2P74A

Ctx-m-9 class a beta-lactamase apo crystal structure at 0.88 angstrom resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase CTX-M-9a
publication title The Acylation Mechanism of CTX-M beta-Lactamase at 0.88 A Resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2p74A00
3VP4A 3GSGA 3GRJA 2VGKA 2XGNA 4OOYA 4DE3A 1NYMA 4KG5A 3BLSA 5EVIB 4KG2A 2WGIA 1XA1A 1KE3A 3LY3A 3S4XA 1E3UD 1AXBA 3ZG0A 2ZLYA 1L2SA 3N7WA 5CRFA 5M18A 4KENB 3M2JA 1KDSA 3FYZA 3MBZA 1MY8A 2PU2A 2ZM8A 1E3UA 1BT5A 3HLFA 3UDIA 1BZAA 4Y0TA 2I72A 1K4FA 2QMIA 5DF9A 4JF5A 3SS5A 3PBOA 5FSRA 4EQIA 4D2OA 4GD6A 1MPLA 1W8YA 2FFFB 2ZQ8A 4KZ3A 4B4XA 2Z2LB 1PW8A 1EI5A 4HBUA 1ONHA 5FQIA 2X01A 4S2MA 5FQKA 3S1YA 2V1ZA 1SDEA 3IH8A 3FWLA 3OC2A 1S6RA 4QHCA 5F83A 5L2FA 1HD8A 3Q81A 4S2NA 5HW3A 3WS2A 2OV5A 4EBPA 4ZDXA 1I2SA 2XH9A 1ESIA 3IF6B 4JXSA 5FATA 5FAOA 1FQGA 4R3JA 4KZ5A 4WM9A 1K57A 3IWQA 5FA7A 1RCJA 4UA7A 1IYPA 4OKPA 4E3NA 4LV2A 3G34A 3IWIA 5A93A 1BUEA 1MBLA 3PBQA 4DDSA 3GR2A 1EROA 3IWOA 4IEDA 3FKWA 3IHBA 1NRFA 3Q1FA 4YFMA 4OPQA 4Y0UA 2CC1A 3PBTA 3G31A 5F82A 2OSUA 1CEFA 4XUZA 4BL3A 3G4PA 5FI6A 3MXSA 3BYDA 4YINA 1ZKJA 3QHYA 1SKFA 3G30A 2P74A 3ITAA 1KVLA 3Q82A 4JXGA 4NK3A 5GLDA 4DE2A 2ZMAA 1H8ZA 2Y4AA 2HPBA 5CHMA 2WGVA 4CJNA 1IELA 4H8RA 3UDFA 1TEMA 3O87A 4JXWA 2EXBA 3FV7A 3QNBA 4KZ7A 4S2NC 3TG9A 1QMEA 3G2ZA 5CERA 3UE3A 3S22A 1ES3A 3N8LA 4UAAA 2XDMA 4LV3A 5KSHA 4FCFA 1K25A 5M19A 1N9BA 1CI8A 1DJCA 3SH7A 1K57C 1G6AA 1MWSA 4JF4A 4S2JA 1TDLA 1WYBA 4ZAMA 5HARA 4DE0A 1PWCA 3BFGA 1IKGA 1ES2A 3NC8A 1K38A 1NXYA 1QMFA 4X56A 1DJAA 2IWBA 3ZNYA 1JWVA 5EVLA 2XQZA 4GKUA 3W4PA 5CGSA 5CEDA 2EFXA 4PMAA 2WKEA 3MZEA 2G2UA 1W5DA 3C7VA 4DKIA 1W8QA 2A3UA 1MWTA 3AGDA 4OLGA 1E25A 1IEMA 5GLCA 2ZM0A 3A3IA 1L0FA 1U60A 4KG6A 5KMWA 2HP6A 1W79A 2HP5A 1K56D 1W7FA 5GHXA 5AQ7A 1TDGA 4PM8A 3IF6A 1GHPA 3O88A 4RX3A 4Y7PA 4GNUA 4HESA 3VSLA 1K56A 3OPHA 1ES4A 1MWRA 5AQ9A 2ZC7A 4S2OA 5GL9A 3VFHA 1RGYA 4ZJ2A 2HDUA 4NETA 3UN7A 4DE1A 4OPYA 3BEBA 5DTSA 1VM1A 3VP0A 4B88A 4WMCD 3VP3A 3GQZA 2R9WA 1BSGA 1L0EA 3O3VA 4CPKA 4P6BA 3GMWA 4HEFA 4KZBA 4WEJA 1IYSA 4PM9A 3OPPA 1KGEA 4WMCA 3IXHA 3MZFA 3C5AA 1YMXA 2JCHA 5FI7A 3W4QA 4EV4A 2V20A 3IXBA 1PWGA 3CG5A 1KGGA 1Q2PA 4S2PA 4E3IA 3HVFA 1J9MA 3BFDA 3EQVA 4C6YA 3E2KA 5F1GA 5D3OA 3UE1A 2HDQA 1C3BA 5KZHA 1Z6FA 2DRWA 3IXGA 4GN2A 4RX2A 3VSKA 3ZVWA 1G68A 1KVMA 2P9VB 3IF6C 3Q7VA 4N9LA 3IT9A 4OOLA 3SOIA 1GCEA 1O07A 1SHVA 4EBLA 4JKTA 1XGIA 1NJ4A 2A49A 1ERQA 3N4IA 1K55A 1FCNA 1RGZA 3BFFA 4QD4A 5IHVA 1L0GA 1LLBA 2Y2GA 4S2KA 3NBLA 2X02A 1SCWA 4U0TA 4X69A 2WKHA 3W4OA 1PI4A 4BD1A 4WELA 3OPRA 4FH2A 2Q9MA 2H10A 1XP4A 4LENA 3VMAA 2EX9A 1CK3A 4XUXA 5A90A 1PZOA 1DJBA 1BLHA 2JC7A 1YLPA 3N8RA 4JBFA 5DTTA 2ZQAA 4BL2A 2WGWB 5A91A 3PAEA 4N1HA 4UA6A 1IYQA 3OPLA 5FQQA 4QY6A 5FAQA 3BRMA 4JF6A 5AQBA 1YLTA 4DDYA 3M6HA 4FH4A 5JYPA 3HLDA 2J9OA 3V3SA 4WZ4A 2JE5A 3VFFA 3C4OA 1YLYA 4E3JA 4LCLA 4XXRA 5E2HA 2H5SA 2X71A 4GB7A 2B5RA 4X53A 2XLNA 4KZAA 1YQSA 3ZFZA 1GA9A 5A92A 3CZDA 4ZJ1A 1K55C 4RVAA 2IWCA 1KDWA 3G32A 5CGXA 3BECA 2Y2PA 3RXWA 2BLSA 1Y54A 4X68A 3NDEA 3AGFA 1SDNA 2OLUA 2WZZA 1XX2A 4U3TA 4WEKA 1E4DA 5EVID 3HLWA 3WS0A 2ZD8A 3PBNA 3WS4A 1LI9A 4OP5A 4DRTA 5CECA 3BFEA 3UPNA 3NI9A 1HZOA 3A3DA 4LV1A 5EVIA 3PAGA 3ZGAB 4MBHA 4X55A 1M6KA 4QJGA 2ZC3B 4IBXA 4R4RA 2XFTA 5F1FA 2WZXA 1L0DA 5FASA 3DTMA 1LL5A 1HVBA 1LL9A 2G2WA 5CXWA 3PBRA 2ZQCA 1NY0A 4WZ5A 5J8XA 3GVBA 5EE8A 3ZNTA 4BLMA 2ZJ9A 2P9VA 2XF3A 4K0XA 5HX9A 2XFSA 3A3JA 4QU3A 3HL9A 3VOZA 3M2KA 4FD8A 5HFOA 2Y2LA 2PU4A 4BQMA 1N4OA 1ZG6A 4GDNA 1XGJA 2Y2QA 4WYYA 1JTDA 4QB8A 2UWXA 1PWDA 4N1XA 5CTMA 2Z2MB 3IQAA 5FQJA 5GHZA 4B4ZA 3UPOA 3IXDA 4N92A 3UPPA 3ZG8B 4F94A 1RP5A 2Y2OA 4P87A 5FI2A 3V50A 2ZQDA 3JYIA 4KZ6A 1JTGA 1YLWA 3TSGA 4C75A 3V5MA 2EXAA 4IBRA 5M1AA 3A3EA 5TFQA 3SS4A 5EVIC 2RL3A 1KE4A 1M40A 1MWUA 3UE0A 1K4EA 3EQUA 3E2LA 2ZC5B 3SH8A 3CMZA 1KE0A 4E6XA 5AQAA 1IKIA 3DWKA 3VP1A 4WZ5C 2BG1A 4OQGA 1I2WA 4S2IA 1LI0A 4X6TA 4DF6A 1YLJA 1DY6A 1FCOA 3W8KA 1NZUA 4U0XA 4QY5A 3Q07A 4KQQA 2HDSA 3MKFA 3GTCA 5EECA 2QPNA 2VGJA 1ONGA 3HUOA 1JVJA 3UNWA 2J9PA 2V2FF 2XR0A 5FQ9A 4E3KA 1YM1A 5FDHA 1H5XA 4LCMA 4KQOA 2ZC6B 4OP8A 2XD1A 2EX2A 1HTZA 2J8YA 3O86A 3BFCA 3GV9A 2WYXA 3DW0A 5CTNA 1PI5A 4LV0A 2DCFA 3I7JA 3NIAA 2Y2KA 3C4PA 5DVAA 5EPHA 1VQQA 3WWXA 4KZ9A 4JXVA 4OOMA 3N6IA 4M3KA 5FQMA 2DNSA 2E8IA 3MFDA 3NCKA 4HBTA 5KSCA 3Q7ZA 3WS5A 3MXRA 3P09A 4R4SA 5G18A 5I94A 4KZ8A 4MBFA 5DF8A 2R9XA 5E43A 1GA0A 3PTEA 3ISGA 3WRTA 1O7EA 2Y2MA 3VP2A 1Q2QA 1K6RA 4GZBA 3ZVTA 1K54A 4MNRA 2ZC4B 1YLZA 3HLBA 3VOYA 1XA7A 1PYYA 1XXMA 4UA9A 4S2LA 1YMSA 1IYOA 1GHIA 2J7VA 2WAEA 2Y55A 3LCEA 3PBSA 4PPRA 4PM5A 3CJMA 4R0QA 4EBNA 1H8YA 1FOFA 4IVKA 3SS3A 3BLMA 4Q8IA 3UDXA 5EOEA 1FSWA 4OPZA 3MZDA 3B3XA 1LHYA 5GLAA 4P85A 5E2GA 2Y91A 3FZCA 4RYEA 1PIOA 4GDBA 3ZDJA 3HUNA 3TOIA 5JYOA 2XEPA 5HAQA 5DF7A 2Y2IA 5EUAA 2XK1A 3C7UA 4OONA 1BLSA 2EX6A 3A3FA 5E2FA 3SH9A 4KQRA 4JPMA 4R1GA 4E3OA 4WBGA 4PM7A 2EFUA 4PM6A 1OMEA 5HAIA 1BLCA 3BM6A 3HREA 3FKVA 3IH9A 3D4FA 3LO7A 1FR6A 1K54C 4KZ4A 3HBRA 2ZM2A 2PBYA 3WS1A 4DXBA 1BULA 1ESUA 1PW1A 3MKEA 1YT4A 2Y59A 3IF5A 4K0WA 3ZG9B 4ZTKA 2WKIA 2OLVA 3NDGA 5E2EA 1MKIA 1WE4A 4OQIA 3OZHA 4MLLA 3HLGA 1CI9A 1TVFA 4E3MA 1BTLA 3G35A 2Y2HA 4C3QA 3ZCZA 3RXXA 3ITBA 1XPBA 3UY6A 1CEGA 2EX8A 3LEZA 4DXCA 3WRZA 2Y2NA 2C5WB 2IWDA 2Y2JA 3UO9A 1NYYA 2XD5A 4P0MA 3Q7VB 3IHAA 5EOOA 1JWPA 4MEZA 3HUMA 4OQHA 3ZHHA 5HL1A 4E3LA 2WAFA 2HDRA 2QZ6A 1S0WA 2JBFA 3LY4A 3OCNA 4L0LA 2C6WB 4BJPA 4BENA 1EWZA 4OPRA 2WADA 3QNCA 2WK0A 1PZPA 3HLEA 4Z9QA 3AGEA 4RA7A 4IVIA 5CEBA 1XKZA 2WGWA 3ZG7B 3NY4A 4E6WA 4OH0A 5TGFA 5U47A 1MXOA 3P98A 5GLBA 1WYCA 4R3BA 4FSFA 5FAPA 3V3RA 1FSYA 5DTKA 1I5QA 1ERMA 5CGWA 4BD0A 1KGFA 2ZQ9A 5CHUA 4JLFA 4ZJ3A 4Y0OA 4O7DA 5TR7A 4UHUA 1ZG4A 2ZQ7A 4MBKA 2RCXA 4ID4A 4ZBEA 2Q9NA 3OCLA 3M6BA 1BLPA 1ZC2A 1FCMA 4GOGA 1NZOA 1ES5A 4N9KA 4R23A 4EWFA 3DWZA 1FR1A 2H0YA 4A5RA 4EUZA 4GD8A 4OQ0A 4OLDA 2H0TA 3ZG5A 4K91A 5HAPA 2GDNA 3N8SA 1K6SA 1GHMA 1JWZA 3HLCA 5GHYA 2FFYA 3V39A 5BOHA 1ALQA 2WUQA 5CHJA 3RJUA 3G2YA 2HP9A 4OVDA
chains in the Genus database with same CATH superfamily
