2P74A

Ctx-m-9 class a beta-lactamase apo crystal structure at 0.88 angstrom resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title The Acylation Mechanism of CTX-M beta-Lactamase at 0.88 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2p74A00
2Y2OA 3SS4A 4OVDA 3PTEA 1YM1A 2P9VA 5KSHA 3N8LA 3Q7ZA 4FH2A 3A3JA 5CTNA 3UE0A 4BQMA 1PIOA 4CJNA 2WGVA 4DE2A 1ONHA 3FWLA 5HX9A 1XGIA 5CGXA 3IH8A 4S2NA 1G68A 3UE1A 3MZFA 5AQ7A 3N8SA 5FI2A 1RGYA 4JF6A 1K6SA 3BFEA 4MBFA 2HDSA 3GR2A 1LL5A 1ZG6A 2ZJ9A 3GQZA 4Y0TA 3WWXA 2WKIA 4KQRA 1NYYA 2QZ6A 3MXRA 1NJ4A 3IT9A 4R3BA 3AGDA 4DE0A 4S2MA 2OLUA 5E2EA 2XD1A 2XEPA 3A3IA 3FZCA 1FR1A 1RP5A 5GHYA 2VGKA 1GHMA 3M2KA 2X71A 5AQ9A 5TR7A 1GCEA 1LI9A 3O86A 4UA9A 1L0FA 2JBFA 1FCMA 5EOOA 2Y91A 3ISGA 4JBFA 4KQQA 1W79A 4PPRA 1BLHA 1O7EA 1KGGA 2R9XA 1LL9A 5EVIA 3WS4A 4UA6A 3UDIA 1Q2PA 4LENA 2P9VB 3WRTA 4WZ5A 4DRTA 4S2OA 5CTMA 2ZC3B 4LV2A 3PBNA 5E2GA 3SH9A 4ZJ1A 3WRZA 2QMIA 1ZKJA 2EX9A 4RA7A 3ZVWA 2HDQA 2XH9A 3G2YA 5GHXA 1XX2A 3UDXA 3ZHHA 3P09A 2EXBA 3DWZA 2GDNA 3I7JA 4KZBA 4LCLA 1RCJA 1GHIA 1MKIA 5FAQA 2WZXA 3IF5A 2C5WB 4GOGA 3NIAA 5HARA 4BJPA 1EWZA 2ZM0A 4QY5A 3HLBA 2IWDA 3EQUA 4EQIA 4K0WA 2A3UA 3VP4A 3VMAA 2J9PA 1GA9A 5GLAA 5TGFA 3IF6A 4XUXA 2ZC4B 5EVLA 3N7WA 3OPLA 5M19A 3Q81A 4OH0A 4X69A 5CHJA 2C6WB 4E3MA 4IEDA 2Y59A 1DJAA 1YLYA 3M6BA 4GDNA 4KZAA 4PM7A 4KZ6A 1HVBA 3W8KA 3IXHA 4OOLA 4GZBA 4OKPA 1ERQA 4XUZA 3ZCZA 2XFTA 3ZG5A 2ZQCA 4B4ZA 1K57C 1PZOA 2XK1A 3FKWA 4X68A 3LO7A 4HEFA 1FCOA 3S1YA 1GHPA 3VSKA 1HTZA 4OLDA 1MY8A 4OQ0A 4N92A 1O07A 3BM6A 1JWZA 4A5RA 3W4OA 5FQMA 4R4SA 1TVFA 4EBLA 1K4FA 4MBKA 3HLDA 4DDSA 5L2FA 1DY6A 4MEZA 4PM6A 4DKIA 4E3OA 2EX2A 1SHVA 3NI9A 2ZQ7A 2OSUA 1PI4A 1XA7A 4KG2A 4X55A 3VP0A 5CECA 1BT5A 4GN2A 2Y2PA 3QHYA 3LY4A 5CGSA 5DTTA 3ZFZA 1YT4A 4OP5A 3ZNTA 3IF6B 4GB7A 3OCLA 4KZ5A 2ZD8A 3IH9A 5FQIA 4MBHA 3M2JA 3TSGA 4E3LA 5DF7A 1NY0A 2WGIA 1W8QA 3JYIA 3VP2A 3C7VA 4Y0OA 4FSFA 1MWRA 1XKZA 4R3JA 4IBRA 1XPBA 4EWFA 2G2UA 3HLWA 2Y4AA 1CEFA 1KDWA 2EXAA 3BRMA 3ITBA 2ZM8A 4KENB 4OQIA 1ONGA 1HZOA 4MLLA 3FKVA 1BUEA 5TFQA 1OMEA 4D2OA 5DVAA 1LI0A 3ZGAB 5F83A 3MZDA 1KDSA 3ZG0A 4C3QA 4KZ7A 2XF3A 3N8RA 4N1XA 5DF8A 3G30A 3RXXA 4IVIA 3N4IA 2RL3A 5I94A 2Z2LB 4S2IA 4X6TA 3OPHA 3IXBA 4RX2A 5EUAA 4ZJ3A 5EPHA 3BLMA 1IEMA 3C4PA 4WYYA 2ZQDA 4GDBA 3AGFA 4BLMA 4E3NA 1E4DA 1QMEA 2DRWA 4KZ3A 4HBTA 3N6IA 1NYMA 5FATA 1L0DA 1YLPA 1YMXA 2ZC6B 3HL9A 4HESA 3VFHA 3CZDA 4BENA 3UDFA 3UNWA 4C75A 1YLZA 4MNRA 4E3JA 1K4EA 3C7UA 1BTLA 2CC1A 1JVJA 1SDNA 2RCXA 3IWQA 3A3EA 1BLCA 3S22A 1VQQA 1MWUA 5E2HA 4HBUA 5CGWA 3ITAA 4GD8A 4FD8A 1TEMA 3O88A 1IYSA 4E3KA 3MXSA 4R4RA 3VOYA 3C5AA 3IWIA 3O3VA 2E8IA 3D4FA 3HBRA 1C3BA 5EVIC 1IKIA 5KSCA 4JXVA 5A93A 4KG5A 1Y54A 3BFCA 4NK3A 3A3FA 4WEJA 2Y2KA 4EV4A 4GD6A 3E2LA 4H8RA 4KZ4A 1MWTA 5EOEA 3MKFA 3SS3A 5CHMA 3G34A 3BLSA 1WYCA 1PWDA 4JF4A 3GV9A 5CHUA 4DXCA 5F1FA 2OLVA 4R0QA 5DTSA 1PZPA 1KGEA 2H5SA 3HREA 4JXWA 2OV5A 5EVID 2V20A 4N9KA 4RVAA 1AXBA 1W8YA 2EX8A 3V50A 4F94A 1DJBA 4KG6A 2WUQA 1ESUA 4OLGA 1ESIA 3UPOA 2HP6A 5CEDA 2P74A 1IYOA 3EQVA 1KE0A 1XGJA 1LHYA 4OPQA 1G6AA 4OOMA 4U0TA 2J8YA 3IHAA 4WBGA 4IVKA 2G2WA 1FSYA 1JWPA 3OC2A 4UA7A 2EFUA 4DDYA 1DJCA 4OQHA 4EBPA 1J9MA 1CI9A 1N4OA 2V2FF 3CG5A 5FAOA 2ZC7A 5FSRA 2XLNA 3SS5A 1IKGA 1ERMA 1YLJA 3QNBA 3UPPA 3Q82A 4S2LA 5BOHA 1BSGA 3RXWA 3HUMA 2J9OA 4Y7PA 2ZC5B 4UAAA 4S2PA 5A91A 1K55C 2DNSA 5GL9A 2XR0A 1ES5A 2ZQAA 4KZ9A 4R23A 4X53A 1K38A 5CEBA 3PBQA 1VM1A 1ES3A 3OPRA 3B3XA 3WS1A 1K54C 1PW8A 2Y2HA 5HAIA 4PMAA 4QU3A 3ZG8B 4ZAMA 4DE1A 5FI6A 3OCNA 3PAEA 3S4XA 2Y2NA 4QJGA 1EI5A 1E3UA 2FFFB 4ID4A 2ZLYA 4WMCA 2R9WA 3CMZA 4K91A 4PM5A 4P0MA 4UHUA 1JTGA 2BLSA 3BFGA 2Y2JA 2XD5A 5M1AA 3AGEA 2Z2MB 5KZHA 3GSGA 4PM8A 1WE4A 2BG1A 4EBNA 5CRFA 4JKTA 1YQSA 1I2SA 2WKHA 1PW1A 1CEGA 3G32A 3M6HA 3W4PA 3NY4A 3UY6A 2UWXA 3CJMA 4OPRA 1MWSA 1KE4A 1L2SA 3TOIA 2EFXA 4LCMA 5FA7A 4DXBA 5FASA 1K56D 5J8XA 3V3SA 1HD8A 5E43A 5FQJA 5A92A 2WGWA 1I2WA 4N9LA 2HP5A 1Q2QA 1KGFA 3VP3A 5A90A 4ZBEA 4U3TA 1CI8A 4LV3A 4QB8A 3Q7VA 1LLBA 3PBTA 3NDEA 2Y2LA 3UO9A 3HVFA 3IWOA 3V5MA 3O87A 3VSLA 1NZOA 3ZNYA 1K25A 4XXRA 4GKUA 4EUZA 1SDEA 4JXSA 5U47A 4IBXA 1EROA 3G35A 1M40A 5M18A 3V39A 4B4XA 3IQAA 4LV0A 4S2NC 1XXMA 4CPKA 1ES4A 3RJUA 4PM9A 3BFFA 4OP8A 3BFDA 2X02A 1YLWA 3UN7A 3LCEA 3G4PA 1BULA 1L0EA 2HP9A 3WS0A 3HUNA 5DF9A 5HFOA 5GHZA 1NZUA 4P87A 2H10A 5HAPA 2B5RA 4S2KA 2V1ZA 3HLGA 2VGJA 4WEKA 2ZQ8A 4ZJ2A 2JCHA 5D3OA 1S0WA 4BD0A 4YINA 4Z9QA 4OPZA 2WGWB 2J7VA 2WADA 4FH4A 1ZC2A 3MZEA 2Y2GA 1H8YA 1MXOA 3OZHA 5FDHA 3HLCA 2ZQ9A 1IYQA 4DF6A 3BYDA 1ZG4A 1BLPA 4BL2A 5CXWA 3Q7VB 2A49A 1NXYA 5DTKA 2ZM2A 1KVMA 1M6KA 4ZDXA 5E2FA 4OQGA 3SOIA 4WZ5C 5EE8A 4OOYA 5AQAA 3WS2A 1MPLA 4JXGA 1BZAA 1U60A 3G31A 4P6BA 3VOZA 3DWKA 1MBLA 3GTCA 4WELA 4U0XA 3LY3A 5HAQA 5JYPA 1TDGA 5EECA 1RGZA 2WK0A 4K0XA 1N9BA 1GA0A 3A3DA 3PAGA 4QD4A 2X01A 4RYEA 2WYXA 3DW0A 5CERA 2WAFA 1FR6A 5GLDA 4N1HA 4C6YA 4S2JA 5KMWA 4QY6A 3VFFA 3MFDA 3GVBA 3IF6C 3NC8A 1JTDA 3NDGA 2EX6A 4KQOA 4LV1A 4E6XA 1KVLA 5GLCA 4B88A 1XA1A 2Y2IA 2QPNA 4ZTKA 4E6WA 1E25A 4OONA 4JPMA 1S6RA 3Q1FA 3IHBA 5GLBA 2WZZA 3IXDA 4FCFA 1W5DA 5HW3A 4RX3A 2DCFA 4BL3A 5IHVA 4X56A 2Q9MA 1K6RA 3GRJA 2PBYA 1KE3A 1JWVA 2WKEA 3VP1A 1YMSA 3NBLA 3MBZA 4NETA 1ES2A 4P85A 3GMWA 2Y2MA 2IWCA 1IYPA 1SKFA 1W7FA 3HLFA 3MKEA 5AQBA 4L0LA 4KZ8A 1K57A 2XQZA 2IWBA 4E3IA 5FQKA 1IELA 4QHCA 4WZ4A 4WM9A 5EVIB 4M3KA 3W4QA 2HPBA 1QMFA 3WS5A 2XFSA 3C4OA 5G18A 3V3RA 3UPNA 3Q07A 2JC7A 3OPPA 3UE3A 1K55A 5F1GA 2Q9NA 3BEBA 3G2ZA 5F82A 3PBSA 1FQGA 2XGNA 1K54A 3HLEA 3FYZA 2ZMAA 3FV7A 3LEZA 5FQQA 2Y2QA 3HUOA 4O7DA 3PBRA 1K56A 3E2KA 1H8ZA 2JE5A 4R1GA 3ZG9B 2H0YA 1FSWA 1E3UD 1PI5A 1Z6FA 3TG9A 4WMCD 5HL1A 4JF5A 3ZG7B 1NRFA 1BLSA 1TDLA 2PU4A 3PBOA 2HDRA 1WYBA 1H5XA 4YFMA 3BECA 3NCKA 3QNCA 4Y0UA 4BD1A 2HDUA 3ZDJA 1I5QA 5FI7A 3IXGA 3SH8A 2Y55A 4JLFA 1L0GA 4GNUA 2WAEA 4DE3A 1PYYA 3DTMA 2XDMA 3P98A 2H0TA 5FAPA 1FOFA 1PWCA 4OPYA 1CK3A 2FFYA 2I72A 4Q8IA 5JYOA 1PWGA 3ZVTA 1YLTA 1FCNA 1ALQA 1XP4A 2PU2A 5FQ9A 3SH7A 1SCWA
chains in the Genus database with same CATH superfamily
