFQ A;  3E0Y A;  3LFV A;  1DRM A;  4HJ3 A;  1OTI A;  1STZ A;  4HOI A;  3UMD A;  5HWV A;  3KYZ A;  4R3A A;  4DJ2 A;  4I38 A;  4LPZ A;  5IU1 A;  3LUQ A;  4NXG A;  2JKR M;  4MCW A;  5F69 A;  3KSG A;  4B9O A;  4EU0 A;  1OTA A;  1S4R A;  3CUE C;  2K31 A;  4ME4 A;  5TJJ A;  4EEU A;  1NLY A;  4HP9 A;  3T50 A;  4II7 A;  3R4K A;  3FG8 A;  4WEJ A;  3ICY A;  1MC0 A;  2W1R A;  3G6O A;  5TBM A;  3PHY A;  1S4S A;  4M4X A;  3RH8 B;  2PR5 A;  3A0V A;  1S1Z A;  2VJW A;  1LSX A;  4BMW A;  2GZA A;  5FL3 A;  4GHI B;  3E4P A;  1N9L A;  1MKM A;  5DJT A;  2XRN A;  1G6O A;  2W3E A;  5KSH A;  4XT2 B;  4FOF A;  1GSV A;  3PBR A;  4I5S A;  2K2N A;  4L9E A;  1LT0 A;  4F3L B;  3LIA A;  1T1A A;  3TJZ C;  3MQO A;  3PYP A;  3K3D A;  3PBS A;  4R70 A;  3UB8 A;  4ETX A;  2WKR A;  4L9G A;  4PAU A;  2R78 A;  2Z6D A;  3H7W B;  2YKF A;  3OC2 A;  3MR0 A;  2IA2 A;  1OT6 A;  4OOM A;  1T19 A;  2PT7 A;  4H6J B;  2VV8 A;  4JGP A;  4GHI A;  3F1N A;  2OAP 1;  3EWK A;  5F5Y A;  5J3W A;  2JKT I;  1F98 A;  3MMH A;  3T4K A;  5F68 A;  1S1Y A;  3LIB A;  2PD7 A;  1W63 Q;  3T4T A;  4WEK A;  4KQD A;  4WF0 A;  2KOI A;  3LR5 A;  2PDR A;  4HI4 A;  4IUH A;  3E98 A;  4AFI A;  4E04 A;  2A24 A;  2VA0 A;  2J3T D;  2W3G A;  3MFX A;  4WUJ A;  3LIF A;  1H3Q A;  3CLO A;  3KSH A;  2WKP A;  1EW0 A;  4HJ6 A;  1NWZ A;  2JKR I;  3HJK A;  1UGU A;  3H7W A;  4LRY C;  1NLZ A;  4Q0I A;  2VZW A;  4I3J A;  3KO6 A;  1OTE A;  2P08 A;  2JN7 A;  5MC7 A;  2OAQ 1;  5J7E A;  1T1C A;  2H28 A;  4PKY A;  2EWW A;  3CAX A;  4H6J A;  3O5Y A;  4ZRR A;  5K5B A;  2KLI A;  2L0W A;  1LSV A;  5TBM B;  5C5K A;  4CLC E;  4EW7 A;  3TRC A;  1UWP X;  1OTB A;  2KDK A;  1W63 M;  2W3H A;  4IJG A;  3BJN A;  4BBU A;  5DF9 A;  3VOL A;  2O99 A;  3BQA A;  4PKY G;  3B33 A;  2XA7 M;  3UE3 A;  4JGR A;  4PHT A;  4UQI M;  4MN6 A;  2M7U A;  3E4O A;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...