3GSGA 3GRJA 2VGKA 1H0MA 3L7HA 2WGIA 1KE3A 3HCYA 3E4OA 3ZG0A 2ZLYA 3H82B 1L2SA 3N7WA 1X0OA 3A0SA 1MY8A 2ZM8A 3T1QB 4JF5A 4MN6A 3PBOA 5TBMB 3SS5A 3BJNA 3S1YA 5FQIA 4S2MA 2V1ZA 3C38A 3WS2A 1VEUB 4JXSA 5FAOA 4KZ5A 3F1OB 4OKPA 4BBTA 4E3NA 4LV2A 3K3CA 1MBLA 3F1NB 4DDSA 4FUWA 3GR2A 3Q1FA 2WKPA 3PBTA 1JNUA 1CEFA 4BL3A 2YKHA 2OWHA 3MXSA 4HP4A 1ZKJA 2Y4AA 4CJNA 1XJ3A 4H8RA 3UDFA 1TEMA 3NECA 2QJ7A 4KZ7A 3B42A 5CERA 3MR0A 4IUKA 4FCFA 2WKRA 4II7A 1K57C 4ZAMA 1MZUA 4DE0A 1PWCA 3D3OA 3NC8A 1G28A 4X56A 1DJAA 3ZNYA 1JWVA 4GKUA 2EFXA 4PMAA 2G2UA 1H3QA 1Y4OA 1TS6A 3C7VA 2O0YA 1MWTA 3AGDA 3PXPA 5GLCA 2ZM0A 4KG6A 5KMWA 2HP6A 2HP5A 1K56D 3IS2B 3BY9A 3R4KA 4WLAA 5C5KA 1ES4A 1MWRA 5AQ9A 2ZC7A 1RGYA 2JKRM 2HDUA 3UN7A 2W3HA 1VETA 5DTSA 3VP0A 3VP3A 3B47A 1BSGA 4MMNA 5DKKA 1OTEA 3MF0A 4KZBA 1XJ6A 1KGEA 4WMCA 3IXHA 1YSPA 3B33A 3W4QA 4YOFA 1N9NA 3IBRA 3JVVA 4BBVA 1Q2PA 4E3IA 3HVFA 2J3TD 4HI4A 1Z6FA 3IXGA 4WF0A 4N9LA 1XJ4A 3SOIA 1F2KA 3N4IA 1ERQA 5IHVA 1LLBA 2JKGA 2Y2GA 2X02A 1SCWA 3KYEA 4U0TA 2WKHA 4X69A 3OPRA 2H10A 4LENA 1PZOA 1BLHA 2GZAA 2ZQAA 4EESA 3PAEA 5FQQA 5HL6A 5FAQA 5DFYA 3BRMA 5AQBA 2M7UA 3CUEA 2J9OA 3VFFA 4XXRA 2H5SA 2J3TC 5A92A 1GA9A 2QYBA 2W3GA 1D06A 3V67A 4Y5FA 3RXWA 4X68A 2V8CA 3WS0A 1LI9A 5EVIA 3ZGAB 1TS7A 4QJGA 3EGDC 2XFTA 4I3JA 4YWZA 2WZXA 1CJFA 5J8XA 3U2AA 1NRJA 2P9VA 1Y28A 4K0XA 5HFOA 2Y2LA 2JKTM 4GDNA 5HDDA 1JTDA 1N9LA 2Z2MB 2KOIA 2PBDP 3UPPA 3TSGA 4C75A 2ACGA 3V5MA 2EXAA 4IBRA 3A3EA 2JN7A 5TFQA 2RL3A 5DFXA 1MKMA 3E2LA 2ZC5B 1KE0A 4CLCE 4DF6A 1YLJA 3W2ZA 4KQQA 1JVJA 2V2FF 1YM1A 1H5XA 5DJTA 2XA7S 4O8GA 4R70A 3O86A 1SKOA 1ODVA 3BFCA 3EOIA 3GV9A 3C2WA 4LV0A 1V9YA 2DCFA 2FZ0A 2Y2KA 3BW6A 5FQMA 5HPIA 4X1MA 1GSVA 5I94A 2R9XA 1GA0A 2W1RA 3PTEA 3S7QA 1O7EA 2A24A 3QP6A 4LRZE 4G3KA 4MNRA 1J3WA 2EWWA 2ZC4B 1YLZA 2VGLM 1XA7A 1PYYA 5MC7A 3K2NA 1YMSA 4HJ4A 3TJZC 2J7VA 3PBSA 4PM5A 2L4RA 3CJMA 3MQOA 1FOFA 4Q8IA 1FSWA 4BWIA 4WN5A 3B3XA 1P9RA 2M1CA 1PIOA 4G3VA 2K2NA 3G6OA 4GDBA 4HP9A 3HUNA 5HAQA 5DF7A 2Y2IA 5EUAA 2XK1A 3C7UA 5E2FA 4PM7A 3P01A 5HDSA 5HAIA 1BLCA 3BWLA 3IH9A 4EW7A 1K54C 2QHKA 1BULA 4NXEA 1ESUA 3CUEC 3LR4A 4ZTKA 1ZHHB 2IA2A 3OZHA 5K5BA 3HLGA 3G35A 4RQ9A 2PR5A 3RXXA 3ITBA 1CEGA 2EX8A 4DXCA 2C5WB 3UB5P 5EOOA 2NUPC 1JWPA 4MEZA 3HUMA 3ZHHA 2H28A 1OTAA 4B93A 3HJKA 4L9GA 1S0WA 4BJPA 1EWZA 2WADA 4Y13A 3QNCA 2WK0A 5F5YA 4Z9QA 4RA7A 2Q0OA 3LIBA 3SZTA 4GS9A 4BD0A 3SW1A 4JLFA 4ZJ3A 1L3LA 3S7PA 2ZQ7A 4PKYA 4ZBEA 3MXQA 2BASA 1BLPA 4JGQA 2H0YA 1YKDA 4OQ0A 4OLDA 2GDNA 3HJIA 2KDKA 3HLCA 2JKFA 5BOHA 1ALQA 5CHJA 4KQDA 4OVDA 3VP4A 4FTXA 5EVIB 1XA1A 3LY3A 1E3UD 1AXBA 3LEQA 3FC7A 1OTDA 5CRFA 1LL8A 5M18A 4KENB 4EEPA 2VKSA 3R7WA 4NEED 1ACFA 2I72A 2QMIA 4GHIA 3LR0A 4MCWA 2V0WA 1W8YA 2ZQ8A 4B4XA 1PW8A 1NLYA 1ONHA 1SDEA 5L2FA 5F83A 3Q81A 5HW3A 5IS1A 3DTEA 1ESIA 3IF6B 4R3JA 1K57A 4IHQA 4UA7A 2DMWA 3IWIA 4XT2A 1BUEA 3LIAA 3IWOA 4O0PA 3FG8A 4Y0UA 3VOLA 3G31A 3BY8A 5F82A 4YINA 2W3EA 3QHYA 1DP8A 1SKFA 3G30A 2P74A 5GLDA 2FH5A 2ZMAA 2I9VA 2HPBA 2VV6A 1T1AA 4S2NC 1QMEA 3G2ZA 1SKOB 3LICA 4IJGA 3UE3A 3N8LA 5KSHA 1K25A 4ZRRA 1CI8A 3SH7A 1G6AA 4S2JA 1TDLA 1WYBA 3BFGA 1NXYA 3QP1A 2IWBA 5AVFA 2JKRI 1IOUA 2XRNA 2W1TB 4GJ4A 3MZEA 1UWNX 2V8FA 1T19A 1IEMA 3A3IA 1U60A 2VV7A 1W7FA 3VV4A 1TDGA 2PHYA 4RX3A 3IX4A 1K56A 3LIFA 3OPHA 4AFIA 3VFHA 4ZJ2A 1F98A 4DE1A 4OPYA 3BEBA 2R9WA 1Z09A 3O3VA 4P6BA 4WEJA 4PM9A 3EWKA 5HD3A 1ZTUA 5AVEA 1PWGA 3CG5A 2J3WA 2MJ6A 3BFDA 4C6YA 5F1GA 2CMNA 2HDQA 1P0ZA 1SZVA 2DRWA 3ZVWA 4RX2A 1KVMA 3A0RA 4OOLA 4WL9A 1GCEA 1SHVA 1XGIA 1NJ4A 5A90A 1RGZA 5F69A 1L0GA 1T1BA 1S4RA 1T1CA 3LGOA 1V9ZA 1DJBA 2JC7A 1G6OA 4BL2A 5A91A 4N1HA 4ME4A 1YLTA 3M6HA 4FH4A 5JYPA 4GS9B 2VA0A 3C4OA 1YLYA 4E3JA 4LCLA 2KLIA 3KSFA 4EUVA 3ZFZA 3CZDA 3E4PA 5FDSA 1KDWA 5CGXA 3F1PB 2Y2PA 1SDNA 1XX2A 1E4DA 2HF6A 4HIAA 3HLWA 2W3FA 2YKFA 3KYZA 1PFLA 2Z6CA 2QJ5A 3H9WA 3UPNA 3NI9A 1M6KA 5HWTA 2ZC3B 1L0DA 1LL5A 1HVBA 1LL9A 2ZQCA 1NY0A 3D9YA 3ZNTA 4KUKA 2ZJ9A 5DKLA 5L09A 1IFQA 2XFSA 3HL9A 3VOZA 1N4OA 2XROA 4N1XA 4I3AA 4N92A 3KSGA 1XFQA 1JTGA 5IU1A 2E8JA 4I38A 4F3LA 1KE4A 3UE6A 3UE0A 1K4EA 2Z6DA 2W3DA 4E6XA 3CMZA 3VP1A 1DRMA 4XT2B 4X6TA 1FCOA 4L9EA 4CLCB 3Q07A 3MKFA 5CX7A 3HUOA 2QPNA 1ONGA 3DBAA 2VJWA 4E3KA 3KSIA 4LCMA 4MN7A 5I5LA 4KQOA 2GJ3A 2EX2A 2J8YA 2WYXA 4HY8A 3C4PA 1VQQA 3LR3A 4JXVA 4P6ZM 2LB9A 3NCKA 3S7OA 5KSCA 3MQQA 3Q7ZA 4GLQA 3VP2A 1K54A 3L9KA 5J3WA 3UB9A 3RFBA 3VOYA 4S2LA 2Y55A 2WAEA 4Y2FA 4PPRA 4R0QA 3KO6A 4IVKA 2O9CA 5HD5A 1TD5A 1LHYA 4P85A 5E2GA 2Y91A 4Y3IA 3ZDJA 1P97A 5G4YA 4OONA 4HH2A 2EX6A 3A3FA 2EA9A 4JGRA 4KQRA 4WBGA 3LUQA 3LO7A 1FR6A 3LI8A 2XA7M 1LSWA 3RTYA 3MKEA 2Y59A 3IF5A 4GW9A 3UB7A 5E2EA 4MLLA 2O99A 1TVFA 4P6ZS 1XPBA 1OJGA 3LEZA 3WRZA 2Y2NA 2Y2JA 3UO9A 2XD5A 2PT7A 4P0MA 3T4OA 4LPZA 3IHAA 3ICYA 2GX5A 5FEFA 2JBFA 3OCNA 2C6WB 3DAVA 4OPRA 3HLEA 3EGXC 5CEBA 4IVIA 2WGWA 3ZG7B 3NY4A 4E6WA 5U47A 4H6JA 2J80A 5GLBA 4K08A 3V3RA 1K0KA 1ERMA 5CGWA 4O7DA 1ZG4A 4UQIS 4MBKA 2RCXA 2V1AA 3OCLA 3M6BA 4YNRA 4PHTA 3DTIA 4N9KA 4PAUA 3EEHA 5HWWA 3KYQA 4A5RA 1GHMA 2ZBBA 3V39A 2PRFA 3G2YA 4R3AA 1A0KA 2GNXA 2XGNA 4EEUA 4OOYA 3PR6A 3D72A 4KG2A 2P7JA 2HJEA 3S4XA 1PNEA 3TW8A 3FYZA 3MBZA 2PU2A 4ARZA 1E3UA 5FSRA 4EQIA 4D2OA 4KZ3A 2FFFB 3OLOA 1EI5A 2W0NA 4HBUA 2X01A 5J4EA 2VLGA 5HDCA 2VX8A 3OC2A 1S6RA 3MJQA 4S2NA 3O5YA 1NLZA 5L07A 2OV5A 4EBPA 1I2SA 1N9OA 1XFNA 4WM9A 5FA7A 4D60A 1IYPA 2JHEA 3LYXA 5A93A 1VETB 1EROA 3FKWA 4OPQA 2OSUA 3G4PA 4PKYG 4X25A 1NWZA 3ITAA 4NK3A 4JXGA 1KVLA 1H8ZA 5CHMA 5A8BA 1IELA 3O87A 4JXWA 2EXBA 3FV7A 3TG9A 4I5SA 3VE4A 3S22A 4UAAA 4LV3A 5M19A 1DJCA 1MWSA 1OTIA 1ES2A 3PYPA 3H82A 1QMFA 5EVLA 2XQZA 3W4PA 5CGSA 5CEDA 3T4JA 2UV0E 5TBMA 2A3UA 4OLGA 5HWVA 1BYWA 1L0FA 3CI6A 1W79A 5EVEA 1LT0A 2HV1A 2HGVA 3O88A 4Y7PA 4GNUA 3VSLA 3F1OA 2PDRA 4NETA 4Y15A 1VM1A 2O9AA 4CPKA 1LSXA 3GMWA 4HEFA 1IYSA 3EEAA 1H8MA 1D1JA 3C5AA 1YMXA 1S4SA 2JCHA 5FI7A 2V20A 3IXBA 2W27A 1KGGA 4S2PA 5D3OA 5KZHA 2PYPA 2OOLA 2P9VB 2B18A 3IF6C 3IT9A 1O07A 4JKTA 2A49A 1FCNA 2L0WA 3W4OA 4BD1A 4WELA 1STZA 2D01A 2V9AA 3ZQ5A 1XP4A 2EX9A 1CK3A 4JBFA 1YLPA 2L1MA 3QP4A 1S1ZA 2WGWB 4UA6A 1IYQA 4DMZA 4QY6A 4H6JB 4JF6A 4DDYA 2QWSA 3HLDA 4WZ4A 3IS2A 2X71A 2WKQA 2B5RA 4X53A 4KZAA 1YQSA 1K55C 4RVAA 2IWCA 4KUOA 3H7WA 3G32A 4HJ3A 4DJ3A 3NDEA 3AGFA 2OLUA 3NJAA 4U3TA 4WEKA 1UWPX 4OP5A 5CECA 3A3DA 4LV1A 2A2LA 3T4SA 2VV8A 4MBHA 4X55A 4IBXA 4HOIA 5FL3A 4Z1WA 1HLUP 3T4QA 3GVBA 2A24B 3KX0X 2ZOIA 5HX9A 3TE8A 4QU3A 4EERA 3M2KA 3QP8A 4JGPA 4BQMA 1EW0A 5CTMA 3IQAA 5GHZA 4B4ZA 3UPOA 3IXDA 3ZG8B 4F94A 4P87A 5FI2A 3V50A 4KZ6A 1YLWA 3MQ0A 3E98A 5M1AA 3LI9A 3NOTC 3MMHA 1MWUA 3EQUA 3SH8A 2Y8HA 1WA9A 3DWKA 1YAXA 4WZ5C 2PAVP 4S2IA 1LI0A 2PD8A 1CQAA 4IUHA 4EU0A 3W8KA 1DY6A 1NZUA 3CAXA 5EECA 3UNWA 4HH3A 5J7EA 5FQ9A 2G7UA 3T12B 2ZC6B 2XD1A 4DN0A 1HTZA 5CTNA 2OWJA 3WWXA 4ETZA 4KZ9A 5IT5A 4M3KA 3CWFA 3MFDA 2VK3A 4R38A 3NULA 3WS5A 3MXRA 2OAP1 4KZ8A 4MBFA 5DF8A 4ESPA 3MSHA 2Y2MA 4MN5A 1Q2QA 1K6RA 4GZBA 3ZVTA 4NXGA 1IYOA 1GHIA 3LCEA 5DJUA 3SS3A 3UDXA 4OPZA 2LB5A 1FILA 3TOIA 2XEPA 3SH9A 1BLSA 4CLCD 4JPMA 4E3OA 4PM6A 1OMEA 2JKTI 5LBRA 3P7NA 3D4FA 2PBYA 3WS1A 1YT4A 3ZG9B 4Y17A 3NDGA 5EFWA 4E3MA 4C3QA 3ZCZA 1OTBA 1TS0A 3UY6A 3CHWP 2IWDA 1NYYA 3R7WB 3CPTA 4OQHA 3UMDA 5G4ZA 2HDRA 2QZ6A 4GHIB 4L0LA 4HQAA 1PZPA 4CLCC 1G5UA 2P08A 1XKZA 4OH0A 5TGFA 3IX3A 3P98A 1MC0A 3DTKA 4FSFA 5FAPA 1FSYA 2D02A 5DTKA 3LIEA 1I5QA 3MS6A 1W63Q 4LGWA 4Y0OA 4QWOA 4LRYC 2Q9NA 1ZC2A 2R78A 3UB6A 3DWZA 1FR1A 3OOVA 1YPRA 2H0TA 3H7WB 3ZG5A 4K91A 1XJ2A 3N8SA 3LFVA 