5IU1A 2KDKA 4ETXA 1YM1A 2KOIA 5KSHA 3A3JA 4HJ4A 1ONHA 3FWLA 3IS2B 5I5LA 4JF6A 3IX3A 4GLQA 3GR2A 3LR3A 1ZTUA 3KYQA 3GQZA 4KQRA 2W1TA 5F68A 4S2MA 1D7EA 2XEPA 2PBDP 3FZCA 5GHYA 3QP2A 3K2NA 3M2KA 3LIEA 5AQ9A 4UA9A 1LI9A 2JBFA 1H3QA 1ODVA 2V8FA 1W79A 2NUPC 2W3GA 1KGGA 4WLAA 3A0SA 3CLOA 3WS4A 1LSWA 5HD5A 3CPTA 4LENA 2VJWA 4WZ5A 4S2OA 3S7PA 1FILA 3SH9A 3QP4A 4WF0A 2EX9A 3ZVWA 3G2YA 1XX2A 4KZBA 2GDNA 3E4OA 1GHIA 2C5WB 1LL8A 2ZM0A 3TJZC 4GCZA 4ZRRA 1F5MA 1CJFA 3IF6A 4X25A 3N7WA 2MJ6A 5M19A 1D06A 4Q0JA 2C6WB 2B95A 4E3MA 3M6BA 4GDNA 1HVBA 4OOLA 1XJ2A 2XFTA 5IT5A 2XK1A 2PR6A 1FCOA 3S1YA 3VSKA 4N92A 4R6LA 2V1BA 3HLDA 5TBMA 3BQAA 3CITA 3F1PA 5HDCA 4E3OA 2ZQ7A 1PI4A 4X55A 4KG2A 4CLCC 5CECA 4GN2A 1PRQA 3H82B 2D02A 1XJ3A 3SZTA 5DF7A 3VP2A 2WGIA 1W8QA 5L09A 3C7VA 2J3TC 5AVFA 4EWFA 4KENB 3BRMA 4CLCD 4ARZB 4MDZA 5TFQA 1K0KA 3ZGAB 5F83A 2W3HA 3G30A 2J3TD 3N4IA 5I94A 5F6AA 3LR5A 4X6TA 3IXBA 3BLMA 1LT0A 2HJ9C 3MQ0A 2W3FA 2O9AA 2XSSA 3VFHA 4HESA 2JKRI 3KYEA 4E3JA 3C7UA 2RCXA 4DJ3A 1BLCA 3NECA 1VQQA 1MWUA 5E2HA 5CGWA 4PKYA 3MXSA 4DN0A 3T4JA 3C5AA 3IWIA 4I3AA 3HBRA 1SZVA 2V0WA 5A93A 4KG5A 4WEJA 1FIKA 2Y2KA 4EV4A 2VEAA 2BASA 4E04A 4Y2FA 4Y3IA 2PD8A 1J3WA 4MN7A 1KGEA 4N9KA 1T19A 4I39A 1DJBA 4YNRA 3B42A 5CEDA 1G6OA 4OOMA 1XGJA 1CF0A 1LHYA 4OPQA 2J8YA 4WBGA 1GSXA 4KUOA 1FSYA 1JWPA 4D60A 1CI9A 3T1QB 4LFUA 5FSRA 2XLNA 4BMWA 3E4PA 2ZC5B 5A91A 3MF0A 5CEBA 1VM1A 1K54C 4QJGA 4ZAMA 4ID4A 3C38A 1D1JA 5M1AA 4CLCE 3AGEA 2GNXA 3DTEA 5HL6A 4JKTA 2IA2A 2WKHA 3W4PA 1CEGA 3UY6A 5K5BA 1MWSA 1L2SA 2EFXA 4L9GA 3V3SA 1I2WA 1KGFA 4QB8A 5HZHA 3PBTA 3TRCA 4LRZE 3UO9A 3S7QA 3V5MA 3O87A 3VSLA 3ZNYA 1K25A 5AVEA 4JXSA 3U4LP 1XXMA 1ES4A 2PDRA 3K3CA 3LCEA 1BULA 3LICA 3KO6A 5HFOA 1NZUA 1S4RA 4ZJ2A 2JCHA 2OWJA 2VV8A 1MXOA 4DF6A 5FDHA 5CXWA 4AFIA 4LPZA 1NXYA 1F9IA 1GSVA 2ZM2A 1M6KA 4EXOA 2JN7A 2V0UA 3KSFA 4P6BA 1MBLA 4WELA 1TDGA 4K0XA 4I38A 2X01A 4N1HA 3QP6A 3NDGA 1JTDA 4KQDA 4B88A 2PD7A 4ZTKA 4LGWA 1E25A 4BBUA 5GLBA 2WZZA 3IXDA 3O5YA 4RX3A 2Q9MA 3GRJA 1YMSA 3NBLA 2L0WA 2O0YA 4P85A 2Y2MA 1W7FA 4L0LA 4KZ8A 4E3IA 1OTIA 1IELA 2ZL1A 4WM9A 4NXEA 4UQIM 3MMHA 5G18A 1T1AA 4Q0HA 3G2ZA 3PBSA 2XGNA 1K54A 3HLEA 3FYZA 5FQQA 2Y2QA 2Z6CA 3E2KA 3ICYA 5AJGA 2PYPA 2W0NA 3ZG9B 1FSWA 3TG9A 1NRJA 1BLSA 2H28A 1WYBA 2W27A 3BECA 2WKRA 1DP6A 4BD1A 2HDUA 5HWTA 3ZDJA 1L0GA 1DP9A 4R70A 2Y8HA 5JYOA 4MCWA 2JHEA 4LRXC 1XP4A 4LRYC 3KSIA 1TS6A 3N8LA 4FH2A 3UE0A 5CTNA 4CJNA 3NJAA 3E98A 4DE2A 1XGIA 1G5UA 1G68A 3MZFA 5EM1A 1RGYA 1K6SA 4Y5FA 2HDSA 2WKIA 3LIDA 1T18A 3MFXA 1FR1A 1RP5A 4PAUA 5HDDA 1GHMA 1GCEA 3O86A 1L0FA 1FCMA 3F1OA 2Y91A 4GHIA 3ISGA 1YAXA 3BQ8A 1O7EA 4G3KA 2R9XA 3CI6A 5EVIA 2VK3A 1NWZA 2P9VB 4DRTA 3T1SA 5FDSA 2ZC3B 4LV2A 5E2GA 3VE4A 3ULFA 2QMIA 1ZKJA 2HDQA 3DTIA 2HJEA 3P09A 2EXBA 5KIZA 2CMNA 3NIAA 4QY5A 3HLBA 3T4QA 2YKHA 3VMAA 3H82A 3UB5P 1GA9A 5TGFA 3FPWA 4RQ9A 3NOUC 3Q81A 5CHJA 1KOUA 2JKFA 4OKPA 4MN6A 1ERQA 5CX7A 3ZCZA 3ZG5A 4B4ZA 1K57C 4ARZA 1GHPA 2M7VA 3VV4A 4IUKA 1MY8A 3IBRA 1O07A 4A5RA 3W4OA 2KX6A 5FQMA 4R4SA 1TVFA 3R7WB 4EBLA 5DFYA 3MSHA 4MBKA 2Z6DA 4FUWA 5G4ZA 4DKIA 2EX2A 3NULA 2B02A 5J7EA 3LEQA 3EOIA 5DKKA 3BWLA 2Y2PA 5HPIA 4ME4A 1BYWA 5CGSA 3ZFZA 1YT4A 3ZNTA 4GB7A 3OCLA 2ZD8A 4LLOB 5FQIA 4E3LA 3IX4A 3NOPC 4H6JA 1OTBA 4Y0OA 1XKZA 3HLWA 2Y4AA 1CEFA 1KDWA 2EXAA 2DMWA 2ZM8A 4MLLA 3TW8A 1BUEA 5DVAA 4DJ2A 2I9VA 3ZG0A 2XROA 1L3LA 4C3QA 1W63M 2XF3A 3MS6A 4KZ7A 4HJ3A 4YWZA 4O0PA 4IVIA 2RL3A 3T4SA 2P08A 1X0OA 3OPHA 1P9RA 4FOFA 5EUAA 5EPHA 1F98A 2ZQDA 3MQOA 4GS9B 4KZ3A 4HBTA 1EW0A 5FATA 1L0DA 1YLPA 1YMXA 3CZDA 4BENA 3IWQA 4NXGA 3S22A 4GD8A 2VGLS 3O88A 4R38A 4R4RA 2R78A 4YOFA 2E8IA 1C3BA 1IKIA 4F3LB 2HV1A 4NK3A 4UEYA 2O99A 3E2LA 4H8RA 3MKFA 3SS3A 3GV9A 5CHUA 1F2KA 2VKSA 3VOLA 3HREA 2PHYA 2OV5A 4RVAA 2V20A 1DRMA 2PYRA 4XT2A 1AXBA 1W8YA 1Y28A 1ESUA 3UPOA 2HP6A 2P74A 4EEPA 1IYOA 1KE0A 3IHAA 1SKOB 2G2WA 3OC2A 4UA7A 2ZBBA 1DJCA 2PRFA 1J9MA 1N4OA 3C30A 3HJIA 5FAOA 1IKGA 3W2ZA 3UPPA 4S2LA 3RXWA 3HUMA 4Y7PA 1GSWA 2DNSA 5GL9A 5EM0A 2ZQAA 1K38A 3WS1A 2QHKA 2Y2HA 4QU3A 3ZG8B 3D3OA 5FI6A 3PAEA 1VB6A 1EI5A 2M7UA 2FFFB 4EW7A 3L9KA 4WMCA 3CMZA 4K91A 4P0MA 2Y2JA 3PHYA 4EEUA 2Z2MB 3JPUA 3H7WB 1WE4A 2BG1A 3U2AA 1PW1A 4EESA 3M6HA 3CJMA 1KE4A 2QWSA 4LCMA 2HZ5A 4DXBA 3NHQA 5J8XA 1OJ5A 1HD8A 5E43A 5A92A 4N9LA 3T4KA 1S67L 3VP3A 4K08A 3E0YA 4ZBEA 3NDEA 5C5KA 1OT9A 2Y2LA 2K7SA 1NZOA 4XXRA 4GKUA 4EUZA 3GECA 4IBXA 3G35A 5M18A 2K2NA 1MZUA 2K31A 3G6OA 2M1CA 4PM9A 3RJUA 3UN7A 2AVXA 1H8MA 3HUNA 3R4KA 3PYPA 5L10A 2H10A 3CWFA 5EFWA 4BD0A 4Z9QA 4OPZA 3F1NA 1ZC2A 4FH4A 2Y2GA 1H8YA 3PXPA 2QJ5A 2ZQ9A 1IYQA 3HLCA 1BLPA 3Q7VB 5E2FA 4OQGA 5EE8A 4OOYA 5AQAA 3WS2A 1MPLA 3G31A 3DWKA 3GTCA 3BY9A 3PAGA 4RYEA 4C6YA 2GJ3A 3V67A 3MFDA 3NC8A 4KQOA 4NXBA 1KVLA 3ZYTA 2QPNA 2JKTM 3OBFA 1S6RA 4X56A 2FH5A 2WKEA 5HSQA 3UB8A 3QP8A 3GMWA 2IWCA 3HLFA 4WZ4A 2HPBA 3LIFA 3WS5A 3C4OA 1JNUA 3Q07A 3LI8A 5F1GA 2L1MA 1FQGA 4CLCA 2ZMAA 2V9AA 3FV7A 1S4SA 3PBRA 2JE5A 4EETB 5L07A 3LI9A 1E3UD 1Z6FA 4JF5A 3ZG7B 2PU4A 3PBOA 2HDRA 4NG2A 4YFMA 4Y17A 3QNCA 3CUEC 5HWWA 1TS8A 3C2WA 1PYYA 3DTMA 2XDMA 4HP4A 3K3DA 3MR0A 1CK3A 2FFYA 4Q8IA 3ZVTA 1LSXA 1ALQA 2PU2A 5FQ9A 2Y2OA 3SS4A 2P9VA 4BQMA 1PIOA 3F1PB 5CGXA 3JVVA 1UGUA 2A2LA 1ZHHB 3BFEA 2QYBA 2ZMFA 4MBFA 3RTYA 4EQ1A 1LL5A 2XA7S 2ZJ9A 4Y0TA 3WWXA 4HNBA 1XJ4A 3MXRA 1NJ4A 2B18A 3AGDA 5E2EA 4GW9A 2D01A 4L9EA 5TR7A 2J80A 4MN5A 5EOOA 3SW1A 2GX5A 3QP1A 4UA6A 1H0MA 3FG8A 1Q2PA 4Y15A 4JGRA 3PBNA 3T4TA 4ZJ1A 2INWA 4RA7A 3UB7A 5GHXA 2XH9A 3UDXA 4I3IA 3ZHHA 3I7JA 3DWZA 4LCLA 1RCJA 5TJJA 2WZXA 4GOGA 1PNEA 5HARA 4BJPA 2IWDA 4EQIA 2A3UA 2J9PA 5HD3A 5G4YA 2ZC4B 1CQAA 5EVLA 3OPLA 5MC7A 4X69A 1DJAA 1YLYA 4KZAA 4NEED 3W8KA 1N9NA 4GZBA 3OOVA 2JKTI 4WL9A 1PZOA 4JGPA 4O01A 4OQ0A 1JWZA 4Z1WA 2G7UA 1DY6A 4MEZA 4PM6A 1UWPX 1SHVA 3VE3A 3NI9A 3IS2A 3QHYA 4JGQA 1S1ZA 3LY4A 4OP5A 3TSGA 3M2JA 5F5YA 1NY0A 3JYIA 2P04A 1MWRA 5HDSA 4OQIA 3ITBA 1ONGA 3MQQA 4HP9A 1OMEA 1LI0A 4PHTA 3MZDA 1KDSA 3CUEA 2PT7A 3N8RA 3RXXA 4F3LA 2Z2LB 4S2IA 4WN5A 3PR6A 4G3VA 4RX2A 3UB6A 1IOUA 1OT6A 4ZJ3A 4QPRA 2WKQA 4BLMA 1E4DA 3BY8A 1QMEA 4IJGA 2DRWA 2ZC6B 3HL9A 3CHWP 3UNWA 4MNRA 2CC1A 4PKYG 4HBUA 3ITAA 1A0KA 1IYSA 4E3KA 4O8GA 3T4LA 3VOYA 3O3VA 4JXVA 4BWIA 2VGLM 3DAVA 4GD6A 4KZ4A 3TE8A 1MWTA 3S7NA 2FZ0A 3G34A 3BLSA 1WYCA 1PWDA 4JF4A 5F1FA 2OLVA 4JXWA 2H5SA 2VLGA 3A0RA 3V50A 3H9WA 4EERA 1G6AA 4IVKA 4IHQA 2EFUA 4DDYA 4EBPA 2A24B 1N9LA 3UB9A 3P7NA 3T50A 1ERMA 1YLJA 3QNBA 3Q82A 2Y79A 2J9OA 4S2PA 4BBTA 1K55C 2XR0A 4R23A 4KZ9A 3OLOA 4X53A 3PBQA 3B3XA 3KYZA 4B9OA 4DE1A 5FL3A 4PM5A 2WKPA 1JTGA 2BLSA 3GSGA 2XRNA 4EBNA 1Y4OA 5CRFA 1YKDA 4HH3A 1OPXA 5FA7A 3UMDA 2OWHA 5FASA 1K56D 3HCYA 5FQJA 3IBJA 1Q2QA 5A90A 1YSPA 1CI8A 2KLIA 3Q7VA 4I3JA 2PR5A 2V1AA 3V39A 3IQAA 4LV0A 4S2NC 2HF6A 2NUTC 3BFFA 4OP8A 2X02A 2P7JA 1L0EA 5GHZA 4P87A 5HAPA 4IUHA 2B5RA 4P6ZS 4S2KA 2V1ZA 4GJ4A 4WEKA 1S0WA 2PAVP 3LUQA 3MJQA 2WGWB 2VV6A 2J7VA 3MZEA 3BYDA 1S66L 4BL2A 1Z09A 1OTEA 1TF1A 4JXGA 3S7OA 1BZAA 1U60A 3VOZA 2EWVA 3LY3A 5LBRA 5HAQA 1XJ6A 1RGZA 2WK0A 1N9BA 1GA0A 3A3DA 4QD4A 3DTKA 2WAFA 4Q0IA 1FR6A 4S2JA 1V9YA 5KMWA 4QY6A 1VHMA 2EX6A 4HHDA 2LB5A 2Y2IA 5A8BA 4E6WA 4OONA 5HPFA 4JPMA 3Q1FA 3IHBA 3P01A 4FCFA 3LYXA 5HW3A 4MMNA 2DCFA 5IHVA 4II7A 2PBYA 1KE3A 1JWVA 3VP1A 1VETB 4HY8A 1W63Q 1YPRA 1ES2A 3LGOA 3F1OB 4GHIB 2VV7A 1IYPA 1SKFA 2IWBA 1K57A 2QJ7A 5FQKA 4QHCA 2O9CA 5EVIB 4M3KA 3W4QA 1QMFA 2XFSA 4CQHA 3V3RA 3UPNA 2GZAA 4BBVA 3OPPA 3UE3A 1K55A 3EEAA 2Q9NA 3BEBA 5F82A 1VEUB 3LEZA 3HUOA 1TD5A 3T12B 1K56A 2L4RA 3UMEA 