2P74A

Ctx-m-9 class a beta-lactamase apo crystal structure at 0.88 angstrom resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title The Acylation Mechanism of CTX-M beta-Lactamase at 0.88 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2p74A00
5GHZA 5EE8A 3ZG8B 3OPHA 3E2KA 3OC2A 1ES3A 1M6KA 4WMCA 3UPNA 4DXBA 5FSRA 2HP9A 1LI0A 4LV1A 3UDXA 5AQBA 1K56A 4Y7PA 4O7DA 3M2JA 1K57A 1NZUA 2WAEA 2WK0A 3HREA 3QHYA 5FAQA 1DJCA 3BFGA 5CHUA 2Z2LB 3OPPA 5FQ9A 4R1GA 1ZC2A 4OLGA 3MKFA 3UE3A 3ZFZA 4C3QA 5HL1A 2J8YA 1FSYA 3NIAA 4JPMA 3S1YA 5DVAA 4MEZA 4N9KA 4Y0TA 1TDLA 1PWDA 3VP4A 1LLBA 1SHVA 4KENB 4KZ9A 5TGFA 4FSFA 2P9VA 1K54C 2P9VB 5CHJA 2RL3A 5CRFA 1AXBA 3VP1A 2HP6A 2Y2IA 5L2FA 3HLFA 2Q9MA 2Y2NA 3W4PA 1KE4A 1CI9A 1VM1A 4PM9A 3VFHA 1ZG4A 4ID4A 3BEBA 2H0YA 4U3TA 4CPKA 4YINA 2RCXA 1LL5A 5FQMA 1YLZA 5KZHA 3ZG0A 3HLWA 4DE3A 1IYSA 1KGEA 3HLCA 4X56A 1CEGA 1YQSA 3ZNTA 2ZC5B 3NDGA 5FQQA 5FQIA 4WYYA 2V20A 1IKIA 3GSGA 3Q7VA 3B3XA 2ZQCA 3OPRA 3MXSA 3UE0A 1XGJA 3GVBA 3I7JA 4NK3A 4IBRA 2Y2KA 1L0GA 4KZ5A 1K57C 4DF6A 4ZTKA 2HDUA 5GLCA 4BD0A 4KQRA 4OP8A 3VP2A 5M1AA 3PAGA 4E3KA 2ZD8A 3G34A 3V3SA 4E3NA 1IYOA 3DWZA 3ZCZA 1RGYA 3UN7A 1RCJA 3PBOA 2P74A 3DWKA 3IF6A 3MZEA 3LY4A 4UA7A 4P6BA 2WUQA 3ITAA 1L0DA 4DDSA 2H10A 1MWSA 1PW8A 2ZQ8A 3LEZA 4GDNA 4ZJ1A 4JXGA 4U0XA 1L0FA 1FOFA 4R23A 3IF5A 3ZNYA 1EWZA 1BSGA 2WGVA 1I5QA 3O87A 3PBQA 4OPZA 2XD1A 5HARA 3A3EA 5JYPA 1XA7A 1Y54A 2XLNA 3HUMA 2Y2HA 4LV0A 1K4FA 4C6YA 2HDRA 3P09A 5A92A 2ZQ9A 4MBKA 4WZ4A 1JTGA 3HLDA 1K6RA 5E2EA 5FATA 3WS5A 4EBLA 1DY6A 3NBLA 5JYOA 4N9LA 1LL9A 1U60A 2PBYA 1FR6A 2E8IA 3FKVA 4BENA 4B4XA 3W4OA 3HUOA 3M2KA 3SS5A 4GD8A 1LHYA 4R4RA 4Z9QA 2ZQAA 4KG2A 1K25A 2Y2OA 4P87A 4PM6A 4QU3A 1GA0A 4X55A 3UDIA 2ZC4B 3ZG5A 1QMFA 3IWQA 1L2SA 4HESA 1CEFA 2Y59A 1S0WA 3IXBA 3Q7ZA 3A3DA 4KZ6A 4MNRA 4RX2A 1GHIA 4BL2A 2XGNA 1ES4A 1HZOA 3OPLA 1PYYA 3MBZA 1JWPA 4MBHA 3AGEA 1CK3A 4WZ5A 2XH9A 5HX9A 3SH9A 5KSCA 4E3OA 1EROA 5HAQA 3IH9A 3VSKA 2Q9NA 1IEMA 1I2SA 2DCFA 3FKWA 4XUXA 3DTMA 2C5WB 3NI9A 3N8RA 2WKHA 4JLFA 3NCKA 5GHYA 1XX2A 1ERQA 2XFTA 1HD8A 4N1XA 1G68A 2DNSA 2JE5A 1IYQA 3CMZA 4DE2A 4WELA 4GN2A 1C3BA 4BD1A 4XUZA 1XP4A 4LV2A 3VSLA 1BLHA 1Q2QA 3O86A 2V1ZA 4RVAA 1G6AA 1NZOA 5DF8A 4D2OA 1WYCA 2XFSA 4RX3A 5F83A 3A3FA 5CGXA 3BM6A 5M19A 1I2WA 4K91A 1YMSA 3IWIA 4PMAA 2VGJA 1TEMA 4KQQA 4RYEA 4KZBA 2IWCA 4GB7A 1PI4A 2J9PA 3ZDJA 3S4XA 2ZQDA 3IWOA 4M3KA 3SH8A 3V39A 4RA7A 4EUZA 3NY4A 3EQUA 5TR7A 4Y0OA 5G18A 5F1FA 5U47A 1KE0A 4UA6A 1XGIA 3WS2A 2EX6A 3G2YA 3GRJA 1JWZA 3OZHA 2WKIA 2XK1A 4UAAA 3ZVWA 2J7VA 2ZC6B 3BLMA 4A5RA 1PZPA 3C4OA 1HVBA 2OLVA 3Q81A 4PM7A 4WZ5C 3SS4A 3A3IA 4ZAMA 3G2ZA 1ERMA 4FH4A 2ZC3B 3RJUA 3GMWA 4MBFA 2XDMA 3ITBA 4EV4A 3C4PA 4X68A 5D3OA 1BT5A 2WZXA 3ZGAB 4OQIA 4P0MA 3JYIA 2XQZA 2WZZA 1PIOA 1FQGA 2G2UA 2R9XA 3N8SA 2WGIA 1KGGA 1FR1A 4QHCA 1LI9A 4JXWA 4IVKA 2XF3A 4BLMA 1N4OA 3V5MA 4B88A 2Y2LA 4S2MA 4KZ4A 3QNCA 2EXBA 3HLGA 1FSWA 4E3MA 4OOYA 4JF6A 5KSHA 1XKZA 1IYPA 2ZJ9A 3C7UA 1KVMA 2X02A 2A49A 4S2OA 5EPHA 4ZBEA 4OPRA 4GZBA 4PM5A 4N1HA 2EX8A 3IQAA 4EBNA 1TVFA 4UHUA 1XXMA 5M18A 4OOLA 1XPBA 4X53A 1Z6FA 2BG1A 4GNUA 1K6SA 2EX2A 4HBTA 2OV5A 3RXXA 1NYYA 4UA9A 2ZMAA 3HL9A 3PBTA 4QD4A 3TSGA 5CEBA 3OCNA 5FAOA 1YLTA 2B5RA 5EOOA 2HP5A 3MXRA 5FI2A 1NYMA 2UWXA 3BRMA 3UO9A 2X71A 3UE1A 2Y55A 4JXVA 4FCFA 1KDWA 3M6HA 4YFMA 2GDNA 2PU2A 5F1GA 5FQJA 3SS3A 1YLYA 3GTCA 2H0TA 3O88A 5AQ9A 3VOYA 2EXAA 4ZJ2A 1CI8A 3CZDA 2ZM8A 3IXHA 1BULA 3E2LA 2R9WA 2FFFB 5HAIA 3TG9A 1DJAA 2QPNA 1W5DA 1J9MA 3BLSA 4KG5A 4NETA 2C6WB 3NC8A 4OQ0A 3IXGA 4R0QA 4LCLA 3WS4A 1DJBA 4K0WA 4C75A 1ZKJA 2WYXA 3PBSA 3ISGA 3MZDA 3RXWA 3MZFA 3MKEA 1NXYA 3FZCA 1H8ZA 2Y2MA 4WM9A 5DF7A 3FV7A 3D4FA 4DRTA 1YLJA 3G4PA 4OOMA 5DTTA 2OSUA 4HEFA 5EVIB 1YLWA 5EVIA 4S2KA 2OLUA 2Y2JA 3PBRA 1S6RA 1HTZA 3C5AA 1SDNA 4KZ3A 1E25A 4IEDA 3VP0A 5HFOA 4DDYA 5EVID 1OMEA 1MXOA 4S2NC 3ZHHA 3VP3A 5CXWA 2Y2QA 5F82A 3W8KA 4OLDA 3SOIA 3VOZA 4FD8A 2FFYA 4IVIA 2BLSA 2WAFA 5FQKA 1FCMA 3CG5A 5E2FA 1E3UD 2EFUA 2EX9A 3IHBA 1W8YA 2CC1A 3GR2A 1BLSA 2Y2GA 2ZM2A 4WEJA 3Q82A 4X69A 1PW1A 3BYDA 4DXCA 1MY8A 4ZJ3A 1MWRA 4QY5A 4OPYA 3VFFA 1PZOA 1KDSA 3UPOA 2A3UA 1BTLA 4R3JA 2I72A 3LCEA 1EI5A 3UPPA 4P85A 3FYZA 3UNWA 1GHPA 1RGZA 3N8LA 5E2HA 1WE4A 3M6BA 1BUEA 3ZVTA 4GKUA 5EUAA 4Y0UA 3TOIA 5AQAA 2IWBA 1MKIA 1TDGA 1W8QA 1XA1A 2PU4A 4WEKA 3N4IA 5CTNA 5FA7A 5CEDA 4LCMA 4E6XA 1YMXA 5A90A 1H8YA 3Q1FA 4U0TA 4F94A 1SKFA 4E6WA 2XR0A 1N9BA 4WMCD 4KQOA 2EFXA 2J9OA 1ESUA 4KZAA 2XEPA 3WS0A 1FCNA 1O07A 1K56D 3BFDA 5EVIC 4BL3A 5FASA 1L0EA 3S22A 1GA9A 1K4EA 3ZG7B 4L0LA 1O7EA 4QJGA 3PBNA 4PPRA 4OQHA 1M40A 4S2JA 4Q8IA 4QB8A 2WKEA 3WRTA 5CECA 3IXDA 4GD6A 3UDFA 1SDEA 4GOGA 5AQ7A 1BLPA 1MPLA 3WS1A 2G2WA 1IELA 5GHXA 1PWCA 4OQGA 1RP5A 4LV3A 3G35A 1E4DA 3GV9A 1W79A 4S2LA 3PTEA 5GL9A 4EQIA 4OP5A 2JBFA 3VMAA 4KZ7A 4E3JA 3QNBA 3Q07A 1WYBA 3HUNA 4JBFA 1QMEA 1IKGA 3A3JA 3IT9A 5DTKA 1YLPA 2JCHA 1PI5A 4JF5A 5BOHA 4JKTA 1K55C 4OPQA 1MBLA 5I94A 3NDEA 3CJMA 4R3BA 4S2NA 3V50A 1SCWA 3LY3A 3BFEA 3Q7VB 3V3RA 4DE0A 4OVDA 4KZ8A 4E3LA 1VQQA 4CJNA 4OH0A 4KG6A 5GLBA 2QMIA 4E3IA 3HVFA 1ONGA 5FI7A 3C7VA 4EBPA 1ALQA 2Y91A 5CGWA 5IHVA 1ESIA 3LO7A 3HLEA 1JVJA 4IBXA 4FH2A 3IHAA 5GLAA 5CTMA 3BFFA 1ES2A 2Y2PA 4BQMA 1PWGA 3BFCA 3IF6B 3AGDA 1MWUA 5GLDA 4X6TA 3HBRA 5CGSA 5DTSA 3BECA 5A91A 5CERA 3UY6A 3WWXA 1Q2PA 1JWVA 3MFDA 5DF9A 1GHMA 1NRFA 1YT4A 5EECA 5FAPA 4QY6A 3O3VA 5A93A 5HW3A 2H5SA 5HAPA 2VGKA 1BLCA 4OKPA 2Y4AA 5EOEA 1KGFA 4N92A 5E43A 5CHMA 2ZM0A 3AGFA 1KVLA 3WRZA 2WADA 4OONA 4S2PA 2QZ6A 1ZG6A 4PM8A 4WBGA 1ES5A 3IH8A 1H5XA 3SH7A 2XD5A 5E2GA 2ZC7A 2HDSA 4R4SA 2X01A 2ZLYA 5J8XA 3G30A 5KMWA 4ZDXA 2WGWA 2WGWB 3EQVA 4H8RA 3GQZA 4S2IA 3ZG9B 1E3UA 4B4ZA 3P98A 3DW0A 3FWLA 3N7WA 1K54A 3G32A 4DE1A 1ONHA 2IWDA 2JC7A 2DRWA 4HBUA 1BZAA 4JF4A 4GDBA 4BJPA 1NJ4A 2Z2MB 4MLLA 5FDHA 5FI6A 4DKIA 1K38A 1KE3A 1W7FA 5EVLA 3G31A 4JXSA 4LENA 1MWTA 3W4QA 3PAEA 3OCLA 5TFQA 1FCOA 1YM1A 4XXRA 1NY0A 3IF6C 2HPBA 2ZQ7A 4EWFA 1GCEA 1JTDA 2HDQA 1K55A 4K0XA 3N6IA 3HLBA 2V2FF
chains in the Genus database with same CATH superfamily