5GHYA 2FFYA 2WUQA 2HP9A 5HPFA 2M7VA 4DE3A 1NYMA 4KG5A 3BLSA 4QPRA 1LSVA 5L10A 4O01A 2V0UA 1CF0A 4BMWA 4R6LA 3PHYA 3M2JA 1KDSA 3NOUC 4WUJA 1OPXA 1BT5A 3HLFA 3UDIA 1BZAA 4Y0TA 1K4FA 5DF9A 4GD6A 1MPLA 2Z2LB 1W63M 5FQKA 3GDIA 3C8CA 2V1BA 3FWLA 3IH8A 4QHCA 4CQHA 1HD8A 2HJ9C 5F68A 3C30A 4UQIM 4ZDXA 2XH9A 4E04A 5FATA 1FQGA 3IWQA 1RCJA 3G34A 3PBQA 4IEDA 4YFMA 3IHBA 1NRFA 2CC1A 4XUZA 5FI6A 2P04A 3BYDA 2EWVA 3Q82A 4DE2A 3T4TA 4NKPA 2WGVA 1D7EA 3KSHA 3NHQA 3QNBA 1ES3A 2XDMA 3T4LA 3CLOA 4NXBA 1N9BA 2ZMVA 5HZHA 4UEYA 4JF4A 5HARA 1P9WA 1IKGA 1K38A 4I3IA 3NOPC 2WKEA 4EETB 1W5DA 4DKIA 1W8QA 1E25A 3FPWA 5KIZA 5AJGA 5GHXA 5TJJA 5AQ7A 4PM8A 4EXOA 3IF6A 1GHPA 4G3WA 2OAQ1 3FPVA 4HESA 5GL9A 4S2OA 4L9FA 1GSWA 3LIDA 4B88A 4WMCD 3GQZA 4HHDA 1L0EA 5HSQA 4LLOB 3OPPA 3K3DA 3E0YA 3MZFA 4EV4A 1J9MA 2ZL1A 3EQVA 4ETXA 3GECA 3E2KA 2Y79A 1YSQA 3UE1A 1C3BA 4GN2A 3VSKA 1G68A 1S66L 3Q7VA 4EBLA 4ZJ1A 1K55A 3BFFA 4QD4A 4EQ1A 3CPTB 4S2KA 3NBLA 4LFUA 1PI4A 3BQAA 3ULFA 4FH2A 4JGOA 2Q9MA 3VMAA 4XUXA 4X1LA 3N8RA 2W1TA 5DTTA 2ZOHA 3OPLA 4F3LB 3MFXA 1OJ5A 3V3SA 2JE5A 4FOFA 5E2HA 2VEAA 1VB6A 4GB7A 3T1XA 2XLNA 1PRQA 1UGUA 3BECA 2BLSA 1Y54A 2WZZA 2XSSA 5EVID 2ZD8A 3PBNA 3WS4A 4MDZA 4Q0HA 4DRTA 3BFEA 1HZOA 4HNBA 1FIKA 3PAGA 3CITA 4R4RA 5F1FA 5FASA 3DTMA 2G2WA 5CXWA 3PBRA 1GSXA 4WZ5A 5EE8A 4BLMA 2PD7A 2XF3A 2B95A 3A3JA 3UB8A 4FD8A 2PU4A 1ZG6A 1XGJA 2Y2QA 4WYYA 4M4XA 4QB8A 2UWXA 1PWDA 5FQJA 5L8MA 2VGLS 1RP5A 2Y2OA 2ZQDA 3JYIA 3A0VA 2HZ5A 1VEUA 4GCZA 3JVUA 5EVIC 3SS4A 1M40A 2PYRA 4BBUA 2VZWA 5AQAA 1IKIA 3F1NA 2BG1A 4OQGA 1I2WA 1S1YA 1OT9A 3IX8A 4U0XA 4QY5A 2INWA 2HDSA 3GTCA 3RH8B 2VGJA 3F1PA 3TRCA 2J9PA 2XR0A 3IBJA 5FDHA 3T4KA 4LRXC 4OP8A 3BQ8A 3DW0A 5HAPA 1PI5A 3I7JA 3NIAA 5DVAA 5EPHA 3T1RA 4OOMA 3N6IA 2DNSA 4Q0IA 2E8IA 4HBTA 3P09A 4R4SA 5G18A 2BTFP 5E43A 3ISGA 3WRTA 1TS8A 1TF1A 5EM0A 3HLBA 4UA9A 1XXMA 1DP6A 3UMEA 4EBNA 1H8YA 1F5MA 3BLMA 5EOEA 1DP9A 3MZDA 5GLAA 3FZCA 4RYEA 1OT6A 5JYOA 4R1GA 2ZMFA 2EFUA 3BM6A 3HREA 3FKVA 1KOUA 3T1SA 4KZ4A 4CLCA 2B02A 2ZM2A 3HBRA 4DXBA 1PW1A 4K0WA 5EV0A 3VE3A 2WKIA 3OBFA 2K31A 2OLVA 1MKIA 1WE4A 2QKPA 4OQIA 1CI9A 2PR6A 1BTLA 1S67L 2Y2HA 2ZL1B 3E4QA 5FEGA 4ARZB 3Q7VB 3S7NA 2K7SA 5HL1A 4E3LA 2WAFA 3QP2A 4HJ6A 3LY4A 5EM1A 1VHMA 4BENA 3AGEA 3ZYTA 1F9IA 1MXOA 1WYCA 4R3BA 2AVXA 2NUTC 3LR5A 3JPUA 1KGFA 2ZQ9A 3QP5A 5CHUA 4B9OA 5TR7A 4UHUA 4Q0JA 4ID4A 1T18A 3T50A 1FCMA 4GOGA 1NZOA 1ES5A 4R23A 4EWFA 4EUZA 4GD8A 4I39A 4NXFA 2KX6A 1K6SA 1JWZA 2O9BA 4DJ2A 5F6AA 3U4LP 4NG2A 3RJUA 1AWIA
chains in the Genus database with same CATH topology
3VP4A 3GSGA 3GRJA 2VGKA 2XGNA 4OOYA 4DE3A 1NYMA 4KG5A 3BLSA 5EVIB 4KG2A 2WGIA 1XA1A 1KE3A 3LY3A 3S4XA 1E3UD 1AXBA 3ZG0A 2ZLYA 1L2SA 3N7WA 5CRFA 5M18A 4KENB 3M2JA 1KDSA 3FYZA 3MBZA 1MY8A 2PU2A 2ZM8A 1E3UA 1BT5A 3HLFA 3UDIA 1BZAA 4Y0TA 2I72A 1K4FA 2QMIA 5DF9A 4JF5A 3SS5A 3PBOA 5FSRA 4EQIA 4D2OA 4GD6A 1MPLA 1W8YA 2FFFB 2ZQ8A 4KZ3A 4B4XA 2Z2LB 1PW8A 1EI5A 4HBUA 1ONHA 5FQIA 2X01A 4S2MA 5FQKA 3S1YA 2V1ZA 1SDEA 3IH8A 3FWLA 3OC2A 1S6RA 4QHCA 5F83A 5L2FA 1HD8A 3Q81A 4S2NA 5HW3A 3WS2A 2OV5A 4EBPA 4ZDXA 1I2SA 2XH9A 1ESIA 3IF6B 4JXSA 5FATA 5FAOA 1FQGA 4R3JA 4KZ5A 4WM9A 1K57A 3IWQA 5FA7A 1RCJA 4UA7A 1IYPA 4OKPA 4E3NA 4LV2A 3G34A 3IWIA 5A93A 1BUEA 1MBLA 3PBQA 4DDSA 3GR2A 1EROA 3IWOA 4IEDA 3FKWA 3IHBA 1NRFA 3Q1FA 4YFMA 4OPQA 4Y0UA 2CC1A 3PBTA 3G31A 5F82A 2OSUA 1CEFA 4XUZA 4BL3A 3G4PA 5FI6A 3MXSA 3BYDA 4YINA 1ZKJA 3QHYA 1SKFA 3G30A 2P74A 3ITAA 1KVLA 3Q82A 4JXGA 4NK3A 5GLDA 4DE2A 2ZMAA 1H8ZA 2Y4AA 2HPBA 5CHMA 2WGVA 4CJNA 1IELA 4H8RA 3UDFA 1TEMA 3O87A 4JXWA 2EXBA 3FV7A 3QNBA 4KZ7A 4S2NC 3TG9A 1QMEA 3G2ZA 5CERA 3UE3A 3S22A 1ES3A 3N8LA 4UAAA 2XDMA 4LV3A 5KSHA 4FCFA 1K25A 5M19A 1N9BA 1CI8A 1DJCA 3SH7A 1K57C 1G6AA 1MWSA 4JF4A 4S2JA 1TDLA 1WYBA 4ZAMA 5HARA 4DE0A 1PWCA 3BFGA 1IKGA 1ES2A 3NC8A 1K38A 1NXYA 1QMFA 4X56A 1DJAA 2IWBA 3ZNYA 1JWVA 5EVLA 2XQZA 4GKUA 3W4PA 5CGSA 5CEDA 2EFXA 4PMAA 2WKEA 3MZEA 2G2UA 1W5DA 3C7VA 4DKIA 1W8QA 2A3UA 1MWTA 3AGDA 4OLGA 1E25A 1IEMA 5GLCA 2ZM0A 3A3IA 1L0FA 1U60A 4KG6A 5KMWA 2HP6A 1W79A 2HP5A 1K56D 1W7FA 5GHXA 5AQ7A 1TDGA 4PM8A 3IF6A 1GHPA 3O88A 4RX3A 4Y7PA 4GNUA 4HESA 3VSLA 1K56A 3OPHA 1ES4A 1MWRA 5AQ9A 2ZC7A 4S2OA 5GL9A 3VFHA 1RGYA 4ZJ2A 2HDUA 4NETA 3UN7A 4DE1A 4OPYA 3BEBA 5DTSA 1VM1A 3VP0A 4B88A 4WMCD 3VP3A 3GQZA 2R9WA 1BSGA 1L0EA 3O3VA 4CPKA 4P6BA 3GMWA 4HEFA 4KZBA 4WEJA 1IYSA 4PM9A 3OPPA 1KGEA 4WMCA 3IXHA 3MZFA 3C5AA 1YMXA 2JCHA 5FI7A 3W4QA 4EV4A 2V20A 3IXBA 1PWGA 3CG5A 1KGGA 1Q2PA 4S2PA 4E3IA 3HVFA 1J9MA 3BFDA 3EQVA 4C6YA 3E2KA 5F1GA 5D3OA 3UE1A 2HDQA 1C3BA 5KZHA 1Z6FA 2DRWA 3IXGA 4GN2A 4RX2A 3VSKA 3ZVWA 1G68A 1KVMA 2P9VB 3IF6C 3Q7VA 4N9LA 3IT9A 4OOLA 3SOIA 1GCEA 1O07A 1SHVA 4EBLA 4JKTA 1XGIA 1NJ4A 2A49A 1ERQA 3N4IA 1K55A 1FCNA 1RGZA 3BFFA 4QD4A 5IHVA 1L0GA 1LLBA 2Y2GA 4S2KA 3NBLA 2X02A 1SCWA 4U0TA 4X69A 2WKHA 3W4OA 1PI4A 4BD1A 4WELA 3OPRA 4FH2A 2Q9MA 2H10A 1XP4A 4LENA 3VMAA 2EX9A 1CK3A 4XUXA 5A90A 1PZOA 1DJBA 1BLHA 2JC7A 1YLPA 3N8RA 4JBFA 5DTTA 2ZQAA 4BL2A 2WGWB 5A91A 3PAEA 4N1HA 4UA6A 1IYQA 3OPLA 5FQQA 4QY6A 5FAQA 3BRMA 4JF6A 5AQBA 1YLTA 4DDYA 3M6HA 4FH4A 5JYPA 3HLDA 2J9OA 3V3SA 4WZ4A 2JE5A 3VFFA 3C4OA 1YLYA 4E3JA 4LCLA 4XXRA 5E2HA 2H5SA 2X71A 4GB7A 2B5RA 4X53A 2XLNA 4KZAA 1YQSA 3ZFZA 1GA9A 5A92A 3CZDA 4ZJ1A 1K55C 4RVAA 2IWCA 1KDWA 3G32A 5CGXA 3BECA 2Y2PA 3RXWA 2BLSA 1Y54A 4X68A 3NDEA 3AGFA 1SDNA 2OLUA 2WZZA 1XX2A 4U3TA 4WEKA 1E4DA 5EVID 3HLWA 3WS0A 2ZD8A 3PBNA 3WS4A 1LI9A 4OP5A 4DRTA 5CECA 3BFEA 3UPNA 3NI9A 1HZOA 3A3DA 4LV1A 5EVIA 3PAGA 3ZGAB 4MBHA 4X55A 1M6KA 4QJGA 2ZC3B 4IBXA 4R4RA 2XFTA 5F1FA 2WZXA 1L0DA 5FASA 3DTMA 1LL5A 1HVBA 1LL9A 2G2WA 5CXWA 3PBRA 2ZQCA 1NY0A 4WZ5A 5J8XA 3GVBA 5EE8A 3ZNTA 4BLMA 2ZJ9A 2P9VA 2XF3A 4K0XA 5HX9A 2XFSA 3A3JA 4QU3A 3HL9A 3VOZA 3M2KA 4FD8A 5HFOA 2Y2LA 2PU4A 4BQMA 1N4OA 1ZG6A 4GDNA 1XGJA 2Y2QA 4WYYA 1JTDA 4QB8A 2UWXA 1PWDA 4N1XA 5CTMA 2Z2MB 3IQAA 5FQJA 5GHZA 4B4ZA 3UPOA 3IXDA 4N92A 3UPPA 3ZG8B 4F94A 1RP5A 2Y2OA 4P87A 5FI2A 3V50A 2ZQDA 3JYIA 4KZ6A 1JTGA 1YLWA 3TSGA 4C75A 3V5MA 2EXAA 4IBRA 5M1AA 3A3EA 5TFQA 3SS4A 5EVIC 2RL3A 1KE4A 1M40A 1MWUA 3UE0A 1K4EA 3EQUA 3E2LA 2ZC5B 3SH8A 3CMZA 1KE0A 4E6XA 5AQAA 1IKIA 3DWKA 3VP1A 4WZ5C 2BG1A 4OQGA 1I2WA 4S2IA 1LI0A 4X6TA 4DF6A 1YLJA 1DY6A 1FCOA 3W8KA 1NZUA 4U0XA 4QY5A 3Q07A 4KQQA 2HDSA 3MKFA 3GTCA 5EECA 2QPNA 2VGJA 1ONGA 3HUOA 1JVJA 3UNWA 2J9PA 2V2FF 2XR0A 5FQ9A 4E3KA 1YM1A 5FDHA 1H5XA 4LCMA 4KQOA 2ZC6B 4OP8A 2XD1A 2EX2A 1HTZA 2J8YA 3O86A 3BFCA 3GV9A 2WYXA 3DW0A 5CTNA 1PI5A 4LV0A 2DCFA 3I7JA 3NIAA 2Y2KA 3C4PA 5DVAA 5EPHA 1VQQA 3WWXA 4KZ9A 4JXVA 4OOMA 3N6IA 4M3KA 5FQMA 2DNSA 2E8IA 3MFDA 3NCKA 4HBTA 5KSCA 3Q7ZA 3WS5A 3MXRA 3P09A 4R4SA 5G18A 5I94A 4KZ8A 4MBFA 5DF8A 2R9XA 5E43A 1GA0A 3PTEA 3ISGA 3WRTA 1O7EA 2Y2MA 3VP2A 1Q2QA 1K6RA 4GZBA 3ZVTA 1K54A 4MNRA 