1MC0A 4QWOA 1PI5A 1NRFA 1TDLA 1H5XA 3NCKA 1I5QA 2OAP1 2Y55A 4JLFA 2WAEA 3P98A 5FAPA 1FOFA 1PWCA 1IFQA 2I72A 1PWGA 1YLTA 1PFLA 3LIBA 3SH7A 2VA0A 2VX8A 4OVDA 3PTEA 3Q7ZA 2WGVA 5HX9A 3BJNA 3IH8A 4S2NA 4ESPA 3UE1A 4WUJA 5AQ7A 3N8SA 5FI2A 4EUVA 1ZG6A 1OTDA 4R3BA 1NYYA 2QZ6A 3IT9A 4DE0A 4H6JB 2OLUA 2XD1A 3A3IA 3EGDC 3NOTC 2ZOHA 4HQAA 2VGKA 2X71A 2XA7M 4JBFA 4KQQA 4PPRA 3LR4A 1BLHA 2O9BA 1LL9A 3UDIA 4I5SA 3WRTA 3E4QA 5CTMA 2Q0OA 3WRZA 5FEGA 5FAQA 1MKIA 3IF5A 1EWZA 3GDIA 4KUKA 2W1TB 3T1XA 3EQUA 4K0WA 3VP4A 2VZWA 5GLAA 4XUXA 5EV0A 4DMZA 4OH0A 4IEDA 2Y59A 3L7HA 4PM7A 1S1YA 4KZ6A 3IXHA 4XUZA 2ZQCA 1TS7A 3FKWA 4HIAA 4X68A 3LO7A 3CPTB 3T1RA 4HEFA 1HTZA 4OLDA 3BM6A 1OJGA 3LFVA 1K4FA 4DDSA 5L2FA 5J4EA 4X1LA 3VP0A 1XA7A 2OSUA 1BT5A 5DTTA 4XT2B 3IF6B 4R3AA 3B33A 4KZ5A 3IH9A 4MBHA 1XFQA 3KSGA 2ZOIA 4FSFA 4R3JA 4IBRA 1XPBA 2G2UA 1STZA 1HZOA 3FKVA 1XFNA 2EA9A 4D2OA 1OTAA 4EU0A 1NLZA 2W3EA 2V8CA 3UE6A 4N1XA 5DF8A 5TBMB 1V9ZA 5F69A 1IEMA 3C4PA 4WYYA 4GDBA 3AGFA 5J3WA 4E3NA 3D9YA 4NXFA 3B47A 3JVUA 3N6IA 1NYMA 2UV0E 1YSQA 3UDFA 4C75A 1YLZA 1K4EA 1BTLA 1JVJA 1SDNA 3A3EA 1G28A 1NLYA 3QP5A 1P0ZA 4FD8A 1TEMA 2A24A 5DKLA 3D4FA 3FPVA 5EVIC 5KSCA 1Y54A 3BFCA 3A3FA 1WA9A 3R7WA 4X1MA 5EOEA 2J3WA 5CHMA 4HH2A 4DXCA 3IX8A 4R0QA 5DTSA 1PZPA 5EVID 5FEFA 4L9FA 4NKPA 2EX8A 1HLUP 4F94A 4KG6A 2WUQA 4OLGA 1ESIA 2OOLA 3EQVA 4U0TA 1T1CA 3F1NB 4OQHA 2V2FF 3CG5A 2ZC7A 3SS5A 5BOHA 1BSGA 4UAAA 2HGVA 1ES5A 1T1BA 1ES3A 3OPRA 1PW8A 5HAIA 4G3WA 4PMAA 3OCNA 5DJTA 3S4XA 2Y2NA 1E3UA 3EWKA 2ZLYA 4HJ6A 2R9WA 3LIAA 4FTXA 4UHUA 4GS9A 3BFGA 2XD5A 4Y13A 5KZHA 4PM8A 2W1RA 1YQSA 1I2SA 3G32A 3NY4A 1AWIA 2UWXA 2E8JA 4OPRA 3TOIA 4HI4A 2WGWA 2W3DA 2HP5A 4U3TA 4LV3A 1LLBA 3T4OA 3HVFA 3IWOA 1SDEA 2ZMVA 5U47A 1EROA 1M40A 5L8MA 4B4XA 2YKFA 4CPKA 3BFDA 3RFBA 1YLWA 2EWWA 3G4PA 2HP9A 3WS0A 5DF9A 1ACFA 3ZQ5A 5IS1A 2OAQ1 4CLCB 3HLGA 1P97A 2VGJA 5HWVA 2ZQ8A 5D3OA 4YINA 3KX0X 1SKOA 2WADA 3OZHA 1ZG4A 1N9OA 4P6ZM 1UWNX 2A49A 5DTKA 1KVMA 2BTFP 4B93A 4ZDXA 1VETA 3A0VA 3SOIA 4WZ5C 3LR0A 5JYPA 4U0XA 5EECA 2WYXA 3DW0A 5CERA 5GLDA 3EEHA 3MXQA 3H7WA 3VFFA 1TS0A 3GVBA 3IF6C 4LV1A 3CAXA 5GLCA 4E6XA 1XA1A 4ETZA 1VEUA 3HJKA 3DBAA 1W5DA 1MKMA 4BL3A 1K6RA 2JKGA 1LSVA 3MBZA 4NETA 4UQIS 2LB9A 3MKEA 5AQBA 1P9WA 2XQZA 3D72A 3KSHA 3RH8B 4M4XA 2JC7A 3C8CA 1DP8A 3FC7A 4O7DA 1H8ZA 4R1GA 4JGOA 2H0YA 5DJUA 4WMCD 5HL1A 5EVEA 4Y0UA 3EGXC 4HOIA 5FI7A 3IXGA 3SH8A 4GNUA 4DE3A 2ZL1B 2ACGA 2H0TA 3BW6A 4OPYA 2QKPA 5DFXA 1FCNA 2JKRM 1SCWA
chains in the Genus database with same CATH topology
2Y2OA 3SS4A 4OVDA 3PTEA 1YM1A 2P9VA 5KSHA 3N8LA 3Q7ZA 4FH2A 3A3JA 5CTNA 3UE0A 4BQMA 1PIOA 4CJNA 2WGVA 4DE2A 1ONHA 3FWLA 5HX9A 1XGIA 5CGXA 3IH8A 4S2NA 1G68A 3UE1A 3MZFA 5AQ7A 3N8SA 5FI2A 1RGYA 4JF6A 1K6SA 3BFEA 4MBFA 2HDSA 3GR2A 1LL5A 1ZG6A 2ZJ9A 3GQZA 4Y0TA 3WWXA 2WKIA 4KQRA 1NYYA 2QZ6A 3MXRA 1NJ4A 3IT9A 4R3BA 3AGDA 4DE0A 4S2MA 2OLUA 5E2EA 2XD1A 2XEPA 3A3IA 3FZCA 1FR1A 1RP5A 5GHYA 2VGKA 1GHMA 3M2KA 2X71A 5AQ9A 5TR7A 1GCEA 1LI9A 3O86A 4UA9A 1L0FA 2JBFA 1FCMA 5EOOA 2Y91A 3ISGA 4JBFA 4KQQA 1W79A 4PPRA 1BLHA 1O7EA 1KGGA 2R9XA 1LL9A 5EVIA 3WS4A 4UA6A 3UDIA 1Q2PA 4LENA 2P9VB 3WRTA 4WZ5A 4DRTA 4S2OA 5CTMA 2ZC3B 4LV2A 3PBNA 5E2GA 3SH9A 4ZJ1A 3WRZA 2QMIA 1ZKJA 2EX9A 4RA7A 3ZVWA 2HDQA 2XH9A 3G2YA 5GHXA 1XX2A 3UDXA 3ZHHA 3P09A 2EXBA 3DWZA 2GDNA 3I7JA 4KZBA 4LCLA 1RCJA 1GHIA 1MKIA 5FAQA 2WZXA 3IF5A 2C5WB 4GOGA 3NIAA 5HARA 4BJPA 1EWZA 2ZM0A 4QY5A 3HLBA 2IWDA 3EQUA 4EQIA 4K0WA 2A3UA 3VP4A 3VMAA 2J9PA 1GA9A 5GLAA 5TGFA 3IF6A 4XUXA 2ZC4B 5EVLA 3N7WA 3OPLA 5M19A 3Q81A 4OH0A 4X69A 5CHJA 2C6WB 4E3MA 4IEDA 2Y59A 1DJAA 1YLYA 3M6BA 4GDNA 4KZAA 4PM7A 4KZ6A 1HVBA 3W8KA 3IXHA 4OOLA 4GZBA 4OKPA 1ERQA 4XUZA 3ZCZA 2XFTA 3ZG5A 2ZQCA 4B4ZA 1K57C 1PZOA 2XK1A 3FKWA 4X68A 3LO7A 4HEFA 1FCOA 3S1YA 1GHPA 3VSKA 1HTZA 4OLDA 1MY8A 4OQ0A 4N92A 1O07A 3BM6A 1JWZA 4A5RA 3W4OA 5FQMA 4R4SA 1TVFA 4EBLA 1K4FA 4MBKA 3HLDA 4DDSA 5L2FA 1DY6A 4MEZA 4PM6A 4DKIA 4E3OA 2EX2A 1SHVA 3NI9A 2ZQ7A 2OSUA 1PI4A 1XA7A 4KG2A 4X55A 3VP0A 5CECA 1BT5A 4GN2A 2Y2PA 3QHYA 3LY4A 5CGSA 5DTTA 3ZFZA 1YT4A 4OP5A 3ZNTA 3IF6B 4GB7A 3OCLA 4KZ5A 2ZD8A 3IH9A 5FQIA 4MBHA 3M2JA 3TSGA 4E3LA 5DF7A 1NY0A 2WGIA 1W8QA 3JYIA 3VP2A 3C7VA 4Y0OA 4FSFA 1MWRA 1XKZA 4R3JA 4IBRA 1XPBA 4EWFA 2G2UA 3HLWA 2Y4AA 1CEFA 1KDWA 2EXAA 3BRMA 3ITBA 2ZM8A 4KENB 4OQIA 1ONGA 1HZOA 4MLLA 3FKVA 1BUEA 5TFQA 1OMEA 4D2OA 5DVAA 1LI0A 3ZGAB 5F83A 3MZDA 1KDSA 3ZG0A 4C3QA 4KZ7A 2XF3A 3N8RA 4N1XA 5DF8A 3G30A 3RXXA 4IVIA 3N4IA 2RL3A 5I94A 2Z2LB 4S2IA 4X6TA 3OPHA 3IXBA 4RX2A 5EUAA 4ZJ3A 5EPHA 3BLMA 1IEMA 3C4PA 4WYYA 2ZQDA 4GDBA 3AGFA 4BLMA 4E3NA 1E4DA 1QMEA 2DRWA 4KZ3A 4HBTA 3N6IA 1NYMA 5FATA 1L0DA 1YLPA 1YMXA 2ZC6B 3HL9A 4HESA 3VFHA 3CZDA 4BENA 3UDFA 3UNWA 4C75A 1YLZA 4MNRA 4E3JA 1K4EA 3C7UA 1BTLA 2CC1A 1JVJA 1SDNA 2RCXA 3IWQA 3A3EA 1BLCA 3S22A 1VQQA 1MWUA 5E2HA 4HBUA 5CGWA 3ITAA 4GD8A 4FD8A 1TEMA 3O88A 1IYSA 4E3KA 3MXSA 4R4RA 3VOYA 3C5AA 3IWIA 3O3VA 2E8IA 3D4FA 3HBRA 1C3BA 5EVIC 1IKIA 5KSCA 4JXVA 5A93A 4KG5A 1Y54A 3BFCA 4NK3A 3A3FA 4WEJA 2Y2KA 4EV4A 4GD6A 3E2LA 4H8RA 4KZ4A 1MWTA 5EOEA 3MKFA 3SS3A 5CHMA 3G34A 3BLSA 1WYCA 1PWDA 4JF4A 3GV9A 5CHUA 4DXCA 5F1FA 2OLVA 4R0QA 5DTSA 1PZPA 1KGEA 2H5SA 3HREA 4JXWA 2OV5A 5EVID 2V20A 4N9KA 4RVAA 1AXBA 1W8YA 2EX8A 3V50A 4F94A 1DJBA 4KG6A 2WUQA 1ESUA 4OLGA 1ESIA 3UPOA 2HP6A 5CEDA 2P74A 1IYOA 3EQVA 1KE0A 1XGJA 1LHYA 4OPQA 1G6AA 4OOMA 4U0TA 2J8YA 3IHAA 4WBGA 4IVKA 2G2WA 1FSYA 1JWPA 3OC2A 4UA7A 2EFUA 4DDYA 1DJCA 4OQHA 4EBPA 1J9MA 1CI9A 1N4OA 2V2FF 3CG5A 5FAOA 2ZC7A 5FSRA 2XLNA 3SS5A 1IKGA 1ERMA 1YLJA 3QNBA 3UPPA 3Q82A 4S2LA 5BOHA 1BSGA 3RXWA 3HUMA 2J9OA 4Y7PA 2ZC5B 4UAAA 4S2PA 5A91A 1K55C 2DNSA 5GL9A 2XR0A 1ES5A 2ZQAA 4KZ9A 4R23A 4X53A 1K38A 5CEBA 3PBQA 1VM1A 1ES3A 3OPRA 3B3XA 3WS1A 1K54C 1PW8A 2Y2HA 5HAIA 4PMAA 4QU3A 3ZG8B 4ZAMA 4DE1A 5FI6A 3OCNA 3PAEA 3S4XA 2Y2NA 4QJGA 1EI5A 1E3UA 2FFFB 4ID4A 2ZLYA 4WMCA 2R9WA 3CMZA 4K91A 4PM5A 4P0MA 4UHUA 1JTGA 2BLSA 3BFGA 2Y2JA 2XD5A 5M1AA 3AGEA 2Z2MB 5KZHA 3GSGA 4PM8A 1WE4A 2BG1A 4EBNA 5CRFA 4JKTA 1YQSA 1I2SA 2WKHA 1PW1A 1CEGA 3G32A 3M6HA 3W4PA 3NY4A 3UY6A 2UWXA 3CJMA 4OPRA 1MWSA 1KE4A 1L2SA 3TOIA 2EFXA 4LCMA 5FA7A 4DXBA 5FASA 1K56D 5J8XA 3V3SA 1HD8A 5E43A 5FQJA 5A92A 2WGWA 1I2WA 4N9LA 2HP5A 1Q2QA 1KGFA 3VP3A 5A90A 4ZBEA 4U3TA 1CI8A 4LV3A 4QB8A 3Q7VA 1LLBA 3PBTA 3NDEA 2Y2LA 3UO9A 3HVFA 3IWOA 3V5MA 3O87A 3VSLA 1NZOA 3ZNYA 1K25A 4XXRA 4GKUA 4EUZA 1SDEA 4JXSA 5U47A 4IBXA 1EROA 3G35A 1M40A 5M18A 3V39A 4B4XA 3IQAA 4LV0A 4S2NC 1XXMA 4CPKA 1ES4A 3RJUA 4PM9A 3BFFA 4OP8A 3BFDA 2X02A 1YLWA 3UN7A 3LCEA 3G4PA 1BULA 1L0EA 2HP9A 3WS0A 3HUNA 5DF9A 5HFOA 5GHZA 1NZUA 4P87A 2H10A 5HAPA 2B5RA 4S2KA 2V1ZA 3HLGA 2VGJA 4WEKA 2ZQ8A 4ZJ2A 2JCHA 5D3OA 1S0WA 4BD0A 4YINA 4Z9QA 4OPZA 2WGWB 2J7VA 2WADA 4FH4A 1ZC2A 3MZEA 2Y2GA 