4LPZA 5EE8A 3ZG8B 3OPHA 3E2KA 1ES3A 2HP9A 2KDKA 2O99A 1ODVA 1K57A 3HREA 2Z6DA 3BFGA 1X0OA 3OPPA 5FQ9A 3UE3A 2B95A 3D3OA 4JPMA 3S1YA 1TD5A 2JKGA 5TGFA 5CHJA 2RL3A 3MFXA 3HLFA 4QPRA 5G4ZA 3TJZC 4YNRA 4ID4A 3BEBA 5HD3A 3D9YA 4HP9A 2RCXA 1PRQA 5KZHA 3JPUA 3GDIA 2E8JA 1KGEA 2BTFP 4X56A 3LI8A 1CEGA 1YQSA 3QP8A 5HD5A 2Y2KA 4DF6A 4ZTKA 4XT2B 4MN6A 3E98A 4KQRA 3KYEA 3VP2A 4PAUA 4O8GA 3G34A 3V3SA 1IYOA 2P74A 1L0DA 4R38A 2H10A 2ZQ8A 5FEGA 4JXGA 3T4OA 4R23A 3IF5A 3ZNYA 1GSWA 2WGVA 4OPZA 1WA9A 2XD1A 3NJAA 5HARA 3CPTA 2VV8A 3A3EA 1N9OA 1XA7A 3HUMA 4LV0A 1YPRA 2VEAA 4MBKA 4BBTA 4N9LA 1LL9A 2PBYA 1F98A 1FR6A 2I9VA 5L07A 2VA0A 3T1QB 4R4RA 5HWVA 3UDIA 2Y2OA 1QMFA 3IWQA 2ZL1B 1CEFA 5J7EA 3A3DA 1HZOA 4MBHA 4E3OA 5HAQA 4EW7A 4LRYC 2XSSA 4XUXA 3DTMA 3UB6A 2C5WB 1OT9A 3NI9A 4JLFA 5GHYA 2XFTA 3LGOA 1IYQA 4WELA 4GN2A 1C3BA 5TJJA 3R7WB 3DTEA 5F68A 4RVAA 3DTIA 4RX3A 5F83A 3A3FA 1I2WA 5IT5A 4RYEA 1D7EA 4KZBA 4GHIA 5L10A 3V39A 4M3KA 4EUZA 4RA7A 3EQUA 1TS6A 1ACFA 5DFXA 3CUEC 3IS2A 2XK1A 4HHDA 2V0WA 1PZPA 4WZ5C 1HVBA 2OLVA 2L0WA 4ZAMA 4MBFA 3SW1A 3ITBA 3A0VA 3MSHA 1BT5A 4F3LB 2QYBA 2WZZA 1FQGA 2G2UA 2R9XA 5DJUA 5F5YA 4O0PA 1LI9A 4I3JA 4KZ4A 2V8CA 2GX5A 3HLGA 1FSWA 2M1CA 4JF6A 4B93A 3C7UA 4ZBEA 4OPRA 4PM5A 2VGLM 2EX8A 3D72A 4HQAA 1XXMA 4OOLA 1Z6FA 2L4RA 3LIAA 4GNUA 2ZMAA 3HL9A 3PBTA 3MS6A 5CEBA 1ZHHB 3MXRA 5FI2A 1NYMA 2GNXA 2H28A 4FCFA 3BWLA 2FH5A 4YFMA 4PHTA 1YLYA 2O9AA 3E2LA 5HAIA 2FFFB 3TG9A 3C2WA 4P6ZM 1W5DA 1J9MA 3BLSA 4KG5A 4OQ0A 3MXQA 1DJBA 3UE6A 1ZKJA 3T4SA 3FZCA 2PR5A 3NOUC 1XJ3A 2Y2MA 3K2NA 5DTTA 1S1YA 3C5AA 1SDNA 3NECA 4KZ3A 5HFOA 4DDYA 5EVID 4E04A 2Y2QA 5F82A 4OLDA 1IOUA 3SOIA 4FD8A 5FQKA 1LL8A 2EFUA 4DN0A 3IHBA 2CC1A 3EGDC 2Y2GA 3Q82A 3S7PA 3IX3A 1PZOA 3UPOA 3T4KA 1EI5A 3ZYTA 3N8LA 5E2HA 1WE4A 4EESA 1BUEA 4GKUA 4Y0UA 5AVEA 1XA1A 1TDGA 1W8QA 3N4IA 3NOPC 5FA7A 4UQIS 1H8YA 4U0TA 2D01A 2JN7A 2EFXA 3BQ8A 3E4QA 3WS0A 1O07A 2EA9A 3JVUA 1K56D 3OLOA 3T12B 1PFLA 3S22A 3BY8A 2R78A 4OQHA 1AWIA 1M40A 2WKEA 3WRTA 3IX8A 3IXDA 4I3AA 1MPLA 3WS1A 1H0MA 4KUOA 4IUKA 3ULFA 2HGVA 1RP5A 4LV3A 4S2LA 2AVXA 4EQIA 1LSVA 4OP5A 3LR5A 1G6OA 1MKMA 3KSHA 1WYBA 4BMWA 3HJIA 1CF0A 2JCHA 4JF5A 5BOHA 5I94A 3NDEA 4S2NA 4II7A 1P9WA 3BFEA 4DE0A 2PAVP 5GLBA 3L9KA 3C7VA 4CLCD 3SZTA 2A24A 3BFFA 4L9GA 5AVFA 3BFCA 5KIZA 3F1OB 1JWVA 2H5SA 2VGKA 2W1TB 1OT6A 2QZ6A 4WBGA 1H5XA 2HDSA 1S1ZA 2X01A 2ZLYA 5J8XA 1UGUA 4I39A 4ZDXA 1N9NA 4H8RA 4S2IA 3GQZA 1T1AA 3P98A 3FWLA 3G32A 1A0KA 4UEYA 4NEED 4LENA 3PAEA 3H82A 4XXRA 3LR4A 4WLAA 4EWFA 1JTDA 3N6IA 2V2FF 5AQBA 1K56A 4Y7PA 4O01A 4O7DA 3M2JA 1NZUA 2WAEA 3QHYA 5FAQA 1DJCA 4IUHA 4GHIB 4C3QA 3NIAA 4GS9B 4HJ4A 5FDSA 2L1MA 5DVAA 4Y0TA 1TDLA 2FZ0A 4BWIA 3VE3A 1K54C 2P9VB 3VP1A 5CX7A 1AXBA 2HP6A 4WUJA 5L2FA 1KE4A 4HJ3A 5FEFA 1VM1A 3B33A 1ZG4A 2VX8A 1LSXA 4U3TA 4YINA 3TRCA 5FQMA 1YLZA 4AFIA 3ZG0A 3HLWA 2GJ3A 5TBMA 3ZNTA 4WYYA 3Q7VA 4DMZA 2ZQCA 3UE0A 1XGJA 3I7JA 3P7NA 4IBRA 1L0GA 4KZ5A 4CLCA 2HDUA 1XJ2A 5GLCA 4BBUA 3CHWP 5M1AA 2NUTC 3PAGA 3DWZA 3MZEA 4UA7A 3LY4A 2JKTM 5F6AA 2QKPA 3UMDA 4BBVA 4X1MA 4Y5FA 1OTAA 1MWSA 1PW8A 1FOFA 1EWZA 1I5QA 5JYPA 4EEUA 3RH8B 2XLNA 2PR6A 5A92A 3P09A 3ZQ5A 3DBAA 1JTGA 3HLDA 1K6RA 4EBLA 1OTEA 2E8IA 4BENA 5HPIA 1LHYA 2ZQAA 4QU3A 1OTBA 4G3WA 2ZC4B 3C30A 3ZG5A 4WN5A 4R3AA 4MNRA 2WKPA 3EGXC 1PYYA 3MBZA 1JWPA 1LSWA 1CK3A 2QWSA 1EROA 2Q9NA 1IEMA 2VV6A 1XX2A 4N1XA 3CMZA 2VJWA 1MZUA 1SKOA 3QP4A 1BLHA 3O86A 5DF8A 4K08A 1YMSA 4PMAA 2M7VA 4GW9A 2IWCA 2J9PA 3SH8A 3TW8A 4G3KA 4UA6A 3WS2A 1Y28A 2EX6A 1JWZA 3OZHA 2EWWA 4UAAA 3T4TA 4ZRRA 2J7VA 2VK3A 3BLMA 1OTDA 3SS4A 3G2ZA 3GMWA 1F5MA 1DP9A 4X68A 3ZGAB 4OQIA 2Q0OA 1PIOA 3FG8A 3LUQA 3MMHA 1NLYA 1YAXA 4BLMA 4S2MA 2K7SA 3QNCA 4NKPA 1CQAA 2Y79A 4E3MA 4FOFA 4LGWA 1KVMA 2X02A 4N1HA 1Z09A 3JVVA 1XPBA 1S4RA 2EX2A 4HBTA 2OV5A 2OWJA 4D60A 5FAOA 2B5RA 3EOIA 1P0ZA 3NHQA 2P7JA 3UE1A 4JXVA 3LI9A 3M6HA 2GDNA 5FQJA 5F1GA 3SS3A 3VOLA 2EXAA 3CZDA 2R9WA 2QPNA 4LCLA 3WS4A 5I5LA 4C75A 3CITA 3MKEA 1H8ZA 2XRNA 4WM9A 5DF7A 3D4FA 5EVIB 1YLWA 4S2KA 2Y2JA 2XA7M 1P9RA 4S2NC 3ZHHA 5A8BA 4YOFA 3F1NA 4LRZE 2BLSA 2WAFA 1FCMA 3CG5A 1N9LA 5E2FA 1E3UD 1K0KA 2GZAA 1W8YA 4WEJA 4X69A 1PW1A 1GSVA 2P08A 1MY8A 1SZVA 1LT0A 1MWRA 3E4PA 3QP2A 1KDSA 2A3UA 3KSGA 4Y15A 3LCEA 3UPPA 3BQAA 3E0YA 4ME4A 1VETB 3M6BA 3TOIA 2IWBA 5CEDA 5CTNA 2PRFA 4MN5A 3KSIA 5A90A 1SKFA 2XR0A 4ARZA 4KZAA 4QWOA 5K5BA 2XEPA 1FCNA 5EVIC 1TS7A 3MQQA 1K4EA 2XROA 4L0LA 1O7EA 3VV4A 4QB8A 5AQ7A 3T1SA 1TS8A 2W0NA 5GHXA 2KOIA 3PTEA 5GL9A 4KZ7A 4LRXC 3LEQA 5DTKA 4Y2FA 1IKGA 2G7UA 1W63M 2IA2A 3EEAA 5HZHA 4OPQA 1MBLA 2Y8HA 3V50A 1L3LA 3Q7VB 3V3RA 1XJ4A 1VQQA 3B47A 4CJNA 2QMIA 5EVEA 4CLCB 3UB8A 1ONGA 5IHVA 2W3EA 3H9WA 3LO7A 1JVJA 4IBXA 5GLAA 5CTMA 1PWGA 1MWUA 3UY6A 5A91A 2W1RA 5CGSA 3BECA 1Q2PA 2ZOIA 3MFDA 2PYPA 4Y13A 4OKPA 2ZMVA 2Y4AA 4GJ4A 4N92A 2W3DA 2ZM0A 3AGFA 3WRZA 4OONA 4PM8A 3LIDA 1Y4OA 1ES5A 4I5SA 2KLIA 2XD5A 5E2GA 2JKRM 3PR6A 2WGWB 1E3UA 3DW0A 1H3QA 1S66L 2DRWA 4BJPA 4GDBA 5FI6A 4DKIA 3G31A 3H7WA 3OCLA 1YM1A 4JGOA 1NY0A 1GCEA 1VEUA 1MC0A 2HDQA 2PD7A 4K0XA 2Z6CA 4MN7A 3OC2A 1M6KA 5FSRA 1JNUA 2ZMFA 1LI0A 3UDXA 2JKTI 2WK0A 5DFYA 2Z2LB 3ZFZA 1ZC2A 5HSQA 5HL1A 1FSYA 3T50A 3U2AA 1LLBA 1FIKA 3LR3A 4FSFA 1S4SA 5CRFA 3HJKA 2Y2IA 4NXFA 2Q9MA 2Y2NA 3W4PA 4PM9A 3VFHA 4JGQA 4CPKA 1LL5A 3V67A 2W3FA 4I38A 1IYSA 3HLCA 3PYPA 2ZC5B 5FQQA 4HJ6A 5FQIA 3B3XA 3MQ0A 3OPRA 3VE4A 3GVBA 4NK3A 5HDDA 1K57C 4OP8A 2PT7A 1XFNA 2ZD8A 4E3NA 4NXEA 3ZCZA 1RGYA 1RCJA 3DWKA 3IF6A 4I3IA 2WUQA 4H6JA 4GDNA 3LEZA 4U0XA 3K3CA 1L0FA 4DJ3A 1BSGA 2OAQ1 1NWZA 5J3WA 3CPTB 1TS0A 4HP4A 1Y54A 5C5KA 5FL3A 3QP1A 1K4FA 2BASA 2ZQ9A 4WZ4A 3ICYA 5E2EA 5FATA 3NBLA 1U60A 4HH3A 5IU1A 3FKVA 4EERA 1H8MA 4EXOA 4GD8A 4Z9QA 4P87A 1K25A 1GA0A 3CUEA 2ZL1A 4HESA 3GECA 2Y59A 3Q7ZA 4KZ6A 1GHIA 1UWNX 4BL2A 1HLUP 4WZ5A 3MF0A 4YWZA 5HX9A 3SH9A 3VSKA 4L9FA 1I2SA 2DCFA 3FKWA 5G4YA 5DJTA 2WKRA 1ERQA 1S67L 2JE5A 2QHKA 4XUZA 1XP4A 2HJEA 3VSLA 2V1ZA 1G6AA 2XFSA 3BY9A 5M19A 4HH2A 1OJGA 3LIBA 4KQQA 4GB7A 3S4XA 3NY4A 2VV7A 2INWA 5G18A 5U47A 2KX6A 1XGIA 3G2YA 3GRJA 3IS2B 2WKIA 4ARZB 3ZVWA 4HNBA 1VHMA 2QJ5A 2ZC6B 3Q81A 4PM7A 5HDCA 5HPFA 3A3IA 1ERMA 2WKQA 1STZA 3RJUA 1DRMA 2XDMA 2PBDP 4EV4A 1V9ZA 2J3WA 4Y3IA 3JYIA 3N8SA 3QP6A 4QHCA 1F9IA 5EFWA 4JXWA 2W3HA 4PKYA 3K3DA 5EM0A 1N4OA 2A2LA 2ZBBA 2EXBA 2V1BA 3KX0X 4OOYA 1XKZA 4EETB 1IYPA 2ZJ9A 2A49A 4CQHA 4GZBA 4EEPA 4UHUA 2D02A 5M18A 4X53A 4L9EA 1K6SA 1NYYA 3T4JA 1OPXA 1YLTA 3O5YA 5EOOA 2LB5A 1IFQA 3UO9A 2X71A 5HDSA 3CAXA 3L7HA 1EW0A 1KDWA 2OAP1 2PU2A 3LFVA 2UV0E 4GLQA 1CI8A 4UQIM 2ZM8A 1BULA 4DJ2A 3NC8A 4R0QA 3RFBA 3T1RA 4K0WA 4NXBA 4KQDA 2WYXA 3PBSA 4HY8A 4IHQA 3F1PA 3MZDA 3RXWA 3MZFA 1NXYA 3S7QA 1OTIA 1YLJA 2OSUA 4HEFA 2OLUA 3PBRA 1HTZA 1TF1A 3VP0A 1OMEA 1MXOA 1YSPA 5CXWA 2VGLS 3W8KA 5AJGA 3VOZA 3LICA 2ACGA 4EU0A 3HCYA 2EX9A 3NOTC 2ZM2A 3UB5P 2J3TD 4QY5A 4OPYA 4P85A 3FYZA 1VEUB 3P01A 5AQAA 1MKIA 1FILA 2J80A 2PU4A 5HWWA 4LCMA 4E6XA 1V9YA 4F94A 1N9BA 4WMCD 4P6ZS 3A0SA 4HIAA 1T19A 4MDZA 3KO6A 4QJGA 2ZOHA 5CECA 4GD6A 3UDFA 1SDEA 4GOGA 2G2WA 1IELA 2JKRI 1W63Q 4G3VA 3T4QA 3QNBA 3Q07A 2HJ9C 3HUNA 4JBFA 3NULA 4JKTA 3EWKA 3BW6A 4R3BA 4PKYG 1SCWA 4KZ8A 4E3LA 3FC7A 4OH0A 4E3IA 5FI7A 4EBPA 2Y91A 3LYXA 1OJ5A 1ESIA 2A24B 2P04A 2Y2PA 4EQ1A 4BQMA 3IF6B 5GLDA 5DTSA 4X6TA 3F1OA 4H6JB 3U4LP 5DF9A 4RQ9A 4KUKA 5A93A 5HW3A 3O3VA 2W1TA 3CI6A 4R70A 1KGFA 3E4OA 5CHMA 1KVLA 4S2PA 1ZG6A 3IH8A 3KYQA 4IJGA 4MMNA 5EV0A 2V1AA 2JKFA 3G30A 3ZG9B 1K54A 4DE1A 1DP8A 4HBUA 4CLCE 1NJ4A 2Z2MB 1K38A 5F69A 1W7FA 5EVLA 1FCOA 3PXPA 3H82B 3IF6C 1K55A 1GSXA 3HLBA 3S7OA 5GHZA 1XJ6A 4WMCA 3UPNA 4DXBA 2MJ6A 5LBRA 4LV1A 1T1CA 1XFQA 4Y17A 3OBFA 5CHUA 4R1GA 4OLGA 3MKFA 2J8YA 4GS9A 4MEZA 4N9KA 1PWDA 3VP4A 1SHVA 4KENB 2HF6A 4KZ9A 2P9VA 1T18A 5J4EA 2VKSA 1CI9A 2M7UA 2H0YA 4ETZA 4FTXA 4DE3A 5DKLA 5TBMB 3NDGA 1VB6A 2V20A 1IKIA 3GSGA 4MCWA 3MXSA 3DTKA 4BD0A 4LFUA 4E3KA 5MC7A 1NRJA 3UN7A 3PBOA 4P6BA 3ITAA 4DDSA 4JGPA 4ZJ1A 3TE8A 5L8MA 3O87A 3PBQA 5HWTA 1PNEA 2Y2HA 4C6YA 1BYWA 2HDRA 2W3GA 3R4KA 3WS5A 1DY6A 1CJFA 2W27A 5JYOA 2K31A 1F2KA 3UB7A 4B4XA 3W4OA 3HUOA 3B42A 3M2KA 3SS5A 4KG2A 1NLZA 4PM6A 1KOUA 4X55A 3F1PB 4CLCC 1L2SA 2V0UA 3IXBA 1S0WA 4RX2A 3UMEA 2XGNA 1ES4A 3OPLA 3LIEA 3AGEA 2XH9A 5KSCA 1YKDA 3IH9A 4GCZA 3KYZA 4JGRA 1T1BA 3N8RA 2WKHA 3NCKA 5DKKA 1HD8A 1G68A 2DNSA 4DE2A 3IBJA 1SKOB 4BD1A 4LV2A 1D1JA 3PHYA 1Q2QA 1NZOA 4D2OA 1WYCA 5CGXA 3BM6A 3KSFA 4K91A 3IWIA 2VGJA 1TEMA 3T1XA 1PI4A 3ZDJA 2ZQDA 3IWOA 5TR7A 2QJ7A 4Y0OA 5F1FA 1KE0A 3MJQA 3QP5A 1P97A 5EM1A 2OOLA 4NXGA 2JHEA 3MR0A 2PHYA 4A5RA 3MQOA 2EWVA 3C4OA 4FH4A 2ZC3B 4WL9A 1J3WA 3C4PA 5D3OA 2WZXA 4FUWA 3W2ZA 4P0MA 2XQZA 2NUPC 2WGIA 1KGGA 1FR1A 4IVKA 2XF3A 3V5MA 4B88A 2Y2LA 3S7NA 1YSQA 2VLGA 4XT2A 5KSHA 4S2OA 5EPHA 2PYRA 2VZWA 4EBNA 3IQAA 1TVFA 2HV1A 2BG1A 3RXXA 4UA9A 4QD4A 4HOIA 3TSGA 3OCNA 3IX4A 2HP5A 4Z1WA 2UWXA 3BRMA 2Y55A 1ZTUA 3GTCA 2H0TA 3O88A 5AQ9A 3VOYA 4ZJ2A 2PDRA 2O9BA 3IXHA 2B02A 1DJAA 4NETA 2C6WB 4Q0JA 3IXGA 4X1LA 4ETXA 3ISGA 3BJNA 3FV7A 4DRTA 3G4PA 4OOMA 5IS1A 2HZ5A 5EVIA 1S6RA 2YKHA 1E25A 4IEDA 5HL6A 3VP3A 3F1NB 1DP6A 4IVIA 2FFYA 3G6OA 3GR2A 1BLSA 3R7WA 4DXCA 3BYDA 4ZJ3A 3VFFA 1BTLA 4R3JA 2I72A 4ESPA 3RTYA 1VETA 4Q0HA 3UNWA 1GHPA 1RGZA 3ZVTA 5EUAA 3EEHA 4WEKA 1YMXA 3Q1FA 3OOVA 4E6WA 4KQOA 2J9OA 1ESUA 4M4XA 4Q0IA 3BFDA 3LIFA 2CMNA 4BL3A 5FASA 1L0EA 1GA9A 4WF0A 3ZG7B 3PBNA 4PPRA 4S2JA 4F3LA 4Q8IA 2XA7S 1BLPA 3T4LA 2J3TC 2LB9A 1PWCA 4OQGA 3G35A 2DMWA 1E4DA 3GV9A 1W79A 3CWFA 2JBFA 3VMAA 4E3JA 4EUVA 1QMEA 3IT9A 3A3JA 2YKFA 1YLPA 1PI5A 1K55C 3IBRA 2K2NA 3CJMA 3LY3A 4LLOB 4OVDA 4KG6A 3C8CA 3HVFA 1ALQA 2PD8A 5CGWA 1G28A 2B18A 3CLOA 3HLEA 1D06A 2V9AA 4FH2A 3IHAA 1G5UA 1ES2A 3AGDA 4B9OA 3HBRA 4X25A 5CERA 3WWXA 1GHMA 1NRFA 1YT4A 5EECA 5FAPA 4QY6A 5HAPA 4NG2A 1BLCA 5EOEA 5E43A 2O0YA 2WADA 3A0RA 1UWPX 2O9CA 3SH7A 3DAVA 2ZC7A 4R4SA 3LR0A 2OWHA 3FPVA 4R6LA 5KMWA 2WGWA 3EQVA 4B4ZA 3C38A 3N7WA 1ONHA 3FPWA 2IWDA 2JC7A 2V8FA 1BZAA 4JF4A 5FDHA 4MLLA 1KE3A 3W4QA 3H7WB 4JXSA 1MWTA 5TFQA 4HI4A 5L09A 3UB9A 2HPBA 2ZQ7A
chains in the Genus database with same CATH topology
5GHZA 5EE8A 3ZG8B 3OPHA 3E2KA 3OC2A 1ES3A 1M6KA 4WMCA 3UPNA 4DXBA 5FSRA 2HP9A 1LI0A 4LV1A 3UDXA 5AQBA 1K56A 4Y7PA 4O7DA 3M2JA 1K57A 1NZUA 2WAEA 2WK0A 3HREA 3QHYA 5FAQA 1DJCA 3BFGA 5CHUA 2Z2LB 3OPPA 5FQ9A 4R1GA 1ZC2A 4OLGA 3MKFA 3UE3A 3ZFZA 4C3QA 5HL1A 2J8YA 1FSYA 3NIAA 4JPMA 3S1YA 5DVAA 4MEZA 4N9KA 4Y0TA 1TDLA 1PWDA 3VP4A 1LLBA 1SHVA 4KENB 4KZ9A 5TGFA 4FSFA 2P9VA 1K54C 2P9VB 5CHJA 2RL3A 5CRFA 1AXBA 3VP1A 2HP6A 2Y2IA 5L2FA 3HLFA 2Q9MA 2Y2NA 3W4PA 1KE4A 1CI9A 1VM1A 4PM9A 3VFHA 1ZG4A 4ID4A 3BEBA 2H0YA 4U3TA 4CPKA 4YINA 2RCXA 1LL5A 5FQMA 1YLZA 5KZHA 3ZG0A 3HLWA 4DE3A 1IYSA 1KGEA 3HLCA 4X56A 1CEGA 1YQSA 3ZNTA 2ZC5B 3NDGA 5FQQA 5FQIA 4WYYA 2V20A 1IKIA 3GSGA 3Q7VA 3B3XA 2ZQCA 3OPRA 3MXSA 3UE0A 1XGJA 3GVBA 3I7JA 4NK3A 4IBRA 2Y2KA 1L0GA 4KZ5A 1K57C 4DF6A 4ZTKA 2HDUA 5GLCA 4BD0A 4KQRA 4OP8A 3VP2A 5M1AA 3PAGA 4E3KA 2ZD8A 3G34A 3V3SA 4E3NA 1IYOA 3DWZA 3ZCZA 1RGYA 3UN7A 1RCJA 3PBOA 2P74A 3DWKA 3IF6A 3MZEA 3LY4A 4UA7A 4P6BA 2WUQA 3ITAA 1L0DA 4DDSA 2H10A 1MWSA 1PW8A 2ZQ8A 3LEZA 4GDNA 4ZJ1A 4JXGA 4U0XA 1L0FA 1FOFA 4R23A 3IF5A 3ZNYA 1EWZA 1BSGA 2WGVA 1I5QA 3O87A 3PBQA 4OPZA 2XD1A 5HARA 3A3EA 5JYPA 1XA7A 1Y54A 2XLNA 3HUMA 2Y2HA 4LV0A 1K4FA 4C6YA 2HDRA 3P09A 5A92A 2ZQ9A 4MBKA 4WZ4A 1JTGA 3HLDA 1K6RA 5E2EA 5FATA 3WS5A 4EBLA 1DY6A 3NBLA 5JYOA 4N9LA 1LL9A 1U60A 2PBYA 1FR6A 2E8IA 3FKVA 4BENA 4B4XA 3W4OA 3HUOA 3M2KA 3SS5A 4GD8A 1LHYA 4R4RA 4Z9QA 2ZQAA 4KG2A 1K25A 2Y2OA 4P87A 4PM6A 4QU3A 1GA0A 4X55A 3UDIA 2ZC4B 3ZG5A 1QMFA 3IWQA 1L2SA 4HESA 1CEFA 2Y59A 1S0WA 3IXBA 3Q7ZA 3A3DA 4KZ6A 4MNRA 4RX2A 1GHIA 4BL2A 2XGNA 1ES4A 1HZOA 3OPLA 1PYYA 3MBZA 1JWPA 4MBHA 3AGEA 1CK3A 4WZ5A 2XH9A 5HX9A 3SH9A 5KSCA 4E3OA 1EROA 5HAQA 3IH9A 3VSKA 2Q9NA 1IEMA 1I2SA 2DCFA 3FKWA 4XUXA 3DTMA 2C5WB 3NI9A 3N8RA 2WKHA 4JLFA 3NCKA 5GHYA 1XX2A 1ERQA 2XFTA 1HD8A 4N1XA 1G68A 2DNSA 2JE5A 1IYQA 3CMZA 4DE2A 4WELA 4GN2A 1C3BA 4BD1A 4XUZA 1XP4A 4LV2A 3VSLA 1BLHA 1Q2QA 3O86A 2V1ZA 4RVAA 1G6AA 1NZOA 5DF8A 4D2OA 1WYCA 2XFSA 4RX3A 5F83A 3A3FA 5CGXA 3BM6A 5M19A 1I2WA 4K91A 1YMSA 3IWIA 4PMAA 2VGJA 1TEMA 4KQQA 4RYEA 4KZBA 2IWCA 4GB7A 1PI4A 2J9PA 3ZDJA 3S4XA 2ZQDA 3IWOA 4M3KA 3SH8A 3V39A 4RA7A 4EUZA 3NY4A 3EQUA 5TR7A 4Y0OA 5G18A 5F1FA 5U47A 1KE0A 4UA6A 1XGIA 3WS2A 2EX6A 3G2YA 3GRJA 1JWZA 3OZHA 2WKIA 2XK1A 4UAAA 3ZVWA 2J7VA 2ZC6B 3BLMA 4A5RA 1PZPA 3C4OA 1HVBA 2OLVA 3Q81A 4PM7A 4WZ5C 3SS4A 3A3IA 4ZAMA 3G2ZA 1ERMA 4FH4A 2ZC3B 3RJUA 3GMWA 4MBFA 2XDMA 3ITBA 4EV4A 3C4PA 4X68A 5D3OA 1BT5A 2WZXA 3ZGAB 4OQIA 4P0MA 3JYIA 2XQZA 2WZZA 1PIOA 1FQGA 2G2UA 2R9XA 3N8SA 2WGIA 1KGGA 1FR1A 4QHCA 1LI9A 4JXWA 4IVKA 2XF3A 4BLMA 1N4OA 3V5MA 4B88A 2Y2LA 4S2MA 4KZ4A 3QNCA 2EXBA 3HLGA 1FSWA 4E3MA 4OOYA 4JF6A 5KSHA 1XKZA 1IYPA 2ZJ9A 3C7UA 1KVMA 2X02A 2A49A 4S2OA 5EPHA 4ZBEA 4OPRA 4GZBA 4PM5A 4N1HA 2EX8A 3IQAA 4EBNA 1TVFA 4UHUA 1XXMA 5M18A 4OOLA 1XPBA 4X53A 1Z6FA 2BG1A 4GNUA 1K6SA 2EX2A 4HBTA 2OV5A 3RXXA 1NYYA 4UA9A 2ZMAA 3HL9A 3PBTA 4QD4A 3TSGA 5CEBA 3OCNA 5FAOA 1YLTA 2B5RA 5EOOA 2HP5A 3MXRA 5FI2A 1NYMA 2UWXA 3BRMA 3UO9A 2X71A 3UE1A 2Y55A 4JXVA 4FCFA 1KDWA 3M6HA 4YFMA 2GDNA 2PU2A 5F1GA 5FQJA 3SS3A 1YLYA 3GTCA 2H0TA 3O88A 5AQ9A 3VOYA 2EXAA 4ZJ2A 1CI8A 3CZDA 2ZM8A 3IXHA 1BULA 3E2LA 2R9WA 2FFFB 5HAIA 3TG9A 1DJAA 2QPNA 1W5DA 1J9MA 3BLSA 4KG5A 4NETA 2C6WB 3NC8A 4OQ0A 3IXGA 4R0QA 4LCLA 3WS4A 1DJBA 4K0WA 4C75A 1ZKJA 2WYXA 3PBSA 3ISGA 3MZDA 3RXWA 3MZFA 3MKEA 1NXYA 3FZCA 1H8ZA 2Y2MA 4WM9A 5DF7A 3FV7A 3D4FA 4DRTA 1YLJA 3G4PA 4OOMA 5DTTA 2OSUA 4HEFA 5EVIB 1YLWA 5EVIA 4S2KA 2OLUA 2Y2JA 3PBRA 1S6RA 1HTZA 3C5AA 1SDNA 4KZ3A 1E25A 4IEDA 3VP0A 5HFOA 4DDYA 5EVID 1OMEA 1MXOA 4S2NC 3ZHHA 3VP3A 5CXWA 2Y2QA 5F82A 3W8KA 4OLDA 3SOIA 3VOZA 4FD8A 2FFYA 4IVIA 2BLSA 2WAFA 5FQKA 1FCMA 3CG5A 5E2FA 1E3UD 2EFUA 2EX9A 3IHBA 1W8YA 2CC1A 3GR2A 1BLSA 2Y2GA 2ZM2A 4WEJA 3Q82A 4X69A 1PW1A 3BYDA 4DXCA 1MY8A 4ZJ3A 1MWRA 4QY5A 4OPYA 3VFFA 1PZOA 1KDSA 3UPOA 2A3UA 1BTLA 4R3JA 2I72A 3LCEA 1EI5A 3UPPA 4P85A 3FYZA 3UNWA 1GHPA 1RGZA 3N8LA 5E2HA 1WE4A 3M6BA 1BUEA 3ZVTA 4GKUA 5EUAA 4Y0UA 3TOIA 5AQAA 2IWBA 1MKIA 1TDGA 1W8QA 1XA1A 2PU4A 4WEKA 3N4IA 5CTNA 5FA7A 5CEDA 4LCMA 4E6XA 1YMXA 5A90A 1H8YA 3Q1FA 4U0TA 4F94A 1SKFA 4E6WA 2XR0A 1N9BA 4WMCD 4KQOA 2EFXA 2J9OA 1ESUA 4KZAA 2XEPA 3WS0A 1FCNA 1O07A 1K56D 3BFDA 