2ZC4B 1YLZA 3HLBA 3VOYA 1XA7A 1PYYA 1XXMA 4UA9A 4S2LA 1YMSA 1IYOA 1GHIA 2J7VA 2WAEA 2Y55A 3LCEA 3PBSA 4PPRA 4PM5A 3CJMA 4R0QA 4EBNA 1H8YA 1FOFA 4IVKA 3SS3A 3BLMA 4Q8IA 3UDXA 5EOEA 1FSWA 4OPZA 3MZDA 3B3XA 1LHYA 5GLAA 4P85A 5E2GA 2Y91A 3FZCA 4RYEA 1PIOA 4GDBA 3ZDJA 3HUNA 3TOIA 5JYOA 2XEPA 5HAQA 5DF7A 2Y2IA 5EUAA 2XK1A 3C7UA 4OONA 1BLSA 2EX6A 3A3FA 5E2FA 3SH9A 4KQRA 4JPMA 4R1GA 4E3OA 4WBGA 4PM7A 2EFUA 4PM6A 1OMEA 5HAIA 1BLCA 3BM6A 3HREA 3FKVA 3IH9A 3D4FA 3LO7A 1FR6A 1K54C 4KZ4A 3HBRA 2ZM2A 2PBYA 3WS1A 4DXBA 1BULA 1ESUA 1PW1A 3MKEA 1YT4A 2Y59A 3IF5A 4K0WA 3ZG9B 4ZTKA 2WKIA 2OLVA 3NDGA 5E2EA 1MKIA 1WE4A 4OQIA 3OZHA 4MLLA 3HLGA 1CI9A 1TVFA 4E3MA 1BTLA 3G35A 2Y2HA 4C3QA 3ZCZA 3RXXA 3ITBA 1XPBA 3UY6A 1CEGA 2EX8A 3LEZA 4DXCA 3WRZA 2Y2NA 2C5WB 2IWDA 2Y2JA 3UO9A 1NYYA 2XD5A 4P0MA 3Q7VB 3IHAA 5EOOA 1JWPA 4MEZA 3HUMA 4OQHA 3ZHHA 5HL1A 4E3LA 2WAFA 2HDRA 2QZ6A 1S0WA 2JBFA 3LY4A 3OCNA 4L0LA 2C6WB 4BJPA 4BENA 1EWZA 4OPRA 2WADA 3QNCA 2WK0A 1PZPA 3HLEA 4Z9QA 3AGEA 4RA7A 4IVIA 5CEBA 1XKZA 2WGWA 3ZG7B 3NY4A 4E6WA 4OH0A 5TGFA 5U47A 1MXOA 3P98A 5GLBA 1WYCA 4R3BA 4FSFA 5FAPA 3V3RA 1FSYA 5DTKA 1I5QA 1ERMA 5CGWA 4BD0A 1KGFA 2ZQ9A 5CHUA 4JLFA 4ZJ3A 4Y0OA 4O7DA 5TR7A 4UHUA 1ZG4A 2ZQ7A 4MBKA 2RCXA 4ID4A 4ZBEA 2Q9NA 3OCLA 3M6BA 1BLPA 1ZC2A 1FCMA 4GOGA 1NZOA 1ES5A 4N9KA 4R23A 4EWFA 3DWZA 1FR1A 2H0YA 4A5RA 4EUZA 4GD8A 4OQ0A 4OLDA 2H0TA 3ZG5A 4K91A 5HAPA 2GDNA 3N8SA 1K6SA 1GHMA 1JWZA 3HLCA 5GHYA 2FFYA 3V39A 5BOHA 1ALQA 2WUQA 5CHJA 3RJUA 3G2YA 2HP9A 4OVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP4 A;  3GSG A;  3GRJ A;  2VGK A;  2XGN A;  4OOY A;  4DE3 A;  1NYM A;  4KG5 A;  3BLS A;  5EVI B;  4KG2 A;  2WGI A;  1XA1 A;  1KE3 A;  3LY3 A;  3S4X A;  1E3U D;  1AXB A;  3ZG0 A;  2ZLY A;  1L2S A;  3N7W A;  5CRF A;  5M18 A;  4KEN B;  3M2J A;  1KDS A;  3FYZ A;  3MBZ A;  1MY8 A;  2PU2 A;  2ZM8 A;  1E3U A;  1BT5 A;  3HLF A;  3UDI A;  1BZA A;  4Y0T A;  2I72 A;  1K4F A;  2QMI A;  5DF9 A;  4JF5 A;  3SS5 A;  3PBO A;  5FSR A;  4EQI A;  4D2O A;  4GD6 A;  1MPL A;  1W8Y A;  2FFF B;  2ZQ8 A;  4KZ3 A;  4B4X A;  2Z2L B;  1PW8 A;  1EI5 A;  4HBU A;  1ONH A;  5FQI A;  2X01 A;  4S2M A;  5FQK A;  3S1Y A;  2V1Z A;  1SDE A;  3IH8 A;  3FWL A;  3OC2 A;  1S6R A;  4QHC A;  5F83 A;  5L2F A;  1HD8 A;  3Q81 A;  4S2N A;  5HW3 A;  3WS2 A;  2OV5 A;  4EBP A;  4ZDX A;  1I2S A;  2XH9 A;  1ESI A;  3IF6 B;  4JXS A;  5FAT A;  5FAO A;  1FQG A;  4R3J A;  4KZ5 A;  4WM9 A;  1K57 A;  3IWQ A;  5FA7 A;  1RCJ A;  4UA7 A;  1IYP A;  4OKP A;  4E3N A;  4LV2 A;  3G34 A;  3IWI A;  5A93 A;  1BUE A;  1MBL A;  3PBQ A;  4DDS A;  3GR2 A;  1ERO A;  3IWO A;  4IED A;  3FKW A;  3IHB A;  1NRF A;  3Q1F A;  4YFM A;  4OPQ A;  4Y0U A;  2CC1 A;  3PBT A;  3G31 A;  5F82 A;  2OSU A;  1CEF A;  4XUZ A;  4BL3 A;  3G4P A;  5FI6 A;  3MXS A;  3BYD A;  4YIN A;  1ZKJ A;  3QHY A;  1SKF A;  3G30 A;  2P74 A;  3ITA A;  1KVL A;  3Q82 A;  4JXG A;  4NK3 A;  5GLD A;  4DE2 A;  2ZMA A;  1H8Z A;  2Y4A A;  2HPB A;  5CHM A;  2WGV A;  4CJN A;  1IEL A;  4H8R A;  3UDF A;  1TEM A;  3O87 A;  4JXW A;  2EXB A;  3FV7 A;  3QNB A;  4KZ7 A;  4S2N C;  3TG9 A;  1QME A;  3G2Z A;  5CER A;  3UE3 A;  3S22 A;  1ES3 A;  3N8L A;  4UAA A;  2XDM A;  4LV3 A;  5KSH A;  4FCF A;  1K25 A;  5M19 A;  1N9B A;  1CI8 A;  1DJC A;  3SH7 A;  1K57 C;  1G6A A;  1MWS A;  4JF4 A;  4S2J A;  1TDL A;  1WYB A;  4ZAM A;  5HAR A;  4DE0 A;  1PWC A;  3BFG A;  1IKG A;  1ES2 A;  3NC8 A;  1K38 A;  1NXY A;  1QMF A;  4X56 A;  1DJA A;  2IWB A;  3ZNY A;  1JWV A;  5EVL A;  2XQZ A;  4GKU A;  3W4P A;  5CGS A;  5CED A;  2EFX A;  4PMA A;  2WKE A;  3MZE A;  2G2U A;  1W5D A;  3C7V A;  4DKI A;  1W8Q A;  2A3U A;  1MWT A;  3AGD A;  4OLG A;  1E25 A;  1IEM A;  5GLC A;  2ZM0 A;  3A3I A;  1L0F A;  1U60 A;  4KG6 A;  5KMW A;  2HP6 A;  1W79 A;  2HP5 A;  1K56 D;  1W7F A;  5GHX A;  5AQ7 A;  1TDG A;  4PM8 A;  3IF6 A;  1GHP A;  3O88 A;  4RX3 A;  4Y7P A;  4GNU A;  4HES A;  3VSL A;  1K56 A;  3OPH A;  1ES4 A;  1MWR A;  5AQ9 A;  2ZC7 A;  4S2O A;  5GL9 A;  3VFH A;  1RGY A;  4ZJ2 A;  2HDU A;  4NET A;  3UN7 A;  4DE1 A;  4OPY A;  3BEB A;  5DTS A;  1VM1 A;  3VP0 A;  4B88 A;  4WMC D;  3VP3 A;  3GQZ A;  2R9W A;  1BSG A;  1L0E A;  3O3V A;  4CPK A;  4P6B A;  3GMW A;  4HEF A;  4KZB A;  4WEJ A;  1IYS A;  4PM9 A;  3OPP A;  1KGE A;  4WMC A;  3IXH A;  3MZF A;  3C5A A;  1YMX A;  2JCH A;  5FI7 A;  3W4Q A;  4EV4 A;  2V20 A;  3IXB A;  1PWG A;  3CG5 A;  1KGG A;  1Q2P A;  4S2P A;  4E3I A;  3HVF A;  1J9M A;  3BFD A;  3EQV A;  4C6Y A;  3E2K A;  5F1G A;  5D3O A;  3UE1 A;  2HDQ A;  1C3B A;  5KZH A;  1Z6F A;  2DRW A;  3IXG A;  4GN2 A;  4RX2 A;  3VSK A;  3ZVW A;  1G68 A;  1KVM A;  2P9V B;  3IF6 C;  3Q7V A;  4N9L A;  3IT9 A;  4OOL A;  3SOI A;  1GCE A;  1O07 A;  1SHV A;  4EBL A;  4JKT A;  1XGI A;  1NJ4 A;  2A49 A;  1ERQ A;  3N4I A;  1K55 A;  1FCN A;  1RGZ A;  3BFF A;  4QD4 A;  5IHV A;  1L0G A;  1LLB A;  2Y2G A;  4S2K A;  3NBL A;  2X02 A;  1SCW A;  4U0T A;  4X69 A;  2WKH A;  3W4O A;  1PI4 A;  4BD1 A;  4WEL A;  3OPR A;  4FH2 A;  2Q9M A;  2H10 A;  1XP4 A;  4LEN A;  3VMA A;  2EX9 A;  1CK3 A;  4XUX A;  5A90 A;  1PZO A;  1DJB A;  1BLH A;  2JC7 A;  1YLP A;  3N8R A;  4JBF A;  5DTT A;  2ZQA A;  4BL2 A;  2WGW B;  5A91 A;  3PAE A;  4N1H A;  4UA6 A;  1IYQ A;  3OPL A;  5FQQ A;  4QY6 A;  5FAQ A;  3BRM A;  4JF6 A;  5AQB A;  1YLT A;  4DDY A;  3M6H A;  4FH4 A;  5JYP A;  3HLD A;  2J9O A;  3V3S A;  4WZ4 A;  2JE5 A;  3VFF A;  3C4O A;  1YLY A;  4E3J A;  4LCL A;  4XXR A;  5E2H A;  2H5S A;  2X71 A;  4GB7 A;  2B5R A;  4X53 A;  2XLN A;  4KZA A;  1YQS A;  3ZFZ A;  1GA9 A;  5A92 A;  3CZD A;  4ZJ1 A;  1K55 C;  4RVA A;  2IWC A;  1KDW A;  3G32 A;  5CGX A;  3BEC A;  2Y2P A;  3RXW A;  2BLS A;  1Y54 A;  4X68 A;  3NDE A;  3AGF A;  1SDN A;  2OLU A;  2WZZ A;  1XX2 A;  4U3T A;  4WEK A;  1E4D A;  5EVI D;  3HLW A;  3WS0 A;  2ZD8 A;  3PBN A;  3WS4 A;  1LI9 A;  4OP5 A;  4DRT A;  5CEC A;  3BFE A;  3UPN A;  3NI9 A;  1HZO A;  3A3D A;  4LV1 A;  5EVI A;  3PAG A;  3ZGA B;  4MBH A;  4X55 A;  1M6K A;  4QJG A;  2ZC3 B;  4IBX A;  4R4R A;  2XFT A;  5F1F A;  2WZX A;  1L0D A;  5FAS A;  3DTM A;  1LL5 A;  1HVB A;  1LL9 A;  2G2W A;  5CXW A;  3PBR A;  2ZQC A;  1NY0 A;  4WZ5 A;  5J8X A;  3GVB A;  5EE8 A;  3ZNT A;  4BLM A;  2ZJ9 A;  2P9V A;  2XF3 A;  4K0X A;  5HX9 A;  2XFS A;  3A3J A;  4QU3 A;  3HL9 A;  3VOZ A;  3M2K A;  4FD8 A;  5HFO A;  2Y2L A;  2PU4 A;  4BQM A;  1N4O A;  1ZG6 A;  4GDN A;  1XGJ A;  2Y2Q A;  4WYY A;  1JTD A;  4QB8 A;  2UWX A;  1PWD A;  4N1X A;  5CTM A;  2Z2M B;  3IQA A;  5FQJ A;  5GHZ A;  4B4Z A;  3UPO A;  3IXD A;  4N92 A;  3UPP A;  3ZG8 B;  4F94 A;  1RP5 A;  2Y2O A;  4P87 A;  5FI2 A;  3V50 A;  2ZQD A;  3JYI A;  4KZ6 A;  1JTG A;  1YLW A;  3TSG A;  4C75 A;  3V5M A;  2EXA A;  4IBR A;  5M1A A;  3A3E A;  5TFQ A;  3SS4 A;  5EVI C;  2RL3 A;  1KE4 A;  1M40 A;  1MWU A;  3UE0 A;  1K4E A;  3EQU A;  3E2L A;  2ZC5 B;  3SH8 A;  3CMZ A;  1KE0 A;  4E6X A;  5AQA A;  1IKI A;  3DWK A;  3VP1 A;  4WZ5 C;  2BG1 A;  4OQG A;  1I2W A;  4S2I A;  1LI0 A;  4X6T A;  4DF6 A;  1YLJ A;  1DY6 A;  1FCO A;  3W8K A;  1NZU A;  4U0X A;  4QY5 A;  3Q07 A;  4KQQ A;  2HDS A;  3MKF A;  3GTC A;  5EEC A;  2QPN A;  2VGJ A;  1ONG A;  3HUO A;  1JVJ A;  3UNW A;  2J9P A;  2V2F F;  2XR0 A;  5FQ9 A;  4E3K A;  1YM1 A;  5FDH A;  1H5X A;  4LCM A;  4KQO A;  2ZC6 B;  4OP8 A;  2XD1 A;  2EX2 A;  1HTZ A;  2J8Y A;  3O86 A;  3BFC A;  3GV9 A;  2WYX A;  3DW0 A;  5CTN A;  1PI5 A;  4LV0 A;  2DCF A;  3I7J A;  3NIA A;  2Y2K A;  3C4P A;  5DVA A;  5EPH A;  1VQQ A;  3WWX A;  4KZ9 A;  4JXV A;  4OOM A;  3N6I A;  4M3K A;  5FQM A;  2DNS A;  2E8I A;  3MFD A;  3NCK A;  4HBT A;  5KSC A;  3Q7Z A;  3WS5 A;  3MXR A;  3P09 A;  4R4S A;  5G18 A;  5I94 A;  4KZ8 A;  4MBF A;  5DF8 A;  2R9X A;  5E43 A;  1GA0 A;  3PTE A;  3ISG A;  3WRT A;  1O7E A;  2Y2M A;  3VP2 A;  1Q2Q A;  1K6R A;  4GZB A;  3ZVT A;  1K54 A;  4MNR A;  2ZC4 B;  1YLZ A;  3HLB A;  3VOY A;  1XA7 A;  1PYY A;  1XXM A;  4UA9 A;  4S2L A;  1YMS A;  1IYO A;  1GHI A;  2J7V A;  2WAE A;  2Y55 A;  3LCE A;  3PBS A;  4PPR A;  4PM5 A;  3CJM A;  4R0Q A;  4EBN A;  1H8Y A;  1FOF A;  4IVK A;  3SS3 A;  3BLM A;  4Q8I A;  3UDX A;  5EOE A;  1FSW A;  4OPZ A;  3MZD A;  3B3X A;  1LHY A;  5GLA A;  4P85 A;  5E2G A;  2Y91 A;  3FZC A;  4RYE A;  1PIO A;  4GDB A;  3ZDJ A;  3HUN A;  3TOI A;  5JYO A;  2XEP A;  5HAQ A;  5DF7 A;  2Y2I A;  5EUA A;  2XK1 A;  3C7U A;  4OON A;  1BLS A;  2EX6 A;  3A3F A;  5E2F A;  3SH9 A;  4KQR A;  4JPM A;  4R1G A;  4E3O A;  4WBG A;  4PM7 A;  2EFU A;  4PM6 A;  1OME A;  5HAI A;  1BLC A;  3BM6 A;  3HRE A;  3FKV A;  3IH9 A;  3D4F A;  3LO7 A;  1FR6 A;  1K54 C;  4KZ4 A;  3HBR A;  2ZM2 A;  2PBY A;  3WS1 A;  4DXB A;  1BUL A;  1ESU A;  1PW1 A;  3MKE A;  1YT4 A;  2Y59 A;  3IF5 A;  4K0W A;  3ZG9 B;  4ZTK A;  2WKI A;  2OLV A;  3NDG A;  5E2E A;  1MKI A;  1WE4 A;  4OQI A;  3OZH A;  4MLL A;  3HLG A;  1CI9 A;  1TVF A;  4E3M A;  1BTL A;  3G35 A;  2Y2H A;  4C3Q A;  3ZCZ A;  3RXX A;  3ITB A;  1XPB A;  3UY6 A;  1CEG A;  2EX8 A;  3LEZ A;  4DXC A;  3WRZ A;  2Y2N A;  2C5W B;  2IWD A;  2Y2J A;  3UO9 A;  1NYY A;  2XD5 A;  4P0M A;  3Q7V B;  3IHA A;  5EOO A;  1JWP A;  4MEZ A;  3HUM A;  4OQH A;  3ZHH A;  5HL1 A;  4E3L A;  2WAF A;  2HDR A;  2QZ6 A;  1S0W A;  2JBF A;  3LY4 A;  3OCN A;  4L0L A;  2C6W B;  4BJP A;  4BEN A;  1EWZ A;  4OPR A;  2WAD A;  3QNC A;  2WK0 A;  1PZP A;  3HLE A;  4Z9Q A;  3AGE A;  4RA7 A;  4IVI A;  5CEB A;  1XKZ A;  2WGW A;  3ZG7 B;  3NY4 A;  4E6W A;  4OH0 A;  5TGF A;  5U47 A;  1MXO A;  3P98 A;  5GLB A;  1WYC A;  4R3B A;  4FSF A;  5FAP A;  3V3R A;  1FSY A;  5DTK A;  1I5Q A;  1ERM A;  5CGW A;  4BD0 A;  1KGF A;  2ZQ9 A;  5CHU A;  4JLF A;  4ZJ3 A;  4Y0O A;  4O7D A;  5TR7 A;  4UHU A;  1ZG4 A;  2ZQ7 A;  4MBK A;  2RCX A;  4ID4 A;  4ZBE A;  2Q9N A;  3OCL A;  3M6B A;  1BLP A;  1ZC2 A;  1FCM A;  4GOG A;  1NZO A;  1ES5 A;  4N9K A;  4R23 A;  4EWF A;  3DWZ A;  1FR1 A;  2H0Y A;  4A5R A;  4EUZ A;  4GD8 A;  4OQ0 A;  4OLD A;  2H0T A;  3ZG5 A;  4K91 A;  5HAP A;  2GDN A;  3N8S A;  1K6S A;  1GHM A;  1JWZ A;  3HLC A;  5GHY A;  2FFY A;  3V39 A;  5BOH A;  1ALQ A;  2WUQ A;  5CHJ A;  3RJU A;  3G2Y A;  2HP9 A;  4OVD A; 
#chains in the Genus database with same CATH topology
 3GSG A;  3GRJ A;  2VGK A;  1H0M A;  3L7H A;  2WGI A;  1KE3 A;  3HCY A;  3E4O A;  3ZG0 A;  2ZLY A;  3H82 B;  1L2S A;  3N7W A;  1X0O A;  3A0S A;  1MY8 A;  2ZM8 A;  3T1Q B;  4JF5 A;  4MN6 A;  3PBO A;  5TBM B;  3SS5 A;  3BJN A;  3S1Y A;  5FQI A;  4S2M A;  2V1Z A;  3C38 A;  3WS2 A;  1VEU B;  4JXS A;  5FAO A;  4KZ5 A;  3F1O B;  4OKP A;  4BBT A;  4E3N A;  4LV2 A;  3K3C A;  1MBL A;  3F1N B;  4DDS A;  4FUW A;  3GR2 A;  3Q1F A;  2WKP A;  3PBT A;  1JNU A;  1CEF A;  4BL3 A;  2YKH A;  2OWH A;  3MXS A;  4HP4 A;  1ZKJ A;  2Y4A A;  4CJN A;  1XJ3 A;  4H8R A;  3UDF A;  1TEM A;  3NEC A;  2QJ7 A;  4KZ7 A;  3B42 A;  5CER A;  3MR0 A;  4IUK A;  4FCF A;  2WKR A;  4II7 A;  1K57 C;  4ZAM A;  1MZU A;  4DE0 A;  1PWC A;  3D3O A;  3NC8 A;  1G28 A;  4X56 A;  1DJA A;  3ZNY A;  1JWV A;  4GKU A;  2EFX A;  4PMA A;  2G2U A;  1H3Q A;  1Y4O A;  1TS6 A;  3C7V A;  2O0Y A;  1MWT A;  3AGD A;  3PXP A;  5GLC A;  2ZM0 A;  4KG6 A;  5KMW A;  2HP6 A;  2HP5 A;  1K56 D;  3IS2 B;  3BY9 A;  3R4K A;  4WLA A;  5C5K A;  1ES4 A;  1MWR A;  5AQ9 A;  2ZC7 A;  1RGY A;  2JKR M;  2HDU A;  3UN7 A;  2W3H A;  1VET A;  5DTS A;  3VP0 A;  3VP3 A;  3B47 A;  1BSG A;  4MMN A;  5DKK A;  1OTE A;  3MF0 A;  4KZB A;  1XJ6 A;  1KGE A;  4WMC A;  3IXH A;  1YSP A;  3B33 A;  3W4Q A;  4YOF A;  1N9N A;  3IBR A;  3JVV A;  4BBV A;  1Q2P A;  4E3I A;  3HVF A;  2J3T D;  4HI4 A;  1Z6F A;  3IXG A;  4WF0 A;  4N9L A;  1XJ4 A;  3SOI A;  1F2K A;  3N4I A;  1ERQ A;  5IHV A;  1LLB A;  2JKG A;  2Y2G A;  2X02 A;  1SCW A;  3KYE A;  4U0T A;  2WKH A;  4X69 A;  3OPR A;  2H10 A;  4LEN A;  1PZO A;  1BLH A;  2GZA A;  2ZQA A;  4EES A;  3PAE A;  5FQQ A;  5HL6 A;  5FAQ A;  5DFY A;  3BRM A;  5AQB A;  2M7U A;  3CUE A;  2J9O A;  3VFF A;  4XXR A;  2H5S A;  2J3T C;  5A92 A;  1GA9 A;  2QYB A;  2W3G A;  1D06 A;  3V67 A;  4Y5F A;  3RXW A;  4X68 A;  2V8C A;  3WS0 A;  1LI9 A;  5EVI A;  3ZGA B;  1TS7 A;  4QJG A;  3EGD C;  2XFT A;  4I3J A;  4YWZ A;  2WZX A;  1CJF A;  5J8X A;  3U2A A;  1NRJ A;  2P9V A;  1Y28 A;  4K0X A;  5HFO A;  2Y2L A;  2JKT M;  4GDN A;  5HDD A;  1JTD A;  1N9L A;  2Z2M B;  2KOI A;  2PBD P;  3UPP A;  3TSG A;  4C75 A;  2ACG A;  3V5M A;  2EXA A;  4IBR A;  3A3E A;  2JN7 A;  5TFQ A;  2RL3 A;  5DFX A;  1MKM A;  3E2L A;  2ZC5 B;  1KE0 A;  4CLC E;  4DF6 A;  1YLJ A;  3W2Z A;  4KQQ A;  1JVJ A;  2V2F F;  1YM1 A;  1H5X A;  5DJT A;  2XA7 S;  4O8G A;  4R70 A;  3O86 A;  1SKO A;  1ODV A;  3BFC A;  3EOI A;  3GV9 A;  3C2W A;  4LV0 A;  1V9Y A;  2DCF A;  2FZ0 A;  2Y2K A;  3BW6 A;  5FQM A;  5HPI A;  4X1M A;  1GSV A;  5I94 A;  2R9X A;  1GA0 A;  2W1R A;  3PTE A;  3S7Q A;  1O7E A;  2A24 A;  3QP6 A;  4LRZ E;  4G3K A;  4MNR A;  1J3W A;  2EWW A;  2ZC4 B;  1YLZ A;  2VGL M;  1XA7 A;  1PYY A;  5MC7 A;  3K2N A;  1YMS A;  4HJ4 A;  3TJZ C;  2J7V A;  3PBS A;  4PM5 A;  2L4R A;  3CJM A;  3MQO A;  1FOF A;  4Q8I A;  1FSW A;  4BWI A;  4WN5 A;  3B3X A;  1P9R A;  2M1C A;  1PIO A;  4G3V A;  2K2N A;  3G6O A;  4GDB A;  4HP9 A;  3HUN A;  5HAQ A;  5DF7 A;  2Y2I A;  5EUA A;  2XK1 A;  3C7U A;  5E2F A;  4PM7 A;  3P01 A;  5HDS A;  5HAI A;  1BLC A;  3BWL A;  3IH9 A;  4EW7 A;  1K54 C;  2QHK A;  1BUL A;  4NXE A;  1ESU A;  3CUE C;  3LR4 A;  4ZTK A;  1ZHH B;  2IA2 A;  3OZH A;  5K5B A;  3HLG A;  3G35 A;  4RQ9 A;  2PR5 A;  3RXX A;  3ITB A;  1CEG A;  2EX8 A;  4DXC A;  2C5W B;  3UB5 