1H8YA 1MXOA 3OZHA 5FDHA 3HLCA 2ZQ9A 1IYQA 4DF6A 3BYDA 1ZG4A 1BLPA 4BL2A 5CXWA 3Q7VB 2A49A 1NXYA 5DTKA 2ZM2A 1KVMA 1M6KA 4ZDXA 5E2FA 4OQGA 3SOIA 4WZ5C 5EE8A 4OOYA 5AQAA 3WS2A 1MPLA 4JXGA 1BZAA 1U60A 3G31A 4P6BA 3VOZA 3DWKA 1MBLA 3GTCA 4WELA 4U0XA 3LY3A 5HAQA 5JYPA 1TDGA 5EECA 1RGZA 2WK0A 4K0XA 1N9BA 1GA0A 3A3DA 3PAGA 4QD4A 2X01A 4RYEA 2WYXA 3DW0A 5CERA 2WAFA 1FR6A 5GLDA 4N1HA 4C6YA 4S2JA 5KMWA 4QY6A 3VFFA 3MFDA 3GVBA 3IF6C 3NC8A 1JTDA 3NDGA 2EX6A 4KQOA 4LV1A 4E6XA 1KVLA 5GLCA 4B88A 1XA1A 2Y2IA 2QPNA 4ZTKA 4E6WA 1E25A 4OONA 4JPMA 1S6RA 3Q1FA 3IHBA 5GLBA 2WZZA 3IXDA 4FCFA 1W5DA 5HW3A 4RX3A 2DCFA 4BL3A 5IHVA 4X56A 2Q9MA 1K6RA 3GRJA 2PBYA 1KE3A 1JWVA 2WKEA 3VP1A 1YMSA 3NBLA 3MBZA 4NETA 1ES2A 4P85A 3GMWA 2Y2MA 2IWCA 1IYPA 1SKFA 1W7FA 3HLFA 3MKEA 5AQBA 4L0LA 4KZ8A 1K57A 2XQZA 2IWBA 4E3IA 5FQKA 1IELA 4QHCA 4WZ4A 4WM9A 5EVIB 4M3KA 3W4QA 2HPBA 1QMFA 3WS5A 2XFSA 3C4OA 5G18A 3V3RA 3UPNA 3Q07A 2JC7A 3OPPA 3UE3A 1K55A 5F1GA 2Q9NA 3BEBA 3G2ZA 5F82A 3PBSA 1FQGA 2XGNA 1K54A 3HLEA 3FYZA 2ZMAA 3FV7A 3LEZA 5FQQA 2Y2QA 3HUOA 4O7DA 3PBRA 1K56A 3E2KA 1H8ZA 2JE5A 4R1GA 3ZG9B 2H0YA 1FSWA 1E3UD 1PI5A 1Z6FA 3TG9A 4WMCD 5HL1A 4JF5A 3ZG7B 1NRFA 1BLSA 1TDLA 2PU4A 3PBOA 2HDRA 1WYBA 1H5XA 4YFMA 3BECA 3NCKA 3QNCA 4Y0UA 4BD1A 2HDUA 3ZDJA 1I5QA 5FI7A 3IXGA 3SH8A 2Y55A 4JLFA 1L0GA 4GNUA 2WAEA 4DE3A 1PYYA 3DTMA 2XDMA 3P98A 2H0TA 5FAPA 1FOFA 1PWCA 4OPYA 1CK3A 2FFYA 2I72A 4Q8IA 5JYOA 1PWGA 3ZVTA 1YLTA 1FCNA 1ALQA 1XP4A 2PU2A 5FQ9A 3SH7A 1SCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2O A;  3SS4 A;  4OVD A;  3PTE A;  1YM1 A;  2P9V A;  5KSH A;  3N8L A;  3Q7Z A;  4FH2 A;  3A3J A;  5CTN A;  3UE0 A;  4BQM A;  1PIO A;  4CJN A;  2WGV A;  4DE2 A;  1ONH A;  3FWL A;  5HX9 A;  1XGI A;  5CGX A;  3IH8 A;  4S2N A;  1G68 A;  3UE1 A;  3MZF A;  5AQ7 A;  3N8S A;  5FI2 A;  1RGY A;  4JF6 A;  1K6S A;  3BFE A;  4MBF A;  2HDS A;  3GR2 A;  1LL5 A;  1ZG6 A;  2ZJ9 A;  3GQZ A;  4Y0T A;  3WWX A;  2WKI A;  4KQR A;  1NYY A;  2QZ6 A;  3MXR A;  1NJ4 A;  3IT9 A;  4R3B A;  3AGD A;  4DE0 A;  4S2M A;  2OLU A;  5E2E A;  2XD1 A;  2XEP A;  3A3I A;  3FZC A;  1FR1 A;  1RP5 A;  5GHY A;  2VGK A;  1GHM A;  3M2K A;  2X71 A;  5AQ9 A;  5TR7 A;  1GCE A;  1LI9 A;  3O86 A;  4UA9 A;  1L0F A;  2JBF A;  1FCM A;  5EOO A;  2Y91 A;  3ISG A;  4JBF A;  4KQQ A;  1W79 A;  4PPR A;  1BLH A;  1O7E A;  1KGG A;  2R9X A;  1LL9 A;  5EVI A;  3WS4 A;  4UA6 A;  3UDI A;  1Q2P A;  4LEN A;  2P9V B;  3WRT A;  4WZ5 A;  4DRT A;  4S2O A;  5CTM A;  2ZC3 B;  4LV2 A;  3PBN A;  5E2G A;  3SH9 A;  4ZJ1 A;  3WRZ A;  2QMI A;  1ZKJ A;  2EX9 A;  4RA7 A;  3ZVW A;  2HDQ A;  2XH9 A;  3G2Y A;  5GHX A;  1XX2 A;  3UDX A;  3ZHH A;  3P09 A;  2EXB A;  3DWZ A;  2GDN A;  3I7J A;  4KZB A;  4LCL A;  1RCJ A;  1GHI A;  1MKI A;  5FAQ A;  2WZX A;  3IF5 A;  2C5W B;  4GOG A;  3NIA A;  5HAR A;  4BJP A;  1EWZ A;  2ZM0 A;  4QY5 A;  3HLB A;  2IWD A;  3EQU A;  4EQI A;  4K0W A;  2A3U A;  3VP4 A;  3VMA A;  2J9P A;  1GA9 A;  5GLA A;  5TGF A;  3IF6 A;  4XUX A;  2ZC4 B;  5EVL A;  3N7W A;  3OPL A;  5M19 A;  3Q81 A;  4OH0 A;  4X69 A;  5CHJ A;  2C6W B;  4E3M A;  4IED A;  2Y59 A;  1DJA A;  1YLY A;  3M6B A;  4GDN A;  4KZA A;  4PM7 A;  4KZ6 A;  1HVB A;  3W8K A;  3IXH A;  4OOL A;  4GZB A;  4OKP A;  1ERQ A;  4XUZ A;  3ZCZ A;  2XFT A;  3ZG5 A;  2ZQC A;  4B4Z A;  1K57 C;  1PZO A;  2XK1 A;  3FKW A;  4X68 A;  3LO7 A;  4HEF A;  1FCO A;  3S1Y A;  1GHP A;  3VSK A;  1HTZ A;  4OLD A;  1MY8 A;  4OQ0 A;  4N92 A;  1O07 A;  3BM6 A;  1JWZ A;  4A5R A;  3W4O A;  5FQM A;  4R4S A;  1TVF A;  4EBL A;  1K4F A;  4MBK A;  3HLD A;  4DDS A;  5L2F A;  1DY6 A;  4MEZ A;  4PM6 A;  4DKI A;  4E3O A;  2EX2 A;  1SHV A;  3NI9 A;  2ZQ7 A;  2OSU A;  1PI4 A;  1XA7 A;  4KG2 A;  4X55 A;  3VP0 A;  5CEC A;  1BT5 A;  4GN2 A;  2Y2P A;  3QHY A;  3LY4 A;  5CGS A;  5DTT A;  3ZFZ A;  1YT4 A;  4OP5 A;  3ZNT A;  3IF6 B;  4GB7 A;  3OCL A;  4KZ5 A;  2ZD8 A;  3IH9 A;  5FQI A;  4MBH A;  3M2J A;  3TSG A;  4E3L A;  5DF7 A;  1NY0 A;  2WGI A;  1W8Q A;  3JYI A;  3VP2 A;  3C7V A;  4Y0O A;  4FSF A;  1MWR A;  1XKZ A;  4R3J A;  4IBR A;  1XPB A;  4EWF A;  2G2U A;  3HLW A;  2Y4A A;  1CEF A;  1KDW A;  2EXA A;  3BRM A;  3ITB A;  2ZM8 A;  4KEN B;  4OQI A;  1ONG A;  1HZO A;  4MLL A;  3FKV A;  1BUE A;  5TFQ A;  1OME A;  4D2O A;  5DVA A;  1LI0 A;  3ZGA B;  5F83 A;  3MZD A;  1KDS A;  3ZG0 A;  4C3Q A;  4KZ7 A;  2XF3 A;  3N8R A;  4N1X A;  5DF8 A;  3G30 A;  3RXX A;  4IVI A;  3N4I A;  2RL3 A;  5I94 A;  2Z2L B;  4S2I A;  4X6T A;  3OPH A;  3IXB A;  4RX2 A;  5EUA A;  4ZJ3 A;  5EPH A;  3BLM A;  1IEM A;  3C4P A;  4WYY A;  2ZQD A;  4GDB A;  3AGF A;  4BLM A;  4E3N A;  1E4D A;  1QME A;  2DRW A;  4KZ3 A;  4HBT A;  3N6I A;  1NYM A;  5FAT A;  1L0D A;  1YLP A;  1YMX A;  2ZC6 B;  3HL9 A;  4HES A;  3VFH A;  3CZD A;  4BEN A;  3UDF A;  3UNW A;  4C75 A;  1YLZ A;  4MNR A;  4E3J A;  1K4E A;  3C7U A;  1BTL A;  2CC1 A;  1JVJ A;  1SDN A;  2RCX A;  3IWQ A;  3A3E A;  1BLC A;  3S22 A;  1VQQ A;  1MWU A;  5E2H A;  4HBU A;  5CGW A;  3ITA A;  4GD8 A;  4FD8 A;  1TEM A;  3O88 A;  1IYS A;  4E3K A;  3MXS A;  4R4R A;  3VOY A;  3C5A A;  3IWI A;  3O3V A;  2E8I A;  3D4F A;  3HBR A;  1C3B A;  5EVI C;  1IKI A;  5KSC A;  4JXV A;  5A93 A;  4KG5 A;  1Y54 A;  3BFC A;  4NK3 A;  3A3F A;  4WEJ A;  2Y2K A;  4EV4 A;  4GD6 A;  3E2L A;  4H8R A;  4KZ4 A;  1MWT A;  5EOE A;  3MKF A;  3SS3 A;  5CHM A;  3G34 A;  3BLS A;  1WYC A;  1PWD A;  4JF4 A;  3GV9 A;  5CHU A;  4DXC A;  5F1F A;  2OLV A;  4R0Q A;  5DTS A;  1PZP A;  1KGE A;  2H5S A;  3HRE A;  4JXW A;  2OV5 A;  5EVI D;  2V20 A;  4N9K A;  4RVA A;  1AXB A;  1W8Y A;  2EX8 A;  3V50 A;  4F94 A;  1DJB A;  4KG6 A;  2WUQ A;  1ESU A;  4OLG A;  1ESI A;  3UPO A;  2HP6 A;  5CED A;  2P74 A;  1IYO A;  3EQV A;  1KE0 A;  1XGJ A;  1LHY A;  4OPQ A;  1G6A A;  4OOM A;  4U0T A;  2J8Y A;  3IHA A;  4WBG A;  4IVK A;  2G2W A;  1FSY A;  1JWP A;  3OC2 A;  4UA7 A;  2EFU A;  4DDY A;  1DJC A;  4OQH A;  4EBP A;  1J9M A;  1CI9 A;  1N4O A;  2V2F F;  3CG5 A;  5FAO A;  2ZC7 A;  5FSR A;  2XLN A;  3SS5 A;  1IKG A;  1ERM A;  1YLJ A;  3QNB A;  3UPP A;  3Q82 A;  4S2L A;  5BOH A;  1BSG A;  3RXW A;  3HUM A;  2J9O A;  4Y7P A;  2ZC5 B;  4UAA A;  4S2P A;  5A91 A;  1K55 C;  2DNS A;  5GL9 A;  2XR0 A;  1ES5 A;  2ZQA A;  4KZ9 A;  4R23 A;  4X53 A;  1K38 A;  5CEB A;  3PBQ A;  1VM1 A;  1ES3 A;  3OPR A;  3B3X A;  3WS1 A;  1K54 C;  1PW8 A;  2Y2H A;  5HAI A;  4PMA A;  4QU3 A;  3ZG8 B;  4ZAM A;  4DE1 A;  5FI6 A;  3OCN A;  3PAE A;  3S4X A;  2Y2N A;  4QJG A;  1EI5 A;  1E3U A;  2FFF B;  4ID4 A;  2ZLY A;  4WMC A;  2R9W A;  3CMZ A;  4K91 A;  4PM5 A;  4P0M A;  4UHU A;  1JTG A;  2BLS A;  3BFG A;  2Y2J A;  2XD5 A;  5M1A A;  3AGE A;  2Z2M B;  5KZH A;  3GSG A;  4PM8 A;  1WE4 A;  2BG1 A;  4EBN A;  5CRF A;  4JKT A;  1YQS A;  