5EVIC 4BL3A 5FASA 1L0EA 3S22A 1GA9A 1K4EA 3ZG7B 4L0LA 1O7EA 4QJGA 3PBNA 4PPRA 4OQHA 1M40A 4S2JA 4Q8IA 4QB8A 2WKEA 3WRTA 5CECA 3IXDA 4GD6A 3UDFA 1SDEA 4GOGA 5AQ7A 1BLPA 1MPLA 3WS1A 2G2WA 1IELA 5GHXA 1PWCA 4OQGA 1RP5A 4LV3A 3G35A 1E4DA 3GV9A 1W79A 4S2LA 3PTEA 5GL9A 4EQIA 4OP5A 2JBFA 3VMAA 4KZ7A 4E3JA 3QNBA 3Q07A 1WYBA 3HUNA 4JBFA 1QMEA 1IKGA 3A3JA 3IT9A 5DTKA 1YLPA 2JCHA 1PI5A 4JF5A 5BOHA 4JKTA 1K55C 4OPQA 1MBLA 5I94A 3NDEA 3CJMA 4R3BA 4S2NA 3V50A 1SCWA 3LY3A 3BFEA 3Q7VB 3V3RA 4DE0A 4OVDA 4KZ8A 4E3LA 1VQQA 4CJNA 4OH0A 4KG6A 5GLBA 2QMIA 4E3IA 3HVFA 1ONGA 5FI7A 3C7VA 4EBPA 1ALQA 2Y91A 5CGWA 5IHVA 1ESIA 3LO7A 3HLEA 1JVJA 4IBXA 4FH2A 3IHAA 5GLAA 5CTMA 3BFFA 1ES2A 2Y2PA 4BQMA 1PWGA 3BFCA 3IF6B 3AGDA 1MWUA 5GLDA 4X6TA 3HBRA 5CGSA 5DTSA 3BECA 5A91A 5CERA 3UY6A 3WWXA 1Q2PA 1JWVA 3MFDA 5DF9A 1GHMA 1NRFA 1YT4A 5EECA 5FAPA 4QY6A 3O3VA 5A93A 5HW3A 2H5SA 5HAPA 2VGKA 1BLCA 4OKPA 2Y4AA 5EOEA 1KGFA 4N92A 5E43A 5CHMA 2ZM0A 3AGFA 1KVLA 3WRZA 2WADA 4OONA 4S2PA 2QZ6A 1ZG6A 4PM8A 4WBGA 1ES5A 3IH8A 1H5XA 3SH7A 2XD5A 5E2GA 2ZC7A 2HDSA 4R4SA 2X01A 2ZLYA 5J8XA 3G30A 5KMWA 4ZDXA 2WGWA 2WGWB 3EQVA 4H8RA 3GQZA 4S2IA 3ZG9B 1E3UA 4B4ZA 3P98A 3DW0A 3FWLA 3N7WA 1K54A 3G32A 4DE1A 1ONHA 2IWDA 2JC7A 2DRWA 4HBUA 1BZAA 4JF4A 4GDBA 4BJPA 1NJ4A 2Z2MB 4MLLA 5FDHA 5FI6A 4DKIA 1K38A 1KE3A 1W7FA 5EVLA 3G31A 4JXSA 4LENA 1MWTA 3W4QA 3PAEA 3OCLA 5TFQA 1FCOA 1YM1A 4XXRA 1NY0A 3IF6C 2HPBA 2ZQ7A 4EWFA 1GCEA 1JTDA 2HDQA 1K55A 4K0XA 3N6IA 3HLBA 2V2FF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHZ A;  5EE8 A;  3ZG8 B;  3OPH A;  3E2K A;  3OC2 A;  1ES3 A;  1M6K A;  4WMC A;  3UPN A;  4DXB A;  5FSR A;  2HP9 A;  1LI0 A;  4LV1 A;  3UDX A;  5AQB A;  1K56 A;  4Y7P A;  4O7D A;  3M2J A;  1K57 A;  1NZU A;  2WAE A;  2WK0 A;  3HRE A;  3QHY A;  5FAQ A;  1DJC A;  3BFG A;  5CHU A;  2Z2L B;  3OPP A;  5FQ9 A;  4R1G A;  1ZC2 A;  4OLG A;  3MKF A;  3UE3 A;  3ZFZ A;  4C3Q A;  5HL1 A;  2J8Y A;  1FSY A;  3NIA A;  4JPM A;  3S1Y A;  5DVA A;  4MEZ A;  4N9K A;  4Y0T A;  1TDL A;  1PWD A;  3VP4 A;  1LLB A;  1SHV A;  4KEN B;  4KZ9 A;  5TGF A;  4FSF A;  2P9V A;  1K54 C;  2P9V B;  5CHJ A;  2RL3 A;  5CRF A;  1AXB A;  3VP1 A;  2HP6 A;  2Y2I A;  5L2F A;  3HLF A;  2Q9M A;  2Y2N A;  3W4P A;  1KE4 A;  1CI9 A;  1VM1 A;  4PM9 A;  3VFH A;  1ZG4 A;  4ID4 A;  3BEB A;  2H0Y A;  4U3T A;  4CPK A;  4YIN A;  2RCX A;  1LL5 A;  5FQM A;  1YLZ A;  5KZH A;  3ZG0 A;  3HLW A;  4DE3 A;  1IYS A;  1KGE A;  3HLC A;  4X56 A;  1CEG A;  1YQS A;  3ZNT A;  2ZC5 B;  3NDG A;  5FQQ A;  5FQI A;  4WYY A;  2V20 A;  1IKI A;  3GSG A;  3Q7V A;  3B3X A;  2ZQC A;  3OPR A;  3MXS A;  3UE0 A;  1XGJ A;  3GVB A;  3I7J A;  4NK3 A;  4IBR A;  2Y2K A;  1L0G A;  4KZ5 A;  1K57 C;  4DF6 A;  4ZTK A;  2HDU A;  5GLC A;  4BD0 A;  4KQR A;  4OP8 A;  3VP2 A;  5M1A A;  3PAG A;  4E3K A;  2ZD8 A;  3G34 A;  3V3S A;  4E3N A;  1IYO A;  3DWZ A;  3ZCZ A;  1RGY A;  3UN7 A;  1RCJ A;  3PBO A;  2P74 A;  3DWK A;  3IF6 A;  3MZE A;  3LY4 A;  4UA7 A;  4P6B A;  2WUQ A;  3ITA A;  1L0D A;  4DDS A;  2H10 A;  1MWS A;  1PW8 A;  2ZQ8 A;  3LEZ A;  4GDN A;  4ZJ1 A;  4JXG A;  4U0X A;  1L0F A;  1FOF A;  4R23 A;  3IF5 A;  3ZNY A;  1EWZ A;  1BSG A;  2WGV A;  1I5Q A;  3O87 A;  3PBQ A;  4OPZ A;  2XD1 A;  5HAR A;  3A3E A;  5JYP A;  1XA7 A;  1Y54 A;  2XLN A;  3HUM A;  2Y2H A;  4LV0 A;  1K4F A;  4C6Y A;  2HDR A;  3P09 A;  5A92 A;  2ZQ9 A;  4MBK A;  4WZ4 A;  1JTG A;  3HLD A;  1K6R A;  5E2E A;  5FAT A;  3WS5 A;  4EBL A;  1DY6 A;  3NBL A;  5JYO A;  4N9L A;  1LL9 A;  1U60 A;  2PBY A;  1FR6 A;  2E8I A;  3FKV A;  4BEN A;  4B4X A;  3W4O A;  3HUO A;  3M2K A;  3SS5 A;  4GD8 A;  1LHY A;  4R4R A;  4Z9Q A;  2ZQA A;  4KG2 A;  1K25 A;  2Y2O A;  4P87 A;  4PM6 A;  4QU3 A;  1GA0 A;  4X55 A;  3UDI A;  2ZC4 B;  3ZG5 A;  1QMF A;  3IWQ A;  1L2S A;  4HES A;  1CEF A;  2Y59 A;  1S0W A;  3IXB A;  3Q7Z A;  3A3D A;  4KZ6 A;  4MNR A;  4RX2 A;  1GHI A;  4BL2 A;  2XGN A;  1ES4 A;  1HZO A;  3OPL A;  1PYY A;  3MBZ A;  1JWP A;  4MBH A;  3AGE A;  1CK3 A;  4WZ5 A;  2XH9 A;  5HX9 A;  3SH9 A;  5KSC A;  4E3O A;  1ERO A;  5HAQ A;  3IH9 A;  3VSK A;  2Q9N A;  1IEM A;  1I2S A;  2DCF A;  3FKW A;  4XUX A;  3DTM A;  2C5W B;  3NI9 A;  3N8R A;  2WKH A;  4JLF A;  3NCK A;  5GHY A;  1XX2 A;  1ERQ A;  2XFT A;  1HD8 A;  4N1X A;  1G68 A;  2DNS A;  2JE5 A;  1IYQ A;  3CMZ A;  4DE2 A;  4WEL A;  4GN2 A;  1C3B A;  4BD1 A;  4XUZ A;  1XP4 A;  4LV2 A;  3VSL A;  1BLH A;  1Q2Q A;  3O86 A;  2V1Z A;  4RVA A;  1G6A A;  1NZO A;  5DF8 A;  4D2O A;  1WYC A;  2XFS A;  4RX3 A;  5F83 A;  3A3F A;  5CGX A;  3BM6 A;  5M19 A;  1I2W A;  4K91 A;  1YMS A;  3IWI A;  4PMA A;  2VGJ A;  1TEM A;  4KQQ A;  4RYE A;  4KZB A;  2IWC A;  4GB7 A;  1PI4 A;  2J9P A;  3ZDJ A;  3S4X A;  2ZQD A;  3IWO A;  4M3K A;  3SH8 A;  3V39 A;  4RA7 A;  4EUZ A;  3NY4 A;  3EQU A;  5TR7 A;  4Y0O A;  5G18 A;  5F1F A;  5U47 A;  1KE0 A;  4UA6 A;  1XGI A;  3WS2 A;  2EX6 A;  3G2Y A;  3GRJ A;  1JWZ A;  3OZH A;  2WKI A;  2XK1 A;  4UAA A;  3ZVW A;  2J7V A;  2ZC6 B;  3BLM A;  4A5R A;  1PZP A;  3C4O A;  1HVB A;  2OLV A;  3Q81 A;  4PM7 A;  4WZ5 C;  3SS4 A;  3A3I A;  4ZAM A;  3G2Z A;  1ERM A;  4FH4 A;  2ZC3 B;  3RJU A;  3GMW A;  4MBF A;  2XDM A;  3ITB A;  4EV4 A;  3C4P A;  4X68 A;  5D3O A;  1BT5 A;  2WZX A;  3ZGA B;  4OQI A;  4P0M A;  3JYI A;  2XQZ A;  2WZZ A;  1PIO A;  1FQG A;  2G2U A;  2R9X A;  3N8S A;  2WGI A;  1KGG A;  1FR1 A;  4QHC A;  1LI9 A;  4JXW A;  4IVK A;  2XF3 A;  4BLM A;  1N4O A;  3V5M A;  4B88 A;  2Y2L A;  4S2M A;  4KZ4 A;  3QNC A;  2EXB A;  3HLG A;  1FSW A;  4E3M A;  4OOY A;  4JF6 A;  5KSH A;  1XKZ A;  1IYP A;  2ZJ9 A;  3C7U A;  1KVM A;  2X02 A;  2A49 A;  4S2O A;  5EPH A;  4ZBE A;  4OPR A;  4GZB A;  4PM5 A;  4N1H A;  2EX8 A;  3IQA A;  4EBN A;  1TVF A;  4UHU A;  1XXM A;  5M18 A;  4OOL A;  1XPB A;  4X53 A;  1Z6F A;  2BG1 A;  4GNU A;  1K6S A;  2EX2 A;  4HBT A;  2OV5 A;  3RXX A;  1NYY A;  4UA9 A;  2ZMA A;  3HL9 A;  3PBT A;  4QD4 A;  3TSG A;  5CEB A;  3OCN A;  5FAO A;  1YLT A;  2B5R A;  5EOO A;  2HP5 A;  3MXR A;  5FI2 A;  1NYM A;  2UWX A;  3BRM A;  3UO9 A;  2X71 A;  3UE1 A;  2Y55 A;  4JXV A;  4FCF A;  1KDW A;  3M6H A;  4YFM A;  2GDN A;  2PU2 A;  5F1G A;  5FQJ A;  3SS3 A;  1YLY A;  3GTC A;  2H0T A;  3O88 A;  5AQ9 A;  3VOY A;  2EXA A;  4ZJ2 A;  1CI8 A;  3CZD A;  2ZM8 A;  3IXH A;  1BUL A;  3E2L A;  2R9W A;  2FFF B;  5HAI A;  3TG9 A;  1DJA A;  2QPN A;  1W5D A;  1J9M A;  3BLS A;  4KG5 A;  4NET A;  2C6W B;  3NC8 A;  4OQ0 A;  3IXG A;  4R0Q A;  4LCL A;  3WS4 A;  1DJB A;  4K0W A;  4C75 A;  1ZKJ A;  2WYX A;  3PBS A;  3ISG A;  3MZD A;  3RXW A;  3MZF A;  3MKE A;  1NXY A;  3FZC A;  1H8Z A;  2Y2M A;  4WM9 A;  5DF7 A;  3FV7 A;  3D4F A;  4DRT A;  1YLJ A;  3G4P A;  4OOM A;  5DTT A;  2OSU A;  4HEF A;  5EVI B;  1YLW A;  5EVI A;  