P;  5EOO A;  2NUP C;  1JWP A;  4MEZ A;  3HUM A;  3ZHH A;  2H28 A;  1OTA A;  4B93 A;  3HJK A;  4L9G A;  1S0W A;  4BJP A;  1EWZ A;  2WAD A;  4Y13 A;  3QNC A;  2WK0 A;  5F5Y A;  4Z9Q A;  4RA7 A;  2Q0O A;  3LIB A;  3SZT A;  4GS9 A;  4BD0 A;  3SW1 A;  4JLF A;  4ZJ3 A;  1L3L A;  3S7P A;  2ZQ7 A;  4PKY A;  4ZBE A;  3MXQ A;  2BAS A;  1BLP A;  4JGQ A;  2H0Y A;  1YKD A;  4OQ0 A;  4OLD A;  2GDN A;  3HJI A;  2KDK A;  3HLC A;  2JKF A;  5BOH A;  1ALQ A;  5CHJ A;  4KQD A;  4OVD A;  3VP4 A;  4FTX A;  5EVI B;  1XA1 A;  3LY3 A;  1E3U D;  1AXB A;  3LEQ A;  3FC7 A;  1OTD A;  5CRF A;  1LL8 A;  5M18 A;  4KEN B;  4EEP A;  2VKS A;  3R7W A;  4NEE D;  1ACF A;  2I72 A;  2QMI A;  4GHI A;  3LR0 A;  4MCW A;  2V0W A;  1W8Y A;  2ZQ8 A;  4B4X A;  1PW8 A;  1NLY A;  1ONH A;  1SDE A;  5L2F A;  5F83 A;  3Q81 A;  5HW3 A;  5IS1 A;  3DTE A;  1ESI A;  3IF6 B;  4R3J A;  1K57 A;  4IHQ A;  4UA7 A;  2DMW A;  3IWI A;  4XT2 A;  1BUE A;  3LIA A;  3IWO A;  4O0P A;  3FG8 A;  4Y0U A;  3VOL A;  3G31 A;  3BY8 A;  5F82 A;  4YIN A;  2W3E A;  3QHY A;  1DP8 A;  1SKF A;  3G30 A;  2P74 A;  5GLD A;  2FH5 A;  2ZMA A;  2I9V A;  2HPB A;  2VV6 A;  1T1A A;  4S2N C;  1QME A;  3G2Z A;  1SKO B;  3LIC A;  4IJG A;  3UE3 A;  3N8L A;  5KSH A;  1K25 A;  4ZRR A;  1CI8 A;  3SH7 A;  1G6A A;  4S2J A;  1TDL A;  1WYB A;  3BFG A;  1NXY A;  3QP1 A;  2IWB A;  5AVF A;  2JKR I;  1IOU A;  2XRN A;  2W1T B;  4GJ4 A;  3MZE A;  1UWN X;  2V8F A;  1T19 A;  1IEM A;  3A3I A;  1U60 A;  2VV7 A;  1W7F A;  3VV4 A;  1TDG A;  2PHY A;  4RX3 A;  3IX4 A;  1K56 A;  3LIF A;  3OPH A;  4AFI A;  3VFH A;  4ZJ2 A;  1F98 A;  4DE1 A;  4OPY A;  3BEB A;  2R9W A;  1Z09 A;  3O3V A;  4P6B A;  4WEJ A;  4PM9 A;  3EWK A;  5HD3 A;  1ZTU A;  5AVE A;  1PWG A;  3CG5 A;  2J3W A;  2MJ6 A;  3BFD A;  4C6Y A;  5F1G A;  2CMN A;  2HDQ A;  1P0Z A;  1SZV A;  2DRW A;  3ZVW A;  4RX2 A;  1KVM A;  3A0R A;  4OOL A;  4WL9 A;  1GCE A;  1SHV A;  1XGI A;  1NJ4 A;  5A90 A;  1RGZ A;  5F69 A;  1L0G A;  1T1B A;  1S4R A;  1T1C A;  3LGO A;  1V9Z A;  1DJB A;  2JC7 A;  1G6O A;  4BL2 A;  5A91 A;  4N1H A;  4ME4 A;  1YLT A;  3M6H A;  4FH4 A;  5JYP A;  4GS9 B;  2VA0 A;  3C4O A;  1YLY A;  4E3J A;  4LCL A;  2KLI A;  3KSF A;  4EUV A;  3ZFZ A;  3CZD A;  3E4P A;  5FDS A;  1KDW A;  5CGX A;  3F1P B;  2Y2P A;  1SDN A;  1XX2 A;  1E4D A;  2HF6 A;  4HIA A;  3HLW A;  2W3F A;  2YKF A;  3KYZ A;  1PFL A;  2Z6C A;  2QJ5 A;  3H9W A;  3UPN A;  3NI9 A;  1M6K A;  5HWT A;  2ZC3 B;  1L0D A;  1LL5 A;  1HVB A;  1LL9 A;  2ZQC A;  1NY0 A;  3D9Y A;  3ZNT A;  4KUK A;  2ZJ9 A;  5DKL A;  5L09 A;  1IFQ A;  2XFS A;  3HL9 A;  3VOZ A;  1N4O A;  2XRO A;  4N1X A;  4I3A A;  4N92 A;  3KSG A;  1XFQ A;  1JTG A;  5IU1 A;  2E8J A;  4I38 A;  4F3L A;  1KE4 A;  3UE6 A;  3UE0 A;  1K4E A;  2Z6D A;  2W3D A;  4E6X A;  3CMZ A;  3VP1 A;  1DRM A;  4XT2 B;  4X6T A;  1FCO A;  4L9E A;  4CLC B;  3Q07 A;  3MKF A;  5CX7 A;  3HUO A;  2QPN A;  1ONG A;  3DBA A;  2VJW A;  4E3K A;  3KSI A;  4LCM A;  4MN7 A;  5I5L A;  4KQO A;  2GJ3 A;  2EX2 A;  2J8Y A;  2WYX A;  4HY8 A;  3C4P A;  1VQQ A;  3LR3 A;  4JXV A;  4P6Z M;  2LB9 A;  3NCK A;  3S7O A;  5KSC A;  3MQQ A;  3Q7Z A;  4GLQ A;  3VP2 A;  1K54 A;  3L9K A;  5J3W A;  3UB9 A;  3RFB A;  3VOY A;  4S2L A;  2Y55 A;  2WAE A;  4Y2F A;  4PPR A;  4R0Q A;  3KO6 A;  4IVK A;  2O9C A;  5HD5 A;  1TD5 A;  1LHY A;  4P85 A;  5E2G A;  2Y91 A;  4Y3I A;  3ZDJ A;  1P97 A;  5G4Y A;  4OON A;  4HH2 A;  2EX6 A;  3A3F A;  2EA9 A;  4JGR A;  4KQR A;  4WBG A;  3LUQ A;  3LO7 A;  1FR6 A;  3LI8 A;  2XA7 M;  1LSW A;  3RTY A;  3MKE A;  2Y59 A;  3IF5 A;  4GW9 A;  3UB7 A;  5E2E A;  4MLL A;  2O99 A;  1TVF A;  4P6Z S;  1XPB A;  1OJG A;  3LEZ A;  3WRZ A;  2Y2N A;  2Y2J A;  3UO9 A;  2XD5 A;  2PT7 A;  4P0M A;  3T4O A;  4LPZ A;  3IHA A;  3ICY A;  2GX5 A;  5FEF A;  2JBF A;  3OCN A;  2C6W B;  3DAV A;  4OPR A;  3HLE A;  3EGX C;  5CEB A;  4IVI A;  2WGW A;  3ZG7 B;  3NY4 A;  4E6W A;  5U47 A;  4H6J A;  2J80 A;  5GLB A;  4K08 A;  3V3R A;  1K0K A;  1ERM A;  5CGW A;  4O7D A;  1ZG4 A;  4UQI S;  4MBK A;  2RCX A;  2V1A A;  3OCL A;  3M6B A;  4YNR A;  4PHT A;  3DTI A;  4N9K A;  4PAU A;  3EEH A;  5HWW A;  3KYQ A;  4A5R A;  1GHM A;  2ZBB A;  3V39 A;  2PRF A;  3G2Y A;  4R3A A;  1A0K A;  2GNX A;  2XGN A;  4EEU A;  4OOY A;  3PR6 A;  3D72 A;  4KG2 A;  2P7J A;  2HJE A;  3S4X A;  1PNE A;  3TW8 A;  3FYZ A;  3MBZ A;  2PU2 A;  4ARZ A;  1E3U A;  5FSR A;  4EQI A;  4D2O A;  4KZ3 A;  2FFF B;  3OLO A;  1EI5 A;  2W0N A;  4HBU A;  2X01 A;  5J4E A;  2VLG A;  5HDC A;  2VX8 A;  3OC2 A;  1S6R A;  3MJQ A;  4S2N A;  3O5Y A;  1NLZ A;  5L07 A;  2OV5 A;  4EBP A;  1I2S A;  1N9O A;  1XFN A;  4WM9 A;  5FA7 A;  4D60 A;  1IYP A;  2JHE A;  3LYX A;  5A93 A;  1VET B;  1ERO A;  3FKW A;  4OPQ A;  2OSU A;  3G4P A;  4PKY G;  4X25 A;  1NWZ A;  3ITA A;  4NK3 A;  4JXG A;  1KVL A;  1H8Z A;  5CHM A;  5A8B A;  1IEL A;  3O87 A;  4JXW A;  2EXB A;  3FV7 A;  3TG9 A;  4I5S A;  3VE4 A;  3S22 A;  4UAA A;  4LV3 A;  5M19 A;  1DJC A;  1MWS A;  1OTI A;  1ES2 A;  3PYP A;  3H82 A;  1QMF A;  5EVL A;  2XQZ A;  3W4P A;  5CGS A;  5CED A;  3T4J A;  2UV0 E;  5TBM A;  2A3U A;  4OLG A;  5HWV A;  1BYW A;  1L0F A;  3CI6 A;  1W79 A;  5EVE A;  1LT0 A;  2HV1 A;  2HGV A;  3O88 A;  4Y7P A;  4GNU A;  3VSL A;  3F1O A;  2PDR A;  4NET A;  4Y15 A;  1VM1 A;  2O9A A;  4CPK A;  1LSX A;  3GMW A;  4HEF A;  1IYS A;  3EEA A;  1H8M A;  1D1J A;  3C5A A;  1YMX A;  1S4S A;  2JCH A;  5FI7 A;  2V20 A;  3IXB A;  2W27 A;  1KGG A;  4S2P A;  5D3O A;  5KZH A;  2PYP A;  2OOL A;  2P9V B;  2B18 A;  3IF6 C;  3IT9 A;  1O07 A;  4JKT A;  2A49 A;  1FCN A;  2L0W A;  3W4O A;  4BD1 A;  4WEL A;  1STZ A;  2D01 A;  2V9A A;  3ZQ5 A;  1XP4 A;  2EX9 A;  1CK3 A;  4JBF A;  1YLP A;  2L1M A;  3QP4 A;  1S1Z A;  2WGW B;  4UA6 A;  1IYQ A;  4DMZ A;  4QY6 A;  4H6J B;  4JF6 A;  4DDY A;  2QWS A;  3HLD A;  4WZ4 A;  3IS2 A;  2X71 A;  2WKQ A;  2B5R A;  4X53 A;  4KZA A;  1YQS A;  1K55 C;  4RVA A;  2IWC A;  4KUO A;  3H7W A;  3G32 A;  4HJ3 A;  4DJ3 A;  3NDE A;  3AGF A;  2OLU A;  3NJA A;  4U3T A;  4WEK A;  1UWP X;  4OP5 A;  5CEC A;  3A3D A;  4LV1 A;  2A2L A;  3T4S A;  2VV8 A;  4MBH A;  4X55 A;  4IBX A;  4HOI A;  5FL3 A;  4Z1W A;  1HLU P;  3T4Q A;  3GVB A;  2A24 B;  3KX0 X;  2ZOI A;  5HX9 A;  3TE8 A;  4QU3 A;  4EER A;  3M2K A;  3QP8 A;  4JGP A;  4BQM A;  1EW0 A;  5CTM A;  3IQA A;  5GHZ A;  4B4Z A;  3UPO A;  3IXD A;  3ZG8 B;  4F94 A;  4P87 A;  5FI2 A;  3V50 A;  4KZ6 A;  1YLW A;  3MQ0 A;  3E98 A;  5M1A A;  3LI9 A;  3NOT C;  3MMH A;  1MWU A;  3EQU A;  3SH8 A;  2Y8H A;  1WA9 A;  3DWK A;  1YAX A;  4WZ5 C;  2PAV P;  4S2I A;  1LI0 A;  2PD8 A;  1CQA A;  4IUH A;  4EU0 A;  3W8K A;  1DY6 A;  1NZU A;  3CAX A;  5EEC A;  3UNW A;  4HH3 A;  5J7E A;  5FQ9 A;  2G7U A;  3T12 B;  2ZC6 B;  2XD1 A;  4DN0 A;  