1I2S A;  2WKH A;  1PW1 A;  1CEG A;  3G32 A;  3M6H A;  3W4P A;  3NY4 A;  3UY6 A;  2UWX A;  3CJM A;  4OPR A;  1MWS A;  1KE4 A;  1L2S A;  3TOI A;  2EFX A;  4LCM A;  5FA7 A;  4DXB A;  5FAS A;  1K56 D;  5J8X A;  3V3S A;  1HD8 A;  5E43 A;  5FQJ A;  5A92 A;  2WGW A;  1I2W A;  4N9L A;  2HP5 A;  1Q2Q A;  1KGF A;  3VP3 A;  5A90 A;  4ZBE A;  4U3T A;  1CI8 A;  4LV3 A;  4QB8 A;  3Q7V A;  1LLB A;  3PBT A;  3NDE A;  2Y2L A;  3UO9 A;  3HVF A;  3IWO A;  3V5M A;  3O87 A;  3VSL A;  1NZO A;  3ZNY A;  1K25 A;  4XXR A;  4GKU A;  4EUZ A;  1SDE A;  4JXS A;  5U47 A;  4IBX A;  1ERO A;  3G35 A;  1M40 A;  5M18 A;  3V39 A;  4B4X A;  3IQA A;  4LV0 A;  4S2N C;  1XXM A;  4CPK A;  1ES4 A;  3RJU A;  4PM9 A;  3BFF A;  4OP8 A;  3BFD A;  2X02 A;  1YLW A;  3UN7 A;  3LCE A;  3G4P A;  1BUL A;  1L0E A;  2HP9 A;  3WS0 A;  3HUN A;  5DF9 A;  5HFO A;  5GHZ A;  1NZU A;  4P87 A;  2H10 A;  5HAP A;  2B5R A;  4S2K A;  2V1Z A;  3HLG A;  2VGJ A;  4WEK A;  2ZQ8 A;  4ZJ2 A;  2JCH A;  5D3O A;  1S0W A;  4BD0 A;  4YIN A;  4Z9Q A;  4OPZ A;  2WGW B;  2J7V A;  2WAD A;  4FH4 A;  1ZC2 A;  3MZE A;  2Y2G A;  1H8Y A;  1MXO A;  3OZH A;  5FDH A;  3HLC A;  2ZQ9 A;  1IYQ A;  4DF6 A;  3BYD A;  1ZG4 A;  1BLP A;  4BL2 A;  5CXW A;  3Q7V B;  2A49 A;  1NXY A;  5DTK A;  2ZM2 A;  1KVM A;  1M6K A;  4ZDX A;  5E2F A;  4OQG A;  3SOI A;  4WZ5 C;  5EE8 A;  4OOY A;  5AQA A;  3WS2 A;  1MPL A;  4JXG A;  1BZA A;  1U60 A;  3G31 A;  4P6B A;  3VOZ A;  3DWK A;  1MBL A;  3GTC A;  4WEL A;  4U0X A;  3LY3 A;  5HAQ A;  5JYP A;  1TDG A;  5EEC A;  1RGZ A;  2WK0 A;  4K0X A;  1N9B A;  1GA0 A;  3A3D A;  3PAG A;  4QD4 A;  2X01 A;  4RYE A;  2WYX A;  3DW0 A;  5CER A;  2WAF A;  1FR6 A;  5GLD A;  4N1H A;  4C6Y A;  4S2J A;  5KMW A;  4QY6 A;  3VFF A;  3MFD A;  3GVB A;  3IF6 C;  3NC8 A;  1JTD A;  3NDG A;  2EX6 A;  4KQO A;  4LV1 A;  4E6X A;  1KVL A;  5GLC A;  4B88 A;  1XA1 A;  2Y2I A;  2QPN A;  4ZTK A;  4E6W A;  1E25 A;  4OON A;  4JPM A;  1S6R A;  3Q1F A;  3IHB A;  5GLB A;  2WZZ A;  3IXD A;  4FCF A;  1W5D A;  5HW3 A;  4RX3 A;  2DCF A;  4BL3 A;  5IHV A;  4X56 A;  2Q9M A;  1K6R A;  3GRJ A;  2PBY A;  1KE3 A;  1JWV A;  2WKE A;  3VP1 A;  1YMS A;  3NBL A;  3MBZ A;  4NET A;  1ES2 A;  4P85 A;  3GMW A;  2Y2M A;  2IWC A;  1IYP A;  1SKF A;  1W7F A;  3HLF A;  3MKE A;  5AQB A;  4L0L A;  4KZ8 A;  1K57 A;  2XQZ A;  2IWB A;  4E3I A;  5FQK A;  1IEL A;  4QHC A;  4WZ4 A;  4WM9 A;  5EVI B;  4M3K A;  3W4Q A;  2HPB A;  1QMF A;  3WS5 A;  2XFS A;  3C4O A;  5G18 A;  3V3R A;  3UPN A;  3Q07 A;  2JC7 A;  3OPP A;  3UE3 A;  1K55 A;  5F1G A;  2Q9N A;  3BEB A;  3G2Z A;  5F82 A;  3PBS A;  1FQG A;  2XGN A;  1K54 A;  3HLE A;  3FYZ A;  2ZMA A;  3FV7 A;  3LEZ A;  5FQQ A;  2Y2Q A;  3HUO A;  4O7D A;  3PBR A;  1K56 A;  3E2K A;  1H8Z A;  2JE5 A;  4R1G A;  3ZG9 B;  2H0Y A;  1FSW A;  1E3U D;  1PI5 A;  1Z6F A;  3TG9 A;  4WMC D;  5HL1 A;  4JF5 A;  3ZG7 B;  1NRF A;  1BLS A;  1TDL A;  2PU4 A;  3PBO A;  2HDR A;  1WYB A;  1H5X A;  4YFM A;  3BEC A;  3NCK A;  3QNC A;  4Y0U A;  4BD1 A;  2HDU A;  3ZDJ A;  1I5Q A;  5FI7 A;  3IXG A;  3SH8 A;  2Y55 A;  4JLF A;  1L0G A;  4GNU A;  2WAE A;  4DE3 A;  1PYY A;  3DTM A;  2XDM A;  3P98 A;  2H0T A;  5FAP A;  1FOF A;  1PWC A;  4OPY A;  1CK3 A;  2FFY A;  2I72 A;  4Q8I A;  5JYO A;  1PWG A;  3ZVT A;  1YLT A;  1FCN A;  1ALQ A;  1XP4 A;  2PU2 A;  5FQ9 A;  3SH7 A;  1SCW A; 
#chains in the Genus database with same CATH topology
 5IU1 A;  2KDK A;  4ETX A;  1YM1 A;  2KOI A;  5KSH A;  3A3J A;  4HJ4 A;  1ONH A;  3FWL A;  3IS2 B;  5I5L A;  4JF6 A;  3IX3 A;  4GLQ A;  3GR2 A;  3LR3 A;  1ZTU A;  3KYQ A;  3GQZ A;  4KQR A;  2W1T A;  5F68 A;  4S2M A;  1D7E A;  2XEP A;  2PBD P;  3FZC A;  5GHY A;  3QP2 A;  3K2N A;  3M2K A;  3LIE A;  5AQ9 A;  4UA9 A;  1LI9 A;  2JBF A;  1H3Q A;  1ODV A;  2V8F A;  1W79 A;  2NUP C;  2W3G A;  1KGG A;  4WLA A;  3A0S A;  3CLO A;  3WS4 A;  1LSW A;  5HD5 A;  3CPT A;  4LEN A;  2VJW A;  4WZ5 A;  4S2O A;  3S7P A;  1FIL A;  3SH9 A;  3QP4 A;  4WF0 A;  2EX9 A;  3ZVW A;  3G2Y A;  1XX2 A;  4KZB A;  2GDN A;  3E4O A;  1GHI A;  2C5W B;  1LL8 A;  2ZM0 A;  3TJZ C;  4GCZ A;  4ZRR A;  1F5M A;  1CJF A;  3IF6 A;  4X25 A;  3N7W A;  2MJ6 A;  5M19 A;  1D06 A;  4Q0J A;  2C6W B;  2B95 A;  4E3M A;  3M6B A;  4GDN A;  1HVB A;  4OOL A;  1XJ2 A;  2XFT A;  5IT5 A;  2XK1 A;  2PR6 A;  1FCO A;  3S1Y A;  3VSK A;  4N92 A;  4R6L A;  2V1B A;  3HLD A;  5TBM A;  3BQA A;  3CIT A;  3F1P A;  5HDC A;  4E3O A;  2ZQ7 A;  1PI4 A;  4X55 A;  4KG2 A;  4CLC C;  5CEC A;  4GN2 A;  1PRQ A;  3H82 B;  2D02 A;  1XJ3 A;  3SZT A;  5DF7 A;  3VP2 A;  2WGI A;  1W8Q A;  5L09 A;  3C7V A;  2J3T C;  5AVF A;  4EWF A;  4KEN B;  3BRM A;  4CLC D;  4ARZ B;  4MDZ A;  5TFQ A;  1K0K A;  3ZGA B;  5F83 A;  2W3H A;  3G30 A;  2J3T D;  3N4I A;  5I94 A;  5F6A A;  3LR5 A;  4X6T A;  3IXB A;  3BLM A;  1LT0 A;  2HJ9 C;  3MQ0 A;  2W3F A;  2O9A A;  2XSS A;  3VFH A;  4HES A;  2JKR I;  3KYE A;  4E3J A;  3C7U A;  2RCX A;  4DJ3 A;  1BLC A;  3NEC A;  1VQQ A;  1MWU A;  5E2H A;  5CGW A;  4PKY A;  3MXS A;  4DN0 A;  3T4J A;  3C5A A;  3IWI A;  4I3A A;  3HBR A;  1SZV A;  2V0W A;  5A93 A;  4KG5 A;  4WEJ A;  1FIK A;  2Y2K A;  4EV4 A;  2VEA A;  2BAS A;  4E04 A;  4Y2F A;  4Y3I A;  2PD8 A;  1J3W A;  4MN7 A;  1KGE A;  4N9K A;  1T19 A;  4I39 A;  1DJB A;  4YNR A;  3B42 A;  5CED A;  1G6O A;  4OOM A;  1XGJ A;  1CF0 A;  1LHY A;  4OPQ A;  2J8Y A;  4WBG A;  1GSX A;  4KUO A;  1FSY A;  1JWP A;  4D60 A;  1CI9 A;  3T1Q B;  4LFU A;  5FSR A;  2XLN A;  4BMW A;  3E4P A;  2ZC5 B;  5A91 A;  3MF0 A;  5CEB A;  1VM1 A;  1K54 C;  4QJG A;  4ZAM A;  4ID4 A;  3C38 A;  1D1J A;  5M1A A;  4CLC E;  3AGE A;  2GNX A;  3DTE A;  5HL6 A;  4JKT A;  2IA2 A;  2WKH A;  3W4P A;  1CEG A;  3UY6 A;  5K5B A;  1MWS A;  1L2S A;  2EFX A;  4L9G A;  3V3S A;  1I2W A;  1KGF A;  4QB8 A;  5HZH A;  3PBT A;  3TRC A;  4LRZ E;  3UO9 A;  3S7Q A;  3V5M A;  3O87 A;  3VSL A;  3ZNY A;  1K25 A;  5AVE A;  4JXS A;  3U4L P;  1XXM A;  1ES4 A;  2PDR A;  3K3C A;  3LCE A;  1BUL A;  3LIC A;  3KO6 A;  5HFO A;  1NZU A;  1S4R A;  4ZJ2 A;  2JCH A;  2OWJ A;  2VV8 A;  1MXO A;  4DF6 A;  5FDH A;  5CXW A;  4AFI A;  4LPZ A;  1NXY A;  1F9I A;  1GSV A;  2ZM2 A;  1M6K A;  4EXO A;  2JN7 A;  2V0U A;  3KSF A;  4P6B A;  1MBL A;  4WEL A;  1TDG A;  4K0X A;  4I38 A;  2X01 A;  4N1H A;  3QP6 A;  3NDG A;  1JTD A;  4KQD A;  4B88 A;  2PD7 A;  4ZTK A;  4LGW A;  1E25 A;  4BBU A;  5GLB A;  2WZZ A;  3IXD A;  3O5Y A;  4RX3 A;  2Q9M A;  3GRJ A;  1YMS A;  3NBL A;  2L0W A;  2O0Y A;  4P85 A;  2Y2M A;  1W7F A;  4L0L A;  4KZ8 A;  4E3I A;  1OTI A;  1IEL A;  2ZL1 A;  4WM9 A;  4NXE A;  4UQI M;  3MMH A;  5G18 A;  1T1A A;  4Q0H A;  3G2Z A;  3PBS A;  2XGN A;  1K54 A;  3HLE A;  3FYZ A;  5FQQ A;  2Y2Q A;  2Z6C A;  3E2K A;  3ICY A;  5AJG A;  2PYP A;  2W0N A;  