4S2K A;  2OLU A;  2Y2J A;  3PBR A;  1S6R A;  1HTZ A;  3C5A A;  1SDN A;  4KZ3 A;  1E25 A;  4IED A;  3VP0 A;  5HFO A;  4DDY A;  5EVI D;  1OME A;  1MXO A;  4S2N C;  3ZHH A;  3VP3 A;  5CXW A;  2Y2Q A;  5F82 A;  3W8K A;  4OLD A;  3SOI A;  3VOZ A;  4FD8 A;  2FFY A;  4IVI A;  2BLS A;  2WAF A;  5FQK A;  1FCM A;  3CG5 A;  5E2F A;  1E3U D;  2EFU A;  2EX9 A;  3IHB A;  1W8Y A;  2CC1 A;  3GR2 A;  1BLS A;  2Y2G A;  2ZM2 A;  4WEJ A;  3Q82 A;  4X69 A;  1PW1 A;  3BYD A;  4DXC A;  1MY8 A;  4ZJ3 A;  1MWR A;  4QY5 A;  4OPY A;  3VFF A;  1PZO A;  1KDS A;  3UPO A;  2A3U A;  1BTL A;  4R3J A;  2I72 A;  3LCE A;  1EI5 A;  3UPP A;  4P85 A;  3FYZ A;  3UNW A;  1GHP A;  1RGZ A;  3N8L A;  5E2H A;  1WE4 A;  3M6B A;  1BUE A;  3ZVT A;  4GKU A;  5EUA A;  4Y0U A;  3TOI A;  5AQA A;  2IWB A;  1MKI A;  1TDG A;  1W8Q A;  1XA1 A;  2PU4 A;  4WEK A;  3N4I A;  5CTN A;  5FA7 A;  5CED A;  4LCM A;  4E6X A;  1YMX A;  5A90 A;  1H8Y A;  3Q1F A;  4U0T A;  4F94 A;  1SKF A;  4E6W A;  2XR0 A;  1N9B A;  4WMC D;  4KQO A;  2EFX A;  2J9O A;  1ESU A;  4KZA A;  2XEP A;  3WS0 A;  1FCN A;  1O07 A;  1K56 D;  3BFD A;  5EVI C;  4BL3 A;  5FAS A;  1L0E A;  3S22 A;  1GA9 A;  1K4E A;  3ZG7 B;  4L0L A;  1O7E A;  4QJG A;  3PBN A;  4PPR A;  4OQH A;  1M40 A;  4S2J A;  4Q8I A;  4QB8 A;  2WKE A;  3WRT A;  5CEC A;  3IXD A;  4GD6 A;  3UDF A;  1SDE A;  4GOG A;  5AQ7 A;  1BLP A;  1MPL A;  3WS1 A;  2G2W A;  1IEL A;  5GHX A;  1PWC A;  4OQG A;  1RP5 A;  4LV3 A;  3G35 A;  1E4D A;  3GV9 A;  1W79 A;  4S2L A;  3PTE A;  5GL9 A;  4EQI A;  4OP5 A;  2JBF A;  3VMA A;  4KZ7 A;  4E3J A;  3QNB A;  3Q07 A;  1WYB A;  3HUN A;  4JBF A;  1QME A;  1IKG A;  3A3J A;  3IT9 A;  5DTK A;  1YLP A;  2JCH A;  1PI5 A;  4JF5 A;  5BOH A;  4JKT A;  1K55 C;  4OPQ A;  1MBL A;  5I94 A;  3NDE A;  3CJM A;  4R3B A;  4S2N A;  3V50 A;  1SCW A;  3LY3 A;  3BFE A;  3Q7V B;  3V3R A;  4DE0 A;  4OVD A;  4KZ8 A;  4E3L A;  1VQQ A;  4CJN A;  4OH0 A;  4KG6 A;  5GLB A;  2QMI A;  4E3I A;  3HVF A;  1ONG A;  5FI7 A;  3C7V A;  4EBP A;  1ALQ A;  2Y91 A;  5CGW A;  5IHV A;  1ESI A;  3LO7 A;  3HLE A;  1JVJ A;  4IBX A;  4FH2 A;  3IHA A;  5GLA A;  5CTM A;  3BFF A;  1ES2 A;  2Y2P A;  4BQM A;  1PWG A;  3BFC A;  3IF6 B;  3AGD A;  1MWU A;  5GLD A;  4X6T A;  3HBR A;  5CGS A;  5DTS A;  3BEC A;  5A91 A;  5CER A;  3UY6 A;  3WWX A;  1Q2P A;  1JWV A;  3MFD A;  5DF9 A;  1GHM A;  1NRF A;  1YT4 A;  5EEC A;  5FAP A;  4QY6 A;  3O3V A;  5A93 A;  5HW3 A;  2H5S A;  5HAP A;  2VGK A;  1BLC A;  4OKP A;  2Y4A A;  5EOE A;  1KGF A;  4N92 A;  5E43 A;  5CHM A;  2ZM0 A;  3AGF A;  1KVL A;  3WRZ A;  2WAD A;  4OON A;  4S2P A;  2QZ6 A;  1ZG6 A;  4PM8 A;  4WBG A;  1ES5 A;  3IH8 A;  1H5X A;  3SH7 A;  2XD5 A;  5E2G A;  2ZC7 A;  2HDS A;  4R4S A;  2X01 A;  2ZLY A;  5J8X A;  3G30 A;  5KMW A;  4ZDX A;  2WGW A;  2WGW B;  3EQV A;  4H8R A;  3GQZ A;  4S2I A;  3ZG9 B;  1E3U A;  4B4Z A;  3P98 A;  3DW0 A;  3FWL A;  3N7W A;  1K54 A;  3G32 A;  4DE1 A;  1ONH A;  2IWD A;  2JC7 A;  2DRW A;  4HBU A;  1BZA A;  4JF4 A;  4GDB A;  4BJP A;  1NJ4 A;  2Z2M B;  4MLL A;  5FDH A;  5FI6 A;  4DKI A;  1K38 A;  1KE3 A;  1W7F A;  5EVL A;  3G31 A;  4JXS A;  4LEN A;  1MWT A;  3W4Q A;  3PAE A;  3OCL A;  5TFQ A;  1FCO A;  1YM1 A;  4XXR A;  1NY0 A;  3IF6 C;  2HPB A;  2ZQ7 A;  4EWF A;  1GCE A;  1JTD A;  2HDQ A;  1K55 A;  4K0X A;  3N6I A;  3HLB A;  2V2F F; 
#chains in the Genus database with same CATH topology
 4LPZ A;  5EE8 A;  3ZG8 B;  3OPH A;  3E2K A;  1ES3 A;  2HP9 A;  2KDK A;  2O99 A;  1ODV A;  1K57 A;  3HRE A;  2Z6D A;  3BFG A;  1X0O A;  3OPP A;  5FQ9 A;  3UE3 A;  2B95 A;  3D3O A;  4JPM A;  3S1Y A;  1TD5 A;  2JKG A;  5TGF A;  5CHJ A;  2RL3 A;  3MFX A;  3HLF A;  4QPR A;  5G4Z A;  3TJZ C;  4YNR A;  4ID4 A;  3BEB A;  5HD3 A;  3D9Y A;  4HP9 A;  2RCX A;  1PRQ A;  5KZH A;  3JPU A;  3GDI A;  2E8J A;  1KGE A;  2BTF P;  4X56 A;  3LI8 A;  1CEG A;  1YQS A;  3QP8 A;  5HD5 A;  2Y2K A;  4DF6 A;  4ZTK A;  4XT2 B;  4MN6 A;  3E98 A;  4KQR A;  3KYE A;  3VP2 A;  4PAU A;  4O8G A;  3G34 A;  3V3S A;  1IYO A;  2P74 A;  1L0D A;  4R38 A;  2H10 A;  2ZQ8 A;  5FEG A;  4JXG A;  3T4O A;  4R23 A;  3IF5 A;  3ZNY A;  1GSW A;  2WGV A;  4OPZ A;  1WA9 A;  2XD1 A;  3NJA A;  5HAR A;  3CPT A;  2VV8 A;  3A3E A;  1N9O A;  1XA7 A;  3HUM A;  4LV0 A;  1YPR A;  2VEA A;  4MBK A;  4BBT A;  4N9L A;  1LL9 A;  2PBY A;  1F98 A;  1FR6 A;  2I9V A;  5L07 A;  2VA0 A;  3T1Q B;  4R4R A;  5HWV A;  3UDI A;  2Y2O A;  1QMF A;  3IWQ A;  2ZL1 B;  1CEF A;  5J7E A;  3A3D A;  1HZO A;  4MBH A;  4E3O A;  5HAQ A;  4EW7 A;  4LRY C;  2XSS A;  4XUX A;  3DTM A;  3UB6 A;  2C5W B;  1OT9 A;  3NI9 A;  4JLF A;  5GHY A;  2XFT A;  3LGO A;  1IYQ A;  4WEL A;  4GN2 A;  1C3B A;  5TJJ A;  3R7W B;  3DTE A;  5F68 A;  4RVA A;  3DTI A;  4RX3 A;  5F83 A;  3A3F A;  1I2W A;  5IT5 A;  4RYE A;  1D7E A;  4KZB A;  4GHI A;  5L10 A;  3V39 A;  4M3K A;  4EUZ A;  4RA7 A;  3EQU A;  1TS6 A;  1ACF A;  5DFX A;  3CUE C;  3IS2 A;  2XK1 A;  4HHD A;  2V0W A;  1PZP A;  4WZ5 C;  1HVB A;  2OLV A;  2L0W A;  4ZAM A;  4MBF A;  3SW1 A;  3ITB A;  3A0V A;  3MSH A;  1BT5 A;  4F3L B;  2QYB A;  2WZZ A;  1FQG A;  2G2U A;  2R9X A;  5DJU A;  5F5Y A;  4O0P A;  1LI9 A;  4I3J A;  4KZ4 A;  2V8C A;  2GX5 A;  3HLG A;  1FSW A;  2M1C A;  4JF6 A;  4B93 A;  3C7U A;  4ZBE A;  4OPR A;  4PM5 A;  2VGL M;  2EX8 A;  3D72 A;  4HQA A;  1XXM A;  4OOL A;  1Z6F A;  2L4R A;  3LIA A;  4GNU A;  2ZMA A;  3HL9 A;  3PBT A;  3MS6 A;  5CEB A;  1ZHH B;  3MXR A;  5FI2 A;  1NYM A;  2GNX A;  2H28 A;  4FCF A;  3BWL A;  2FH5 A;  4YFM A;  4PHT A;  1YLY A;  2O9A A;  3E2L A;  5HAI A;  2FFF B;  3TG9 A;  3C2W A;  4P6Z M;  1W5D A;  1J9M A;  3BLS A;  4KG5 A;  4OQ0 A;  3MXQ A;  1DJB A;  3UE6 A;  1ZKJ A;  3T4S A;  3FZC A;  2PR5 A;  3NOU C;  1XJ3 A;  2Y2M A;  3K2N A;  5DTT A;  1S1Y A;  3C5A A;  1SDN A;  3NEC A;  4KZ3 A;  5HFO A;  4DDY A;  5EVI D;  4E04 A;  2Y2Q A;  5F82 A;  4OLD A;  1IOU A;  3SOI A;  4FD8 A;  5FQK A;  1LL8 A;  2EFU A;  4DN0 A;  3IHB A;  2CC1 A;  3EGD C;  2Y2G A;  3Q82 A;  3S7P A;  3IX3 A;  1PZO A;  3UPO A;  3T4K A;  1EI5 A;  3ZYT A;  3N8L A;  5E2H A;  1WE4 A;  4EES A;  1BUE A;  4GKU A;  4Y0U A;  5AVE A;  1XA1 A;  1TDG A;  1W8Q A;  3N4I A;  3NOP C;  5FA7 A;  4UQI S;  1H8Y A;  4U0T A;  2D01 A;  2JN7 A;  2EFX A;  3BQ8 A;  3E4Q A;  3WS0 A;  1O07 A;  2EA9 A;  3JVU A;  1K56 D;  3OLO A;  3T12 B;  1PFL A;  3S22 A;  3BY8 A;  2R78 A;  4OQH A;  1AWI A;  1M40 A;  2WKE A;  3WRT A;  3IX8 A;  3IXD A;  4I3A A;  1MPL A;  3WS1 A;  1H0M A;  4KUO A;  4IUK A;  3ULF A;  2HGV A;  1RP5 A;  4LV3 A;  4S2L A;  2AVX A;  4EQI A;  1LSV A;  4OP5 A;  3LR5 A;  1G6O A;  1MKM A;  3KSH A;  1WYB A;  4BMW A;  3HJI A;  1CF0 A;  2JCH A;  4JF5 A;  5BOH A;  5I94 A;  3NDE A;  4S2N A;  4II7 A;  1P9W A;  3BFE A;  4DE0 A;  2PAV P;  