1HTZ A;  5CTN A;  2OWJ A;  3WWX A;  4ETZ A;  4KZ9 A;  5IT5 A;  4M3K A;  3CWF A;  3MFD A;  2VK3 A;  4R38 A;  3NUL A;  3WS5 A;  3MXR A;  2OAP 1;  4KZ8 A;  4MBF A;  5DF8 A;  4ESP A;  3MSH A;  2Y2M A;  4MN5 A;  1Q2Q A;  1K6R A;  4GZB A;  3ZVT A;  4NXG A;  1IYO A;  1GHI A;  3LCE A;  5DJU A;  3SS3 A;  3UDX A;  4OPZ A;  2LB5 A;  1FIL A;  3TOI A;  2XEP A;  3SH9 A;  1BLS A;  4CLC D;  4JPM A;  4E3O A;  4PM6 A;  1OME A;  2JKT I;  5LBR A;  3P7N A;  3D4F A;  2PBY A;  3WS1 A;  1YT4 A;  3ZG9 B;  4Y17 A;  3NDG A;  5EFW A;  4E3M A;  4C3Q A;  3ZCZ A;  1OTB A;  1TS0 A;  3UY6 A;  3CHW P;  2IWD A;  1NYY A;  3R7W B;  3CPT A;  4OQH A;  3UMD A;  5G4Z A;  2HDR A;  2QZ6 A;  4GHI B;  4L0L A;  4HQA A;  1PZP A;  4CLC C;  1G5U A;  2P08 A;  1XKZ A;  4OH0 A;  5TGF A;  3IX3 A;  3P98 A;  1MC0 A;  3DTK A;  4FSF A;  5FAP A;  1FSY A;  2D02 A;  5DTK A;  3LIE A;  1I5Q A;  3MS6 A;  1W63 Q;  4LGW A;  4Y0O A;  4QWO A;  4LRY C;  2Q9N A;  1ZC2 A;  2R78 A;  3UB6 A;  3DWZ A;  1FR1 A;  3OOV A;  1YPR A;  2H0T A;  3H7W B;  3ZG5 A;  4K91 A;  1XJ2 A;  3N8S A;  3LFV A;  5GHY A;  2FFY A;  2WUQ A;  2HP9 A;  5HPF A;  2M7V A;  4DE3 A;  1NYM A;  4KG5 A;  3BLS A;  4QPR A;  1LSV A;  5L10 A;  4O01 A;  2V0U A;  1CF0 A;  4BMW A;  4R6L A;  3PHY A;  3M2J A;  1KDS A;  3NOU C;  4WUJ A;  1OPX A;  1BT5 A;  3HLF A;  3UDI A;  1BZA A;  4Y0T A;  1K4F A;  5DF9 A;  4GD6 A;  1MPL A;  2Z2L B;  1W63 M;  5FQK A;  3GDI A;  3C8C A;  2V1B A;  3FWL A;  3IH8 A;  4QHC A;  4CQH A;  1HD8 A;  2HJ9 C;  5F68 A;  3C30 A;  4UQI M;  4ZDX A;  2XH9 A;  4E04 A;  5FAT A;  1FQG A;  3IWQ A;  1RCJ A;  3G34 A;  3PBQ A;  4IED A;  4YFM A;  3IHB A;  1NRF A;  2CC1 A;  4XUZ A;  5FI6 A;  2P04 A;  3BYD A;  2EWV A;  3Q82 A;  4DE2 A;  3T4T A;  4NKP A;  2WGV A;  1D7E A;  3KSH A;  3NHQ A;  3QNB A;  1ES3 A;  2XDM A;  3T4L A;  3CLO A;  4NXB A;  1N9B A;  2ZMV A;  5HZH A;  4UEY A;  4JF4 A;  5HAR A;  1P9W A;  1IKG A;  1K38 A;  4I3I A;  3NOP C;  2WKE A;  4EET B;  1W5D A;  4DKI A;  1W8Q A;  1E25 A;  3FPW A;  5KIZ A;  5AJG A;  5GHX A;  5TJJ A;  5AQ7 A;  4PM8 A;  4EXO A;  3IF6 A;  1GHP A;  4G3W A;  2OAQ 1;  3FPV A;  4HES A;  5GL9 A;  4S2O A;  4L9F A;  1GSW A;  3LID A;  4B88 A;  4WMC D;  3GQZ A;  4HHD A;  1L0E A;  5HSQ A;  4LLO B;  3OPP A;  3K3D A;  3E0Y A;  3MZF A;  4EV4 A;  1J9M A;  2ZL1 A;  3EQV A;  4ETX A;  3GEC A;  3E2K A;  2Y79 A;  1YSQ A;  3UE1 A;  1C3B A;  4GN2 A;  3VSK A;  1G68 A;  1S66 L;  3Q7V A;  4EBL A;  4ZJ1 A;  1K55 A;  3BFF A;  4QD4 A;  4EQ1 A;  3CPT B;  4S2K A;  3NBL A;  4LFU A;  1PI4 A;  3BQA A;  3ULF A;  4FH2 A;  4JGO A;  2Q9M A;  3VMA A;  4XUX A;  4X1L A;  3N8R A;  2W1T A;  5DTT A;  2ZOH A;  3OPL A;  4F3L B;  3MFX A;  1OJ5 A;  3V3S A;  2JE5 A;  4FOF A;  5E2H A;  2VEA A;  1VB6 A;  4GB7 A;  3T1X A;  2XLN A;  1PRQ A;  1UGU A;  3BEC A;  2BLS A;  1Y54 A;  2WZZ A;  2XSS A;  5EVI D;  2ZD8 A;  3PBN A;  3WS4 A;  4MDZ A;  4Q0H A;  4DRT A;  3BFE A;  1HZO A;  4HNB A;  1FIK A;  3PAG A;  3CIT A;  4R4R A;  5F1F A;  5FAS A;  3DTM A;  2G2W A;  5CXW A;  3PBR A;  1GSX A;  4WZ5 A;  5EE8 A;  4BLM A;  2PD7 A;  2XF3 A;  2B95 A;  3A3J A;  3UB8 A;  4FD8 A;  2PU4 A;  1ZG6 A;  1XGJ A;  2Y2Q A;  4WYY A;  4M4X A;  4QB8 A;  2UWX A;  1PWD A;  5FQJ A;  5L8M A;  2VGL S;  1RP5 A;  2Y2O A;  2ZQD A;  3JYI A;  3A0V A;  2HZ5 A;  1VEU A;  4GCZ A;  3JVU A;  5EVI C;  3SS4 A;  1M40 A;  2PYR A;  4BBU A;  2VZW A;  5AQA A;  1IKI A;  3F1N A;  2BG1 A;  4OQG A;  1I2W A;  1S1Y A;  1OT9 A;  3IX8 A;  4U0X A;  4QY5 A;  2INW A;  2HDS A;  3GTC A;  3RH8 B;  2VGJ A;  3F1P A;  3TRC A;  2J9P A;  2XR0 A;  3IBJ A;  5FDH A;  3T4K A;  4LRX C;  4OP8 A;  3BQ8 A;  3DW0 A;  5HAP A;  1PI5 A;  3I7J A;  3NIA A;  5DVA A;  5EPH A;  3T1R A;  4OOM A;  3N6I A;  2DNS A;  4Q0I A;  2E8I A;  4HBT A;  3P09 A;  4R4S A;  5G18 A;  2BTF P;  5E43 A;  3ISG A;  3WRT A;  1TS8 A;  1TF1 A;  5EM0 A;  3HLB A;  4UA9 A;  1XXM A;  1DP6 A;  3UME A;  4EBN A;  1H8Y A;  1F5M A;  3BLM A;  5EOE A;  1DP9 A;  3MZD A;  5GLA A;  3FZC A;  4RYE A;  1OT6 A;  5JYO A;  4R1G A;  2ZMF A;  2EFU A;  3BM6 A;  3HRE A;  3FKV A;  1KOU A;  3T1S A;  4KZ4 A;  4CLC A;  2B02 A;  2ZM2 A;  3HBR A;  4DXB A;  1PW1 A;  4K0W A;  5EV0 A;  3VE3 A;  2WKI A;  3OBF A;  2K31 A;  2OLV A;  1MKI A;  1WE4 A;  2QKP A;  4OQI A;  1CI9 A;  2PR6 A;  1BTL A;  1S67 L;  2Y2H A;  2ZL1 B;  3E4Q A;  5FEG A;  4ARZ B;  3Q7V B;  3S7N A;  2K7S A;  5HL1 A;  4E3L A;  2WAF A;  3QP2 A;  4HJ6 A;  3LY4 A;  5EM1 A;  1VHM A;  4BEN A;  3AGE A;  3ZYT A;  1F9I A;  1MXO A;  1WYC A;  4R3B A;  2AVX A;  2NUT C;  3LR5 A;  3JPU A;  1KGF A;  2ZQ9 A;  3QP5 A;  5CHU A;  4B9O A;  5TR7 A;  4UHU A;  4Q0J A;  4ID4 A;  1T18 A;  3T50 A;  1FCM A;  4GOG A;  1NZO A;  1ES5 A;  4R23 A;  4EWF A;  4EUZ A;  4GD8 A;  4I39 A;  4NXF A;  2KX6 A;  1K6S A;  1JWZ A;  2O9B A;  4DJ2 A;  5F6A A;  3U4L P;  4NG2 A;  3RJU A;  1AWI A; 
#chains in the Genus database with same CATH homology
 3VP4 A;  3GSG A;  3GRJ A;  2VGK A;  2XGN A;  4OOY A;  4DE3 A;  1NYM A;  4KG5 A;  3BLS A;  5EVI B;  4KG2 A;  2WGI A;  1XA1 A;  1KE3 A;  3LY3 A;  3S4X A;  1E3U D;  1AXB A;  3ZG0 A;  2ZLY A;  1L2S A;  3N7W A;  5CRF A;  5M18 A;  4KEN B;  3M2J A;  1KDS A;  3FYZ A;  3MBZ A;  1MY8 A;  2PU2 A;  2ZM8 A;  1E3U A;  1BT5 A;  3HLF A;  3UDI A;  1BZA A;  4Y0T A;  2I72 A;  1K4F A;  2QMI A;  5DF9 A;  4JF5 A;  3SS5 A;  3PBO A;  5FSR A;  4EQI A;  4D2O A;  4GD6 A;  1MPL A;  1W8Y A;  2FFF B;  2ZQ8 A;  4KZ3 A;  4B4X A;  2Z2L B;  1PW8 A;  1EI5 A;  4HBU A;  1ONH A;  5FQI A;  2X01 A;  4S2M A;  5FQK A;  3S1Y A;  2V1Z A;  1SDE A;  3IH8 A;  3FWL A;  3OC2 A;  1S6R A;  4QHC A;  5F83 A;  5L2F A;  1HD8 A;  3Q81 A;  4S2N A;  5HW3 A;  3WS2 A;  2OV5 A;  4EBP A;  4ZDX A;  1I2S A;  2XH9 A;  1ESI A;  3IF6 B;  4JXS A;  5FAT A;  5FAO A;  1FQG A;  4R3J A;  4KZ5 A;  4WM9 A;  1K57 A;  3IWQ A;  5FA7 A;  1RCJ A;  4UA7 A;  1IYP A;  4OKP A;  4E3N A;  4LV2 A;  3G34 A;  3IWI A;  5A93 A;  1BUE A;  1MBL A;  3PBQ A;  4DDS A;  3GR2 A;  1ERO A;  3IWO A;  4IED A;  3FKW A;  3IHB A;  1NRF A;  3Q1F A;  4YFM A;  4OPQ A;  4Y0U A;  2CC1 A;  3PBT A;  3G31 A;  5F82 A;  2OSU A;  1CEF A;  4XUZ A;  4BL3 A;  3G4P A;  5FI6 A;  3MXS A;  3BYD A;  4YIN A;  1ZKJ A;  3QHY A;  1SKF A;  3G30 A;  2P74 A;  3ITA A;  1KVL A;  3Q82 A;  4JXG A;  4NK3 A;  5GLD A;  4DE2 A;  2ZMA A;  1H8Z A;  2Y4A A;  2HPB A;  5CHM A;  2WGV A;  4CJN A;  1IEL A;  4H8R A;  3UDF A;  1TEM A;  3O87 A;  4JXW A;  2EXB A;  3FV7 A;  3QNB A;  4KZ7 A;  4S2N C;  3TG9 A;  1QME A;  3G2Z A;  5CER A;  3UE3 A;  3S22 A;  1ES3 A;  3N8L A;  4UAA A;  2XDM A;  4LV3 A;  5KSH A;  4FCF A;  1K25 A;  5M19 A;  1N9B A;  1CI8 A;  1DJC A;  3SH7 A;  1K57 C;  1G6A A;  1MWS A;  4JF4 A;  4S2J A;  1TDL A;  1WYB A;  4ZAM A;  5HAR A;  4DE0 A;  1PWC A;  3BFG A;  1IKG A;  1ES2 A;  