3ZG9 B;  1FSW A;  3TG9 A;  1NRJ A;  1BLS A;  2H28 A;  1WYB A;  2W27 A;  3BEC A;  2WKR A;  1DP6 A;  4BD1 A;  2HDU A;  5HWT A;  3ZDJ A;  1L0G A;  1DP9 A;  4R70 A;  2Y8H A;  5JYO A;  4MCW A;  2JHE A;  4LRX C;  1XP4 A;  4LRY C;  3KSI A;  1TS6 A;  3N8L A;  4FH2 A;  3UE0 A;  5CTN A;  4CJN A;  3NJA A;  3E98 A;  4DE2 A;  1XGI A;  1G5U A;  1G68 A;  3MZF A;  5EM1 A;  1RGY A;  1K6S A;  4Y5F A;  2HDS A;  2WKI A;  3LID A;  1T18 A;  3MFX A;  1FR1 A;  1RP5 A;  4PAU A;  5HDD A;  1GHM A;  1GCE A;  3O86 A;  1L0F A;  1FCM A;  3F1O A;  2Y91 A;  4GHI A;  3ISG A;  1YAX A;  3BQ8 A;  1O7E A;  4G3K A;  2R9X A;  3CI6 A;  5EVI A;  2VK3 A;  1NWZ A;  2P9V B;  4DRT A;  3T1S A;  5FDS A;  2ZC3 B;  4LV2 A;  5E2G A;  3VE4 A;  3ULF A;  2QMI A;  1ZKJ A;  2HDQ A;  3DTI A;  2HJE A;  3P09 A;  2EXB A;  5KIZ A;  2CMN A;  3NIA A;  4QY5 A;  3HLB A;  3T4Q A;  2YKH A;  3VMA A;  3H82 A;  3UB5 P;  1GA9 A;  5TGF A;  3FPW A;  4RQ9 A;  3NOU C;  3Q81 A;  5CHJ A;  1KOU A;  2JKF A;  4OKP A;  4MN6 A;  1ERQ A;  5CX7 A;  3ZCZ A;  3ZG5 A;  4B4Z A;  1K57 C;  4ARZ A;  1GHP A;  2M7V A;  3VV4 A;  4IUK A;  1MY8 A;  3IBR A;  1O07 A;  4A5R A;  3W4O A;  2KX6 A;  5FQM A;  4R4S A;  1TVF A;  3R7W B;  4EBL A;  5DFY A;  3MSH A;  4MBK A;  2Z6D A;  4FUW A;  5G4Z A;  4DKI A;  2EX2 A;  3NUL A;  2B02 A;  5J7E A;  3LEQ A;  3EOI A;  5DKK A;  3BWL A;  2Y2P A;  5HPI A;  4ME4 A;  1BYW A;  5CGS A;  3ZFZ A;  1YT4 A;  3ZNT A;  4GB7 A;  3OCL A;  2ZD8 A;  4LLO B;  5FQI A;  4E3L A;  3IX4 A;  3NOP C;  4H6J A;  1OTB A;  4Y0O A;  1XKZ A;  3HLW A;  2Y4A A;  1CEF A;  1KDW A;  2EXA A;  2DMW A;  2ZM8 A;  4MLL A;  3TW8 A;  1BUE A;  5DVA A;  4DJ2 A;  2I9V A;  3ZG0 A;  2XRO A;  1L3L A;  4C3Q A;  1W63 M;  2XF3 A;  3MS6 A;  4KZ7 A;  4HJ3 A;  4YWZ A;  4O0P A;  4IVI A;  2RL3 A;  3T4S A;  2P08 A;  1X0O A;  3OPH A;  1P9R A;  4FOF A;  5EUA A;  5EPH A;  1F98 A;  2ZQD A;  3MQO A;  4GS9 B;  4KZ3 A;  4HBT A;  1EW0 A;  5FAT A;  1L0D A;  1YLP A;  1YMX A;  3CZD A;  4BEN A;  3IWQ A;  4NXG A;  3S22 A;  4GD8 A;  2VGL S;  3O88 A;  4R38 A;  4R4R A;  2R78 A;  4YOF A;  2E8I A;  1C3B A;  1IKI A;  4F3L B;  2HV1 A;  4NK3 A;  4UEY A;  2O99 A;  3E2L A;  4H8R A;  3MKF A;  3SS3 A;  3GV9 A;  5CHU A;  1F2K A;  2VKS A;  3VOL A;  3HRE A;  2PHY A;  2OV5 A;  4RVA A;  2V20 A;  1DRM A;  2PYR A;  4XT2 A;  1AXB A;  1W8Y A;  1Y28 A;  1ESU A;  3UPO A;  2HP6 A;  2P74 A;  4EEP A;  1IYO A;  1KE0 A;  3IHA A;  1SKO B;  2G2W A;  3OC2 A;  4UA7 A;  2ZBB A;  1DJC A;  2PRF A;  1J9M A;  1N4O A;  3C30 A;  3HJI A;  5FAO A;  1IKG A;  3W2Z A;  3UPP A;  4S2L A;  3RXW A;  3HUM A;  4Y7P A;  1GSW A;  2DNS A;  5GL9 A;  5EM0 A;  2ZQA A;  1K38 A;  3WS1 A;  2QHK A;  2Y2H A;  4QU3 A;  3ZG8 B;  3D3O A;  5FI6 A;  3PAE A;  1VB6 A;  1EI5 A;  2M7U A;  2FFF B;  4EW7 A;  3L9K A;  4WMC A;  3CMZ A;  4K91 A;  4P0M A;  2Y2J A;  3PHY A;  4EEU A;  2Z2M B;  3JPU A;  3H7W B;  1WE4 A;  2BG1 A;  3U2A A;  1PW1 A;  4EES A;  3M6H A;  3CJM A;  1KE4 A;  2QWS A;  4LCM A;  2HZ5 A;  4DXB A;  3NHQ A;  5J8X A;  1OJ5 A;  1HD8 A;  5E43 A;  5A92 A;  4N9L A;  3T4K A;  1S67 L;  3VP3 A;  4K08 A;  3E0Y A;  4ZBE A;  3NDE A;  5C5K A;  1OT9 A;  2Y2L A;  2K7S A;  1NZO A;  4XXR A;  4GKU A;  4EUZ A;  3GEC A;  4IBX A;  3G35 A;  5M18 A;  2K2N A;  1MZU A;  2K31 A;  3G6O A;  2M1C A;  4PM9 A;  3RJU A;  3UN7 A;  2AVX A;  1H8M A;  3HUN A;  3R4K A;  3PYP A;  5L10 A;  2H10 A;  3CWF A;  5EFW A;  4BD0 A;  4Z9Q A;  4OPZ A;  3F1N A;  1ZC2 A;  4FH4 A;  2Y2G A;  1H8Y A;  3PXP A;  2QJ5 A;  2ZQ9 A;  1IYQ A;  3HLC A;  1BLP A;  3Q7V B;  5E2F A;  4OQG A;  5EE8 A;  4OOY A;  5AQA A;  3WS2 A;  1MPL A;  3G31 A;  3DWK A;  3GTC A;  3BY9 A;  3PAG A;  4RYE A;  4C6Y A;  2GJ3 A;  3V67 A;  3MFD A;  3NC8 A;  4KQO A;  4NXB A;  1KVL A;  3ZYT A;  2QPN A;  2JKT M;  3OBF A;  1S6R A;  4X56 A;  2FH5 A;  2WKE A;  5HSQ A;  3UB8 A;  3QP8 A;  3GMW A;  2IWC A;  3HLF A;  4WZ4 A;  2HPB A;  3LIF A;  3WS5 A;  3C4O A;  1JNU A;  3Q07 A;  3LI8 A;  5F1G A;  2L1M A;  1FQG A;  4CLC A;  2ZMA A;  2V9A A;  3FV7 A;  1S4S A;  3PBR A;  2JE5 A;  4EET B;  5L07 A;  3LI9 A;  1E3U D;  1Z6F A;  4JF5 A;  3ZG7 B;  2PU4 A;  3PBO A;  2HDR A;  4NG2 A;  4YFM A;  4Y17 A;  3QNC A;  3CUE C;  5HWW A;  1TS8 A;  3C2W A;  1PYY A;  3DTM A;  2XDM A;  4HP4 A;  3K3D A;  3MR0 A;  1CK3 A;  2FFY A;  4Q8I A;  3ZVT A;  1LSX A;  1ALQ A;  2PU2 A;  5FQ9 A;  2Y2O A;  3SS4 A;  2P9V A;  4BQM A;  1PIO A;  3F1P B;  5CGX A;  3JVV A;  1UGU A;  2A2L A;  1ZHH B;  3BFE A;  2QYB A;  2ZMF A;  4MBF A;  3RTY A;  4EQ1 A;  1LL5 A;  2XA7 S;  2ZJ9 A;  4Y0T A;  3WWX A;  4HNB A;  1XJ4 A;  3MXR A;  1NJ4 A;  2B18 A;  3AGD A;  5E2E A;  4GW9 A;  2D01 A;  4L9E A;  5TR7 A;  2J80 A;  4MN5 A;  5EOO A;  3SW1 A;  2GX5 A;  3QP1 A;  4UA6 A;  1H0M A;  3FG8 A;  1Q2P A;  4Y15 A;  4JGR A;  3PBN A;  3T4T A;  4ZJ1 A;  2INW A;  4RA7 A;  3UB7 A;  5GHX A;  2XH9 A;  3UDX A;  4I3I A;  3ZHH A;  3I7J A;  3DWZ A;  4LCL A;  1RCJ A;  5TJJ A;  2WZX A;  4GOG A;  1PNE A;  5HAR A;  4BJP A;  2IWD A;  4EQI A;  2A3U A;  2J9P A;  5HD3 A;  5G4Y A;  2ZC4 B;  1CQA A;  5EVL A;  3OPL A;  5MC7 A;  4X69 A;  1DJA A;  1YLY A;  4KZA A;  4NEE D;  3W8K A;  1N9N A;  4GZB A;  3OOV A;  2JKT I;  4WL9 A;  1PZO A;  4JGP A;  4O01 A;  4OQ0 A;  1JWZ A;  4Z1W A;  2G7U A;  1DY6 A;  4MEZ A;  4PM6 A;  1UWP X;  1SHV A;  3VE3 A;  3NI9 A;  3IS2 A;  3QHY A;  4JGQ A;  1S1Z A;  3LY4 A;  4OP5 A;  3TSG A;  3M2J A;  5F5Y A;  1NY0 A;  3JYI A;  2P04 A;  1MWR A;  5HDS A;  4OQI A;  3ITB A;  1ONG A;  3MQQ A;  4HP9 A;  1OME A;  1LI0 A;  4PHT A;  3MZD A;  1KDS A;  3CUE A;  2PT7 A;  3N8R A;  3RXX A;  4F3L A;  2Z2L B;  4S2I A;  4WN5 A;  3PR6 A;  4G3V A;  4RX2 A;  3UB6 A;  1IOU A;  1OT6 A;  4ZJ3 A;  4QPR A;  2WKQ A;  4BLM A;  1E4D A;  3BY8 A;  1QME A;  4IJG A;  2DRW A;  2ZC6 B;  3HL9 A;  3CHW P;  3UNW A;  4MNR A;  2CC1 A;  4PKY G;  4HBU A;  3ITA A;  1A0K A;  1IYS A;  4E3K A;  4O8G A;  3T4L A;  3VOY A;  3O3V A;  4JXV A;  4BWI A;  2VGL M;  3DAV A;  4GD6 A;  4KZ4 A;  3TE8 A;  1MWT A;  3S7N A;  2FZ0 A;  3G34 A;  3BLS A;  1WYC A;  1PWD A;  4JF4 A;  5F1F A;  2OLV A;  4JXW A;  2H5S A;  2VLG A;  3A0R A;  3V50 A;  3H9W A;  4EER A;  1G6A A;  4IVK A;  4IHQ A;  2EFU A;  4DDY A;  4EBP A;  2A24 B;  1N9L A;  3UB9 A;  3P7N A;  3T50 A;  1ERM A;  1YLJ A;  3QNB A;  3Q82 A;  2Y79 A;  2J9O A;  4S2P A;  4BBT A;  1K55 C;  2XR0 A;  4R23 A;  4KZ9 A;  3OLO A;  4X53 A;  3PBQ A;  3B3X A;  3KYZ A;  4B9O A;  4DE1 A;  5FL3 A;  4PM5 A;  2WKP A;  1JTG A;  2BLS A;  3GSG A;  2XRN A;  4EBN A;  1Y4O A;  5CRF A;  1YKD A;  4HH3 A;  1OPX A;  5FA7 A;  3UMD A;  2OWH A;  5FAS A;  1K56 D;  3HCY A;  5FQJ A;  3IBJ A;  1Q2Q A;  5A90 A;  1YSP A;  1CI8 A;  2KLI A;  3Q7V A;  4I3J A;  2PR5 A;  2V1A A;  3V39 A;  3IQA A;  4LV0 A;  4S2N C;  2HF6 A;  2NUT C;  3BFF A;  