5GLB A;  3L9K A;  3C7V A;  4CLC D;  3SZT A;  2A24 A;  3BFF A;  4L9G A;  5AVF A;  3BFC A;  5KIZ A;  3F1O B;  1JWV A;  2H5S A;  2VGK A;  2W1T B;  1OT6 A;  2QZ6 A;  4WBG A;  1H5X A;  2HDS A;  1S1Z A;  2X01 A;  2ZLY A;  5J8X A;  1UGU A;  4I39 A;  4ZDX A;  1N9N A;  4H8R A;  4S2I A;  3GQZ A;  1T1A A;  3P98 A;  3FWL A;  3G32 A;  1A0K A;  4UEY A;  4NEE D;  4LEN A;  3PAE A;  3H82 A;  4XXR A;  3LR4 A;  4WLA A;  4EWF A;  1JTD A;  3N6I A;  2V2F F;  5AQB A;  1K56 A;  4Y7P A;  4O01 A;  4O7D A;  3M2J A;  1NZU A;  2WAE A;  3QHY A;  5FAQ A;  1DJC A;  4IUH A;  4GHI B;  4C3Q A;  3NIA A;  4GS9 B;  4HJ4 A;  5FDS A;  2L1M A;  5DVA A;  4Y0T A;  1TDL A;  2FZ0 A;  4BWI A;  3VE3 A;  1K54 C;  2P9V B;  3VP1 A;  5CX7 A;  1AXB A;  2HP6 A;  4WUJ A;  5L2F A;  1KE4 A;  4HJ3 A;  5FEF A;  1VM1 A;  3B33 A;  1ZG4 A;  2VX8 A;  1LSX A;  4U3T A;  4YIN A;  3TRC A;  5FQM A;  1YLZ A;  4AFI A;  3ZG0 A;  3HLW A;  2GJ3 A;  5TBM A;  3ZNT A;  4WYY A;  3Q7V A;  4DMZ A;  2ZQC A;  3UE0 A;  1XGJ A;  3I7J A;  3P7N A;  4IBR A;  1L0G A;  4KZ5 A;  4CLC A;  2HDU A;  1XJ2 A;  5GLC A;  4BBU A;  3CHW P;  5M1A A;  2NUT C;  3PAG A;  3DWZ A;  3MZE A;  4UA7 A;  3LY4 A;  2JKT M;  5F6A A;  2QKP A;  3UMD A;  4BBV A;  4X1M A;  4Y5F A;  1OTA A;  1MWS A;  1PW8 A;  1FOF A;  1EWZ A;  1I5Q A;  5JYP A;  4EEU A;  3RH8 B;  2XLN A;  2PR6 A;  5A92 A;  3P09 A;  3ZQ5 A;  3DBA A;  1JTG A;  3HLD A;  1K6R A;  4EBL A;  1OTE A;  2E8I A;  4BEN A;  5HPI A;  1LHY A;  2ZQA A;  4QU3 A;  1OTB A;  4G3W A;  2ZC4 B;  3C30 A;  3ZG5 A;  4WN5 A;  4R3A A;  4MNR A;  2WKP A;  3EGX C;  1PYY A;  3MBZ A;  1JWP A;  1LSW A;  1CK3 A;  2QWS A;  1ERO A;  2Q9N A;  1IEM A;  2VV6 A;  1XX2 A;  4N1X A;  3CMZ A;  2VJW A;  1MZU A;  1SKO A;  3QP4 A;  1BLH A;  3O86 A;  5DF8 A;  4K08 A;  1YMS A;  4PMA A;  2M7V A;  4GW9 A;  2IWC A;  2J9P A;  3SH8 A;  3TW8 A;  4G3K A;  4UA6 A;  3WS2 A;  1Y28 A;  2EX6 A;  1JWZ A;  3OZH A;  2EWW A;  4UAA A;  3T4T A;  4ZRR A;  2J7V A;  2VK3 A;  3BLM A;  1OTD A;  3SS4 A;  3G2Z A;  3GMW A;  1F5M A;  1DP9 A;  4X68 A;  3ZGA B;  4OQI A;  2Q0O A;  1PIO A;  3FG8 A;  3LUQ A;  3MMH A;  1NLY A;  1YAX A;  4BLM A;  4S2M A;  2K7S A;  3QNC A;  4NKP A;  1CQA A;  2Y79 A;  4E3M A;  4FOF A;  4LGW A;  1KVM A;  2X02 A;  4N1H A;  1Z09 A;  3JVV A;  1XPB A;  1S4R A;  2EX2 A;  4HBT A;  2OV5 A;  2OWJ A;  4D60 A;  5FAO A;  2B5R A;  3EOI A;  1P0Z A;  3NHQ A;  2P7J A;  3UE1 A;  4JXV A;  3LI9 A;  3M6H A;  2GDN A;  5FQJ A;  5F1G A;  3SS3 A;  3VOL A;  2EXA A;  3CZD A;  2R9W A;  2QPN A;  4LCL A;  3WS4 A;  5I5L A;  4C75 A;  3CIT A;  3MKE A;  1H8Z A;  2XRN A;  4WM9 A;  5DF7 A;  3D4F A;  5EVI B;  1YLW A;  4S2K A;  2Y2J A;  2XA7 M;  1P9R A;  4S2N C;  3ZHH A;  5A8B A;  4YOF A;  3F1N A;  4LRZ E;  2BLS A;  2WAF A;  1FCM A;  3CG5 A;  1N9L A;  5E2F A;  1E3U D;  1K0K A;  2GZA A;  1W8Y A;  4WEJ A;  4X69 A;  1PW1 A;  1GSV A;  2P08 A;  1MY8 A;  1SZV A;  1LT0 A;  1MWR A;  3E4P A;  3QP2 A;  1KDS A;  2A3U A;  3KSG A;  4Y15 A;  3LCE A;  3UPP A;  3BQA A;  3E0Y A;  4ME4 A;  1VET B;  3M6B A;  3TOI A;  2IWB A;  5CED A;  5CTN A;  2PRF A;  4MN5 A;  3KSI A;  5A90 A;  1SKF A;  2XR0 A;  4ARZ A;  4KZA A;  4QWO A;  5K5B A;  2XEP A;  1FCN A;  5EVI C;  1TS7 A;  3MQQ A;  1K4E A;  2XRO A;  4L0L A;  1O7E A;  3VV4 A;  4QB8 A;  5AQ7 A;  3T1S A;  1TS8 A;  2W0N A;  5GHX A;  2KOI A;  3PTE A;  5GL9 A;  4KZ7 A;  4LRX C;  3LEQ A;  5DTK A;  4Y2F A;  1IKG A;  2G7U A;  1W63 M;  2IA2 A;  3EEA A;  5HZH A;  4OPQ A;  1MBL A;  2Y8H A;  3V50 A;  1L3L A;  3Q7V B;  3V3R A;  1XJ4 A;  1VQQ A;  3B47 A;  4CJN A;  2QMI A;  5EVE A;  4CLC B;  3UB8 A;  1ONG A;  5IHV A;  2W3E A;  3H9W A;  3LO7 A;  1JVJ A;  4IBX A;  5GLA A;  5CTM A;  1PWG A;  1MWU A;  3UY6 A;  5A91 A;  2W1R A;  5CGS A;  3BEC A;  1Q2P A;  2ZOI A;  3MFD A;  2PYP A;  4Y13 A;  4OKP A;  2ZMV A;  2Y4A A;  4GJ4 A;  4N92 A;  2W3D A;  2ZM0 A;  3AGF A;  3WRZ A;  4OON A;  4PM8 A;  3LID A;  1Y4O A;  1ES5 A;  4I5S A;  2KLI A;  2XD5 A;  5E2G A;  2JKR M;  3PR6 A;  2WGW B;  1E3U A;  3DW0 A;  1H3Q A;  1S66 L;  2DRW A;  4BJP A;  4GDB A;  5FI6 A;  4DKI A;  3G31 A;  3H7W A;  3OCL A;  1YM1 A;  4JGO A;  1NY0 A;  1GCE A;  1VEU A;  1MC0 A;  2HDQ A;  2PD7 A;  4K0X A;  2Z6C A;  4MN7 A;  3OC2 A;  1M6K A;  5FSR A;  1JNU A;  2ZMF A;  1LI0 A;  3UDX A;  2JKT I;  2WK0 A;  5DFY A;  2Z2L B;  3ZFZ A;  1ZC2 A;  5HSQ A;  5HL1 A;  1FSY A;  3T50 A;  3U2A A;  1LLB A;  1FIK A;  3LR3 A;  4FSF A;  1S4S A;  5CRF A;  3HJK A;  2Y2I A;  4NXF A;  2Q9M A;  2Y2N A;  3W4P A;  4PM9 A;  3VFH A;  4JGQ A;  4CPK A;  1LL5 A;  3V67 A;  2W3F A;  4I38 A;  1IYS A;  3HLC A;  3PYP A;  2ZC5 B;  5FQQ A;  4HJ6 A;  5FQI A;  3B3X A;  3MQ0 A;  3OPR A;  3VE4 A;  3GVB A;  4NK3 A;  5HDD A;  1K57 C;  4OP8 A;  2PT7 A;  1XFN A;  2ZD8 A;  4E3N A;  4NXE A;  3ZCZ A;  1RGY A;  1RCJ A;  3DWK A;  3IF6 A;  4I3I A;  2WUQ A;  4H6J A;  4GDN A;  3LEZ A;  4U0X A;  3K3C A;  1L0F A;  4DJ3 A;  1BSG A;  2OAQ 1;  1NWZ A;  5J3W A;  3CPT B;  1TS0 A;  4HP4 A;  1Y54 A;  5C5K A;  5FL3 A;  3QP1 A;  1K4F A;  2BAS A;  2ZQ9 A;  4WZ4 A;  3ICY A;  5E2E A;  5FAT A;  3NBL A;  1U60 A;  4HH3 A;  5IU1 A;  3FKV A;  4EER A;  1H8M A;  4EXO A;  4GD8 A;  4Z9Q A;  4P87 A;  1K25 A;  1GA0 A;  3CUE A;  2ZL1 A;  4HES A;  3GEC A;  2Y59 A;  3Q7Z A;  4KZ6 A;  1GHI A;  1UWN X;  4BL2 A;  1HLU P;  4WZ5 A;  3MF0 A;  4YWZ A;  5HX9 A;  3SH9 A;  3VSK A;  4L9F A;  1I2S A;  2DCF A;  3FKW A;  5G4Y A;  5DJT A;  2WKR A;  1ERQ A;  1S67 L;  2JE5 A;  2QHK A;  4XUZ A;  1XP4 A;  2HJE A;  3VSL A;  2V1Z A;  1G6A A;  2XFS A;  3BY9 A;  5M19 A;  4HH2 A;  1OJG A;  3LIB A;  4KQQ A;  4GB7 A;  3S4X A;  3NY4 A;  2VV7 A;  2INW A;  5G18 A;  5U47 A;  2KX6 A;  1XGI A;  3G2Y A;  3GRJ A;  3IS2 B;  2WKI A;  4ARZ B;  3ZVW A;  4HNB A;  1VHM A;  2QJ5 A;  2ZC6 B;  3Q81 A;  4PM7 A;  5HDC A;  5HPF A;  3A3I A;  1ERM A;  2WKQ A;  1STZ A;  3RJU A;  1DRM A;  2XDM A;  2PBD P;  4EV4 A;  1V9Z A;  2J3W A;  4Y3I A;  3JYI A;  3N8S A;  3QP6 A;  4QHC A;  1F9I A;  5EFW A;  4JXW A;  2W3H A;  4PKY A;  3K3D A;  5EM0 A;  1N4O A;  2A2L A;  2ZBB A;  2EXB A;  2V1B A;  3KX0 X;  4OOY A;  1XKZ A;  4EET B;  1IYP A;  2ZJ9 A;  2A49 A;  4CQH A;  4GZB A;  4EEP A;  4UHU A;  2D02 A;  5M18 A;  4X53 A;  4L9E A;  1K6S A;  1NYY A;  3T4J A;  1OPX A;  1YLT A;  3O5Y A;  5EOO A;  2LB5 A;  1IFQ A;  3UO9 A;  2X71 A;  5HDS A;  3CAX A;  3L7H A;  1EW0 A;  1KDW A;  2OAP 1;  2PU2 A;  3LFV A;  2UV0 E;  4GLQ A;  1CI8 A;  4UQI M;  2ZM8 A;  1BUL A;  4DJ2 A;  3NC8 A;  4R0Q A;  3RFB A;  3T1R A;  4K0W A;  4NXB A;  4KQD A;  2WYX A;  3PBS A;  4HY8 A;  4IHQ A;  3F1P A;  3MZD A;  3RXW A;  3MZF A;  1NXY A;  3S7Q A;  1OTI A;  1YLJ A;  2OSU A;  4HEF A;  2OLU A;  3PBR A;  1HTZ A;  1TF1 A;  3VP0 A;  1OME A;  1MXO A;  1YSP A;  5CXW A;  2VGL S;  3W8K A;  5AJG A;  