3NC8 A;  1K38 A;  1NXY A;  1QMF A;  4X56 A;  1DJA A;  2IWB A;  3ZNY A;  1JWV A;  5EVL A;  2XQZ A;  4GKU A;  3W4P A;  5CGS A;  5CED A;  2EFX A;  4PMA A;  2WKE A;  3MZE A;  2G2U A;  1W5D A;  3C7V A;  4DKI A;  1W8Q A;  2A3U A;  1MWT A;  3AGD A;  4OLG A;  1E25 A;  1IEM A;  5GLC A;  2ZM0 A;  3A3I A;  1L0F A;  1U60 A;  4KG6 A;  5KMW A;  2HP6 A;  1W79 A;  2HP5 A;  1K56 D;  1W7F A;  5GHX A;  5AQ7 A;  1TDG A;  4PM8 A;  3IF6 A;  1GHP A;  3O88 A;  4RX3 A;  4Y7P A;  4GNU A;  4HES A;  3VSL A;  1K56 A;  3OPH A;  1ES4 A;  1MWR A;  5AQ9 A;  2ZC7 A;  4S2O A;  5GL9 A;  3VFH A;  1RGY A;  4ZJ2 A;  2HDU A;  4NET A;  3UN7 A;  4DE1 A;  4OPY A;  3BEB A;  5DTS A;  1VM1 A;  3VP0 A;  4B88 A;  4WMC D;  3VP3 A;  3GQZ A;  2R9W A;  1BSG A;  1L0E A;  3O3V A;  4CPK A;  4P6B A;  3GMW A;  4HEF A;  4KZB A;  4WEJ A;  1IYS A;  4PM9 A;  3OPP A;  1KGE A;  4WMC A;  3IXH A;  3MZF A;  3C5A A;  1YMX A;  2JCH A;  5FI7 A;  3W4Q A;  4EV4 A;  2V20 A;  3IXB A;  1PWG A;  3CG5 A;  1KGG A;  1Q2P A;  4S2P A;  4E3I A;  3HVF A;  1J9M A;  3BFD A;  3EQV A;  4C6Y A;  3E2K A;  5F1G A;  5D3O A;  3UE1 A;  2HDQ A;  1C3B A;  5KZH A;  1Z6F A;  2DRW A;  3IXG A;  4GN2 A;  4RX2 A;  3VSK A;  3ZVW A;  1G68 A;  1KVM A;  2P9V B;  3IF6 C;  3Q7V A;  4N9L A;  3IT9 A;  4OOL A;  3SOI A;  1GCE A;  1O07 A;  1SHV A;  4EBL A;  4JKT A;  1XGI A;  1NJ4 A;  2A49 A;  1ERQ A;  3N4I A;  1K55 A;  1FCN A;  1RGZ A;  3BFF A;  4QD4 A;  5IHV A;  1L0G A;  1LLB A;  2Y2G A;  4S2K A;  3NBL A;  2X02 A;  1SCW A;  4U0T A;  4X69 A;  2WKH A;  3W4O A;  1PI4 A;  4BD1 A;  4WEL A;  3OPR A;  4FH2 A;  2Q9M A;  2H10 A;  1XP4 A;  4LEN A;  3VMA A;  2EX9 A;  1CK3 A;  4XUX A;  5A90 A;  1PZO A;  1DJB A;  1BLH A;  2JC7 A;  1YLP A;  3N8R A;  4JBF A;  5DTT A;  2ZQA A;  4BL2 A;  2WGW B;  5A91 A;  3PAE A;  4N1H A;  4UA6 A;  1IYQ A;  3OPL A;  5FQQ A;  4QY6 A;  5FAQ A;  3BRM A;  4JF6 A;  5AQB A;  1YLT A;  4DDY A;  3M6H A;  4FH4 A;  5JYP A;  3HLD A;  2J9O A;  3V3S A;  4WZ4 A;  2JE5 A;  3VFF A;  3C4O A;  1YLY A;  4E3J A;  4LCL A;  4XXR A;  5E2H A;  2H5S A;  2X71 A;  4GB7 A;  2B5R A;  4X53 A;  2XLN A;  4KZA A;  1YQS A;  3ZFZ A;  1GA9 A;  5A92 A;  3CZD A;  4ZJ1 A;  1K55 C;  4RVA A;  2IWC A;  1KDW A;  3G32 A;  5CGX A;  3BEC A;  2Y2P A;  3RXW A;  2BLS A;  1Y54 A;  4X68 A;  3NDE A;  3AGF A;  1SDN A;  2OLU A;  2WZZ A;  1XX2 A;  4U3T A;  4WEK A;  1E4D A;  5EVI D;  3HLW A;  3WS0 A;  2ZD8 A;  3PBN A;  3WS4 A;  1LI9 A;  4OP5 A;  4DRT A;  5CEC A;  3BFE A;  3UPN A;  3NI9 A;  1HZO A;  3A3D A;  4LV1 A;  5EVI A;  3PAG A;  3ZGA B;  4MBH A;  4X55 A;  1M6K A;  4QJG A;  2ZC3 B;  4IBX A;  4R4R A;  2XFT A;  5F1F A;  2WZX A;  1L0D A;  5FAS A;  3DTM A;  1LL5 A;  1HVB A;  1LL9 A;  2G2W A;  5CXW A;  3PBR A;  2ZQC A;  1NY0 A;  4WZ5 A;  5J8X A;  3GVB A;  5EE8 A;  3ZNT A;  4BLM A;  2ZJ9 A;  2P9V A;  2XF3 A;  4K0X A;  5HX9 A;  2XFS A;  3A3J A;  4QU3 A;  3HL9 A;  3VOZ A;  3M2K A;  4FD8 A;  5HFO A;  2Y2L A;  2PU4 A;  4BQM A;  1N4O A;  1ZG6 A;  4GDN A;  1XGJ A;  2Y2Q A;  4WYY A;  1JTD A;  4QB8 A;  2UWX A;  1PWD A;  4N1X A;  5CTM A;  2Z2M B;  3IQA A;  5FQJ A;  5GHZ A;  4B4Z A;  3UPO A;  3IXD A;  4N92 A;  3UPP A;  3ZG8 B;  4F94 A;  1RP5 A;  2Y2O A;  4P87 A;  5FI2 A;  3V50 A;  2ZQD A;  3JYI A;  4KZ6 A;  1JTG A;  1YLW A;  3TSG A;  4C75 A;  3V5M A;  2EXA A;  4IBR A;  5M1A A;  3A3E A;  5TFQ A;  3SS4 A;  5EVI C;  2RL3 A;  1KE4 A;  1M40 A;  1MWU A;  3UE0 A;  1K4E A;  3EQU A;  3E2L A;  2ZC5 B;  3SH8 A;  3CMZ A;  1KE0 A;  4E6X A;  5AQA A;  1IKI A;  3DWK A;  3VP1 A;  4WZ5 C;  2BG1 A;  4OQG A;  1I2W A;  4S2I A;  1LI0 A;  4X6T A;  4DF6 A;  1YLJ A;  1DY6 A;  1FCO A;  3W8K A;  1NZU A;  4U0X A;  4QY5 A;  3Q07 A;  4KQQ A;  2HDS A;  3MKF A;  3GTC A;  5EEC A;  2QPN A;  2VGJ A;  1ONG A;  3HUO A;  1JVJ A;  3UNW A;  2J9P A;  2V2F F;  2XR0 A;  5FQ9 A;  4E3K A;  1YM1 A;  5FDH A;  1H5X A;  4LCM A;  4KQO A;  2ZC6 B;  4OP8 A;  2XD1 A;  2EX2 A;  1HTZ A;  2J8Y A;  3O86 A;  3BFC A;  3GV9 A;  2WYX A;  3DW0 A;  5CTN A;  1PI5 A;  4LV0 A;  2DCF A;  3I7J A;  3NIA A;  2Y2K A;  3C4P A;  5DVA A;  5EPH A;  1VQQ A;  3WWX A;  4KZ9 A;  4JXV A;  4OOM A;  3N6I A;  4M3K A;  5FQM A;  2DNS A;  2E8I A;  3MFD A;  3NCK A;  4HBT A;  5KSC A;  3Q7Z A;  3WS5 A;  3MXR A;  3P09 A;  4R4S A;  5G18 A;  5I94 A;  4KZ8 A;  4MBF A;  5DF8 A;  2R9X A;  5E43 A;  1GA0 A;  3PTE A;  3ISG A;  3WRT A;  1O7E A;  2Y2M A;  3VP2 A;  1Q2Q A;  1K6R A;  4GZB A;  3ZVT A;  1K54 A;  4MNR A;  2ZC4 B;  1YLZ A;  3HLB A;  3VOY A;  1XA7 A;  1PYY A;  1XXM A;  4UA9 A;  4S2L A;  1YMS A;  1IYO A;  1GHI A;  2J7V A;  2WAE A;  2Y55 A;  3LCE A;  3PBS A;  4PPR A;  4PM5 A;  3CJM A;  4R0Q A;  4EBN A;  1H8Y A;  1FOF A;  4IVK A;  3SS3 A;  3BLM A;  4Q8I A;  3UDX A;  5EOE A;  1FSW A;  4OPZ A;  3MZD A;  3B3X A;  1LHY A;  5GLA A;  4P85 A;  5E2G A;  2Y91 A;  3FZC A;  4RYE A;  1PIO A;  4GDB A;  3ZDJ A;  3HUN A;  3TOI A;  5JYO A;  2XEP A;  5HAQ A;  5DF7 A;  2Y2I A;  5EUA A;  2XK1 A;  3C7U A;  4OON A;  1BLS A;  2EX6 A;  3A3F A;  5E2F A;  3SH9 A;  4KQR A;  4JPM A;  4R1G A;  4E3O A;  4WBG A;  4PM7 A;  2EFU A;  4PM6 A;  1OME A;  5HAI A;  1BLC A;  3BM6 A;  3HRE A;  3FKV A;  3IH9 A;  3D4F A;  3LO7 A;  1FR6 A;  1K54 C;  4KZ4 A;  3HBR A;  2ZM2 A;  2PBY A;  3WS1 A;  4DXB A;  1BUL A;  1ESU A;  1PW1 A;  3MKE A;  1YT4 A;  2Y59 A;  3IF5 A;  4K0W A;  3ZG9 B;  4ZTK A;  2WKI A;  2OLV A;  3NDG A;  5E2E A;  1MKI A;  1WE4 A;  4OQI A;  3OZH A;  4MLL A;  3HLG A;  1CI9 A;  1TVF A;  4E3M A;  1BTL A;  3G35 A;  2Y2H A;  4C3Q A;  3ZCZ A;  3RXX A;  3ITB A;  1XPB A;  3UY6 A;  1CEG A;  2EX8 A;  3LEZ A;  4DXC A;  3WRZ A;  2Y2N A;  2C5W B;  2IWD A;  2Y2J A;  3UO9 A;  1NYY A;  2XD5 A;  4P0M A;  3Q7V B;  3IHA A;  5EOO A;  1JWP A;  4MEZ A;  3HUM A;  4OQH A;  3ZHH A;  5HL1 A;  4E3L A;  2WAF A;  2HDR A;  2QZ6 A;  1S0W A;  2JBF A;  3LY4 A;  3OCN A;  4L0L A;  2C6W B;  4BJP A;  4BEN A;  1EWZ A;  4OPR A;  2WAD A;  3QNC A;  2WK0 A;  1PZP A;  3HLE A;  4Z9Q A;  3AGE A;  4RA7 A;  4IVI A;  5CEB A;  1XKZ A;  2WGW A;  3ZG7 B;  3NY4 A;  4E6W A;  4OH0 A;  5TGF A;  5U47 A;  1MXO A;  3P98 A;  5GLB A;  1WYC A;  4R3B A;  4FSF A;  5FAP A;  3V3R A;  1FSY A;  5DTK A;  1I5Q A;  1ERM A;  5CGW A;  4BD0 A;  1KGF A;  2ZQ9 A;  5CHU A;  4JLF A;  4ZJ3 A;  4Y0O A;  4O7D A;  5TR7 A;  4UHU A;  1ZG4 A;  2ZQ7 A;  4MBK A;  2RCX A;  4ID4 A;  4ZBE A;  2Q9N A;  3OCL A;  3M6B A;  1BLP A;  1ZC2 A;  1FCM A;  4GOG A;  1NZO A;  1ES5 A;  4N9K A;  4R23 A;  4EWF A;  3DWZ A;  1FR1 A;  2H0Y A;  4A5R A;  4EUZ A;  4GD8 A;  4OQ0 A;  4OLD A;  2H0T A;  3ZG5 A;  4K91 A;  5HAP A;  2GDN A;  3N8S A;  1K6S A;  1GHM A;  1JWZ A;  3HLC A;  5GHY A;  2FFY A;  3V39 A;  5BOH A;  1ALQ A;  2WUQ A;  5CHJ A;  3RJU A;  3G2Y A;  2HP9 A;  4OVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...