4OP8 A;  2X02 A;  2P7J A;  1L0E A;  5GHZ A;  4P87 A;  5HAP A;  4IUH A;  2B5R A;  4P6Z S;  4S2K A;  2V1Z A;  4GJ4 A;  4WEK A;  1S0W A;  2PAV P;  3LUQ A;  3MJQ A;  2WGW B;  2VV6 A;  2J7V A;  3MZE A;  3BYD A;  1S66 L;  4BL2 A;  1Z09 A;  1OTE A;  1TF1 A;  4JXG A;  3S7O A;  1BZA A;  1U60 A;  3VOZ A;  2EWV A;  3LY3 A;  5LBR A;  5HAQ A;  1XJ6 A;  1RGZ A;  2WK0 A;  1N9B A;  1GA0 A;  3A3D A;  4QD4 A;  3DTK A;  2WAF A;  4Q0I A;  1FR6 A;  4S2J A;  1V9Y A;  5KMW A;  4QY6 A;  1VHM A;  2EX6 A;  4HHD A;  2LB5 A;  2Y2I A;  5A8B A;  4E6W A;  4OON A;  5HPF A;  4JPM A;  3Q1F A;  3IHB A;  3P01 A;  4FCF A;  3LYX A;  5HW3 A;  4MMN A;  2DCF A;  5IHV A;  4II7 A;  2PBY A;  1KE3 A;  1JWV A;  3VP1 A;  1VET B;  4HY8 A;  1W63 Q;  1YPR A;  1ES2 A;  3LGO A;  3F1O B;  4GHI B;  2VV7 A;  1IYP A;  1SKF A;  2IWB A;  1K57 A;  2QJ7 A;  5FQK A;  4QHC A;  2O9C A;  5EVI B;  4M3K A;  3W4Q A;  1QMF A;  2XFS A;  4CQH A;  3V3R A;  3UPN A;  2GZA A;  4BBV A;  3OPP A;  3UE3 A;  1K55 A;  3EEA A;  2Q9N A;  3BEB A;  5F82 A;  1VEU B;  3LEZ A;  3HUO A;  1TD5 A;  3T12 B;  1K56 A;  2L4R A;  3UME A;  1MC0 A;  4QWO A;  1PI5 A;  1NRF A;  1TDL A;  1H5X A;  3NCK A;  1I5Q A;  2OAP 1;  2Y55 A;  4JLF A;  2WAE A;  3P98 A;  5FAP A;  1FOF A;  1PWC A;  1IFQ A;  2I72 A;  1PWG A;  1YLT A;  1PFL A;  3LIB A;  3SH7 A;  2VA0 A;  2VX8 A;  4OVD A;  3PTE A;  3Q7Z A;  2WGV A;  5HX9 A;  3BJN A;  3IH8 A;  4S2N A;  4ESP A;  3UE1 A;  4WUJ A;  5AQ7 A;  3N8S A;  5FI2 A;  4EUV A;  1ZG6 A;  1OTD A;  4R3B A;  1NYY A;  2QZ6 A;  3IT9 A;  4DE0 A;  4H6J B;  2OLU A;  2XD1 A;  3A3I A;  3EGD C;  3NOT C;  2ZOH A;  4HQA A;  2VGK A;  2X71 A;  2XA7 M;  4JBF A;  4KQQ A;  4PPR A;  3LR4 A;  1BLH A;  2O9B A;  1LL9 A;  3UDI A;  4I5S A;  3WRT A;  3E4Q A;  5CTM A;  2Q0O A;  3WRZ A;  5FEG A;  5FAQ A;  1MKI A;  3IF5 A;  1EWZ A;  3GDI A;  4KUK A;  2W1T B;  3T1X A;  3EQU A;  4K0W A;  3VP4 A;  2VZW A;  5GLA A;  4XUX A;  5EV0 A;  4DMZ A;  4OH0 A;  4IED A;  2Y59 A;  3L7H A;  4PM7 A;  1S1Y A;  4KZ6 A;  3IXH A;  4XUZ A;  2ZQC A;  1TS7 A;  3FKW A;  4HIA A;  4X68 A;  3LO7 A;  3CPT B;  3T1R A;  4HEF A;  1HTZ A;  4OLD A;  3BM6 A;  1OJG A;  3LFV A;  1K4F A;  4DDS A;  5L2F A;  5J4E A;  4X1L A;  3VP0 A;  1XA7 A;  2OSU A;  1BT5 A;  5DTT A;  4XT2 B;  3IF6 B;  4R3A A;  3B33 A;  4KZ5 A;  3IH9 A;  4MBH A;  1XFQ A;  3KSG A;  2ZOI A;  4FSF A;  4R3J A;  4IBR A;  1XPB A;  2G2U A;  1STZ A;  1HZO A;  3FKV A;  1XFN A;  2EA9 A;  4D2O A;  1OTA A;  4EU0 A;  1NLZ A;  2W3E A;  2V8C A;  3UE6 A;  4N1X A;  5DF8 A;  5TBM B;  1V9Z A;  5F69 A;  1IEM A;  3C4P A;  4WYY A;  4GDB A;  3AGF A;  5J3W A;  4E3N A;  3D9Y A;  4NXF A;  3B47 A;  3JVU A;  3N6I A;  1NYM A;  2UV0 E;  1YSQ A;  3UDF A;  4C75 A;  1YLZ A;  1K4E A;  1BTL A;  1JVJ A;  1SDN A;  3A3E A;  1G28 A;  1NLY A;  3QP5 A;  1P0Z A;  4FD8 A;  1TEM A;  2A24 A;  5DKL A;  3D4F A;  3FPV A;  5EVI C;  5KSC A;  1Y54 A;  3BFC A;  3A3F A;  1WA9 A;  3R7W A;  4X1M A;  5EOE A;  2J3W A;  5CHM A;  4HH2 A;  4DXC A;  3IX8 A;  4R0Q A;  5DTS A;  1PZP A;  5EVI D;  5FEF A;  4L9F A;  4NKP A;  2EX8 A;  1HLU P;  4F94 A;  4KG6 A;  2WUQ A;  4OLG A;  1ESI A;  2OOL A;  3EQV A;  4U0T A;  1T1C A;  3F1N B;  4OQH A;  2V2F F;  3CG5 A;  2ZC7 A;  3SS5 A;  5BOH A;  1BSG A;  4UAA A;  2HGV A;  1ES5 A;  1T1B A;  1ES3 A;  3OPR A;  1PW8 A;  5HAI A;  4G3W A;  4PMA A;  3OCN A;  5DJT A;  3S4X A;  2Y2N A;  1E3U A;  3EWK A;  2ZLY A;  4HJ6 A;  2R9W A;  3LIA A;  4FTX A;  4UHU A;  4GS9 A;  3BFG A;  2XD5 A;  4Y13 A;  5KZH A;  4PM8 A;  2W1R A;  1YQS A;  1I2S A;  3G32 A;  3NY4 A;  1AWI A;  2UWX A;  2E8J A;  4OPR A;  3TOI A;  4HI4 A;  2WGW A;  2W3D A;  2HP5 A;  4U3T A;  4LV3 A;  1LLB A;  3T4O A;  3HVF A;  3IWO A;  1SDE A;  2ZMV A;  5U47 A;  1ERO A;  1M40 A;  5L8M A;  4B4X A;  2YKF A;  4CPK A;  3BFD A;  3RFB A;  1YLW A;  2EWW A;  3G4P A;  2HP9 A;  3WS0 A;  5DF9 A;  1ACF A;  3ZQ5 A;  5IS1 A;  2OAQ 1;  4CLC B;  3HLG A;  1P97 A;  2VGJ A;  5HWV A;  2ZQ8 A;  5D3O A;  4YIN A;  3KX0 X;  1SKO A;  2WAD A;  3OZH A;  1ZG4 A;  1N9O A;  4P6Z M;  1UWN X;  2A49 A;  5DTK A;  1KVM A;  2BTF P;  4B93 A;  4ZDX A;  1VET A;  3A0V A;  3SOI A;  4WZ5 C;  3LR0 A;  5JYP A;  4U0X A;  5EEC A;  2WYX A;  3DW0 A;  5CER A;  5GLD A;  3EEH A;  3MXQ A;  3H7W A;  3VFF A;  1TS0 A;  3GVB A;  3IF6 C;  4LV1 A;  3CAX A;  5GLC A;  4E6X A;  1XA1 A;  4ETZ A;  1VEU A;  3HJK A;  3DBA A;  1W5D A;  1MKM A;  4BL3 A;  1K6R A;  2JKG A;  1LSV A;  3MBZ A;  4NET A;  4UQI S;  2LB9 A;  3MKE A;  5AQB A;  1P9W A;  2XQZ A;  3D72 A;  3KSH A;  3RH8 B;  4M4X A;  2JC7 A;  3C8C A;  1DP8 A;  3FC7 A;  4O7D A;  1H8Z A;  4R1G A;  4JGO A;  2H0Y A;  5DJU A;  4WMC D;  5HL1 A;  5EVE A;  4Y0U A;  3EGX C;  4HOI A;  5FI7 A;  3IXG A;  3SH8 A;  4GNU A;  4DE3 A;  2ZL1 B;  2ACG A;  2H0T A;  3BW6 A;  4OPY A;  2QKP A;  5DFX A;  1FCN A;  2JKR M;  1SCW A; 
#chains in the Genus database with same CATH homology
 2Y2O A;  3SS4 A;  4OVD A;  3PTE A;  1YM1 A;  2P9V A;  5KSH A;  3N8L A;  3Q7Z A;  4FH2 A;  3A3J A;  5CTN A;  3UE0 A;  4BQM A;  1PIO A;  4CJN A;  2WGV A;  4DE2 A;  1ONH A;  3FWL A;  5HX9 A;  1XGI A;  5CGX A;  3IH8 A;  4S2N A;  1G68 A;  3UE1 A;  3MZF A;  5AQ7 A;  3N8S A;  5FI2 A;  1RGY A;  4JF6 A;  1K6S A;  3BFE A;  4MBF A;  2HDS A;  3GR2 A;  1LL5 A;  1ZG6 A;  2ZJ9 A;  3GQZ A;  4Y0T A;  3WWX A;  2WKI A;  4KQR A;  1NYY A;  2QZ6 A;  3MXR A;  1NJ4 A;  3IT9 A;  4R3B A;  3AGD A;  4DE0 A;  4S2M A;  2OLU A;  5E2E A;  2XD1 A;  2XEP A;  3A3I A;  3FZC A;  1FR1 A;  1RP5 A;  5GHY A;  2VGK A;  1GHM A;  3M2K A;  2X71 A;  5AQ9 A;  5TR7 A;  1GCE A;  1LI9 A;  3O86 A;  4UA9 A;  1L0F A;  2JBF A;  1FCM A;  5EOO A;  2Y91 A;  3ISG A;  4JBF A;  4KQQ A;  1W79 A;  4PPR A;  1BLH A;  1O7E A;  1KGG A;  2R9X A;  1LL9 A;  5EVI A;  3WS4 A;  4UA6 A;  3UDI A;  1Q2P A;  4LEN A;  2P9V B;  3WRT A;  4WZ5 A;  4DRT A;  4S2O A;  5CTM A;  2ZC3 B;  4LV2 A;  3PBN A;  5E2G A;  3SH9 A;  4ZJ1 A;  3WRZ A;  2QMI A;  1ZKJ A;  2EX9 A;  4RA7 A;  3ZVW A;  2HDQ A;  2XH9 A;  3G2Y A;  5GHX A;  1XX2 A;  3UDX A;  3ZHH A;  3P09 A;  2EXB A;  3DWZ A;  2GDN A;  3I7J A;  4KZB A;  4LCL A;  1RCJ A;  1GHI A;  1MKI A;  5FAQ A;  2WZX A;  3IF5 A;  2C5W B;  4GOG A;  3NIA A;  5HAR A;  4BJP A;  1EWZ A;  2ZM0 A;  4QY5 A;  3HLB A;  2IWD A;  3EQU A;  4EQI A;  4K0W A;  2A3U A;  3VP4 A;  3VMA A;  2J9P A;  1GA9 A;  5GLA A;  5TGF A;  3IF6 A;  4XUX A;  2ZC4 B;  5EVL A;  3N7W A;  3OPL A;  5M19 A;  3Q81 A;  4OH0 A;  4X69 A;  5CHJ A;  2C6W B;  4E3M A;  4IED A;  2Y59 A;  1DJA A;  1YLY A;  3M6B A;  4GDN A;  4KZA A;  4PM7 A;  4KZ6 A;  1HVB A;  3W8K A;  3IXH A;  4OOL A;  4GZB A;  4OKP A;  1ERQ A;  4XUZ A;  3ZCZ A;  2XFT A;  3ZG5 A;  2ZQC A;  4B4Z A;  1K57 C;  1PZO A;  2XK1 A;  3FKW A;  4X68 A;  3LO7 A;  4HEF A;  1FCO A;  3S1Y A;  1GHP