3VOZ A;  3LIC A;  2ACG A;  4EU0 A;  3HCY A;  2EX9 A;  3NOT C;  2ZM2 A;  3UB5 P;  2J3T D;  4QY5 A;  4OPY A;  4P85 A;  3FYZ A;  1VEU B;  3P01 A;  5AQA A;  1MKI A;  1FIL A;  2J80 A;  2PU4 A;  5HWW A;  4LCM A;  4E6X A;  1V9Y A;  4F94 A;  1N9B A;  4WMC D;  4P6Z S;  3A0S A;  4HIA A;  1T19 A;  4MDZ A;  3KO6 A;  4QJG A;  2ZOH A;  5CEC A;  4GD6 A;  3UDF A;  1SDE A;  4GOG A;  2G2W A;  1IEL A;  2JKR I;  1W63 Q;  4G3V A;  3T4Q A;  3QNB A;  3Q07 A;  2HJ9 C;  3HUN A;  4JBF A;  3NUL A;  4JKT A;  3EWK A;  3BW6 A;  4R3B A;  4PKY G;  1SCW A;  4KZ8 A;  4E3L A;  3FC7 A;  4OH0 A;  4E3I A;  5FI7 A;  4EBP A;  2Y91 A;  3LYX A;  1OJ5 A;  1ESI A;  2A24 B;  2P04 A;  2Y2P A;  4EQ1 A;  4BQM A;  3IF6 B;  5GLD A;  5DTS A;  4X6T A;  3F1O A;  4H6J B;  3U4L P;  5DF9 A;  4RQ9 A;  4KUK A;  5A93 A;  5HW3 A;  3O3V A;  2W1T A;  3CI6 A;  4R70 A;  1KGF A;  3E4O A;  5CHM A;  1KVL A;  4S2P A;  1ZG6 A;  3IH8 A;  3KYQ A;  4IJG A;  4MMN A;  5EV0 A;  2V1A A;  2JKF A;  3G30 A;  3ZG9 B;  1K54 A;  4DE1 A;  1DP8 A;  4HBU A;  4CLC E;  1NJ4 A;  2Z2M B;  1K38 A;  5F69 A;  1W7F A;  5EVL A;  1FCO A;  3PXP A;  3H82 B;  3IF6 C;  1K55 A;  1GSX A;  3HLB A;  3S7O A;  5GHZ A;  1XJ6 A;  4WMC A;  3UPN A;  4DXB A;  2MJ6 A;  5LBR A;  4LV1 A;  1T1C A;  1XFQ A;  4Y17 A;  3OBF A;  5CHU A;  4R1G A;  4OLG A;  3MKF A;  2J8Y A;  4GS9 A;  4MEZ A;  4N9K A;  1PWD A;  3VP4 A;  1SHV A;  4KEN B;  2HF6 A;  4KZ9 A;  2P9V A;  1T18 A;  5J4E A;  2VKS A;  1CI9 A;  2M7U A;  2H0Y A;  4ETZ A;  4FTX A;  4DE3 A;  5DKL A;  5TBM B;  3NDG A;  1VB6 A;  2V20 A;  1IKI A;  3GSG A;  4MCW A;  3MXS A;  3DTK A;  4BD0 A;  4LFU A;  4E3K A;  5MC7 A;  1NRJ A;  3UN7 A;  3PBO A;  4P6B A;  3ITA A;  4DDS A;  4JGP A;  4ZJ1 A;  3TE8 A;  5L8M A;  3O87 A;  3PBQ A;  5HWT A;  1PNE A;  2Y2H A;  4C6Y A;  1BYW A;  2HDR A;  2W3G A;  3R4K A;  3WS5 A;  1DY6 A;  1CJF A;  2W27 A;  5JYO A;  2K31 A;  1F2K A;  3UB7 A;  4B4X A;  3W4O A;  3HUO A;  3B42 A;  3M2K A;  3SS5 A;  4KG2 A;  1NLZ A;  4PM6 A;  1KOU A;  4X55 A;  3F1P B;  4CLC C;  1L2S A;  2V0U A;  3IXB A;  1S0W A;  4RX2 A;  3UME A;  2XGN A;  1ES4 A;  3OPL A;  3LIE A;  3AGE A;  2XH9 A;  5KSC A;  1YKD A;  3IH9 A;  4GCZ A;  3KYZ A;  4JGR A;  1T1B A;  3N8R A;  2WKH A;  3NCK A;  5DKK A;  1HD8 A;  1G68 A;  2DNS A;  4DE2 A;  3IBJ A;  1SKO B;  4BD1 A;  4LV2 A;  1D1J A;  3PHY A;  1Q2Q A;  1NZO A;  4D2O A;  1WYC A;  5CGX A;  3BM6 A;  3KSF A;  4K91 A;  3IWI A;  2VGJ A;  1TEM A;  3T1X A;  1PI4 A;  3ZDJ A;  2ZQD A;  3IWO A;  5TR7 A;  2QJ7 A;  4Y0O A;  5F1F A;  1KE0 A;  3MJQ A;  3QP5 A;  1P97 A;  5EM1 A;  2OOL A;  4NXG A;  2JHE A;  3MR0 A;  2PHY A;  4A5R A;  3MQO A;  2EWV A;  3C4O A;  4FH4 A;  2ZC3 B;  4WL9 A;  1J3W A;  3C4P A;  5D3O A;  2WZX A;  4FUW A;  3W2Z A;  4P0M A;  2XQZ A;  2NUP C;  2WGI A;  1KGG A;  1FR1 A;  4IVK A;  2XF3 A;  3V5M A;  4B88 A;  2Y2L A;  3S7N A;  1YSQ A;  2VLG A;  4XT2 A;  5KSH A;  4S2O A;  5EPH A;  2PYR A;  2VZW A;  4EBN A;  3IQA A;  1TVF A;  2HV1 A;  2BG1 A;  3RXX A;  4UA9 A;  4QD4 A;  4HOI A;  3TSG A;  3OCN A;  3IX4 A;  2HP5 A;  4Z1W A;  2UWX A;  3BRM A;  2Y55 A;  1ZTU A;  3GTC A;  2H0T A;  3O88 A;  5AQ9 A;  3VOY A;  4ZJ2 A;  2PDR A;  2O9B A;  3IXH A;  2B02 A;  1DJA A;  4NET A;  2C6W B;  4Q0J A;  3IXG A;  4X1L A;  4ETX A;  3ISG A;  3BJN A;  3FV7 A;  4DRT A;  3G4P A;  4OOM A;  5IS1 A;  2HZ5 A;  5EVI A;  1S6R A;  2YKH A;  1E25 A;  4IED A;  5HL6 A;  3VP3 A;  3F1N B;  1DP6 A;  4IVI A;  2FFY A;  3G6O A;  3GR2 A;  1BLS A;  3R7W A;  4DXC A;  3BYD A;  4ZJ3 A;  3VFF A;  1BTL A;  4R3J A;  2I72 A;  4ESP A;  3RTY A;  1VET A;  4Q0H A;  3UNW A;  1GHP A;  1RGZ A;  3ZVT A;  5EUA A;  3EEH A;  4WEK A;  1YMX A;  3Q1F A;  3OOV A;  4E6W A;  4KQO A;  2J9O A;  1ESU A;  4M4X A;  4Q0I A;  3BFD A;  3LIF A;  2CMN A;  4BL3 A;  5FAS A;  1L0E A;  1GA9 A;  4WF0 A;  3ZG7 B;  3PBN A;  4PPR A;  4S2J A;  4F3L A;  4Q8I A;  2XA7 S;  1BLP A;  3T4L A;  2J3T C;  2LB9 A;  1PWC A;  4OQG A;  3G35 A;  2DMW A;  1E4D A;  3GV9 A;  1W79 A;  3CWF A;  2JBF A;  3VMA A;  4E3J A;  4EUV A;  1QME A;  3IT9 A;  3A3J A;  2YKF A;  1YLP A;  1PI5 A;  1K55 C;  3IBR A;  2K2N A;  3CJM A;  3LY3 A;  4LLO B;  4OVD A;  4KG6 A;  3C8C A;  3HVF A;  1ALQ A;  2PD8 A;  5CGW A;  1G28 A;  2B18 A;  3CLO A;  3HLE A;  1D06 A;  2V9A A;  4FH2 A;  3IHA A;  1G5U A;  1ES2 A;  3AGD A;  4B9O A;  3HBR A;  4X25 A;  5CER A;  3WWX A;  1GHM A;  1NRF A;  1YT4 A;  5EEC A;  5FAP A;  4QY6 A;  5HAP A;  4NG2 A;  1BLC A;  5EOE A;  5E43 A;  2O0Y A;  2WAD A;  3A0R A;  1UWP X;  2O9C A;  3SH7 A;  3DAV A;  2ZC7 A;  4R4S A;  3LR0 A;  2OWH A;  3FPV A;  4R6L A;  5KMW A;  2WGW A;  3EQV A;  4B4Z A;  3C38 A;  3N7W A;  1ONH A;  3FPW A;  2IWD A;  2JC7 A;  2V8F A;  1BZA A;  4JF4 A;  5FDH A;  4MLL A;  1KE3 A;  3W4Q A;  3H7W B;  4JXS A;  1MWT A;  5TFQ A;  4HI4 A;  5L09 A;  3UB9 A;  2HPB A;  2ZQ7 A; 
#chains in the Genus database with same CATH homology
 5GHZ A;  5EE8 A;  3ZG8 B;  3OPH A;  3E2K A;  3OC2 A;  1ES3 A;  1M6K A;  4WMC A;  3UPN A;  4DXB A;  5FSR A;  2HP9 A;  1LI0 A;  4LV1 A;  3UDX A;  5AQB A;  1K56 A;  4Y7P A;  4O7D A;  3M2J A;  1K57 A;  1NZU A;  2WAE A;  2WK0 A;  3HRE A;  3QHY A;  5FAQ A;  1DJC A;  3BFG A;  5CHU A;  2Z2L B;  3OPP A;  5FQ9 A;  4R1G A;  1ZC2 A;  4OLG A;  3MKF A;  3UE3 A;  3ZFZ A;  4C3Q A;  5HL1 A;  2J8Y A;  1FSY A;  3NIA A;  4JPM A;  3S1Y A;  5DVA A;  4MEZ A;  4N9K A;  4Y0T A;  1TDL A;  1PWD A;  3VP4 A;  1LLB A;  1SHV A;  4KEN B;  4KZ9 A;  5TGF A;  4FSF A;  2P9V A;  1K54 C;  2P9V B;  5CHJ A;  2RL3 A;  5CRF A;  1AXB A;  3VP1 A;  2HP6 A;  2Y2I A;  5L2F A;  3HLF A;  2Q9M A;  2Y2N A;  3W4P A;  1KE4 A;  1CI9 A;  1VM1 A;  4PM9 A;  3VFH A;  1ZG4 A;  4ID4 A;  3BEB A;  2H0Y A;  4U3T A;  4CPK A;  4YIN A;  2RCX A;  1LL5 A;  5FQM A;  1YLZ A;  5KZH A;  3ZG0 A;  3HLW A;  4DE3 A;  1IYS A;  1KGE A;  3HLC A;  4X56 A;  1CEG A;  1YQS A;  3ZNT A;  2ZC5 B;  3NDG A;  5FQQ A;  5FQI A;  4WYY A;  2V20 A;  1IKI A;  3GSG A;  3Q7V A;  3B3X A;  2ZQC A;  3OPR A;  3MXS A;  3UE0 A;  1XGJ A;  3GVB A;  3I7J A;  4NK3 A;  4IBR A;  2Y2K A;  1L0G A;  4KZ5 A;  1K57 C;  4DF6 A;  4ZTK A;  2HDU A;  5GLC A;  4BD0 A;  4KQR A;  4OP8 A;  3VP2 A;  5M1A A;  3PAG A;  4E3K A;  2ZD8 A;  3G34 A;  3V3S A;  4E3N A;  1IYO A;  3DWZ A;  3ZCZ A;  1RGY A;  3UN7 A;  1RCJ A;  3PBO A;  2P74 A;  3DWK A;  3IF6 A;  3MZE A;  3LY4 A;  4UA7 A;  4P6B A;  2WUQ A;  3ITA A;  1L0D A;  4DDS A;  2H10 A;  1MWS A;  1PW8 A;  2ZQ8 A;  3LEZ A;  4GDN A;  4ZJ1 A;  4JXG A;  4U0X A;  1L0F A;  1FOF A;  4R23 A;  3IF5 A;  3ZNY A;  1EWZ A;  1BSG A;  2WGV A;  1I5Q A;  3O87 A;  3PBQ A;  4OPZ A;  2XD1 A;  5HAR A;  3A3E A;  5JYP A;  1XA7 A;  1Y54 A;  2XLN A;  3HUM A;  2Y2H A;  4LV0 A;  1K4F A;  4C6Y A;  2HDR A;  3P09 A;  5A92 A;  2ZQ9 A;  4MBK A;  4WZ4 A;  1JTG A;  