A;  3VSK A;  1HTZ A;  4OLD A;  1MY8 A;  4OQ0 A;  4N92 A;  1O07 A;  3BM6 A;  1JWZ A;  4A5R A;  3W4O A;  5FQM A;  4R4S A;  1TVF A;  4EBL A;  1K4F A;  4MBK A;  3HLD A;  4DDS A;  5L2F A;  1DY6 A;  4MEZ A;  4PM6 A;  4DKI A;  4E3O A;  2EX2 A;  1SHV A;  3NI9 A;  2ZQ7 A;  2OSU A;  1PI4 A;  1XA7 A;  4KG2 A;  4X55 A;  3VP0 A;  5CEC A;  1BT5 A;  4GN2 A;  2Y2P A;  3QHY A;  3LY4 A;  5CGS A;  5DTT A;  3ZFZ A;  1YT4 A;  4OP5 A;  3ZNT A;  3IF6 B;  4GB7 A;  3OCL A;  4KZ5 A;  2ZD8 A;  3IH9 A;  5FQI A;  4MBH A;  3M2J A;  3TSG A;  4E3L A;  5DF7 A;  1NY0 A;  2WGI A;  1W8Q A;  3JYI A;  3VP2 A;  3C7V A;  4Y0O A;  4FSF A;  1MWR A;  1XKZ A;  4R3J A;  4IBR A;  1XPB A;  4EWF A;  2G2U A;  3HLW A;  2Y4A A;  1CEF A;  1KDW A;  2EXA A;  3BRM A;  3ITB A;  2ZM8 A;  4KEN B;  4OQI A;  1ONG A;  1HZO A;  4MLL A;  3FKV A;  1BUE A;  5TFQ A;  1OME A;  4D2O A;  5DVA A;  1LI0 A;  3ZGA B;  5F83 A;  3MZD A;  1KDS A;  3ZG0 A;  4C3Q A;  4KZ7 A;  2XF3 A;  3N8R A;  4N1X A;  5DF8 A;  3G30 A;  3RXX A;  4IVI A;  3N4I A;  2RL3 A;  5I94 A;  2Z2L B;  4S2I A;  4X6T A;  3OPH A;  3IXB A;  4RX2 A;  5EUA A;  4ZJ3 A;  5EPH A;  3BLM A;  1IEM A;  3C4P A;  4WYY A;  2ZQD A;  4GDB A;  3AGF A;  4BLM A;  4E3N A;  1E4D A;  1QME A;  2DRW A;  4KZ3 A;  4HBT A;  3N6I A;  1NYM A;  5FAT A;  1L0D A;  1YLP A;  1YMX A;  2ZC6 B;  3HL9 A;  4HES A;  3VFH A;  3CZD A;  4BEN A;  3UDF A;  3UNW A;  4C75 A;  1YLZ A;  4MNR A;  4E3J A;  1K4E A;  3C7U A;  1BTL A;  2CC1 A;  1JVJ A;  1SDN A;  2RCX A;  3IWQ A;  3A3E A;  1BLC A;  3S22 A;  1VQQ A;  1MWU A;  5E2H A;  4HBU A;  5CGW A;  3ITA A;  4GD8 A;  4FD8 A;  1TEM A;  3O88 A;  1IYS A;  4E3K A;  3MXS A;  4R4R A;  3VOY A;  3C5A A;  3IWI A;  3O3V A;  2E8I A;  3D4F A;  3HBR A;  1C3B A;  5EVI C;  1IKI A;  5KSC A;  4JXV A;  5A93 A;  4KG5 A;  1Y54 A;  3BFC A;  4NK3 A;  3A3F A;  4WEJ A;  2Y2K A;  4EV4 A;  4GD6 A;  3E2L A;  4H8R A;  4KZ4 A;  1MWT A;  5EOE A;  3MKF A;  3SS3 A;  5CHM A;  3G34 A;  3BLS A;  1WYC A;  1PWD A;  4JF4 A;  3GV9 A;  5CHU A;  4DXC A;  5F1F A;  2OLV A;  4R0Q A;  5DTS A;  1PZP A;  1KGE A;  2H5S A;  3HRE A;  4JXW A;  2OV5 A;  5EVI D;  2V20 A;  4N9K A;  4RVA A;  1AXB A;  1W8Y A;  2EX8 A;  3V50 A;  4F94 A;  1DJB A;  4KG6 A;  2WUQ A;  1ESU A;  4OLG A;  1ESI A;  3UPO A;  2HP6 A;  5CED A;  2P74 A;  1IYO A;  3EQV A;  1KE0 A;  1XGJ A;  1LHY A;  4OPQ A;  1G6A A;  4OOM A;  4U0T A;  2J8Y A;  3IHA A;  4WBG A;  4IVK A;  2G2W A;  1FSY A;  1JWP A;  3OC2 A;  4UA7 A;  2EFU A;  4DDY A;  1DJC A;  4OQH A;  4EBP A;  1J9M A;  1CI9 A;  1N4O A;  2V2F F;  3CG5 A;  5FAO A;  2ZC7 A;  5FSR A;  2XLN A;  3SS5 A;  1IKG A;  1ERM A;  1YLJ A;  3QNB A;  3UPP A;  3Q82 A;  4S2L A;  5BOH A;  1BSG A;  3RXW A;  3HUM A;  2J9O A;  4Y7P A;  2ZC5 B;  4UAA A;  4S2P A;  5A91 A;  1K55 C;  2DNS A;  5GL9 A;  2XR0 A;  1ES5 A;  2ZQA A;  4KZ9 A;  4R23 A;  4X53 A;  1K38 A;  5CEB A;  3PBQ A;  1VM1 A;  1ES3 A;  3OPR A;  3B3X A;  3WS1 A;  1K54 C;  1PW8 A;  2Y2H A;  5HAI A;  4PMA A;  4QU3 A;  3ZG8 B;  4ZAM A;  4DE1 A;  5FI6 A;  3OCN A;  3PAE A;  3S4X A;  2Y2N A;  4QJG A;  1EI5 A;  1E3U A;  2FFF B;  4ID4 A;  2ZLY A;  4WMC A;  2R9W A;  3CMZ A;  4K91 A;  4PM5 A;  4P0M A;  4UHU A;  1JTG A;  2BLS A;  3BFG A;  2Y2J A;  2XD5 A;  5M1A A;  3AGE A;  2Z2M B;  5KZH A;  3GSG A;  4PM8 A;  1WE4 A;  2BG1 A;  4EBN A;  5CRF A;  4JKT A;  1YQS A;  1I2S A;  2WKH A;  1PW1 A;  1CEG A;  3G32 A;  3M6H A;  3W4P A;  3NY4 A;  3UY6 A;  2UWX A;  3CJM A;  4OPR A;  1MWS A;  1KE4 A;  1L2S A;  3TOI A;  2EFX A;  4LCM A;  5FA7 A;  4DXB A;  5FAS A;  1K56 D;  5J8X A;  3V3S A;  1HD8 A;  5E43 A;  5FQJ A;  5A92 A;  2WGW A;  1I2W A;  4N9L A;  2HP5 A;  1Q2Q A;  1KGF A;  3VP3 A;  5A90 A;  4ZBE A;  4U3T A;  1CI8 A;  4LV3 A;  4QB8 A;  3Q7V A;  1LLB A;  3PBT A;  3NDE A;  2Y2L A;  3UO9 A;  3HVF A;  3IWO A;  3V5M A;  3O87 A;  3VSL A;  1NZO A;  3ZNY A;  1K25 A;  4XXR A;  4GKU A;  4EUZ A;  1SDE A;  4JXS A;  5U47 A;  4IBX A;  1ERO A;  3G35 A;  1M40 A;  5M18 A;  3V39 A;  4B4X A;  3IQA A;  4LV0 A;  4S2N C;  1XXM A;  4CPK A;  1ES4 A;  3RJU A;  4PM9 A;  3BFF A;  4OP8 A;  3BFD A;  2X02 A;  1YLW A;  3UN7 A;  3LCE A;  3G4P A;  1BUL A;  1L0E A;  2HP9 A;  3WS0 A;  3HUN A;  5DF9 A;  5HFO A;  5GHZ A;  1NZU A;  4P87 A;  2H10 A;  5HAP A;  2B5R A;  4S2K A;  2V1Z A;  3HLG A;  2VGJ A;  4WEK A;  2ZQ8 A;  4ZJ2 A;  2JCH A;  5D3O A;  1S0W A;  4BD0 A;  4YIN A;  4Z9Q A;  4OPZ A;  2WGW B;  2J7V A;  2WAD A;  4FH4 A;  1ZC2 A;  3MZE A;  2Y2G A;  1H8Y A;  1MXO A;  3OZH A;  5FDH A;  3HLC A;  2ZQ9 A;  1IYQ A;  4DF6 A;  3BYD A;  1ZG4 A;  1BLP A;  4BL2 A;  5CXW A;  3Q7V B;  2A49 A;  1NXY A;  5DTK A;  2ZM2 A;  1KVM A;  1M6K A;  4ZDX A;  5E2F A;  4OQG A;  3SOI A;  4WZ5 C;  5EE8 A;  4OOY A;  5AQA A;  3WS2 A;  1MPL A;  4JXG A;  1BZA A;  1U60 A;  3G31 A;  4P6B A;  3VOZ A;  3DWK A;  1MBL A;  3GTC A;  4WEL A;  4U0X A;  3LY3 A;  5HAQ A;  5JYP A;  1TDG A;  5EEC A;  1RGZ A;  2WK0 A;  4K0X A;  1N9B A;  1GA0 A;  3A3D A;  3PAG A;  4QD4 A;  2X01 A;  4RYE A;  2WYX A;  3DW0 A;  5CER A;  2WAF A;  1FR6 A;  5GLD A;  4N1H A;  4C6Y A;  4S2J A;  5KMW A;  4QY6 A;  3VFF A;  3MFD A;  3GVB A;  3IF6 C;  3NC8 A;  1JTD A;  3NDG A;  2EX6 A;  4KQO A;  4LV1 A;  4E6X A;  1KVL A;  5GLC A;  4B88 A;  1XA1 A;  2Y2I A;  2QPN A;  4ZTK A;  4E6W A;  1E25 A;  4OON A;  4JPM A;  1S6R A;  3Q1F A;  3IHB A;  5GLB A;  2WZZ A;  3IXD A;  4FCF A;  1W5D A;  5HW3 A;  4RX3 A;  2DCF A;  4BL3 A;  5IHV A;  4X56 A;  2Q9M A;  1K6R A;  3GRJ A;  2PBY A;  1KE3 A;  1JWV A;  2WKE A;  3VP1 A;  1YMS A;  3NBL A;  3MBZ A;  4NET A;  1ES2 A;  4P85 A;  3GMW A;  2Y2M A;  2IWC A;  1IYP A;  1SKF A;  1W7F A;  3HLF A;  3MKE A;  5AQB A;  4L0L A;  4KZ8 A;  1K57 A;  2XQZ A;  2IWB A;  4E3I A;  5FQK A;  1IEL A;  4QHC A;  4WZ4 A;  4WM9 A;  5EVI B;  4M3K A;  3W4Q A;  2HPB A;  1QMF A;  3WS5 A;  2XFS A;  3C4O A;  5G18 A;  3V3R A;  3UPN A;  3Q07 A;  2JC7 A;  3OPP A;  3UE3 A;  1K55 A;  5F1G A;  2Q9N A;  3BEB A;  3G2Z A;  5F82 A;  3PBS A;  1FQG A;  2XGN A;  1K54 A;  3HLE A;  3FYZ A;  2ZMA A;  3FV7 A;  3LEZ A;  5FQQ A;  2Y2Q A;  3HUO A;  4O7D A;  3PBR A;  1K56 A;  3E2K A;  1H8Z A;  2JE5 A;  4R1G A;  3ZG9 B;  2H0Y A;  1FSW A;  1E3U D;  1PI5 A;  1Z6F A;  3TG9 A;  4WMC D;  5HL1 A;  4JF5 A;  3ZG7 B;  1NRF A;  1BLS A;  1TDL A;  2PU4 A;  3PBO A;  2HDR A;  1WYB A;  1H5X A;  4YFM A;  3BEC A;  3NCK A;  3QNC A;  4Y0U A;  4BD1 A;  2HDU A;  3ZDJ A;  1I5Q A;  5FI7 A;  3IXG A;  3SH8 A;  2Y55 A;  4JLF A;  1L0G A;  4GNU A;  2WAE A;  4DE3 A;  1PYY A;  3DTM A;  2XDM A;  3P98 A;  2H0T A;  5FAP A;  1FOF A;  1PWC A;  4OPY A;  1CK3 A;  2FFY A;  2I72 A;  4Q8I A;  5JYO A;  1PWG A;  3ZVT A;  1YLT A;  1FCN A;  1ALQ A;  1XP4 A;  2PU2 A;  5FQ9 A;  3SH7 A;  1SCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...