3HLD A;  1K6R A;  5E2E A;  5FAT A;  3WS5 A;  4EBL A;  1DY6 A;  3NBL A;  5JYO A;  4N9L A;  1LL9 A;  1U60 A;  2PBY A;  1FR6 A;  2E8I A;  3FKV A;  4BEN A;  4B4X A;  3W4O A;  3HUO A;  3M2K A;  3SS5 A;  4GD8 A;  1LHY A;  4R4R A;  4Z9Q A;  2ZQA A;  4KG2 A;  1K25 A;  2Y2O A;  4P87 A;  4PM6 A;  4QU3 A;  1GA0 A;  4X55 A;  3UDI A;  2ZC4 B;  3ZG5 A;  1QMF A;  3IWQ A;  1L2S A;  4HES A;  1CEF A;  2Y59 A;  1S0W A;  3IXB A;  3Q7Z A;  3A3D A;  4KZ6 A;  4MNR A;  4RX2 A;  1GHI A;  4BL2 A;  2XGN A;  1ES4 A;  1HZO A;  3OPL A;  1PYY A;  3MBZ A;  1JWP A;  4MBH A;  3AGE A;  1CK3 A;  4WZ5 A;  2XH9 A;  5HX9 A;  3SH9 A;  5KSC A;  4E3O A;  1ERO A;  5HAQ A;  3IH9 A;  3VSK A;  2Q9N A;  1IEM A;  1I2S A;  2DCF A;  3FKW A;  4XUX A;  3DTM A;  2C5W B;  3NI9 A;  3N8R A;  2WKH A;  4JLF A;  3NCK A;  5GHY A;  1XX2 A;  1ERQ A;  2XFT A;  1HD8 A;  4N1X A;  1G68 A;  2DNS A;  2JE5 A;  1IYQ A;  3CMZ A;  4DE2 A;  4WEL A;  4GN2 A;  1C3B A;  4BD1 A;  4XUZ A;  1XP4 A;  4LV2 A;  3VSL A;  1BLH A;  1Q2Q A;  3O86 A;  2V1Z A;  4RVA A;  1G6A A;  1NZO A;  5DF8 A;  4D2O A;  1WYC A;  2XFS A;  4RX3 A;  5F83 A;  3A3F A;  5CGX A;  3BM6 A;  5M19 A;  1I2W A;  4K91 A;  1YMS A;  3IWI A;  4PMA A;  2VGJ A;  1TEM A;  4KQQ A;  4RYE A;  4KZB A;  2IWC A;  4GB7 A;  1PI4 A;  2J9P A;  3ZDJ A;  3S4X A;  2ZQD A;  3IWO A;  4M3K A;  3SH8 A;  3V39 A;  4RA7 A;  4EUZ A;  3NY4 A;  3EQU A;  5TR7 A;  4Y0O A;  5G18 A;  5F1F A;  5U47 A;  1KE0 A;  4UA6 A;  1XGI A;  3WS2 A;  2EX6 A;  3G2Y A;  3GRJ A;  1JWZ A;  3OZH A;  2WKI A;  2XK1 A;  4UAA A;  3ZVW A;  2J7V A;  2ZC6 B;  3BLM A;  4A5R A;  1PZP A;  3C4O A;  1HVB A;  2OLV A;  3Q81 A;  4PM7 A;  4WZ5 C;  3SS4 A;  3A3I A;  4ZAM A;  3G2Z A;  1ERM A;  4FH4 A;  2ZC3 B;  3RJU A;  3GMW A;  4MBF A;  2XDM A;  3ITB A;  4EV4 A;  3C4P A;  4X68 A;  5D3O A;  1BT5 A;  2WZX A;  3ZGA B;  4OQI A;  4P0M A;  3JYI A;  2XQZ A;  2WZZ A;  1PIO A;  1FQG A;  2G2U A;  2R9X A;  3N8S A;  2WGI A;  1KGG A;  1FR1 A;  4QHC A;  1LI9 A;  4JXW A;  4IVK A;  2XF3 A;  4BLM A;  1N4O A;  3V5M A;  4B88 A;  2Y2L A;  4S2M A;  4KZ4 A;  3QNC A;  2EXB A;  3HLG A;  1FSW A;  4E3M A;  4OOY A;  4JF6 A;  5KSH A;  1XKZ A;  1IYP A;  2ZJ9 A;  3C7U A;  1KVM A;  2X02 A;  2A49 A;  4S2O A;  5EPH A;  4ZBE A;  4OPR A;  4GZB A;  4PM5 A;  4N1H A;  2EX8 A;  3IQA A;  4EBN A;  1TVF A;  4UHU A;  1XXM A;  5M18 A;  4OOL A;  1XPB A;  4X53 A;  1Z6F A;  2BG1 A;  4GNU A;  1K6S A;  2EX2 A;  4HBT A;  2OV5 A;  3RXX A;  1NYY A;  4UA9 A;  2ZMA A;  3HL9 A;  3PBT A;  4QD4 A;  3TSG A;  5CEB A;  3OCN A;  5FAO A;  1YLT A;  2B5R A;  5EOO A;  2HP5 A;  3MXR A;  5FI2 A;  1NYM A;  2UWX A;  3BRM A;  3UO9 A;  2X71 A;  3UE1 A;  2Y55 A;  4JXV A;  4FCF A;  1KDW A;  3M6H A;  4YFM A;  2GDN A;  2PU2 A;  5F1G A;  5FQJ A;  3SS3 A;  1YLY A;  3GTC A;  2H0T A;  3O88 A;  5AQ9 A;  3VOY A;  2EXA A;  4ZJ2 A;  1CI8 A;  3CZD A;  2ZM8 A;  3IXH A;  1BUL A;  3E2L A;  2R9W A;  2FFF B;  5HAI A;  3TG9 A;  1DJA A;  2QPN A;  1W5D A;  1J9M A;  3BLS A;  4KG5 A;  4NET A;  2C6W B;  3NC8 A;  4OQ0 A;  3IXG A;  4R0Q A;  4LCL A;  3WS4 A;  1DJB A;  4K0W A;  4C75 A;  1ZKJ A;  2WYX A;  3PBS A;  3ISG A;  3MZD A;  3RXW A;  3MZF A;  3MKE A;  1NXY A;  3FZC A;  1H8Z A;  2Y2M A;  4WM9 A;  5DF7 A;  3FV7 A;  3D4F A;  4DRT A;  1YLJ A;  3G4P A;  4OOM A;  5DTT A;  2OSU A;  4HEF A;  5EVI B;  1YLW A;  5EVI A;  4S2K A;  2OLU A;  2Y2J A;  3PBR A;  1S6R A;  1HTZ A;  3C5A A;  1SDN A;  4KZ3 A;  1E25 A;  4IED A;  3VP0 A;  5HFO A;  4DDY A;  5EVI D;  1OME A;  1MXO A;  4S2N C;  3ZHH A;  3VP3 A;  5CXW A;  2Y2Q A;  5F82 A;  3W8K A;  4OLD A;  3SOI A;  3VOZ A;  4FD8 A;  2FFY A;  4IVI A;  2BLS A;  2WAF A;  5FQK A;  1FCM A;  3CG5 A;  5E2F A;  1E3U D;  2EFU A;  2EX9 A;  3IHB A;  1W8Y A;  2CC1 A;  3GR2 A;  1BLS A;  2Y2G A;  2ZM2 A;  4WEJ A;  3Q82 A;  4X69 A;  1PW1 A;  3BYD A;  4DXC A;  1MY8 A;  4ZJ3 A;  1MWR A;  4QY5 A;  4OPY A;  3VFF A;  1PZO A;  1KDS A;  3UPO A;  2A3U A;  1BTL A;  4R3J A;  2I72 A;  3LCE A;  1EI5 A;  3UPP A;  4P85 A;  3FYZ A;  3UNW A;  1GHP A;  1RGZ A;  3N8L A;  5E2H A;  1WE4 A;  3M6B A;  1BUE A;  3ZVT A;  4GKU A;  5EUA A;  4Y0U A;  3TOI A;  5AQA A;  2IWB A;  1MKI A;  1TDG A;  1W8Q A;  1XA1 A;  2PU4 A;  4WEK A;  3N4I A;  5CTN A;  5FA7 A;  5CED A;  4LCM A;  4E6X A;  1YMX A;  5A90 A;  1H8Y A;  3Q1F A;  4U0T A;  4F94 A;  1SKF A;  4E6W A;  2XR0 A;  1N9B A;  4WMC D;  4KQO A;  2EFX A;  2J9O A;  1ESU A;  4KZA A;  2XEP A;  3WS0 A;  1FCN A;  1O07 A;  1K56 D;  3BFD A;  5EVI C;  4BL3 A;  5FAS A;  1L0E A;  3S22 A;  1GA9 A;  1K4E A;  3ZG7 B;  4L0L A;  1O7E A;  4QJG A;  3PBN A;  4PPR A;  4OQH A;  1M40 A;  4S2J A;  4Q8I A;  4QB8 A;  2WKE A;  3WRT A;  5CEC A;  3IXD A;  4GD6 A;  3UDF A;  1SDE A;  4GOG A;  5AQ7 A;  1BLP A;  1MPL A;  3WS1 A;  2G2W A;  1IEL A;  5GHX A;  1PWC A;  4OQG A;  1RP5 A;  4LV3 A;  3G35 A;  1E4D A;  3GV9 A;  1W79 A;  4S2L A;  3PTE A;  5GL9 A;  4EQI A;  4OP5 A;  2JBF A;  3VMA A;  4KZ7 A;  4E3J A;  3QNB A;  3Q07 A;  1WYB A;  3HUN A;  4JBF A;  1QME A;  1IKG A;  3A3J A;  3IT9 A;  5DTK A;  1YLP A;  2JCH A;  1PI5 A;  4JF5 A;  5BOH A;  4JKT A;  1K55 C;  4OPQ A;  1MBL A;  5I94 A;  3NDE A;  3CJM A;  4R3B A;  4S2N A;  3V50 A;  1SCW A;  3LY3 A;  3BFE A;  3Q7V B;  3V3R A;  4DE0 A;  4OVD A;  4KZ8 A;  4E3L A;  1VQQ A;  4CJN A;  4OH0 A;  4KG6 A;  5GLB A;  2QMI A;  4E3I A;  3HVF A;  1ONG A;  5FI7 A;  3C7V A;  4EBP A;  1ALQ A;  2Y91 A;  5CGW A;  5IHV A;  1ESI A;  3LO7 A;  3HLE A;  1JVJ A;  4IBX A;  4FH2 A;  3IHA A;  5GLA A;  5CTM A;  3BFF A;  1ES2 A;  2Y2P A;  4BQM A;  1PWG A;  3BFC A;  3IF6 B;  3AGD A;  1MWU A;  5GLD A;  4X6T A;  3HBR A;  5CGS A;  5DTS A;  3BEC A;  5A91 A;  5CER A;  3UY6 A;  3WWX A;  1Q2P A;  1JWV A;  3MFD A;  5DF9 A;  1GHM A;  1NRF A;  1YT4 A;  5EEC A;  5FAP A;  4QY6 A;  3O3V A;  5A93 A;  5HW3 A;  2H5S A;  5HAP A;  2VGK A;  1BLC A;  4OKP A;  2Y4A A;  5EOE A;  1KGF A;  4N92 A;  5E43 A;  5CHM A;  2ZM0 A;  3AGF A;  1KVL A;  3WRZ A;  2WAD A;  4OON A;  4S2P A;  2QZ6 A;  1ZG6 A;  4PM8 A;  4WBG A;  1ES5 A;  3IH8 A;  1H5X A;  3SH7 A;  2XD5 A;  5E2G A;  2ZC7 A;  2HDS A;  4R4S A;  2X01 A;  2ZLY A;  5J8X A;  3G30 A;  5KMW A;  4ZDX A;  2WGW A;  2WGW B;  3EQV A;  4H8R A;  3GQZ A;  4S2I A;  3ZG9 B;  1E3U A;  4B4Z A;  3P98 A;  3DW0 A;  3FWL A;  3N7W A;  1K54 A;  3G32 A;  4DE1 A;  1ONH A;  2IWD A;  2JC7 A;  2DRW A;  4HBU A;  1BZA A;  4JF4 A;  4GDB A;  4BJP A;  1NJ4 A;  2Z2M B;  4MLL A;  5FDH A;  5FI6 A;  4DKI A;  1K38 A;  1KE3 A;  1W7F A;  5EVL A;  3G31 A;  4JXS A;  4LEN A;  1MWT A;  3W4Q A;  3PAE A;  3OCL A;  5TFQ A;  1FCO A;  1YM1 A;  4XXR A;  1NY0 A;  3IF6 C;  2HPB A;  2ZQ7 A;  4EWF A;  1GCE A;  1JTD A;  2HDQ A;  1K55 A;  4K0X A;  3N6I A;  3HLB A;  2V2F F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...